data_3VZC
# 
_entry.id   3VZC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3VZC         
RCSB  RCSB095689   
WWPDB D_1000095689 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3VZB . unspecified 
PDB 3VZD . unspecified 
# 
_pdbx_database_status.entry_id                        3VZC 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2012-10-11 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Min, X.'      1 
'Walker, N.P.' 2 
'Wang, Z.'     3 
# 
_citation.id                        primary 
_citation.title                     'Molecular basis of sphingosine kinase 1 substrate recognition and catalysis.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            21 
_citation.page_first                798 
_citation.page_last                 809 
_citation.year                      2013 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23602659 
_citation.pdbx_database_id_DOI      10.1016/j.str.2013.02.025 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, Z.'      1  
primary 'Min, X.'       2  
primary 'Xiao, S.H.'    3  
primary 'Johnstone, S.' 4  
primary 'Romanow, W.'   5  
primary 'Meininger, D.' 6  
primary 'Xu, H.'        7  
primary 'Liu, J.'       8  
primary 'Dai, J.'       9  
primary 'An, S.'        10 
primary 'Thibault, S.'  11 
primary 'Walker, N.'    12 
# 
_cell.entry_id           3VZC 
_cell.length_a           102.220 
_cell.length_b           106.610 
_cell.length_c           226.180 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3VZC 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Sphingosine kinase 1'                                 39917.469 6   2.7.1.91 ? 'UNP RESIDUES 9-364' ? 
2 non-polymer syn '4-{[4-(4-chlorophenyl)-1,3-thiazol-2-yl]amino}phenol' 302.779   6   ?        ? ?                    ? 
3 non-polymer syn 1,2-ETHANEDIOL                                         62.068    2   ?        ? ?                    ? 
4 water       nat water                                                  18.015    292 ?        ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SK 1, SPK 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMGSGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHARELVRSEELGRWDALVVMSGDGL
MHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRL
FSVLSLAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVPLEE
PVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVP
VVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFWMVSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMGSGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHARELVRSEELGRWDALVVMSGDGL
MHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRL
FSVLSLAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVPLEE
PVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVP
VVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFWMVSG
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   SER n 
1 6   GLY n 
1 7   VAL n 
1 8   LEU n 
1 9   PRO n 
1 10  ARG n 
1 11  PRO n 
1 12  CYS n 
1 13  ARG n 
1 14  VAL n 
1 15  LEU n 
1 16  VAL n 
1 17  LEU n 
1 18  LEU n 
1 19  ASN n 
1 20  PRO n 
1 21  ARG n 
1 22  GLY n 
1 23  GLY n 
1 24  LYS n 
1 25  GLY n 
1 26  LYS n 
1 27  ALA n 
1 28  LEU n 
1 29  GLN n 
1 30  LEU n 
1 31  PHE n 
1 32  ARG n 
1 33  SER n 
1 34  HIS n 
1 35  VAL n 
1 36  GLN n 
1 37  PRO n 
1 38  LEU n 
1 39  LEU n 
1 40  ALA n 
1 41  GLU n 
1 42  ALA n 
1 43  GLU n 
1 44  ILE n 
1 45  SER n 
1 46  PHE n 
1 47  THR n 
1 48  LEU n 
1 49  MET n 
1 50  LEU n 
1 51  THR n 
1 52  GLU n 
1 53  ARG n 
1 54  ARG n 
1 55  ASN n 
1 56  HIS n 
1 57  ALA n 
1 58  ARG n 
1 59  GLU n 
1 60  LEU n 
1 61  VAL n 
1 62  ARG n 
1 63  SER n 
1 64  GLU n 
1 65  GLU n 
1 66  LEU n 
1 67  GLY n 
1 68  ARG n 
1 69  TRP n 
1 70  ASP n 
1 71  ALA n 
1 72  LEU n 
1 73  VAL n 
1 74  VAL n 
1 75  MET n 
1 76  SER n 
1 77  GLY n 
1 78  ASP n 
1 79  GLY n 
1 80  LEU n 
1 81  MET n 
1 82  HIS n 
1 83  GLU n 
1 84  VAL n 
1 85  VAL n 
1 86  ASN n 
1 87  GLY n 
1 88  LEU n 
1 89  MET n 
1 90  GLU n 
1 91  ARG n 
1 92  PRO n 
1 93  ASP n 
1 94  TRP n 
1 95  GLU n 
1 96  THR n 
1 97  ALA n 
1 98  ILE n 
1 99  GLN n 
1 100 LYS n 
1 101 PRO n 
1 102 LEU n 
1 103 CYS n 
1 104 SER n 
1 105 LEU n 
1 106 PRO n 
1 107 ALA n 
1 108 GLY n 
1 109 SER n 
1 110 GLY n 
1 111 ASN n 
1 112 ALA n 
1 113 LEU n 
1 114 ALA n 
1 115 ALA n 
1 116 SER n 
1 117 LEU n 
1 118 ASN n 
1 119 HIS n 
1 120 TYR n 
1 121 ALA n 
1 122 GLY n 
1 123 TYR n 
1 124 GLU n 
1 125 GLN n 
1 126 VAL n 
1 127 THR n 
1 128 ASN n 
1 129 GLU n 
1 130 ASP n 
1 131 LEU n 
1 132 LEU n 
1 133 THR n 
1 134 ASN n 
1 135 CYS n 
1 136 THR n 
1 137 LEU n 
1 138 LEU n 
1 139 LEU n 
1 140 CYS n 
1 141 ARG n 
1 142 ARG n 
1 143 LEU n 
1 144 LEU n 
1 145 SER n 
1 146 PRO n 
1 147 MET n 
1 148 ASN n 
1 149 LEU n 
1 150 LEU n 
1 151 SER n 
1 152 LEU n 
1 153 HIS n 
1 154 THR n 
1 155 ALA n 
1 156 SER n 
1 157 GLY n 
1 158 LEU n 
1 159 ARG n 
1 160 LEU n 
1 161 PHE n 
1 162 SER n 
1 163 VAL n 
1 164 LEU n 
1 165 SER n 
1 166 LEU n 
1 167 ALA n 
1 168 TRP n 
1 169 GLY n 
1 170 PHE n 
1 171 ILE n 
1 172 ALA n 
1 173 ASP n 
1 174 VAL n 
1 175 ASP n 
1 176 LEU n 
1 177 GLU n 
1 178 SER n 
1 179 GLU n 
1 180 LYS n 
1 181 TYR n 
1 182 ARG n 
1 183 ARG n 
1 184 LEU n 
1 185 GLY n 
1 186 GLU n 
1 187 MET n 
1 188 ARG n 
1 189 PHE n 
1 190 THR n 
1 191 LEU n 
1 192 GLY n 
1 193 THR n 
1 194 PHE n 
1 195 LEU n 
1 196 ARG n 
1 197 LEU n 
1 198 ALA n 
1 199 ALA n 
1 200 LEU n 
1 201 ARG n 
1 202 THR n 
1 203 TYR n 
1 204 ARG n 
1 205 GLY n 
1 206 ARG n 
1 207 LEU n 
1 208 ALA n 
1 209 TYR n 
1 210 LEU n 
1 211 PRO n 
1 212 VAL n 
1 213 GLY n 
1 214 ARG n 
1 215 VAL n 
1 216 GLY n 
1 217 SER n 
1 218 LYS n 
1 219 THR n 
1 220 PRO n 
1 221 ALA n 
1 222 SER n 
1 223 PRO n 
1 224 VAL n 
1 225 VAL n 
1 226 VAL n 
1 227 GLN n 
1 228 GLN n 
1 229 GLY n 
1 230 PRO n 
1 231 VAL n 
1 232 ASP n 
1 233 ALA n 
1 234 HIS n 
1 235 LEU n 
1 236 VAL n 
1 237 PRO n 
1 238 LEU n 
1 239 GLU n 
1 240 GLU n 
1 241 PRO n 
1 242 VAL n 
1 243 PRO n 
1 244 SER n 
1 245 HIS n 
1 246 TRP n 
1 247 THR n 
1 248 VAL n 
1 249 VAL n 
1 250 PRO n 
1 251 ASP n 
1 252 GLU n 
1 253 ASP n 
1 254 PHE n 
1 255 VAL n 
1 256 LEU n 
1 257 VAL n 
1 258 LEU n 
1 259 ALA n 
1 260 LEU n 
1 261 LEU n 
1 262 HIS n 
1 263 SER n 
1 264 HIS n 
1 265 LEU n 
1 266 GLY n 
1 267 SER n 
1 268 GLU n 
1 269 MET n 
1 270 PHE n 
1 271 ALA n 
1 272 ALA n 
1 273 PRO n 
1 274 MET n 
1 275 GLY n 
1 276 ARG n 
1 277 CYS n 
1 278 ALA n 
1 279 ALA n 
1 280 GLY n 
1 281 VAL n 
1 282 MET n 
1 283 HIS n 
1 284 LEU n 
1 285 PHE n 
1 286 TYR n 
1 287 VAL n 
1 288 ARG n 
1 289 ALA n 
1 290 GLY n 
1 291 VAL n 
1 292 SER n 
1 293 ARG n 
1 294 ALA n 
1 295 MET n 
1 296 LEU n 
1 297 LEU n 
1 298 ARG n 
1 299 LEU n 
1 300 PHE n 
1 301 LEU n 
1 302 ALA n 
1 303 MET n 
1 304 GLU n 
1 305 LYS n 
1 306 GLY n 
1 307 ARG n 
1 308 HIS n 
1 309 MET n 
1 310 GLU n 
1 311 TYR n 
1 312 GLU n 
1 313 CYS n 
1 314 PRO n 
1 315 TYR n 
1 316 LEU n 
1 317 VAL n 
1 318 TYR n 
1 319 VAL n 
1 320 PRO n 
1 321 VAL n 
1 322 VAL n 
1 323 ALA n 
1 324 PHE n 
1 325 ARG n 
1 326 LEU n 
1 327 GLU n 
1 328 PRO n 
1 329 LYS n 
1 330 ASP n 
1 331 GLY n 
1 332 LYS n 
1 333 GLY n 
1 334 VAL n 
1 335 PHE n 
1 336 ALA n 
1 337 VAL n 
1 338 ASP n 
1 339 GLY n 
1 340 GLU n 
1 341 LEU n 
1 342 MET n 
1 343 VAL n 
1 344 SER n 
1 345 GLU n 
1 346 ALA n 
1 347 VAL n 
1 348 GLN n 
1 349 GLY n 
1 350 GLN n 
1 351 VAL n 
1 352 HIS n 
1 353 PRO n 
1 354 ASN n 
1 355 TYR n 
1 356 PHE n 
1 357 TRP n 
1 358 MET n 
1 359 VAL n 
1 360 SER n 
1 361 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SPHK1, SPHK, SPK' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            sf9 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pFastBac HTb' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SPHK1_HUMAN 
_struct_ref.pdbx_db_accession          Q9NYA1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHARELVRSEELGRWDALVVMSGDGLMHEVV
NGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLS
LAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVPLEEPVPSH
WTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFR
LEPKDGKGVFAVDGELMVSEAVQGQVHPNYFWMVSG
;
_struct_ref.pdbx_align_begin           9 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3VZC A 6 ? 361 ? Q9NYA1 9 ? 364 ? 9 364 
2 1 3VZC B 6 ? 361 ? Q9NYA1 9 ? 364 ? 9 364 
3 1 3VZC C 6 ? 361 ? Q9NYA1 9 ? 364 ? 9 364 
4 1 3VZC D 6 ? 361 ? Q9NYA1 9 ? 364 ? 9 364 
5 1 3VZC E 6 ? 361 ? Q9NYA1 9 ? 364 ? 9 364 
6 1 3VZC F 6 ? 361 ? Q9NYA1 9 ? 364 ? 9 364 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3VZC GLY A 1 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 4 1  
1 3VZC ALA A 2 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 5 2  
1 3VZC MET A 3 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 6 3  
1 3VZC GLY A 4 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 7 4  
1 3VZC SER A 5 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 8 5  
2 3VZC GLY B 1 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 4 6  
2 3VZC ALA B 2 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 5 7  
2 3VZC MET B 3 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 6 8  
2 3VZC GLY B 4 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 7 9  
2 3VZC SER B 5 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 8 10 
3 3VZC GLY C 1 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 4 11 
3 3VZC ALA C 2 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 5 12 
3 3VZC MET C 3 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 6 13 
3 3VZC GLY C 4 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 7 14 
3 3VZC SER C 5 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 8 15 
4 3VZC GLY D 1 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 4 16 
4 3VZC ALA D 2 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 5 17 
4 3VZC MET D 3 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 6 18 
4 3VZC GLY D 4 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 7 19 
4 3VZC SER D 5 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 8 20 
5 3VZC GLY E 1 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 4 21 
5 3VZC ALA E 2 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 5 22 
5 3VZC MET E 3 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 6 23 
5 3VZC GLY E 4 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 7 24 
5 3VZC SER E 5 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 8 25 
6 3VZC GLY F 1 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 4 26 
6 3VZC ALA F 2 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 5 27 
6 3VZC MET F 3 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 6 28 
6 3VZC GLY F 4 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 7 29 
6 3VZC SER F 5 ? UNP Q9NYA1 ? ? 'EXPRESSION TAG' 8 30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                ?                 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                               ?                 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                             ?                 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                        ?                 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                               ?                 'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                         'ETHYLENE GLYCOL' 'C2 H6 O2'          62.068  
GLN 'L-peptide linking' y GLUTAMINE                                              ?                 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                        ?                 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                ?                 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                              ?                 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                  ?                 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                             ?                 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                ?                 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                 ?                 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                             ?                 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                          ?                 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                ?                 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                 ?                 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                              ?                 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                             ?                 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                               ?                 'C9 H11 N O3'       181.189 
UUL non-polymer         . '4-{[4-(4-chlorophenyl)-1,3-thiazol-2-yl]amino}phenol' ?                 'C15 H11 Cl N2 O S' 302.779 
VAL 'L-peptide linking' y VALINE                                                 ?                 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3VZC 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        0.340 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   52.16 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'sitting drop' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.pdbx_details    
'1.0-1.4M ammonium sulfate, 0.3-1.3M NaCl, 0.1M Bis-Tris, pH 6.0, sitting drop, temperature 289K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ADSC315R 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                '3x3 CCD array' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.monochromator                    'Double-crystal, Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
# 
_reflns.entry_id                     3VZC 
_reflns.d_resolution_high            2.300 
_reflns.d_resolution_low             113.090 
_reflns.number_all                   101561 
_reflns.number_obs                   101561 
_reflns.pdbx_netI_over_sigmaI        12.600 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_redundancy              3.400 
_reflns.percent_possible_obs         92.100 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.300 2.420  ? 45115 ? ? 0.381 1.900  0.381 ? 3.300 ? 3.100  ? 13635 ? ? 0.450 ? 85.600 0.450 0.237 1  1 
2.420 2.570  ? 42469 ? ? 0.265 2.800  0.265 ? 3.300 ? 4.400  ? 12885 ? ? 0.313 ? 85.700 0.313 0.165 2  1 
2.570 2.750  ? 40430 ? ? 0.180 4.100  0.180 ? 3.300 ? 6.000  ? 12394 ? ? 0.213 ? 87.200 0.213 0.112 3  1 
2.750 2.970  ? 38615 ? ? 0.116 6.300  0.116 ? 3.200 ? 8.700  ? 11904 ? ? 0.138 ? 90.100 0.138 0.073 4  1 
2.970 3.250  ? 37112 ? ? 0.079 8.600  0.079 ? 3.200 ? 12.400 ? 11535 ? ? 0.094 ? 94.600 0.094 0.050 5  1 
3.250 3.640  ? 35548 ? ? 0.052 11.700 0.052 ? 3.300 ? 17.700 ? 10800 ? ? 0.061 ? 97.500 0.061 0.032 6  1 
3.640 4.200  ? 33701 ? ? 0.041 13.500 0.041 ? 3.400 ? 21.900 ? 9776  ? ? 0.049 ? 99.500 0.049 0.026 7  1 
4.200 5.140  ? 30215 ? ? 0.042 12.300 0.042 ? 3.600 ? 25.200 ? 8377  ? ? 0.049 ? 99.900 0.049 0.025 8  1 
5.140 7.270  ? 23644 ? ? 0.045 10.700 0.045 ? 3.600 ? 22.900 ? 6512  ? ? 0.053 ? 99.500 0.053 0.027 9  1 
7.270 49.954 ? 14540 ? ? 0.030 15.200 0.030 ? 3.900 ? 25.700 ? 3743  ? ? 0.035 ? 98.900 0.035 0.018 10 1 
# 
_refine.entry_id                                 3VZC 
_refine.ls_d_res_high                            2.3000 
_refine.ls_d_res_low                             50.0000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    91.9700 
_refine.ls_number_reflns_obs                     101479 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES: REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2318 
_refine.ls_R_factor_R_work                       0.2290 
_refine.ls_wR_factor_R_work                      0.2323 
_refine.ls_R_factor_R_free                       0.2846 
_refine.ls_wR_factor_R_free                      0.2877 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  5084 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               44.2649 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.2000 
_refine.aniso_B[2][2]                            0.1400 
_refine.aniso_B[3][3]                            0.0600 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9440 
_refine.correlation_coeff_Fo_to_Fc_free          0.9110 
_refine.overall_SU_R_Cruickshank_DPI             0.4048 
_refine.overall_SU_R_free                        0.2830 
_refine.pdbx_overall_ESU_R                       0.4050 
_refine.pdbx_overall_ESU_R_Free                  0.2830 
_refine.overall_SU_ML                            0.2130 
_refine.overall_SU_B                             8.8890 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7464 
_refine.B_iso_max                                127.700 
_refine.B_iso_min                                16.490 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16048 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         128 
_refine_hist.number_atoms_solvent             292 
_refine_hist.number_atoms_total               16468 
_refine_hist.d_res_high                       2.3000 
_refine_hist.d_res_low                        50.0000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       16556 0.008  0.019  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    22449 1.456  1.986  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 2045  6.756  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 691   35.945 22.185 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 2731  19.596 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 150   18.492 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         2511  0.097  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   12486 0.006  0.021  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.3000 
_refine_ls_shell.d_res_low                        2.3600 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               84.8900 
_refine_ls_shell.number_reflns_R_work             6199 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3060 
_refine_ls_shell.R_factor_R_free                  0.3650 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             334 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                6533 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3VZC 
_struct.title                     'Crystal structure of Sphingosine Kinase 1 with inhibitor' 
_struct.pdbx_descriptor           'Sphingosine kinase 1 (E.C.2.7.1.91)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3VZC 
_struct_keywords.text            'lipid kinase, TRANSFERASE-INHIBITOR complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/INHIBITOR 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 3 ? 
L N N 2 ? 
M N N 2 ? 
N N N 3 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 26  ? VAL A 35  ? LYS A 29  VAL A 38  1 ? 10 
HELX_P HELX_P2  2  VAL A 35  ? ALA A 42  ? VAL A 38  ALA A 45  1 ? 8  
HELX_P HELX_P3  3  ASN A 55  ? GLU A 64  ? ASN A 58  GLU A 67  1 ? 10 
HELX_P HELX_P4  4  GLU A 65  ? TRP A 69  ? GLU A 68  TRP A 72  5 ? 5  
HELX_P HELX_P5  5  GLY A 77  ? GLU A 90  ? GLY A 80  GLU A 93  1 ? 14 
HELX_P HELX_P6  6  ASP A 93  ? ILE A 98  ? ASP A 96  ILE A 101 1 ? 6  
HELX_P HELX_P7  7  ASN A 111 ? ALA A 121 ? ASN A 114 ALA A 124 1 ? 11 
HELX_P HELX_P8  8  THR A 127 ? ARG A 142 ? THR A 130 ARG A 145 1 ? 16 
HELX_P HELX_P9  9  PHE A 170 ? SER A 178 ? PHE A 173 SER A 181 1 ? 9  
HELX_P HELX_P10 10 ARG A 188 ? LEU A 197 ? ARG A 191 LEU A 200 1 ? 10 
HELX_P HELX_P11 11 SER A 292 ? MET A 303 ? SER A 295 MET A 306 1 ? 12 
HELX_P HELX_P12 12 GLU A 304 ? GLY A 306 ? GLU A 307 GLY A 309 5 ? 3  
HELX_P HELX_P13 13 ARG A 307 ? GLU A 312 ? ARG A 310 GLU A 315 5 ? 6  
HELX_P HELX_P14 14 ARG B 21  ? LYS B 26  ? ARG B 24  LYS B 29  1 ? 6  
HELX_P HELX_P15 15 LYS B 26  ? VAL B 35  ? LYS B 29  VAL B 38  1 ? 10 
HELX_P HELX_P16 16 VAL B 35  ? ALA B 42  ? VAL B 38  ALA B 45  1 ? 8  
HELX_P HELX_P17 17 ASN B 55  ? GLU B 64  ? ASN B 58  GLU B 67  1 ? 10 
HELX_P HELX_P18 18 GLU B 65  ? TRP B 69  ? GLU B 68  TRP B 72  5 ? 5  
HELX_P HELX_P19 19 GLY B 77  ? GLU B 90  ? GLY B 80  GLU B 93  1 ? 14 
HELX_P HELX_P20 20 ASP B 93  ? ILE B 98  ? ASP B 96  ILE B 101 1 ? 6  
HELX_P HELX_P21 21 ASN B 111 ? ALA B 121 ? ASN B 114 ALA B 124 1 ? 11 
HELX_P HELX_P22 22 THR B 127 ? ARG B 142 ? THR B 130 ARG B 145 1 ? 16 
HELX_P HELX_P23 23 PHE B 170 ? GLU B 177 ? PHE B 173 GLU B 180 1 ? 8  
HELX_P HELX_P24 24 ARG B 188 ? ALA B 199 ? ARG B 191 ALA B 202 1 ? 12 
HELX_P HELX_P25 25 SER B 292 ? GLU B 304 ? SER B 295 GLU B 307 1 ? 13 
HELX_P HELX_P26 26 LYS B 305 ? GLY B 306 ? LYS B 308 GLY B 309 5 ? 2  
HELX_P HELX_P27 27 ARG B 307 ? TYR B 311 ? ARG B 310 TYR B 314 5 ? 5  
HELX_P HELX_P28 28 LYS C 26  ? VAL C 35  ? LYS C 29  VAL C 38  1 ? 10 
HELX_P HELX_P29 29 VAL C 35  ? ALA C 42  ? VAL C 38  ALA C 45  1 ? 8  
HELX_P HELX_P30 30 ASN C 55  ? GLU C 64  ? ASN C 58  GLU C 67  1 ? 10 
HELX_P HELX_P31 31 GLU C 65  ? TRP C 69  ? GLU C 68  TRP C 72  5 ? 5  
HELX_P HELX_P32 32 GLY C 77  ? GLU C 90  ? GLY C 80  GLU C 93  1 ? 14 
HELX_P HELX_P33 33 ASP C 93  ? ILE C 98  ? ASP C 96  ILE C 101 1 ? 6  
HELX_P HELX_P34 34 ASN C 111 ? ALA C 121 ? ASN C 114 ALA C 124 1 ? 11 
HELX_P HELX_P35 35 THR C 127 ? ARG C 141 ? THR C 130 ARG C 144 1 ? 15 
HELX_P HELX_P36 36 PHE C 170 ? SER C 178 ? PHE C 173 SER C 181 1 ? 9  
HELX_P HELX_P37 37 ARG C 188 ? ALA C 199 ? ARG C 191 ALA C 202 1 ? 12 
HELX_P HELX_P38 38 SER C 292 ? MET C 303 ? SER C 295 MET C 306 1 ? 12 
HELX_P HELX_P39 39 GLU C 304 ? GLY C 306 ? GLU C 307 GLY C 309 5 ? 3  
HELX_P HELX_P40 40 HIS C 308 ? GLU C 312 ? HIS C 311 GLU C 315 5 ? 5  
HELX_P HELX_P41 41 ARG D 21  ? LYS D 26  ? ARG D 24  LYS D 29  1 ? 6  
HELX_P HELX_P42 42 LYS D 26  ? VAL D 35  ? LYS D 29  VAL D 38  1 ? 10 
HELX_P HELX_P43 43 VAL D 35  ? ALA D 42  ? VAL D 38  ALA D 45  1 ? 8  
HELX_P HELX_P44 44 ASN D 55  ? GLU D 64  ? ASN D 58  GLU D 67  1 ? 10 
HELX_P HELX_P45 45 GLU D 65  ? TRP D 69  ? GLU D 68  TRP D 72  5 ? 5  
HELX_P HELX_P46 46 GLY D 77  ? GLU D 90  ? GLY D 80  GLU D 93  1 ? 14 
HELX_P HELX_P47 47 ASP D 93  ? ILE D 98  ? ASP D 96  ILE D 101 1 ? 6  
HELX_P HELX_P48 48 ASN D 111 ? ALA D 121 ? ASN D 114 ALA D 124 1 ? 11 
HELX_P HELX_P49 49 THR D 127 ? ARG D 142 ? THR D 130 ARG D 145 1 ? 16 
HELX_P HELX_P50 50 PHE D 170 ? GLU D 177 ? PHE D 173 GLU D 180 1 ? 8  
HELX_P HELX_P51 51 ARG D 188 ? ALA D 199 ? ARG D 191 ALA D 202 1 ? 12 
HELX_P HELX_P52 52 GLY D 213 ? VAL D 215 ? GLY D 216 VAL D 218 5 ? 3  
HELX_P HELX_P53 53 SER D 292 ? MET D 303 ? SER D 295 MET D 306 1 ? 12 
HELX_P HELX_P54 54 GLU D 304 ? GLY D 306 ? GLU D 307 GLY D 309 5 ? 3  
HELX_P HELX_P55 55 ARG D 307 ? GLU D 312 ? ARG D 310 GLU D 315 5 ? 6  
HELX_P HELX_P56 56 LYS E 26  ? VAL E 35  ? LYS E 29  VAL E 38  1 ? 10 
HELX_P HELX_P57 57 VAL E 35  ? ALA E 42  ? VAL E 38  ALA E 45  1 ? 8  
HELX_P HELX_P58 58 ASN E 55  ? GLU E 64  ? ASN E 58  GLU E 67  1 ? 10 
HELX_P HELX_P59 59 GLU E 65  ? TRP E 69  ? GLU E 68  TRP E 72  5 ? 5  
HELX_P HELX_P60 60 GLY E 77  ? GLU E 90  ? GLY E 80  GLU E 93  1 ? 14 
HELX_P HELX_P61 61 ASP E 93  ? ILE E 98  ? ASP E 96  ILE E 101 1 ? 6  
HELX_P HELX_P62 62 ASN E 111 ? ALA E 121 ? ASN E 114 ALA E 124 1 ? 11 
HELX_P HELX_P63 63 THR E 127 ? ARG E 142 ? THR E 130 ARG E 145 1 ? 16 
HELX_P HELX_P64 64 PHE E 170 ? SER E 178 ? PHE E 173 SER E 181 1 ? 9  
HELX_P HELX_P65 65 ARG E 188 ? ALA E 199 ? ARG E 191 ALA E 202 1 ? 12 
HELX_P HELX_P66 66 SER E 292 ? MET E 303 ? SER E 295 MET E 306 1 ? 12 
HELX_P HELX_P67 67 GLU E 304 ? GLY E 306 ? GLU E 307 GLY E 309 5 ? 3  
HELX_P HELX_P68 68 ARG E 307 ? TYR E 311 ? ARG E 310 TYR E 314 5 ? 5  
HELX_P HELX_P69 69 LYS F 26  ? HIS F 34  ? LYS F 29  HIS F 37  1 ? 9  
HELX_P HELX_P70 70 HIS F 34  ? ALA F 42  ? HIS F 37  ALA F 45  1 ? 9  
HELX_P HELX_P71 71 ASN F 55  ? GLU F 64  ? ASN F 58  GLU F 67  1 ? 10 
HELX_P HELX_P72 72 GLU F 65  ? TRP F 69  ? GLU F 68  TRP F 72  5 ? 5  
HELX_P HELX_P73 73 GLY F 77  ? GLU F 90  ? GLY F 80  GLU F 93  1 ? 14 
HELX_P HELX_P74 74 ASP F 93  ? ILE F 98  ? ASP F 96  ILE F 101 1 ? 6  
HELX_P HELX_P75 75 ASN F 111 ? ALA F 121 ? ASN F 114 ALA F 124 1 ? 11 
HELX_P HELX_P76 76 THR F 127 ? ARG F 142 ? THR F 130 ARG F 145 1 ? 16 
HELX_P HELX_P77 77 PHE F 170 ? GLU F 177 ? PHE F 173 GLU F 180 1 ? 8  
HELX_P HELX_P78 78 ARG F 188 ? ALA F 199 ? ARG F 191 ALA F 202 1 ? 12 
HELX_P HELX_P79 79 SER F 292 ? MET F 303 ? SER F 295 MET F 306 1 ? 12 
HELX_P HELX_P80 80 HIS F 308 ? GLU F 312 ? HIS F 311 GLU F 315 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ARG 10  A . ? ARG 13  A PRO 11  A ? PRO 14  A 1 -6.50  
2  ARG 10  B . ? ARG 13  B PRO 11  B ? PRO 14  B 1 -11.13 
3  PRO 328 B . ? PRO 331 B LYS 329 B ? LYS 332 B 1 14.87  
4  GLY 6   C . ? GLY 9   C VAL 7   C ? VAL 10  C 1 -9.57  
5  ARG 10  C . ? ARG 13  C PRO 11  C ? PRO 14  C 1 3.38   
6  PRO 328 C . ? PRO 331 C LYS 329 C ? LYS 332 C 1 20.69  
7  ARG 10  D . ? ARG 13  D PRO 11  D ? PRO 14  D 1 -4.60  
8  PRO 328 D . ? PRO 331 D LYS 329 D ? LYS 332 D 1 29.77  
9  ARG 10  E . ? ARG 13  E PRO 11  E ? PRO 14  E 1 -5.70  
10 PRO 328 E . ? PRO 331 E LYS 329 E ? LYS 332 E 1 15.14  
11 ARG 10  F . ? ARG 13  F PRO 11  F ? PRO 14  F 1 0.11   
12 PRO 328 F . ? PRO 331 F LYS 329 F ? LYS 332 F 1 8.22   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 6 ? 
C ? 6 ? 
D ? 4 ? 
E ? 8 ? 
F ? 8 ? 
G ? 7 ? 
H ? 8 ? 
I ? 7 ? 
J ? 9 ? 
K ? 6 ? 
L ? 6 ? 
M ? 4 ? 
N ? 4 ? 
O ? 8 ? 
P ? 7 ? 
Q ? 4 ? 
R ? 8 ? 
S ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
E 5 6 ? parallel      
E 6 7 ? parallel      
E 7 8 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 7 8 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
H 5 6 ? anti-parallel 
H 7 8 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 5 6 ? anti-parallel 
I 6 7 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
J 5 6 ? anti-parallel 
J 6 7 ? anti-parallel 
J 7 8 ? anti-parallel 
J 8 9 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
K 5 6 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
L 5 6 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? parallel      
M 3 4 ? parallel      
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? parallel      
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
O 5 6 ? anti-parallel 
O 7 8 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
P 5 6 ? anti-parallel 
P 6 7 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? parallel      
Q 3 4 ? parallel      
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
R 4 5 ? anti-parallel 
R 5 6 ? anti-parallel 
R 7 8 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
S 5 6 ? anti-parallel 
S 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 6   ? VAL A 7   ? GLY A 9   VAL A 10  
A 2 LEU A 143 ? THR A 154 ? LEU A 146 THR A 157 
A 3 VAL A 347 ? VAL A 359 ? VAL A 350 VAL A 362 
A 4 LEU A 316 ? GLU A 327 ? LEU A 319 GLU A 330 
A 5 MET A 282 ? ARG A 288 ? MET A 285 ARG A 291 
A 6 ASP A 253 ? LEU A 260 ? ASP A 256 LEU A 263 
A 7 SER A 165 ? GLY A 169 ? SER A 168 GLY A 172 
A 8 GLY A 333 ? VAL A 337 ? GLY A 336 VAL A 340 
A 9 GLU A 340 ? SER A 344 ? GLU A 343 SER A 347 
B 1 ARG A 159 ? SER A 162 ? ARG A 162 SER A 165 
B 2 LEU A 143 ? THR A 154 ? LEU A 146 THR A 157 
B 3 VAL A 347 ? VAL A 359 ? VAL A 350 VAL A 362 
B 4 LEU A 316 ? GLU A 327 ? LEU A 319 GLU A 330 
B 5 ARG A 206 ? PRO A 211 ? ARG A 209 PRO A 214 
B 6 THR A 247 ? VAL A 248 ? THR A 250 VAL A 251 
C 1 THR A 247 ? VAL A 248 ? THR A 250 VAL A 251 
C 2 ARG A 206 ? PRO A 211 ? ARG A 209 PRO A 214 
C 3 LEU A 316 ? GLU A 327 ? LEU A 319 GLU A 330 
C 4 MET A 282 ? ARG A 288 ? MET A 285 ARG A 291 
C 5 ASP A 253 ? LEU A 260 ? ASP A 256 LEU A 263 
C 6 TYR A 203 ? ARG A 204 ? TYR A 206 ARG A 207 
D 1 ILE A 44  ? LEU A 50  ? ILE A 47  LEU A 53  
D 2 CYS A 12  ? LEU A 18  ? CYS A 15  LEU A 21  
D 3 ALA A 71  ? SER A 76  ? ALA A 74  SER A 79  
D 4 LEU A 102 ? PRO A 106 ? LEU A 105 PRO A 109 
E 1 LEU B 102 ? PRO B 106 ? LEU B 105 PRO B 109 
E 2 ALA B 71  ? SER B 76  ? ALA B 74  SER B 79  
E 3 CYS B 12  ? LEU B 18  ? CYS B 15  LEU B 21  
E 4 ILE B 44  ? LEU B 50  ? ILE B 47  LEU B 53  
E 5 ILE C 44  ? LEU C 50  ? ILE C 47  LEU C 53  
E 6 CYS C 12  ? LEU C 18  ? CYS C 15  LEU C 21  
E 7 ALA C 71  ? SER C 76  ? ALA C 74  SER C 79  
E 8 LEU C 102 ? PRO C 106 ? LEU C 105 PRO C 109 
F 1 ARG B 159 ? SER B 162 ? ARG B 162 SER B 165 
F 2 LEU B 144 ? THR B 154 ? LEU B 147 THR B 157 
F 3 VAL B 347 ? VAL B 359 ? VAL B 350 VAL B 362 
F 4 LEU B 316 ? GLU B 327 ? LEU B 319 GLU B 330 
F 5 MET B 282 ? ARG B 288 ? MET B 285 ARG B 291 
F 6 ASP B 253 ? LEU B 260 ? ASP B 256 LEU B 263 
F 7 ARG B 206 ? PRO B 211 ? ARG B 209 PRO B 214 
F 8 THR B 247 ? VAL B 248 ? THR B 250 VAL B 251 
G 1 TYR B 203 ? ARG B 204 ? TYR B 206 ARG B 207 
G 2 ASP B 253 ? LEU B 260 ? ASP B 256 LEU B 263 
G 3 MET B 282 ? ARG B 288 ? MET B 285 ARG B 291 
G 4 LEU B 316 ? GLU B 327 ? LEU B 319 GLU B 330 
G 5 SER B 165 ? GLY B 169 ? SER B 168 GLY B 172 
G 6 GLY B 333 ? VAL B 337 ? GLY B 336 VAL B 340 
G 7 GLU B 340 ? SER B 344 ? GLU B 343 SER B 347 
H 1 ARG C 159 ? SER C 162 ? ARG C 162 SER C 165 
H 2 LEU C 144 ? THR C 154 ? LEU C 147 THR C 157 
H 3 VAL C 347 ? VAL C 359 ? VAL C 350 VAL C 362 
H 4 LEU C 316 ? GLU C 327 ? LEU C 319 GLU C 330 
H 5 MET C 282 ? ARG C 288 ? MET C 285 ARG C 291 
H 6 ASP C 253 ? LEU C 260 ? ASP C 256 LEU C 263 
H 7 ARG C 206 ? PRO C 211 ? ARG C 209 PRO C 214 
H 8 THR C 247 ? VAL C 248 ? THR C 250 VAL C 251 
I 1 TYR C 203 ? ARG C 204 ? TYR C 206 ARG C 207 
I 2 ASP C 253 ? LEU C 260 ? ASP C 256 LEU C 263 
I 3 MET C 282 ? ARG C 288 ? MET C 285 ARG C 291 
I 4 LEU C 316 ? GLU C 327 ? LEU C 319 GLU C 330 
I 5 SER C 165 ? GLY C 169 ? SER C 168 GLY C 172 
I 6 GLY C 333 ? VAL C 337 ? GLY C 336 VAL C 340 
I 7 GLU C 340 ? SER C 344 ? GLU C 343 SER C 347 
J 1 GLY D 6   ? VAL D 7   ? GLY D 9   VAL D 10  
J 2 LEU D 143 ? THR D 154 ? LEU D 146 THR D 157 
J 3 VAL D 347 ? VAL D 359 ? VAL D 350 VAL D 362 
J 4 LEU D 316 ? GLU D 327 ? LEU D 319 GLU D 330 
J 5 MET D 282 ? ARG D 288 ? MET D 285 ARG D 291 
J 6 ASP D 253 ? LEU D 260 ? ASP D 256 LEU D 263 
J 7 SER D 165 ? GLY D 169 ? SER D 168 GLY D 172 
J 8 GLY D 333 ? VAL D 337 ? GLY D 336 VAL D 340 
J 9 GLU D 340 ? SER D 344 ? GLU D 343 SER D 347 
K 1 ARG D 159 ? SER D 162 ? ARG D 162 SER D 165 
K 2 LEU D 143 ? THR D 154 ? LEU D 146 THR D 157 
K 3 VAL D 347 ? VAL D 359 ? VAL D 350 VAL D 362 
K 4 LEU D 316 ? GLU D 327 ? LEU D 319 GLU D 330 
K 5 ARG D 206 ? PRO D 211 ? ARG D 209 PRO D 214 
K 6 THR D 247 ? VAL D 248 ? THR D 250 VAL D 251 
L 1 THR D 247 ? VAL D 248 ? THR D 250 VAL D 251 
L 2 ARG D 206 ? PRO D 211 ? ARG D 209 PRO D 214 
L 3 LEU D 316 ? GLU D 327 ? LEU D 319 GLU D 330 
L 4 MET D 282 ? ARG D 288 ? MET D 285 ARG D 291 
L 5 ASP D 253 ? LEU D 260 ? ASP D 256 LEU D 263 
L 6 TYR D 203 ? ARG D 204 ? TYR D 206 ARG D 207 
M 1 ILE D 44  ? LEU D 50  ? ILE D 47  LEU D 53  
M 2 CYS D 12  ? LEU D 18  ? CYS D 15  LEU D 21  
M 3 ALA D 71  ? SER D 76  ? ALA D 74  SER D 79  
M 4 LEU D 102 ? PRO D 106 ? LEU D 105 PRO D 109 
N 1 ILE E 44  ? LEU E 50  ? ILE E 47  LEU E 53  
N 2 CYS E 12  ? LEU E 18  ? CYS E 15  LEU E 21  
N 3 ALA E 71  ? SER E 76  ? ALA E 74  SER E 79  
N 4 LEU E 102 ? PRO E 106 ? LEU E 105 PRO E 109 
O 1 ARG E 159 ? SER E 162 ? ARG E 162 SER E 165 
O 2 LEU E 144 ? THR E 154 ? LEU E 147 THR E 157 
O 3 VAL E 347 ? VAL E 359 ? VAL E 350 VAL E 362 
O 4 LEU E 316 ? GLU E 327 ? LEU E 319 GLU E 330 
O 5 MET E 282 ? ARG E 288 ? MET E 285 ARG E 291 
O 6 ASP E 253 ? LEU E 260 ? ASP E 256 LEU E 263 
O 7 ARG E 206 ? PRO E 211 ? ARG E 209 PRO E 214 
O 8 THR E 247 ? VAL E 248 ? THR E 250 VAL E 251 
P 1 TYR E 203 ? ARG E 204 ? TYR E 206 ARG E 207 
P 2 ASP E 253 ? LEU E 260 ? ASP E 256 LEU E 263 
P 3 MET E 282 ? ARG E 288 ? MET E 285 ARG E 291 
P 4 LEU E 316 ? GLU E 327 ? LEU E 319 GLU E 330 
P 5 SER E 165 ? GLY E 169 ? SER E 168 GLY E 172 
P 6 GLY E 333 ? VAL E 337 ? GLY E 336 VAL E 340 
P 7 GLU E 340 ? SER E 344 ? GLU E 343 SER E 347 
Q 1 ILE F 44  ? LEU F 50  ? ILE F 47  LEU F 53  
Q 2 CYS F 12  ? LEU F 18  ? CYS F 15  LEU F 21  
Q 3 ALA F 71  ? SER F 76  ? ALA F 74  SER F 79  
Q 4 LEU F 102 ? PRO F 106 ? LEU F 105 PRO F 109 
R 1 ARG F 159 ? SER F 162 ? ARG F 162 SER F 165 
R 2 LEU F 144 ? THR F 154 ? LEU F 147 THR F 157 
R 3 VAL F 347 ? VAL F 359 ? VAL F 350 VAL F 362 
R 4 LEU F 316 ? GLU F 327 ? LEU F 319 GLU F 330 
R 5 MET F 282 ? ARG F 288 ? MET F 285 ARG F 291 
R 6 ASP F 253 ? LEU F 260 ? ASP F 256 LEU F 263 
R 7 ARG F 206 ? PRO F 211 ? ARG F 209 PRO F 214 
R 8 THR F 247 ? VAL F 248 ? THR F 250 VAL F 251 
S 1 TYR F 203 ? ARG F 204 ? TYR F 206 ARG F 207 
S 2 ASP F 253 ? LEU F 260 ? ASP F 256 LEU F 263 
S 3 MET F 282 ? ARG F 288 ? MET F 285 ARG F 291 
S 4 LEU F 316 ? GLU F 327 ? LEU F 319 GLU F 330 
S 5 SER F 165 ? GLY F 169 ? SER F 168 GLY F 172 
S 6 GLY F 333 ? VAL F 337 ? GLY F 336 VAL F 340 
S 7 GLU F 340 ? SER F 344 ? GLU F 343 SER F 347 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 6   ? N GLY A 9   O LEU A 144 ? O LEU A 147 
A 2 3 N LEU A 149 ? N LEU A 152 O HIS A 352 ? O HIS A 355 
A 3 4 O VAL A 347 ? O VAL A 350 N LEU A 326 ? N LEU A 329 
A 4 5 O VAL A 317 ? O VAL A 320 N TYR A 286 ? N TYR A 289 
A 5 6 O PHE A 285 ? O PHE A 288 N LEU A 258 ? N LEU A 261 
A 6 7 O ALA A 259 ? O ALA A 262 N LEU A 166 ? N LEU A 169 
A 7 8 N ALA A 167 ? N ALA A 170 O ALA A 336 ? O ALA A 339 
A 8 9 N PHE A 335 ? N PHE A 338 O MET A 342 ? O MET A 345 
B 1 2 O LEU A 160 ? O LEU A 163 N LEU A 152 ? N LEU A 155 
B 2 3 N LEU A 149 ? N LEU A 152 O HIS A 352 ? O HIS A 355 
B 3 4 O VAL A 347 ? O VAL A 350 N LEU A 326 ? N LEU A 329 
B 4 5 O ARG A 325 ? O ARG A 328 N ALA A 208 ? N ALA A 211 
B 5 6 N TYR A 209 ? N TYR A 212 O THR A 247 ? O THR A 250 
C 1 2 O THR A 247 ? O THR A 250 N TYR A 209 ? N TYR A 212 
C 2 3 N ALA A 208 ? N ALA A 211 O ARG A 325 ? O ARG A 328 
C 3 4 O VAL A 317 ? O VAL A 320 N TYR A 286 ? N TYR A 289 
C 4 5 O PHE A 285 ? O PHE A 288 N LEU A 258 ? N LEU A 261 
C 5 6 O PHE A 254 ? O PHE A 257 N TYR A 203 ? N TYR A 206 
D 1 2 O MET A 49  ? O MET A 52  N VAL A 16  ? N VAL A 19  
D 2 3 N LEU A 17  ? N LEU A 20  O MET A 75  ? O MET A 78  
D 3 4 N VAL A 74  ? N VAL A 77  O CYS A 103 ? O CYS A 106 
E 1 2 O LEU B 105 ? O LEU B 108 N VAL B 74  ? N VAL B 77  
E 2 3 O VAL B 73  ? O VAL B 76  N LEU B 15  ? N LEU B 18  
E 3 4 N VAL B 16  ? N VAL B 19  O THR B 47  ? O THR B 50  
E 4 5 N LEU B 48  ? N LEU B 51  O LEU C 50  ? O LEU C 53  
E 5 6 O THR C 47  ? O THR C 50  N VAL C 16  ? N VAL C 19  
E 6 7 N LEU C 15  ? N LEU C 18  O VAL C 73  ? O VAL C 76  
E 7 8 N VAL C 74  ? N VAL C 77  O LEU C 105 ? O LEU C 108 
F 1 2 O LEU B 160 ? O LEU B 163 N LEU B 152 ? N LEU B 155 
F 2 3 N LEU B 149 ? N LEU B 152 O HIS B 352 ? O HIS B 355 
F 3 4 O VAL B 351 ? O VAL B 354 N VAL B 322 ? N VAL B 325 
F 4 5 O VAL B 317 ? O VAL B 320 N TYR B 286 ? N TYR B 289 
F 5 6 O PHE B 285 ? O PHE B 288 N LEU B 258 ? N LEU B 261 
F 7 8 N TYR B 209 ? N TYR B 212 O THR B 247 ? O THR B 250 
G 1 2 N TYR B 203 ? N TYR B 206 O PHE B 254 ? O PHE B 257 
G 2 3 N LEU B 258 ? N LEU B 261 O PHE B 285 ? O PHE B 288 
G 3 4 N TYR B 286 ? N TYR B 289 O VAL B 317 ? O VAL B 320 
G 5 6 N ALA B 167 ? N ALA B 170 O ALA B 336 ? O ALA B 339 
G 6 7 N PHE B 335 ? N PHE B 338 O MET B 342 ? O MET B 345 
H 1 2 O LEU C 160 ? O LEU C 163 N LEU C 152 ? N LEU C 155 
H 2 3 N SER C 151 ? N SER C 154 O GLN C 350 ? O GLN C 353 
H 3 4 O VAL C 347 ? O VAL C 350 N LEU C 326 ? N LEU C 329 
H 4 5 O VAL C 321 ? O VAL C 324 N MET C 282 ? N MET C 285 
H 5 6 O VAL C 287 ? O VAL C 290 N VAL C 255 ? N VAL C 258 
H 7 8 N TYR C 209 ? N TYR C 212 O THR C 247 ? O THR C 250 
I 1 2 N TYR C 203 ? N TYR C 206 O PHE C 254 ? O PHE C 257 
I 2 3 N VAL C 255 ? N VAL C 258 O VAL C 287 ? O VAL C 290 
I 3 4 N MET C 282 ? N MET C 285 O VAL C 321 ? O VAL C 324 
I 5 6 N ALA C 167 ? N ALA C 170 O ALA C 336 ? O ALA C 339 
I 6 7 N PHE C 335 ? N PHE C 338 O MET C 342 ? O MET C 345 
J 1 2 N GLY D 6   ? N GLY D 9   O LEU D 144 ? O LEU D 147 
J 2 3 N MET D 147 ? N MET D 150 O PHE D 356 ? O PHE D 359 
J 3 4 O VAL D 347 ? O VAL D 350 N LEU D 326 ? N LEU D 329 
J 4 5 O VAL D 317 ? O VAL D 320 N TYR D 286 ? N TYR D 289 
J 5 6 O HIS D 283 ? O HIS D 286 N LEU D 260 ? N LEU D 263 
J 6 7 O ALA D 259 ? O ALA D 262 N LEU D 166 ? N LEU D 169 
J 7 8 N ALA D 167 ? N ALA D 170 O ALA D 336 ? O ALA D 339 
J 8 9 N VAL D 337 ? N VAL D 340 O GLU D 340 ? O GLU D 343 
K 1 2 O LEU D 160 ? O LEU D 163 N LEU D 152 ? N LEU D 155 
K 2 3 N MET D 147 ? N MET D 150 O PHE D 356 ? O PHE D 359 
K 3 4 O VAL D 347 ? O VAL D 350 N LEU D 326 ? N LEU D 329 
K 4 5 O GLU D 327 ? O GLU D 330 N ARG D 206 ? N ARG D 209 
K 5 6 N TYR D 209 ? N TYR D 212 O THR D 247 ? O THR D 250 
L 1 2 O THR D 247 ? O THR D 250 N TYR D 209 ? N TYR D 212 
L 2 3 N ARG D 206 ? N ARG D 209 O GLU D 327 ? O GLU D 330 
L 3 4 O VAL D 317 ? O VAL D 320 N TYR D 286 ? N TYR D 289 
L 4 5 O HIS D 283 ? O HIS D 286 N LEU D 260 ? N LEU D 263 
L 5 6 O PHE D 254 ? O PHE D 257 N TYR D 203 ? N TYR D 206 
M 1 2 O MET D 49  ? O MET D 52  N VAL D 16  ? N VAL D 19  
M 2 3 N LEU D 15  ? N LEU D 18  O VAL D 73  ? O VAL D 76  
M 3 4 N VAL D 74  ? N VAL D 77  O CYS D 103 ? O CYS D 106 
N 1 2 O MET E 49  ? O MET E 52  N VAL E 16  ? N VAL E 19  
N 2 3 N LEU E 15  ? N LEU E 18  O VAL E 73  ? O VAL E 76  
N 3 4 N VAL E 74  ? N VAL E 77  O CYS E 103 ? O CYS E 106 
O 1 2 O SER E 162 ? O SER E 165 N LEU E 150 ? N LEU E 153 
O 2 3 N SER E 151 ? N SER E 154 O GLN E 350 ? O GLN E 353 
O 3 4 O VAL E 347 ? O VAL E 350 N LEU E 326 ? N LEU E 329 
O 4 5 O VAL E 317 ? O VAL E 320 N TYR E 286 ? N TYR E 289 
O 5 6 O HIS E 283 ? O HIS E 286 N LEU E 260 ? N LEU E 263 
O 7 8 N TYR E 209 ? N TYR E 212 O THR E 247 ? O THR E 250 
P 1 2 N TYR E 203 ? N TYR E 206 O PHE E 254 ? O PHE E 257 
P 2 3 N LEU E 260 ? N LEU E 263 O HIS E 283 ? O HIS E 286 
P 3 4 N TYR E 286 ? N TYR E 289 O VAL E 317 ? O VAL E 320 
P 5 6 N ALA E 167 ? N ALA E 170 O ALA E 336 ? O ALA E 339 
P 6 7 N PHE E 335 ? N PHE E 338 O MET E 342 ? O MET E 345 
Q 1 2 O MET F 49  ? O MET F 52  N LEU F 18  ? N LEU F 21  
Q 2 3 N LEU F 17  ? N LEU F 20  O MET F 75  ? O MET F 78  
Q 3 4 N VAL F 74  ? N VAL F 77  O LEU F 105 ? O LEU F 108 
R 1 2 O LEU F 160 ? O LEU F 163 N LEU F 152 ? N LEU F 155 
R 2 3 N HIS F 153 ? N HIS F 156 O GLN F 348 ? O GLN F 351 
R 3 4 O VAL F 351 ? O VAL F 354 N VAL F 322 ? N VAL F 325 
R 4 5 O VAL F 317 ? O VAL F 320 N TYR F 286 ? N TYR F 289 
R 5 6 O HIS F 283 ? O HIS F 286 N LEU F 260 ? N LEU F 263 
R 7 8 N TYR F 209 ? N TYR F 212 O THR F 247 ? O THR F 250 
S 1 2 N TYR F 203 ? N TYR F 206 O PHE F 254 ? O PHE F 257 
S 2 3 N LEU F 260 ? N LEU F 263 O HIS F 283 ? O HIS F 286 
S 3 4 N TYR F 286 ? N TYR F 289 O VAL F 317 ? O VAL F 320 
S 5 6 N ALA F 167 ? N ALA F 170 O ALA F 336 ? O ALA F 339 
S 6 7 N VAL F 337 ? N VAL F 340 O GLU F 340 ? O GLU F 343 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE UUL A 1001' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE UUL B 1001' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE UUL C 1001' 
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE UUL D 1001' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO D 1002' 
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE UUL E 1001' 
AC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE UUL F 1001' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO F 1002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  PHE A 170 ? PHE A 173 . ? 1_555 ? 
2  AC1 9  ILE A 171 ? ILE A 174 . ? 1_555 ? 
3  AC1 9  VAL A 174 ? VAL A 177 . ? 1_555 ? 
4  AC1 9  ASP A 175 ? ASP A 178 . ? 1_555 ? 
5  AC1 9  THR A 193 ? THR A 196 . ? 1_555 ? 
6  AC1 9  MET A 269 ? MET A 272 . ? 1_555 ? 
7  AC1 9  PHE A 285 ? PHE A 288 . ? 1_555 ? 
8  AC1 9  LEU A 296 ? LEU A 299 . ? 1_555 ? 
9  AC1 9  PHE A 300 ? PHE A 303 . ? 1_555 ? 
10 AC2 10 PHE B 170 ? PHE B 173 . ? 1_555 ? 
11 AC2 10 ILE B 171 ? ILE B 174 . ? 1_555 ? 
12 AC2 10 VAL B 174 ? VAL B 177 . ? 1_555 ? 
13 AC2 10 ASP B 175 ? ASP B 178 . ? 1_555 ? 
14 AC2 10 THR B 193 ? THR B 196 . ? 1_555 ? 
15 AC2 10 MET B 269 ? MET B 272 . ? 1_555 ? 
16 AC2 10 PHE B 285 ? PHE B 288 . ? 1_555 ? 
17 AC2 10 LEU B 296 ? LEU B 299 . ? 1_555 ? 
18 AC2 10 PHE B 300 ? PHE B 303 . ? 1_555 ? 
19 AC2 10 MET B 303 ? MET B 306 . ? 1_555 ? 
20 AC3 10 PHE C 170 ? PHE C 173 . ? 1_555 ? 
21 AC3 10 ILE C 171 ? ILE C 174 . ? 1_555 ? 
22 AC3 10 VAL C 174 ? VAL C 177 . ? 1_555 ? 
23 AC3 10 ASP C 175 ? ASP C 178 . ? 1_555 ? 
24 AC3 10 THR C 193 ? THR C 196 . ? 1_555 ? 
25 AC3 10 MET C 269 ? MET C 272 . ? 1_555 ? 
26 AC3 10 PHE C 285 ? PHE C 288 . ? 1_555 ? 
27 AC3 10 PHE C 300 ? PHE C 303 . ? 1_555 ? 
28 AC3 10 MET C 303 ? MET C 306 . ? 1_555 ? 
29 AC3 10 HIS C 308 ? HIS C 311 . ? 1_555 ? 
30 AC4 10 PHE D 170 ? PHE D 173 . ? 1_555 ? 
31 AC4 10 ILE D 171 ? ILE D 174 . ? 1_555 ? 
32 AC4 10 VAL D 174 ? VAL D 177 . ? 1_555 ? 
33 AC4 10 ASP D 175 ? ASP D 178 . ? 1_555 ? 
34 AC4 10 THR D 193 ? THR D 196 . ? 1_555 ? 
35 AC4 10 MET D 269 ? MET D 272 . ? 1_555 ? 
36 AC4 10 PHE D 285 ? PHE D 288 . ? 1_555 ? 
37 AC4 10 PHE D 300 ? PHE D 303 . ? 1_555 ? 
38 AC4 10 MET D 303 ? MET D 306 . ? 1_555 ? 
39 AC4 10 HIS D 308 ? HIS D 311 . ? 1_555 ? 
40 AC5 6  MET D 147 ? MET D 150 . ? 1_555 ? 
41 AC5 6  ASN D 148 ? ASN D 151 . ? 1_555 ? 
42 AC5 6  LEU D 261 ? LEU D 264 . ? 1_555 ? 
43 AC5 6  HIS D 262 ? HIS D 265 . ? 1_555 ? 
44 AC5 6  ARG D 276 ? ARG D 279 . ? 1_555 ? 
45 AC5 6  CYS D 277 ? CYS D 280 . ? 1_555 ? 
46 AC6 9  PHE E 170 ? PHE E 173 . ? 1_555 ? 
47 AC6 9  ILE E 171 ? ILE E 174 . ? 1_555 ? 
48 AC6 9  VAL E 174 ? VAL E 177 . ? 1_555 ? 
49 AC6 9  ASP E 175 ? ASP E 178 . ? 1_555 ? 
50 AC6 9  THR E 193 ? THR E 196 . ? 1_555 ? 
51 AC6 9  MET E 269 ? MET E 272 . ? 1_555 ? 
52 AC6 9  PHE E 285 ? PHE E 288 . ? 1_555 ? 
53 AC6 9  PHE E 300 ? PHE E 303 . ? 1_555 ? 
54 AC6 9  MET E 303 ? MET E 306 . ? 1_555 ? 
55 AC7 9  PHE F 170 ? PHE F 173 . ? 1_555 ? 
56 AC7 9  ILE F 171 ? ILE F 174 . ? 1_555 ? 
57 AC7 9  ASP F 175 ? ASP F 178 . ? 1_555 ? 
58 AC7 9  PHE F 189 ? PHE F 192 . ? 1_555 ? 
59 AC7 9  THR F 193 ? THR F 196 . ? 1_555 ? 
60 AC7 9  MET F 269 ? MET F 272 . ? 1_555 ? 
61 AC7 9  PHE F 285 ? PHE F 288 . ? 1_555 ? 
62 AC7 9  PHE F 300 ? PHE F 303 . ? 1_555 ? 
63 AC7 9  HIS F 308 ? HIS F 311 . ? 1_555 ? 
64 AC8 5  MET F 147 ? MET F 150 . ? 1_555 ? 
65 AC8 5  ASN F 148 ? ASN F 151 . ? 1_555 ? 
66 AC8 5  LEU F 261 ? LEU F 264 . ? 1_555 ? 
67 AC8 5  ARG F 276 ? ARG F 279 . ? 1_555 ? 
68 AC8 5  CYS F 277 ? CYS F 280 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3VZC 
_atom_sites.fract_transf_matrix[1][1]   0.009783 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009380 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004421 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A 1 3   ? -22.760 -22.958  10.547  1.00 59.71  ? 6    MET A N   1 
ATOM   2     C  CA  . MET A 1 3   ? -21.458 -23.262  9.883   1.00 63.07  ? 6    MET A CA  1 
ATOM   3     C  C   . MET A 1 3   ? -20.373 -22.266  10.331  1.00 62.03  ? 6    MET A C   1 
ATOM   4     O  O   . MET A 1 3   ? -19.260 -22.664  10.679  1.00 63.09  ? 6    MET A O   1 
ATOM   5     C  CB  . MET A 1 3   ? -21.632 -23.266  8.357   1.00 66.03  ? 6    MET A CB  1 
ATOM   6     C  CG  . MET A 1 3   ? -20.478 -23.844  7.546   1.00 67.37  ? 6    MET A CG  1 
ATOM   7     S  SD  . MET A 1 3   ? -20.291 -25.640  7.652   1.00 77.14  ? 6    MET A SD  1 
ATOM   8     C  CE  . MET A 1 3   ? -18.872 -25.766  8.743   1.00 70.64  ? 6    MET A CE  1 
ATOM   9     N  N   . GLY A 1 4   ? -20.703 -20.976  10.338  1.00 58.57  ? 7    GLY A N   1 
ATOM   10    C  CA  . GLY A 1 4   ? -19.788 -19.951  10.842  1.00 54.08  ? 7    GLY A CA  1 
ATOM   11    C  C   . GLY A 1 4   ? -19.717 -19.910  12.364  1.00 52.05  ? 7    GLY A C   1 
ATOM   12    O  O   . GLY A 1 4   ? -20.725 -20.056  13.049  1.00 49.42  ? 7    GLY A O   1 
ATOM   13    N  N   . SER A 1 5   ? -18.519 -19.695  12.892  1.00 48.40  ? 8    SER A N   1 
ATOM   14    C  CA  . SER A 1 5   ? -18.304 -19.656  14.328  1.00 46.97  ? 8    SER A CA  1 
ATOM   15    C  C   . SER A 1 5   ? -18.042 -18.245  14.879  1.00 47.84  ? 8    SER A C   1 
ATOM   16    O  O   . SER A 1 5   ? -17.722 -18.086  16.055  1.00 50.01  ? 8    SER A O   1 
ATOM   17    C  CB  . SER A 1 5   ? -17.155 -20.590  14.697  1.00 46.42  ? 8    SER A CB  1 
ATOM   18    O  OG  . SER A 1 5   ? -17.538 -21.936  14.514  1.00 47.47  ? 8    SER A OG  1 
ATOM   19    N  N   . GLY A 1 6   ? -18.176 -17.227  14.029  1.00 45.50  ? 9    GLY A N   1 
ATOM   20    C  CA  . GLY A 1 6   ? -17.918 -15.846  14.427  1.00 41.71  ? 9    GLY A CA  1 
ATOM   21    C  C   . GLY A 1 6   ? -18.282 -14.900  13.304  1.00 39.07  ? 9    GLY A C   1 
ATOM   22    O  O   . GLY A 1 6   ? -18.546 -15.332  12.184  1.00 36.59  ? 9    GLY A O   1 
ATOM   23    N  N   . VAL A 1 7   ? -18.321 -13.606  13.605  1.00 38.66  ? 10   VAL A N   1 
ATOM   24    C  CA  . VAL A 1 7   ? -18.583 -12.604  12.570  1.00 38.55  ? 10   VAL A CA  1 
ATOM   25    C  C   . VAL A 1 7   ? -17.732 -11.369  12.707  1.00 36.88  ? 10   VAL A C   1 
ATOM   26    O  O   . VAL A 1 7   ? -17.424 -10.931  13.814  1.00 37.98  ? 10   VAL A O   1 
ATOM   27    C  CB  . VAL A 1 7   ? -20.051 -12.156  12.517  1.00 39.64  ? 10   VAL A CB  1 
ATOM   28    C  CG1 . VAL A 1 7   ? -20.905 -13.274  11.967  1.00 40.34  ? 10   VAL A CG1 1 
ATOM   29    C  CG2 . VAL A 1 7   ? -20.537 -11.669  13.883  1.00 40.88  ? 10   VAL A CG2 1 
ATOM   30    N  N   . LEU A 1 8   ? -17.340 -10.817  11.568  1.00 35.37  ? 11   LEU A N   1 
ATOM   31    C  CA  . LEU A 1 8   ? -16.824 -9.464   11.560  1.00 36.81  ? 11   LEU A CA  1 
ATOM   32    C  C   . LEU A 1 8   ? -18.001 -8.525   11.792  1.00 36.09  ? 11   LEU A C   1 
ATOM   33    O  O   . LEU A 1 8   ? -19.110 -8.799   11.332  1.00 35.84  ? 11   LEU A O   1 
ATOM   34    C  CB  . LEU A 1 8   ? -16.117 -9.135   10.243  1.00 35.26  ? 11   LEU A CB  1 
ATOM   35    C  CG  . LEU A 1 8   ? -14.937 -10.037  9.864   1.00 33.59  ? 11   LEU A CG  1 
ATOM   36    C  CD1 . LEU A 1 8   ? -14.496 -9.710   8.448   1.00 33.01  ? 11   LEU A CD1 1 
ATOM   37    C  CD2 . LEU A 1 8   ? -13.780 -9.899   10.844  1.00 31.17  ? 11   LEU A CD2 1 
ATOM   38    N  N   . PRO A 1 9   ? -17.766 -7.446   12.548  1.00 36.39  ? 12   PRO A N   1 
ATOM   39    C  CA  . PRO A 1 9   ? -18.698 -6.328   12.675  1.00 37.84  ? 12   PRO A CA  1 
ATOM   40    C  C   . PRO A 1 9   ? -19.063 -5.723   11.318  1.00 40.25  ? 12   PRO A C   1 
ATOM   41    O  O   . PRO A 1 9   ? -18.220 -5.673   10.415  1.00 38.22  ? 12   PRO A O   1 
ATOM   42    C  CB  . PRO A 1 9   ? -17.894 -5.291   13.466  1.00 37.21  ? 12   PRO A CB  1 
ATOM   43    C  CG  . PRO A 1 9   ? -16.865 -6.058   14.210  1.00 37.07  ? 12   PRO A CG  1 
ATOM   44    C  CD  . PRO A 1 9   ? -16.570 -7.288   13.399  1.00 35.90  ? 12   PRO A CD  1 
ATOM   45    N  N   . ARG A 1 10  ? -20.317 -5.293   11.176  1.00 43.42  ? 13   ARG A N   1 
ATOM   46    C  CA  . ARG A 1 10  ? -20.724 -4.402   10.088  1.00 44.14  ? 13   ARG A CA  1 
ATOM   47    C  C   . ARG A 1 10  ? -21.160 -3.070   10.699  1.00 44.80  ? 13   ARG A C   1 
ATOM   48    O  O   . ARG A 1 10  ? -22.037 -3.055   11.558  1.00 47.48  ? 13   ARG A O   1 
ATOM   49    C  CB  . ARG A 1 10  ? -21.873 -4.992   9.267   1.00 47.22  ? 13   ARG A CB  1 
ATOM   50    C  CG  . ARG A 1 10  ? -22.331 -4.076   8.132   1.00 49.40  ? 13   ARG A CG  1 
ATOM   51    C  CD  . ARG A 1 10  ? -23.686 -4.473   7.562   1.00 50.77  ? 13   ARG A CD  1 
ATOM   52    N  NE  . ARG A 1 10  ? -23.568 -5.407   6.440   1.00 56.05  ? 13   ARG A NE  1 
ATOM   53    C  CZ  . ARG A 1 10  ? -23.682 -5.078   5.151   1.00 55.47  ? 13   ARG A CZ  1 
ATOM   54    N  NH1 . ARG A 1 10  ? -23.919 -3.817   4.785   1.00 55.21  ? 13   ARG A NH1 1 
ATOM   55    N  NH2 . ARG A 1 10  ? -23.553 -6.019   4.219   1.00 51.81  ? 13   ARG A NH2 1 
ATOM   56    N  N   . PRO A 1 11  ? -20.531 -1.948   10.292  1.00 43.50  ? 14   PRO A N   1 
ATOM   57    C  CA  . PRO A 1 11  ? -19.372 -1.829   9.416   1.00 41.46  ? 14   PRO A CA  1 
ATOM   58    C  C   . PRO A 1 11  ? -18.091 -2.313   10.102  1.00 39.53  ? 14   PRO A C   1 
ATOM   59    O  O   . PRO A 1 11  ? -18.085 -2.586   11.303  1.00 37.65  ? 14   PRO A O   1 
ATOM   60    C  CB  . PRO A 1 11  ? -19.274 -0.315   9.194   1.00 43.57  ? 14   PRO A CB  1 
ATOM   61    C  CG  . PRO A 1 11  ? -19.819 0.262    10.463  1.00 42.24  ? 14   PRO A CG  1 
ATOM   62    C  CD  . PRO A 1 11  ? -20.999 -0.622   10.741  1.00 43.19  ? 14   PRO A CD  1 
ATOM   63    N  N   . CYS A 1 12  ? -17.015 -2.413   9.332   1.00 38.04  ? 15   CYS A N   1 
ATOM   64    C  CA  . CYS A 1 12  ? -15.710 -2.719   9.880   1.00 36.08  ? 15   CYS A CA  1 
ATOM   65    C  C   . CYS A 1 12  ? -14.648 -2.082   9.004   1.00 35.81  ? 15   CYS A C   1 
ATOM   66    O  O   . CYS A 1 12  ? -14.938 -1.615   7.903   1.00 34.92  ? 15   CYS A O   1 
ATOM   67    C  CB  . CYS A 1 12  ? -15.496 -4.235   9.962   1.00 36.09  ? 15   CYS A CB  1 
ATOM   68    S  SG  . CYS A 1 12  ? -15.646 -5.119   8.390   1.00 37.69  ? 15   CYS A SG  1 
ATOM   69    N  N   . ARG A 1 13  ? -13.420 -2.059   9.507   1.00 37.28  ? 16   ARG A N   1 
ATOM   70    C  CA  . ARG A 1 13  ? -12.273 -1.632   8.731   1.00 38.63  ? 16   ARG A CA  1 
ATOM   71    C  C   . ARG A 1 13  ? -11.237 -2.733   8.750   1.00 37.45  ? 16   ARG A C   1 
ATOM   72    O  O   . ARG A 1 13  ? -11.119 -3.487   9.719   1.00 39.93  ? 16   ARG A O   1 
ATOM   73    C  CB  . ARG A 1 13  ? -11.684 -0.330   9.267   1.00 42.65  ? 16   ARG A CB  1 
ATOM   74    C  CG  . ARG A 1 13  ? -11.193 -0.392   10.701  1.00 46.36  ? 16   ARG A CG  1 
ATOM   75    C  CD  . ARG A 1 13  ? -10.966 1.002    11.264  1.00 51.40  ? 16   ARG A CD  1 
ATOM   76    N  NE  . ARG A 1 13  ? -12.218 1.661    11.632  1.00 56.87  ? 16   ARG A NE  1 
ATOM   77    C  CZ  . ARG A 1 13  ? -12.328 2.947    11.965  1.00 59.22  ? 16   ARG A CZ  1 
ATOM   78    N  NH1 . ARG A 1 13  ? -11.255 3.732    11.977  1.00 60.12  ? 16   ARG A NH1 1 
ATOM   79    N  NH2 . ARG A 1 13  ? -13.515 3.447    12.291  1.00 57.78  ? 16   ARG A NH2 1 
ATOM   80    N  N   . VAL A 1 14  ? -10.450 -2.780   7.686   1.00 34.96  ? 17   VAL A N   1 
ATOM   81    C  CA  . VAL A 1 14  ? -9.714  -3.975   7.321   1.00 31.74  ? 17   VAL A CA  1 
ATOM   82    C  C   . VAL A 1 14  ? -8.369  -3.571   6.742   1.00 30.67  ? 17   VAL A C   1 
ATOM   83    O  O   . VAL A 1 14  ? -8.296  -2.667   5.906   1.00 31.84  ? 17   VAL A O   1 
ATOM   84    C  CB  . VAL A 1 14  ? -10.597 -4.759   6.328   1.00 31.86  ? 17   VAL A CB  1 
ATOM   85    C  CG1 . VAL A 1 14  ? -10.007 -4.819   4.927   1.00 30.35  ? 17   VAL A CG1 1 
ATOM   86    C  CG2 . VAL A 1 14  ? -11.053 -6.083   6.916   1.00 29.93  ? 17   VAL A CG2 1 
ATOM   87    N  N   . LEU A 1 15  ? -7.292  -4.186   7.216   1.00 28.52  ? 18   LEU A N   1 
ATOM   88    C  CA  . LEU A 1 15  ? -5.978  -3.933   6.625   1.00 27.23  ? 18   LEU A CA  1 
ATOM   89    C  C   . LEU A 1 15  ? -5.718  -4.901   5.467   1.00 28.01  ? 18   LEU A C   1 
ATOM   90    O  O   . LEU A 1 15  ? -5.766  -6.117   5.668   1.00 28.56  ? 18   LEU A O   1 
ATOM   91    C  CB  . LEU A 1 15  ? -4.883  -4.069   7.671   1.00 26.84  ? 18   LEU A CB  1 
ATOM   92    C  CG  . LEU A 1 15  ? -3.456  -3.881   7.144   1.00 27.38  ? 18   LEU A CG  1 
ATOM   93    C  CD1 . LEU A 1 15  ? -3.279  -2.509   6.510   1.00 25.37  ? 18   LEU A CD1 1 
ATOM   94    C  CD2 . LEU A 1 15  ? -2.420  -4.126   8.238   1.00 26.44  ? 18   LEU A CD2 1 
ATOM   95    N  N   . VAL A 1 16  ? -5.447  -4.369   4.273   1.00 26.46  ? 19   VAL A N   1 
ATOM   96    C  CA  . VAL A 1 16  ? -5.138  -5.202   3.110   1.00 26.47  ? 19   VAL A CA  1 
ATOM   97    C  C   . VAL A 1 16  ? -3.646  -5.180   2.796   1.00 26.73  ? 19   VAL A C   1 
ATOM   98    O  O   . VAL A 1 16  ? -3.107  -4.152   2.389   1.00 29.37  ? 19   VAL A O   1 
ATOM   99    C  CB  . VAL A 1 16  ? -5.927  -4.788   1.840   1.00 26.10  ? 19   VAL A CB  1 
ATOM   100   C  CG1 . VAL A 1 16  ? -5.592  -5.712   0.679   1.00 24.75  ? 19   VAL A CG1 1 
ATOM   101   C  CG2 . VAL A 1 16  ? -7.433  -4.777   2.085   1.00 26.05  ? 19   VAL A CG2 1 
ATOM   102   N  N   . LEU A 1 17  ? -2.978  -6.313   2.982   1.00 25.70  ? 20   LEU A N   1 
ATOM   103   C  CA  . LEU A 1 17  ? -1.599  -6.453   2.565   1.00 25.29  ? 20   LEU A CA  1 
ATOM   104   C  C   . LEU A 1 17  ? -1.584  -7.118   1.185   1.00 27.24  ? 20   LEU A C   1 
ATOM   105   O  O   . LEU A 1 17  ? -2.180  -8.181   0.978   1.00 26.30  ? 20   LEU A O   1 
ATOM   106   C  CB  . LEU A 1 17  ? -0.794  -7.252   3.577   1.00 26.63  ? 20   LEU A CB  1 
ATOM   107   C  CG  . LEU A 1 17  ? -0.812  -6.832   5.053   1.00 27.35  ? 20   LEU A CG  1 
ATOM   108   C  CD1 . LEU A 1 17  ? 0.255   -7.602   5.797   1.00 27.38  ? 20   LEU A CD1 1 
ATOM   109   C  CD2 . LEU A 1 17  ? -0.541  -5.334   5.179   1.00 30.10  ? 20   LEU A CD2 1 
ATOM   110   N  N   . LEU A 1 18  ? -0.926  -6.459   0.242   1.00 27.50  ? 21   LEU A N   1 
ATOM   111   C  CA  . LEU A 1 18  ? -0.964  -6.848   -1.151  1.00 29.53  ? 21   LEU A CA  1 
ATOM   112   C  C   . LEU A 1 18  ? 0.450   -6.826   -1.673  1.00 30.98  ? 21   LEU A C   1 
ATOM   113   O  O   . LEU A 1 18  ? 1.224   -5.896   -1.397  1.00 30.39  ? 21   LEU A O   1 
ATOM   114   C  CB  . LEU A 1 18  ? -1.842  -5.878   -1.939  1.00 29.61  ? 21   LEU A CB  1 
ATOM   115   C  CG  . LEU A 1 18  ? -2.177  -6.110   -3.415  1.00 31.27  ? 21   LEU A CG  1 
ATOM   116   C  CD1 . LEU A 1 18  ? -3.656  -5.809   -3.648  1.00 30.38  ? 21   LEU A CD1 1 
ATOM   117   C  CD2 . LEU A 1 18  ? -1.304  -5.243   -4.311  1.00 29.85  ? 21   LEU A CD2 1 
ATOM   118   N  N   . ASN A 1 19  ? 0.786   -7.886   -2.390  1.00 32.75  ? 22   ASN A N   1 
ATOM   119   C  CA  . ASN A 1 19  ? 2.051   -7.995   -3.087  1.00 34.60  ? 22   ASN A CA  1 
ATOM   120   C  C   . ASN A 1 19  ? 1.731   -7.660   -4.533  1.00 36.02  ? 22   ASN A C   1 
ATOM   121   O  O   . ASN A 1 19  ? 1.045   -8.419   -5.198  1.00 35.65  ? 22   ASN A O   1 
ATOM   122   C  CB  . ASN A 1 19  ? 2.597   -9.420   -2.947  1.00 34.72  ? 22   ASN A CB  1 
ATOM   123   C  CG  . ASN A 1 19  ? 3.940   -9.637   -3.644  1.00 37.07  ? 22   ASN A CG  1 
ATOM   124   O  OD1 . ASN A 1 19  ? 4.525   -10.709  -3.517  1.00 41.78  ? 22   ASN A OD1 1 
ATOM   125   N  ND2 . ASN A 1 19  ? 4.429   -8.647   -4.373  1.00 37.17  ? 22   ASN A ND2 1 
ATOM   126   N  N   . PRO A 1 20  ? 2.194   -6.492   -5.009  1.00 37.29  ? 23   PRO A N   1 
ATOM   127   C  CA  . PRO A 1 20  ? 1.914   -6.031   -6.368  1.00 39.09  ? 23   PRO A CA  1 
ATOM   128   C  C   . PRO A 1 20  ? 2.542   -6.894   -7.462  1.00 43.04  ? 23   PRO A C   1 
ATOM   129   O  O   . PRO A 1 20  ? 2.115   -6.796   -8.605  1.00 42.86  ? 23   PRO A O   1 
ATOM   130   C  CB  . PRO A 1 20  ? 2.523   -4.630   -6.397  1.00 38.53  ? 23   PRO A CB  1 
ATOM   131   C  CG  . PRO A 1 20  ? 3.582   -4.671   -5.337  1.00 39.12  ? 23   PRO A CG  1 
ATOM   132   C  CD  . PRO A 1 20  ? 2.979   -5.506   -4.253  1.00 36.68  ? 23   PRO A CD  1 
ATOM   133   N  N   . ARG A 1 21  ? 3.532   -7.724   -7.120  1.00 46.38  ? 24   ARG A N   1 
ATOM   134   C  CA  . ARG A 1 21  ? 4.137   -8.671   -8.079  1.00 51.36  ? 24   ARG A CA  1 
ATOM   135   C  C   . ARG A 1 21  ? 3.302   -9.943   -8.274  1.00 54.70  ? 24   ARG A C   1 
ATOM   136   O  O   . ARG A 1 21  ? 3.783   -10.925  -8.846  1.00 57.28  ? 24   ARG A O   1 
ATOM   137   C  CB  . ARG A 1 21  ? 5.571   -9.037   -7.664  1.00 56.08  ? 24   ARG A CB  1 
ATOM   138   C  CG  . ARG A 1 21  ? 6.523   -7.848   -7.565  1.00 60.67  ? 24   ARG A CG  1 
ATOM   139   C  CD  . ARG A 1 21  ? 7.945   -8.267   -7.229  1.00 66.45  ? 24   ARG A CD  1 
ATOM   140   N  NE  . ARG A 1 21  ? 8.675   -8.751   -8.405  1.00 74.86  ? 24   ARG A NE  1 
ATOM   141   C  CZ  . ARG A 1 21  ? 8.920   -10.034  -8.682  1.00 74.44  ? 24   ARG A CZ  1 
ATOM   142   N  NH1 . ARG A 1 21  ? 8.499   -10.999  -7.870  1.00 76.28  ? 24   ARG A NH1 1 
ATOM   143   N  NH2 . ARG A 1 21  ? 9.594   -10.355  -9.778  1.00 71.32  ? 24   ARG A NH2 1 
ATOM   144   N  N   . GLY A 1 22  ? 2.050   -9.914   -7.807  1.00 55.03  ? 25   GLY A N   1 
ATOM   145   C  CA  . GLY A 1 22  ? 1.165   -11.076  -7.852  1.00 55.88  ? 25   GLY A CA  1 
ATOM   146   C  C   . GLY A 1 22  ? 0.198   -11.019  -9.016  1.00 58.68  ? 25   GLY A C   1 
ATOM   147   O  O   . GLY A 1 22  ? -0.238  -9.936   -9.413  1.00 56.74  ? 25   GLY A O   1 
ATOM   148   N  N   . GLY A 1 23  ? -0.143  -12.190  -9.557  1.00 60.93  ? 26   GLY A N   1 
ATOM   149   C  CA  . GLY A 1 23  ? -0.981  -12.280  -10.760 1.00 63.43  ? 26   GLY A CA  1 
ATOM   150   C  C   . GLY A 1 23  ? -0.283  -11.657  -11.963 1.00 65.19  ? 26   GLY A C   1 
ATOM   151   O  O   . GLY A 1 23  ? -0.858  -10.796  -12.649 1.00 61.01  ? 26   GLY A O   1 
ATOM   152   N  N   . LYS A 1 24  ? 0.957   -12.102  -12.208 1.00 65.14  ? 27   LYS A N   1 
ATOM   153   C  CA  . LYS A 1 24  ? 1.883   -11.469  -13.161 1.00 63.15  ? 27   LYS A CA  1 
ATOM   154   C  C   . LYS A 1 24  ? 1.857   -9.936   -13.027 1.00 59.33  ? 27   LYS A C   1 
ATOM   155   O  O   . LYS A 1 24  ? 1.669   -9.210   -14.006 1.00 61.67  ? 27   LYS A O   1 
ATOM   156   C  CB  . LYS A 1 24  ? 1.634   -11.961  -14.608 1.00 67.12  ? 27   LYS A CB  1 
ATOM   157   C  CG  . LYS A 1 24  ? 2.466   -11.293  -15.716 1.00 71.70  ? 27   LYS A CG  1 
ATOM   158   C  CD  . LYS A 1 24  ? 3.979   -11.374  -15.508 1.00 74.48  ? 27   LYS A CD  1 
ATOM   159   C  CE  . LYS A 1 24  ? 4.613   -12.518  -16.291 1.00 74.98  ? 27   LYS A CE  1 
ATOM   160   N  NZ  . LYS A 1 24  ? 4.728   -12.220  -17.747 1.00 75.43  ? 27   LYS A NZ  1 
ATOM   161   N  N   . GLY A 1 25  ? 2.028   -9.461   -11.795 1.00 53.96  ? 28   GLY A N   1 
ATOM   162   C  CA  . GLY A 1 25  ? 2.097   -8.031   -11.507 1.00 49.02  ? 28   GLY A CA  1 
ATOM   163   C  C   . GLY A 1 25  ? 0.800   -7.257   -11.668 1.00 47.15  ? 28   GLY A C   1 
ATOM   164   O  O   . GLY A 1 25  ? 0.823   -6.040   -11.891 1.00 46.42  ? 28   GLY A O   1 
ATOM   165   N  N   . LYS A 1 26  ? -0.332  -7.944   -11.541 1.00 43.35  ? 29   LYS A N   1 
ATOM   166   C  CA  . LYS A 1 26  ? -1.636  -7.299   -11.744 1.00 42.31  ? 29   LYS A CA  1 
ATOM   167   C  C   . LYS A 1 26  ? -2.519  -7.322   -10.496 1.00 37.13  ? 29   LYS A C   1 
ATOM   168   O  O   . LYS A 1 26  ? -3.712  -6.998   -10.564 1.00 37.60  ? 29   LYS A O   1 
ATOM   169   C  CB  . LYS A 1 26  ? -2.375  -7.929   -12.940 1.00 47.02  ? 29   LYS A CB  1 
ATOM   170   C  CG  . LYS A 1 26  ? -1.628  -7.786   -14.258 1.00 50.43  ? 29   LYS A CG  1 
ATOM   171   C  CD  . LYS A 1 26  ? -2.419  -8.313   -15.445 1.00 54.53  ? 29   LYS A CD  1 
ATOM   172   C  CE  . LYS A 1 26  ? -1.591  -8.220   -16.725 1.00 58.90  ? 29   LYS A CE  1 
ATOM   173   N  NZ  . LYS A 1 26  ? -2.296  -8.751   -17.931 1.00 60.27  ? 29   LYS A NZ  1 
ATOM   174   N  N   . ALA A 1 27  ? -1.927  -7.685   -9.362  1.00 33.36  ? 30   ALA A N   1 
ATOM   175   C  CA  . ALA A 1 27  ? -2.661  -7.818   -8.104  1.00 32.45  ? 30   ALA A CA  1 
ATOM   176   C  C   . ALA A 1 27  ? -3.406  -6.541   -7.696  1.00 31.98  ? 30   ALA A C   1 
ATOM   177   O  O   . ALA A 1 27  ? -4.599  -6.589   -7.368  1.00 32.25  ? 30   ALA A O   1 
ATOM   178   C  CB  . ALA A 1 27  ? -1.743  -8.307   -6.998  1.00 31.79  ? 30   ALA A CB  1 
ATOM   179   N  N   . LEU A 1 28  ? -2.722  -5.398   -7.749  1.00 33.51  ? 31   LEU A N   1 
ATOM   180   C  CA  . LEU A 1 28  ? -3.360  -4.117   -7.443  1.00 34.42  ? 31   LEU A CA  1 
ATOM   181   C  C   . LEU A 1 28  ? -4.531  -3.806   -8.388  1.00 35.24  ? 31   LEU A C   1 
ATOM   182   O  O   . LEU A 1 28  ? -5.616  -3.435   -7.939  1.00 34.65  ? 31   LEU A O   1 
ATOM   183   C  CB  . LEU A 1 28  ? -2.327  -2.992   -7.434  1.00 34.80  ? 31   LEU A CB  1 
ATOM   184   C  CG  . LEU A 1 28  ? -2.745  -1.548   -7.123  1.00 36.13  ? 31   LEU A CG  1 
ATOM   185   C  CD1 . LEU A 1 28  ? -3.623  -1.403   -5.888  1.00 35.05  ? 31   LEU A CD1 1 
ATOM   186   C  CD2 . LEU A 1 28  ? -1.489  -0.712   -6.962  1.00 36.18  ? 31   LEU A CD2 1 
ATOM   187   N  N   . GLN A 1 29  ? -4.309  -3.985   -9.686  1.00 38.00  ? 32   GLN A N   1 
ATOM   188   C  CA  . GLN A 1 29  ? -5.342  -3.778   -10.700 1.00 40.50  ? 32   GLN A CA  1 
ATOM   189   C  C   . GLN A 1 29  ? -6.552  -4.685   -10.429 1.00 37.96  ? 32   GLN A C   1 
ATOM   190   O  O   . GLN A 1 29  ? -7.707  -4.224   -10.428 1.00 36.31  ? 32   GLN A O   1 
ATOM   191   C  CB  . GLN A 1 29  ? -4.736  -3.999   -12.105 1.00 46.24  ? 32   GLN A CB  1 
ATOM   192   C  CG  . GLN A 1 29  ? -5.709  -4.339   -13.228 1.00 53.33  ? 32   GLN A CG  1 
ATOM   193   C  CD  . GLN A 1 29  ? -5.012  -4.950   -14.449 1.00 57.45  ? 32   GLN A CD  1 
ATOM   194   O  OE1 . GLN A 1 29  ? -4.844  -6.175   -14.543 1.00 59.73  ? 32   GLN A OE1 1 
ATOM   195   N  NE2 . GLN A 1 29  ? -4.603  -4.098   -15.385 1.00 54.53  ? 32   GLN A NE2 1 
ATOM   196   N  N   . LEU A 1 30  ? -6.271  -5.961   -10.162 1.00 36.50  ? 33   LEU A N   1 
ATOM   197   C  CA  . LEU A 1 30  ? -7.305  -6.928   -9.773  1.00 33.96  ? 33   LEU A CA  1 
ATOM   198   C  C   . LEU A 1 30  ? -8.035  -6.491   -8.497  1.00 31.10  ? 33   LEU A C   1 
ATOM   199   O  O   . LEU A 1 30  ? -9.266  -6.623   -8.398  1.00 28.77  ? 33   LEU A O   1 
ATOM   200   C  CB  . LEU A 1 30  ? -6.715  -8.336   -9.609  1.00 33.14  ? 33   LEU A CB  1 
ATOM   201   C  CG  . LEU A 1 30  ? -6.273  -9.131   -10.851 1.00 36.02  ? 33   LEU A CG  1 
ATOM   202   C  CD1 . LEU A 1 30  ? -5.329  -10.276  -10.483 1.00 36.43  ? 33   LEU A CD1 1 
ATOM   203   C  CD2 . LEU A 1 30  ? -7.454  -9.658   -11.662 1.00 34.02  ? 33   LEU A CD2 1 
ATOM   204   N  N   . PHE A 1 31  ? -7.301  -5.950   -7.528  1.00 30.18  ? 34   PHE A N   1 
ATOM   205   C  CA  . PHE A 1 31  ? -7.974  -5.429   -6.319  1.00 30.49  ? 34   PHE A CA  1 
ATOM   206   C  C   . PHE A 1 31  ? -8.960  -4.333   -6.698  1.00 30.65  ? 34   PHE A C   1 
ATOM   207   O  O   . PHE A 1 31  ? -10.124 -4.349   -6.280  1.00 29.51  ? 34   PHE A O   1 
ATOM   208   C  CB  . PHE A 1 31  ? -6.984  -4.888   -5.284  1.00 29.44  ? 34   PHE A CB  1 
ATOM   209   C  CG  . PHE A 1 31  ? -7.651  -4.286   -4.071  1.00 29.40  ? 34   PHE A CG  1 
ATOM   210   C  CD1 . PHE A 1 31  ? -7.966  -5.079   -2.964  1.00 27.89  ? 34   PHE A CD1 1 
ATOM   211   C  CD2 . PHE A 1 31  ? -7.982  -2.925   -4.036  1.00 28.67  ? 34   PHE A CD2 1 
ATOM   212   C  CE1 . PHE A 1 31  ? -8.592  -4.533   -1.849  1.00 28.43  ? 34   PHE A CE1 1 
ATOM   213   C  CE2 . PHE A 1 31  ? -8.609  -2.370   -2.920  1.00 29.88  ? 34   PHE A CE2 1 
ATOM   214   C  CZ  . PHE A 1 31  ? -8.911  -3.176   -1.816  1.00 29.73  ? 34   PHE A CZ  1 
ATOM   215   N  N   . ARG A 1 32  ? -8.471  -3.379   -7.492  1.00 32.02  ? 35   ARG A N   1 
ATOM   216   C  CA  . ARG A 1 32  ? -9.269  -2.238   -7.933  1.00 32.84  ? 35   ARG A CA  1 
ATOM   217   C  C   . ARG A 1 32  ? -10.519 -2.667   -8.692  1.00 31.85  ? 35   ARG A C   1 
ATOM   218   O  O   . ARG A 1 32  ? -11.616 -2.190   -8.393  1.00 32.29  ? 35   ARG A O   1 
ATOM   219   C  CB  . ARG A 1 32  ? -8.415  -1.282   -8.771  1.00 34.41  ? 35   ARG A CB  1 
ATOM   220   C  CG  . ARG A 1 32  ? -8.199  0.082    -8.140  1.00 38.43  ? 35   ARG A CG  1 
ATOM   221   C  CD  . ARG A 1 32  ? -7.120  0.172    -7.076  1.00 41.61  ? 35   ARG A CD  1 
ATOM   222   N  NE  . ARG A 1 32  ? -7.657  0.908    -5.925  1.00 47.05  ? 35   ARG A NE  1 
ATOM   223   C  CZ  . ARG A 1 32  ? -6.959  1.575    -5.004  1.00 44.58  ? 35   ARG A CZ  1 
ATOM   224   N  NH1 . ARG A 1 32  ? -5.634  1.669    -5.051  1.00 46.29  ? 35   ARG A NH1 1 
ATOM   225   N  NH2 . ARG A 1 32  ? -7.618  2.171    -4.026  1.00 46.65  ? 35   ARG A NH2 1 
ATOM   226   N  N   . SER A 1 33  ? -10.353 -3.583   -9.648  1.00 29.87  ? 36   SER A N   1 
ATOM   227   C  CA  . SER A 1 33  ? -11.467 -4.050   -10.476 1.00 31.47  ? 36   SER A CA  1 
ATOM   228   C  C   . SER A 1 33  ? -12.411 -5.054   -9.790  1.00 31.87  ? 36   SER A C   1 
ATOM   229   O  O   . SER A 1 33  ? -13.629 -4.984   -9.964  1.00 30.78  ? 36   SER A O   1 
ATOM   230   C  CB  . SER A 1 33  ? -10.942 -4.639   -11.788 1.00 31.09  ? 36   SER A CB  1 
ATOM   231   O  OG  . SER A 1 33  ? -10.072 -5.729   -11.547 1.00 35.03  ? 36   SER A OG  1 
ATOM   232   N  N   . HIS A 1 34  ? -11.855 -5.980   -9.009  1.00 32.96  ? 37   HIS A N   1 
ATOM   233   C  CA  . HIS A 1 34  ? -12.649 -7.086   -8.473  1.00 34.28  ? 37   HIS A CA  1 
ATOM   234   C  C   . HIS A 1 34  ? -12.986 -7.006   -7.004  1.00 36.77  ? 37   HIS A C   1 
ATOM   235   O  O   . HIS A 1 34  ? -14.091 -7.371   -6.604  1.00 40.05  ? 37   HIS A O   1 
ATOM   236   C  CB  . HIS A 1 34  ? -12.000 -8.411   -8.833  1.00 34.06  ? 37   HIS A CB  1 
ATOM   237   C  CG  . HIS A 1 34  ? -12.153 -8.765   -10.288 1.00 37.11  ? 37   HIS A CG  1 
ATOM   238   N  ND1 . HIS A 1 34  ? -11.341 -8.266   -11.245 1.00 39.24  ? 37   HIS A ND1 1 
ATOM   239   C  CD2 . HIS A 1 34  ? -13.106 -9.552   -10.945 1.00 38.25  ? 37   HIS A CD2 1 
ATOM   240   C  CE1 . HIS A 1 34  ? -11.738 -8.726   -12.453 1.00 40.55  ? 37   HIS A CE1 1 
ATOM   241   N  NE2 . HIS A 1 34  ? -12.821 -9.513   -12.265 1.00 41.68  ? 37   HIS A NE2 1 
ATOM   242   N  N   . VAL A 1 35  ? -12.069 -6.492   -6.192  1.00 35.63  ? 38   VAL A N   1 
ATOM   243   C  CA  . VAL A 1 35  ? -12.273 -6.461   -4.741  1.00 34.66  ? 38   VAL A CA  1 
ATOM   244   C  C   . VAL A 1 35  ? -12.888 -5.161   -4.229  1.00 32.46  ? 38   VAL A C   1 
ATOM   245   O  O   . VAL A 1 35  ? -13.931 -5.182   -3.577  1.00 31.48  ? 38   VAL A O   1 
ATOM   246   C  CB  . VAL A 1 35  ? -10.970 -6.786   -3.973  1.00 33.82  ? 38   VAL A CB  1 
ATOM   247   C  CG1 . VAL A 1 35  ? -11.238 -6.839   -2.476  1.00 32.25  ? 38   VAL A CG1 1 
ATOM   248   C  CG2 . VAL A 1 35  ? -10.396 -8.107   -4.462  1.00 33.50  ? 38   VAL A CG2 1 
ATOM   249   N  N   . GLN A 1 36  ? -12.247 -4.032   -4.527  1.00 33.14  ? 39   GLN A N   1 
ATOM   250   C  CA  . GLN A 1 36  ? -12.775 -2.711   -4.112  1.00 34.24  ? 39   GLN A CA  1 
ATOM   251   C  C   . GLN A 1 36  ? -14.305 -2.465   -4.272  1.00 32.61  ? 39   GLN A C   1 
ATOM   252   O  O   . GLN A 1 36  ? -14.953 -2.076   -3.304  1.00 33.64  ? 39   GLN A O   1 
ATOM   253   C  CB  . GLN A 1 36  ? -11.975 -1.566   -4.743  1.00 34.67  ? 39   GLN A CB  1 
ATOM   254   C  CG  . GLN A 1 36  ? -12.365 -0.204   -4.204  1.00 35.93  ? 39   GLN A CG  1 
ATOM   255   C  CD  . GLN A 1 36  ? -11.390 0.880    -4.590  1.00 38.09  ? 39   GLN A CD  1 
ATOM   256   O  OE1 . GLN A 1 36  ? -10.248 0.612    -4.984  1.00 37.21  ? 39   GLN A OE1 1 
ATOM   257   N  NE2 . GLN A 1 36  ? -11.833 2.123    -4.467  1.00 37.81  ? 39   GLN A NE2 1 
ATOM   258   N  N   . PRO A 1 37  ? -14.890 -2.699   -5.468  1.00 32.57  ? 40   PRO A N   1 
ATOM   259   C  CA  . PRO A 1 37  ? -16.315 -2.353   -5.560  1.00 33.96  ? 40   PRO A CA  1 
ATOM   260   C  C   . PRO A 1 37  ? -17.214 -3.171   -4.638  1.00 36.66  ? 40   PRO A C   1 
ATOM   261   O  O   . PRO A 1 37  ? -18.265 -2.675   -4.217  1.00 39.50  ? 40   PRO A O   1 
ATOM   262   C  CB  . PRO A 1 37  ? -16.671 -2.658   -7.020  1.00 34.49  ? 40   PRO A CB  1 
ATOM   263   C  CG  . PRO A 1 37  ? -15.369 -2.714   -7.746  1.00 33.93  ? 40   PRO A CG  1 
ATOM   264   C  CD  . PRO A 1 37  ? -14.385 -3.244   -6.742  1.00 33.63  ? 40   PRO A CD  1 
ATOM   265   N  N   . LEU A 1 38  ? -16.818 -4.407   -4.326  1.00 36.92  ? 41   LEU A N   1 
ATOM   266   C  CA  . LEU A 1 38  ? -17.625 -5.254   -3.435  1.00 35.88  ? 41   LEU A CA  1 
ATOM   267   C  C   . LEU A 1 38  ? -17.513 -4.786   -1.982  1.00 34.48  ? 41   LEU A C   1 
ATOM   268   O  O   . LEU A 1 38  ? -18.502 -4.821   -1.233  1.00 33.24  ? 41   LEU A O   1 
ATOM   269   C  CB  . LEU A 1 38  ? -17.275 -6.738   -3.605  1.00 36.25  ? 41   LEU A CB  1 
ATOM   270   C  CG  . LEU A 1 38  ? -17.916 -7.526   -4.766  1.00 37.91  ? 41   LEU A CG  1 
ATOM   271   C  CD1 . LEU A 1 38  ? -17.750 -6.877   -6.139  1.00 41.52  ? 41   LEU A CD1 1 
ATOM   272   C  CD2 . LEU A 1 38  ? -17.387 -8.947   -4.823  1.00 36.98  ? 41   LEU A CD2 1 
ATOM   273   N  N   . LEU A 1 39  ? -16.328 -4.296   -1.608  1.00 32.72  ? 42   LEU A N   1 
ATOM   274   C  CA  . LEU A 1 39  ? -16.105 -3.765   -0.250  1.00 32.96  ? 42   LEU A CA  1 
ATOM   275   C  C   . LEU A 1 39  ? -16.960 -2.538   0.026   1.00 34.96  ? 42   LEU A C   1 
ATOM   276   O  O   . LEU A 1 39  ? -17.501 -2.391   1.125   1.00 36.52  ? 42   LEU A O   1 
ATOM   277   C  CB  . LEU A 1 39  ? -14.629 -3.429   0.005   1.00 29.18  ? 42   LEU A CB  1 
ATOM   278   C  CG  . LEU A 1 39  ? -13.565 -4.510   -0.229  1.00 28.70  ? 42   LEU A CG  1 
ATOM   279   C  CD1 . LEU A 1 39  ? -12.177 -4.038   0.200   1.00 26.93  ? 42   LEU A CD1 1 
ATOM   280   C  CD2 . LEU A 1 39  ? -13.929 -5.806   0.473   1.00 27.80  ? 42   LEU A CD2 1 
ATOM   281   N  N   . ALA A 1 40  ? -17.083 -1.665   -0.978  1.00 37.07  ? 43   ALA A N   1 
ATOM   282   C  CA  . ALA A 1 40  ? -17.893 -0.451   -0.871  1.00 37.00  ? 43   ALA A CA  1 
ATOM   283   C  C   . ALA A 1 40  ? -19.336 -0.802   -0.528  1.00 38.24  ? 43   ALA A C   1 
ATOM   284   O  O   . ALA A 1 40  ? -19.876 -0.285   0.449   1.00 37.62  ? 43   ALA A O   1 
ATOM   285   C  CB  . ALA A 1 40  ? -17.822 0.359    -2.161  1.00 35.82  ? 43   ALA A CB  1 
ATOM   286   N  N   . GLU A 1 41  ? -19.942 -1.691   -1.318  1.00 38.57  ? 44   GLU A N   1 
ATOM   287   C  CA  . GLU A 1 41  ? -21.308 -2.176   -1.061  1.00 42.15  ? 44   GLU A CA  1 
ATOM   288   C  C   . GLU A 1 41  ? -21.493 -2.857   0.312   1.00 42.38  ? 44   GLU A C   1 
ATOM   289   O  O   . GLU A 1 41  ? -22.574 -2.762   0.910   1.00 40.51  ? 44   GLU A O   1 
ATOM   290   C  CB  . GLU A 1 41  ? -21.790 -3.079   -2.216  1.00 46.32  ? 44   GLU A CB  1 
ATOM   291   C  CG  . GLU A 1 41  ? -22.632 -4.304   -1.832  1.00 53.63  ? 44   GLU A CG  1 
ATOM   292   C  CD  . GLU A 1 41  ? -24.146 -4.082   -1.857  1.00 59.88  ? 44   GLU A CD  1 
ATOM   293   O  OE1 . GLU A 1 41  ? -24.867 -4.988   -2.342  1.00 60.39  ? 44   GLU A OE1 1 
ATOM   294   O  OE2 . GLU A 1 41  ? -24.626 -3.026   -1.383  1.00 63.94  ? 44   GLU A OE2 1 
ATOM   295   N  N   . ALA A 1 42  ? -20.454 -3.531   0.811   1.00 40.52  ? 45   ALA A N   1 
ATOM   296   C  CA  . ALA A 1 42  ? -20.566 -4.278   2.086   1.00 39.79  ? 45   ALA A CA  1 
ATOM   297   C  C   . ALA A 1 42  ? -20.239 -3.432   3.319   1.00 38.91  ? 45   ALA A C   1 
ATOM   298   O  O   . ALA A 1 42  ? -20.245 -3.933   4.441   1.00 37.31  ? 45   ALA A O   1 
ATOM   299   C  CB  . ALA A 1 42  ? -19.706 -5.540   2.057   1.00 36.55  ? 45   ALA A CB  1 
ATOM   300   N  N   . GLU A 1 43  ? -19.969 -2.146   3.094   1.00 41.01  ? 46   GLU A N   1 
ATOM   301   C  CA  . GLU A 1 43  ? -19.554 -1.208   4.146   1.00 41.77  ? 46   GLU A CA  1 
ATOM   302   C  C   . GLU A 1 43  ? -18.255 -1.659   4.806   1.00 39.36  ? 46   GLU A C   1 
ATOM   303   O  O   . GLU A 1 43  ? -18.099 -1.562   6.021   1.00 38.39  ? 46   GLU A O   1 
ATOM   304   C  CB  . GLU A 1 43  ? -20.638 -1.011   5.214   1.00 43.95  ? 46   GLU A CB  1 
ATOM   305   C  CG  . GLU A 1 43  ? -22.045 -0.727   4.707   1.00 49.36  ? 46   GLU A CG  1 
ATOM   306   C  CD  . GLU A 1 43  ? -23.031 -0.562   5.855   1.00 53.27  ? 46   GLU A CD  1 
ATOM   307   O  OE1 . GLU A 1 43  ? -22.773 0.278    6.746   1.00 53.54  ? 46   GLU A OE1 1 
ATOM   308   O  OE2 . GLU A 1 43  ? -24.059 -1.278   5.877   1.00 57.48  ? 46   GLU A OE2 1 
ATOM   309   N  N   . ILE A 1 44  ? -17.328 -2.161   4.000   1.00 38.28  ? 47   ILE A N   1 
ATOM   310   C  CA  . ILE A 1 44  ? -16.015 -2.540   4.511   1.00 37.14  ? 47   ILE A CA  1 
ATOM   311   C  C   . ILE A 1 44  ? -14.985 -1.511   4.071   1.00 36.59  ? 47   ILE A C   1 
ATOM   312   O  O   . ILE A 1 44  ? -14.619 -1.472   2.893   1.00 36.73  ? 47   ILE A O   1 
ATOM   313   C  CB  . ILE A 1 44  ? -15.572 -3.951   4.042   1.00 33.89  ? 47   ILE A CB  1 
ATOM   314   C  CG1 . ILE A 1 44  ? -16.474 -5.029   4.646   1.00 34.19  ? 47   ILE A CG1 1 
ATOM   315   C  CG2 . ILE A 1 44  ? -14.130 -4.221   4.448   1.00 34.76  ? 47   ILE A CG2 1 
ATOM   316   C  CD1 . ILE A 1 44  ? -16.234 -6.432   4.106   1.00 32.55  ? 47   ILE A CD1 1 
ATOM   317   N  N   . SER A 1 45  ? -14.517 -0.686   5.010   1.00 34.30  ? 48   SER A N   1 
ATOM   318   C  CA  . SER A 1 45  ? -13.379 0.201    4.733   1.00 34.74  ? 48   SER A CA  1 
ATOM   319   C  C   . SER A 1 45  ? -12.096 -0.589   4.733   1.00 33.82  ? 48   SER A C   1 
ATOM   320   O  O   . SER A 1 45  ? -12.031 -1.666   5.329   1.00 36.35  ? 48   SER A O   1 
ATOM   321   C  CB  . SER A 1 45  ? -13.269 1.294    5.788   1.00 35.16  ? 48   SER A CB  1 
ATOM   322   O  OG  . SER A 1 45  ? -14.483 2.002    5.853   1.00 41.13  ? 48   SER A OG  1 
ATOM   323   N  N   . PHE A 1 46  ? -11.064 -0.044   4.099   1.00 32.56  ? 49   PHE A N   1 
ATOM   324   C  CA  . PHE A 1 46  ? -9.771  -0.701   4.051   1.00 31.80  ? 49   PHE A CA  1 
ATOM   325   C  C   . PHE A 1 46  ? -8.636  0.300    3.880   1.00 33.22  ? 49   PHE A C   1 
ATOM   326   O  O   . PHE A 1 46  ? -8.857  1.439    3.476   1.00 33.48  ? 49   PHE A O   1 
ATOM   327   C  CB  . PHE A 1 46  ? -9.742  -1.657   2.858   1.00 31.42  ? 49   PHE A CB  1 
ATOM   328   C  CG  . PHE A 1 46  ? -9.832  -0.952   1.529   1.00 31.34  ? 49   PHE A CG  1 
ATOM   329   C  CD1 . PHE A 1 46  ? -11.067 -0.719   0.933   1.00 30.78  ? 49   PHE A CD1 1 
ATOM   330   C  CD2 . PHE A 1 46  ? -8.684  -0.495   0.892   1.00 30.25  ? 49   PHE A CD2 1 
ATOM   331   C  CE1 . PHE A 1 46  ? -11.150 -0.051   -0.280  1.00 33.28  ? 49   PHE A CE1 1 
ATOM   332   C  CE2 . PHE A 1 46  ? -8.762  0.177    -0.316  1.00 30.75  ? 49   PHE A CE2 1 
ATOM   333   C  CZ  . PHE A 1 46  ? -9.995  0.402    -0.906  1.00 31.18  ? 49   PHE A CZ  1 
ATOM   334   N  N   . THR A 1 47  ? -7.412  -0.140   4.156   1.00 33.00  ? 50   THR A N   1 
ATOM   335   C  CA  . THR A 1 47  ? -6.244  0.565    3.675   1.00 32.51  ? 50   THR A CA  1 
ATOM   336   C  C   . THR A 1 47  ? -5.261  -0.422   3.018   1.00 33.28  ? 50   THR A C   1 
ATOM   337   O  O   . THR A 1 47  ? -4.989  -1.491   3.563   1.00 32.36  ? 50   THR A O   1 
ATOM   338   C  CB  . THR A 1 47  ? -5.597  1.487    4.750   1.00 33.28  ? 50   THR A CB  1 
ATOM   339   O  OG1 . THR A 1 47  ? -4.286  1.051    5.117   1.00 35.27  ? 50   THR A OG1 1 
ATOM   340   C  CG2 . THR A 1 47  ? -6.472  1.672    5.967   1.00 30.61  ? 50   THR A CG2 1 
ATOM   341   N  N   . LEU A 1 48  ? -4.776  -0.074   1.828   1.00 31.77  ? 51   LEU A N   1 
ATOM   342   C  CA  . LEU A 1 48  ? -3.810  -0.903   1.116   1.00 34.15  ? 51   LEU A CA  1 
ATOM   343   C  C   . LEU A 1 48  ? -2.376  -0.603   1.499   1.00 34.69  ? 51   LEU A C   1 
ATOM   344   O  O   . LEU A 1 48  ? -1.913  0.542    1.432   1.00 34.86  ? 51   LEU A O   1 
ATOM   345   C  CB  . LEU A 1 48  ? -3.946  -0.734   -0.397  1.00 35.92  ? 51   LEU A CB  1 
ATOM   346   C  CG  . LEU A 1 48  ? -5.006  -1.528   -1.140  1.00 37.14  ? 51   LEU A CG  1 
ATOM   347   C  CD1 . LEU A 1 48  ? -5.383  -0.763   -2.403  1.00 37.07  ? 51   LEU A CD1 1 
ATOM   348   C  CD2 . LEU A 1 48  ? -4.494  -2.921   -1.472  1.00 35.51  ? 51   LEU A CD2 1 
ATOM   349   N  N   . MET A 1 49  ? -1.671  -1.650   1.888   1.00 36.23  ? 52   MET A N   1 
ATOM   350   C  CA  . MET A 1 49  ? -0.270  -1.555   2.203   1.00 37.61  ? 52   MET A CA  1 
ATOM   351   C  C   . MET A 1 49  ? 0.425   -2.497   1.249   1.00 35.93  ? 52   MET A C   1 
ATOM   352   O  O   . MET A 1 49  ? 0.075   -3.678   1.176   1.00 34.75  ? 52   MET A O   1 
ATOM   353   C  CB  . MET A 1 49  ? -0.050  -2.011   3.632   1.00 42.53  ? 52   MET A CB  1 
ATOM   354   C  CG  . MET A 1 49  ? 0.984   -1.206   4.380   1.00 52.60  ? 52   MET A CG  1 
ATOM   355   S  SD  . MET A 1 49  ? 0.817   -1.347   6.176   1.00 66.08  ? 52   MET A SD  1 
ATOM   356   C  CE  . MET A 1 49  ? -0.862  -0.798   6.459   1.00 59.50  ? 52   MET A CE  1 
ATOM   357   N  N   . LEU A 1 50  ? 1.393   -1.984   0.506   1.00 34.45  ? 53   LEU A N   1 
ATOM   358   C  CA  . LEU A 1 50  ? 2.103   -2.808   -0.465  1.00 35.53  ? 53   LEU A CA  1 
ATOM   359   C  C   . LEU A 1 50  ? 3.298   -3.507   0.178   1.00 36.77  ? 53   LEU A C   1 
ATOM   360   O  O   . LEU A 1 50  ? 4.072   -2.898   0.917   1.00 38.19  ? 53   LEU A O   1 
ATOM   361   C  CB  . LEU A 1 50  ? 2.517   -2.005   -1.707  1.00 32.57  ? 53   LEU A CB  1 
ATOM   362   C  CG  . LEU A 1 50  ? 1.471   -1.282   -2.585  1.00 32.81  ? 53   LEU A CG  1 
ATOM   363   C  CD1 . LEU A 1 50  ? 2.083   -0.955   -3.936  1.00 30.70  ? 53   LEU A CD1 1 
ATOM   364   C  CD2 . LEU A 1 50  ? 0.150   -2.030   -2.782  1.00 31.34  ? 53   LEU A CD2 1 
ATOM   365   N  N   . THR A 1 51  ? 3.435   -4.796   -0.101  1.00 39.27  ? 54   THR A N   1 
ATOM   366   C  CA  . THR A 1 51  ? 4.489   -5.600   0.512   1.00 42.40  ? 54   THR A CA  1 
ATOM   367   C  C   . THR A 1 51  ? 5.102   -6.568   -0.501  1.00 44.80  ? 54   THR A C   1 
ATOM   368   O  O   . THR A 1 51  ? 4.492   -7.590   -0.829  1.00 42.10  ? 54   THR A O   1 
ATOM   369   C  CB  . THR A 1 51  ? 3.951   -6.373   1.742   1.00 43.42  ? 54   THR A CB  1 
ATOM   370   O  OG1 . THR A 1 51  ? 5.001   -7.157   2.320   1.00 51.05  ? 54   THR A OG1 1 
ATOM   371   C  CG2 . THR A 1 51  ? 2.801   -7.303   1.366   1.00 39.59  ? 54   THR A CG2 1 
ATOM   372   N  N   . GLU A 1 52  ? 6.299   -6.244   -1.002  1.00 50.36  ? 55   GLU A N   1 
ATOM   373   C  CA  . GLU A 1 52  ? 6.987   -7.123   -1.977  1.00 51.42  ? 55   GLU A CA  1 
ATOM   374   C  C   . GLU A 1 52  ? 8.286   -7.781   -1.470  1.00 51.48  ? 55   GLU A C   1 
ATOM   375   O  O   . GLU A 1 52  ? 8.498   -8.972   -1.711  1.00 50.49  ? 55   GLU A O   1 
ATOM   376   C  CB  . GLU A 1 52  ? 7.201   -6.432   -3.343  1.00 53.04  ? 55   GLU A CB  1 
ATOM   377   C  CG  . GLU A 1 52  ? 8.171   -5.241   -3.362  1.00 58.92  ? 55   GLU A CG  1 
ATOM   378   C  CD  . GLU A 1 52  ? 8.269   -4.544   -4.729  1.00 64.09  ? 55   GLU A CD  1 
ATOM   379   O  OE1 . GLU A 1 52  ? 9.407   -4.265   -5.183  1.00 64.53  ? 55   GLU A OE1 1 
ATOM   380   O  OE2 . GLU A 1 52  ? 7.214   -4.266   -5.356  1.00 62.23  ? 55   GLU A OE2 1 
ATOM   381   N  N   . ARG A 1 53  ? 9.144   -7.025   -0.781  1.00 49.69  ? 56   ARG A N   1 
ATOM   382   C  CA  . ARG A 1 53  ? 10.465  -7.542   -0.387  1.00 53.04  ? 56   ARG A CA  1 
ATOM   383   C  C   . ARG A 1 53  ? 10.357  -8.631   0.694   1.00 54.76  ? 56   ARG A C   1 
ATOM   384   O  O   . ARG A 1 53  ? 9.358   -8.697   1.415   1.00 53.91  ? 56   ARG A O   1 
ATOM   385   C  CB  . ARG A 1 53  ? 11.420  -6.403   0.029   1.00 55.58  ? 56   ARG A CB  1 
ATOM   386   C  CG  . ARG A 1 53  ? 11.431  -6.069   1.519   1.00 59.27  ? 56   ARG A CG  1 
ATOM   387   C  CD  . ARG A 1 53  ? 12.510  -5.066   1.906   1.00 59.36  ? 56   ARG A CD  1 
ATOM   388   N  NE  . ARG A 1 53  ? 11.960  -3.727   2.119   1.00 64.15  ? 56   ARG A NE  1 
ATOM   389   C  CZ  . ARG A 1 53  ? 11.447  -3.289   3.269   1.00 66.55  ? 56   ARG A CZ  1 
ATOM   390   N  NH1 . ARG A 1 53  ? 11.402  -4.079   4.336   1.00 70.34  ? 56   ARG A NH1 1 
ATOM   391   N  NH2 . ARG A 1 53  ? 10.970  -2.055   3.356   1.00 64.77  ? 56   ARG A NH2 1 
ATOM   392   N  N   . ARG A 1 54  ? 11.376  -9.485   0.795   1.00 57.33  ? 57   ARG A N   1 
ATOM   393   C  CA  . ARG A 1 54  ? 11.351  -10.609  1.751   1.00 61.86  ? 57   ARG A CA  1 
ATOM   394   C  C   . ARG A 1 54  ? 11.281  -10.176  3.225   1.00 58.47  ? 57   ARG A C   1 
ATOM   395   O  O   . ARG A 1 54  ? 11.995  -9.256   3.660   1.00 57.55  ? 57   ARG A O   1 
ATOM   396   C  CB  . ARG A 1 54  ? 12.523  -11.577  1.520   1.00 64.88  ? 57   ARG A CB  1 
ATOM   397   C  CG  . ARG A 1 54  ? 13.914  -11.021  1.827   1.00 70.37  ? 57   ARG A CG  1 
ATOM   398   C  CD  . ARG A 1 54  ? 14.990  -12.097  1.714   1.00 74.77  ? 57   ARG A CD  1 
ATOM   399   N  NE  . ARG A 1 54  ? 15.071  -12.645  0.358   1.00 77.86  ? 57   ARG A NE  1 
ATOM   400   C  CZ  . ARG A 1 54  ? 15.626  -13.811  0.039   1.00 77.00  ? 57   ARG A CZ  1 
ATOM   401   N  NH1 . ARG A 1 54  ? 16.162  -14.583  0.977   1.00 77.63  ? 57   ARG A NH1 1 
ATOM   402   N  NH2 . ARG A 1 54  ? 15.640  -14.207  -1.228  1.00 77.92  ? 57   ARG A NH2 1 
ATOM   403   N  N   . ASN A 1 55  ? 10.397  -10.836  3.971   1.00 56.18  ? 58   ASN A N   1 
ATOM   404   C  CA  . ASN A 1 55  ? 10.176  -10.562  5.406   1.00 54.28  ? 58   ASN A CA  1 
ATOM   405   C  C   . ASN A 1 55  ? 9.479   -9.237   5.711   1.00 50.11  ? 58   ASN A C   1 
ATOM   406   O  O   . ASN A 1 55  ? 9.310   -8.866   6.870   1.00 49.12  ? 58   ASN A O   1 
ATOM   407   C  CB  . ASN A 1 55  ? 11.480  -10.688  6.209   1.00 55.31  ? 58   ASN A CB  1 
ATOM   408   C  CG  . ASN A 1 55  ? 12.025  -12.104  6.218   1.00 56.58  ? 58   ASN A CG  1 
ATOM   409   O  OD1 . ASN A 1 55  ? 11.308  -13.070  5.922   1.00 56.69  ? 58   ASN A OD1 1 
ATOM   410   N  ND2 . ASN A 1 55  ? 13.302  -12.237  6.562   1.00 58.24  ? 58   ASN A ND2 1 
ATOM   411   N  N   . HIS A 1 56  ? 9.040   -8.544   4.670   1.00 46.15  ? 59   HIS A N   1 
ATOM   412   C  CA  . HIS A 1 56  ? 8.430   -7.253   4.862   1.00 44.98  ? 59   HIS A CA  1 
ATOM   413   C  C   . HIS A 1 56  ? 7.112   -7.341   5.582   1.00 42.58  ? 59   HIS A C   1 
ATOM   414   O  O   . HIS A 1 56  ? 6.934   -6.704   6.632   1.00 39.19  ? 59   HIS A O   1 
ATOM   415   C  CB  . HIS A 1 56  ? 8.310   -6.507   3.541   1.00 47.21  ? 59   HIS A CB  1 
ATOM   416   C  CG  . HIS A 1 56  ? 7.827   -5.092   3.692   1.00 48.14  ? 59   HIS A CG  1 
ATOM   417   N  ND1 . HIS A 1 56  ? 7.292   -4.400   2.672   1.00 48.77  ? 59   HIS A ND1 1 
ATOM   418   C  CD2 . HIS A 1 56  ? 7.796   -4.250   4.800   1.00 46.99  ? 59   HIS A CD2 1 
ATOM   419   C  CE1 . HIS A 1 56  ? 6.950   -3.176   3.097   1.00 47.72  ? 59   HIS A CE1 1 
ATOM   420   N  NE2 . HIS A 1 56  ? 7.253   -3.089   4.403   1.00 48.06  ? 59   HIS A NE2 1 
ATOM   421   N  N   . ALA A 1 57  ? 6.194   -8.143   5.042   1.00 38.94  ? 60   ALA A N   1 
ATOM   422   C  CA  . ALA A 1 57  ? 4.858   -8.288   5.612   1.00 37.02  ? 60   ALA A CA  1 
ATOM   423   C  C   . ALA A 1 57  ? 4.902   -8.890   7.023   1.00 35.64  ? 60   ALA A C   1 
ATOM   424   O  O   . ALA A 1 57  ? 4.085   -8.543   7.882   1.00 33.10  ? 60   ALA A O   1 
ATOM   425   C  CB  . ALA A 1 57  ? 3.974   -9.115   4.693   1.00 34.75  ? 60   ALA A CB  1 
ATOM   426   N  N   . ARG A 1 58  ? 5.868   -9.782   7.232   1.00 36.55  ? 61   ARG A N   1 
ATOM   427   C  CA  . ARG A 1 58  ? 6.195   -10.356  8.538   1.00 38.82  ? 61   ARG A CA  1 
ATOM   428   C  C   . ARG A 1 58  ? 6.517   -9.252   9.561   1.00 37.82  ? 61   ARG A C   1 
ATOM   429   O  O   . ARG A 1 58  ? 5.976   -9.242   10.668  1.00 34.75  ? 61   ARG A O   1 
ATOM   430   C  CB  . ARG A 1 58  ? 7.417   -11.260  8.371   1.00 40.68  ? 61   ARG A CB  1 
ATOM   431   C  CG  . ARG A 1 58  ? 7.647   -12.326  9.433   1.00 41.99  ? 61   ARG A CG  1 
ATOM   432   C  CD  . ARG A 1 58  ? 7.849   -13.632  8.688   1.00 43.47  ? 61   ARG A CD  1 
ATOM   433   N  NE  . ARG A 1 58  ? 8.613   -14.644  9.400   1.00 47.18  ? 61   ARG A NE  1 
ATOM   434   C  CZ  . ARG A 1 58  ? 8.881   -15.854  8.903   1.00 48.49  ? 61   ARG A CZ  1 
ATOM   435   N  NH1 . ARG A 1 58  ? 8.450   -16.201  7.688   1.00 45.63  ? 61   ARG A NH1 1 
ATOM   436   N  NH2 . ARG A 1 58  ? 9.584   -16.720  9.618   1.00 47.68  ? 61   ARG A NH2 1 
ATOM   437   N  N   . GLU A 1 59  ? 7.413   -8.344   9.183   1.00 38.68  ? 62   GLU A N   1 
ATOM   438   C  CA  . GLU A 1 59  ? 7.840   -7.263   10.073  1.00 40.60  ? 62   GLU A CA  1 
ATOM   439   C  C   . GLU A 1 59  ? 6.714   -6.270   10.358  1.00 38.06  ? 62   GLU A C   1 
ATOM   440   O  O   . GLU A 1 59  ? 6.529   -5.858   11.505  1.00 38.55  ? 62   GLU A O   1 
ATOM   441   C  CB  . GLU A 1 59  ? 9.107   -6.590   9.549   1.00 43.11  ? 62   GLU A CB  1 
ATOM   442   C  CG  . GLU A 1 59  ? 10.360  -7.405   9.883   1.00 49.02  ? 62   GLU A CG  1 
ATOM   443   C  CD  . GLU A 1 59  ? 11.425  -7.411   8.786   1.00 53.62  ? 62   GLU A CD  1 
ATOM   444   O  OE1 . GLU A 1 59  ? 11.298  -6.659   7.781   1.00 57.17  ? 62   GLU A OE1 1 
ATOM   445   O  OE2 . GLU A 1 59  ? 12.400  -8.189   8.927   1.00 52.67  ? 62   GLU A OE2 1 
ATOM   446   N  N   . LEU A 1 60  ? 5.931   -5.937   9.336   1.00 35.64  ? 63   LEU A N   1 
ATOM   447   C  CA  . LEU A 1 60  ? 4.761   -5.072   9.521   1.00 35.75  ? 63   LEU A CA  1 
ATOM   448   C  C   . LEU A 1 60  ? 3.782   -5.624   10.542  1.00 33.49  ? 63   LEU A C   1 
ATOM   449   O  O   . LEU A 1 60  ? 3.371   -4.933   11.471  1.00 32.07  ? 63   LEU A O   1 
ATOM   450   C  CB  . LEU A 1 60  ? 4.031   -4.846   8.201   1.00 37.00  ? 63   LEU A CB  1 
ATOM   451   C  CG  . LEU A 1 60  ? 4.550   -3.670   7.385   1.00 41.28  ? 63   LEU A CG  1 
ATOM   452   C  CD1 . LEU A 1 60  ? 4.177   -3.825   5.915   1.00 41.99  ? 63   LEU A CD1 1 
ATOM   453   C  CD2 . LEU A 1 60  ? 4.007   -2.366   7.951   1.00 41.87  ? 63   LEU A CD2 1 
ATOM   454   N  N   . VAL A 1 61  ? 3.414   -6.879   10.348  1.00 31.79  ? 64   VAL A N   1 
ATOM   455   C  CA  . VAL A 1 61  ? 2.433   -7.546   11.180  1.00 29.42  ? 64   VAL A CA  1 
ATOM   456   C  C   . VAL A 1 61  ? 2.959   -7.751   12.605  1.00 29.49  ? 64   VAL A C   1 
ATOM   457   O  O   . VAL A 1 61  ? 2.205   -7.634   13.571  1.00 29.13  ? 64   VAL A O   1 
ATOM   458   C  CB  . VAL A 1 61  ? 1.989   -8.846   10.471  1.00 30.67  ? 64   VAL A CB  1 
ATOM   459   C  CG1 . VAL A 1 61  ? 2.074   -10.073  11.362  1.00 28.96  ? 64   VAL A CG1 1 
ATOM   460   C  CG2 . VAL A 1 61  ? 0.608   -8.650   9.886   1.00 31.52  ? 64   VAL A CG2 1 
ATOM   461   N  N   . ARG A 1 62  ? 4.262   -8.002   12.721  1.00 30.25  ? 65   ARG A N   1 
ATOM   462   C  CA  . ARG A 1 62  ? 4.929   -8.145   14.007  1.00 32.62  ? 65   ARG A CA  1 
ATOM   463   C  C   . ARG A 1 62  ? 4.819   -6.858   14.840  1.00 33.21  ? 65   ARG A C   1 
ATOM   464   O  O   . ARG A 1 62  ? 4.629   -6.919   16.058  1.00 34.04  ? 65   ARG A O   1 
ATOM   465   C  CB  . ARG A 1 62  ? 6.394   -8.548   13.797  1.00 33.81  ? 65   ARG A CB  1 
ATOM   466   C  CG  . ARG A 1 62  ? 7.058   -9.201   14.993  1.00 37.32  ? 65   ARG A CG  1 
ATOM   467   C  CD  . ARG A 1 62  ? 8.166   -10.177  14.603  1.00 40.32  ? 65   ARG A CD  1 
ATOM   468   N  NE  . ARG A 1 62  ? 9.385   -9.505   14.165  1.00 43.83  ? 65   ARG A NE  1 
ATOM   469   C  CZ  . ARG A 1 62  ? 10.057  -9.780   13.043  1.00 46.97  ? 65   ARG A CZ  1 
ATOM   470   N  NH1 . ARG A 1 62  ? 9.665   -10.753  12.221  1.00 45.52  ? 65   ARG A NH1 1 
ATOM   471   N  NH2 . ARG A 1 62  ? 11.146  -9.077   12.747  1.00 49.23  ? 65   ARG A NH2 1 
ATOM   472   N  N   . SER A 1 63  ? 4.894   -5.704   14.174  1.00 33.39  ? 66   SER A N   1 
ATOM   473   C  CA  . SER A 1 63  ? 4.914   -4.403   14.849  1.00 33.45  ? 66   SER A CA  1 
ATOM   474   C  C   . SER A 1 63  ? 3.568   -3.658   14.871  1.00 34.25  ? 66   SER A C   1 
ATOM   475   O  O   . SER A 1 63  ? 3.436   -2.646   15.548  1.00 39.66  ? 66   SER A O   1 
ATOM   476   C  CB  . SER A 1 63  ? 5.992   -3.514   14.226  1.00 32.78  ? 66   SER A CB  1 
ATOM   477   O  OG  . SER A 1 63  ? 5.618   -3.116   12.914  1.00 30.84  ? 66   SER A OG  1 
ATOM   478   N  N   . GLU A 1 64  ? 2.578   -4.162   14.144  1.00 34.44  ? 67   GLU A N   1 
ATOM   479   C  CA  . GLU A 1 64  ? 1.258   -3.514   13.999  1.00 35.01  ? 67   GLU A CA  1 
ATOM   480   C  C   . GLU A 1 64  ? 0.459   -3.382   15.304  1.00 36.11  ? 67   GLU A C   1 
ATOM   481   O  O   . GLU A 1 64  ? 0.526   -4.254   16.176  1.00 34.55  ? 67   GLU A O   1 
ATOM   482   C  CB  . GLU A 1 64  ? 0.430   -4.307   12.979  1.00 36.07  ? 67   GLU A CB  1 
ATOM   483   C  CG  . GLU A 1 64  ? -0.887  -3.685   12.532  1.00 38.26  ? 67   GLU A CG  1 
ATOM   484   C  CD  . GLU A 1 64  ? -0.708  -2.553   11.529  1.00 40.31  ? 67   GLU A CD  1 
ATOM   485   O  OE1 . GLU A 1 64  ? 0.318   -2.524   10.805  1.00 43.56  ? 67   GLU A OE1 1 
ATOM   486   O  OE2 . GLU A 1 64  ? -1.607  -1.691   11.460  1.00 39.20  ? 67   GLU A OE2 1 
ATOM   487   N  N   . GLU A 1 65  ? -0.293  -2.288   15.427  1.00 37.41  ? 68   GLU A N   1 
ATOM   488   C  CA  . GLU A 1 65  ? -1.303  -2.157   16.471  1.00 38.77  ? 68   GLU A CA  1 
ATOM   489   C  C   . GLU A 1 65  ? -2.578  -2.762   15.913  1.00 37.67  ? 68   GLU A C   1 
ATOM   490   O  O   . GLU A 1 65  ? -3.184  -2.214   14.997  1.00 37.54  ? 68   GLU A O   1 
ATOM   491   C  CB  . GLU A 1 65  ? -1.505  -0.690   16.902  1.00 41.31  ? 68   GLU A CB  1 
ATOM   492   C  CG  . GLU A 1 65  ? -2.698  -0.443   17.835  1.00 44.60  ? 68   GLU A CG  1 
ATOM   493   C  CD  . GLU A 1 65  ? -2.691  -1.317   19.082  1.00 49.14  ? 68   GLU A CD  1 
ATOM   494   O  OE1 . GLU A 1 65  ? -1.765  -1.166   19.917  1.00 51.30  ? 68   GLU A OE1 1 
ATOM   495   O  OE2 . GLU A 1 65  ? -3.618  -2.151   19.236  1.00 50.04  ? 68   GLU A OE2 1 
ATOM   496   N  N   . LEU A 1 66  ? -2.982  -3.899   16.463  1.00 36.85  ? 69   LEU A N   1 
ATOM   497   C  CA  . LEU A 1 66  ? -3.996  -4.720   15.809  1.00 34.17  ? 69   LEU A CA  1 
ATOM   498   C  C   . LEU A 1 66  ? -5.406  -4.298   16.175  1.00 32.95  ? 69   LEU A C   1 
ATOM   499   O  O   . LEU A 1 66  ? -6.374  -4.717   15.527  1.00 32.58  ? 69   LEU A O   1 
ATOM   500   C  CB  . LEU A 1 66  ? -3.753  -6.203   16.104  1.00 35.72  ? 69   LEU A CB  1 
ATOM   501   C  CG  . LEU A 1 66  ? -2.420  -6.804   15.642  1.00 35.02  ? 69   LEU A CG  1 
ATOM   502   C  CD1 . LEU A 1 66  ? -2.219  -8.172   16.278  1.00 33.35  ? 69   LEU A CD1 1 
ATOM   503   C  CD2 . LEU A 1 66  ? -2.360  -6.896   14.122  1.00 33.82  ? 69   LEU A CD2 1 
ATOM   504   N  N   . GLY A 1 67  ? -5.509  -3.454   17.202  1.00 31.22  ? 70   GLY A N   1 
ATOM   505   C  CA  . GLY A 1 67  ? -6.785  -2.907   17.651  1.00 29.54  ? 70   GLY A CA  1 
ATOM   506   C  C   . GLY A 1 67  ? -7.441  -1.966   16.654  1.00 31.39  ? 70   GLY A C   1 
ATOM   507   O  O   . GLY A 1 67  ? -8.661  -1.759   16.718  1.00 32.71  ? 70   GLY A O   1 
ATOM   508   N  N   . ARG A 1 68  ? -6.659  -1.386   15.735  1.00 29.60  ? 71   ARG A N   1 
ATOM   509   C  CA  . ARG A 1 68  ? -7.253  -0.550   14.679  1.00 32.40  ? 71   ARG A CA  1 
ATOM   510   C  C   . ARG A 1 68  ? -7.945  -1.351   13.568  1.00 32.61  ? 71   ARG A C   1 
ATOM   511   O  O   . ARG A 1 68  ? -8.647  -0.763   12.743  1.00 35.15  ? 71   ARG A O   1 
ATOM   512   C  CB  . ARG A 1 68  ? -6.249  0.441    14.059  1.00 34.12  ? 71   ARG A CB  1 
ATOM   513   C  CG  . ARG A 1 68  ? -4.793  0.082    14.261  1.00 35.82  ? 71   ARG A CG  1 
ATOM   514   C  CD  . ARG A 1 68  ? -3.942  0.323    13.024  1.00 36.85  ? 71   ARG A CD  1 
ATOM   515   N  NE  . ARG A 1 68  ? -3.967  1.705    12.574  1.00 35.37  ? 71   ARG A NE  1 
ATOM   516   C  CZ  . ARG A 1 68  ? -3.112  2.222    11.701  1.00 33.40  ? 71   ARG A CZ  1 
ATOM   517   N  NH1 . ARG A 1 68  ? -2.140  1.478    11.182  1.00 30.40  ? 71   ARG A NH1 1 
ATOM   518   N  NH2 . ARG A 1 68  ? -3.222  3.503    11.372  1.00 31.27  ? 71   ARG A NH2 1 
ATOM   519   N  N   . TRP A 1 69  ? -7.764  -2.670   13.550  1.00 29.75  ? 72   TRP A N   1 
ATOM   520   C  CA  . TRP A 1 69  ? -8.339  -3.504   12.482  1.00 30.19  ? 72   TRP A CA  1 
ATOM   521   C  C   . TRP A 1 69  ? -9.291  -4.557   12.976  1.00 29.47  ? 72   TRP A C   1 
ATOM   522   O  O   . TRP A 1 69  ? -9.049  -5.187   14.011  1.00 29.02  ? 72   TRP A O   1 
ATOM   523   C  CB  . TRP A 1 69  ? -7.233  -4.171   11.657  1.00 28.46  ? 72   TRP A CB  1 
ATOM   524   C  CG  . TRP A 1 69  ? -6.143  -3.227   11.235  1.00 27.95  ? 72   TRP A CG  1 
ATOM   525   C  CD1 . TRP A 1 69  ? -4.814  -3.229   11.645  1.00 27.34  ? 72   TRP A CD1 1 
ATOM   526   C  CD2 . TRP A 1 69  ? -6.255  -2.090   10.310  1.00 27.35  ? 72   TRP A CD2 1 
ATOM   527   N  NE1 . TRP A 1 69  ? -4.120  -2.213   11.052  1.00 27.25  ? 72   TRP A NE1 1 
ATOM   528   C  CE2 . TRP A 1 69  ? -4.921  -1.491   10.240  1.00 28.19  ? 72   TRP A CE2 1 
ATOM   529   C  CE3 . TRP A 1 69  ? -7.281  -1.540   9.567   1.00 27.01  ? 72   TRP A CE3 1 
ATOM   530   C  CZ2 . TRP A 1 69  ? -4.650  -0.379   9.450   1.00 29.86  ? 72   TRP A CZ2 1 
ATOM   531   C  CZ3 . TRP A 1 69  ? -7.001  -0.420   8.769   1.00 29.72  ? 72   TRP A CZ3 1 
ATOM   532   C  CH2 . TRP A 1 69  ? -5.716  0.154    8.723   1.00 29.95  ? 72   TRP A CH2 1 
ATOM   533   N  N   . ASP A 1 70  ? -10.380 -4.762   12.235  1.00 30.47  ? 73   ASP A N   1 
ATOM   534   C  CA  . ASP A 1 70  ? -11.285 -5.893   12.500  1.00 30.08  ? 73   ASP A CA  1 
ATOM   535   C  C   . ASP A 1 70  ? -10.810 -7.190   11.820  1.00 29.62  ? 73   ASP A C   1 
ATOM   536   O  O   . ASP A 1 70  ? -11.152 -8.282   12.261  1.00 30.30  ? 73   ASP A O   1 
ATOM   537   C  CB  . ASP A 1 70  ? -12.722 -5.551   12.113  1.00 29.37  ? 73   ASP A CB  1 
ATOM   538   C  CG  . ASP A 1 70  ? -13.231 -4.316   12.839  1.00 31.29  ? 73   ASP A CG  1 
ATOM   539   O  OD1 . ASP A 1 70  ? -13.212 -4.320   14.081  1.00 31.99  ? 73   ASP A OD1 1 
ATOM   540   O  OD2 . ASP A 1 70  ? -13.616 -3.328   12.175  1.00 30.59  ? 73   ASP A OD2 1 
ATOM   541   N  N   . ALA A 1 71  ? -10.015 -7.056   10.761  1.00 30.28  ? 74   ALA A N   1 
ATOM   542   C  CA  . ALA A 1 71  ? -9.404  -8.204   10.069  1.00 29.24  ? 74   ALA A CA  1 
ATOM   543   C  C   . ALA A 1 71  ? -8.193  -7.770   9.249   1.00 28.68  ? 74   ALA A C   1 
ATOM   544   O  O   . ALA A 1 71  ? -8.111  -6.618   8.825   1.00 28.02  ? 74   ALA A O   1 
ATOM   545   C  CB  . ALA A 1 71  ? -10.419 -8.891   9.174   1.00 28.40  ? 74   ALA A CB  1 
ATOM   546   N  N   . LEU A 1 72  ? -7.254  -8.690   9.046   1.00 27.26  ? 75   LEU A N   1 
ATOM   547   C  CA  . LEU A 1 72  ? -6.165  -8.481   8.116   1.00 28.24  ? 75   LEU A CA  1 
ATOM   548   C  C   . LEU A 1 72  ? -6.433  -9.279   6.846   1.00 29.62  ? 75   LEU A C   1 
ATOM   549   O  O   . LEU A 1 72  ? -6.486  -10.501  6.892   1.00 29.94  ? 75   LEU A O   1 
ATOM   550   C  CB  . LEU A 1 72  ? -4.832  -8.899   8.739   1.00 28.04  ? 75   LEU A CB  1 
ATOM   551   C  CG  . LEU A 1 72  ? -4.570  -8.381   10.157  1.00 29.55  ? 75   LEU A CG  1 
ATOM   552   C  CD1 . LEU A 1 72  ? -3.188  -8.808   10.619  1.00 29.58  ? 75   LEU A CD1 1 
ATOM   553   C  CD2 . LEU A 1 72  ? -4.722  -6.869   10.283  1.00 29.20  ? 75   LEU A CD2 1 
ATOM   554   N  N   . VAL A 1 73  ? -6.629  -8.605   5.713   1.00 30.03  ? 76   VAL A N   1 
ATOM   555   C  CA  . VAL A 1 73  ? -6.824  -9.358   4.482   1.00 29.07  ? 76   VAL A CA  1 
ATOM   556   C  C   . VAL A 1 73  ? -5.545  -9.402   3.665   1.00 29.84  ? 76   VAL A C   1 
ATOM   557   O  O   . VAL A 1 73  ? -4.865  -8.385   3.488   1.00 30.70  ? 76   VAL A O   1 
ATOM   558   C  CB  . VAL A 1 73  ? -8.097  -8.981   3.671   1.00 30.13  ? 76   VAL A CB  1 
ATOM   559   C  CG1 . VAL A 1 73  ? -9.091  -8.187   4.507   1.00 28.06  ? 76   VAL A CG1 1 
ATOM   560   C  CG2 . VAL A 1 73  ? -7.760  -8.312   2.348   1.00 30.10  ? 76   VAL A CG2 1 
ATOM   561   N  N   . VAL A 1 74  ? -5.216  -10.603  3.203   1.00 29.19  ? 77   VAL A N   1 
ATOM   562   C  CA  . VAL A 1 74  ? -3.934  -10.891  2.593   1.00 29.87  ? 77   VAL A CA  1 
ATOM   563   C  C   . VAL A 1 74  ? -4.175  -11.226  1.119   1.00 31.33  ? 77   VAL A C   1 
ATOM   564   O  O   . VAL A 1 74  ? -4.815  -12.228  0.809   1.00 30.22  ? 77   VAL A O   1 
ATOM   565   C  CB  . VAL A 1 74  ? -3.263  -12.076  3.320   1.00 31.25  ? 77   VAL A CB  1 
ATOM   566   C  CG1 . VAL A 1 74  ? -1.788  -12.153  3.003   1.00 29.80  ? 77   VAL A CG1 1 
ATOM   567   C  CG2 . VAL A 1 74  ? -3.437  -11.949  4.831   1.00 32.09  ? 77   VAL A CG2 1 
ATOM   568   N  N   . MET A 1 75  ? -3.699  -10.365  0.216   1.00 33.08  ? 78   MET A N   1 
ATOM   569   C  CA  . MET A 1 75  ? -3.921  -10.540  -1.226  1.00 32.33  ? 78   MET A CA  1 
ATOM   570   C  C   . MET A 1 75  ? -2.636  -10.818  -1.987  1.00 35.28  ? 78   MET A C   1 
ATOM   571   O  O   . MET A 1 75  ? -1.907  -9.891   -2.398  1.00 35.94  ? 78   MET A O   1 
ATOM   572   C  CB  . MET A 1 75  ? -4.651  -9.344   -1.831  1.00 32.39  ? 78   MET A CB  1 
ATOM   573   C  CG  . MET A 1 75  ? -4.894  -9.447   -3.328  1.00 30.87  ? 78   MET A CG  1 
ATOM   574   S  SD  . MET A 1 75  ? -6.423  -8.586   -3.745  1.00 30.67  ? 78   MET A SD  1 
ATOM   575   C  CE  . MET A 1 75  ? -6.426  -8.794   -5.526  1.00 29.17  ? 78   MET A CE  1 
ATOM   576   N  N   . SER A 1 76  ? -2.387  -12.110  -2.177  1.00 32.91  ? 79   SER A N   1 
ATOM   577   C  CA  . SER A 1 76  ? -1.210  -12.627  -2.865  1.00 34.36  ? 79   SER A CA  1 
ATOM   578   C  C   . SER A 1 76  ? -1.461  -14.131  -2.972  1.00 33.96  ? 79   SER A C   1 
ATOM   579   O  O   . SER A 1 76  ? -2.522  -14.542  -3.439  1.00 34.39  ? 79   SER A O   1 
ATOM   580   C  CB  . SER A 1 76  ? 0.066   -12.320  -2.069  1.00 34.17  ? 79   SER A CB  1 
ATOM   581   O  OG  . SER A 1 76  ? 1.241   -12.516  -2.848  1.00 36.07  ? 79   SER A OG  1 
ATOM   582   N  N   . GLY A 1 77  ? -0.531  -14.941  -2.481  1.00 34.08  ? 80   GLY A N   1 
ATOM   583   C  CA  . GLY A 1 77  ? -0.728  -16.383  -2.433  1.00 33.20  ? 80   GLY A CA  1 
ATOM   584   C  C   . GLY A 1 77  ? -0.721  -16.988  -1.033  1.00 33.78  ? 80   GLY A C   1 
ATOM   585   O  O   . GLY A 1 77  ? -0.995  -16.311  -0.021  1.00 32.50  ? 80   GLY A O   1 
ATOM   586   N  N   . ASP A 1 78  ? -0.419  -18.284  -0.981  1.00 31.19  ? 81   ASP A N   1 
ATOM   587   C  CA  . ASP A 1 78  ? -0.281  -18.990  0.281   1.00 28.16  ? 81   ASP A CA  1 
ATOM   588   C  C   . ASP A 1 78  ? 0.944   -18.472  1.004   1.00 26.14  ? 81   ASP A C   1 
ATOM   589   O  O   . ASP A 1 78  ? 0.946   -18.403  2.228   1.00 24.86  ? 81   ASP A O   1 
ATOM   590   C  CB  . ASP A 1 78  ? -0.159  -20.502  0.061   1.00 28.03  ? 81   ASP A CB  1 
ATOM   591   C  CG  . ASP A 1 78  ? -1.408  -21.106  -0.544  1.00 28.41  ? 81   ASP A CG  1 
ATOM   592   O  OD1 . ASP A 1 78  ? -2.527  -20.750  -0.115  1.00 28.17  ? 81   ASP A OD1 1 
ATOM   593   O  OD2 . ASP A 1 78  ? -1.272  -21.945  -1.459  1.00 28.54  ? 81   ASP A OD2 1 
ATOM   594   N  N   . GLY A 1 79  ? 1.969   -18.100  0.239   1.00 24.57  ? 82   GLY A N   1 
ATOM   595   C  CA  . GLY A 1 79  ? 3.215   -17.603  0.803   1.00 24.90  ? 82   GLY A CA  1 
ATOM   596   C  C   . GLY A 1 79  ? 3.079   -16.341  1.662   1.00 26.69  ? 82   GLY A C   1 
ATOM   597   O  O   . GLY A 1 79  ? 3.845   -16.154  2.619   1.00 26.22  ? 82   GLY A O   1 
ATOM   598   N  N   . LEU A 1 80  ? 2.131   -15.466  1.334   1.00 24.97  ? 83   LEU A N   1 
ATOM   599   C  CA  . LEU A 1 80  ? 1.993   -14.231  2.093   1.00 27.12  ? 83   LEU A CA  1 
ATOM   600   C  C   . LEU A 1 80  ? 1.311   -14.521  3.419   1.00 27.39  ? 83   LEU A C   1 
ATOM   601   O  O   . LEU A 1 80  ? 1.761   -14.042  4.467   1.00 26.52  ? 83   LEU A O   1 
ATOM   602   C  CB  . LEU A 1 80  ? 1.228   -13.153  1.326   1.00 26.57  ? 83   LEU A CB  1 
ATOM   603   C  CG  . LEU A 1 80  ? 1.839   -11.742  1.204   1.00 30.29  ? 83   LEU A CG  1 
ATOM   604   C  CD1 . LEU A 1 80  ? 0.776   -10.632  1.197   1.00 29.53  ? 83   LEU A CD1 1 
ATOM   605   C  CD2 . LEU A 1 80  ? 2.912   -11.434  2.226   1.00 26.77  ? 83   LEU A CD2 1 
ATOM   606   N  N   . MET A 1 81  ? 0.235   -15.312  3.365   1.00 26.61  ? 84   MET A N   1 
ATOM   607   C  CA  . MET A 1 81  ? -0.469  -15.766  4.569   1.00 26.67  ? 84   MET A CA  1 
ATOM   608   C  C   . MET A 1 81  ? 0.499   -16.405  5.547   1.00 25.07  ? 84   MET A C   1 
ATOM   609   O  O   . MET A 1 81  ? 0.526   -16.065  6.724   1.00 27.35  ? 84   MET A O   1 
ATOM   610   C  CB  . MET A 1 81  ? -1.595  -16.732  4.224   1.00 26.78  ? 84   MET A CB  1 
ATOM   611   C  CG  . MET A 1 81  ? -2.451  -17.098  5.420   1.00 29.94  ? 84   MET A CG  1 
ATOM   612   S  SD  . MET A 1 81  ? -3.394  -15.714  6.107   1.00 33.49  ? 84   MET A SD  1 
ATOM   613   C  CE  . MET A 1 81  ? -4.636  -15.405  4.857   1.00 27.88  ? 84   MET A CE  1 
ATOM   614   N  N   . HIS A 1 82  ? 1.316   -17.306  5.041   1.00 23.64  ? 85   HIS A N   1 
ATOM   615   C  CA  . HIS A 1 82  ? 2.441   -17.835  5.784   1.00 23.66  ? 85   HIS A CA  1 
ATOM   616   C  C   . HIS A 1 82  ? 3.234   -16.788  6.540   1.00 23.91  ? 85   HIS A C   1 
ATOM   617   O  O   . HIS A 1 82  ? 3.453   -16.942  7.747   1.00 23.03  ? 85   HIS A O   1 
ATOM   618   C  CB  . HIS A 1 82  ? 3.358   -18.603  4.851   1.00 22.47  ? 85   HIS A CB  1 
ATOM   619   C  CG  . HIS A 1 82  ? 4.460   -19.331  5.560   1.00 23.23  ? 85   HIS A CG  1 
ATOM   620   N  ND1 . HIS A 1 82  ? 5.741   -18.894  5.558   1.00 25.18  ? 85   HIS A ND1 1 
ATOM   621   C  CD2 . HIS A 1 82  ? 4.437   -20.484  6.330   1.00 22.17  ? 85   HIS A CD2 1 
ATOM   622   C  CE1 . HIS A 1 82  ? 6.505   -19.749  6.266   1.00 23.81  ? 85   HIS A CE1 1 
ATOM   623   N  NE2 . HIS A 1 82  ? 5.703   -20.716  6.746   1.00 24.33  ? 85   HIS A NE2 1 
ATOM   624   N  N   . GLU A 1 83  ? 3.685   -15.734  5.850   1.00 23.96  ? 86   GLU A N   1 
ATOM   625   C  CA  . GLU A 1 83  ? 4.485   -14.683  6.494   1.00 26.15  ? 86   GLU A CA  1 
ATOM   626   C  C   . GLU A 1 83  ? 3.693   -13.942  7.572   1.00 25.80  ? 86   GLU A C   1 
ATOM   627   O  O   . GLU A 1 83  ? 4.233   -13.643  8.644   1.00 25.29  ? 86   GLU A O   1 
ATOM   628   C  CB  . GLU A 1 83  ? 5.036   -13.676  5.475   1.00 29.20  ? 86   GLU A CB  1 
ATOM   629   C  CG  . GLU A 1 83  ? 6.010   -14.259  4.466   1.00 32.12  ? 86   GLU A CG  1 
ATOM   630   C  CD  . GLU A 1 83  ? 7.329   -14.680  5.086   1.00 37.64  ? 86   GLU A CD  1 
ATOM   631   O  OE1 . GLU A 1 83  ? 7.743   -15.848  4.890   1.00 41.53  ? 86   GLU A OE1 1 
ATOM   632   O  OE2 . GLU A 1 83  ? 7.969   -13.849  5.768   1.00 41.06  ? 86   GLU A OE2 1 
ATOM   633   N  N   . VAL A 1 84  ? 2.419   -13.656  7.278   1.00 24.83  ? 87   VAL A N   1 
ATOM   634   C  CA  . VAL A 1 84  ? 1.538   -12.947  8.186   1.00 25.23  ? 87   VAL A CA  1 
ATOM   635   C  C   . VAL A 1 84  ? 1.329   -13.744  9.469   1.00 26.59  ? 87   VAL A C   1 
ATOM   636   O  O   . VAL A 1 84  ? 1.483   -13.223  10.574  1.00 27.40  ? 87   VAL A O   1 
ATOM   637   C  CB  . VAL A 1 84  ? 0.182   -12.624  7.525   1.00 24.96  ? 87   VAL A CB  1 
ATOM   638   C  CG1 . VAL A 1 84  ? -0.805  -12.039  8.533   1.00 23.84  ? 87   VAL A CG1 1 
ATOM   639   C  CG2 . VAL A 1 84  ? 0.379   -11.642  6.375   1.00 24.98  ? 87   VAL A CG2 1 
ATOM   640   N  N   . VAL A 1 85  ? 0.980   -15.012  9.318   1.00 26.79  ? 88   VAL A N   1 
ATOM   641   C  CA  . VAL A 1 85  ? 0.772   -15.884  10.462  1.00 25.68  ? 88   VAL A CA  1 
ATOM   642   C  C   . VAL A 1 85  ? 2.054   -16.042  11.285  1.00 25.86  ? 88   VAL A C   1 
ATOM   643   O  O   . VAL A 1 85  ? 2.035   -15.930  12.503  1.00 26.61  ? 88   VAL A O   1 
ATOM   644   C  CB  . VAL A 1 85  ? 0.137   -17.225  10.020  1.00 25.44  ? 88   VAL A CB  1 
ATOM   645   C  CG1 . VAL A 1 85  ? 0.109   -18.238  11.167  1.00 25.10  ? 88   VAL A CG1 1 
ATOM   646   C  CG2 . VAL A 1 85  ? -1.279  -16.953  9.532   1.00 24.04  ? 88   VAL A CG2 1 
ATOM   647   N  N   . ASN A 1 86  ? 3.187   -16.242  10.637  1.00 25.83  ? 89   ASN A N   1 
ATOM   648   C  CA  . ASN A 1 86  ? 4.408   -16.298  11.408  1.00 26.31  ? 89   ASN A CA  1 
ATOM   649   C  C   . ASN A 1 86  ? 4.742   -14.989  12.122  1.00 28.84  ? 89   ASN A C   1 
ATOM   650   O  O   . ASN A 1 86  ? 5.212   -15.008  13.257  1.00 29.39  ? 89   ASN A O   1 
ATOM   651   C  CB  . ASN A 1 86  ? 5.553   -16.773  10.555  1.00 26.96  ? 89   ASN A CB  1 
ATOM   652   C  CG  . ASN A 1 86  ? 5.555   -18.274  10.406  1.00 26.46  ? 89   ASN A CG  1 
ATOM   653   O  OD1 . ASN A 1 86  ? 5.033   -18.809  9.425   1.00 28.30  ? 89   ASN A OD1 1 
ATOM   654   N  ND2 . ASN A 1 86  ? 6.118   -18.962  11.384  1.00 24.37  ? 89   ASN A ND2 1 
ATOM   655   N  N   . GLY A 1 87  ? 4.476   -13.862  11.456  1.00 28.74  ? 90   GLY A N   1 
ATOM   656   C  CA  . GLY A 1 87  ? 4.606   -12.541  12.050  1.00 28.08  ? 90   GLY A CA  1 
ATOM   657   C  C   . GLY A 1 87  ? 3.813   -12.382  13.332  1.00 30.09  ? 90   GLY A C   1 
ATOM   658   O  O   . GLY A 1 87  ? 4.337   -11.877  14.318  1.00 31.21  ? 90   GLY A O   1 
ATOM   659   N  N   . LEU A 1 88  ? 2.552   -12.814  13.325  1.00 28.56  ? 91   LEU A N   1 
ATOM   660   C  CA  . LEU A 1 88  ? 1.716   -12.714  14.504  1.00 27.85  ? 91   LEU A CA  1 
ATOM   661   C  C   . LEU A 1 88  ? 2.214   -13.611  15.650  1.00 29.67  ? 91   LEU A C   1 
ATOM   662   O  O   . LEU A 1 88  ? 2.218   -13.194  16.814  1.00 30.74  ? 91   LEU A O   1 
ATOM   663   C  CB  . LEU A 1 88  ? 0.262   -13.059  14.158  1.00 26.38  ? 91   LEU A CB  1 
ATOM   664   C  CG  . LEU A 1 88  ? -0.494  -12.175  13.159  1.00 25.08  ? 91   LEU A CG  1 
ATOM   665   C  CD1 . LEU A 1 88  ? -1.778  -12.857  12.731  1.00 24.38  ? 91   LEU A CD1 1 
ATOM   666   C  CD2 . LEU A 1 88  ? -0.798  -10.809  13.743  1.00 25.07  ? 91   LEU A CD2 1 
ATOM   667   N  N   . MET A 1 89  ? 2.607   -14.843  15.309  1.00 29.33  ? 92   MET A N   1 
ATOM   668   C  CA  . MET A 1 89  ? 3.082   -15.841  16.279  1.00 29.73  ? 92   MET A CA  1 
ATOM   669   C  C   . MET A 1 89  ? 4.428   -15.475  16.877  1.00 30.63  ? 92   MET A C   1 
ATOM   670   O  O   . MET A 1 89  ? 4.735   -15.882  17.994  1.00 30.98  ? 92   MET A O   1 
ATOM   671   C  CB  . MET A 1 89  ? 3.181   -17.232  15.636  1.00 28.99  ? 92   MET A CB  1 
ATOM   672   C  CG  . MET A 1 89  ? 1.838   -17.846  15.290  1.00 28.24  ? 92   MET A CG  1 
ATOM   673   S  SD  . MET A 1 89  ? 0.786   -18.130  16.725  1.00 30.32  ? 92   MET A SD  1 
ATOM   674   C  CE  . MET A 1 89  ? 1.763   -19.346  17.615  1.00 30.07  ? 92   MET A CE  1 
ATOM   675   N  N   . GLU A 1 90  ? 5.221   -14.700  16.135  1.00 33.42  ? 93   GLU A N   1 
ATOM   676   C  CA  . GLU A 1 90  ? 6.522   -14.222  16.617  1.00 34.78  ? 93   GLU A CA  1 
ATOM   677   C  C   . GLU A 1 90  ? 6.401   -13.050  17.609  1.00 35.55  ? 93   GLU A C   1 
ATOM   678   O  O   . GLU A 1 90  ? 7.418   -12.549  18.110  1.00 33.64  ? 93   GLU A O   1 
ATOM   679   C  CB  . GLU A 1 90  ? 7.402   -13.793  15.444  1.00 36.30  ? 93   GLU A CB  1 
ATOM   680   C  CG  . GLU A 1 90  ? 8.063   -14.919  14.679  1.00 38.24  ? 93   GLU A CG  1 
ATOM   681   C  CD  . GLU A 1 90  ? 8.621   -14.463  13.335  1.00 43.86  ? 93   GLU A CD  1 
ATOM   682   O  OE1 . GLU A 1 90  ? 9.010   -13.277  13.206  1.00 45.57  ? 93   GLU A OE1 1 
ATOM   683   O  OE2 . GLU A 1 90  ? 8.669   -15.290  12.393  1.00 46.07  ? 93   GLU A OE2 1 
ATOM   684   N  N   . ARG A 1 91  ? 5.172   -12.599  17.873  1.00 33.69  ? 94   ARG A N   1 
ATOM   685   C  CA  . ARG A 1 91  ? 4.963   -11.432  18.719  1.00 33.45  ? 94   ARG A CA  1 
ATOM   686   C  C   . ARG A 1 91  ? 4.984   -11.848  20.187  1.00 34.14  ? 94   ARG A C   1 
ATOM   687   O  O   . ARG A 1 91  ? 4.550   -12.955  20.514  1.00 36.91  ? 94   ARG A O   1 
ATOM   688   C  CB  . ARG A 1 91  ? 3.628   -10.759  18.387  1.00 33.40  ? 94   ARG A CB  1 
ATOM   689   C  CG  . ARG A 1 91  ? 3.601   -9.987   17.077  1.00 33.96  ? 94   ARG A CG  1 
ATOM   690   C  CD  . ARG A 1 91  ? 2.168   -9.596   16.706  1.00 35.33  ? 94   ARG A CD  1 
ATOM   691   N  NE  . ARG A 1 91  ? 1.535   -8.693   17.679  1.00 36.40  ? 94   ARG A NE  1 
ATOM   692   C  CZ  . ARG A 1 91  ? 1.296   -7.395   17.486  1.00 35.50  ? 94   ARG A CZ  1 
ATOM   693   N  NH1 . ARG A 1 91  ? 1.620   -6.803   16.341  1.00 35.15  ? 94   ARG A NH1 1 
ATOM   694   N  NH2 . ARG A 1 91  ? 0.718   -6.681   18.445  1.00 34.94  ? 94   ARG A NH2 1 
ATOM   695   N  N   . PRO A 1 92  ? 5.469   -10.966  21.087  1.00 35.39  ? 95   PRO A N   1 
ATOM   696   C  CA  . PRO A 1 92  ? 5.335   -11.278  22.530  1.00 34.09  ? 95   PRO A CA  1 
ATOM   697   C  C   . PRO A 1 92  ? 3.867   -11.450  22.960  1.00 33.70  ? 95   PRO A C   1 
ATOM   698   O  O   . PRO A 1 92  ? 3.569   -12.285  23.821  1.00 32.11  ? 95   PRO A O   1 
ATOM   699   C  CB  . PRO A 1 92  ? 5.979   -10.067  23.227  1.00 35.36  ? 95   PRO A CB  1 
ATOM   700   C  CG  . PRO A 1 92  ? 6.080   -9.004   22.163  1.00 35.62  ? 95   PRO A CG  1 
ATOM   701   C  CD  . PRO A 1 92  ? 6.246   -9.730   20.862  1.00 33.09  ? 95   PRO A CD  1 
ATOM   702   N  N   . ASP A 1 93  ? 2.956   -10.698  22.343  1.00 31.73  ? 96   ASP A N   1 
ATOM   703   C  CA  . ASP A 1 93  ? 1.529   -10.867  22.625  1.00 31.66  ? 96   ASP A CA  1 
ATOM   704   C  C   . ASP A 1 93  ? 0.816   -11.845  21.657  1.00 30.98  ? 96   ASP A C   1 
ATOM   705   O  O   . ASP A 1 93  ? -0.361  -11.661  21.336  1.00 30.19  ? 96   ASP A O   1 
ATOM   706   C  CB  . ASP A 1 93  ? 0.820   -9.501   22.662  1.00 32.86  ? 96   ASP A CB  1 
ATOM   707   C  CG  . ASP A 1 93  ? 0.777   -8.805   21.283  1.00 36.45  ? 96   ASP A CG  1 
ATOM   708   O  OD1 . ASP A 1 93  ? 1.712   -8.988   20.468  1.00 38.94  ? 96   ASP A OD1 1 
ATOM   709   O  OD2 . ASP A 1 93  ? -0.204  -8.072   21.016  1.00 35.34  ? 96   ASP A OD2 1 
ATOM   710   N  N   . TRP A 1 94  ? 1.513   -12.897  21.225  1.00 31.04  ? 97   TRP A N   1 
ATOM   711   C  CA  . TRP A 1 94  ? 0.949   -13.837  20.234  1.00 33.30  ? 97   TRP A CA  1 
ATOM   712   C  C   . TRP A 1 94  ? -0.399  -14.410  20.578  1.00 34.81  ? 97   TRP A C   1 
ATOM   713   O  O   . TRP A 1 94  ? -1.218  -14.596  19.681  1.00 33.19  ? 97   TRP A O   1 
ATOM   714   C  CB  . TRP A 1 94  ? 1.919   -14.960  19.889  1.00 32.37  ? 97   TRP A CB  1 
ATOM   715   C  CG  . TRP A 1 94  ? 2.215   -15.907  21.016  1.00 32.38  ? 97   TRP A CG  1 
ATOM   716   C  CD1 . TRP A 1 94  ? 3.284   -15.859  21.894  1.00 34.84  ? 97   TRP A CD1 1 
ATOM   717   C  CD2 . TRP A 1 94  ? 1.452   -17.100  21.412  1.00 33.16  ? 97   TRP A CD2 1 
ATOM   718   N  NE1 . TRP A 1 94  ? 3.234   -16.896  22.786  1.00 34.87  ? 97   TRP A NE1 1 
ATOM   719   C  CE2 . TRP A 1 94  ? 2.160   -17.677  22.552  1.00 34.17  ? 97   TRP A CE2 1 
ATOM   720   C  CE3 . TRP A 1 94  ? 0.289   -17.717  20.961  1.00 33.28  ? 97   TRP A CE3 1 
ATOM   721   C  CZ2 . TRP A 1 94  ? 1.712   -18.825  23.193  1.00 33.47  ? 97   TRP A CZ2 1 
ATOM   722   C  CZ3 . TRP A 1 94  ? -0.159  -18.865  21.620  1.00 32.59  ? 97   TRP A CZ3 1 
ATOM   723   C  CH2 . TRP A 1 94  ? 0.543   -19.408  22.705  1.00 32.50  ? 97   TRP A CH2 1 
ATOM   724   N  N   . GLU A 1 95  ? -0.642  -14.688  21.866  1.00 36.87  ? 98   GLU A N   1 
ATOM   725   C  CA  . GLU A 1 95  ? -1.877  -15.365  22.313  1.00 40.26  ? 98   GLU A CA  1 
ATOM   726   C  C   . GLU A 1 95  ? -3.118  -14.607  21.881  1.00 38.40  ? 98   GLU A C   1 
ATOM   727   O  O   . GLU A 1 95  ? -4.104  -15.208  21.465  1.00 41.13  ? 98   GLU A O   1 
ATOM   728   C  CB  . GLU A 1 95  ? -1.922  -15.558  23.842  1.00 45.62  ? 98   GLU A CB  1 
ATOM   729   C  CG  . GLU A 1 95  ? -0.797  -16.394  24.442  1.00 52.14  ? 98   GLU A CG  1 
ATOM   730   C  CD  . GLU A 1 95  ? -0.960  -16.633  25.943  1.00 58.50  ? 98   GLU A CD  1 
ATOM   731   O  OE1 . GLU A 1 95  ? 0.062   -16.878  26.629  1.00 60.81  ? 98   GLU A OE1 1 
ATOM   732   O  OE2 . GLU A 1 95  ? -2.106  -16.579  26.442  1.00 58.76  ? 98   GLU A OE2 1 
ATOM   733   N  N   . THR A 1 96  ? -3.067  -13.284  21.985  1.00 35.36  ? 99   THR A N   1 
ATOM   734   C  CA  . THR A 1 96  ? -4.182  -12.444  21.552  1.00 34.54  ? 99   THR A CA  1 
ATOM   735   C  C   . THR A 1 96  ? -4.011  -11.981  20.080  1.00 31.51  ? 99   THR A C   1 
ATOM   736   O  O   . THR A 1 96  ? -4.987  -11.820  19.357  1.00 32.01  ? 99   THR A O   1 
ATOM   737   C  CB  . THR A 1 96  ? -4.376  -11.230  22.503  1.00 35.27  ? 99   THR A CB  1 
ATOM   738   O  OG1 . THR A 1 96  ? -3.106  -10.618  22.744  1.00 35.68  ? 99   THR A OG1 1 
ATOM   739   C  CG2 . THR A 1 96  ? -4.972  -11.670  23.855  1.00 34.74  ? 99   THR A CG2 1 
ATOM   740   N  N   . ALA A 1 97  ? -2.775  -11.781  19.649  1.00 28.33  ? 100  ALA A N   1 
ATOM   741   C  CA  . ALA A 1 97  ? -2.496  -11.379  18.265  1.00 29.97  ? 100  ALA A CA  1 
ATOM   742   C  C   . ALA A 1 97  ? -2.982  -12.401  17.223  1.00 30.54  ? 100  ALA A C   1 
ATOM   743   O  O   . ALA A 1 97  ? -3.465  -12.022  16.140  1.00 30.41  ? 100  ALA A O   1 
ATOM   744   C  CB  . ALA A 1 97  ? -1.012  -11.112  18.078  1.00 28.12  ? 100  ALA A CB  1 
ATOM   745   N  N   . ILE A 1 98  ? -2.851  -13.686  17.545  1.00 29.41  ? 101  ILE A N   1 
ATOM   746   C  CA  . ILE A 1 98  ? -3.263  -14.755  16.623  1.00 29.94  ? 101  ILE A CA  1 
ATOM   747   C  C   . ILE A 1 98  ? -4.791  -14.841  16.499  1.00 30.41  ? 101  ILE A C   1 
ATOM   748   O  O   . ILE A 1 98  ? -5.298  -15.487  15.595  1.00 30.96  ? 101  ILE A O   1 
ATOM   749   C  CB  . ILE A 1 98  ? -2.641  -16.129  16.993  1.00 28.78  ? 101  ILE A CB  1 
ATOM   750   C  CG1 . ILE A 1 98  ? -2.766  -17.134  15.837  1.00 31.39  ? 101  ILE A CG1 1 
ATOM   751   C  CG2 . ILE A 1 98  ? -3.314  -16.716  18.218  1.00 27.18  ? 101  ILE A CG2 1 
ATOM   752   C  CD1 . ILE A 1 98  ? -2.219  -16.650  14.508  1.00 30.70  ? 101  ILE A CD1 1 
ATOM   753   N  N   . GLN A 1 99  ? -5.523  -14.175  17.387  1.00 31.75  ? 102  GLN A N   1 
ATOM   754   C  CA  . GLN A 1 99  ? -6.992  -14.130  17.265  1.00 33.52  ? 102  GLN A CA  1 
ATOM   755   C  C   . GLN A 1 99  ? -7.570  -13.150  16.231  1.00 31.30  ? 102  GLN A C   1 
ATOM   756   O  O   . GLN A 1 99  ? -8.769  -13.174  15.957  1.00 31.48  ? 102  GLN A O   1 
ATOM   757   C  CB  . GLN A 1 99  ? -7.644  -13.916  18.622  1.00 37.89  ? 102  GLN A CB  1 
ATOM   758   C  CG  . GLN A 1 99  ? -8.125  -15.224  19.234  1.00 44.03  ? 102  GLN A CG  1 
ATOM   759   C  CD  . GLN A 1 99  ? -7.755  -15.344  20.693  1.00 45.98  ? 102  GLN A CD  1 
ATOM   760   O  OE1 . GLN A 1 99  ? -7.992  -14.430  21.476  1.00 51.38  ? 102  GLN A OE1 1 
ATOM   761   N  NE2 . GLN A 1 99  ? -7.159  -16.468  21.062  1.00 46.92  ? 102  GLN A NE2 1 
ATOM   762   N  N   . LYS A 1 100 ? -6.727  -12.308  15.646  1.00 28.86  ? 103  LYS A N   1 
ATOM   763   C  CA  . LYS A 1 100 ? -7.191  -11.379  14.614  1.00 28.03  ? 103  LYS A CA  1 
ATOM   764   C  C   . LYS A 1 100 ? -7.679  -12.126  13.364  1.00 26.93  ? 103  LYS A C   1 
ATOM   765   O  O   . LYS A 1 100 ? -6.902  -12.838  12.729  1.00 25.80  ? 103  LYS A O   1 
ATOM   766   C  CB  . LYS A 1 100 ? -6.075  -10.392  14.253  1.00 27.45  ? 103  LYS A CB  1 
ATOM   767   C  CG  . LYS A 1 100 ? -6.501  -9.215   13.388  1.00 29.09  ? 103  LYS A CG  1 
ATOM   768   C  CD  . LYS A 1 100 ? -7.584  -8.332   14.015  1.00 29.98  ? 103  LYS A CD  1 
ATOM   769   C  CE  . LYS A 1 100 ? -7.140  -7.640   15.304  1.00 30.12  ? 103  LYS A CE  1 
ATOM   770   N  NZ  . LYS A 1 100 ? -8.269  -6.865   15.899  1.00 30.03  ? 103  LYS A NZ  1 
ATOM   771   N  N   . PRO A 1 101 ? -8.970  -11.978  13.015  1.00 25.62  ? 104  PRO A N   1 
ATOM   772   C  CA  . PRO A 1 101 ? -9.472  -12.613  11.806  1.00 26.17  ? 104  PRO A CA  1 
ATOM   773   C  C   . PRO A 1 101 ? -8.589  -12.339  10.560  1.00 27.84  ? 104  PRO A C   1 
ATOM   774   O  O   . PRO A 1 101 ? -8.152  -11.205  10.307  1.00 28.02  ? 104  PRO A O   1 
ATOM   775   C  CB  . PRO A 1 101 ? -10.859 -11.990  11.642  1.00 27.26  ? 104  PRO A CB  1 
ATOM   776   C  CG  . PRO A 1 101 ? -11.292 -11.664  13.038  1.00 25.88  ? 104  PRO A CG  1 
ATOM   777   C  CD  . PRO A 1 101 ? -10.029 -11.254  13.744  1.00 25.95  ? 104  PRO A CD  1 
ATOM   778   N  N   . LEU A 1 102 ? -8.297  -13.390  9.816   1.00 26.42  ? 105  LEU A N   1 
ATOM   779   C  CA  . LEU A 1 102 ? -7.454  -13.281  8.653   1.00 27.75  ? 105  LEU A CA  1 
ATOM   780   C  C   . LEU A 1 102 ? -8.316  -13.618  7.459   1.00 28.30  ? 105  LEU A C   1 
ATOM   781   O  O   . LEU A 1 102 ? -9.296  -14.369  7.567   1.00 29.71  ? 105  LEU A O   1 
ATOM   782   C  CB  . LEU A 1 102 ? -6.274  -14.253  8.763   1.00 27.52  ? 105  LEU A CB  1 
ATOM   783   C  CG  . LEU A 1 102 ? -4.921  -13.836  9.373   1.00 28.52  ? 105  LEU A CG  1 
ATOM   784   C  CD1 . LEU A 1 102 ? -4.920  -12.566  10.213  1.00 27.82  ? 105  LEU A CD1 1 
ATOM   785   C  CD2 . LEU A 1 102 ? -4.316  -14.971  10.165  1.00 26.42  ? 105  LEU A CD2 1 
ATOM   786   N  N   . CYS A 1 103 ? -7.980  -13.026  6.329   1.00 28.51  ? 106  CYS A N   1 
ATOM   787   C  CA  . CYS A 1 103 ? -8.726  -13.260  5.105   1.00 29.57  ? 106  CYS A CA  1 
ATOM   788   C  C   . CYS A 1 103 ? -7.735  -13.478  3.970   1.00 28.62  ? 106  CYS A C   1 
ATOM   789   O  O   . CYS A 1 103 ? -6.770  -12.716  3.811   1.00 29.21  ? 106  CYS A O   1 
ATOM   790   C  CB  . CYS A 1 103 ? -9.682  -12.095  4.784   1.00 27.58  ? 106  CYS A CB  1 
ATOM   791   S  SG  . CYS A 1 103 ? -10.400 -12.221  3.124   1.00 30.08  ? 106  CYS A SG  1 
ATOM   792   N  N   . SER A 1 104 ? -7.985  -14.523  3.195   1.00 28.56  ? 107  SER A N   1 
ATOM   793   C  CA  . SER A 1 104 ? -7.128  -14.869  2.082   1.00 30.84  ? 107  SER A CA  1 
ATOM   794   C  C   . SER A 1 104 ? -7.795  -14.536  0.752   1.00 31.76  ? 107  SER A C   1 
ATOM   795   O  O   . SER A 1 104 ? -8.776  -15.176  0.371   1.00 34.97  ? 107  SER A O   1 
ATOM   796   C  CB  . SER A 1 104 ? -6.773  -16.344  2.129   1.00 30.08  ? 107  SER A CB  1 
ATOM   797   O  OG  . SER A 1 104 ? -5.882  -16.649  1.074   1.00 36.29  ? 107  SER A OG  1 
ATOM   798   N  N   . LEU A 1 105 ? -7.272  -13.527  0.061   1.00 30.85  ? 108  LEU A N   1 
ATOM   799   C  CA  . LEU A 1 105 ? -7.719  -13.194  -1.292  1.00 30.82  ? 108  LEU A CA  1 
ATOM   800   C  C   . LEU A 1 105 ? -6.667  -13.632  -2.307  1.00 32.64  ? 108  LEU A C   1 
ATOM   801   O  O   . LEU A 1 105 ? -5.514  -13.182  -2.250  1.00 34.88  ? 108  LEU A O   1 
ATOM   802   C  CB  . LEU A 1 105 ? -8.022  -11.710  -1.437  1.00 30.00  ? 108  LEU A CB  1 
ATOM   803   C  CG  . LEU A 1 105 ? -9.184  -11.129  -0.623  1.00 30.13  ? 108  LEU A CG  1 
ATOM   804   C  CD1 . LEU A 1 105 ? -9.391  -9.706   -1.100  1.00 29.22  ? 108  LEU A CD1 1 
ATOM   805   C  CD2 . LEU A 1 105 ? -10.493 -11.902  -0.723  1.00 28.93  ? 108  LEU A CD2 1 
ATOM   806   N  N   . PRO A 1 106 ? -7.057  -14.528  -3.229  1.00 31.53  ? 109  PRO A N   1 
ATOM   807   C  CA  . PRO A 1 106 ? -6.127  -15.133  -4.185  1.00 35.28  ? 109  PRO A CA  1 
ATOM   808   C  C   . PRO A 1 106 ? -5.713  -14.175  -5.305  1.00 37.42  ? 109  PRO A C   1 
ATOM   809   O  O   . PRO A 1 106 ? -6.568  -13.601  -5.976  1.00 36.52  ? 109  PRO A O   1 
ATOM   810   C  CB  . PRO A 1 106 ? -6.937  -16.289  -4.785  1.00 33.73  ? 109  PRO A CB  1 
ATOM   811   C  CG  . PRO A 1 106 ? -8.358  -15.848  -4.666  1.00 33.80  ? 109  PRO A CG  1 
ATOM   812   C  CD  . PRO A 1 106 ? -8.454  -14.928  -3.471  1.00 30.91  ? 109  PRO A CD  1 
ATOM   813   N  N   . ALA A 1 107 ? -4.411  -14.013  -5.497  1.00 41.36  ? 110  ALA A N   1 
ATOM   814   C  CA  . ALA A 1 107 ? -3.903  -13.272  -6.642  1.00 48.63  ? 110  ALA A CA  1 
ATOM   815   C  C   . ALA A 1 107 ? -2.957  -14.146  -7.462  1.00 55.59  ? 110  ALA A C   1 
ATOM   816   O  O   . ALA A 1 107 ? -3.313  -14.581  -8.565  1.00 61.83  ? 110  ALA A O   1 
ATOM   817   C  CB  . ALA A 1 107 ? -3.220  -11.984  -6.206  1.00 49.09  ? 110  ALA A CB  1 
ATOM   818   N  N   . GLY A 1 108 ? -1.778  -14.435  -6.913  1.00 58.12  ? 111  GLY A N   1 
ATOM   819   C  CA  . GLY A 1 108 ? -0.711  -15.087  -7.677  1.00 63.46  ? 111  GLY A CA  1 
ATOM   820   C  C   . GLY A 1 108 ? -0.988  -16.503  -8.162  1.00 67.23  ? 111  GLY A C   1 
ATOM   821   O  O   . GLY A 1 108 ? -1.981  -16.774  -8.859  1.00 62.11  ? 111  GLY A O   1 
ATOM   822   N  N   . SER A 1 109 ? -0.063  -17.393  -7.814  1.00 66.59  ? 112  SER A N   1 
ATOM   823   C  CA  . SER A 1 109 ? -0.224  -18.833  -7.971  1.00 62.72  ? 112  SER A CA  1 
ATOM   824   C  C   . SER A 1 109 ? 0.202   -19.461  -6.664  1.00 57.06  ? 112  SER A C   1 
ATOM   825   O  O   . SER A 1 109 ? 1.136   -18.993  -6.007  1.00 56.37  ? 112  SER A O   1 
ATOM   826   C  CB  . SER A 1 109 ? 0.633   -19.380  -9.116  1.00 64.46  ? 112  SER A CB  1 
ATOM   827   O  OG  . SER A 1 109 ? -0.082  -19.354  -10.336 1.00 65.94  ? 112  SER A OG  1 
ATOM   828   N  N   . GLY A 1 110 ? -0.472  -20.538  -6.302  1.00 51.22  ? 113  GLY A N   1 
ATOM   829   C  CA  . GLY A 1 110 ? -0.331  -21.083  -4.969  1.00 44.91  ? 113  GLY A CA  1 
ATOM   830   C  C   . GLY A 1 110 ? -1.395  -20.384  -4.163  1.00 41.14  ? 113  GLY A C   1 
ATOM   831   O  O   . GLY A 1 110 ? -1.086  -19.534  -3.319  1.00 40.75  ? 113  GLY A O   1 
ATOM   832   N  N   . ASN A 1 111 ? -2.650  -20.709  -4.478  1.00 35.18  ? 114  ASN A N   1 
ATOM   833   C  CA  . ASN A 1 111 ? -3.805  -20.254  -3.723  1.00 32.15  ? 114  ASN A CA  1 
ATOM   834   C  C   . ASN A 1 111 ? -4.605  -21.445  -3.225  1.00 29.46  ? 114  ASN A C   1 
ATOM   835   O  O   . ASN A 1 111 ? -5.835  -21.497  -3.355  1.00 28.53  ? 114  ASN A O   1 
ATOM   836   C  CB  . ASN A 1 111 ? -4.686  -19.349  -4.566  1.00 33.73  ? 114  ASN A CB  1 
ATOM   837   C  CG  . ASN A 1 111 ? -3.886  -18.321  -5.329  1.00 37.58  ? 114  ASN A CG  1 
ATOM   838   O  OD1 . ASN A 1 111 ? -3.466  -17.279  -4.772  1.00 35.42  ? 114  ASN A OD1 1 
ATOM   839   N  ND2 . ASN A 1 111 ? -3.669  -18.600  -6.623  1.00 34.37  ? 114  ASN A ND2 1 
ATOM   840   N  N   . ALA A 1 112 ? -3.893  -22.390  -2.622  1.00 27.64  ? 115  ALA A N   1 
ATOM   841   C  CA  . ALA A 1 112 ? -4.524  -23.584  -2.065  1.00 25.63  ? 115  ALA A CA  1 
ATOM   842   C  C   . ALA A 1 112 ? -5.449  -23.235  -0.907  1.00 24.43  ? 115  ALA A C   1 
ATOM   843   O  O   . ALA A 1 112 ? -6.554  -23.774  -0.815  1.00 25.11  ? 115  ALA A O   1 
ATOM   844   C  CB  . ALA A 1 112 ? -3.468  -24.587  -1.654  1.00 24.74  ? 115  ALA A CB  1 
ATOM   845   N  N   . LEU A 1 113 ? -5.021  -22.308  -0.049  1.00 23.89  ? 116  LEU A N   1 
ATOM   846   C  CA  . LEU A 1 113 ? -5.835  -21.890  1.081   1.00 24.40  ? 116  LEU A CA  1 
ATOM   847   C  C   . LEU A 1 113 ? -7.157  -21.289  0.623   1.00 26.16  ? 116  LEU A C   1 
ATOM   848   O  O   . LEU A 1 113 ? -8.228  -21.672  1.120   1.00 26.92  ? 116  LEU A O   1 
ATOM   849   C  CB  . LEU A 1 113 ? -5.079  -20.894  1.979   1.00 24.78  ? 116  LEU A CB  1 
ATOM   850   C  CG  . LEU A 1 113 ? -5.636  -20.721  3.400   1.00 25.78  ? 116  LEU A CG  1 
ATOM   851   C  CD1 . LEU A 1 113 ? -5.580  -22.037  4.181   1.00 25.91  ? 116  LEU A CD1 1 
ATOM   852   C  CD2 . LEU A 1 113 ? -4.948  -19.608  4.200   1.00 26.78  ? 116  LEU A CD2 1 
ATOM   853   N  N   . ALA A 1 114 ? -7.071  -20.346  -0.320  1.00 25.78  ? 117  ALA A N   1 
ATOM   854   C  CA  . ALA A 1 114 ? -8.230  -19.659  -0.855  1.00 26.66  ? 117  ALA A CA  1 
ATOM   855   C  C   . ALA A 1 114 ? -9.150  -20.665  -1.539  1.00 26.49  ? 117  ALA A C   1 
ATOM   856   O  O   . ALA A 1 114 ? -10.383 -20.601  -1.397  1.00 26.43  ? 117  ALA A O   1 
ATOM   857   C  CB  . ALA A 1 114 ? -7.792  -18.578  -1.852  1.00 27.40  ? 117  ALA A CB  1 
ATOM   858   N  N   . ALA A 1 115 ? -8.541  -21.589  -2.286  1.00 26.52  ? 118  ALA A N   1 
ATOM   859   C  CA  . ALA A 1 115 ? -9.298  -22.654  -2.963  1.00 26.04  ? 118  ALA A CA  1 
ATOM   860   C  C   . ALA A 1 115 ? -10.074 -23.509  -1.958  1.00 25.20  ? 118  ALA A C   1 
ATOM   861   O  O   . ALA A 1 115 ? -11.262 -23.786  -2.163  1.00 26.70  ? 118  ALA A O   1 
ATOM   862   C  CB  . ALA A 1 115 ? -8.377  -23.515  -3.813  1.00 24.36  ? 118  ALA A CB  1 
ATOM   863   N  N   . SER A 1 116 ? -9.409  -23.905  -0.870  1.00 24.78  ? 119  SER A N   1 
ATOM   864   C  CA  . SER A 1 116 ? -10.039 -24.741  0.171   1.00 24.09  ? 119  SER A CA  1 
ATOM   865   C  C   . SER A 1 116 ? -11.250 -24.048  0.780   1.00 24.97  ? 119  SER A C   1 
ATOM   866   O  O   . SER A 1 116 ? -12.309 -24.661  0.931   1.00 26.30  ? 119  SER A O   1 
ATOM   867   C  CB  . SER A 1 116 ? -9.037  -25.118  1.262   1.00 23.09  ? 119  SER A CB  1 
ATOM   868   O  OG  . SER A 1 116 ? -7.825  -25.630  0.712   1.00 23.34  ? 119  SER A OG  1 
ATOM   869   N  N   . LEU A 1 117 ? -11.094 -22.766  1.113   1.00 25.90  ? 120  LEU A N   1 
ATOM   870   C  CA  . LEU A 1 117 ? -12.167 -21.968  1.722   1.00 26.34  ? 120  LEU A CA  1 
ATOM   871   C  C   . LEU A 1 117 ? -13.338 -21.793  0.784   1.00 26.38  ? 120  LEU A C   1 
ATOM   872   O  O   . LEU A 1 117 ? -14.487 -21.843  1.202   1.00 27.57  ? 120  LEU A O   1 
ATOM   873   C  CB  . LEU A 1 117 ? -11.644 -20.588  2.150   1.00 27.61  ? 120  LEU A CB  1 
ATOM   874   C  CG  . LEU A 1 117 ? -10.682 -20.598  3.348   1.00 27.83  ? 120  LEU A CG  1 
ATOM   875   C  CD1 . LEU A 1 117 ? -10.045 -19.248  3.565   1.00 28.99  ? 120  LEU A CD1 1 
ATOM   876   C  CD2 . LEU A 1 117 ? -11.406 -21.028  4.597   1.00 26.84  ? 120  LEU A CD2 1 
ATOM   877   N  N   . ASN A 1 118 ? -13.031 -21.565  -0.488  1.00 28.39  ? 121  ASN A N   1 
ATOM   878   C  CA  . ASN A 1 118 ? -14.041 -21.486  -1.524  1.00 28.53  ? 121  ASN A CA  1 
ATOM   879   C  C   . ASN A 1 118 ? -14.861 -22.783  -1.605  1.00 29.24  ? 121  ASN A C   1 
ATOM   880   O  O   . ASN A 1 118 ? -16.102 -22.751  -1.721  1.00 27.71  ? 121  ASN A O   1 
ATOM   881   C  CB  . ASN A 1 118 ? -13.374 -21.210  -2.866  1.00 28.89  ? 121  ASN A CB  1 
ATOM   882   C  CG  . ASN A 1 118 ? -14.369 -21.172  -4.002  1.00 29.95  ? 121  ASN A CG  1 
ATOM   883   O  OD1 . ASN A 1 118 ? -14.349 -22.034  -4.893  1.00 32.05  ? 121  ASN A OD1 1 
ATOM   884   N  ND2 . ASN A 1 118 ? -15.279 -20.210  -3.951  1.00 27.20  ? 121  ASN A ND2 1 
ATOM   885   N  N   . HIS A 1 119 ? -14.145 -23.907  -1.556  1.00 29.27  ? 122  HIS A N   1 
ATOM   886   C  CA  . HIS A 1 119 ? -14.746 -25.229  -1.434  1.00 30.17  ? 122  HIS A CA  1 
ATOM   887   C  C   . HIS A 1 119 ? -15.551 -25.422  -0.162  1.00 31.18  ? 122  HIS A C   1 
ATOM   888   O  O   . HIS A 1 119 ? -16.688 -25.900  -0.226  1.00 32.21  ? 122  HIS A O   1 
ATOM   889   C  CB  . HIS A 1 119 ? -13.687 -26.321  -1.566  1.00 29.78  ? 122  HIS A CB  1 
ATOM   890   C  CG  . HIS A 1 119 ? -14.218 -27.697  -1.278  1.00 31.68  ? 122  HIS A CG  1 
ATOM   891   N  ND1 . HIS A 1 119 ? -13.940 -28.356  -0.139  1.00 32.76  ? 122  HIS A ND1 1 
ATOM   892   C  CD2 . HIS A 1 119 ? -15.091 -28.507  -2.000  1.00 32.77  ? 122  HIS A CD2 1 
ATOM   893   C  CE1 . HIS A 1 119 ? -14.577 -29.539  -0.140  1.00 33.49  ? 122  HIS A CE1 1 
ATOM   894   N  NE2 . HIS A 1 119 ? -15.284 -29.629  -1.278  1.00 34.56  ? 122  HIS A NE2 1 
ATOM   895   N  N   . TYR A 1 120 ? -15.012 -25.050  1.000   1.00 30.35  ? 123  TYR A N   1 
ATOM   896   C  CA  . TYR A 1 120 ? -15.782 -25.256  2.241   1.00 31.57  ? 123  TYR A CA  1 
ATOM   897   C  C   . TYR A 1 120 ? -17.110 -24.509  2.184   1.00 33.25  ? 123  TYR A C   1 
ATOM   898   O  O   . TYR A 1 120 ? -18.109 -24.941  2.769   1.00 34.08  ? 123  TYR A O   1 
ATOM   899   C  CB  . TYR A 1 120 ? -15.024 -24.840  3.507   1.00 29.06  ? 123  TYR A CB  1 
ATOM   900   C  CG  . TYR A 1 120 ? -13.666 -25.484  3.726   1.00 27.68  ? 123  TYR A CG  1 
ATOM   901   C  CD1 . TYR A 1 120 ? -13.408 -26.800  3.352   1.00 26.14  ? 123  TYR A CD1 1 
ATOM   902   C  CD2 . TYR A 1 120 ? -12.645 -24.763  4.348   1.00 26.72  ? 123  TYR A CD2 1 
ATOM   903   C  CE1 . TYR A 1 120 ? -12.159 -27.369  3.567   1.00 26.50  ? 123  TYR A CE1 1 
ATOM   904   C  CE2 . TYR A 1 120 ? -11.394 -25.315  4.559   1.00 26.66  ? 123  TYR A CE2 1 
ATOM   905   C  CZ  . TYR A 1 120 ? -11.156 -26.617  4.173   1.00 26.65  ? 123  TYR A CZ  1 
ATOM   906   O  OH  . TYR A 1 120 ? -9.906  -27.131  4.394   1.00 25.91  ? 123  TYR A OH  1 
ATOM   907   N  N   . ALA A 1 121 ? -17.117 -23.392  1.463   1.00 33.61  ? 124  ALA A N   1 
ATOM   908   C  CA  . ALA A 1 121 ? -18.276 -22.511  1.438   1.00 35.67  ? 124  ALA A CA  1 
ATOM   909   C  C   . ALA A 1 121 ? -19.365 -23.055  0.519   1.00 35.68  ? 124  ALA A C   1 
ATOM   910   O  O   . ALA A 1 121 ? -20.497 -22.578  0.528   1.00 36.59  ? 124  ALA A O   1 
ATOM   911   C  CB  . ALA A 1 121 ? -17.860 -21.105  1.024   1.00 36.27  ? 124  ALA A CB  1 
ATOM   912   N  N   . GLY A 1 122 ? -19.011 -24.068  -0.263  1.00 36.54  ? 125  GLY A N   1 
ATOM   913   C  CA  . GLY A 1 122 ? -19.957 -24.725  -1.153  1.00 38.05  ? 125  GLY A CA  1 
ATOM   914   C  C   . GLY A 1 122 ? -19.968 -24.245  -2.598  1.00 39.53  ? 125  GLY A C   1 
ATOM   915   O  O   . GLY A 1 122 ? -20.906 -24.557  -3.328  1.00 40.48  ? 125  GLY A O   1 
ATOM   916   N  N   . TYR A 1 123 ? -18.942 -23.496  -3.017  1.00 38.64  ? 126  TYR A N   1 
ATOM   917   C  CA  . TYR A 1 123 ? -18.851 -23.042  -4.407  1.00 39.72  ? 126  TYR A CA  1 
ATOM   918   C  C   . TYR A 1 123 ? -18.168 -24.081  -5.274  1.00 37.50  ? 126  TYR A C   1 
ATOM   919   O  O   . TYR A 1 123 ? -17.472 -24.966  -4.770  1.00 33.94  ? 126  TYR A O   1 
ATOM   920   C  CB  . TYR A 1 123 ? -18.076 -21.721  -4.532  1.00 42.20  ? 126  TYR A CB  1 
ATOM   921   C  CG  . TYR A 1 123 ? -18.723 -20.508  -3.910  1.00 46.47  ? 126  TYR A CG  1 
ATOM   922   C  CD1 . TYR A 1 123 ? -19.957 -20.022  -4.363  1.00 48.77  ? 126  TYR A CD1 1 
ATOM   923   C  CD2 . TYR A 1 123 ? -18.081 -19.818  -2.881  1.00 49.19  ? 126  TYR A CD2 1 
ATOM   924   C  CE1 . TYR A 1 123 ? -20.536 -18.892  -3.789  1.00 52.28  ? 126  TYR A CE1 1 
ATOM   925   C  CE2 . TYR A 1 123 ? -18.644 -18.693  -2.303  1.00 51.82  ? 126  TYR A CE2 1 
ATOM   926   C  CZ  . TYR A 1 123 ? -19.867 -18.230  -2.751  1.00 54.43  ? 126  TYR A CZ  1 
ATOM   927   O  OH  . TYR A 1 123 ? -20.402 -17.111  -2.144  1.00 56.94  ? 126  TYR A OH  1 
ATOM   928   N  N   . GLU A 1 124 ? -18.342 -23.939  -6.587  1.00 37.74  ? 127  GLU A N   1 
ATOM   929   C  CA  . GLU A 1 124 ? -17.663 -24.789  -7.566  1.00 38.59  ? 127  GLU A CA  1 
ATOM   930   C  C   . GLU A 1 124 ? -16.166 -24.532  -7.517  1.00 36.20  ? 127  GLU A C   1 
ATOM   931   O  O   . GLU A 1 124 ? -15.719 -23.487  -7.072  1.00 37.45  ? 127  GLU A O   1 
ATOM   932   C  CB  . GLU A 1 124 ? -18.168 -24.517  -8.995  1.00 41.55  ? 127  GLU A CB  1 
ATOM   933   C  CG  . GLU A 1 124 ? -19.679 -24.416  -9.180  1.00 48.69  ? 127  GLU A CG  1 
ATOM   934   C  CD  . GLU A 1 124 ? -20.398 -25.729  -8.925  1.00 55.85  ? 127  GLU A CD  1 
ATOM   935   O  OE1 . GLU A 1 124 ? -20.749 -25.998  -7.753  1.00 58.14  ? 127  GLU A OE1 1 
ATOM   936   O  OE2 . GLU A 1 124 ? -20.625 -26.487  -9.898  1.00 61.33  ? 127  GLU A OE2 1 
ATOM   937   N  N   . GLN A 1 125 ? -15.386 -25.474  -8.007  1.00 34.28  ? 128  GLN A N   1 
ATOM   938   C  CA  . GLN A 1 125 ? -13.951 -25.301  -8.033  1.00 34.18  ? 128  GLN A CA  1 
ATOM   939   C  C   . GLN A 1 125 ? -13.528 -24.315  -9.128  1.00 36.64  ? 128  GLN A C   1 
ATOM   940   O  O   . GLN A 1 125 ? -13.010 -24.716  -10.177 1.00 36.55  ? 128  GLN A O   1 
ATOM   941   C  CB  . GLN A 1 125 ? -13.314 -26.643  -8.288  1.00 32.67  ? 128  GLN A CB  1 
ATOM   942   C  CG  . GLN A 1 125 ? -11.919 -26.761  -7.751  1.00 32.41  ? 128  GLN A CG  1 
ATOM   943   C  CD  . GLN A 1 125 ? -11.466 -28.186  -7.839  1.00 30.48  ? 128  GLN A CD  1 
ATOM   944   O  OE1 . GLN A 1 125 ? -11.005 -28.624  -8.878  1.00 29.71  ? 128  GLN A OE1 1 
ATOM   945   N  NE2 . GLN A 1 125 ? -11.620 -28.923  -6.757  1.00 30.27  ? 128  GLN A NE2 1 
ATOM   946   N  N   . VAL A 1 126 ? -13.745 -23.030  -8.867  1.00 36.57  ? 129  VAL A N   1 
ATOM   947   C  CA  . VAL A 1 126 ? -13.468 -21.977  -9.835  1.00 36.82  ? 129  VAL A CA  1 
ATOM   948   C  C   . VAL A 1 126 ? -12.015 -21.525  -9.752  1.00 39.07  ? 129  VAL A C   1 
ATOM   949   O  O   . VAL A 1 126 ? -11.285 -21.917  -8.840  1.00 37.20  ? 129  VAL A O   1 
ATOM   950   C  CB  . VAL A 1 126 ? -14.412 -20.764  -9.652  1.00 38.15  ? 129  VAL A CB  1 
ATOM   951   C  CG1 . VAL A 1 126 ? -15.867 -21.149  -9.931  1.00 34.41  ? 129  VAL A CG1 1 
ATOM   952   C  CG2 . VAL A 1 126 ? -14.247 -20.143  -8.260  1.00 35.29  ? 129  VAL A CG2 1 
ATOM   953   N  N   . THR A 1 127 ? -11.603 -20.680  -10.697 1.00 40.57  ? 130  THR A N   1 
ATOM   954   C  CA  . THR A 1 127 ? -10.187 -20.352  -10.834 1.00 41.51  ? 130  THR A CA  1 
ATOM   955   C  C   . THR A 1 127 ? -9.956  -18.858  -11.131 1.00 41.99  ? 130  THR A C   1 
ATOM   956   O  O   . THR A 1 127 ? -10.904 -18.119  -11.428 1.00 42.54  ? 130  THR A O   1 
ATOM   957   C  CB  . THR A 1 127 ? -9.522  -21.315  -11.856 1.00 44.22  ? 130  THR A CB  1 
ATOM   958   O  OG1 . THR A 1 127 ? -8.276  -21.794  -11.344 1.00 46.38  ? 130  THR A OG1 1 
ATOM   959   C  CG2 . THR A 1 127 ? -9.348  -20.693  -13.255 1.00 45.85  ? 130  THR A CG2 1 
ATOM   960   N  N   . ASN A 1 128 ? -8.712  -18.411  -10.990 1.00 42.05  ? 131  ASN A N   1 
ATOM   961   C  CA  . ASN A 1 128 ? -8.334  -17.030  -11.290 1.00 43.72  ? 131  ASN A CA  1 
ATOM   962   C  C   . ASN A 1 128 ? -9.294  -15.971  -10.737 1.00 43.97  ? 131  ASN A C   1 
ATOM   963   O  O   . ASN A 1 128 ? -9.491  -15.862  -9.525  1.00 46.54  ? 131  ASN A O   1 
ATOM   964   C  CB  . ASN A 1 128 ? -8.137  -16.851  -12.802 1.00 45.24  ? 131  ASN A CB  1 
ATOM   965   C  CG  . ASN A 1 128 ? -6.915  -17.578  -13.314 1.00 48.83  ? 131  ASN A CG  1 
ATOM   966   O  OD1 . ASN A 1 128 ? -7.026  -18.579  -14.018 1.00 50.94  ? 131  ASN A OD1 1 
ATOM   967   N  ND2 . ASN A 1 128 ? -5.734  -17.089  -12.944 1.00 52.57  ? 131  ASN A ND2 1 
ATOM   968   N  N   . GLU A 1 129 ? -9.905  -15.218  -11.643 1.00 41.91  ? 132  GLU A N   1 
ATOM   969   C  CA  . GLU A 1 129 ? -10.724 -14.068  -11.289 1.00 42.78  ? 132  GLU A CA  1 
ATOM   970   C  C   . GLU A 1 129 ? -12.033 -14.466  -10.615 1.00 39.67  ? 132  GLU A C   1 
ATOM   971   O  O   . GLU A 1 129 ? -12.512 -13.767  -9.720  1.00 38.13  ? 132  GLU A O   1 
ATOM   972   C  CB  . GLU A 1 129 ? -10.956 -13.194  -12.530 1.00 47.23  ? 132  GLU A CB  1 
ATOM   973   C  CG  . GLU A 1 129 ? -9.957  -13.498  -13.649 1.00 51.58  ? 132  GLU A CG  1 
ATOM   974   C  CD  . GLU A 1 129 ? -9.321  -12.259  -14.249 1.00 57.83  ? 132  GLU A CD  1 
ATOM   975   O  OE1 . GLU A 1 129 ? -10.063 -11.408  -14.798 1.00 63.04  ? 132  GLU A OE1 1 
ATOM   976   O  OE2 . GLU A 1 129 ? -8.074  -12.144  -14.188 1.00 55.35  ? 132  GLU A OE2 1 
ATOM   977   N  N   . ASP A 1 130 ? -12.608 -15.585  -11.047 1.00 39.31  ? 133  ASP A N   1 
ATOM   978   C  CA  . ASP A 1 130 ? -13.798 -16.158  -10.402 1.00 39.92  ? 133  ASP A CA  1 
ATOM   979   C  C   . ASP A 1 130 ? -13.521 -16.549  -8.942  1.00 36.39  ? 133  ASP A C   1 
ATOM   980   O  O   . ASP A 1 130 ? -14.363 -16.352  -8.063  1.00 36.69  ? 133  ASP A O   1 
ATOM   981   C  CB  . ASP A 1 130 ? -14.306 -17.370  -11.197 1.00 43.61  ? 133  ASP A CB  1 
ATOM   982   C  CG  . ASP A 1 130 ? -15.167 -16.973  -12.388 1.00 48.04  ? 133  ASP A CG  1 
ATOM   983   O  OD1 . ASP A 1 130 ? -15.583 -17.877  -13.145 1.00 50.59  ? 133  ASP A OD1 1 
ATOM   984   O  OD2 . ASP A 1 130 ? -15.436 -15.762  -12.566 1.00 49.13  ? 133  ASP A OD2 1 
ATOM   985   N  N   . LEU A 1 131 ? -12.327 -17.084  -8.698  1.00 32.82  ? 134  LEU A N   1 
ATOM   986   C  CA  . LEU A 1 131 ? -11.892 -17.428  -7.341  1.00 31.66  ? 134  LEU A CA  1 
ATOM   987   C  C   . LEU A 1 131 ? -11.755 -16.166  -6.488  1.00 30.15  ? 134  LEU A C   1 
ATOM   988   O  O   . LEU A 1 131 ? -12.289 -16.093  -5.371  1.00 27.27  ? 134  LEU A O   1 
ATOM   989   C  CB  . LEU A 1 131 ? -10.575 -18.221  -7.366  1.00 28.52  ? 134  LEU A CB  1 
ATOM   990   C  CG  . LEU A 1 131 ? -10.184 -18.811  -6.012  1.00 28.72  ? 134  LEU A CG  1 
ATOM   991   C  CD1 . LEU A 1 131 ? -11.325 -19.659  -5.461  1.00 27.44  ? 134  LEU A CD1 1 
ATOM   992   C  CD2 . LEU A 1 131 ? -8.893  -19.612  -6.122  1.00 27.84  ? 134  LEU A CD2 1 
ATOM   993   N  N   . LEU A 1 132 ? -11.051 -15.176  -7.033  1.00 31.00  ? 135  LEU A N   1 
ATOM   994   C  CA  . LEU A 1 132 ? -10.911 -13.869  -6.372  1.00 31.25  ? 135  LEU A CA  1 
ATOM   995   C  C   . LEU A 1 132 ? -12.270 -13.271  -5.996  1.00 30.43  ? 135  LEU A C   1 
ATOM   996   O  O   . LEU A 1 132 ? -12.436 -12.742  -4.893  1.00 31.08  ? 135  LEU A O   1 
ATOM   997   C  CB  . LEU A 1 132 ? -10.080 -12.896  -7.219  1.00 30.47  ? 135  LEU A CB  1 
ATOM   998   C  CG  . LEU A 1 132 ? -9.910  -11.472  -6.668  1.00 33.10  ? 135  LEU A CG  1 
ATOM   999   C  CD1 . LEU A 1 132 ? -9.254  -11.497  -5.279  1.00 30.91  ? 135  LEU A CD1 1 
ATOM   1000  C  CD2 . LEU A 1 132 ? -9.139  -10.578  -7.649  1.00 29.80  ? 135  LEU A CD2 1 
ATOM   1001  N  N   . THR A 1 133 ? -13.248 -13.402  -6.886  1.00 28.83  ? 136  THR A N   1 
ATOM   1002  C  CA  . THR A 1 133 ? -14.577 -12.847  -6.647  1.00 28.73  ? 136  THR A CA  1 
ATOM   1003  C  C   . THR A 1 133 ? -15.313 -13.593  -5.544  1.00 30.01  ? 136  THR A C   1 
ATOM   1004  O  O   . THR A 1 133 ? -15.981 -12.975  -4.697  1.00 31.25  ? 136  THR A O   1 
ATOM   1005  C  CB  . THR A 1 133 ? -15.426 -12.875  -7.932  1.00 28.77  ? 136  THR A CB  1 
ATOM   1006  O  OG1 . THR A 1 133 ? -14.810 -12.036  -8.920  1.00 29.41  ? 136  THR A OG1 1 
ATOM   1007  C  CG2 . THR A 1 133 ? -16.870 -12.393  -7.659  1.00 27.90  ? 136  THR A CG2 1 
ATOM   1008  N  N   . ASN A 1 134 ? -15.207 -14.918  -5.568  1.00 31.14  ? 137  ASN A N   1 
ATOM   1009  C  CA  . ASN A 1 134 ? -15.842 -15.761  -4.555  1.00 33.18  ? 137  ASN A CA  1 
ATOM   1010  C  C   . ASN A 1 134 ? -15.313 -15.514  -3.134  1.00 31.94  ? 137  ASN A C   1 
ATOM   1011  O  O   . ASN A 1 134 ? -16.094 -15.395  -2.180  1.00 32.65  ? 137  ASN A O   1 
ATOM   1012  C  CB  . ASN A 1 134 ? -15.715 -17.243  -4.935  1.00 35.20  ? 137  ASN A CB  1 
ATOM   1013  C  CG  . ASN A 1 134 ? -16.766 -17.687  -5.943  1.00 36.91  ? 137  ASN A CG  1 
ATOM   1014  O  OD1 . ASN A 1 134 ? -17.791 -17.028  -6.120  1.00 39.15  ? 137  ASN A OD1 1 
ATOM   1015  N  ND2 . ASN A 1 134 ? -16.520 -18.814  -6.600  1.00 34.42  ? 137  ASN A ND2 1 
ATOM   1016  N  N   . CYS A 1 135 ? -13.992 -15.408  -3.005  1.00 31.12  ? 138  CYS A N   1 
ATOM   1017  C  CA  . CYS A 1 135 ? -13.355 -15.181  -1.699  1.00 28.26  ? 138  CYS A CA  1 
ATOM   1018  C  C   . CYS A 1 135 ? -13.653 -13.783  -1.142  1.00 29.41  ? 138  CYS A C   1 
ATOM   1019  O  O   . CYS A 1 135 ? -13.735 -13.576  0.094   1.00 29.76  ? 138  CYS A O   1 
ATOM   1020  C  CB  . CYS A 1 135 ? -11.850 -15.409  -1.801  1.00 26.03  ? 138  CYS A CB  1 
ATOM   1021  S  SG  . CYS A 1 135 ? -11.435 -17.109  -2.248  1.00 27.39  ? 138  CYS A SG  1 
ATOM   1022  N  N   . THR A 1 136 ? -13.800 -12.828  -2.056  1.00 27.23  ? 139  THR A N   1 
ATOM   1023  C  CA  . THR A 1 136 ? -14.199 -11.477  -1.697  1.00 28.22  ? 139  THR A CA  1 
ATOM   1024  C  C   . THR A 1 136 ? -15.633 -11.472  -1.148  1.00 28.59  ? 139  THR A C   1 
ATOM   1025  O  O   . THR A 1 136 ? -15.947 -10.754  -0.182  1.00 28.90  ? 139  THR A O   1 
ATOM   1026  C  CB  . THR A 1 136 ? -14.077 -10.529  -2.913  1.00 27.27  ? 139  THR A CB  1 
ATOM   1027  O  OG1 . THR A 1 136 ? -12.720 -10.541  -3.404  1.00 25.48  ? 139  THR A OG1 1 
ATOM   1028  C  CG2 . THR A 1 136 ? -14.462 -9.119   -2.517  1.00 26.27  ? 139  THR A CG2 1 
ATOM   1029  N  N   . LEU A 1 137 ? -16.487 -12.283  -1.773  1.00 29.34  ? 140  LEU A N   1 
ATOM   1030  C  CA  . LEU A 1 137 ? -17.879 -12.441  -1.365  1.00 29.96  ? 140  LEU A CA  1 
ATOM   1031  C  C   . LEU A 1 137 ? -17.963 -13.062  0.014   1.00 30.48  ? 140  LEU A C   1 
ATOM   1032  O  O   . LEU A 1 137 ? -18.825 -12.690  0.808   1.00 31.76  ? 140  LEU A O   1 
ATOM   1033  C  CB  . LEU A 1 137 ? -18.632 -13.304  -2.374  1.00 32.05  ? 140  LEU A CB  1 
ATOM   1034  C  CG  . LEU A 1 137 ? -19.175 -12.537  -3.576  1.00 33.55  ? 140  LEU A CG  1 
ATOM   1035  C  CD1 . LEU A 1 137 ? -19.480 -13.474  -4.739  1.00 32.31  ? 140  LEU A CD1 1 
ATOM   1036  C  CD2 . LEU A 1 137 ? -20.402 -11.755  -3.136  1.00 33.50  ? 140  LEU A CD2 1 
ATOM   1037  N  N   . LEU A 1 138 ? -17.061 -14.001  0.297   1.00 29.65  ? 141  LEU A N   1 
ATOM   1038  C  CA  . LEU A 1 138 ? -16.903 -14.522  1.658   1.00 29.47  ? 141  LEU A CA  1 
ATOM   1039  C  C   . LEU A 1 138 ? -16.547 -13.407  2.633   1.00 28.07  ? 141  LEU A C   1 
ATOM   1040  O  O   . LEU A 1 138 ? -17.182 -13.275  3.656   1.00 30.06  ? 141  LEU A O   1 
ATOM   1041  C  CB  . LEU A 1 138 ? -15.873 -15.664  1.714   1.00 28.31  ? 141  LEU A CB  1 
ATOM   1042  C  CG  . LEU A 1 138 ? -16.320 -16.904  0.922   1.00 30.18  ? 141  LEU A CG  1 
ATOM   1043  C  CD1 . LEU A 1 138 ? -15.297 -18.037  0.992   1.00 29.93  ? 141  LEU A CD1 1 
ATOM   1044  C  CD2 . LEU A 1 138 ? -17.685 -17.371  1.406   1.00 29.31  ? 141  LEU A CD2 1 
ATOM   1045  N  N   . LEU A 1 139 ? -15.548 -12.596  2.311   1.00 27.17  ? 142  LEU A N   1 
ATOM   1046  C  CA  . LEU A 1 139 ? -15.213 -11.458  3.160   1.00 27.92  ? 142  LEU A CA  1 
ATOM   1047  C  C   . LEU A 1 139 ? -16.424 -10.530  3.338   1.00 29.84  ? 142  LEU A C   1 
ATOM   1048  O  O   . LEU A 1 139 ? -16.738 -10.142  4.460   1.00 29.58  ? 142  LEU A O   1 
ATOM   1049  C  CB  . LEU A 1 139 ? -13.984 -10.709  2.629   1.00 27.26  ? 142  LEU A CB  1 
ATOM   1050  C  CG  . LEU A 1 139 ? -13.671 -9.322   3.226   1.00 27.46  ? 142  LEU A CG  1 
ATOM   1051  C  CD1 . LEU A 1 139 ? -13.538 -9.334   4.755   1.00 26.67  ? 142  LEU A CD1 1 
ATOM   1052  C  CD2 . LEU A 1 139 ? -12.410 -8.770   2.576   1.00 26.32  ? 142  LEU A CD2 1 
ATOM   1053  N  N   . CYS A 1 140 ? -17.133 -10.224  2.255   1.00 30.48  ? 143  CYS A N   1 
ATOM   1054  C  CA  . CYS A 1 140 ? -18.357 -9.415   2.357   1.00 34.02  ? 143  CYS A CA  1 
ATOM   1055  C  C   . CYS A 1 140 ? -19.430 -9.988   3.275   1.00 36.57  ? 143  CYS A C   1 
ATOM   1056  O  O   . CYS A 1 140 ? -20.137 -9.233   3.945   1.00 38.37  ? 143  CYS A O   1 
ATOM   1057  C  CB  . CYS A 1 140 ? -18.950 -9.132   0.973   1.00 34.27  ? 143  CYS A CB  1 
ATOM   1058  S  SG  . CYS A 1 140 ? -17.866 -8.030   0.039   1.00 37.89  ? 143  CYS A SG  1 
ATOM   1059  N  N   . ARG A 1 141 ? -19.547 -11.314  3.309   1.00 38.63  ? 144  ARG A N   1 
ATOM   1060  C  CA  . ARG A 1 141 ? -20.529 -11.987  4.164   1.00 38.19  ? 144  ARG A CA  1 
ATOM   1061  C  C   . ARG A 1 141 ? -20.120 -12.042  5.631   1.00 36.76  ? 144  ARG A C   1 
ATOM   1062  O  O   . ARG A 1 141 ? -20.962 -12.262  6.499   1.00 36.49  ? 144  ARG A O   1 
ATOM   1063  C  CB  . ARG A 1 141 ? -20.831 -13.381  3.625   1.00 40.66  ? 144  ARG A CB  1 
ATOM   1064  C  CG  . ARG A 1 141 ? -22.019 -13.383  2.692   1.00 46.39  ? 144  ARG A CG  1 
ATOM   1065  C  CD  . ARG A 1 141 ? -22.045 -14.612  1.805   1.00 52.22  ? 144  ARG A CD  1 
ATOM   1066  N  NE  . ARG A 1 141 ? -23.060 -14.437  0.767   1.00 58.15  ? 144  ARG A NE  1 
ATOM   1067  C  CZ  . ARG A 1 141 ? -22.797 -14.168  -0.511  1.00 61.34  ? 144  ARG A CZ  1 
ATOM   1068  N  NH1 . ARG A 1 141 ? -21.541 -14.068  -0.930  1.00 62.71  ? 144  ARG A NH1 1 
ATOM   1069  N  NH2 . ARG A 1 141 ? -23.795 -14.013  -1.374  1.00 61.79  ? 144  ARG A NH2 1 
ATOM   1070  N  N   . ARG A 1 142 ? -18.823 -11.864  5.895   1.00 35.66  ? 145  ARG A N   1 
ATOM   1071  C  CA  . ARG A 1 142 ? -18.296 -11.611  7.252   1.00 33.36  ? 145  ARG A CA  1 
ATOM   1072  C  C   . ARG A 1 142 ? -18.210 -12.803  8.241   1.00 32.73  ? 145  ARG A C   1 
ATOM   1073  O  O   . ARG A 1 142 ? -17.745 -12.634  9.381   1.00 31.75  ? 145  ARG A O   1 
ATOM   1074  C  CB  . ARG A 1 142 ? -19.040 -10.435  7.908   1.00 33.44  ? 145  ARG A CB  1 
ATOM   1075  C  CG  . ARG A 1 142 ? -18.769 -9.058   7.308   1.00 33.24  ? 145  ARG A CG  1 
ATOM   1076  C  CD  . ARG A 1 142 ? -19.649 -8.008   7.986   1.00 34.38  ? 145  ARG A CD  1 
ATOM   1077  N  NE  . ARG A 1 142 ? -19.068 -6.659   7.961   1.00 34.97  ? 145  ARG A NE  1 
ATOM   1078  C  CZ  . ARG A 1 142 ? -19.284 -5.748   7.010   1.00 34.15  ? 145  ARG A CZ  1 
ATOM   1079  N  NH1 . ARG A 1 142 ? -20.068 -6.020   5.978   1.00 33.42  ? 145  ARG A NH1 1 
ATOM   1080  N  NH2 . ARG A 1 142 ? -18.708 -4.555   7.092   1.00 35.67  ? 145  ARG A NH2 1 
ATOM   1081  N  N   . LEU A 1 143 ? -18.637 -13.993  7.820   1.00 30.96  ? 146  LEU A N   1 
ATOM   1082  C  CA  . LEU A 1 143 ? -18.539 -15.185  8.683   1.00 31.76  ? 146  LEU A CA  1 
ATOM   1083  C  C   . LEU A 1 143 ? -17.101 -15.612  8.940   1.00 31.78  ? 146  LEU A C   1 
ATOM   1084  O  O   . LEU A 1 143 ? -16.240 -15.507  8.073   1.00 31.93  ? 146  LEU A O   1 
ATOM   1085  C  CB  . LEU A 1 143 ? -19.333 -16.360  8.112   1.00 30.65  ? 146  LEU A CB  1 
ATOM   1086  C  CG  . LEU A 1 143 ? -20.834 -16.139  7.868   1.00 31.60  ? 146  LEU A CG  1 
ATOM   1087  C  CD1 . LEU A 1 143 ? -21.553 -17.454  7.550   1.00 30.31  ? 146  LEU A CD1 1 
ATOM   1088  C  CD2 . LEU A 1 143 ? -21.499 -15.414  9.036   1.00 30.50  ? 146  LEU A CD2 1 
ATOM   1089  N  N   . LEU A 1 144 ? -16.859 -16.102  10.146  1.00 32.85  ? 147  LEU A N   1 
ATOM   1090  C  CA  . LEU A 1 144 ? -15.535 -16.484  10.607  1.00 32.57  ? 147  LEU A CA  1 
ATOM   1091  C  C   . LEU A 1 144 ? -15.556 -17.948  11.030  1.00 31.91  ? 147  LEU A C   1 
ATOM   1092  O  O   . LEU A 1 144 ? -16.551 -18.392  11.592  1.00 32.36  ? 147  LEU A O   1 
ATOM   1093  C  CB  . LEU A 1 144 ? -15.155 -15.599  11.797  1.00 33.67  ? 147  LEU A CB  1 
ATOM   1094  C  CG  . LEU A 1 144 ? -14.294 -14.341  11.621  1.00 35.69  ? 147  LEU A CG  1 
ATOM   1095  C  CD1 . LEU A 1 144 ? -14.206 -13.818  10.187  1.00 36.67  ? 147  LEU A CD1 1 
ATOM   1096  C  CD2 . LEU A 1 144 ? -14.729 -13.243  12.576  1.00 33.63  ? 147  LEU A CD2 1 
ATOM   1097  N  N   . SER A 1 145 ? -14.474 -18.681  10.736  1.00 31.98  ? 148  SER A N   1 
ATOM   1098  C  CA  . SER A 1 145 ? -14.251 -20.083  11.161  1.00 30.78  ? 148  SER A CA  1 
ATOM   1099  C  C   . SER A 1 145 ? -12.861 -20.191  11.775  1.00 30.52  ? 148  SER A C   1 
ATOM   1100  O  O   . SER A 1 145 ? -11.932 -19.580  11.261  1.00 29.94  ? 148  SER A O   1 
ATOM   1101  C  CB  . SER A 1 145 ? -14.235 -21.030  9.954   1.00 32.19  ? 148  SER A CB  1 
ATOM   1102  O  OG  . SER A 1 145 ? -15.527 -21.282  9.436   1.00 34.45  ? 148  SER A OG  1 
ATOM   1103  N  N   . PRO A 1 146 ? -12.688 -20.997  12.847  1.00 30.03  ? 149  PRO A N   1 
ATOM   1104  C  CA  . PRO A 1 146 ? -11.318 -21.237  13.338  1.00 28.59  ? 149  PRO A CA  1 
ATOM   1105  C  C   . PRO A 1 146 ? -10.578 -22.344  12.545  1.00 27.65  ? 149  PRO A C   1 
ATOM   1106  O  O   . PRO A 1 146 ? -11.203 -23.278  12.078  1.00 27.66  ? 149  PRO A O   1 
ATOM   1107  C  CB  . PRO A 1 146 ? -11.556 -21.672  14.787  1.00 28.70  ? 149  PRO A CB  1 
ATOM   1108  C  CG  . PRO A 1 146 ? -12.878 -22.365  14.737  1.00 29.09  ? 149  PRO A CG  1 
ATOM   1109  C  CD  . PRO A 1 146 ? -13.702 -21.613  13.727  1.00 28.68  ? 149  PRO A CD  1 
ATOM   1110  N  N   . MET A 1 147 ? -9.260  -22.230  12.412  1.00 26.24  ? 150  MET A N   1 
ATOM   1111  C  CA  . MET A 1 147 ? -8.472  -23.163  11.627  1.00 26.03  ? 150  MET A CA  1 
ATOM   1112  C  C   . MET A 1 147 ? -7.302  -23.702  12.414  1.00 24.58  ? 150  MET A C   1 
ATOM   1113  O  O   . MET A 1 147 ? -6.748  -23.025  13.278  1.00 25.18  ? 150  MET A O   1 
ATOM   1114  C  CB  . MET A 1 147 ? -7.907  -22.498  10.360  1.00 29.70  ? 150  MET A CB  1 
ATOM   1115  C  CG  . MET A 1 147 ? -8.872  -21.550  9.659   1.00 32.49  ? 150  MET A CG  1 
ATOM   1116  S  SD  . MET A 1 147 ? -9.975  -22.289  8.444   1.00 37.03  ? 150  MET A SD  1 
ATOM   1117  C  CE  . MET A 1 147 ? -10.711 -23.704  9.232   1.00 35.16  ? 150  MET A CE  1 
ATOM   1118  N  N   . ASN A 1 148 ? -6.899  -24.912  12.063  1.00 23.47  ? 151  ASN A N   1 
ATOM   1119  C  CA  . ASN A 1 148 ? -5.724  -25.534  12.636  1.00 23.00  ? 151  ASN A CA  1 
ATOM   1120  C  C   . ASN A 1 148 ? -4.431  -24.844  12.193  1.00 23.21  ? 151  ASN A C   1 
ATOM   1121  O  O   . ASN A 1 148 ? -4.381  -24.222  11.119  1.00 23.03  ? 151  ASN A O   1 
ATOM   1122  C  CB  . ASN A 1 148 ? -5.737  -27.024  12.302  1.00 22.26  ? 151  ASN A CB  1 
ATOM   1123  C  CG  . ASN A 1 148 ? -6.937  -27.753  12.906  1.00 22.74  ? 151  ASN A CG  1 
ATOM   1124  O  OD1 . ASN A 1 148 ? -7.344  -27.497  14.050  1.00 23.38  ? 151  ASN A OD1 1 
ATOM   1125  N  ND2 . ASN A 1 148 ? -7.498  -28.681  12.150  1.00 21.97  ? 151  ASN A ND2 1 
ATOM   1126  N  N   . LEU A 1 149 ? -3.399  -24.922  13.030  1.00 23.63  ? 152  LEU A N   1 
ATOM   1127  C  CA  . LEU A 1 149 ? -2.080  -24.378  12.689  1.00 24.56  ? 152  LEU A CA  1 
ATOM   1128  C  C   . LEU A 1 149 ? -1.081  -25.484  12.874  1.00 24.85  ? 152  LEU A C   1 
ATOM   1129  O  O   . LEU A 1 149 ? -1.173  -26.235  13.827  1.00 26.09  ? 152  LEU A O   1 
ATOM   1130  C  CB  . LEU A 1 149 ? -1.673  -23.251  13.652  1.00 24.80  ? 152  LEU A CB  1 
ATOM   1131  C  CG  . LEU A 1 149 ? -1.089  -21.889  13.239  1.00 27.12  ? 152  LEU A CG  1 
ATOM   1132  C  CD1 . LEU A 1 149 ? -0.312  -21.246  14.395  1.00 26.31  ? 152  LEU A CD1 1 
ATOM   1133  C  CD2 . LEU A 1 149 ? -0.251  -21.893  11.971  1.00 26.73  ? 152  LEU A CD2 1 
ATOM   1134  N  N   . LEU A 1 150 ? -0.086  -25.546  12.003  1.00 26.22  ? 153  LEU A N   1 
ATOM   1135  C  CA  . LEU A 1 150 ? 0.970   -26.532  12.130  1.00 26.31  ? 153  LEU A CA  1 
ATOM   1136  C  C   . LEU A 1 150 ? 2.231   -25.889  12.689  1.00 25.67  ? 153  LEU A C   1 
ATOM   1137  O  O   . LEU A 1 150 ? 2.767   -24.936  12.113  1.00 23.92  ? 153  LEU A O   1 
ATOM   1138  C  CB  . LEU A 1 150 ? 1.297   -27.116  10.760  1.00 26.12  ? 153  LEU A CB  1 
ATOM   1139  C  CG  . LEU A 1 150 ? 1.729   -28.569  10.604  1.00 27.34  ? 153  LEU A CG  1 
ATOM   1140  C  CD1 . LEU A 1 150 ? 2.598   -28.674  9.353   1.00 27.13  ? 153  LEU A CD1 1 
ATOM   1141  C  CD2 . LEU A 1 150 ? 2.397   -29.185  11.821  1.00 25.51  ? 153  LEU A CD2 1 
ATOM   1142  N  N   . SER A 1 151 ? 2.713   -26.441  13.797  1.00 26.47  ? 154  SER A N   1 
ATOM   1143  C  CA  . SER A 1 151 ? 3.993   -26.031  14.360  1.00 26.08  ? 154  SER A CA  1 
ATOM   1144  C  C   . SER A 1 151 ? 5.097   -27.007  13.924  1.00 26.13  ? 154  SER A C   1 
ATOM   1145  O  O   . SER A 1 151 ? 4.942   -28.218  14.075  1.00 27.17  ? 154  SER A O   1 
ATOM   1146  C  CB  . SER A 1 151 ? 3.908   -25.965  15.876  1.00 24.61  ? 154  SER A CB  1 
ATOM   1147  O  OG  . SER A 1 151 ? 5.174   -25.638  16.398  1.00 26.03  ? 154  SER A OG  1 
ATOM   1148  N  N   . LEU A 1 152 ? 6.197   -26.475  13.390  1.00 24.75  ? 155  LEU A N   1 
ATOM   1149  C  CA  . LEU A 1 152 ? 7.280   -27.287  12.849  1.00 24.69  ? 155  LEU A CA  1 
ATOM   1150  C  C   . LEU A 1 152 ? 8.598   -26.940  13.502  1.00 25.68  ? 155  LEU A C   1 
ATOM   1151  O  O   . LEU A 1 152 ? 8.815   -25.793  13.880  1.00 23.97  ? 155  LEU A O   1 
ATOM   1152  C  CB  . LEU A 1 152 ? 7.441   -27.031  11.365  1.00 23.71  ? 155  LEU A CB  1 
ATOM   1153  C  CG  . LEU A 1 152 ? 6.257   -27.311  10.454  1.00 25.31  ? 155  LEU A CG  1 
ATOM   1154  C  CD1 . LEU A 1 152 ? 6.492   -26.638  9.099   1.00 24.72  ? 155  LEU A CD1 1 
ATOM   1155  C  CD2 . LEU A 1 152 ? 6.052   -28.816  10.308  1.00 23.08  ? 155  LEU A CD2 1 
ATOM   1156  N  N   . HIS A 1 153 ? 9.471   -27.944  13.598  1.00 26.37  ? 156  HIS A N   1 
ATOM   1157  C  CA  . HIS A 1 153 ? 10.803  -27.818  14.171  1.00 26.89  ? 156  HIS A CA  1 
ATOM   1158  C  C   . HIS A 1 153 ? 11.722  -28.453  13.192  1.00 28.62  ? 156  HIS A C   1 
ATOM   1159  O  O   . HIS A 1 153 ? 11.367  -29.441  12.547  1.00 29.20  ? 156  HIS A O   1 
ATOM   1160  C  CB  . HIS A 1 153 ? 10.904  -28.584  15.490  1.00 27.75  ? 156  HIS A CB  1 
ATOM   1161  C  CG  . HIS A 1 153 ? 10.057  -28.012  16.604  1.00 28.51  ? 156  HIS A CG  1 
ATOM   1162  N  ND1 . HIS A 1 153 ? 10.548  -27.159  17.521  1.00 30.26  ? 156  HIS A ND1 1 
ATOM   1163  C  CD2 . HIS A 1 153 ? 8.711   -28.200  16.926  1.00 29.26  ? 156  HIS A CD2 1 
ATOM   1164  C  CE1 . HIS A 1 153 ? 9.567   -26.819  18.397  1.00 29.43  ? 156  HIS A CE1 1 
ATOM   1165  N  NE2 . HIS A 1 153 ? 8.448   -27.454  18.033  1.00 29.05  ? 156  HIS A NE2 1 
ATOM   1166  N  N   . THR A 1 154 ? 12.919  -27.899  13.069  1.00 28.72  ? 157  THR A N   1 
ATOM   1167  C  CA  . THR A 1 154 ? 13.884  -28.357  12.099  1.00 28.94  ? 157  THR A CA  1 
ATOM   1168  C  C   . THR A 1 154 ? 15.164  -28.664  12.844  1.00 28.91  ? 157  THR A C   1 
ATOM   1169  O  O   . THR A 1 154 ? 15.417  -28.088  13.896  1.00 28.27  ? 157  THR A O   1 
ATOM   1170  C  CB  . THR A 1 154 ? 14.153  -27.290  11.004  1.00 29.81  ? 157  THR A CB  1 
ATOM   1171  O  OG1 . THR A 1 154 ? 14.913  -26.200  11.549  1.00 29.79  ? 157  THR A OG1 1 
ATOM   1172  C  CG2 . THR A 1 154 ? 12.844  -26.761  10.401  1.00 29.55  ? 157  THR A CG2 1 
ATOM   1173  N  N   . ALA A 1 155 ? 15.979  -29.549  12.282  1.00 31.36  ? 158  ALA A N   1 
ATOM   1174  C  CA  . ALA A 1 155 ? 17.200  -30.028  12.947  1.00 35.17  ? 158  ALA A CA  1 
ATOM   1175  C  C   . ALA A 1 155 ? 18.154  -28.906  13.356  1.00 37.94  ? 158  ALA A C   1 
ATOM   1176  O  O   . ALA A 1 155 ? 18.889  -29.051  14.324  1.00 37.26  ? 158  ALA A O   1 
ATOM   1177  C  CB  . ALA A 1 155 ? 17.923  -31.035  12.069  1.00 34.76  ? 158  ALA A CB  1 
ATOM   1178  N  N   . SER A 1 156 ? 18.134  -27.793  12.619  1.00 38.82  ? 159  SER A N   1 
ATOM   1179  C  CA  . SER A 1 156 ? 18.983  -26.655  12.942  1.00 40.35  ? 159  SER A CA  1 
ATOM   1180  C  C   . SER A 1 156 ? 18.436  -25.857  14.123  1.00 39.51  ? 159  SER A C   1 
ATOM   1181  O  O   . SER A 1 156 ? 19.120  -24.995  14.642  1.00 40.60  ? 159  SER A O   1 
ATOM   1182  C  CB  . SER A 1 156 ? 19.166  -25.746  11.722  1.00 40.93  ? 159  SER A CB  1 
ATOM   1183  O  OG  . SER A 1 156 ? 17.960  -25.049  11.438  1.00 43.96  ? 159  SER A OG  1 
ATOM   1184  N  N   . GLY A 1 157 ? 17.204  -26.144  14.537  1.00 39.95  ? 160  GLY A N   1 
ATOM   1185  C  CA  . GLY A 1 157 ? 16.620  -25.503  15.714  1.00 37.83  ? 160  GLY A CA  1 
ATOM   1186  C  C   . GLY A 1 157 ? 15.590  -24.426  15.417  1.00 39.90  ? 160  GLY A C   1 
ATOM   1187  O  O   . GLY A 1 157 ? 15.084  -23.779  16.334  1.00 40.33  ? 160  GLY A O   1 
ATOM   1188  N  N   . LEU A 1 158 ? 15.265  -24.235  14.140  1.00 38.47  ? 161  LEU A N   1 
ATOM   1189  C  CA  . LEU A 1 158 ? 14.233  -23.276  13.754  1.00 37.85  ? 161  LEU A CA  1 
ATOM   1190  C  C   . LEU A 1 158 ? 12.840  -23.806  14.082  1.00 36.70  ? 161  LEU A C   1 
ATOM   1191  O  O   . LEU A 1 158 ? 12.524  -24.961  13.808  1.00 36.90  ? 161  LEU A O   1 
ATOM   1192  C  CB  . LEU A 1 158 ? 14.330  -22.950  12.266  1.00 38.58  ? 161  LEU A CB  1 
ATOM   1193  C  CG  . LEU A 1 158 ? 13.499  -21.779  11.718  1.00 43.65  ? 161  LEU A CG  1 
ATOM   1194  C  CD1 . LEU A 1 158 ? 13.940  -20.426  12.286  1.00 41.56  ? 161  LEU A CD1 1 
ATOM   1195  C  CD2 . LEU A 1 158 ? 13.577  -21.770  10.197  1.00 41.60  ? 161  LEU A CD2 1 
ATOM   1196  N  N   . ARG A 1 159 ? 12.021  -22.956  14.687  1.00 34.29  ? 162  ARG A N   1 
ATOM   1197  C  CA  . ARG A 1 159 ? 10.623  -23.258  14.908  1.00 32.34  ? 162  ARG A CA  1 
ATOM   1198  C  C   . ARG A 1 159 ? 9.797   -22.296  14.068  1.00 31.81  ? 162  ARG A C   1 
ATOM   1199  O  O   . ARG A 1 159 ? 9.990   -21.087  14.125  1.00 31.67  ? 162  ARG A O   1 
ATOM   1200  C  CB  . ARG A 1 159 ? 10.272  -23.106  16.380  1.00 32.73  ? 162  ARG A CB  1 
ATOM   1201  C  CG  . ARG A 1 159 ? 9.010   -23.837  16.793  1.00 32.98  ? 162  ARG A CG  1 
ATOM   1202  C  CD  . ARG A 1 159 ? 7.855   -22.894  17.094  1.00 32.54  ? 162  ARG A CD  1 
ATOM   1203  N  NE  . ARG A 1 159 ? 6.693   -23.651  17.557  1.00 33.01  ? 162  ARG A NE  1 
ATOM   1204  C  CZ  . ARG A 1 159 ? 6.207   -23.650  18.802  1.00 32.32  ? 162  ARG A CZ  1 
ATOM   1205  N  NH1 . ARG A 1 159 ? 6.745   -22.896  19.756  1.00 32.39  ? 162  ARG A NH1 1 
ATOM   1206  N  NH2 . ARG A 1 159 ? 5.146   -24.392  19.087  1.00 29.98  ? 162  ARG A NH2 1 
ATOM   1207  N  N   . LEU A 1 160 ? 8.881   -22.838  13.276  1.00 30.64  ? 163  LEU A N   1 
ATOM   1208  C  CA  . LEU A 1 160 ? 8.042   -22.010  12.407  1.00 28.36  ? 163  LEU A CA  1 
ATOM   1209  C  C   . LEU A 1 160 ? 6.626   -22.574  12.334  1.00 27.15  ? 163  LEU A C   1 
ATOM   1210  O  O   . LEU A 1 160 ? 6.342   -23.650  12.885  1.00 25.40  ? 163  LEU A O   1 
ATOM   1211  C  CB  . LEU A 1 160 ? 8.661   -21.897  11.004  1.00 27.51  ? 163  LEU A CB  1 
ATOM   1212  C  CG  . LEU A 1 160 ? 8.652   -23.092  10.040  1.00 27.11  ? 163  LEU A CG  1 
ATOM   1213  C  CD1 . LEU A 1 160 ? 8.857   -22.545  8.639   1.00 27.30  ? 163  LEU A CD1 1 
ATOM   1214  C  CD2 . LEU A 1 160 ? 9.717   -24.141  10.348  1.00 26.26  ? 163  LEU A CD2 1 
ATOM   1215  N  N   . PHE A 1 161 ? 5.744   -21.846  11.658  1.00 24.67  ? 164  PHE A N   1 
ATOM   1216  C  CA  . PHE A 1 161 ? 4.356   -22.252  11.577  1.00 24.68  ? 164  PHE A CA  1 
ATOM   1217  C  C   . PHE A 1 161 ? 3.909   -22.372  10.131  1.00 24.83  ? 164  PHE A C   1 
ATOM   1218  O  O   . PHE A 1 161 ? 4.411   -21.668  9.239   1.00 24.25  ? 164  PHE A O   1 
ATOM   1219  C  CB  . PHE A 1 161 ? 3.451   -21.331  12.402  1.00 24.16  ? 164  PHE A CB  1 
ATOM   1220  C  CG  . PHE A 1 161 ? 3.844   -21.250  13.854  1.00 24.77  ? 164  PHE A CG  1 
ATOM   1221  C  CD1 . PHE A 1 161 ? 3.318   -22.141  14.783  1.00 25.56  ? 164  PHE A CD1 1 
ATOM   1222  C  CD2 . PHE A 1 161 ? 4.775   -20.303  14.291  1.00 25.05  ? 164  PHE A CD2 1 
ATOM   1223  C  CE1 . PHE A 1 161 ? 3.695   -22.084  16.120  1.00 25.28  ? 164  PHE A CE1 1 
ATOM   1224  C  CE2 . PHE A 1 161 ? 5.165   -20.241  15.631  1.00 25.47  ? 164  PHE A CE2 1 
ATOM   1225  C  CZ  . PHE A 1 161 ? 4.621   -21.131  16.545  1.00 26.20  ? 164  PHE A CZ  1 
ATOM   1226  N  N   . SER A 1 162 ? 2.973   -23.288  9.917   1.00 23.61  ? 165  SER A N   1 
ATOM   1227  C  CA  . SER A 1 162 ? 2.501   -23.643  8.596   1.00 21.97  ? 165  SER A CA  1 
ATOM   1228  C  C   . SER A 1 162 ? 0.979   -23.575  8.627   1.00 22.03  ? 165  SER A C   1 
ATOM   1229  O  O   . SER A 1 162 ? 0.327   -24.108  9.551   1.00 22.06  ? 165  SER A O   1 
ATOM   1230  C  CB  . SER A 1 162 ? 3.015   -25.048  8.266   1.00 21.69  ? 165  SER A CB  1 
ATOM   1231  O  OG  . SER A 1 162 ? 2.445   -25.607  7.096   1.00 21.50  ? 165  SER A OG  1 
ATOM   1232  N  N   . VAL A 1 163 ? 0.399   -22.862  7.666   1.00 21.06  ? 166  VAL A N   1 
ATOM   1233  C  CA  . VAL A 1 163 ? -1.060  -22.755  7.616   1.00 21.46  ? 166  VAL A CA  1 
ATOM   1234  C  C   . VAL A 1 163 ? -1.701  -23.759  6.638   1.00 21.01  ? 166  VAL A C   1 
ATOM   1235  O  O   . VAL A 1 163 ? -2.908  -23.957  6.658   1.00 21.67  ? 166  VAL A O   1 
ATOM   1236  C  CB  . VAL A 1 163 ? -1.530  -21.313  7.290   1.00 22.05  ? 166  VAL A CB  1 
ATOM   1237  C  CG1 . VAL A 1 163 ? -1.050  -20.353  8.374   1.00 22.45  ? 166  VAL A CG1 1 
ATOM   1238  C  CG2 . VAL A 1 163 ? -1.043  -20.864  5.915   1.00 21.94  ? 166  VAL A CG2 1 
ATOM   1239  N  N   . LEU A 1 164 ? -0.894  -24.404  5.809   1.00 20.45  ? 167  LEU A N   1 
ATOM   1240  C  CA  . LEU A 1 164 ? -1.433  -25.236  4.714   1.00 21.62  ? 167  LEU A CA  1 
ATOM   1241  C  C   . LEU A 1 164 ? -0.789  -26.614  4.558   1.00 20.79  ? 167  LEU A C   1 
ATOM   1242  O  O   . LEU A 1 164 ? -1.464  -27.639  4.681   1.00 21.24  ? 167  LEU A O   1 
ATOM   1243  C  CB  . LEU A 1 164 ? -1.351  -24.481  3.373   1.00 22.73  ? 167  LEU A CB  1 
ATOM   1244  C  CG  . LEU A 1 164 ? -1.875  -25.246  2.164   1.00 24.58  ? 167  LEU A CG  1 
ATOM   1245  C  CD1 . LEU A 1 164 ? -3.391  -25.100  2.056   1.00 24.12  ? 167  LEU A CD1 1 
ATOM   1246  C  CD2 . LEU A 1 164 ? -1.150  -24.732  0.930   1.00 27.25  ? 167  LEU A CD2 1 
ATOM   1247  N  N   . SER A 1 165 ? 0.511   -26.645  4.293   1.00 21.46  ? 168  SER A N   1 
ATOM   1248  C  CA  . SER A 1 165 ? 1.163   -27.897  3.955   1.00 23.55  ? 168  SER A CA  1 
ATOM   1249  C  C   . SER A 1 165 ? 2.646   -27.919  4.248   1.00 24.12  ? 168  SER A C   1 
ATOM   1250  O  O   . SER A 1 165 ? 3.307   -26.887  4.230   1.00 25.11  ? 168  SER A O   1 
ATOM   1251  C  CB  . SER A 1 165 ? 0.950   -28.207  2.458   1.00 23.19  ? 168  SER A CB  1 
ATOM   1252  O  OG  . SER A 1 165 ? 1.306   -27.078  1.651   1.00 23.34  ? 168  SER A OG  1 
ATOM   1253  N  N   . LEU A 1 166 ? 3.147   -29.113  4.542   1.00 25.20  ? 169  LEU A N   1 
ATOM   1254  C  CA  . LEU A 1 166 ? 4.568   -29.418  4.419   1.00 26.41  ? 169  LEU A CA  1 
ATOM   1255  C  C   . LEU A 1 166 ? 4.679   -30.603  3.477   1.00 26.46  ? 169  LEU A C   1 
ATOM   1256  O  O   . LEU A 1 166 ? 4.005   -31.628  3.661   1.00 29.19  ? 169  LEU A O   1 
ATOM   1257  C  CB  . LEU A 1 166 ? 5.252   -29.742  5.759   1.00 28.05  ? 169  LEU A CB  1 
ATOM   1258  C  CG  . LEU A 1 166 ? 6.698   -30.171  5.430   1.00 28.49  ? 169  LEU A CG  1 
ATOM   1259  C  CD1 . LEU A 1 166 ? 7.757   -29.253  5.996   1.00 26.90  ? 169  LEU A CD1 1 
ATOM   1260  C  CD2 . LEU A 1 166 ? 7.004   -31.647  5.712   1.00 28.26  ? 169  LEU A CD2 1 
ATOM   1261  N  N   . ALA A 1 167 ? 5.520   -30.443  2.467   1.00 25.89  ? 170  ALA A N   1 
ATOM   1262  C  CA  . ALA A 1 167 ? 5.631   -31.394  1.381   1.00 26.82  ? 170  ALA A CA  1 
ATOM   1263  C  C   . ALA A 1 167 ? 7.083   -31.738  1.215   1.00 26.37  ? 170  ALA A C   1 
ATOM   1264  O  O   . ALA A 1 167 ? 7.945   -30.884  1.389   1.00 25.10  ? 170  ALA A O   1 
ATOM   1265  C  CB  . ALA A 1 167 ? 5.099   -30.778  0.099   1.00 27.08  ? 170  ALA A CB  1 
ATOM   1266  N  N   . TRP A 1 168 ? 7.348   -32.999  0.892   1.00 26.58  ? 171  TRP A N   1 
ATOM   1267  C  CA  . TRP A 1 168 ? 8.706   -33.463  0.663   1.00 26.57  ? 171  TRP A CA  1 
ATOM   1268  C  C   . TRP A 1 168 ? 8.761   -34.438  -0.481  1.00 28.71  ? 171  TRP A C   1 
ATOM   1269  O  O   . TRP A 1 168 ? 7.810   -35.187  -0.716  1.00 28.40  ? 171  TRP A O   1 
ATOM   1270  C  CB  . TRP A 1 168 ? 9.209   -34.122  1.923   1.00 25.65  ? 171  TRP A CB  1 
ATOM   1271  C  CG  . TRP A 1 168 ? 10.565  -34.734  1.786   1.00 24.29  ? 171  TRP A CG  1 
ATOM   1272  C  CD1 . TRP A 1 168 ? 11.770  -34.077  1.581   1.00 25.16  ? 171  TRP A CD1 1 
ATOM   1273  C  CD2 . TRP A 1 168 ? 10.903  -36.150  1.857   1.00 23.38  ? 171  TRP A CD2 1 
ATOM   1274  N  NE1 . TRP A 1 168 ? 12.804  -34.977  1.529   1.00 25.02  ? 171  TRP A NE1 1 
ATOM   1275  C  CE2 . TRP A 1 168 ? 12.350  -36.234  1.694   1.00 23.91  ? 171  TRP A CE2 1 
ATOM   1276  C  CE3 . TRP A 1 168 ? 10.180  -37.319  2.048   1.00 24.49  ? 171  TRP A CE3 1 
ATOM   1277  C  CZ2 . TRP A 1 168 ? 13.024  -37.445  1.714   1.00 24.90  ? 171  TRP A CZ2 1 
ATOM   1278  C  CZ3 . TRP A 1 168 ? 10.873  -38.538  2.067   1.00 24.11  ? 171  TRP A CZ3 1 
ATOM   1279  C  CH2 . TRP A 1 168 ? 12.257  -38.597  1.902   1.00 23.56  ? 171  TRP A CH2 1 
ATOM   1280  N  N   . GLY A 1 169 ? 9.881   -34.438  -1.198  1.00 29.19  ? 172  GLY A N   1 
ATOM   1281  C  CA  . GLY A 1 169 ? 10.050  -35.305  -2.345  1.00 30.47  ? 172  GLY A CA  1 
ATOM   1282  C  C   . GLY A 1 169 ? 9.508   -34.673  -3.611  1.00 30.14  ? 172  GLY A C   1 
ATOM   1283  O  O   . GLY A 1 169 ? 9.727   -33.481  -3.867  1.00 29.28  ? 172  GLY A O   1 
ATOM   1284  N  N   . PHE A 1 170 ? 8.773   -35.470  -4.384  1.00 30.35  ? 173  PHE A N   1 
ATOM   1285  C  CA  . PHE A 1 170 ? 8.278   -35.069  -5.707  1.00 29.81  ? 173  PHE A CA  1 
ATOM   1286  C  C   . PHE A 1 170 ? 7.600   -33.698  -5.726  1.00 28.99  ? 173  PHE A C   1 
ATOM   1287  O  O   . PHE A 1 170 ? 7.992   -32.821  -6.507  1.00 29.02  ? 173  PHE A O   1 
ATOM   1288  C  CB  . PHE A 1 170 ? 7.348   -36.149  -6.261  1.00 31.68  ? 173  PHE A CB  1 
ATOM   1289  C  CG  . PHE A 1 170 ? 6.950   -35.954  -7.701  1.00 33.09  ? 173  PHE A CG  1 
ATOM   1290  C  CD1 . PHE A 1 170 ? 5.758   -35.303  -8.025  1.00 33.55  ? 173  PHE A CD1 1 
ATOM   1291  C  CD2 . PHE A 1 170 ? 7.745   -36.451  -8.731  1.00 33.26  ? 173  PHE A CD2 1 
ATOM   1292  C  CE1 . PHE A 1 170 ? 5.371   -35.143  -9.344  1.00 33.01  ? 173  PHE A CE1 1 
ATOM   1293  C  CE2 . PHE A 1 170 ? 7.366   -36.294  -10.060 1.00 34.25  ? 173  PHE A CE2 1 
ATOM   1294  C  CZ  . PHE A 1 170 ? 6.177   -35.633  -10.364 1.00 33.77  ? 173  PHE A CZ  1 
ATOM   1295  N  N   . ILE A 1 171 ? 6.597   -33.512  -4.873  1.00 28.30  ? 174  ILE A N   1 
ATOM   1296  C  CA  . ILE A 1 171 ? 5.897   -32.222  -4.767  1.00 28.05  ? 174  ILE A CA  1 
ATOM   1297  C  C   . ILE A 1 171 ? 6.836   -31.053  -4.411  1.00 29.18  ? 174  ILE A C   1 
ATOM   1298  O  O   . ILE A 1 171 ? 6.692   -29.948  -4.940  1.00 27.75  ? 174  ILE A O   1 
ATOM   1299  C  CB  . ILE A 1 171 ? 4.770   -32.285  -3.729  1.00 28.14  ? 174  ILE A CB  1 
ATOM   1300  C  CG1 . ILE A 1 171 ? 3.703   -33.269  -4.170  1.00 26.73  ? 174  ILE A CG1 1 
ATOM   1301  C  CG2 . ILE A 1 171 ? 4.173   -30.896  -3.473  1.00 27.46  ? 174  ILE A CG2 1 
ATOM   1302  C  CD1 . ILE A 1 171 ? 2.525   -33.280  -3.221  1.00 25.92  ? 174  ILE A CD1 1 
ATOM   1303  N  N   . ALA A 1 172 ? 7.797   -31.292  -3.527  1.00 29.96  ? 175  ALA A N   1 
ATOM   1304  C  CA  . ALA A 1 172 ? 8.739   -30.238  -3.177  1.00 33.86  ? 175  ALA A CA  1 
ATOM   1305  C  C   . ALA A 1 172 ? 9.615   -29.900  -4.373  1.00 35.64  ? 175  ALA A C   1 
ATOM   1306  O  O   . ALA A 1 172 ? 9.806   -28.724  -4.699  1.00 39.38  ? 175  ALA A O   1 
ATOM   1307  C  CB  . ALA A 1 172 ? 9.592   -30.628  -1.985  1.00 31.42  ? 175  ALA A CB  1 
ATOM   1308  N  N   . ASP A 1 173 ? 10.130  -30.930  -5.032  1.00 36.56  ? 176  ASP A N   1 
ATOM   1309  C  CA  . ASP A 1 173 ? 11.026  -30.738  -6.165  1.00 39.85  ? 176  ASP A CA  1 
ATOM   1310  C  C   . ASP A 1 173 ? 10.385  -29.906  -7.287  1.00 39.70  ? 176  ASP A C   1 
ATOM   1311  O  O   . ASP A 1 173 ? 11.058  -29.094  -7.923  1.00 38.23  ? 176  ASP A O   1 
ATOM   1312  C  CB  . ASP A 1 173 ? 11.509  -32.086  -6.692  1.00 41.84  ? 176  ASP A CB  1 
ATOM   1313  C  CG  . ASP A 1 173 ? 12.651  -32.661  -5.867  1.00 45.42  ? 176  ASP A CG  1 
ATOM   1314  O  OD1 . ASP A 1 173 ? 12.975  -32.096  -4.793  1.00 49.22  ? 176  ASP A OD1 1 
ATOM   1315  O  OD2 . ASP A 1 173 ? 13.233  -33.683  -6.297  1.00 45.71  ? 176  ASP A OD2 1 
ATOM   1316  N  N   . VAL A 1 174 ? 9.085   -30.117  -7.493  1.00 38.63  ? 177  VAL A N   1 
ATOM   1317  C  CA  . VAL A 1 174 ? 8.314   -29.444  -8.527  1.00 37.45  ? 177  VAL A CA  1 
ATOM   1318  C  C   . VAL A 1 174 ? 7.967   -27.995  -8.128  1.00 39.71  ? 177  VAL A C   1 
ATOM   1319  O  O   . VAL A 1 174 ? 8.050   -27.087  -8.955  1.00 38.10  ? 177  VAL A O   1 
ATOM   1320  C  CB  . VAL A 1 174 ? 7.050   -30.264  -8.887  1.00 35.44  ? 177  VAL A CB  1 
ATOM   1321  C  CG1 . VAL A 1 174 ? 6.055   -29.435  -9.688  1.00 35.34  ? 177  VAL A CG1 1 
ATOM   1322  C  CG2 . VAL A 1 174 ? 7.431   -31.518  -9.661  1.00 31.65  ? 177  VAL A CG2 1 
ATOM   1323  N  N   . ASP A 1 175 ? 7.584   -27.776  -6.869  1.00 40.56  ? 178  ASP A N   1 
ATOM   1324  C  CA  . ASP A 1 175 ? 7.377   -26.412  -6.366  1.00 41.75  ? 178  ASP A CA  1 
ATOM   1325  C  C   . ASP A 1 175 ? 8.625   -25.546  -6.613  1.00 43.61  ? 178  ASP A C   1 
ATOM   1326  O  O   . ASP A 1 175 ? 8.503   -24.395  -7.019  1.00 42.71  ? 178  ASP A O   1 
ATOM   1327  C  CB  . ASP A 1 175 ? 7.023   -26.407  -4.875  1.00 41.30  ? 178  ASP A CB  1 
ATOM   1328  C  CG  . ASP A 1 175 ? 5.589   -26.836  -4.594  1.00 41.99  ? 178  ASP A CG  1 
ATOM   1329  O  OD1 . ASP A 1 175 ? 5.219   -26.819  -3.398  1.00 45.59  ? 178  ASP A OD1 1 
ATOM   1330  O  OD2 . ASP A 1 175 ? 4.830   -27.196  -5.526  1.00 38.82  ? 178  ASP A OD2 1 
ATOM   1331  N  N   . LEU A 1 176 ? 9.813   -26.115  -6.379  1.00 46.74  ? 179  LEU A N   1 
ATOM   1332  C  CA  . LEU A 1 176 ? 11.082  -25.434  -6.647  1.00 50.84  ? 179  LEU A CA  1 
ATOM   1333  C  C   . LEU A 1 176 ? 11.369  -25.331  -8.150  1.00 54.64  ? 179  LEU A C   1 
ATOM   1334  O  O   . LEU A 1 176 ? 11.649  -24.241  -8.645  1.00 54.68  ? 179  LEU A O   1 
ATOM   1335  C  CB  . LEU A 1 176 ? 12.261  -26.125  -5.940  1.00 50.40  ? 179  LEU A CB  1 
ATOM   1336  C  CG  . LEU A 1 176 ? 13.485  -25.320  -5.427  1.00 49.98  ? 179  LEU A CG  1 
ATOM   1337  C  CD1 . LEU A 1 176 ? 14.790  -26.094  -5.610  1.00 45.76  ? 179  LEU A CD1 1 
ATOM   1338  C  CD2 . LEU A 1 176 ? 13.626  -23.900  -5.978  1.00 49.33  ? 179  LEU A CD2 1 
ATOM   1339  N  N   . GLU A 1 177 ? 11.293  -26.456  -8.865  1.00 57.89  ? 180  GLU A N   1 
ATOM   1340  C  CA  . GLU A 1 177 ? 11.590  -26.493  -10.305 1.00 62.29  ? 180  GLU A CA  1 
ATOM   1341  C  C   . GLU A 1 177 ? 10.736  -25.490  -11.100 1.00 62.96  ? 180  GLU A C   1 
ATOM   1342  O  O   . GLU A 1 177 ? 11.129  -25.057  -12.184 1.00 66.40  ? 180  GLU A O   1 
ATOM   1343  C  CB  . GLU A 1 177 ? 11.507  -27.936  -10.857 1.00 66.64  ? 180  GLU A CB  1 
ATOM   1344  C  CG  . GLU A 1 177 ? 11.053  -28.118  -12.314 1.00 74.80  ? 180  GLU A CG  1 
ATOM   1345  C  CD  . GLU A 1 177 ? 12.150  -27.929  -13.372 1.00 78.61  ? 180  GLU A CD  1 
ATOM   1346  O  OE1 . GLU A 1 177 ? 13.338  -27.726  -13.024 1.00 81.49  ? 180  GLU A OE1 1 
ATOM   1347  O  OE2 . GLU A 1 177 ? 11.815  -27.990  -14.580 1.00 73.70  ? 180  GLU A OE2 1 
ATOM   1348  N  N   . SER A 1 178 ? 9.594   -25.100  -10.543 1.00 60.88  ? 181  SER A N   1 
ATOM   1349  C  CA  . SER A 1 178 ? 8.738   -24.099  -11.175 1.00 63.82  ? 181  SER A CA  1 
ATOM   1350  C  C   . SER A 1 178 ? 9.258   -22.654  -11.027 1.00 67.33  ? 181  SER A C   1 
ATOM   1351  O  O   . SER A 1 178 ? 9.569   -22.181  -9.924  1.00 64.64  ? 181  SER A O   1 
ATOM   1352  C  CB  . SER A 1 178 ? 7.308   -24.224  -10.661 1.00 62.41  ? 181  SER A CB  1 
ATOM   1353  O  OG  . SER A 1 178 ? 6.817   -25.531  -10.874 1.00 57.32  ? 181  SER A OG  1 
ATOM   1354  N  N   . GLU A 1 179 ? 9.367   -21.980  -12.172 1.00 75.28  ? 182  GLU A N   1 
ATOM   1355  C  CA  . GLU A 1 179 ? 9.763   -20.573  -12.270 1.00 71.09  ? 182  GLU A CA  1 
ATOM   1356  C  C   . GLU A 1 179 ? 8.986   -19.974  -13.446 1.00 73.55  ? 182  GLU A C   1 
ATOM   1357  O  O   . GLU A 1 179 ? 9.553   -19.589  -14.472 1.00 74.68  ? 182  GLU A O   1 
ATOM   1358  C  CB  . GLU A 1 179 ? 11.287  -20.442  -12.446 1.00 72.12  ? 182  GLU A CB  1 
ATOM   1359  C  CG  . GLU A 1 179 ? 11.826  -20.486  -13.876 1.00 73.96  ? 182  GLU A CG  1 
ATOM   1360  C  CD  . GLU A 1 179 ? 11.759  -21.861  -14.524 1.00 75.03  ? 182  GLU A CD  1 
ATOM   1361  O  OE1 . GLU A 1 179 ? 10.751  -22.154  -15.205 1.00 74.88  ? 182  GLU A OE1 1 
ATOM   1362  O  OE2 . GLU A 1 179 ? 12.719  -22.645  -14.365 1.00 74.32  ? 182  GLU A OE2 1 
ATOM   1363  N  N   . LYS A 1 180 ? 7.665   -19.922  -13.295 1.00 73.98  ? 183  LYS A N   1 
ATOM   1364  C  CA  . LYS A 1 180 ? 6.785   -19.570  -14.401 1.00 70.70  ? 183  LYS A CA  1 
ATOM   1365  C  C   . LYS A 1 180 ? 5.575   -18.736  -13.964 1.00 75.48  ? 183  LYS A C   1 
ATOM   1366  O  O   . LYS A 1 180 ? 5.496   -18.265  -12.827 1.00 72.84  ? 183  LYS A O   1 
ATOM   1367  C  CB  . LYS A 1 180 ? 6.362   -20.839  -15.157 1.00 66.91  ? 183  LYS A CB  1 
ATOM   1368  C  CG  . LYS A 1 180 ? 7.544   -21.618  -15.728 1.00 65.11  ? 183  LYS A CG  1 
ATOM   1369  C  CD  . LYS A 1 180 ? 7.181   -22.987  -16.277 1.00 61.37  ? 183  LYS A CD  1 
ATOM   1370  C  CE  . LYS A 1 180 ? 8.317   -23.957  -16.004 1.00 62.58  ? 183  LYS A CE  1 
ATOM   1371  N  NZ  . LYS A 1 180 ? 8.486   -25.002  -17.047 1.00 62.03  ? 183  LYS A NZ  1 
ATOM   1372  N  N   . TYR A 1 181 ? 4.651   -18.545  -14.899 1.00 80.03  ? 184  TYR A N   1 
ATOM   1373  C  CA  . TYR A 1 181 ? 3.444   -17.757  -14.697 1.00 80.62  ? 184  TYR A CA  1 
ATOM   1374  C  C   . TYR A 1 181 ? 2.301   -18.715  -15.010 1.00 78.74  ? 184  TYR A C   1 
ATOM   1375  O  O   . TYR A 1 181 ? 1.373   -18.907  -14.216 1.00 75.45  ? 184  TYR A O   1 
ATOM   1376  C  CB  . TYR A 1 181 ? 3.439   -16.569  -15.666 1.00 84.09  ? 184  TYR A CB  1 
ATOM   1377  C  CG  . TYR A 1 181 ? 4.764   -16.389  -16.392 1.00 90.79  ? 184  TYR A CG  1 
ATOM   1378  C  CD1 . TYR A 1 181 ? 5.885   -15.867  -15.735 1.00 92.26  ? 184  TYR A CD1 1 
ATOM   1379  C  CD2 . TYR A 1 181 ? 4.903   -16.766  -17.732 1.00 94.00  ? 184  TYR A CD2 1 
ATOM   1380  C  CE1 . TYR A 1 181 ? 7.100   -15.720  -16.394 1.00 95.52  ? 184  TYR A CE1 1 
ATOM   1381  C  CE2 . TYR A 1 181 ? 6.114   -16.617  -18.401 1.00 93.51  ? 184  TYR A CE2 1 
ATOM   1382  C  CZ  . TYR A 1 181 ? 7.209   -16.094  -17.729 1.00 94.71  ? 184  TYR A CZ  1 
ATOM   1383  O  OH  . TYR A 1 181 ? 8.412   -15.942  -18.386 1.00 87.92  ? 184  TYR A OH  1 
ATOM   1384  N  N   . ARG A 1 182 ? 2.398   -19.330  -16.182 1.00 74.06  ? 185  ARG A N   1 
ATOM   1385  C  CA  . ARG A 1 182 ? 1.562   -20.454  -16.547 1.00 70.37  ? 185  ARG A CA  1 
ATOM   1386  C  C   . ARG A 1 182 ? 2.160   -21.087  -17.797 1.00 67.78  ? 185  ARG A C   1 
ATOM   1387  O  O   . ARG A 1 182 ? 3.381   -21.060  -17.988 1.00 62.90  ? 185  ARG A O   1 
ATOM   1388  C  CB  . ARG A 1 182 ? 0.124   -20.007  -16.777 1.00 69.42  ? 185  ARG A CB  1 
ATOM   1389  N  N   . MET A 1 187 ? -1.131  -24.553  -16.057 1.00 42.16  ? 190  MET A N   1 
ATOM   1390  C  CA  . MET A 1 187 ? -0.377  -24.119  -14.879 1.00 42.39  ? 190  MET A CA  1 
ATOM   1391  C  C   . MET A 1 187 ? 0.975   -24.829  -14.754 1.00 39.37  ? 190  MET A C   1 
ATOM   1392  O  O   . MET A 1 187 ? 1.150   -25.994  -15.158 1.00 34.47  ? 190  MET A O   1 
ATOM   1393  C  CB  . MET A 1 187 ? -1.202  -24.248  -13.581 1.00 45.82  ? 190  MET A CB  1 
ATOM   1394  C  CG  . MET A 1 187 ? -0.645  -23.478  -12.378 1.00 51.59  ? 190  MET A CG  1 
ATOM   1395  S  SD  . MET A 1 187 ? -0.231  -21.724  -12.685 1.00 59.79  ? 190  MET A SD  1 
ATOM   1396  C  CE  . MET A 1 187 ? -1.881  -21.009  -12.691 1.00 55.75  ? 190  MET A CE  1 
ATOM   1397  N  N   . ARG A 1 188 ? 1.922   -24.101  -14.177 1.00 36.79  ? 191  ARG A N   1 
ATOM   1398  C  CA  . ARG A 1 188 ? 3.298   -24.553  -14.029 1.00 38.77  ? 191  ARG A CA  1 
ATOM   1399  C  C   . ARG A 1 188 ? 3.456   -25.873  -13.270 1.00 37.64  ? 191  ARG A C   1 
ATOM   1400  O  O   . ARG A 1 188 ? 4.501   -26.504  -13.358 1.00 36.92  ? 191  ARG A O   1 
ATOM   1401  C  CB  . ARG A 1 188 ? 4.137   -23.458  -13.348 1.00 40.96  ? 191  ARG A CB  1 
ATOM   1402  C  CG  . ARG A 1 188 ? 3.736   -23.148  -11.916 1.00 41.93  ? 191  ARG A CG  1 
ATOM   1403  C  CD  . ARG A 1 188 ? 4.421   -21.881  -11.459 1.00 48.08  ? 191  ARG A CD  1 
ATOM   1404  N  NE  . ARG A 1 188 ? 3.896   -21.369  -10.190 1.00 51.89  ? 191  ARG A NE  1 
ATOM   1405  C  CZ  . ARG A 1 188 ? 4.424   -21.618  -8.992  1.00 53.71  ? 191  ARG A CZ  1 
ATOM   1406  N  NH1 . ARG A 1 188 ? 5.492   -22.399  -8.861  1.00 51.26  ? 191  ARG A NH1 1 
ATOM   1407  N  NH2 . ARG A 1 188 ? 3.869   -21.082  -7.914  1.00 59.08  ? 191  ARG A NH2 1 
ATOM   1408  N  N   . PHE A 1 189 ? 2.432   -26.272  -12.514 1.00 37.64  ? 192  PHE A N   1 
ATOM   1409  C  CA  . PHE A 1 189 ? 2.537   -27.473  -11.694 1.00 37.67  ? 192  PHE A CA  1 
ATOM   1410  C  C   . PHE A 1 189 ? 2.337   -28.718  -12.525 1.00 36.34  ? 192  PHE A C   1 
ATOM   1411  O  O   . PHE A 1 189 ? 3.042   -29.704  -12.331 1.00 36.21  ? 192  PHE A O   1 
ATOM   1412  C  CB  . PHE A 1 189 ? 1.593   -27.422  -10.481 1.00 37.39  ? 192  PHE A CB  1 
ATOM   1413  C  CG  . PHE A 1 189 ? 1.966   -26.359  -9.488  1.00 35.71  ? 192  PHE A CG  1 
ATOM   1414  C  CD1 . PHE A 1 189 ? 3.215   -26.378  -8.867  1.00 35.15  ? 192  PHE A CD1 1 
ATOM   1415  C  CD2 . PHE A 1 189 ? 1.081   -25.324  -9.192  1.00 35.00  ? 192  PHE A CD2 1 
ATOM   1416  C  CE1 . PHE A 1 189 ? 3.573   -25.389  -7.952  1.00 35.59  ? 192  PHE A CE1 1 
ATOM   1417  C  CE2 . PHE A 1 189 ? 1.433   -24.329  -8.282  1.00 36.00  ? 192  PHE A CE2 1 
ATOM   1418  C  CZ  . PHE A 1 189 ? 2.682   -24.360  -7.666  1.00 35.65  ? 192  PHE A CZ  1 
ATOM   1419  N  N   . THR A 1 190 ? 1.395   -28.651  -13.464 1.00 37.73  ? 193  THR A N   1 
ATOM   1420  C  CA  . THR A 1 190 ? 1.179   -29.733  -14.427 1.00 36.93  ? 193  THR A CA  1 
ATOM   1421  C  C   . THR A 1 190 ? 2.431   -29.947  -15.266 1.00 37.77  ? 193  THR A C   1 
ATOM   1422  O  O   . THR A 1 190 ? 2.935   -31.071  -15.370 1.00 38.84  ? 193  THR A O   1 
ATOM   1423  C  CB  . THR A 1 190 ? -0.041  -29.464  -15.316 1.00 36.86  ? 193  THR A CB  1 
ATOM   1424  O  OG1 . THR A 1 190 ? -1.196  -29.312  -14.487 1.00 36.85  ? 193  THR A OG1 1 
ATOM   1425  C  CG2 . THR A 1 190 ? -0.282  -30.627  -16.278 1.00 39.16  ? 193  THR A CG2 1 
ATOM   1426  N  N   . LEU A 1 191 ? 2.945   -28.857  -15.828 1.00 39.36  ? 194  LEU A N   1 
ATOM   1427  C  CA  . LEU A 1 191 ? 4.150   -28.888  -16.644 1.00 40.40  ? 194  LEU A CA  1 
ATOM   1428  C  C   . LEU A 1 191 ? 5.338   -29.415  -15.840 1.00 41.44  ? 194  LEU A C   1 
ATOM   1429  O  O   . LEU A 1 191 ? 6.065   -30.300  -16.299 1.00 42.82  ? 194  LEU A O   1 
ATOM   1430  C  CB  . LEU A 1 191 ? 4.423   -27.490  -17.212 1.00 41.27  ? 194  LEU A CB  1 
ATOM   1431  C  CG  . LEU A 1 191 ? 5.691   -27.155  -18.007 1.00 43.16  ? 194  LEU A CG  1 
ATOM   1432  C  CD1 . LEU A 1 191 ? 5.923   -28.097  -19.189 1.00 43.40  ? 194  LEU A CD1 1 
ATOM   1433  C  CD2 . LEU A 1 191 ? 5.597   -25.711  -18.482 1.00 43.25  ? 194  LEU A CD2 1 
ATOM   1434  N  N   . GLY A 1 192 ? 5.512   -28.888  -14.630 1.00 39.67  ? 195  GLY A N   1 
ATOM   1435  C  CA  . GLY A 1 192 ? 6.570   -29.351  -13.743 1.00 38.63  ? 195  GLY A CA  1 
ATOM   1436  C  C   . GLY A 1 192 ? 6.435   -30.815  -13.340 1.00 35.84  ? 195  GLY A C   1 
ATOM   1437  O  O   . GLY A 1 192 ? 7.427   -31.552  -13.254 1.00 33.02  ? 195  GLY A O   1 
ATOM   1438  N  N   . THR A 1 193 ? 5.204   -31.238  -13.089 1.00 33.65  ? 196  THR A N   1 
ATOM   1439  C  CA  . THR A 1 193 ? 4.954   -32.619  -12.712 1.00 34.62  ? 196  THR A CA  1 
ATOM   1440  C  C   . THR A 1 193 ? 5.315   -33.515  -13.884 1.00 35.63  ? 196  THR A C   1 
ATOM   1441  O  O   . THR A 1 193 ? 6.000   -34.532  -13.702 1.00 35.66  ? 196  THR A O   1 
ATOM   1442  C  CB  . THR A 1 193 ? 3.496   -32.813  -12.263 1.00 33.37  ? 196  THR A CB  1 
ATOM   1443  O  OG1 . THR A 1 193 ? 3.334   -32.229  -10.962 1.00 32.63  ? 196  THR A OG1 1 
ATOM   1444  C  CG2 . THR A 1 193 ? 3.103   -34.301  -12.211 1.00 32.05  ? 196  THR A CG2 1 
ATOM   1445  N  N   . PHE A 1 194 ? 4.885   -33.104  -15.079 1.00 36.01  ? 197  PHE A N   1 
ATOM   1446  C  CA  . PHE A 1 194 ? 5.107   -33.880  -16.290 1.00 40.40  ? 197  PHE A CA  1 
ATOM   1447  C  C   . PHE A 1 194 ? 6.577   -34.158  -16.519 1.00 38.96  ? 197  PHE A C   1 
ATOM   1448  O  O   . PHE A 1 194 ? 6.946   -35.289  -16.803 1.00 36.97  ? 197  PHE A O   1 
ATOM   1449  C  CB  . PHE A 1 194 ? 4.498   -33.213  -17.543 1.00 44.01  ? 197  PHE A CB  1 
ATOM   1450  C  CG  . PHE A 1 194 ? 4.752   -33.983  -18.821 1.00 46.03  ? 197  PHE A CG  1 
ATOM   1451  C  CD1 . PHE A 1 194 ? 3.835   -34.935  -19.276 1.00 47.51  ? 197  PHE A CD1 1 
ATOM   1452  C  CD2 . PHE A 1 194 ? 5.925   -33.778  -19.564 1.00 49.24  ? 197  PHE A CD2 1 
ATOM   1453  C  CE1 . PHE A 1 194 ? 4.074   -35.656  -20.443 1.00 45.89  ? 197  PHE A CE1 1 
ATOM   1454  C  CE2 . PHE A 1 194 ? 6.167   -34.502  -20.732 1.00 48.05  ? 197  PHE A CE2 1 
ATOM   1455  C  CZ  . PHE A 1 194 ? 5.236   -35.436  -21.169 1.00 45.94  ? 197  PHE A CZ  1 
ATOM   1456  N  N   . LEU A 1 195 ? 7.413   -33.136  -16.395 1.00 40.86  ? 198  LEU A N   1 
ATOM   1457  C  CA  . LEU A 1 195 ? 8.809   -33.313  -16.765 1.00 44.55  ? 198  LEU A CA  1 
ATOM   1458  C  C   . LEU A 1 195 ? 9.706   -33.840  -15.645 1.00 47.77  ? 198  LEU A C   1 
ATOM   1459  O  O   . LEU A 1 195 ? 10.746  -34.428  -15.925 1.00 54.29  ? 198  LEU A O   1 
ATOM   1460  C  CB  . LEU A 1 195 ? 9.370   -32.083  -17.500 1.00 47.25  ? 198  LEU A CB  1 
ATOM   1461  C  CG  . LEU A 1 195 ? 9.890   -30.775  -16.913 1.00 48.31  ? 198  LEU A CG  1 
ATOM   1462  C  CD1 . LEU A 1 195 ? 9.480   -29.648  -17.852 1.00 48.44  ? 198  LEU A CD1 1 
ATOM   1463  C  CD2 . LEU A 1 195 ? 9.389   -30.489  -15.508 1.00 51.17  ? 198  LEU A CD2 1 
ATOM   1464  N  N   . ARG A 1 196 ? 9.296   -33.664  -14.388 1.00 47.72  ? 199  ARG A N   1 
ATOM   1465  C  CA  . ARG A 1 196 ? 9.924   -34.395  -13.276 1.00 46.84  ? 199  ARG A CA  1 
ATOM   1466  C  C   . ARG A 1 196 ? 9.563   -35.877  -13.336 1.00 44.85  ? 199  ARG A C   1 
ATOM   1467  O  O   . ARG A 1 196 ? 10.351  -36.737  -12.948 1.00 45.10  ? 199  ARG A O   1 
ATOM   1468  C  CB  . ARG A 1 196 ? 9.534   -33.810  -11.909 1.00 46.29  ? 199  ARG A CB  1 
ATOM   1469  C  CG  . ARG A 1 196 ? 10.695  -33.172  -11.162 1.00 51.55  ? 199  ARG A CG  1 
ATOM   1470  C  CD  . ARG A 1 196 ? 11.483  -34.220  -10.377 1.00 54.57  ? 199  ARG A CD  1 
ATOM   1471  N  NE  . ARG A 1 196 ? 12.884  -33.887  -10.068 1.00 58.95  ? 199  ARG A NE  1 
ATOM   1472  C  CZ  . ARG A 1 196 ? 13.426  -32.664  -10.017 1.00 63.05  ? 199  ARG A CZ  1 
ATOM   1473  N  NH1 . ARG A 1 196 ? 12.706  -31.559  -10.248 1.00 61.94  ? 199  ARG A NH1 1 
ATOM   1474  N  NH2 . ARG A 1 196 ? 14.719  -32.547  -9.725  1.00 60.34  ? 199  ARG A NH2 1 
ATOM   1475  N  N   . LEU A 1 197 ? 8.363   -36.161  -13.829 1.00 42.70  ? 200  LEU A N   1 
ATOM   1476  C  CA  . LEU A 1 197 ? 7.907   -37.526  -14.041 1.00 42.99  ? 200  LEU A CA  1 
ATOM   1477  C  C   . LEU A 1 197 ? 8.850   -38.276  -14.975 1.00 46.13  ? 200  LEU A C   1 
ATOM   1478  O  O   . LEU A 1 197 ? 8.969   -39.495  -14.884 1.00 48.86  ? 200  LEU A O   1 
ATOM   1479  C  CB  . LEU A 1 197 ? 6.506   -37.499  -14.648 1.00 39.33  ? 200  LEU A CB  1 
ATOM   1480  C  CG  . LEU A 1 197 ? 5.338   -38.250  -14.016 1.00 36.75  ? 200  LEU A CG  1 
ATOM   1481  C  CD1 . LEU A 1 197 ? 5.459   -38.314  -12.500 1.00 34.61  ? 200  LEU A CD1 1 
ATOM   1482  C  CD2 . LEU A 1 197 ? 4.035   -37.554  -14.401 1.00 34.23  ? 200  LEU A CD2 1 
ATOM   1483  N  N   . ALA A 1 198 ? 9.522   -37.545  -15.863 1.00 48.89  ? 201  ALA A N   1 
ATOM   1484  C  CA  . ALA A 1 198 ? 10.373  -38.158  -16.888 1.00 53.23  ? 201  ALA A CA  1 
ATOM   1485  C  C   . ALA A 1 198 ? 11.481  -39.000  -16.258 1.00 55.03  ? 201  ALA A C   1 
ATOM   1486  O  O   . ALA A 1 198 ? 11.500  -40.223  -16.412 1.00 56.13  ? 201  ALA A O   1 
ATOM   1487  C  CB  . ALA A 1 198 ? 10.942  -37.100  -17.831 1.00 50.07  ? 201  ALA A CB  1 
ATOM   1488  N  N   . ALA A 1 199 ? 12.389  -38.350  -15.536 1.00 59.20  ? 202  ALA A N   1 
ATOM   1489  C  CA  . ALA A 1 199 ? 13.409  -39.076  -14.788 1.00 60.23  ? 202  ALA A CA  1 
ATOM   1490  C  C   . ALA A 1 199 ? 12.990  -39.142  -13.328 1.00 58.03  ? 202  ALA A C   1 
ATOM   1491  O  O   . ALA A 1 199 ? 13.614  -38.525  -12.470 1.00 56.94  ? 202  ALA A O   1 
ATOM   1492  C  CB  . ALA A 1 199 ? 14.772  -38.416  -14.943 1.00 64.64  ? 202  ALA A CB  1 
ATOM   1493  N  N   . LEU A 1 200 ? 11.909  -39.884  -13.071 1.00 59.95  ? 203  LEU A N   1 
ATOM   1494  C  CA  . LEU A 1 200 ? 11.351  -40.071  -11.728 1.00 55.69  ? 203  LEU A CA  1 
ATOM   1495  C  C   . LEU A 1 200 ? 12.439  -40.555  -10.792 1.00 54.73  ? 203  LEU A C   1 
ATOM   1496  O  O   . LEU A 1 200 ? 13.257  -41.405  -11.163 1.00 59.15  ? 203  LEU A O   1 
ATOM   1497  C  CB  . LEU A 1 200 ? 10.222  -41.111  -11.747 1.00 54.20  ? 203  LEU A CB  1 
ATOM   1498  C  CG  . LEU A 1 200 ? 8.981   -41.045  -10.829 1.00 54.56  ? 203  LEU A CG  1 
ATOM   1499  C  CD1 . LEU A 1 200 ? 8.387   -42.433  -10.616 1.00 53.22  ? 203  LEU A CD1 1 
ATOM   1500  C  CD2 . LEU A 1 200 ? 9.197   -40.365  -9.484  1.00 54.97  ? 203  LEU A CD2 1 
ATOM   1501  N  N   . ARG A 1 201 ? 12.457  -39.993  -9.592  1.00 49.31  ? 204  ARG A N   1 
ATOM   1502  C  CA  . ARG A 1 201 ? 13.349  -40.452  -8.545  1.00 47.78  ? 204  ARG A CA  1 
ATOM   1503  C  C   . ARG A 1 201 ? 12.601  -40.734  -7.249  1.00 44.09  ? 204  ARG A C   1 
ATOM   1504  O  O   . ARG A 1 201 ? 11.486  -40.248  -7.025  1.00 43.48  ? 204  ARG A O   1 
ATOM   1505  C  CB  . ARG A 1 201 ? 14.490  -39.466  -8.311  1.00 49.24  ? 204  ARG A CB  1 
ATOM   1506  C  CG  . ARG A 1 201 ? 14.062  -38.046  -7.998  1.00 54.88  ? 204  ARG A CG  1 
ATOM   1507  C  CD  . ARG A 1 201 ? 15.271  -37.189  -7.663  1.00 57.81  ? 204  ARG A CD  1 
ATOM   1508  N  NE  . ARG A 1 201 ? 16.026  -37.751  -6.546  1.00 59.68  ? 204  ARG A NE  1 
ATOM   1509  C  CZ  . ARG A 1 201 ? 16.918  -37.079  -5.826  1.00 62.87  ? 204  ARG A CZ  1 
ATOM   1510  N  NH1 . ARG A 1 201 ? 17.170  -35.800  -6.091  1.00 61.24  ? 204  ARG A NH1 1 
ATOM   1511  N  NH2 . ARG A 1 201 ? 17.550  -37.686  -4.828  1.00 63.16  ? 204  ARG A NH2 1 
ATOM   1512  N  N   . THR A 1 202 ? 13.211  -41.554  -6.410  1.00 39.67  ? 205  THR A N   1 
ATOM   1513  C  CA  . THR A 1 202 ? 12.654  -41.839  -5.114  1.00 37.64  ? 205  THR A CA  1 
ATOM   1514  C  C   . THR A 1 202 ? 13.517  -41.115  -4.111  1.00 35.08  ? 205  THR A C   1 
ATOM   1515  O  O   . THR A 1 202 ? 14.676  -40.821  -4.387  1.00 34.16  ? 205  THR A O   1 
ATOM   1516  C  CB  . THR A 1 202 ? 12.649  -43.341  -4.824  1.00 37.61  ? 205  THR A CB  1 
ATOM   1517  O  OG1 . THR A 1 202 ? 13.996  -43.828  -4.775  1.00 39.92  ? 205  THR A OG1 1 
ATOM   1518  C  CG2 . THR A 1 202 ? 11.909  -44.058  -5.903  1.00 38.72  ? 205  THR A CG2 1 
ATOM   1519  N  N   . TYR A 1 203 ? 12.953  -40.819  -2.954  1.00 33.49  ? 206  TYR A N   1 
ATOM   1520  C  CA  . TYR A 1 203 ? 13.711  -40.147  -1.914  1.00 34.76  ? 206  TYR A CA  1 
ATOM   1521  C  C   . TYR A 1 203 ? 13.821  -41.076  -0.698  1.00 34.64  ? 206  TYR A C   1 
ATOM   1522  O  O   . TYR A 1 203 ? 12.843  -41.735  -0.308  1.00 32.99  ? 206  TYR A O   1 
ATOM   1523  C  CB  . TYR A 1 203 ? 13.077  -38.785  -1.572  1.00 34.89  ? 206  TYR A CB  1 
ATOM   1524  C  CG  . TYR A 1 203 ? 12.773  -37.916  -2.790  1.00 35.69  ? 206  TYR A CG  1 
ATOM   1525  C  CD1 . TYR A 1 203 ? 11.594  -38.101  -3.520  1.00 36.68  ? 206  TYR A CD1 1 
ATOM   1526  C  CD2 . TYR A 1 203 ? 13.659  -36.923  -3.215  1.00 35.04  ? 206  TYR A CD2 1 
ATOM   1527  C  CE1 . TYR A 1 203 ? 11.308  -37.335  -4.641  1.00 37.14  ? 206  TYR A CE1 1 
ATOM   1528  C  CE2 . TYR A 1 203 ? 13.377  -36.136  -4.333  1.00 36.63  ? 206  TYR A CE2 1 
ATOM   1529  C  CZ  . TYR A 1 203 ? 12.198  -36.348  -5.044  1.00 38.78  ? 206  TYR A CZ  1 
ATOM   1530  O  OH  . TYR A 1 203 ? 11.889  -35.592  -6.169  1.00 38.22  ? 206  TYR A OH  1 
ATOM   1531  N  N   . ARG A 1 204 ? 15.024  -41.165  -0.137  1.00 35.31  ? 207  ARG A N   1 
ATOM   1532  C  CA  . ARG A 1 204 ? 15.260  -42.047  1.003   1.00 37.98  ? 207  ARG A CA  1 
ATOM   1533  C  C   . ARG A 1 204 ? 15.015  -41.269  2.280   1.00 36.03  ? 207  ARG A C   1 
ATOM   1534  O  O   . ARG A 1 204 ? 15.627  -40.232  2.503   1.00 36.29  ? 207  ARG A O   1 
ATOM   1535  C  CB  . ARG A 1 204 ? 16.690  -42.588  0.980   1.00 43.70  ? 207  ARG A CB  1 
ATOM   1536  C  CG  . ARG A 1 204 ? 16.951  -43.634  -0.100  1.00 49.04  ? 207  ARG A CG  1 
ATOM   1537  C  CD  . ARG A 1 204 ? 18.423  -44.021  -0.197  1.00 52.04  ? 207  ARG A CD  1 
ATOM   1538  N  NE  . ARG A 1 204 ? 18.766  -45.130  0.695   1.00 55.01  ? 207  ARG A NE  1 
ATOM   1539  C  CZ  . ARG A 1 204 ? 19.745  -45.107  1.598   1.00 57.08  ? 207  ARG A CZ  1 
ATOM   1540  N  NH1 . ARG A 1 204 ? 20.509  -44.030  1.739   1.00 57.65  ? 207  ARG A NH1 1 
ATOM   1541  N  NH2 . ARG A 1 204 ? 19.965  -46.172  2.365   1.00 58.27  ? 207  ARG A NH2 1 
ATOM   1542  N  N   . GLY A 1 205 ? 14.103  -41.746  3.112   1.00 36.13  ? 208  GLY A N   1 
ATOM   1543  C  CA  . GLY A 1 205 ? 13.871  -41.091  4.398   1.00 35.37  ? 208  GLY A CA  1 
ATOM   1544  C  C   . GLY A 1 205 ? 13.167  -41.928  5.441   1.00 32.77  ? 208  GLY A C   1 
ATOM   1545  O  O   . GLY A 1 205 ? 12.726  -43.029  5.164   1.00 32.72  ? 208  GLY A O   1 
ATOM   1546  N  N   . ARG A 1 206 ? 13.065  -41.390  6.653   1.00 34.20  ? 209  ARG A N   1 
ATOM   1547  C  CA  . ARG A 1 206 ? 12.334  -42.043  7.742   1.00 33.20  ? 209  ARG A CA  1 
ATOM   1548  C  C   . ARG A 1 206 ? 11.141  -41.207  8.181   1.00 30.54  ? 209  ARG A C   1 
ATOM   1549  O  O   . ARG A 1 206 ? 11.294  -40.041  8.583   1.00 28.50  ? 209  ARG A O   1 
ATOM   1550  C  CB  . ARG A 1 206 ? 13.263  -42.336  8.930   1.00 34.21  ? 209  ARG A CB  1 
ATOM   1551  C  CG  . ARG A 1 206 ? 14.102  -43.586  8.735   1.00 37.90  ? 209  ARG A CG  1 
ATOM   1552  C  CD  . ARG A 1 206 ? 15.228  -43.720  9.755   1.00 41.66  ? 209  ARG A CD  1 
ATOM   1553  N  NE  . ARG A 1 206 ? 16.076  -44.877  9.442   1.00 43.51  ? 209  ARG A NE  1 
ATOM   1554  C  CZ  . ARG A 1 206 ? 17.340  -44.812  9.023   1.00 42.60  ? 209  ARG A CZ  1 
ATOM   1555  N  NH1 . ARG A 1 206 ? 17.955  -43.641  8.882   1.00 42.65  ? 209  ARG A NH1 1 
ATOM   1556  N  NH2 . ARG A 1 206 ? 18.002  -45.931  8.758   1.00 43.54  ? 209  ARG A NH2 1 
ATOM   1557  N  N   . LEU A 1 207 ? 9.964   -41.823  8.107   1.00 27.95  ? 210  LEU A N   1 
ATOM   1558  C  CA  . LEU A 1 207 ? 8.714   -41.183  8.454   1.00 27.00  ? 210  LEU A CA  1 
ATOM   1559  C  C   . LEU A 1 207 ? 8.102   -41.847  9.680   1.00 26.71  ? 210  LEU A C   1 
ATOM   1560  O  O   . LEU A 1 207 ? 7.954   -43.072  9.733   1.00 27.02  ? 210  LEU A O   1 
ATOM   1561  C  CB  . LEU A 1 207 ? 7.726   -41.346  7.309   1.00 26.92  ? 210  LEU A CB  1 
ATOM   1562  C  CG  . LEU A 1 207 ? 6.602   -40.365  6.947   1.00 29.11  ? 210  LEU A CG  1 
ATOM   1563  C  CD1 . LEU A 1 207 ? 5.378   -41.129  6.427   1.00 27.70  ? 210  LEU A CD1 1 
ATOM   1564  C  CD2 . LEU A 1 207 ? 6.209   -39.369  8.032   1.00 27.18  ? 210  LEU A CD2 1 
ATOM   1565  N  N   . ALA A 1 208 ? 7.709   -41.019  10.639  1.00 25.78  ? 211  ALA A N   1 
ATOM   1566  C  CA  . ALA A 1 208 ? 6.964   -41.450  11.803  1.00 26.71  ? 211  ALA A CA  1 
ATOM   1567  C  C   . ALA A 1 208 ? 5.802   -40.480  11.984  1.00 26.32  ? 211  ALA A C   1 
ATOM   1568  O  O   . ALA A 1 208 ? 5.932   -39.310  11.666  1.00 27.81  ? 211  ALA A O   1 
ATOM   1569  C  CB  . ALA A 1 208 ? 7.867   -41.442  13.028  1.00 25.67  ? 211  ALA A CB  1 
ATOM   1570  N  N   . TYR A 1 209 ? 4.679   -40.957  12.495  1.00 26.09  ? 212  TYR A N   1 
ATOM   1571  C  CA  . TYR A 1 209 ? 3.553   -40.073  12.753  1.00 27.41  ? 212  TYR A CA  1 
ATOM   1572  C  C   . TYR A 1 209 ? 2.717   -40.516  13.936  1.00 27.64  ? 212  TYR A C   1 
ATOM   1573  O  O   . TYR A 1 209 ? 2.855   -41.633  14.405  1.00 28.95  ? 212  TYR A O   1 
ATOM   1574  C  CB  . TYR A 1 209 ? 2.673   -39.932  11.512  1.00 27.22  ? 212  TYR A CB  1 
ATOM   1575  C  CG  . TYR A 1 209 ? 2.115   -41.236  10.987  1.00 26.27  ? 212  TYR A CG  1 
ATOM   1576  C  CD1 . TYR A 1 209 ? 2.774   -41.935  9.978   1.00 26.07  ? 212  TYR A CD1 1 
ATOM   1577  C  CD2 . TYR A 1 209 ? 0.928   -41.766  11.493  1.00 26.23  ? 212  TYR A CD2 1 
ATOM   1578  C  CE1 . TYR A 1 209 ? 2.264   -43.126  9.495   1.00 27.14  ? 212  TYR A CE1 1 
ATOM   1579  C  CE2 . TYR A 1 209 ? 0.417   -42.965  11.019  1.00 26.34  ? 212  TYR A CE2 1 
ATOM   1580  C  CZ  . TYR A 1 209 ? 1.090   -43.632  10.017  1.00 27.72  ? 212  TYR A CZ  1 
ATOM   1581  O  OH  . TYR A 1 209 ? 0.596   -44.825  9.522   1.00 32.62  ? 212  TYR A OH  1 
ATOM   1582  N  N   . LEU A 1 210 ? 1.845   -39.624  14.404  1.00 29.14  ? 213  LEU A N   1 
ATOM   1583  C  CA  . LEU A 1 210 ? 0.939   -39.907  15.515  1.00 27.69  ? 213  LEU A CA  1 
ATOM   1584  C  C   . LEU A 1 210 ? -0.501  -39.856  15.055  1.00 27.46  ? 213  LEU A C   1 
ATOM   1585  O  O   . LEU A 1 210 ? -1.049  -38.772  14.896  1.00 28.14  ? 213  LEU A O   1 
ATOM   1586  C  CB  . LEU A 1 210 ? 1.140   -38.911  16.661  1.00 26.39  ? 213  LEU A CB  1 
ATOM   1587  C  CG  . LEU A 1 210 ? 0.343   -39.149  17.964  1.00 27.95  ? 213  LEU A CG  1 
ATOM   1588  C  CD1 . LEU A 1 210 ? 0.425   -40.591  18.498  1.00 26.15  ? 213  LEU A CD1 1 
ATOM   1589  C  CD2 . LEU A 1 210 ? 0.772   -38.155  19.046  1.00 26.72  ? 213  LEU A CD2 1 
ATOM   1590  N  N   . PRO A 1 211 ? -1.132  -41.028  14.873  1.00 28.58  ? 214  PRO A N   1 
ATOM   1591  C  CA  . PRO A 1 211 ? -2.499  -41.079  14.365  1.00 28.72  ? 214  PRO A CA  1 
ATOM   1592  C  C   . PRO A 1 211 ? -3.439  -40.523  15.400  1.00 30.45  ? 214  PRO A C   1 
ATOM   1593  O  O   . PRO A 1 211 ? -3.108  -40.534  16.578  1.00 31.26  ? 214  PRO A O   1 
ATOM   1594  C  CB  . PRO A 1 211 ? -2.770  -42.581  14.198  1.00 28.05  ? 214  PRO A CB  1 
ATOM   1595  C  CG  . PRO A 1 211 ? -1.466  -43.276  14.419  1.00 28.14  ? 214  PRO A CG  1 
ATOM   1596  C  CD  . PRO A 1 211 ? -0.662  -42.357  15.299  1.00 28.98  ? 214  PRO A CD  1 
ATOM   1597  N  N   . VAL A 1 212 ? -4.607  -40.072  14.966  1.00 34.30  ? 215  VAL A N   1 
ATOM   1598  C  CA  . VAL A 1 212 ? -5.659  -39.568  15.855  1.00 39.54  ? 215  VAL A CA  1 
ATOM   1599  C  C   . VAL A 1 212 ? -5.965  -40.489  17.062  1.00 45.33  ? 215  VAL A C   1 
ATOM   1600  O  O   . VAL A 1 212 ? -6.649  -40.079  18.011  1.00 48.21  ? 215  VAL A O   1 
ATOM   1601  C  CB  . VAL A 1 212 ? -6.940  -39.213  15.057  1.00 38.34  ? 215  VAL A CB  1 
ATOM   1602  C  CG1 . VAL A 1 212 ? -7.902  -38.381  15.891  1.00 37.48  ? 215  VAL A CG1 1 
ATOM   1603  C  CG2 . VAL A 1 212 ? -6.581  -38.422  13.823  1.00 36.91  ? 215  VAL A CG2 1 
ATOM   1604  N  N   . GLY A 1 213 ? -5.440  -41.716  17.040  1.00 51.51  ? 216  GLY A N   1 
ATOM   1605  C  CA  . GLY A 1 213 ? -5.348  -42.568  18.250  1.00 53.79  ? 216  GLY A CA  1 
ATOM   1606  C  C   . GLY A 1 213 ? -4.207  -42.263  19.241  1.00 58.80  ? 216  GLY A C   1 
ATOM   1607  O  O   . GLY A 1 213 ? -3.279  -43.066  19.419  1.00 58.17  ? 216  GLY A O   1 
ATOM   1608  N  N   . ARG A 1 214 ? -4.284  -41.096  19.884  1.00 61.44  ? 217  ARG A N   1 
ATOM   1609  C  CA  . ARG A 1 214 ? -3.372  -40.684  20.962  1.00 59.66  ? 217  ARG A CA  1 
ATOM   1610  C  C   . ARG A 1 214 ? -4.088  -40.777  22.328  1.00 63.51  ? 217  ARG A C   1 
ATOM   1611  O  O   . ARG A 1 214 ? -5.314  -40.951  22.381  1.00 60.69  ? 217  ARG A O   1 
ATOM   1612  C  CB  . ARG A 1 214 ? -2.828  -39.265  20.712  1.00 61.42  ? 217  ARG A CB  1 
ATOM   1613  C  CG  . ARG A 1 214 ? -3.849  -38.126  20.717  1.00 60.28  ? 217  ARG A CG  1 
ATOM   1614  C  CD  . ARG A 1 214 ? -4.637  -38.064  19.409  1.00 66.43  ? 217  ARG A CD  1 
ATOM   1615  N  NE  . ARG A 1 214 ? -5.332  -36.787  19.179  1.00 71.79  ? 217  ARG A NE  1 
ATOM   1616  C  CZ  . ARG A 1 214 ? -6.658  -36.618  19.143  1.00 70.38  ? 217  ARG A CZ  1 
ATOM   1617  N  NH1 . ARG A 1 214 ? -7.162  -35.401  18.914  1.00 67.77  ? 217  ARG A NH1 1 
ATOM   1618  N  NH2 . ARG A 1 214 ? -7.481  -37.651  19.336  1.00 66.64  ? 217  ARG A NH2 1 
ATOM   1619  N  N   . VAL A 1 215 ? -3.337  -40.644  23.423  1.00 61.65  ? 218  VAL A N   1 
ATOM   1620  C  CA  . VAL A 1 215 ? -3.810  -41.159  24.720  1.00 66.18  ? 218  VAL A CA  1 
ATOM   1621  C  C   . VAL A 1 215 ? -4.097  -40.109  25.812  1.00 65.87  ? 218  VAL A C   1 
ATOM   1622  O  O   . VAL A 1 215 ? -4.068  -38.905  25.544  1.00 61.87  ? 218  VAL A O   1 
ATOM   1623  C  CB  . VAL A 1 215 ? -2.888  -42.287  25.276  1.00 70.59  ? 218  VAL A CB  1 
ATOM   1624  C  CG1 . VAL A 1 215 ? -3.717  -43.530  25.602  1.00 70.37  ? 218  VAL A CG1 1 
ATOM   1625  C  CG2 . VAL A 1 215 ? -1.760  -42.645  24.307  1.00 69.06  ? 218  VAL A CG2 1 
ATOM   1626  N  N   . GLY A 1 216 ? -4.386  -40.586  27.030  1.00 68.63  ? 219  GLY A N   1 
ATOM   1627  C  CA  . GLY A 1 216 ? -4.756  -39.748  28.185  1.00 65.45  ? 219  GLY A CA  1 
ATOM   1628  C  C   . GLY A 1 216 ? -3.647  -38.892  28.774  1.00 67.77  ? 219  GLY A C   1 
ATOM   1629  O  O   . GLY A 1 216 ? -3.906  -38.007  29.589  1.00 64.85  ? 219  GLY A O   1 
ATOM   1630  N  N   . SER A 1 217 ? -2.410  -39.165  28.364  1.00 72.87  ? 220  SER A N   1 
ATOM   1631  C  CA  . SER A 1 217 ? -1.232  -38.418  28.807  1.00 77.06  ? 220  SER A CA  1 
ATOM   1632  C  C   . SER A 1 217 ? -0.228  -38.337  27.654  1.00 80.18  ? 220  SER A C   1 
ATOM   1633  O  O   . SER A 1 217 ? -0.455  -38.916  26.584  1.00 79.68  ? 220  SER A O   1 
ATOM   1634  C  CB  . SER A 1 217 ? -0.605  -39.074  30.035  1.00 73.92  ? 220  SER A CB  1 
ATOM   1635  N  N   . LYS A 1 218 ? 0.875   -37.621  27.873  1.00 81.86  ? 221  LYS A N   1 
ATOM   1636  C  CA  . LYS A 1 218 ? 1.869   -37.383  26.827  1.00 82.11  ? 221  LYS A CA  1 
ATOM   1637  C  C   . LYS A 1 218 ? 3.257   -37.060  27.384  1.00 83.21  ? 221  LYS A C   1 
ATOM   1638  O  O   . LYS A 1 218 ? 3.391   -36.514  28.483  1.00 87.00  ? 221  LYS A O   1 
ATOM   1639  C  CB  . LYS A 1 218 ? 1.401   -36.256  25.888  1.00 83.34  ? 221  LYS A CB  1 
ATOM   1640  C  CG  . LYS A 1 218 ? 1.603   -34.829  26.402  1.00 85.50  ? 221  LYS A CG  1 
ATOM   1641  C  CD  . LYS A 1 218 ? 0.689   -34.461  27.570  1.00 91.98  ? 221  LYS A CD  1 
ATOM   1642  C  CE  . LYS A 1 218 ? -0.741  -34.185  27.123  1.00 94.67  ? 221  LYS A CE  1 
ATOM   1643  N  NZ  . LYS A 1 218 ? -1.653  -33.982  28.282  1.00 94.25  ? 221  LYS A NZ  1 
ATOM   1644  N  N   . THR A 1 219 ? 4.280   -37.428  26.617  1.00 80.83  ? 222  THR A N   1 
ATOM   1645  C  CA  . THR A 1 219 ? 5.652   -36.959  26.814  1.00 77.27  ? 222  THR A CA  1 
ATOM   1646  C  C   . THR A 1 219 ? 6.326   -36.949  25.445  1.00 77.45  ? 222  THR A C   1 
ATOM   1647  O  O   . THR A 1 219 ? 5.650   -37.031  24.406  1.00 68.74  ? 222  THR A O   1 
ATOM   1648  C  CB  . THR A 1 219 ? 6.413   -37.845  27.792  1.00 73.41  ? 222  THR A CB  1 
ATOM   1649  N  N   . GLN A 1 228 ? 7.769   -17.325  22.675  1.00 56.54  ? 231  GLN A N   1 
ATOM   1650  C  CA  . GLN A 1 228 ? 8.189   -18.721  22.682  1.00 59.60  ? 231  GLN A CA  1 
ATOM   1651  C  C   . GLN A 1 228 ? 7.054   -19.614  22.177  1.00 58.54  ? 231  GLN A C   1 
ATOM   1652  O  O   . GLN A 1 228 ? 7.212   -20.833  22.052  1.00 57.64  ? 231  GLN A O   1 
ATOM   1653  C  CB  . GLN A 1 228 ? 8.665   -19.130  24.091  1.00 64.41  ? 231  GLN A CB  1 
ATOM   1654  C  CG  . GLN A 1 228 ? 9.093   -20.590  24.275  1.00 63.55  ? 231  GLN A CG  1 
ATOM   1655  C  CD  . GLN A 1 228 ? 10.398  -20.960  23.583  1.00 62.36  ? 231  GLN A CD  1 
ATOM   1656  O  OE1 . GLN A 1 228 ? 10.642  -22.134  23.301  1.00 62.74  ? 231  GLN A OE1 1 
ATOM   1657  N  NE2 . GLN A 1 228 ? 11.248  -19.970  23.323  1.00 61.80  ? 231  GLN A NE2 1 
ATOM   1658  N  N   . GLY A 1 229 ? 5.915   -18.992  21.870  1.00 56.58  ? 232  GLY A N   1 
ATOM   1659  C  CA  . GLY A 1 229 ? 4.772   -19.693  21.268  1.00 47.69  ? 232  GLY A CA  1 
ATOM   1660  C  C   . GLY A 1 229 ? 4.224   -20.782  22.166  1.00 42.88  ? 232  GLY A C   1 
ATOM   1661  O  O   . GLY A 1 229 ? 4.658   -20.902  23.325  1.00 42.74  ? 232  GLY A O   1 
ATOM   1662  N  N   . PRO A 1 230 ? 3.262   -21.579  21.653  1.00 37.44  ? 233  PRO A N   1 
ATOM   1663  C  CA  . PRO A 1 230 ? 2.707   -22.663  22.462  1.00 34.99  ? 233  PRO A CA  1 
ATOM   1664  C  C   . PRO A 1 230 ? 3.691   -23.805  22.602  1.00 31.38  ? 233  PRO A C   1 
ATOM   1665  O  O   . PRO A 1 230 ? 4.718   -23.812  21.936  1.00 27.89  ? 233  PRO A O   1 
ATOM   1666  C  CB  . PRO A 1 230 ? 1.461   -23.103  21.683  1.00 36.80  ? 233  PRO A CB  1 
ATOM   1667  C  CG  . PRO A 1 230 ? 1.701   -22.657  20.278  1.00 36.85  ? 233  PRO A CG  1 
ATOM   1668  C  CD  . PRO A 1 230 ? 2.597   -21.456  20.346  1.00 36.95  ? 233  PRO A CD  1 
ATOM   1669  N  N   . VAL A 1 231 ? 3.381   -24.747  23.488  1.00 32.51  ? 234  VAL A N   1 
ATOM   1670  C  CA  . VAL A 1 231 ? 4.240   -25.907  23.697  1.00 31.56  ? 234  VAL A CA  1 
ATOM   1671  C  C   . VAL A 1 231 ? 3.769   -27.030  22.794  1.00 30.67  ? 234  VAL A C   1 
ATOM   1672  O  O   . VAL A 1 231 ? 2.569   -27.270  22.637  1.00 28.32  ? 234  VAL A O   1 
ATOM   1673  C  CB  . VAL A 1 231 ? 4.281   -26.373  25.176  1.00 33.69  ? 234  VAL A CB  1 
ATOM   1674  C  CG1 . VAL A 1 231 ? 4.826   -25.262  26.076  1.00 32.52  ? 234  VAL A CG1 1 
ATOM   1675  C  CG2 . VAL A 1 231 ? 2.899   -26.814  25.655  1.00 34.73  ? 234  VAL A CG2 1 
ATOM   1676  N  N   . ASP A 1 232 ? 4.728   -27.700  22.177  1.00 31.12  ? 235  ASP A N   1 
ATOM   1677  C  CA  . ASP A 1 232 ? 4.418   -28.839  21.354  1.00 32.20  ? 235  ASP A CA  1 
ATOM   1678  C  C   . ASP A 1 232 ? 4.462   -30.110  22.219  1.00 31.92  ? 235  ASP A C   1 
ATOM   1679  O  O   . ASP A 1 232 ? 5.436   -30.868  22.198  1.00 30.93  ? 235  ASP A O   1 
ATOM   1680  C  CB  . ASP A 1 232 ? 5.358   -28.880  20.141  1.00 31.32  ? 235  ASP A CB  1 
ATOM   1681  C  CG  . ASP A 1 232 ? 5.079   -27.752  19.143  1.00 32.98  ? 235  ASP A CG  1 
ATOM   1682  O  OD1 . ASP A 1 232 ? 3.961   -27.180  19.162  1.00 31.45  ? 235  ASP A OD1 1 
ATOM   1683  O  OD2 . ASP A 1 232 ? 5.976   -27.436  18.329  1.00 32.98  ? 235  ASP A OD2 1 
ATOM   1684  N  N   . ALA A 1 233 ? 3.384   -30.340  22.963  1.00 30.58  ? 236  ALA A N   1 
ATOM   1685  C  CA  . ALA A 1 233 ? 3.351   -31.431  23.944  1.00 34.17  ? 236  ALA A CA  1 
ATOM   1686  C  C   . ALA A 1 233 ? 3.529   -32.838  23.354  1.00 33.44  ? 236  ALA A C   1 
ATOM   1687  O  O   . ALA A 1 233 ? 4.002   -33.747  24.036  1.00 35.93  ? 236  ALA A O   1 
ATOM   1688  C  CB  . ALA A 1 233 ? 2.086   -31.353  24.807  1.00 35.17  ? 236  ALA A CB  1 
ATOM   1689  N  N   . HIS A 1 234 ? 3.172   -33.020  22.092  1.00 33.11  ? 237  HIS A N   1 
ATOM   1690  C  CA  . HIS A 1 234 ? 3.305   -34.338  21.457  1.00 30.65  ? 237  HIS A CA  1 
ATOM   1691  C  C   . HIS A 1 234 ? 4.686   -34.645  20.971  1.00 30.16  ? 237  HIS A C   1 
ATOM   1692  O  O   . HIS A 1 234 ? 4.967   -35.790  20.601  1.00 30.96  ? 237  HIS A O   1 
ATOM   1693  C  CB  . HIS A 1 234 ? 2.332   -34.468  20.301  1.00 31.14  ? 237  HIS A CB  1 
ATOM   1694  C  CG  . HIS A 1 234 ? 0.889   -34.568  20.722  1.00 32.18  ? 237  HIS A CG  1 
ATOM   1695  N  ND1 . HIS A 1 234 ? -0.072  -33.792  20.190  1.00 33.15  ? 237  HIS A ND1 1 
ATOM   1696  C  CD2 . HIS A 1 234 ? 0.256   -35.408  21.636  1.00 33.16  ? 237  HIS A CD2 1 
ATOM   1697  C  CE1 . HIS A 1 234 ? -1.263  -34.107  20.739  1.00 35.05  ? 237  HIS A CE1 1 
ATOM   1698  N  NE2 . HIS A 1 234 ? -1.059  -35.100  21.626  1.00 34.59  ? 237  HIS A NE2 1 
ATOM   1699  N  N   . LEU A 1 235 ? 5.569   -33.645  20.969  1.00 28.18  ? 238  LEU A N   1 
ATOM   1700  C  CA  . LEU A 1 235 ? 6.883   -33.784  20.335  1.00 28.08  ? 238  LEU A CA  1 
ATOM   1701  C  C   . LEU A 1 235 ? 8.034   -33.953  21.313  1.00 28.40  ? 238  LEU A C   1 
ATOM   1702  O  O   . LEU A 1 235 ? 8.101   -33.260  22.324  1.00 28.06  ? 238  LEU A O   1 
ATOM   1703  C  CB  . LEU A 1 235 ? 7.184   -32.570  19.410  1.00 27.21  ? 238  LEU A CB  1 
ATOM   1704  C  CG  . LEU A 1 235 ? 6.153   -32.248  18.313  1.00 26.98  ? 238  LEU A CG  1 
ATOM   1705  C  CD1 . LEU A 1 235 ? 6.564   -31.019  17.521  1.00 26.12  ? 238  LEU A CD1 1 
ATOM   1706  C  CD2 . LEU A 1 235 ? 5.948   -33.446  17.385  1.00 25.26  ? 238  LEU A CD2 1 
ATOM   1707  N  N   . VAL A 1 236 ? 8.968   -34.841  20.976  1.00 28.26  ? 239  VAL A N   1 
ATOM   1708  C  CA  . VAL A 1 236 ? 10.213  -34.974  21.730  1.00 29.86  ? 239  VAL A CA  1 
ATOM   1709  C  C   . VAL A 1 236 ? 11.382  -34.501  20.865  1.00 29.45  ? 239  VAL A C   1 
ATOM   1710  O  O   . VAL A 1 236 ? 11.273  -34.472  19.645  1.00 29.87  ? 239  VAL A O   1 
ATOM   1711  C  CB  . VAL A 1 236 ? 10.438  -36.429  22.246  1.00 30.05  ? 239  VAL A CB  1 
ATOM   1712  C  CG1 . VAL A 1 236 ? 9.198   -36.931  22.968  1.00 29.28  ? 239  VAL A CG1 1 
ATOM   1713  C  CG2 . VAL A 1 236 ? 10.815  -37.380  21.109  1.00 29.07  ? 239  VAL A CG2 1 
ATOM   1714  N  N   . PRO A 1 237 ? 12.517  -34.140  21.486  1.00 31.15  ? 240  PRO A N   1 
ATOM   1715  C  CA  . PRO A 1 237 ? 13.586  -33.604  20.632  1.00 32.02  ? 240  PRO A CA  1 
ATOM   1716  C  C   . PRO A 1 237 ? 13.952  -34.548  19.475  1.00 33.44  ? 240  PRO A C   1 
ATOM   1717  O  O   . PRO A 1 237 ? 13.893  -35.777  19.611  1.00 31.21  ? 240  PRO A O   1 
ATOM   1718  C  CB  . PRO A 1 237 ? 14.766  -33.436  21.597  1.00 31.00  ? 240  PRO A CB  1 
ATOM   1719  C  CG  . PRO A 1 237 ? 14.140  -33.315  22.956  1.00 31.51  ? 240  PRO A CG  1 
ATOM   1720  C  CD  . PRO A 1 237 ? 12.882  -34.136  22.919  1.00 30.70  ? 240  PRO A CD  1 
ATOM   1721  N  N   . LEU A 1 238 ? 14.334  -33.949  18.353  1.00 34.93  ? 241  LEU A N   1 
ATOM   1722  C  CA  . LEU A 1 238 ? 14.756  -34.678  17.159  1.00 35.61  ? 241  LEU A CA  1 
ATOM   1723  C  C   . LEU A 1 238 ? 15.925  -35.645  17.375  1.00 36.61  ? 241  LEU A C   1 
ATOM   1724  O  O   . LEU A 1 238 ? 16.110  -36.563  16.574  1.00 36.60  ? 241  LEU A O   1 
ATOM   1725  C  CB  . LEU A 1 238 ? 15.095  -33.693  16.029  1.00 34.53  ? 241  LEU A CB  1 
ATOM   1726  C  CG  . LEU A 1 238 ? 13.922  -33.069  15.285  1.00 34.73  ? 241  LEU A CG  1 
ATOM   1727  C  CD1 . LEU A 1 238 ? 14.421  -31.875  14.479  1.00 35.06  ? 241  LEU A CD1 1 
ATOM   1728  C  CD2 . LEU A 1 238 ? 13.211  -34.092  14.387  1.00 33.71  ? 241  LEU A CD2 1 
ATOM   1729  N  N   . GLU A 1 239 ? 16.706  -35.443  18.440  1.00 38.64  ? 242  GLU A N   1 
ATOM   1730  C  CA  . GLU A 1 239 ? 17.797  -36.376  18.795  1.00 40.15  ? 242  GLU A CA  1 
ATOM   1731  C  C   . GLU A 1 239 ? 17.268  -37.629  19.499  1.00 39.20  ? 242  GLU A C   1 
ATOM   1732  O  O   . GLU A 1 239 ? 17.937  -38.654  19.515  1.00 40.51  ? 242  GLU A O   1 
ATOM   1733  C  CB  . GLU A 1 239 ? 18.860  -35.723  19.694  1.00 45.01  ? 242  GLU A CB  1 
ATOM   1734  C  CG  . GLU A 1 239 ? 19.314  -34.331  19.290  1.00 49.91  ? 242  GLU A CG  1 
ATOM   1735  C  CD  . GLU A 1 239 ? 18.316  -33.258  19.693  1.00 52.14  ? 242  GLU A CD  1 
ATOM   1736  O  OE1 . GLU A 1 239 ? 17.785  -33.332  20.825  1.00 57.98  ? 242  GLU A OE1 1 
ATOM   1737  O  OE2 . GLU A 1 239 ? 18.062  -32.340  18.884  1.00 52.34  ? 242  GLU A OE2 1 
ATOM   1738  N  N   . GLU A 1 240 ? 16.081  -37.531  20.094  1.00 38.51  ? 243  GLU A N   1 
ATOM   1739  C  CA  . GLU A 1 240 ? 15.432  -38.674  20.736  1.00 37.97  ? 243  GLU A CA  1 
ATOM   1740  C  C   . GLU A 1 240 ? 14.633  -39.453  19.693  1.00 34.54  ? 243  GLU A C   1 
ATOM   1741  O  O   . GLU A 1 240 ? 14.202  -38.874  18.695  1.00 36.14  ? 243  GLU A O   1 
ATOM   1742  C  CB  . GLU A 1 240 ? 14.480  -38.204  21.848  1.00 39.26  ? 243  GLU A CB  1 
ATOM   1743  C  CG  . GLU A 1 240 ? 15.150  -37.826  23.164  1.00 45.21  ? 243  GLU A CG  1 
ATOM   1744  C  CD  . GLU A 1 240 ? 16.039  -38.926  23.728  1.00 50.17  ? 243  GLU A CD  1 
ATOM   1745  O  OE1 . GLU A 1 240 ? 15.545  -40.059  23.987  1.00 51.64  ? 243  GLU A OE1 1 
ATOM   1746  O  OE2 . GLU A 1 240 ? 17.241  -38.645  23.929  1.00 50.82  ? 243  GLU A OE2 1 
ATOM   1747  N  N   . PRO A 1 241 ? 14.415  -40.757  19.916  1.00 31.35  ? 244  PRO A N   1 
ATOM   1748  C  CA  . PRO A 1 241 ? 13.489  -41.431  19.000  1.00 28.65  ? 244  PRO A CA  1 
ATOM   1749  C  C   . PRO A 1 241 ? 12.054  -40.983  19.289  1.00 28.70  ? 244  PRO A C   1 
ATOM   1750  O  O   . PRO A 1 241 ? 11.776  -40.473  20.378  1.00 29.96  ? 244  PRO A O   1 
ATOM   1751  C  CB  . PRO A 1 241 ? 13.653  -42.895  19.370  1.00 29.00  ? 244  PRO A CB  1 
ATOM   1752  C  CG  . PRO A 1 241 ? 14.064  -42.870  20.828  1.00 30.21  ? 244  PRO A CG  1 
ATOM   1753  C  CD  . PRO A 1 241 ? 14.934  -41.659  20.967  1.00 28.92  ? 244  PRO A CD  1 
ATOM   1754  N  N   . VAL A 1 242 ? 11.152  -41.146  18.329  1.00 26.98  ? 245  VAL A N   1 
ATOM   1755  C  CA  . VAL A 1 242 ? 9.730   -40.854  18.560  1.00 26.85  ? 245  VAL A CA  1 
ATOM   1756  C  C   . VAL A 1 242 ? 9.125   -41.751  19.666  1.00 27.56  ? 245  VAL A C   1 
ATOM   1757  O  O   . VAL A 1 242 ? 9.589   -42.868  19.869  1.00 27.12  ? 245  VAL A O   1 
ATOM   1758  C  CB  . VAL A 1 242 ? 8.915   -40.935  17.251  1.00 25.36  ? 245  VAL A CB  1 
ATOM   1759  C  CG1 . VAL A 1 242 ? 9.421   -39.888  16.262  1.00 25.51  ? 245  VAL A CG1 1 
ATOM   1760  C  CG2 . VAL A 1 242 ? 8.994   -42.318  16.632  1.00 24.97  ? 245  VAL A CG2 1 
ATOM   1761  N  N   . PRO A 1 243 ? 8.091   -41.267  20.388  1.00 27.89  ? 246  PRO A N   1 
ATOM   1762  C  CA  . PRO A 1 243 ? 7.528   -42.119  21.450  1.00 28.90  ? 246  PRO A CA  1 
ATOM   1763  C  C   . PRO A 1 243 ? 7.019   -43.433  20.890  1.00 29.42  ? 246  PRO A C   1 
ATOM   1764  O  O   . PRO A 1 243 ? 6.647   -43.502  19.718  1.00 28.88  ? 246  PRO A O   1 
ATOM   1765  C  CB  . PRO A 1 243 ? 6.373   -41.285  22.018  1.00 28.95  ? 246  PRO A CB  1 
ATOM   1766  C  CG  . PRO A 1 243 ? 6.681   -39.881  21.606  1.00 29.87  ? 246  PRO A CG  1 
ATOM   1767  C  CD  . PRO A 1 243 ? 7.368   -39.989  20.271  1.00 28.36  ? 246  PRO A CD  1 
ATOM   1768  N  N   . SER A 1 244 ? 7.003   -44.467  21.726  1.00 30.42  ? 247  SER A N   1 
ATOM   1769  C  CA  . SER A 1 244 ? 6.684   -45.830  21.272  1.00 29.84  ? 247  SER A CA  1 
ATOM   1770  C  C   . SER A 1 244 ? 5.248   -45.992  20.771  1.00 29.17  ? 247  SER A C   1 
ATOM   1771  O  O   . SER A 1 244 ? 4.926   -46.975  20.085  1.00 29.16  ? 247  SER A O   1 
ATOM   1772  C  CB  . SER A 1 244 ? 6.931   -46.828  22.403  1.00 30.07  ? 247  SER A CB  1 
ATOM   1773  O  OG  . SER A 1 244 ? 5.841   -46.789  23.307  1.00 32.06  ? 247  SER A OG  1 
ATOM   1774  N  N   . HIS A 1 245 ? 4.375   -45.047  21.105  1.00 26.33  ? 248  HIS A N   1 
ATOM   1775  C  CA  . HIS A 1 245 ? 2.994   -45.180  20.660  1.00 25.92  ? 248  HIS A CA  1 
ATOM   1776  C  C   . HIS A 1 245 ? 2.744   -44.601  19.270  1.00 27.38  ? 248  HIS A C   1 
ATOM   1777  O  O   . HIS A 1 245 ? 1.636   -44.707  18.725  1.00 25.82  ? 248  HIS A O   1 
ATOM   1778  C  CB  . HIS A 1 245 ? 2.029   -44.661  21.725  1.00 24.00  ? 248  HIS A CB  1 
ATOM   1779  C  CG  . HIS A 1 245 ? 2.132   -43.182  21.985  1.00 25.23  ? 248  HIS A CG  1 
ATOM   1780  N  ND1 . HIS A 1 245 ? 3.227   -42.612  22.520  1.00 25.34  ? 248  HIS A ND1 1 
ATOM   1781  C  CD2 . HIS A 1 245 ? 1.214   -42.147  21.773  1.00 24.61  ? 248  HIS A CD2 1 
ATOM   1782  C  CE1 . HIS A 1 245 ? 3.027   -41.284  22.638  1.00 25.41  ? 248  HIS A CE1 1 
ATOM   1783  N  NE2 . HIS A 1 245 ? 1.788   -41.006  22.189  1.00 24.24  ? 248  HIS A NE2 1 
ATOM   1784  N  N   . TRP A 1 246 ? 3.777   -43.995  18.678  1.00 27.09  ? 249  TRP A N   1 
ATOM   1785  C  CA  . TRP A 1 246 ? 3.714   -43.541  17.281  1.00 28.87  ? 249  TRP A CA  1 
ATOM   1786  C  C   . TRP A 1 246 ? 3.847   -44.702  16.319  1.00 29.80  ? 249  TRP A C   1 
ATOM   1787  O  O   . TRP A 1 246 ? 4.333   -45.768  16.692  1.00 30.57  ? 249  TRP A O   1 
ATOM   1788  C  CB  . TRP A 1 246 ? 4.844   -42.563  16.984  1.00 26.90  ? 249  TRP A CB  1 
ATOM   1789  C  CG  . TRP A 1 246 ? 4.726   -41.180  17.575  1.00 26.60  ? 249  TRP A CG  1 
ATOM   1790  C  CD1 . TRP A 1 246 ? 4.225   -40.813  18.827  1.00 26.20  ? 249  TRP A CD1 1 
ATOM   1791  C  CD2 . TRP A 1 246 ? 5.190   -39.915  16.964  1.00 27.01  ? 249  TRP A CD2 1 
ATOM   1792  N  NE1 . TRP A 1 246 ? 4.316   -39.458  19.010  1.00 26.62  ? 249  TRP A NE1 1 
ATOM   1793  C  CE2 . TRP A 1 246 ? 4.888   -38.856  17.934  1.00 26.62  ? 249  TRP A CE2 1 
ATOM   1794  C  CE3 . TRP A 1 246 ? 5.779   -39.569  15.745  1.00 27.19  ? 249  TRP A CE3 1 
ATOM   1795  C  CZ2 . TRP A 1 246 ? 5.185   -37.518  17.682  1.00 26.13  ? 249  TRP A CZ2 1 
ATOM   1796  C  CZ3 . TRP A 1 246 ? 6.068   -38.206  15.501  1.00 26.83  ? 249  TRP A CZ3 1 
ATOM   1797  C  CH2 . TRP A 1 246 ? 5.776   -37.211  16.450  1.00 25.17  ? 249  TRP A CH2 1 
ATOM   1798  N  N   . THR A 1 247 ? 3.453   -44.486  15.064  1.00 30.03  ? 250  THR A N   1 
ATOM   1799  C  CA  . THR A 1 247 ? 3.731   -45.423  13.980  1.00 30.09  ? 250  THR A CA  1 
ATOM   1800  C  C   . THR A 1 247 ? 4.978   -44.947  13.242  1.00 32.20  ? 250  THR A C   1 
ATOM   1801  O  O   . THR A 1 247 ? 5.018   -43.808  12.726  1.00 31.67  ? 250  THR A O   1 
ATOM   1802  C  CB  . THR A 1 247 ? 2.553   -45.500  12.973  1.00 31.75  ? 250  THR A CB  1 
ATOM   1803  O  OG1 . THR A 1 247 ? 1.356   -45.891  13.653  1.00 35.02  ? 250  THR A OG1 1 
ATOM   1804  C  CG2 . THR A 1 247 ? 2.826   -46.494  11.854  1.00 29.60  ? 250  THR A CG2 1 
ATOM   1805  N  N   . VAL A 1 248 ? 5.991   -45.815  13.217  1.00 32.26  ? 251  VAL A N   1 
ATOM   1806  C  CA  . VAL A 1 248 ? 7.165   -45.671  12.363  1.00 32.94  ? 251  VAL A CA  1 
ATOM   1807  C  C   . VAL A 1 248 ? 6.868   -46.407  11.060  1.00 36.33  ? 251  VAL A C   1 
ATOM   1808  O  O   . VAL A 1 248 ? 6.535   -47.602  11.076  1.00 37.37  ? 251  VAL A O   1 
ATOM   1809  C  CB  . VAL A 1 248 ? 8.412   -46.305  13.016  1.00 34.46  ? 251  VAL A CB  1 
ATOM   1810  C  CG1 . VAL A 1 248 ? 9.680   -45.970  12.237  1.00 33.80  ? 251  VAL A CG1 1 
ATOM   1811  C  CG2 . VAL A 1 248 ? 8.545   -45.852  14.467  1.00 32.43  ? 251  VAL A CG2 1 
ATOM   1812  N  N   . VAL A 1 249 ? 6.977   -45.698  9.935   1.00 34.72  ? 252  VAL A N   1 
ATOM   1813  C  CA  . VAL A 1 249 ? 6.721   -46.300  8.628   1.00 33.90  ? 252  VAL A CA  1 
ATOM   1814  C  C   . VAL A 1 249 ? 7.902   -47.203  8.253   1.00 36.50  ? 252  VAL A C   1 
ATOM   1815  O  O   . VAL A 1 249 ? 9.062   -46.797  8.373   1.00 37.79  ? 252  VAL A O   1 
ATOM   1816  C  CB  . VAL A 1 249 ? 6.415   -45.224  7.548   1.00 32.56  ? 252  VAL A CB  1 
ATOM   1817  C  CG1 . VAL A 1 249 ? 6.146   -45.851  6.193   1.00 30.43  ? 252  VAL A CG1 1 
ATOM   1818  C  CG2 . VAL A 1 249 ? 5.207   -44.404  7.973   1.00 31.89  ? 252  VAL A CG2 1 
ATOM   1819  N  N   . PRO A 1 250 ? 7.614   -48.447  7.825   1.00 39.64  ? 253  PRO A N   1 
ATOM   1820  C  CA  . PRO A 1 250 ? 8.706   -49.384  7.518   1.00 40.65  ? 253  PRO A CA  1 
ATOM   1821  C  C   . PRO A 1 250 ? 9.498   -49.009  6.269   1.00 42.51  ? 253  PRO A C   1 
ATOM   1822  O  O   . PRO A 1 250 ? 10.729  -49.041  6.304   1.00 44.38  ? 253  PRO A O   1 
ATOM   1823  C  CB  . PRO A 1 250 ? 7.986   -50.721  7.332   1.00 40.23  ? 253  PRO A CB  1 
ATOM   1824  C  CG  . PRO A 1 250 ? 6.687   -50.552  8.057   1.00 41.48  ? 253  PRO A CG  1 
ATOM   1825  C  CD  . PRO A 1 250 ? 6.304   -49.121  7.847   1.00 38.76  ? 253  PRO A CD  1 
ATOM   1826  N  N   . ASP A 1 251 ? 8.801   -48.640  5.192   1.00 44.83  ? 254  ASP A N   1 
ATOM   1827  C  CA  . ASP A 1 251 ? 9.445   -48.289  3.920   1.00 45.06  ? 254  ASP A CA  1 
ATOM   1828  C  C   . ASP A 1 251 ? 10.232  -47.014  4.096   1.00 43.41  ? 254  ASP A C   1 
ATOM   1829  O  O   . ASP A 1 251 ? 9.780   -46.093  4.750   1.00 42.12  ? 254  ASP A O   1 
ATOM   1830  C  CB  . ASP A 1 251 ? 8.412   -48.065  2.819   1.00 47.64  ? 254  ASP A CB  1 
ATOM   1831  C  CG  . ASP A 1 251 ? 7.089   -48.711  3.128   1.00 54.17  ? 254  ASP A CG  1 
ATOM   1832  O  OD1 . ASP A 1 251 ? 7.048   -49.949  3.332   1.00 59.40  ? 254  ASP A OD1 1 
ATOM   1833  O  OD2 . ASP A 1 251 ? 6.085   -47.976  3.177   1.00 57.13  ? 254  ASP A OD2 1 
ATOM   1834  N  N   . GLU A 1 252 ? 11.411  -46.965  3.501   1.00 45.49  ? 255  GLU A N   1 
ATOM   1835  C  CA  . GLU A 1 252 ? 12.289  -45.820  3.657   1.00 45.01  ? 255  GLU A CA  1 
ATOM   1836  C  C   . GLU A 1 252 ? 12.656  -45.237  2.293   1.00 43.09  ? 255  GLU A C   1 
ATOM   1837  O  O   . GLU A 1 252 ? 13.635  -44.497  2.154   1.00 43.16  ? 255  GLU A O   1 
ATOM   1838  C  CB  . GLU A 1 252 ? 13.516  -46.209  4.483   1.00 45.60  ? 255  GLU A CB  1 
ATOM   1839  C  CG  . GLU A 1 252 ? 13.208  -46.367  5.968   1.00 48.75  ? 255  GLU A CG  1 
ATOM   1840  C  CD  . GLU A 1 252 ? 14.217  -47.233  6.701   1.00 51.72  ? 255  GLU A CD  1 
ATOM   1841  O  OE1 . GLU A 1 252 ? 15.436  -47.024  6.519   1.00 52.52  ? 255  GLU A OE1 1 
ATOM   1842  O  OE2 . GLU A 1 252 ? 13.792  -48.125  7.469   1.00 54.67  ? 255  GLU A OE2 1 
ATOM   1843  N  N   . ASP A 1 253 ? 11.842  -45.585  1.301   1.00 42.36  ? 256  ASP A N   1 
ATOM   1844  C  CA  . ASP A 1 253 ? 11.922  -45.021  -0.048  1.00 44.27  ? 256  ASP A CA  1 
ATOM   1845  C  C   . ASP A 1 253 ? 10.565  -44.473  -0.451  1.00 39.72  ? 256  ASP A C   1 
ATOM   1846  O  O   . ASP A 1 253 ? 9.569   -45.205  -0.493  1.00 38.27  ? 256  ASP A O   1 
ATOM   1847  C  CB  . ASP A 1 253 ? 12.367  -46.081  -1.058  1.00 48.18  ? 256  ASP A CB  1 
ATOM   1848  C  CG  . ASP A 1 253 ? 13.803  -46.512  -0.858  1.00 55.58  ? 256  ASP A CG  1 
ATOM   1849  O  OD1 . ASP A 1 253 ? 14.055  -47.733  -0.910  1.00 61.67  ? 256  ASP A OD1 1 
ATOM   1850  O  OD2 . ASP A 1 253 ? 14.682  -45.646  -0.642  1.00 59.23  ? 256  ASP A OD2 1 
ATOM   1851  N  N   . PHE A 1 254 ? 10.536  -43.182  -0.757  1.00 36.88  ? 257  PHE A N   1 
ATOM   1852  C  CA  . PHE A 1 254 ? 9.286   -42.486  -1.057  1.00 35.52  ? 257  PHE A CA  1 
ATOM   1853  C  C   . PHE A 1 254 ? 9.363   -41.779  -2.411  1.00 32.66  ? 257  PHE A C   1 
ATOM   1854  O  O   . PHE A 1 254 ? 10.450  -41.446  -2.892  1.00 33.38  ? 257  PHE A O   1 
ATOM   1855  C  CB  . PHE A 1 254 ? 8.960   -41.458  0.055   1.00 34.22  ? 257  PHE A CB  1 
ATOM   1856  C  CG  . PHE A 1 254 ? 8.767   -42.064  1.422   1.00 32.55  ? 257  PHE A CG  1 
ATOM   1857  C  CD1 . PHE A 1 254 ? 7.501   -42.428  1.861   1.00 32.92  ? 257  PHE A CD1 1 
ATOM   1858  C  CD2 . PHE A 1 254 ? 9.853   -42.260  2.273   1.00 33.41  ? 257  PHE A CD2 1 
ATOM   1859  C  CE1 . PHE A 1 254 ? 7.313   -42.978  3.112   1.00 32.97  ? 257  PHE A CE1 1 
ATOM   1860  C  CE2 . PHE A 1 254 ? 9.678   -42.810  3.529   1.00 32.98  ? 257  PHE A CE2 1 
ATOM   1861  C  CZ  . PHE A 1 254 ? 8.403   -43.176  3.948   1.00 35.16  ? 257  PHE A CZ  1 
ATOM   1862  N  N   . VAL A 1 255 ? 8.219   -41.544  -3.034  1.00 30.67  ? 258  VAL A N   1 
ATOM   1863  C  CA  . VAL A 1 255 ? 8.220   -40.541  -4.096  1.00 31.17  ? 258  VAL A CA  1 
ATOM   1864  C  C   . VAL A 1 255 ? 7.838   -39.182  -3.489  1.00 29.95  ? 258  VAL A C   1 
ATOM   1865  O  O   . VAL A 1 255 ? 8.453   -38.160  -3.813  1.00 30.04  ? 258  VAL A O   1 
ATOM   1866  C  CB  . VAL A 1 255 ? 7.432   -40.953  -5.383  1.00 31.06  ? 258  VAL A CB  1 
ATOM   1867  C  CG1 . VAL A 1 255 ? 7.475   -42.458  -5.585  1.00 31.08  ? 258  VAL A CG1 1 
ATOM   1868  C  CG2 . VAL A 1 255 ? 6.005   -40.450  -5.389  1.00 31.99  ? 258  VAL A CG2 1 
ATOM   1869  N  N   . LEU A 1 256 ? 6.873   -39.192  -2.563  1.00 29.56  ? 259  LEU A N   1 
ATOM   1870  C  CA  . LEU A 1 256 ? 6.469   -37.979  -1.824  1.00 28.41  ? 259  LEU A CA  1 
ATOM   1871  C  C   . LEU A 1 256 ? 5.841   -38.246  -0.445  1.00 27.51  ? 259  LEU A C   1 
ATOM   1872  O  O   . LEU A 1 256 ? 5.219   -39.298  -0.204  1.00 28.58  ? 259  LEU A O   1 
ATOM   1873  C  CB  . LEU A 1 256 ? 5.512   -37.107  -2.665  1.00 26.76  ? 259  LEU A CB  1 
ATOM   1874  C  CG  . LEU A 1 256 ? 4.072   -37.630  -2.833  1.00 27.48  ? 259  LEU A CG  1 
ATOM   1875  C  CD1 . LEU A 1 256 ? 3.183   -37.218  -1.660  1.00 26.33  ? 259  LEU A CD1 1 
ATOM   1876  C  CD2 . LEU A 1 256 ? 3.457   -37.189  -4.158  1.00 25.44  ? 259  LEU A CD2 1 
ATOM   1877  N  N   . VAL A 1 257 ? 5.999   -37.265  0.441   1.00 26.40  ? 260  VAL A N   1 
ATOM   1878  C  CA  . VAL A 1 257 ? 5.249   -37.180  1.687   1.00 25.49  ? 260  VAL A CA  1 
ATOM   1879  C  C   . VAL A 1 257 ? 4.575   -35.808  1.754   1.00 25.02  ? 260  VAL A C   1 
ATOM   1880  O  O   . VAL A 1 257 ? 5.147   -34.802  1.363   1.00 26.00  ? 260  VAL A O   1 
ATOM   1881  C  CB  . VAL A 1 257 ? 6.162   -37.393  2.912   1.00 26.22  ? 260  VAL A CB  1 
ATOM   1882  C  CG1 . VAL A 1 257 ? 5.362   -37.317  4.208   1.00 26.29  ? 260  VAL A CG1 1 
ATOM   1883  C  CG2 . VAL A 1 257 ? 6.876   -38.742  2.807   1.00 25.03  ? 260  VAL A CG2 1 
ATOM   1884  N  N   . LEU A 1 258 ? 3.353   -35.784  2.249   1.00 23.47  ? 261  LEU A N   1 
ATOM   1885  C  CA  . LEU A 1 258 ? 2.565   -34.587  2.248   1.00 23.60  ? 261  LEU A CA  1 
ATOM   1886  C  C   . LEU A 1 258 ? 1.715   -34.486  3.500   1.00 23.24  ? 261  LEU A C   1 
ATOM   1887  O  O   . LEU A 1 258 ? 0.853   -35.338  3.769   1.00 23.24  ? 261  LEU A O   1 
ATOM   1888  C  CB  . LEU A 1 258 ? 1.674   -34.526  0.989   1.00 23.52  ? 261  LEU A CB  1 
ATOM   1889  C  CG  . LEU A 1 258 ? 0.573   -33.449  0.958   1.00 23.24  ? 261  LEU A CG  1 
ATOM   1890  C  CD1 . LEU A 1 258 ? 1.168   -32.051  1.084   1.00 23.22  ? 261  LEU A CD1 1 
ATOM   1891  C  CD2 . LEU A 1 258 ? -0.217  -33.561  -0.332  1.00 22.82  ? 261  LEU A CD2 1 
ATOM   1892  N  N   . ALA A 1 259 ? 1.980   -33.431  4.260   1.00 24.27  ? 262  ALA A N   1 
ATOM   1893  C  CA  . ALA A 1 259 ? 1.166   -33.065  5.400   1.00 23.69  ? 262  ALA A CA  1 
ATOM   1894  C  C   . ALA A 1 259 ? 0.300   -31.894  4.925   1.00 23.97  ? 262  ALA A C   1 
ATOM   1895  O  O   . ALA A 1 259 ? 0.819   -30.889  4.432   1.00 23.21  ? 262  ALA A O   1 
ATOM   1896  C  CB  . ALA A 1 259 ? 2.056   -32.666  6.567   1.00 23.76  ? 262  ALA A CB  1 
ATOM   1897  N  N   . LEU A 1 260 ? -1.017  -32.043  5.041   1.00 22.75  ? 263  LEU A N   1 
ATOM   1898  C  CA  . LEU A 1 260 ? -1.935  -31.069  4.483   1.00 22.04  ? 263  LEU A CA  1 
ATOM   1899  C  C   . LEU A 1 260 ? -3.083  -30.776  5.439   1.00 21.89  ? 263  LEU A C   1 
ATOM   1900  O  O   . LEU A 1 260 ? -3.791  -31.675  5.878   1.00 21.49  ? 263  LEU A O   1 
ATOM   1901  C  CB  . LEU A 1 260 ? -2.483  -31.589  3.144   1.00 21.94  ? 263  LEU A CB  1 
ATOM   1902  C  CG  . LEU A 1 260 ? -3.532  -30.744  2.435   1.00 21.43  ? 263  LEU A CG  1 
ATOM   1903  C  CD1 . LEU A 1 260 ? -2.863  -29.487  1.873   1.00 21.34  ? 263  LEU A CD1 1 
ATOM   1904  C  CD2 . LEU A 1 260 ? -4.194  -31.569  1.330   1.00 21.40  ? 263  LEU A CD2 1 
ATOM   1905  N  N   . LEU A 1 261 ? -3.290  -29.498  5.726   1.00 22.55  ? 264  LEU A N   1 
ATOM   1906  C  CA  . LEU A 1 261 ? -4.284  -29.093  6.706   1.00 21.93  ? 264  LEU A CA  1 
ATOM   1907  C  C   . LEU A 1 261 ? -5.646  -28.823  6.067   1.00 21.67  ? 264  LEU A C   1 
ATOM   1908  O  O   . LEU A 1 261 ? -6.621  -28.610  6.769   1.00 20.23  ? 264  LEU A O   1 
ATOM   1909  C  CB  . LEU A 1 261 ? -3.804  -27.856  7.467   1.00 21.59  ? 264  LEU A CB  1 
ATOM   1910  C  CG  . LEU A 1 261 ? -2.765  -28.017  8.595   1.00 24.04  ? 264  LEU A CG  1 
ATOM   1911  C  CD1 . LEU A 1 261 ? -1.427  -28.483  8.047   1.00 23.13  ? 264  LEU A CD1 1 
ATOM   1912  C  CD2 . LEU A 1 261 ? -2.586  -26.684  9.321   1.00 22.73  ? 264  LEU A CD2 1 
ATOM   1913  N  N   . HIS A 1 262 ? -5.715  -28.814  4.742   1.00 21.83  ? 265  HIS A N   1 
ATOM   1914  C  CA  . HIS A 1 262 ? -6.945  -28.384  4.078   1.00 24.08  ? 265  HIS A CA  1 
ATOM   1915  C  C   . HIS A 1 262 ? -7.289  -29.298  2.938   1.00 24.40  ? 265  HIS A C   1 
ATOM   1916  O  O   . HIS A 1 262 ? -6.569  -30.282  2.704   1.00 26.10  ? 265  HIS A O   1 
ATOM   1917  C  CB  . HIS A 1 262 ? -6.840  -26.911  3.639   1.00 23.57  ? 265  HIS A CB  1 
ATOM   1918  C  CG  . HIS A 1 262 ? -6.847  -25.940  4.791   1.00 23.92  ? 265  HIS A CG  1 
ATOM   1919  N  ND1 . HIS A 1 262 ? -7.991  -25.488  5.351   1.00 25.30  ? 265  HIS A ND1 1 
ATOM   1920  C  CD2 . HIS A 1 262 ? -5.793  -25.363  5.522   1.00 23.13  ? 265  HIS A CD2 1 
ATOM   1921  C  CE1 . HIS A 1 262 ? -7.689  -24.651  6.377   1.00 23.44  ? 265  HIS A CE1 1 
ATOM   1922  N  NE2 . HIS A 1 262 ? -6.345  -24.588  6.483   1.00 23.40  ? 265  HIS A NE2 1 
ATOM   1923  N  N   . SER A 1 263 ? -8.382  -29.005  2.230   1.00 23.67  ? 266  SER A N   1 
ATOM   1924  C  CA  . SER A 1 263 ? -8.849  -29.889  1.160   1.00 25.27  ? 266  SER A CA  1 
ATOM   1925  C  C   . SER A 1 263 ? -8.039  -29.738  -0.118  1.00 25.52  ? 266  SER A C   1 
ATOM   1926  O  O   . SER A 1 263 ? -7.863  -30.693  -0.870  1.00 25.54  ? 266  SER A O   1 
ATOM   1927  C  CB  . SER A 1 263 ? -10.326 -29.653  0.867   1.00 25.33  ? 266  SER A CB  1 
ATOM   1928  O  OG  . SER A 1 263 ? -10.536 -28.306  0.497   1.00 26.69  ? 266  SER A OG  1 
ATOM   1929  N  N   . HIS A 1 264 ? -7.503  -28.548  -0.353  1.00 24.54  ? 267  HIS A N   1 
ATOM   1930  C  CA  . HIS A 1 264 ? -6.838  -28.302  -1.625  1.00 22.70  ? 267  HIS A CA  1 
ATOM   1931  C  C   . HIS A 1 264 ? -5.382  -28.032  -1.517  1.00 22.96  ? 267  HIS A C   1 
ATOM   1932  O  O   . HIS A 1 264 ? -4.956  -27.275  -0.641  1.00 22.80  ? 267  HIS A O   1 
ATOM   1933  C  CB  . HIS A 1 264 ? -7.521  -27.169  -2.344  1.00 21.69  ? 267  HIS A CB  1 
ATOM   1934  C  CG  . HIS A 1 264 ? -8.836  -27.550  -2.931  1.00 20.76  ? 267  HIS A CG  1 
ATOM   1935  N  ND1 . HIS A 1 264 ? -9.926  -27.769  -2.173  1.00 20.90  ? 267  HIS A ND1 1 
ATOM   1936  C  CD2 . HIS A 1 264 ? -9.219  -27.759  -4.253  1.00 19.41  ? 267  HIS A CD2 1 
ATOM   1937  C  CE1 . HIS A 1 264 ? -10.953 -28.105  -2.976  1.00 20.34  ? 267  HIS A CE1 1 
ATOM   1938  N  NE2 . HIS A 1 264 ? -10.517 -28.084  -4.243  1.00 19.47  ? 267  HIS A NE2 1 
ATOM   1939  N  N   . LEU A 1 265 ? -4.617  -28.656  -2.417  1.00 23.57  ? 268  LEU A N   1 
ATOM   1940  C  CA  . LEU A 1 265 ? -3.199  -28.362  -2.640  1.00 25.46  ? 268  LEU A CA  1 
ATOM   1941  C  C   . LEU A 1 265 ? -2.962  -27.213  -3.624  1.00 25.64  ? 268  LEU A C   1 
ATOM   1942  O  O   . LEU A 1 265 ? -1.835  -26.749  -3.792  1.00 27.42  ? 268  LEU A O   1 
ATOM   1943  C  CB  . LEU A 1 265 ? -2.516  -29.571  -3.243  1.00 26.50  ? 268  LEU A CB  1 
ATOM   1944  C  CG  . LEU A 1 265 ? -1.571  -30.501  -2.521  1.00 28.92  ? 268  LEU A CG  1 
ATOM   1945  C  CD1 . LEU A 1 265 ? -1.110  -31.495  -3.577  1.00 27.60  ? 268  LEU A CD1 1 
ATOM   1946  C  CD2 . LEU A 1 265 ? -0.386  -29.764  -1.904  1.00 29.33  ? 268  LEU A CD2 1 
ATOM   1947  N  N   . GLY A 1 266 ? -4.012  -26.789  -4.305  1.00 25.72  ? 269  GLY A N   1 
ATOM   1948  C  CA  . GLY A 1 266 ? -3.906  -25.821  -5.395  1.00 25.75  ? 269  GLY A CA  1 
ATOM   1949  C  C   . GLY A 1 266 ? -5.313  -25.567  -5.857  1.00 26.33  ? 269  GLY A C   1 
ATOM   1950  O  O   . GLY A 1 266 ? -6.199  -26.341  -5.524  1.00 26.67  ? 269  GLY A O   1 
ATOM   1951  N  N   . SER A 1 267 ? -5.530  -24.513  -6.643  1.00 28.95  ? 270  SER A N   1 
ATOM   1952  C  CA  . SER A 1 267 ? -6.877  -24.132  -7.061  1.00 29.62  ? 270  SER A CA  1 
ATOM   1953  C  C   . SER A 1 267 ? -7.617  -25.204  -7.854  1.00 30.59  ? 270  SER A C   1 
ATOM   1954  O  O   . SER A 1 267 ? -8.858  -25.215  -7.893  1.00 33.00  ? 270  SER A O   1 
ATOM   1955  C  CB  . SER A 1 267 ? -6.878  -22.776  -7.799  1.00 32.58  ? 270  SER A CB  1 
ATOM   1956  O  OG  . SER A 1 267 ? -6.248  -22.849  -9.065  1.00 34.12  ? 270  SER A OG  1 
ATOM   1957  N  N   . GLU A 1 268 ? -6.870  -26.107  -8.480  1.00 32.02  ? 271  GLU A N   1 
ATOM   1958  C  CA  . GLU A 1 268 ? -7.477  -27.236  -9.209  1.00 33.79  ? 271  GLU A CA  1 
ATOM   1959  C  C   . GLU A 1 268 ? -6.902  -28.592  -8.778  1.00 33.29  ? 271  GLU A C   1 
ATOM   1960  O  O   . GLU A 1 268 ? -6.738  -29.519  -9.589  1.00 32.72  ? 271  GLU A O   1 
ATOM   1961  C  CB  . GLU A 1 268 ? -7.388  -27.015  -10.732 1.00 34.56  ? 271  GLU A CB  1 
ATOM   1962  C  CG  . GLU A 1 268 ? -8.476  -26.057  -11.198 1.00 39.69  ? 271  GLU A CG  1 
ATOM   1963  C  CD  . GLU A 1 268 ? -8.477  -25.773  -12.692 1.00 41.13  ? 271  GLU A CD  1 
ATOM   1964  O  OE1 . GLU A 1 268 ? -9.535  -26.010  -13.318 1.00 40.85  ? 271  GLU A OE1 1 
ATOM   1965  O  OE2 . GLU A 1 268 ? -7.445  -25.298  -13.221 1.00 40.32  ? 271  GLU A OE2 1 
ATOM   1966  N  N   . MET A 1 269 ? -6.608  -28.687  -7.482  1.00 31.51  ? 272  MET A N   1 
ATOM   1967  C  CA  . MET A 1 269 ? -6.087  -29.903  -6.875  1.00 30.16  ? 272  MET A CA  1 
ATOM   1968  C  C   . MET A 1 269 ? -6.892  -30.188  -5.599  1.00 28.35  ? 272  MET A C   1 
ATOM   1969  O  O   . MET A 1 269 ? -6.553  -29.716  -4.521  1.00 27.97  ? 272  MET A O   1 
ATOM   1970  C  CB  . MET A 1 269 ? -4.575  -29.774  -6.602  1.00 31.50  ? 272  MET A CB  1 
ATOM   1971  C  CG  . MET A 1 269 ? -3.722  -29.618  -7.860  1.00 31.88  ? 272  MET A CG  1 
ATOM   1972  S  SD  . MET A 1 269 ? -1.937  -29.639  -7.575  1.00 36.51  ? 272  MET A SD  1 
ATOM   1973  C  CE  . MET A 1 269 ? -1.604  -27.892  -7.387  1.00 35.19  ? 272  MET A CE  1 
ATOM   1974  N  N   . PHE A 1 270 ? -7.983  -30.931  -5.750  1.00 27.03  ? 273  PHE A N   1 
ATOM   1975  C  CA  . PHE A 1 270 ? -8.821  -31.360  -4.639  1.00 28.27  ? 273  PHE A CA  1 
ATOM   1976  C  C   . PHE A 1 270 ? -8.166  -32.604  -4.007  1.00 28.66  ? 273  PHE A C   1 
ATOM   1977  O  O   . PHE A 1 270 ? -8.625  -33.734  -4.201  1.00 28.81  ? 273  PHE A O   1 
ATOM   1978  C  CB  . PHE A 1 270 ? -10.238 -31.635  -5.166  1.00 28.16  ? 273  PHE A CB  1 
ATOM   1979  C  CG  . PHE A 1 270 ? -11.279 -31.881  -4.094  1.00 29.36  ? 273  PHE A CG  1 
ATOM   1980  C  CD1 . PHE A 1 270 ? -11.011 -31.649  -2.753  1.00 30.22  ? 273  PHE A CD1 1 
ATOM   1981  C  CD2 . PHE A 1 270 ? -12.553 -32.319  -4.452  1.00 29.85  ? 273  PHE A CD2 1 
ATOM   1982  C  CE1 . PHE A 1 270 ? -11.986 -31.873  -1.781  1.00 33.39  ? 273  PHE A CE1 1 
ATOM   1983  C  CE2 . PHE A 1 270 ? -13.537 -32.535  -3.497  1.00 31.91  ? 273  PHE A CE2 1 
ATOM   1984  C  CZ  . PHE A 1 270 ? -13.257 -32.309  -2.155  1.00 33.08  ? 273  PHE A CZ  1 
ATOM   1985  N  N   . ALA A 1 271 ? -7.066  -32.377  -3.280  1.00 26.81  ? 274  ALA A N   1 
ATOM   1986  C  CA  . ALA A 1 271 ? -6.188  -33.455  -2.792  1.00 26.22  ? 274  ALA A CA  1 
ATOM   1987  C  C   . ALA A 1 271 ? -6.781  -34.262  -1.647  1.00 25.60  ? 274  ALA A C   1 
ATOM   1988  O  O   . ALA A 1 271 ? -6.423  -35.422  -1.458  1.00 25.66  ? 274  ALA A O   1 
ATOM   1989  C  CB  . ALA A 1 271 ? -4.828  -32.904  -2.382  1.00 26.31  ? 274  ALA A CB  1 
ATOM   1990  N  N   . ALA A 1 272 ? -7.689  -33.653  -0.894  1.00 24.67  ? 275  ALA A N   1 
ATOM   1991  C  CA  . ALA A 1 272 ? -8.243  -34.293  0.290   1.00 24.84  ? 275  ALA A CA  1 
ATOM   1992  C  C   . ALA A 1 272 ? -9.762  -34.278  0.283   1.00 25.42  ? 275  ALA A C   1 
ATOM   1993  O  O   . ALA A 1 272 ? -10.382 -33.480  0.998   1.00 25.93  ? 275  ALA A O   1 
ATOM   1994  C  CB  . ALA A 1 272 ? -7.706  -33.636  1.552   1.00 23.12  ? 275  ALA A CB  1 
ATOM   1995  N  N   . PRO A 1 273 ? -10.369 -35.173  -0.509  1.00 26.31  ? 276  PRO A N   1 
ATOM   1996  C  CA  . PRO A 1 273 ? -11.817 -35.262  -0.647  1.00 28.29  ? 276  PRO A CA  1 
ATOM   1997  C  C   . PRO A 1 273 ? -12.550 -36.009  0.480   1.00 29.93  ? 276  PRO A C   1 
ATOM   1998  O  O   . PRO A 1 273 ? -13.781 -35.914  0.586   1.00 29.79  ? 276  PRO A O   1 
ATOM   1999  C  CB  . PRO A 1 273 ? -11.987 -36.026  -1.962  1.00 28.72  ? 276  PRO A CB  1 
ATOM   2000  C  CG  . PRO A 1 273 ? -10.771 -36.871  -2.052  1.00 27.96  ? 276  PRO A CG  1 
ATOM   2001  C  CD  . PRO A 1 273 ? -9.676  -36.012  -1.504  1.00 28.32  ? 276  PRO A CD  1 
ATOM   2002  N  N   . MET A 1 274 ? -11.824 -36.774  1.285   1.00 30.58  ? 277  MET A N   1 
ATOM   2003  C  CA  . MET A 1 274 ? -12.434 -37.338  2.465   1.00 33.45  ? 277  MET A CA  1 
ATOM   2004  C  C   . MET A 1 274 ? -12.674 -36.039  3.221   1.00 36.94  ? 277  MET A C   1 
ATOM   2005  O  O   . MET A 1 274 ? -12.031 -35.040  2.902   1.00 42.14  ? 277  MET A O   1 
ATOM   2006  C  CB  . MET A 1 274 ? -11.497 -38.351  3.153   1.00 30.93  ? 277  MET A CB  1 
ATOM   2007  C  CG  . MET A 1 274 ? -10.195 -37.821  3.745   1.00 30.71  ? 277  MET A CG  1 
ATOM   2008  S  SD  . MET A 1 274 ? -9.044  -36.998  2.617   1.00 30.43  ? 277  MET A SD  1 
ATOM   2009  C  CE  . MET A 1 274 ? -8.477  -38.393  1.631   1.00 29.50  ? 277  MET A CE  1 
ATOM   2010  N  N   . GLY A 1 275 ? -13.607 -35.996  4.155   1.00 34.95  ? 278  GLY A N   1 
ATOM   2011  C  CA  . GLY A 1 275 ? -14.039 -34.694  4.668   1.00 34.74  ? 278  GLY A CA  1 
ATOM   2012  C  C   . GLY A 1 275 ? -12.994 -33.717  5.206   1.00 35.66  ? 278  GLY A C   1 
ATOM   2013  O  O   . GLY A 1 275 ? -11.798 -33.999  5.247   1.00 36.11  ? 278  GLY A O   1 
ATOM   2014  N  N   . ARG A 1 276 ? -13.486 -32.550  5.609   1.00 36.26  ? 279  ARG A N   1 
ATOM   2015  C  CA  . ARG A 1 276 ? -12.715 -31.498  6.240   1.00 36.69  ? 279  ARG A CA  1 
ATOM   2016  C  C   . ARG A 1 276 ? -12.092 -31.938  7.575   1.00 37.29  ? 279  ARG A C   1 
ATOM   2017  O  O   . ARG A 1 276 ? -12.711 -32.670  8.356   1.00 38.07  ? 279  ARG A O   1 
ATOM   2018  C  CB  . ARG A 1 276 ? -13.650 -30.308  6.461   1.00 38.45  ? 279  ARG A CB  1 
ATOM   2019  C  CG  . ARG A 1 276 ? -12.987 -29.072  7.019   1.00 41.21  ? 279  ARG A CG  1 
ATOM   2020  C  CD  . ARG A 1 276 ? -13.943 -27.902  7.027   1.00 44.63  ? 279  ARG A CD  1 
ATOM   2021  N  NE  . ARG A 1 276 ? -13.424 -26.821  7.866   1.00 47.09  ? 279  ARG A NE  1 
ATOM   2022  C  CZ  . ARG A 1 276 ? -13.986 -25.619  8.007   1.00 48.94  ? 279  ARG A CZ  1 
ATOM   2023  N  NH1 . ARG A 1 276 ? -15.106 -25.298  7.357   1.00 52.44  ? 279  ARG A NH1 1 
ATOM   2024  N  NH2 . ARG A 1 276 ? -13.419 -24.727  8.808   1.00 46.90  ? 279  ARG A NH2 1 
ATOM   2025  N  N   . CYS A 1 277 ? -10.878 -31.471  7.848   1.00 35.83  ? 280  CYS A N   1 
ATOM   2026  C  CA  . CYS A 1 277 ? -10.188 -31.816  9.094   1.00 35.40  ? 280  CYS A CA  1 
ATOM   2027  C  C   . CYS A 1 277 ? -10.891 -31.351  10.361  1.00 32.47  ? 280  CYS A C   1 
ATOM   2028  O  O   . CYS A 1 277 ? -11.297 -30.183  10.478  1.00 30.24  ? 280  CYS A O   1 
ATOM   2029  C  CB  . CYS A 1 277 ? -8.771  -31.254  9.085   1.00 38.62  ? 280  CYS A CB  1 
ATOM   2030  S  SG  . CYS A 1 277 ? -7.675  -32.051  7.889   1.00 42.41  ? 280  CYS A SG  1 
ATOM   2031  N  N   . ALA A 1 278 ? -11.022 -32.277  11.308  1.00 29.95  ? 281  ALA A N   1 
ATOM   2032  C  CA  . ALA A 1 278 ? -11.436 -31.958  12.675  1.00 29.14  ? 281  ALA A CA  1 
ATOM   2033  C  C   . ALA A 1 278 ? -10.407 -31.081  13.410  1.00 27.79  ? 281  ALA A C   1 
ATOM   2034  O  O   . ALA A 1 278 ? -9.244  -30.978  13.002  1.00 28.72  ? 281  ALA A O   1 
ATOM   2035  C  CB  . ALA A 1 278 ? -11.672 -33.241  13.467  1.00 29.60  ? 281  ALA A CB  1 
ATOM   2036  N  N   . ALA A 1 279 ? -10.836 -30.488  14.515  1.00 25.93  ? 282  ALA A N   1 
ATOM   2037  C  CA  . ALA A 1 279 ? -9.966  -29.676  15.359  1.00 25.03  ? 282  ALA A CA  1 
ATOM   2038  C  C   . ALA A 1 279 ? -8.744  -30.461  15.835  1.00 24.73  ? 282  ALA A C   1 
ATOM   2039  O  O   . ALA A 1 279 ? -8.891  -31.482  16.527  1.00 25.43  ? 282  ALA A O   1 
ATOM   2040  C  CB  . ALA A 1 279 ? -10.751 -29.144  16.553  1.00 24.86  ? 282  ALA A CB  1 
ATOM   2041  N  N   . GLY A 1 280 ? -7.552  -29.981  15.466  1.00 22.92  ? 283  GLY A N   1 
ATOM   2042  C  CA  . GLY A 1 280 ? -6.281  -30.580  15.903  1.00 22.50  ? 283  GLY A CA  1 
ATOM   2043  C  C   . GLY A 1 280 ? -5.779  -31.720  15.023  1.00 22.49  ? 283  GLY A C   1 
ATOM   2044  O  O   . GLY A 1 280 ? -4.795  -32.383  15.346  1.00 21.51  ? 283  GLY A O   1 
ATOM   2045  N  N   . VAL A 1 281 ? -6.466  -31.955  13.911  1.00 22.32  ? 284  VAL A N   1 
ATOM   2046  C  CA  . VAL A 1 281 ? -6.128  -33.062  13.013  1.00 24.59  ? 284  VAL A CA  1 
ATOM   2047  C  C   . VAL A 1 281 ? -5.705  -32.515  11.644  1.00 24.50  ? 284  VAL A C   1 
ATOM   2048  O  O   . VAL A 1 281 ? -6.261  -31.537  11.184  1.00 25.67  ? 284  VAL A O   1 
ATOM   2049  C  CB  . VAL A 1 281 ? -7.330  -34.006  12.827  1.00 25.15  ? 284  VAL A CB  1 
ATOM   2050  C  CG1 . VAL A 1 281 ? -6.954  -35.189  11.951  1.00 26.38  ? 284  VAL A CG1 1 
ATOM   2051  C  CG2 . VAL A 1 281 ? -7.853  -34.470  14.182  1.00 25.36  ? 284  VAL A CG2 1 
ATOM   2052  N  N   . MET A 1 282 ? -4.713  -33.150  11.027  1.00 23.93  ? 285  MET A N   1 
ATOM   2053  C  CA  . MET A 1 282 ? -4.273  -32.825  9.688   1.00 23.58  ? 285  MET A CA  1 
ATOM   2054  C  C   . MET A 1 282 ? -4.206  -34.111  8.859   1.00 23.67  ? 285  MET A C   1 
ATOM   2055  O  O   . MET A 1 282 ? -4.223  -35.226  9.415   1.00 21.62  ? 285  MET A O   1 
ATOM   2056  C  CB  . MET A 1 282 ? -2.920  -32.108  9.706   1.00 24.30  ? 285  MET A CB  1 
ATOM   2057  C  CG  . MET A 1 282 ? -1.717  -33.021  9.789   1.00 24.44  ? 285  MET A CG  1 
ATOM   2058  S  SD  . MET A 1 282 ? -0.158  -32.146  10.046  1.00 26.62  ? 285  MET A SD  1 
ATOM   2059  C  CE  . MET A 1 282 ? -0.220  -30.872  8.827   1.00 28.33  ? 285  MET A CE  1 
ATOM   2060  N  N   . HIS A 1 283 ? -4.164  -33.950  7.533   1.00 22.50  ? 286  HIS A N   1 
ATOM   2061  C  CA  . HIS A 1 283 ? -4.066  -35.086  6.629   1.00 22.26  ? 286  HIS A CA  1 
ATOM   2062  C  C   . HIS A 1 283 ? -2.630  -35.408  6.433   1.00 23.44  ? 286  HIS A C   1 
ATOM   2063  O  O   . HIS A 1 283 ? -1.829  -34.494  6.265   1.00 24.73  ? 286  HIS A O   1 
ATOM   2064  C  CB  . HIS A 1 283 ? -4.629  -34.735  5.263   1.00 21.62  ? 286  HIS A CB  1 
ATOM   2065  C  CG  . HIS A 1 283 ? -6.092  -34.395  5.253   1.00 20.74  ? 286  HIS A CG  1 
ATOM   2066  N  ND1 . HIS A 1 283 ? -6.553  -33.234  4.762   1.00 21.92  ? 286  HIS A ND1 1 
ATOM   2067  C  CD2 . HIS A 1 283 ? -7.199  -35.114  5.660   1.00 20.83  ? 286  HIS A CD2 1 
ATOM   2068  C  CE1 . HIS A 1 283 ? -7.894  -33.205  4.871   1.00 21.63  ? 286  HIS A CE1 1 
ATOM   2069  N  NE2 . HIS A 1 283 ? -8.286  -34.359  5.414   1.00 20.48  ? 286  HIS A NE2 1 
ATOM   2070  N  N   . LEU A 1 284 ? -2.285  -36.701  6.411   1.00 24.07  ? 287  LEU A N   1 
ATOM   2071  C  CA  . LEU A 1 284 ? -0.949  -37.133  5.985   1.00 23.58  ? 287  LEU A CA  1 
ATOM   2072  C  C   . LEU A 1 284 ? -1.013  -38.098  4.797   1.00 24.45  ? 287  LEU A C   1 
ATOM   2073  O  O   . LEU A 1 284 ? -1.667  -39.143  4.861   1.00 26.11  ? 287  LEU A O   1 
ATOM   2074  C  CB  . LEU A 1 284 ? -0.165  -37.763  7.140   1.00 23.13  ? 287  LEU A CB  1 
ATOM   2075  C  CG  . LEU A 1 284 ? 1.289   -38.159  6.870   1.00 23.03  ? 287  LEU A CG  1 
ATOM   2076  C  CD1 . LEU A 1 284 ? 2.188   -36.953  6.680   1.00 22.83  ? 287  LEU A CD1 1 
ATOM   2077  C  CD2 . LEU A 1 284 ? 1.841   -39.031  7.984   1.00 23.47  ? 287  LEU A CD2 1 
ATOM   2078  N  N   . PHE A 1 285 ? -0.335  -37.740  3.712   1.00 23.27  ? 288  PHE A N   1 
ATOM   2079  C  CA  . PHE A 1 285 ? -0.288  -38.581  2.519   1.00 22.99  ? 288  PHE A CA  1 
ATOM   2080  C  C   . PHE A 1 285 ? 1.148   -38.959  2.279   1.00 23.93  ? 288  PHE A C   1 
ATOM   2081  O  O   . PHE A 1 285 ? 2.053   -38.132  2.419   1.00 23.41  ? 288  PHE A O   1 
ATOM   2082  C  CB  . PHE A 1 285 ? -0.775  -37.829  1.284   1.00 21.92  ? 288  PHE A CB  1 
ATOM   2083  C  CG  . PHE A 1 285 ? -2.231  -37.442  1.327   1.00 21.94  ? 288  PHE A CG  1 
ATOM   2084  C  CD1 . PHE A 1 285 ? -3.194  -38.262  0.762   1.00 21.93  ? 288  PHE A CD1 1 
ATOM   2085  C  CD2 . PHE A 1 285 ? -2.629  -36.240  1.896   1.00 22.63  ? 288  PHE A CD2 1 
ATOM   2086  C  CE1 . PHE A 1 285 ? -4.526  -37.897  0.759   1.00 23.06  ? 288  PHE A CE1 1 
ATOM   2087  C  CE2 . PHE A 1 285 ? -3.968  -35.869  1.912   1.00 23.26  ? 288  PHE A CE2 1 
ATOM   2088  C  CZ  . PHE A 1 285 ? -4.917  -36.696  1.345   1.00 24.02  ? 288  PHE A CZ  1 
ATOM   2089  N  N   . TYR A 1 286 ? 1.385   -40.208  1.922   1.00 25.15  ? 289  TYR A N   1 
ATOM   2090  C  CA  . TYR A 1 286 ? 2.683   -40.502  1.331   1.00 29.19  ? 289  TYR A CA  1 
ATOM   2091  C  C   . TYR A 1 286 ? 2.538   -41.497  0.193   1.00 29.92  ? 289  TYR A C   1 
ATOM   2092  O  O   . TYR A 1 286 ? 1.560   -42.256  0.125   1.00 29.13  ? 289  TYR A O   1 
ATOM   2093  C  CB  . TYR A 1 286 ? 3.749   -40.905  2.383   1.00 28.87  ? 289  TYR A CB  1 
ATOM   2094  C  CG  . TYR A 1 286 ? 3.471   -42.175  3.134   1.00 30.72  ? 289  TYR A CG  1 
ATOM   2095  C  CD1 . TYR A 1 286 ? 4.041   -43.386  2.728   1.00 32.74  ? 289  TYR A CD1 1 
ATOM   2096  C  CD2 . TYR A 1 286 ? 2.654   -42.180  4.259   1.00 30.94  ? 289  TYR A CD2 1 
ATOM   2097  C  CE1 . TYR A 1 286 ? 3.799   -44.565  3.425   1.00 31.39  ? 289  TYR A CE1 1 
ATOM   2098  C  CE2 . TYR A 1 286 ? 2.410   -43.351  4.957   1.00 32.51  ? 289  TYR A CE2 1 
ATOM   2099  C  CZ  . TYR A 1 286 ? 2.980   -44.540  4.529   1.00 32.23  ? 289  TYR A CZ  1 
ATOM   2100  O  OH  . TYR A 1 286 ? 2.739   -45.698  5.228   1.00 33.42  ? 289  TYR A OH  1 
ATOM   2101  N  N   . VAL A 1 287 ? 3.492   -41.436  -0.724  1.00 31.84  ? 290  VAL A N   1 
ATOM   2102  C  CA  . VAL A 1 287 ? 3.555   -42.369  -1.834  1.00 33.62  ? 290  VAL A CA  1 
ATOM   2103  C  C   . VAL A 1 287 ? 4.860   -43.149  -1.722  1.00 34.49  ? 290  VAL A C   1 
ATOM   2104  O  O   . VAL A 1 287 ? 5.965   -42.573  -1.782  1.00 32.44  ? 290  VAL A O   1 
ATOM   2105  C  CB  . VAL A 1 287 ? 3.421   -41.677  -3.215  1.00 34.51  ? 290  VAL A CB  1 
ATOM   2106  C  CG1 . VAL A 1 287 ? 3.541   -42.702  -4.340  1.00 33.46  ? 290  VAL A CG1 1 
ATOM   2107  C  CG2 . VAL A 1 287 ? 2.082   -40.978  -3.328  1.00 33.29  ? 290  VAL A CG2 1 
ATOM   2108  N  N   . ARG A 1 288 ? 4.708   -44.458  -1.532  1.00 36.22  ? 291  ARG A N   1 
ATOM   2109  C  CA  . ARG A 1 288 ? 5.840   -45.362  -1.378  1.00 39.90  ? 291  ARG A CA  1 
ATOM   2110  C  C   . ARG A 1 288 ? 6.510   -45.515  -2.726  1.00 40.01  ? 291  ARG A C   1 
ATOM   2111  O  O   . ARG A 1 288 ? 5.843   -45.403  -3.761  1.00 40.40  ? 291  ARG A O   1 
ATOM   2112  C  CB  . ARG A 1 288 ? 5.376   -46.738  -0.895  1.00 43.01  ? 291  ARG A CB  1 
ATOM   2113  C  CG  . ARG A 1 288 ? 4.140   -46.752  0.001   1.00 45.55  ? 291  ARG A CG  1 
ATOM   2114  C  CD  . ARG A 1 288 ? 3.997   -48.061  0.783   1.00 50.21  ? 291  ARG A CD  1 
ATOM   2115  N  NE  . ARG A 1 288 ? 4.765   -49.156  0.180   1.00 55.78  ? 291  ARG A NE  1 
ATOM   2116  C  CZ  . ARG A 1 288 ? 4.251   -50.162  -0.534  1.00 57.80  ? 291  ARG A CZ  1 
ATOM   2117  N  NH1 . ARG A 1 288 ? 2.937   -50.256  -0.738  1.00 57.86  ? 291  ARG A NH1 1 
ATOM   2118  N  NH2 . ARG A 1 288 ? 5.061   -51.087  -1.042  1.00 55.14  ? 291  ARG A NH2 1 
ATOM   2119  N  N   . ALA A 1 289 ? 7.821   -45.750  -2.723  1.00 40.24  ? 292  ALA A N   1 
ATOM   2120  C  CA  . ALA A 1 289 ? 8.543   -46.108  -3.950  1.00 41.48  ? 292  ALA A CA  1 
ATOM   2121  C  C   . ALA A 1 289 ? 7.943   -47.361  -4.570  1.00 41.41  ? 292  ALA A C   1 
ATOM   2122  O  O   . ALA A 1 289 ? 7.624   -48.312  -3.859  1.00 41.10  ? 292  ALA A O   1 
ATOM   2123  C  CB  . ALA A 1 289 ? 10.015  -46.338  -3.659  1.00 42.16  ? 292  ALA A CB  1 
ATOM   2124  N  N   . GLY A 1 290 ? 7.773   -47.349  -5.891  1.00 46.29  ? 293  GLY A N   1 
ATOM   2125  C  CA  . GLY A 1 290 ? 7.243   -48.509  -6.610  1.00 47.09  ? 293  GLY A CA  1 
ATOM   2126  C  C   . GLY A 1 290 ? 6.080   -48.239  -7.555  1.00 49.77  ? 293  GLY A C   1 
ATOM   2127  O  O   . GLY A 1 290 ? 5.661   -49.144  -8.288  1.00 49.06  ? 293  GLY A O   1 
ATOM   2128  N  N   . VAL A 1 291 ? 5.540   -47.018  -7.541  1.00 46.42  ? 294  VAL A N   1 
ATOM   2129  C  CA  . VAL A 1 291 ? 4.520   -46.654  -8.522  1.00 44.43  ? 294  VAL A CA  1 
ATOM   2130  C  C   . VAL A 1 291 ? 5.155   -46.487  -9.880  1.00 41.87  ? 294  VAL A C   1 
ATOM   2131  O  O   . VAL A 1 291 ? 6.334   -46.139  -9.985  1.00 40.76  ? 294  VAL A O   1 
ATOM   2132  C  CB  . VAL A 1 291 ? 3.786   -45.313  -8.237  1.00 45.37  ? 294  VAL A CB  1 
ATOM   2133  C  CG1 . VAL A 1 291 ? 2.489   -45.543  -7.485  1.00 47.86  ? 294  VAL A CG1 1 
ATOM   2134  C  CG2 . VAL A 1 291 ? 4.693   -44.282  -7.581  1.00 41.33  ? 294  VAL A CG2 1 
ATOM   2135  N  N   . SER A 1 292 ? 4.354   -46.714  -10.913 1.00 41.09  ? 295  SER A N   1 
ATOM   2136  C  CA  . SER A 1 292 ? 4.738   -46.360  -12.281 1.00 41.99  ? 295  SER A CA  1 
ATOM   2137  C  C   . SER A 1 292 ? 4.538   -44.862  -12.498 1.00 41.14  ? 295  SER A C   1 
ATOM   2138  O  O   . SER A 1 292 ? 3.634   -44.259  -11.891 1.00 42.55  ? 295  SER A O   1 
ATOM   2139  C  CB  . SER A 1 292 ? 3.883   -47.142  -13.277 1.00 40.76  ? 295  SER A CB  1 
ATOM   2140  O  OG  . SER A 1 292 ? 2.502   -46.846  -13.104 1.00 42.33  ? 295  SER A OG  1 
ATOM   2141  N  N   . ARG A 1 293 ? 5.369   -44.263  -13.350 1.00 39.88  ? 296  ARG A N   1 
ATOM   2142  C  CA  . ARG A 1 293 ? 5.109   -42.905  -13.842 1.00 40.52  ? 296  ARG A CA  1 
ATOM   2143  C  C   . ARG A 1 293 ? 3.641   -42.692  -14.231 1.00 41.21  ? 296  ARG A C   1 
ATOM   2144  O  O   . ARG A 1 293 ? 3.008   -41.746  -13.765 1.00 41.26  ? 296  ARG A O   1 
ATOM   2145  C  CB  . ARG A 1 293 ? 5.981   -42.578  -15.039 1.00 41.68  ? 296  ARG A CB  1 
ATOM   2146  C  CG  . ARG A 1 293 ? 7.451   -42.397  -14.726 1.00 47.64  ? 296  ARG A CG  1 
ATOM   2147  C  CD  . ARG A 1 293 ? 8.213   -42.239  -16.028 1.00 50.31  ? 296  ARG A CD  1 
ATOM   2148  N  NE  . ARG A 1 293 ? 9.659   -42.176  -15.834 1.00 55.41  ? 296  ARG A NE  1 
ATOM   2149  C  CZ  . ARG A 1 293 ? 10.449  -43.243  -15.717 1.00 60.39  ? 296  ARG A CZ  1 
ATOM   2150  N  NH1 . ARG A 1 293 ? 11.758  -43.087  -15.548 1.00 58.66  ? 296  ARG A NH1 1 
ATOM   2151  N  NH2 . ARG A 1 293 ? 9.930   -44.469  -15.758 1.00 61.81  ? 296  ARG A NH2 1 
ATOM   2152  N  N   . ALA A 1 294 ? 3.098   -43.570  -15.073 1.00 38.65  ? 297  ALA A N   1 
ATOM   2153  C  CA  . ALA A 1 294 ? 1.713   -43.424  -15.520 1.00 39.05  ? 297  ALA A CA  1 
ATOM   2154  C  C   . ALA A 1 294 ? 0.723   -43.281  -14.362 1.00 38.81  ? 297  ALA A C   1 
ATOM   2155  O  O   . ALA A 1 294 ? -0.148  -42.413  -14.397 1.00 39.19  ? 297  ALA A O   1 
ATOM   2156  C  CB  . ALA A 1 294 ? 1.304   -44.574  -16.438 1.00 38.76  ? 297  ALA A CB  1 
ATOM   2157  N  N   . MET A 1 295 ? 0.855   -44.135  -13.346 1.00 37.72  ? 298  MET A N   1 
ATOM   2158  C  CA  . MET A 1 295 ? -0.057  -44.116  -12.196 1.00 36.45  ? 298  MET A CA  1 
ATOM   2159  C  C   . MET A 1 295 ? 0.057   -42.815  -11.386 1.00 34.41  ? 298  MET A C   1 
ATOM   2160  O  O   . MET A 1 295 ? -0.950  -42.250  -10.948 1.00 32.98  ? 298  MET A O   1 
ATOM   2161  C  CB  . MET A 1 295 ? 0.168   -45.344  -11.302 1.00 37.36  ? 298  MET A CB  1 
ATOM   2162  C  CG  . MET A 1 295 ? -1.010  -45.678  -10.416 1.00 38.34  ? 298  MET A CG  1 
ATOM   2163  S  SD  . MET A 1 295 ? -2.582  -45.707  -11.293 1.00 46.26  ? 298  MET A SD  1 
ATOM   2164  C  CE  . MET A 1 295 ? -3.700  -45.638  -9.906  1.00 45.26  ? 298  MET A CE  1 
ATOM   2165  N  N   . LEU A 1 296 ? 1.283   -42.339  -11.210 1.00 33.07  ? 299  LEU A N   1 
ATOM   2166  C  CA  . LEU A 1 296 ? 1.513   -41.074  -10.546 1.00 33.33  ? 299  LEU A CA  1 
ATOM   2167  C  C   . LEU A 1 296 ? 0.717   -39.988  -11.279 1.00 34.24  ? 299  LEU A C   1 
ATOM   2168  O  O   . LEU A 1 296 ? -0.049  -39.237  -10.649 1.00 31.81  ? 299  LEU A O   1 
ATOM   2169  C  CB  . LEU A 1 296 ? 3.008   -40.735  -10.518 1.00 33.48  ? 299  LEU A CB  1 
ATOM   2170  C  CG  . LEU A 1 296 ? 3.630   -40.441  -9.143  1.00 35.83  ? 299  LEU A CG  1 
ATOM   2171  C  CD1 . LEU A 1 296 ? 5.003   -39.799  -9.263  1.00 34.11  ? 299  LEU A CD1 1 
ATOM   2172  C  CD2 . LEU A 1 296 ? 2.726   -39.620  -8.223  1.00 34.12  ? 299  LEU A CD2 1 
ATOM   2173  N  N   . LEU A 1 297 ? 0.849   -39.960  -12.614 1.00 33.54  ? 300  LEU A N   1 
ATOM   2174  C  CA  . LEU A 1 297 ? 0.192   -38.952  -13.446 1.00 33.60  ? 300  LEU A CA  1 
ATOM   2175  C  C   . LEU A 1 297 ? -1.314  -39.085  -13.375 1.00 35.26  ? 300  LEU A C   1 
ATOM   2176  O  O   . LEU A 1 297 ? -2.038  -38.082  -13.248 1.00 35.96  ? 300  LEU A O   1 
ATOM   2177  C  CB  . LEU A 1 297 ? 0.664   -39.037  -14.896 1.00 34.16  ? 300  LEU A CB  1 
ATOM   2178  C  CG  . LEU A 1 297 ? 0.180   -37.932  -15.836 1.00 35.89  ? 300  LEU A CG  1 
ATOM   2179  C  CD1 . LEU A 1 297 ? 0.550   -36.536  -15.337 1.00 37.65  ? 300  LEU A CD1 1 
ATOM   2180  C  CD2 . LEU A 1 297 ? 0.716   -38.156  -17.242 1.00 34.32  ? 300  LEU A CD2 1 
ATOM   2181  N  N   . ARG A 1 298 ? -1.781  -40.324  -13.445 1.00 34.74  ? 301  ARG A N   1 
ATOM   2182  C  CA  . ARG A 1 298 ? -3.191  -40.608  -13.276 1.00 36.44  ? 301  ARG A CA  1 
ATOM   2183  C  C   . ARG A 1 298 ? -3.693  -40.128  -11.920 1.00 35.25  ? 301  ARG A C   1 
ATOM   2184  O  O   . ARG A 1 298 ? -4.790  -39.578  -11.840 1.00 34.56  ? 301  ARG A O   1 
ATOM   2185  C  CB  . ARG A 1 298 ? -3.467  -42.102  -13.457 1.00 39.90  ? 301  ARG A CB  1 
ATOM   2186  C  CG  . ARG A 1 298 ? -2.997  -42.657  -14.799 1.00 43.96  ? 301  ARG A CG  1 
ATOM   2187  C  CD  . ARG A 1 298 ? -3.235  -44.158  -14.930 1.00 46.25  ? 301  ARG A CD  1 
ATOM   2188  N  NE  . ARG A 1 298 ? -4.616  -44.439  -15.307 1.00 51.20  ? 301  ARG A NE  1 
ATOM   2189  C  CZ  . ARG A 1 298 ? -5.037  -44.611  -16.559 1.00 57.17  ? 301  ARG A CZ  1 
ATOM   2190  N  NH1 . ARG A 1 298 ? -4.177  -44.552  -17.576 1.00 56.37  ? 301  ARG A NH1 1 
ATOM   2191  N  NH2 . ARG A 1 298 ? -6.324  -44.853  -16.794 1.00 59.03  ? 301  ARG A NH2 1 
ATOM   2192  N  N   . LEU A 1 299 ? -2.896  -40.326  -10.862 1.00 33.83  ? 302  LEU A N   1 
ATOM   2193  C  CA  . LEU A 1 299 ? -3.294  -39.882  -9.515  1.00 33.24  ? 302  LEU A CA  1 
ATOM   2194  C  C   . LEU A 1 299 ? -3.345  -38.342  -9.488  1.00 31.92  ? 302  LEU A C   1 
ATOM   2195  O  O   . LEU A 1 299 ? -4.282  -37.735  -8.937  1.00 29.58  ? 302  LEU A O   1 
ATOM   2196  C  CB  . LEU A 1 299 ? -2.357  -40.442  -8.414  1.00 33.48  ? 302  LEU A CB  1 
ATOM   2197  C  CG  . LEU A 1 299 ? -2.324  -41.952  -8.053  1.00 34.34  ? 302  LEU A CG  1 
ATOM   2198  C  CD1 . LEU A 1 299 ? -1.269  -42.267  -6.996  1.00 33.10  ? 302  LEU A CD1 1 
ATOM   2199  C  CD2 . LEU A 1 299 ? -3.678  -42.508  -7.613  1.00 33.26  ? 302  LEU A CD2 1 
ATOM   2200  N  N   . PHE A 1 300 ? -2.347  -37.740  -10.125 1.00 30.10  ? 303  PHE A N   1 
ATOM   2201  C  CA  . PHE A 1 300 ? -2.283  -36.306  -10.316 1.00 33.15  ? 303  PHE A CA  1 
ATOM   2202  C  C   . PHE A 1 300 ? -3.500  -35.718  -11.026 1.00 33.55  ? 303  PHE A C   1 
ATOM   2203  O  O   . PHE A 1 300 ? -4.067  -34.740  -10.560 1.00 33.59  ? 303  PHE A O   1 
ATOM   2204  C  CB  . PHE A 1 300 ? -1.010  -35.911  -11.067 1.00 33.30  ? 303  PHE A CB  1 
ATOM   2205  C  CG  . PHE A 1 300 ? -0.848  -34.424  -11.227 1.00 35.76  ? 303  PHE A CG  1 
ATOM   2206  C  CD1 . PHE A 1 300 ? -0.471  -33.634  -10.143 1.00 36.35  ? 303  PHE A CD1 1 
ATOM   2207  C  CD2 . PHE A 1 300 ? -1.070  -33.813  -12.454 1.00 35.27  ? 303  PHE A CD2 1 
ATOM   2208  C  CE1 . PHE A 1 300 ? -0.324  -32.267  -10.278 1.00 37.04  ? 303  PHE A CE1 1 
ATOM   2209  C  CE2 . PHE A 1 300 ? -0.917  -32.445  -12.600 1.00 36.55  ? 303  PHE A CE2 1 
ATOM   2210  C  CZ  . PHE A 1 300 ? -0.543  -31.668  -11.512 1.00 37.11  ? 303  PHE A CZ  1 
ATOM   2211  N  N   . LEU A 1 301 ? -3.896  -36.310  -12.152 1.00 35.05  ? 304  LEU A N   1 
ATOM   2212  C  CA  . LEU A 1 301 ? -4.984  -35.754  -12.960 1.00 33.44  ? 304  LEU A CA  1 
ATOM   2213  C  C   . LEU A 1 301 ? -6.350  -35.994  -12.328 1.00 32.72  ? 304  LEU A C   1 
ATOM   2214  O  O   . LEU A 1 301 ? -7.242  -35.159  -12.439 1.00 31.95  ? 304  LEU A O   1 
ATOM   2215  C  CB  . LEU A 1 301 ? -4.931  -36.295  -14.390 1.00 35.97  ? 304  LEU A CB  1 
ATOM   2216  C  CG  . LEU A 1 301 ? -3.693  -35.842  -15.173 1.00 37.26  ? 304  LEU A CG  1 
ATOM   2217  C  CD1 . LEU A 1 301 ? -3.354  -36.834  -16.280 1.00 37.80  ? 304  LEU A CD1 1 
ATOM   2218  C  CD2 . LEU A 1 301 ? -3.847  -34.410  -15.708 1.00 37.28  ? 304  LEU A CD2 1 
ATOM   2219  N  N   . ALA A 1 302 ? -6.505  -37.127  -11.649 1.00 31.86  ? 305  ALA A N   1 
ATOM   2220  C  CA  . ALA A 1 302 ? -7.737  -37.419  -10.926 1.00 32.13  ? 305  ALA A CA  1 
ATOM   2221  C  C   . ALA A 1 302 ? -7.930  -36.448  -9.755  1.00 34.33  ? 305  ALA A C   1 
ATOM   2222  O  O   . ALA A 1 302 ? -9.071  -36.172  -9.334  1.00 32.52  ? 305  ALA A O   1 
ATOM   2223  C  CB  . ALA A 1 302 ? -7.731  -38.855  -10.440 1.00 32.24  ? 305  ALA A CB  1 
ATOM   2224  N  N   . MET A 1 303 ? -6.812  -35.908  -9.265  1.00 34.85  ? 306  MET A N   1 
ATOM   2225  C  CA  . MET A 1 303 ? -6.810  -34.943  -8.171  1.00 35.55  ? 306  MET A CA  1 
ATOM   2226  C  C   . MET A 1 303 ? -7.663  -33.719  -8.478  1.00 38.17  ? 306  MET A C   1 
ATOM   2227  O  O   . MET A 1 303 ? -8.290  -33.146  -7.566  1.00 39.07  ? 306  MET A O   1 
ATOM   2228  C  CB  . MET A 1 303 ? -5.376  -34.534  -7.818  1.00 36.30  ? 306  MET A CB  1 
ATOM   2229  C  CG  . MET A 1 303 ? -5.233  -33.666  -6.574  1.00 35.13  ? 306  MET A CG  1 
ATOM   2230  S  SD  . MET A 1 303 ? -3.603  -33.834  -5.833  1.00 33.31  ? 306  MET A SD  1 
ATOM   2231  C  CE  . MET A 1 303 ? -2.485  -33.260  -7.104  1.00 31.51  ? 306  MET A CE  1 
ATOM   2232  N  N   . GLU A 1 304 ? -7.705  -33.331  -9.753  1.00 37.41  ? 307  GLU A N   1 
ATOM   2233  C  CA  . GLU A 1 304 ? -8.585  -32.254  -10.178 1.00 35.83  ? 307  GLU A CA  1 
ATOM   2234  C  C   . GLU A 1 304 ? -10.027 -32.452  -9.703  1.00 33.94  ? 307  GLU A C   1 
ATOM   2235  O  O   . GLU A 1 304 ? -10.644 -31.512  -9.207  1.00 35.05  ? 307  GLU A O   1 
ATOM   2236  C  CB  . GLU A 1 304 ? -8.527  -32.024  -11.695 1.00 35.88  ? 307  GLU A CB  1 
ATOM   2237  C  CG  . GLU A 1 304 ? -9.501  -30.946  -12.159 1.00 38.47  ? 307  GLU A CG  1 
ATOM   2238  C  CD  . GLU A 1 304 ? -9.506  -30.720  -13.662 1.00 41.85  ? 307  GLU A CD  1 
ATOM   2239  O  OE1 . GLU A 1 304 ? -8.487  -31.022  -14.322 1.00 41.52  ? 307  GLU A OE1 1 
ATOM   2240  O  OE2 . GLU A 1 304 ? -10.538 -30.224  -14.180 1.00 42.24  ? 307  GLU A OE2 1 
ATOM   2241  N  N   . LYS A 1 305 ? -10.568 -33.655  -9.843  1.00 32.74  ? 308  LYS A N   1 
ATOM   2242  C  CA  . LYS A 1 305 ? -11.952 -33.895  -9.403  1.00 34.98  ? 308  LYS A CA  1 
ATOM   2243  C  C   . LYS A 1 305 ? -12.034 -34.607  -8.040  1.00 34.39  ? 308  LYS A C   1 
ATOM   2244  O  O   . LYS A 1 305 ? -13.119 -35.031  -7.603  1.00 31.45  ? 308  LYS A O   1 
ATOM   2245  C  CB  . LYS A 1 305 ? -12.747 -34.666  -10.471 1.00 39.22  ? 308  LYS A CB  1 
ATOM   2246  C  CG  . LYS A 1 305 ? -12.843 -33.980  -11.835 1.00 42.18  ? 308  LYS A CG  1 
ATOM   2247  C  CD  . LYS A 1 305 ? -13.740 -32.745  -11.818 1.00 46.03  ? 308  LYS A CD  1 
ATOM   2248  C  CE  . LYS A 1 305 ? -15.199 -33.072  -12.139 1.00 51.68  ? 308  LYS A CE  1 
ATOM   2249  N  NZ  . LYS A 1 305 ? -15.487 -33.054  -13.607 1.00 51.74  ? 308  LYS A NZ  1 
ATOM   2250  N  N   . GLY A 1 306 ? -10.885 -34.717  -7.369  1.00 33.30  ? 309  GLY A N   1 
ATOM   2251  C  CA  . GLY A 1 306 ? -10.804 -35.385  -6.063  1.00 34.75  ? 309  GLY A CA  1 
ATOM   2252  C  C   . GLY A 1 306 ? -11.157 -36.862  -6.142  1.00 33.59  ? 309  GLY A C   1 
ATOM   2253  O  O   . GLY A 1 306 ? -11.813 -37.390  -5.249  1.00 32.33  ? 309  GLY A O   1 
ATOM   2254  N  N   . ARG A 1 307 ? -10.713 -37.511  -7.218  1.00 34.63  ? 310  ARG A N   1 
ATOM   2255  C  CA  . ARG A 1 307 ? -11.084 -38.888  -7.540  1.00 37.13  ? 310  ARG A CA  1 
ATOM   2256  C  C   . ARG A 1 307 ? -9.912  -39.853  -7.394  1.00 36.81  ? 310  ARG A C   1 
ATOM   2257  O  O   . ARG A 1 307 ? -10.068 -41.052  -7.610  1.00 35.75  ? 310  ARG A O   1 
ATOM   2258  C  CB  . ARG A 1 307 ? -11.659 -38.982  -8.963  1.00 40.47  ? 310  ARG A CB  1 
ATOM   2259  C  CG  . ARG A 1 307 ? -13.057 -38.404  -9.118  1.00 43.78  ? 310  ARG A CG  1 
ATOM   2260  C  CD  . ARG A 1 307 ? -13.850 -39.164  -10.168 1.00 48.43  ? 310  ARG A CD  1 
ATOM   2261  N  NE  . ARG A 1 307 ? -15.036 -38.416  -10.585 1.00 54.84  ? 310  ARG A NE  1 
ATOM   2262  C  CZ  . ARG A 1 307 ? -15.330 -38.090  -11.846 1.00 60.50  ? 310  ARG A CZ  1 
ATOM   2263  N  NH1 . ARG A 1 307 ? -14.541 -38.463  -12.852 1.00 62.22  ? 310  ARG A NH1 1 
ATOM   2264  N  NH2 . ARG A 1 307 ? -16.431 -37.396  -12.108 1.00 61.80  ? 310  ARG A NH2 1 
ATOM   2265  N  N   . HIS A 1 308 ? -8.750  -39.333  -7.002  1.00 34.86  ? 311  HIS A N   1 
ATOM   2266  C  CA  . HIS A 1 308 ? -7.543  -40.151  -6.906  1.00 34.38  ? 311  HIS A CA  1 
ATOM   2267  C  C   . HIS A 1 308 ? -7.586  -41.253  -5.873  1.00 36.71  ? 311  HIS A C   1 
ATOM   2268  O  O   . HIS A 1 308 ? -6.956  -42.302  -6.065  1.00 37.38  ? 311  HIS A O   1 
ATOM   2269  C  CB  . HIS A 1 308 ? -6.320  -39.271  -6.711  1.00 33.14  ? 311  HIS A CB  1 
ATOM   2270  C  CG  . HIS A 1 308 ? -6.431  -38.333  -5.548  1.00 31.99  ? 311  HIS A CG  1 
ATOM   2271  N  ND1 . HIS A 1 308 ? -7.379  -37.389  -5.474  1.00 31.92  ? 311  HIS A ND1 1 
ATOM   2272  C  CD2 . HIS A 1 308 ? -5.678  -38.231  -4.379  1.00 31.46  ? 311  HIS A CD2 1 
ATOM   2273  C  CE1 . HIS A 1 308 ? -7.243  -36.714  -4.318  1.00 31.73  ? 311  HIS A CE1 1 
ATOM   2274  N  NE2 . HIS A 1 308 ? -6.198  -37.230  -3.655  1.00 31.42  ? 311  HIS A NE2 1 
ATOM   2275  N  N   . MET A 1 309 ? -8.332  -41.046  -4.785  1.00 37.19  ? 312  MET A N   1 
ATOM   2276  C  CA  . MET A 1 309 ? -8.489  -42.075  -3.729  1.00 38.42  ? 312  MET A CA  1 
ATOM   2277  C  C   . MET A 1 309 ? -9.328  -43.268  -4.220  1.00 40.70  ? 312  MET A C   1 
ATOM   2278  O  O   . MET A 1 309 ? -9.292  -44.354  -3.627  1.00 41.58  ? 312  MET A O   1 
ATOM   2279  C  CB  . MET A 1 309 ? -9.104  -41.486  -2.440  1.00 38.30  ? 312  MET A CB  1 
ATOM   2280  C  CG  . MET A 1 309 ? -8.366  -40.295  -1.804  1.00 35.96  ? 312  MET A CG  1 
ATOM   2281  S  SD  . MET A 1 309 ? -6.579  -40.496  -1.545  1.00 39.02  ? 312  MET A SD  1 
ATOM   2282  C  CE  . MET A 1 309 ? -6.492  -41.870  -0.393  1.00 37.31  ? 312  MET A CE  1 
ATOM   2283  N  N   . GLU A 1 310 ? -10.067 -43.051  -5.310  1.00 40.86  ? 313  GLU A N   1 
ATOM   2284  C  CA  . GLU A 1 310 ? -10.921 -44.066  -5.917  1.00 41.66  ? 313  GLU A CA  1 
ATOM   2285  C  C   . GLU A 1 310 ? -10.116 -45.140  -6.637  1.00 41.55  ? 313  GLU A C   1 
ATOM   2286  O  O   . GLU A 1 310 ? -10.611 -46.248  -6.841  1.00 43.23  ? 313  GLU A O   1 
ATOM   2287  C  CB  . GLU A 1 310 ? -11.925 -43.431  -6.874  1.00 42.34  ? 313  GLU A CB  1 
ATOM   2288  C  CG  . GLU A 1 310 ? -13.081 -42.711  -6.192  1.00 45.40  ? 313  GLU A CG  1 
ATOM   2289  C  CD  . GLU A 1 310 ? -13.944 -41.940  -7.187  1.00 49.82  ? 313  GLU A CD  1 
ATOM   2290  O  OE1 . GLU A 1 310 ? -13.805 -42.179  -8.411  1.00 51.91  ? 313  GLU A OE1 1 
ATOM   2291  O  OE2 . GLU A 1 310 ? -14.758 -41.090  -6.755  1.00 49.37  ? 313  GLU A OE2 1 
ATOM   2292  N  N   . TYR A 1 311 ? -8.878  -44.819  -7.008  1.00 40.52  ? 314  TYR A N   1 
ATOM   2293  C  CA  . TYR A 1 311 ? -7.985  -45.809  -7.601  1.00 42.26  ? 314  TYR A CA  1 
ATOM   2294  C  C   . TYR A 1 311 ? -7.566  -46.924  -6.638  1.00 44.62  ? 314  TYR A C   1 
ATOM   2295  O  O   . TYR A 1 311 ? -7.047  -47.955  -7.080  1.00 44.55  ? 314  TYR A O   1 
ATOM   2296  C  CB  . TYR A 1 311 ? -6.734  -45.154  -8.172  1.00 42.22  ? 314  TYR A CB  1 
ATOM   2297  C  CG  . TYR A 1 311 ? -6.955  -44.444  -9.486  1.00 43.87  ? 314  TYR A CG  1 
ATOM   2298  C  CD1 . TYR A 1 311 ? -6.858  -43.057  -9.564  1.00 42.07  ? 314  TYR A CD1 1 
ATOM   2299  C  CD2 . TYR A 1 311 ? -7.246  -45.160  -10.661 1.00 44.05  ? 314  TYR A CD2 1 
ATOM   2300  C  CE1 . TYR A 1 311 ? -7.056  -42.389  -10.762 1.00 44.40  ? 314  TYR A CE1 1 
ATOM   2301  C  CE2 . TYR A 1 311 ? -7.450  -44.498  -11.868 1.00 45.40  ? 314  TYR A CE2 1 
ATOM   2302  C  CZ  . TYR A 1 311 ? -7.355  -43.109  -11.909 1.00 44.96  ? 314  TYR A CZ  1 
ATOM   2303  O  OH  . TYR A 1 311 ? -7.568  -42.424  -13.077 1.00 43.51  ? 314  TYR A OH  1 
ATOM   2304  N  N   . GLU A 1 312 ? -7.779  -46.720  -5.336  1.00 46.73  ? 315  GLU A N   1 
ATOM   2305  C  CA  . GLU A 1 312 ? -7.293  -47.664  -4.302  1.00 49.61  ? 315  GLU A CA  1 
ATOM   2306  C  C   . GLU A 1 312 ? -5.841  -48.105  -4.551  1.00 46.73  ? 315  GLU A C   1 
ATOM   2307  O  O   . GLU A 1 312 ? -5.467  -49.246  -4.280  1.00 49.22  ? 315  GLU A O   1 
ATOM   2308  C  CB  . GLU A 1 312 ? -8.232  -48.877  -4.168  1.00 50.85  ? 315  GLU A CB  1 
ATOM   2309  C  CG  . GLU A 1 312 ? -9.513  -48.589  -3.387  1.00 55.01  ? 315  GLU A CG  1 
ATOM   2310  C  CD  . GLU A 1 312 ? -10.742 -49.311  -3.939  1.00 58.73  ? 315  GLU A CD  1 
ATOM   2311  O  OE1 . GLU A 1 312 ? -11.642 -49.647  -3.136  1.00 60.73  ? 315  GLU A OE1 1 
ATOM   2312  O  OE2 . GLU A 1 312 ? -10.829 -49.531  -5.174  1.00 59.44  ? 315  GLU A OE2 1 
ATOM   2313  N  N   . CYS A 1 313 ? -5.040  -47.190  -5.092  1.00 43.57  ? 316  CYS A N   1 
ATOM   2314  C  CA  . CYS A 1 313 ? -3.608  -47.411  -5.317  1.00 42.55  ? 316  CYS A CA  1 
ATOM   2315  C  C   . CYS A 1 313 ? -2.902  -47.792  -3.994  1.00 42.65  ? 316  CYS A C   1 
ATOM   2316  O  O   . CYS A 1 313 ? -3.063  -47.098  -2.978  1.00 43.09  ? 316  CYS A O   1 
ATOM   2317  C  CB  . CYS A 1 313 ? -2.999  -46.160  -5.960  1.00 39.27  ? 316  CYS A CB  1 
ATOM   2318  S  SG  . CYS A 1 313 ? -1.222  -46.168  -6.249  1.00 38.61  ? 316  CYS A SG  1 
ATOM   2319  N  N   . PRO A 1 314 ? -2.139  -48.905  -4.001  1.00 41.44  ? 317  PRO A N   1 
ATOM   2320  C  CA  . PRO A 1 314 ? -1.571  -49.452  -2.769  1.00 40.81  ? 317  PRO A CA  1 
ATOM   2321  C  C   . PRO A 1 314 ? -0.258  -48.774  -2.376  1.00 39.42  ? 317  PRO A C   1 
ATOM   2322  O  O   . PRO A 1 314 ? 0.215   -48.953  -1.259  1.00 40.23  ? 317  PRO A O   1 
ATOM   2323  C  CB  . PRO A 1 314 ? -1.347  -50.931  -3.119  1.00 39.82  ? 317  PRO A CB  1 
ATOM   2324  C  CG  . PRO A 1 314 ? -1.367  -51.012  -4.619  1.00 38.65  ? 317  PRO A CG  1 
ATOM   2325  C  CD  . PRO A 1 314 ? -1.649  -49.645  -5.180  1.00 40.73  ? 317  PRO A CD  1 
ATOM   2326  N  N   . TYR A 1 315 ? 0.297   -47.980  -3.290  1.00 38.12  ? 318  TYR A N   1 
ATOM   2327  C  CA  . TYR A 1 315 ? 1.464   -47.147  -3.019  1.00 37.45  ? 318  TYR A CA  1 
ATOM   2328  C  C   . TYR A 1 315 ? 1.092   -45.776  -2.428  1.00 36.05  ? 318  TYR A C   1 
ATOM   2329  O  O   . TYR A 1 315 ? 1.970   -45.038  -1.959  1.00 36.16  ? 318  TYR A O   1 
ATOM   2330  C  CB  . TYR A 1 315 ? 2.296   -46.967  -4.295  1.00 39.77  ? 318  TYR A CB  1 
ATOM   2331  C  CG  . TYR A 1 315 ? 2.736   -48.282  -4.880  1.00 45.68  ? 318  TYR A CG  1 
ATOM   2332  C  CD1 . TYR A 1 315 ? 3.806   -48.980  -4.327  1.00 46.01  ? 318  TYR A CD1 1 
ATOM   2333  C  CD2 . TYR A 1 315 ? 2.064   -48.851  -5.967  1.00 47.38  ? 318  TYR A CD2 1 
ATOM   2334  C  CE1 . TYR A 1 315 ? 4.206   -50.200  -4.841  1.00 49.43  ? 318  TYR A CE1 1 
ATOM   2335  C  CE2 . TYR A 1 315 ? 2.458   -50.076  -6.486  1.00 49.72  ? 318  TYR A CE2 1 
ATOM   2336  C  CZ  . TYR A 1 315 ? 3.531   -50.744  -5.915  1.00 49.84  ? 318  TYR A CZ  1 
ATOM   2337  O  OH  . TYR A 1 315 ? 3.943   -51.961  -6.403  1.00 52.53  ? 318  TYR A OH  1 
ATOM   2338  N  N   . LEU A 1 316 ? -0.191  -45.422  -2.468  1.00 33.23  ? 319  LEU A N   1 
ATOM   2339  C  CA  . LEU A 1 316 ? -0.631  -44.166  -1.851  1.00 33.08  ? 319  LEU A CA  1 
ATOM   2340  C  C   . LEU A 1 316 ? -1.269  -44.449  -0.518  1.00 32.59  ? 319  LEU A C   1 
ATOM   2341  O  O   . LEU A 1 316 ? -2.233  -45.206  -0.450  1.00 33.62  ? 319  LEU A O   1 
ATOM   2342  C  CB  . LEU A 1 316 ? -1.615  -43.397  -2.738  1.00 32.90  ? 319  LEU A CB  1 
ATOM   2343  C  CG  . LEU A 1 316 ? -2.258  -42.127  -2.147  1.00 34.26  ? 319  LEU A CG  1 
ATOM   2344  C  CD1 . LEU A 1 316 ? -1.224  -41.031  -1.880  1.00 34.67  ? 319  LEU A CD1 1 
ATOM   2345  C  CD2 . LEU A 1 316 ? -3.381  -41.608  -3.037  1.00 33.87  ? 319  LEU A CD2 1 
ATOM   2346  N  N   . VAL A 1 317 ? -0.732  -43.831  0.531   1.00 31.88  ? 320  VAL A N   1 
ATOM   2347  C  CA  . VAL A 1 317 ? -1.255  -43.992  1.893   1.00 31.91  ? 320  VAL A CA  1 
ATOM   2348  C  C   . VAL A 1 317 ? -1.785  -42.672  2.463   1.00 30.65  ? 320  VAL A C   1 
ATOM   2349  O  O   . VAL A 1 317 ? -1.120  -41.640  2.390   1.00 29.40  ? 320  VAL A O   1 
ATOM   2350  C  CB  . VAL A 1 317 ? -0.182  -44.569  2.850   1.00 33.15  ? 320  VAL A CB  1 
ATOM   2351  C  CG1 . VAL A 1 317 ? -0.763  -44.800  4.240   1.00 33.18  ? 320  VAL A CG1 1 
ATOM   2352  C  CG2 . VAL A 1 317 ? 0.405   -45.873  2.290   1.00 33.40  ? 320  VAL A CG2 1 
ATOM   2353  N  N   . TYR A 1 318 ? -2.997  -42.725  3.010   1.00 29.29  ? 321  TYR A N   1 
ATOM   2354  C  CA  . TYR A 1 318 ? -3.577  -41.612  3.713   1.00 27.46  ? 321  TYR A CA  1 
ATOM   2355  C  C   . TYR A 1 318 ? -3.759  -42.012  5.160   1.00 27.97  ? 321  TYR A C   1 
ATOM   2356  O  O   . TYR A 1 318 ? -4.216  -43.119  5.427   1.00 26.72  ? 321  TYR A O   1 
ATOM   2357  C  CB  . TYR A 1 318 ? -4.950  -41.259  3.143   1.00 27.93  ? 321  TYR A CB  1 
ATOM   2358  C  CG  . TYR A 1 318 ? -5.716  -40.287  4.024   1.00 26.79  ? 321  TYR A CG  1 
ATOM   2359  C  CD1 . TYR A 1 318 ? -5.306  -38.961  4.149   1.00 26.51  ? 321  TYR A CD1 1 
ATOM   2360  C  CD2 . TYR A 1 318 ? -6.828  -40.701  4.749   1.00 28.19  ? 321  TYR A CD2 1 
ATOM   2361  C  CE1 . TYR A 1 318 ? -5.991  -38.067  4.966   1.00 26.88  ? 321  TYR A CE1 1 
ATOM   2362  C  CE2 . TYR A 1 318 ? -7.525  -39.815  5.578   1.00 28.26  ? 321  TYR A CE2 1 
ATOM   2363  C  CZ  . TYR A 1 318 ? -7.100  -38.496  5.677   1.00 28.03  ? 321  TYR A CZ  1 
ATOM   2364  O  OH  . TYR A 1 318 ? -7.790  -37.613  6.480   1.00 28.33  ? 321  TYR A OH  1 
ATOM   2365  N  N   . VAL A 1 319 ? -3.414  -41.101  6.080   1.00 26.51  ? 322  VAL A N   1 
ATOM   2366  C  CA  . VAL A 1 319 ? -3.686  -41.271  7.496   1.00 26.48  ? 322  VAL A CA  1 
ATOM   2367  C  C   . VAL A 1 319 ? -3.941  -39.906  8.134   1.00 25.19  ? 322  VAL A C   1 
ATOM   2368  O  O   . VAL A 1 319 ? -3.146  -39.003  7.956   1.00 24.82  ? 322  VAL A O   1 
ATOM   2369  C  CB  . VAL A 1 319 ? -2.526  -41.954  8.282   1.00 26.81  ? 322  VAL A CB  1 
ATOM   2370  C  CG1 . VAL A 1 319 ? -2.988  -42.241  9.703   1.00 28.51  ? 322  VAL A CG1 1 
ATOM   2371  C  CG2 . VAL A 1 319 ? -2.101  -43.272  7.663   1.00 28.13  ? 322  VAL A CG2 1 
ATOM   2372  N  N   . PRO A 1 320 ? -5.033  -39.770  8.905   1.00 25.35  ? 323  PRO A N   1 
ATOM   2373  C  CA  . PRO A 1 320 ? -5.225  -38.562  9.732   1.00 25.92  ? 323  PRO A CA  1 
ATOM   2374  C  C   . PRO A 1 320 ? -4.256  -38.580  10.917  1.00 27.30  ? 323  PRO A C   1 
ATOM   2375  O  O   . PRO A 1 320 ? -4.142  -39.592  11.598  1.00 29.07  ? 323  PRO A O   1 
ATOM   2376  C  CB  . PRO A 1 320 ? -6.676  -38.681  10.229  1.00 24.79  ? 323  PRO A CB  1 
ATOM   2377  C  CG  . PRO A 1 320 ? -7.290  -39.831  9.486   1.00 24.82  ? 323  PRO A CG  1 
ATOM   2378  C  CD  . PRO A 1 320 ? -6.159  -40.712  9.023   1.00 23.93  ? 323  PRO A CD  1 
ATOM   2379  N  N   . VAL A 1 321 ? -3.527  -37.489  11.132  1.00 27.70  ? 324  VAL A N   1 
ATOM   2380  C  CA  . VAL A 1 321 ? -2.545  -37.434  12.218  1.00 27.07  ? 324  VAL A CA  1 
ATOM   2381  C  C   . VAL A 1 321 ? -2.587  -36.122  12.978  1.00 26.56  ? 324  VAL A C   1 
ATOM   2382  O  O   . VAL A 1 321 ? -3.206  -35.148  12.527  1.00 27.31  ? 324  VAL A O   1 
ATOM   2383  C  CB  . VAL A 1 321 ? -1.105  -37.664  11.712  1.00 27.23  ? 324  VAL A CB  1 
ATOM   2384  C  CG1 . VAL A 1 321 ? -1.005  -39.001  11.010  1.00 26.30  ? 324  VAL A CG1 1 
ATOM   2385  C  CG2 . VAL A 1 321 ? -0.643  -36.515  10.817  1.00 26.75  ? 324  VAL A CG2 1 
ATOM   2386  N  N   . VAL A 1 322 ? -1.924  -36.096  14.132  1.00 26.39  ? 325  VAL A N   1 
ATOM   2387  C  CA  . VAL A 1 322 ? -1.807  -34.865  14.931  1.00 24.45  ? 325  VAL A CA  1 
ATOM   2388  C  C   . VAL A 1 322 ? -0.356  -34.409  14.977  1.00 23.15  ? 325  VAL A C   1 
ATOM   2389  O  O   . VAL A 1 322 ? -0.070  -33.279  15.367  1.00 22.60  ? 325  VAL A O   1 
ATOM   2390  C  CB  . VAL A 1 322 ? -2.345  -35.028  16.375  1.00 25.01  ? 325  VAL A CB  1 
ATOM   2391  C  CG1 . VAL A 1 322 ? -3.790  -35.515  16.373  1.00 25.50  ? 325  VAL A CG1 1 
ATOM   2392  C  CG2 . VAL A 1 322 ? -1.452  -35.952  17.183  1.00 24.47  ? 325  VAL A CG2 1 
ATOM   2393  N  N   . ALA A 1 323 ? 0.557   -35.289  14.577  1.00 22.11  ? 326  ALA A N   1 
ATOM   2394  C  CA  . ALA A 1 323 ? 1.984   -34.998  14.647  1.00 23.34  ? 326  ALA A CA  1 
ATOM   2395  C  C   . ALA A 1 323 ? 2.722   -35.939  13.716  1.00 23.03  ? 326  ALA A C   1 
ATOM   2396  O  O   . ALA A 1 323 ? 2.239   -37.027  13.470  1.00 23.41  ? 326  ALA A O   1 
ATOM   2397  C  CB  . ALA A 1 323 ? 2.495   -35.173  16.086  1.00 22.46  ? 326  ALA A CB  1 
ATOM   2398  N  N   . PHE A 1 324 ? 3.900   -35.537  13.230  1.00 23.33  ? 327  PHE A N   1 
ATOM   2399  C  CA  . PHE A 1 324 ? 4.740   -36.412  12.401  1.00 23.57  ? 327  PHE A CA  1 
ATOM   2400  C  C   . PHE A 1 324 ? 6.216   -36.068  12.587  1.00 24.35  ? 327  PHE A C   1 
ATOM   2401  O  O   . PHE A 1 324 ? 6.567   -35.042  13.188  1.00 24.49  ? 327  PHE A O   1 
ATOM   2402  C  CB  . PHE A 1 324 ? 4.385   -36.282  10.915  1.00 24.14  ? 327  PHE A CB  1 
ATOM   2403  C  CG  . PHE A 1 324 ? 4.825   -34.969  10.320  1.00 24.94  ? 327  PHE A CG  1 
ATOM   2404  C  CD1 . PHE A 1 324 ? 6.032   -34.866  9.656   1.00 24.83  ? 327  PHE A CD1 1 
ATOM   2405  C  CD2 . PHE A 1 324 ? 4.055   -33.821  10.494  1.00 25.09  ? 327  PHE A CD2 1 
ATOM   2406  C  CE1 . PHE A 1 324 ? 6.459   -33.646  9.154   1.00 26.87  ? 327  PHE A CE1 1 
ATOM   2407  C  CE2 . PHE A 1 324 ? 4.476   -32.594  9.993   1.00 26.19  ? 327  PHE A CE2 1 
ATOM   2408  C  CZ  . PHE A 1 324 ? 5.683   -32.507  9.324   1.00 25.86  ? 327  PHE A CZ  1 
ATOM   2409  N  N   . ARG A 1 325 ? 7.078   -36.946  12.085  1.00 25.29  ? 328  ARG A N   1 
ATOM   2410  C  CA  . ARG A 1 325 ? 8.512   -36.666  11.963  1.00 25.95  ? 328  ARG A CA  1 
ATOM   2411  C  C   . ARG A 1 325 ? 9.007   -37.257  10.650  1.00 26.19  ? 328  ARG A C   1 
ATOM   2412  O  O   . ARG A 1 325 ? 8.590   -38.349  10.238  1.00 26.68  ? 328  ARG A O   1 
ATOM   2413  C  CB  . ARG A 1 325 ? 9.347   -37.216  13.137  1.00 23.97  ? 328  ARG A CB  1 
ATOM   2414  C  CG  . ARG A 1 325 ? 10.853  -37.017  12.928  1.00 24.73  ? 328  ARG A CG  1 
ATOM   2415  C  CD  . ARG A 1 325 ? 11.729  -37.627  13.999  1.00 24.70  ? 328  ARG A CD  1 
ATOM   2416  N  NE  . ARG A 1 325 ? 11.461  -37.032  15.307  1.00 27.06  ? 328  ARG A NE  1 
ATOM   2417  C  CZ  . ARG A 1 325 ? 11.990  -37.449  16.456  1.00 26.47  ? 328  ARG A CZ  1 
ATOM   2418  N  NH1 . ARG A 1 325 ? 12.829  -38.491  16.480  1.00 25.55  ? 328  ARG A NH1 1 
ATOM   2419  N  NH2 . ARG A 1 325 ? 11.665  -36.821  17.581  1.00 25.53  ? 328  ARG A NH2 1 
ATOM   2420  N  N   . LEU A 1 326 ? 9.892   -36.525  9.999   1.00 26.28  ? 329  LEU A N   1 
ATOM   2421  C  CA  . LEU A 1 326 ? 10.403  -36.939  8.717   1.00 29.56  ? 329  LEU A CA  1 
ATOM   2422  C  C   . LEU A 1 326 ? 11.874  -36.613  8.643   1.00 30.50  ? 329  LEU A C   1 
ATOM   2423  O  O   . LEU A 1 326 ? 12.274  -35.472  8.823   1.00 31.07  ? 329  LEU A O   1 
ATOM   2424  C  CB  . LEU A 1 326 ? 9.638   -36.244  7.585   1.00 29.24  ? 329  LEU A CB  1 
ATOM   2425  C  CG  . LEU A 1 326 ? 10.079  -36.474  6.135   1.00 31.62  ? 329  LEU A CG  1 
ATOM   2426  C  CD1 . LEU A 1 326 ? 10.242  -37.955  5.803   1.00 30.23  ? 329  LEU A CD1 1 
ATOM   2427  C  CD2 . LEU A 1 326 ? 9.029   -35.835  5.240   1.00 32.94  ? 329  LEU A CD2 1 
ATOM   2428  N  N   . GLU A 1 327 ? 12.673  -37.628  8.374   1.00 32.72  ? 330  GLU A N   1 
ATOM   2429  C  CA  . GLU A 1 327 ? 14.095  -37.446  8.348   1.00 36.91  ? 330  GLU A CA  1 
ATOM   2430  C  C   . GLU A 1 327 ? 14.710  -38.123  7.127   1.00 38.46  ? 330  GLU A C   1 
ATOM   2431  O  O   . GLU A 1 327 ? 14.735  -39.360  7.042   1.00 37.94  ? 330  GLU A O   1 
ATOM   2432  C  CB  . GLU A 1 327 ? 14.716  -37.979  9.643   1.00 39.17  ? 330  GLU A CB  1 
ATOM   2433  C  CG  . GLU A 1 327 ? 16.229  -37.828  9.698   1.00 44.39  ? 330  GLU A CG  1 
ATOM   2434  C  CD  . GLU A 1 327 ? 16.861  -38.409  10.962  1.00 50.51  ? 330  GLU A CD  1 
ATOM   2435  O  OE1 . GLU A 1 327 ? 18.111  -38.466  11.012  1.00 51.17  ? 330  GLU A OE1 1 
ATOM   2436  O  OE2 . GLU A 1 327 ? 16.119  -38.799  11.900  1.00 53.74  ? 330  GLU A OE2 1 
ATOM   2437  N  N   . PRO A 1 328 ? 15.175  -37.316  6.159   1.00 40.02  ? 331  PRO A N   1 
ATOM   2438  C  CA  . PRO A 1 328 ? 16.172  -37.831  5.210   1.00 45.66  ? 331  PRO A CA  1 
ATOM   2439  C  C   . PRO A 1 328 ? 17.519  -37.640  5.912   1.00 51.64  ? 331  PRO A C   1 
ATOM   2440  O  O   . PRO A 1 328 ? 17.799  -36.519  6.339   1.00 57.33  ? 331  PRO A O   1 
ATOM   2441  C  CB  . PRO A 1 328 ? 16.031  -36.893  4.007   1.00 43.56  ? 331  PRO A CB  1 
ATOM   2442  C  CG  . PRO A 1 328 ? 15.221  -35.712  4.463   1.00 41.27  ? 331  PRO A CG  1 
ATOM   2443  C  CD  . PRO A 1 328 ? 14.808  -35.914  5.894   1.00 40.20  ? 331  PRO A CD  1 
ATOM   2444  N  N   . LYS A 1 329 ? 18.391  -38.643  6.042   1.00 58.84  ? 332  LYS A N   1 
ATOM   2445  C  CA  . LYS A 1 329 ? 18.620  -39.789  5.165   1.00 58.33  ? 332  LYS A CA  1 
ATOM   2446  C  C   . LYS A 1 329 ? 19.235  -39.292  3.872   1.00 64.84  ? 332  LYS A C   1 
ATOM   2447  O  O   . LYS A 1 329 ? 18.532  -38.857  2.954   1.00 68.35  ? 332  LYS A O   1 
ATOM   2448  C  CB  . LYS A 1 329 ? 17.412  -40.683  4.959   1.00 55.56  ? 332  LYS A CB  1 
ATOM   2449  C  CG  . LYS A 1 329 ? 17.832  -42.059  4.478   1.00 53.81  ? 332  LYS A CG  1 
ATOM   2450  C  CD  . LYS A 1 329 ? 16.960  -43.152  5.057   1.00 51.50  ? 332  LYS A CD  1 
ATOM   2451  C  CE  . LYS A 1 329 ? 17.679  -44.487  4.963   1.00 51.89  ? 332  LYS A CE  1 
ATOM   2452  N  NZ  . LYS A 1 329 ? 16.742  -45.628  5.119   1.00 47.93  ? 332  LYS A NZ  1 
ATOM   2453  N  N   . ASP A 1 330 ? 20.567  -39.354  3.841   1.00 67.07  ? 333  ASP A N   1 
ATOM   2454  C  CA  . ASP A 1 330 ? 21.389  -38.674  2.846   1.00 70.18  ? 333  ASP A CA  1 
ATOM   2455  C  C   . ASP A 1 330 ? 21.281  -37.162  3.078   1.00 69.67  ? 333  ASP A C   1 
ATOM   2456  O  O   . ASP A 1 330 ? 20.441  -36.489  2.474   1.00 73.40  ? 333  ASP A O   1 
ATOM   2457  C  CB  . ASP A 1 330 ? 20.983  -39.043  1.401   1.00 76.59  ? 333  ASP A CB  1 
ATOM   2458  C  CG  . ASP A 1 330 ? 21.055  -40.550  1.115   1.00 80.52  ? 333  ASP A CG  1 
ATOM   2459  O  OD1 . ASP A 1 330 ? 20.017  -41.132  0.715   1.00 78.98  ? 333  ASP A OD1 1 
ATOM   2460  O  OD2 . ASP A 1 330 ? 22.147  -41.146  1.271   1.00 80.33  ? 333  ASP A OD2 1 
ATOM   2461  N  N   . GLY A 1 331 ? 22.117  -36.651  3.981   1.00 67.83  ? 334  GLY A N   1 
ATOM   2462  C  CA  . GLY A 1 331 ? 22.229  -35.211  4.262   1.00 63.11  ? 334  GLY A CA  1 
ATOM   2463  C  C   . GLY A 1 331 ? 20.921  -34.447  4.375   1.00 61.08  ? 334  GLY A C   1 
ATOM   2464  O  O   . GLY A 1 331 ? 19.975  -34.913  5.000   1.00 63.54  ? 334  GLY A O   1 
ATOM   2465  N  N   . LYS A 1 332 ? 20.879  -33.268  3.758   1.00 59.90  ? 335  LYS A N   1 
ATOM   2466  C  CA  . LYS A 1 332 ? 19.721  -32.368  3.811   1.00 54.65  ? 335  LYS A CA  1 
ATOM   2467  C  C   . LYS A 1 332 ? 18.653  -32.757  2.783   1.00 51.26  ? 335  LYS A C   1 
ATOM   2468  O  O   . LYS A 1 332 ? 18.969  -33.325  1.730   1.00 51.55  ? 335  LYS A O   1 
ATOM   2469  C  CB  . LYS A 1 332 ? 20.166  -30.926  3.544   1.00 55.85  ? 335  LYS A CB  1 
ATOM   2470  C  CG  . LYS A 1 332 ? 21.353  -30.434  4.369   1.00 57.60  ? 335  LYS A CG  1 
ATOM   2471  C  CD  . LYS A 1 332 ? 20.963  -29.301  5.312   1.00 57.93  ? 335  LYS A CD  1 
ATOM   2472  C  CE  . LYS A 1 332 ? 22.161  -28.409  5.606   1.00 57.24  ? 335  LYS A CE  1 
ATOM   2473  N  NZ  . LYS A 1 332 ? 21.766  -27.130  6.259   1.00 58.74  ? 335  LYS A NZ  1 
ATOM   2474  N  N   . GLY A 1 333 ? 17.394  -32.450  3.092   1.00 45.24  ? 336  GLY A N   1 
ATOM   2475  C  CA  . GLY A 1 333 ? 16.290  -32.634  2.145   1.00 41.06  ? 336  GLY A CA  1 
ATOM   2476  C  C   . GLY A 1 333 ? 15.669  -31.292  1.797   1.00 38.92  ? 336  GLY A C   1 
ATOM   2477  O  O   . GLY A 1 333 ? 15.693  -30.364  2.617   1.00 36.37  ? 336  GLY A O   1 
ATOM   2478  N  N   . VAL A 1 334 ? 15.126  -31.168  0.581   1.00 36.75  ? 337  VAL A N   1 
ATOM   2479  C  CA  . VAL A 1 334 ? 14.362  -29.968  0.243   1.00 33.18  ? 337  VAL A CA  1 
ATOM   2480  C  C   . VAL A 1 334 ? 12.884  -30.215  0.514   1.00 31.75  ? 337  VAL A C   1 
ATOM   2481  O  O   . VAL A 1 334 ? 12.328  -31.227  0.101   1.00 29.57  ? 337  VAL A O   1 
ATOM   2482  C  CB  . VAL A 1 334 ? 14.604  -29.392  -1.194  1.00 34.55  ? 337  VAL A CB  1 
ATOM   2483  C  CG1 . VAL A 1 334 ? 15.726  -30.105  -1.954  1.00 32.53  ? 337  VAL A CG1 1 
ATOM   2484  C  CG2 . VAL A 1 334 ? 13.309  -29.284  -2.007  1.00 33.09  ? 337  VAL A CG2 1 
ATOM   2485  N  N   . PHE A 1 335 ? 12.272  -29.267  1.220   1.00 31.09  ? 338  PHE A N   1 
ATOM   2486  C  CA  . PHE A 1 335 ? 10.865  -29.314  1.594   1.00 30.24  ? 338  PHE A CA  1 
ATOM   2487  C  C   . PHE A 1 335 ? 10.186  -28.060  1.054   1.00 28.88  ? 338  PHE A C   1 
ATOM   2488  O  O   . PHE A 1 335 ? 10.857  -27.063  0.778   1.00 28.45  ? 338  PHE A O   1 
ATOM   2489  C  CB  . PHE A 1 335 ? 10.718  -29.265  3.120   1.00 30.56  ? 338  PHE A CB  1 
ATOM   2490  C  CG  . PHE A 1 335 ? 11.269  -30.460  3.847   1.00 31.98  ? 338  PHE A CG  1 
ATOM   2491  C  CD1 . PHE A 1 335 ? 12.614  -30.532  4.180   1.00 32.86  ? 338  PHE A CD1 1 
ATOM   2492  C  CD2 . PHE A 1 335 ? 10.423  -31.486  4.262   1.00 33.52  ? 338  PHE A CD2 1 
ATOM   2493  C  CE1 . PHE A 1 335 ? 13.119  -31.629  4.869   1.00 32.76  ? 338  PHE A CE1 1 
ATOM   2494  C  CE2 . PHE A 1 335 ? 10.918  -32.581  4.960   1.00 32.71  ? 338  PHE A CE2 1 
ATOM   2495  C  CZ  . PHE A 1 335 ? 12.268  -32.649  5.264   1.00 32.41  ? 338  PHE A CZ  1 
ATOM   2496  N  N   . ALA A 1 336 ? 8.865   -28.099  0.935   1.00 25.66  ? 339  ALA A N   1 
ATOM   2497  C  CA  . ALA A 1 336 ? 8.099   -26.892  0.693   1.00 28.54  ? 339  ALA A CA  1 
ATOM   2498  C  C   . ALA A 1 336 ? 7.162   -26.682  1.864   1.00 29.70  ? 339  ALA A C   1 
ATOM   2499  O  O   . ALA A 1 336 ? 6.391   -27.587  2.218   1.00 29.52  ? 339  ALA A O   1 
ATOM   2500  C  CB  . ALA A 1 336 ? 7.317   -26.966  -0.617  1.00 26.48  ? 339  ALA A CB  1 
ATOM   2501  N  N   . VAL A 1 337 ? 7.252   -25.495  2.471   1.00 29.40  ? 340  VAL A N   1 
ATOM   2502  C  CA  . VAL A 1 337 ? 6.385   -25.118  3.582   1.00 28.76  ? 340  VAL A CA  1 
ATOM   2503  C  C   . VAL A 1 337 ? 5.392   -24.087  3.072   1.00 28.09  ? 340  VAL A C   1 
ATOM   2504  O  O   . VAL A 1 337 ? 5.780   -22.952  2.754   1.00 28.10  ? 340  VAL A O   1 
ATOM   2505  C  CB  . VAL A 1 337 ? 7.194   -24.527  4.758   1.00 29.69  ? 340  VAL A CB  1 
ATOM   2506  C  CG1 . VAL A 1 337 ? 6.269   -24.186  5.926   1.00 30.32  ? 340  VAL A CG1 1 
ATOM   2507  C  CG2 . VAL A 1 337 ? 8.258   -25.516  5.205   1.00 32.22  ? 340  VAL A CG2 1 
ATOM   2508  N  N   . ASP A 1 338 ? 4.120   -24.468  2.988   1.00 25.62  ? 341  ASP A N   1 
ATOM   2509  C  CA  . ASP A 1 338 ? 3.117   -23.587  2.395   1.00 27.43  ? 341  ASP A CA  1 
ATOM   2510  C  C   . ASP A 1 338 ? 3.594   -23.033  1.017   1.00 28.61  ? 341  ASP A C   1 
ATOM   2511  O  O   . ASP A 1 338 ? 3.359   -21.865  0.678   1.00 27.19  ? 341  ASP A O   1 
ATOM   2512  C  CB  . ASP A 1 338 ? 2.780   -22.436  3.363   1.00 26.01  ? 341  ASP A CB  1 
ATOM   2513  C  CG  . ASP A 1 338 ? 2.269   -22.928  4.725   1.00 26.63  ? 341  ASP A CG  1 
ATOM   2514  O  OD1 . ASP A 1 338 ? 1.815   -24.100  4.845   1.00 23.15  ? 341  ASP A OD1 1 
ATOM   2515  O  OD2 . ASP A 1 338 ? 2.315   -22.113  5.677   1.00 25.66  ? 341  ASP A OD2 1 
ATOM   2516  N  N   . GLY A 1 339 ? 4.278   -23.882  0.244   1.00 30.62  ? 342  GLY A N   1 
ATOM   2517  C  CA  . GLY A 1 339 ? 4.829   -23.490  -1.049  1.00 32.63  ? 342  GLY A CA  1 
ATOM   2518  C  C   . GLY A 1 339 ? 6.221   -22.860  -1.075  1.00 36.83  ? 342  GLY A C   1 
ATOM   2519  O  O   . GLY A 1 339 ? 6.823   -22.817  -2.146  1.00 39.94  ? 342  GLY A O   1 
ATOM   2520  N  N   . GLU A 1 340 ? 6.734   -22.357  0.060   1.00 36.62  ? 343  GLU A N   1 
ATOM   2521  C  CA  . GLU A 1 340 ? 8.067   -21.721  0.090   0.50 37.50  ? 343  GLU A CA  1 
ATOM   2522  C  C   . GLU A 1 340 ? 9.147   -22.750  0.373   1.00 39.19  ? 343  GLU A C   1 
ATOM   2523  O  O   . GLU A 1 340 ? 8.924   -23.673  1.165   1.00 39.96  ? 343  GLU A O   1 
ATOM   2524  C  CB  . GLU A 1 340 ? 8.151   -20.562  1.113   0.50 37.74  ? 343  GLU A CB  1 
ATOM   2525  C  CG  . GLU A 1 340 ? 8.542   -20.946  2.543   0.50 39.23  ? 343  GLU A CG  1 
ATOM   2526  C  CD  . GLU A 1 340 ? 9.272   -19.840  3.313   0.50 40.04  ? 343  GLU A CD  1 
ATOM   2527  O  OE1 . GLU A 1 340 ? 9.830   -18.918  2.677   0.50 40.90  ? 343  GLU A OE1 1 
ATOM   2528  O  OE2 . GLU A 1 340 ? 9.304   -19.900  4.565   0.50 38.48  ? 343  GLU A OE2 1 
ATOM   2529  N  N   . LEU A 1 341 ? 10.316  -22.577  -0.255  1.00 40.26  ? 344  LEU A N   1 
ATOM   2530  C  CA  . LEU A 1 341 ? 11.475  -23.480  -0.077  1.00 41.66  ? 344  LEU A CA  1 
ATOM   2531  C  C   . LEU A 1 341 ? 12.019  -23.542  1.352   1.00 44.34  ? 344  LEU A C   1 
ATOM   2532  O  O   . LEU A 1 341 ? 12.092  -22.525  2.041   1.00 48.73  ? 344  LEU A O   1 
ATOM   2533  C  CB  . LEU A 1 341 ? 12.629  -23.118  -1.026  1.00 42.38  ? 344  LEU A CB  1 
ATOM   2534  C  CG  . LEU A 1 341 ? 13.953  -23.896  -0.834  1.00 41.67  ? 344  LEU A CG  1 
ATOM   2535  C  CD1 . LEU A 1 341 ? 13.930  -25.246  -1.541  1.00 42.22  ? 344  LEU A CD1 1 
ATOM   2536  C  CD2 . LEU A 1 341 ? 15.200  -23.104  -1.216  1.00 40.72  ? 344  LEU A CD2 1 
ATOM   2537  N  N   . MET A 1 342 ? 12.406  -24.746  1.775   1.00 45.13  ? 345  MET A N   1 
ATOM   2538  C  CA  . MET A 1 342 ? 13.042  -24.974  3.072   1.00 46.10  ? 345  MET A CA  1 
ATOM   2539  C  C   . MET A 1 342 ? 13.965  -26.204  3.014   1.00 45.13  ? 345  MET A C   1 
ATOM   2540  O  O   . MET A 1 342 ? 13.550  -27.279  2.576   1.00 44.90  ? 345  MET A O   1 
ATOM   2541  C  CB  . MET A 1 342 ? 11.977  -25.163  4.148   1.00 44.52  ? 345  MET A CB  1 
ATOM   2542  C  CG  . MET A 1 342 ? 12.431  -24.743  5.526   1.00 46.48  ? 345  MET A CG  1 
ATOM   2543  S  SD  . MET A 1 342 ? 11.503  -25.625  6.787   1.00 50.82  ? 345  MET A SD  1 
ATOM   2544  C  CE  . MET A 1 342 ? 12.124  -27.299  6.582   1.00 45.70  ? 345  MET A CE  1 
ATOM   2545  N  N   . VAL A 1 343 ? 15.211  -26.031  3.453   1.00 43.69  ? 346  VAL A N   1 
ATOM   2546  C  CA  . VAL A 1 343 ? 16.220  -27.091  3.435   1.00 42.88  ? 346  VAL A CA  1 
ATOM   2547  C  C   . VAL A 1 343 ? 16.513  -27.548  4.854   1.00 42.92  ? 346  VAL A C   1 
ATOM   2548  O  O   . VAL A 1 343 ? 16.850  -26.725  5.706   1.00 42.00  ? 346  VAL A O   1 
ATOM   2549  C  CB  . VAL A 1 343 ? 17.554  -26.587  2.841   1.00 43.91  ? 346  VAL A CB  1 
ATOM   2550  C  CG1 . VAL A 1 343 ? 18.532  -27.736  2.663   1.00 42.69  ? 346  VAL A CG1 1 
ATOM   2551  C  CG2 . VAL A 1 343 ? 17.326  -25.888  1.510   1.00 48.69  ? 346  VAL A CG2 1 
ATOM   2552  N  N   . SER A 1 344 ? 16.411  -28.854  5.111   1.00 42.12  ? 347  SER A N   1 
ATOM   2553  C  CA  . SER A 1 344 ? 16.719  -29.373  6.443   1.00 40.70  ? 347  SER A CA  1 
ATOM   2554  C  C   . SER A 1 344 ? 17.076  -30.843  6.491   1.00 41.19  ? 347  SER A C   1 
ATOM   2555  O  O   . SER A 1 344 ? 16.663  -31.623  5.638   1.00 41.63  ? 347  SER A O   1 
ATOM   2556  C  CB  . SER A 1 344 ? 15.573  -29.107  7.410   1.00 39.56  ? 347  SER A CB  1 
ATOM   2557  O  OG  . SER A 1 344 ? 16.049  -29.194  8.740   1.00 41.17  ? 347  SER A OG  1 
ATOM   2558  N  N   . GLU A 1 345 ? 17.858  -31.192  7.515   1.00 43.47  ? 348  GLU A N   1 
ATOM   2559  C  CA  . GLU A 1 345 ? 18.218  -32.572  7.862   1.00 42.21  ? 348  GLU A CA  1 
ATOM   2560  C  C   . GLU A 1 345 ? 17.041  -33.341  8.464   1.00 38.99  ? 348  GLU A C   1 
ATOM   2561  O  O   . GLU A 1 345 ? 16.973  -34.571  8.336   1.00 39.05  ? 348  GLU A O   1 
ATOM   2562  C  CB  . GLU A 1 345 ? 19.374  -32.587  8.863   1.00 44.89  ? 348  GLU A CB  1 
ATOM   2563  C  CG  . GLU A 1 345 ? 20.672  -31.983  8.355   1.00 53.85  ? 348  GLU A CG  1 
ATOM   2564  C  CD  . GLU A 1 345 ? 21.695  -33.033  7.964   1.00 58.36  ? 348  GLU A CD  1 
ATOM   2565  O  OE1 . GLU A 1 345 ? 21.777  -34.070  8.658   1.00 62.33  ? 348  GLU A OE1 1 
ATOM   2566  O  OE2 . GLU A 1 345 ? 22.425  -32.821  6.969   1.00 60.10  ? 348  GLU A OE2 1 
ATOM   2567  N  N   . ALA A 1 346 ? 16.130  -32.638  9.135   1.00 33.11  ? 349  ALA A N   1 
ATOM   2568  C  CA  . ALA A 1 346 ? 14.971  -33.299  9.731   1.00 31.77  ? 349  ALA A CA  1 
ATOM   2569  C  C   . ALA A 1 346 ? 13.937  -32.306  10.222  1.00 30.13  ? 349  ALA A C   1 
ATOM   2570  O  O   . ALA A 1 346 ? 14.285  -31.226  10.688  1.00 28.19  ? 349  ALA A O   1 
ATOM   2571  C  CB  . ALA A 1 346 ? 15.392  -34.233  10.866  1.00 32.85  ? 349  ALA A CB  1 
ATOM   2572  N  N   . VAL A 1 347 ? 12.669  -32.701  10.122  1.00 28.05  ? 350  VAL A N   1 
ATOM   2573  C  CA  . VAL A 1 347 ? 11.548  -31.842  10.416  1.00 27.98  ? 350  VAL A CA  1 
ATOM   2574  C  C   . VAL A 1 347 ? 10.527  -32.676  11.157  1.00 28.54  ? 350  VAL A C   1 
ATOM   2575  O  O   . VAL A 1 347 ? 10.297  -33.840  10.827  1.00 31.18  ? 350  VAL A O   1 
ATOM   2576  C  CB  . VAL A 1 347 ? 10.880  -31.305  9.120   1.00 29.48  ? 350  VAL A CB  1 
ATOM   2577  C  CG1 . VAL A 1 347 ? 9.652   -30.457  9.442   1.00 29.92  ? 350  VAL A CG1 1 
ATOM   2578  C  CG2 . VAL A 1 347 ? 11.870  -30.487  8.292   1.00 30.95  ? 350  VAL A CG2 1 
ATOM   2579  N  N   . GLN A 1 348 ? 9.905   -32.086  12.162  1.00 26.86  ? 351  GLN A N   1 
ATOM   2580  C  CA  . GLN A 1 348 ? 8.794   -32.743  12.798  1.00 26.84  ? 351  GLN A CA  1 
ATOM   2581  C  C   . GLN A 1 348 ? 7.822   -31.657  13.151  1.00 25.93  ? 351  GLN A C   1 
ATOM   2582  O  O   . GLN A 1 348 ? 8.198   -30.486  13.177  1.00 27.18  ? 351  GLN A O   1 
ATOM   2583  C  CB  . GLN A 1 348 ? 9.257   -33.545  14.021  1.00 28.55  ? 351  GLN A CB  1 
ATOM   2584  C  CG  . GLN A 1 348 ? 9.835   -32.736  15.161  1.00 28.91  ? 351  GLN A CG  1 
ATOM   2585  C  CD  . GLN A 1 348 ? 10.167  -33.570  16.384  1.00 31.40  ? 351  GLN A CD  1 
ATOM   2586  O  OE1 . GLN A 1 348 ? 10.750  -33.054  17.345  1.00 32.67  ? 351  GLN A OE1 1 
ATOM   2587  N  NE2 . GLN A 1 348 ? 9.795   -34.851  16.369  1.00 28.58  ? 351  GLN A NE2 1 
ATOM   2588  N  N   . GLY A 1 349 ? 6.569   -32.020  13.379  1.00 25.29  ? 352  GLY A N   1 
ATOM   2589  C  CA  . GLY A 1 349 ? 5.572   -31.025  13.731  1.00 25.79  ? 352  GLY A CA  1 
ATOM   2590  C  C   . GLY A 1 349 ? 4.341   -31.609  14.383  1.00 26.43  ? 352  GLY A C   1 
ATOM   2591  O  O   . GLY A 1 349 ? 4.133   -32.819  14.357  1.00 27.84  ? 352  GLY A O   1 
ATOM   2592  N  N   . GLN A 1 350 ? 3.527   -30.741  14.973  1.00 25.42  ? 353  GLN A N   1 
ATOM   2593  C  CA  . GLN A 1 350 ? 2.226   -31.117  15.468  1.00 24.99  ? 353  GLN A CA  1 
ATOM   2594  C  C   . GLN A 1 350 ? 1.199   -30.027  15.198  1.00 24.10  ? 353  GLN A C   1 
ATOM   2595  O  O   . GLN A 1 350 ? 1.529   -28.847  15.087  1.00 25.91  ? 353  GLN A O   1 
ATOM   2596  C  CB  . GLN A 1 350 ? 2.290   -31.457  16.970  1.00 27.13  ? 353  GLN A CB  1 
ATOM   2597  C  CG  . GLN A 1 350 ? 2.166   -30.277  17.914  1.00 27.49  ? 353  GLN A CG  1 
ATOM   2598  C  CD  . GLN A 1 350 ? 1.872   -30.695  19.345  1.00 29.58  ? 353  GLN A CD  1 
ATOM   2599  O  OE1 . GLN A 1 350 ? 2.735   -31.242  20.038  1.00 30.04  ? 353  GLN A OE1 1 
ATOM   2600  N  NE2 . GLN A 1 350 ? 0.658   -30.416  19.803  1.00 29.66  ? 353  GLN A NE2 1 
ATOM   2601  N  N   . VAL A 1 351 ? -0.054  -30.435  15.115  1.00 23.77  ? 354  VAL A N   1 
ATOM   2602  C  CA  . VAL A 1 351 ? -1.152  -29.539  14.820  1.00 24.63  ? 354  VAL A CA  1 
ATOM   2603  C  C   . VAL A 1 351 ? -1.705  -28.962  16.114  1.00 25.62  ? 354  VAL A C   1 
ATOM   2604  O  O   . VAL A 1 351 ? -1.950  -29.701  17.064  1.00 23.94  ? 354  VAL A O   1 
ATOM   2605  C  CB  . VAL A 1 351 ? -2.296  -30.298  14.142  1.00 23.76  ? 354  VAL A CB  1 
ATOM   2606  C  CG1 . VAL A 1 351 ? -3.360  -29.327  13.656  1.00 25.15  ? 354  VAL A CG1 1 
ATOM   2607  C  CG2 . VAL A 1 351 ? -1.752  -31.108  12.984  1.00 24.27  ? 354  VAL A CG2 1 
ATOM   2608  N  N   . HIS A 1 352 ? -1.903  -27.645  16.127  1.00 25.30  ? 355  HIS A N   1 
ATOM   2609  C  CA  . HIS A 1 352 ? -2.633  -26.973  17.202  1.00 24.87  ? 355  HIS A CA  1 
ATOM   2610  C  C   . HIS A 1 352 ? -4.021  -26.684  16.725  1.00 24.69  ? 355  HIS A C   1 
ATOM   2611  O  O   . HIS A 1 352 ? -4.206  -26.256  15.593  1.00 26.00  ? 355  HIS A O   1 
ATOM   2612  C  CB  . HIS A 1 352 ? -1.893  -25.720  17.649  1.00 24.47  ? 355  HIS A CB  1 
ATOM   2613  C  CG  . HIS A 1 352 ? -0.582  -26.025  18.320  1.00 24.46  ? 355  HIS A CG  1 
ATOM   2614  N  ND1 . HIS A 1 352 ? -0.513  -26.491  19.583  1.00 24.48  ? 355  HIS A ND1 1 
ATOM   2615  C  CD2 . HIS A 1 352 ? 0.723   -26.004  17.832  1.00 24.28  ? 355  HIS A CD2 1 
ATOM   2616  C  CE1 . HIS A 1 352 ? 0.779   -26.739  19.897  1.00 25.54  ? 355  HIS A CE1 1 
ATOM   2617  N  NE2 . HIS A 1 352 ? 1.534   -26.430  18.830  1.00 25.09  ? 355  HIS A NE2 1 
ATOM   2618  N  N   . PRO A 1 353 ? -5.026  -26.947  17.568  1.00 24.99  ? 356  PRO A N   1 
ATOM   2619  C  CA  . PRO A 1 353 ? -6.399  -26.905  17.085  1.00 24.37  ? 356  PRO A CA  1 
ATOM   2620  C  C   . PRO A 1 353 ? -7.006  -25.515  17.038  1.00 24.65  ? 356  PRO A C   1 
ATOM   2621  O  O   . PRO A 1 353 ? -6.813  -24.734  17.944  1.00 24.51  ? 356  PRO A O   1 
ATOM   2622  C  CB  . PRO A 1 353 ? -7.139  -27.751  18.109  1.00 25.11  ? 356  PRO A CB  1 
ATOM   2623  C  CG  . PRO A 1 353 ? -6.360  -27.559  19.377  1.00 24.51  ? 356  PRO A CG  1 
ATOM   2624  C  CD  . PRO A 1 353 ? -4.931  -27.466  18.952  1.00 24.78  ? 356  PRO A CD  1 
ATOM   2625  N  N   . ASN A 1 354 ? -7.752  -25.217  15.984  1.00 24.90  ? 357  ASN A N   1 
ATOM   2626  C  CA  . ASN A 1 354 ? -8.519  -23.987  15.923  1.00 25.06  ? 357  ASN A CA  1 
ATOM   2627  C  C   . ASN A 1 354 ? -7.756  -22.773  16.478  1.00 26.18  ? 357  ASN A C   1 
ATOM   2628  O  O   . ASN A 1 354 ? -8.248  -22.036  17.338  1.00 25.25  ? 357  ASN A O   1 
ATOM   2629  C  CB  . ASN A 1 354 ? -9.838  -24.185  16.655  1.00 25.61  ? 357  ASN A CB  1 
ATOM   2630  C  CG  . ASN A 1 354 ? -10.682 -25.293  16.050  1.00 26.40  ? 357  ASN A CG  1 
ATOM   2631  O  OD1 . ASN A 1 354 ? -10.392 -25.787  14.958  1.00 26.55  ? 357  ASN A OD1 1 
ATOM   2632  N  ND2 . ASN A 1 354 ? -11.743 -25.682  16.758  1.00 25.44  ? 357  ASN A ND2 1 
ATOM   2633  N  N   . TYR A 1 355 ? -6.542  -22.574  15.984  1.00 26.71  ? 358  TYR A N   1 
ATOM   2634  C  CA  . TYR A 1 355 ? -5.668  -21.570  16.550  1.00 28.81  ? 358  TYR A CA  1 
ATOM   2635  C  C   . TYR A 1 355 ? -5.892  -20.148  16.032  1.00 29.52  ? 358  TYR A C   1 
ATOM   2636  O  O   . TYR A 1 355 ? -5.745  -19.186  16.781  1.00 30.23  ? 358  TYR A O   1 
ATOM   2637  C  CB  . TYR A 1 355 ? -4.213  -21.997  16.404  1.00 30.38  ? 358  TYR A CB  1 
ATOM   2638  C  CG  . TYR A 1 355 ? -3.540  -22.186  17.733  1.00 34.56  ? 358  TYR A CG  1 
ATOM   2639  C  CD1 . TYR A 1 355 ? -4.075  -23.052  18.700  1.00 35.19  ? 358  TYR A CD1 1 
ATOM   2640  C  CD2 . TYR A 1 355 ? -2.375  -21.485  18.043  1.00 35.10  ? 358  TYR A CD2 1 
ATOM   2641  C  CE1 . TYR A 1 355 ? -3.455  -23.213  19.928  1.00 35.89  ? 358  TYR A CE1 1 
ATOM   2642  C  CE2 . TYR A 1 355 ? -1.753  -21.639  19.268  1.00 36.50  ? 358  TYR A CE2 1 
ATOM   2643  C  CZ  . TYR A 1 355 ? -2.299  -22.502  20.203  1.00 37.27  ? 358  TYR A CZ  1 
ATOM   2644  O  OH  . TYR A 1 355 ? -1.675  -22.647  21.418  1.00 40.93  ? 358  TYR A OH  1 
ATOM   2645  N  N   . PHE A 1 356 ? -6.250  -20.005  14.764  1.00 28.74  ? 359  PHE A N   1 
ATOM   2646  C  CA  . PHE A 1 356 ? -6.524  -18.679  14.228  1.00 29.15  ? 359  PHE A CA  1 
ATOM   2647  C  C   . PHE A 1 356 ? -7.866  -18.671  13.522  1.00 30.13  ? 359  PHE A C   1 
ATOM   2648  O  O   . PHE A 1 356 ? -8.414  -19.737  13.211  1.00 29.09  ? 359  PHE A O   1 
ATOM   2649  C  CB  . PHE A 1 356 ? -5.385  -18.187  13.336  1.00 28.01  ? 359  PHE A CB  1 
ATOM   2650  C  CG  . PHE A 1 356 ? -5.237  -18.936  12.016  1.00 28.96  ? 359  PHE A CG  1 
ATOM   2651  C  CD1 . PHE A 1 356 ? -4.630  -20.188  11.963  1.00 28.21  ? 359  PHE A CD1 1 
ATOM   2652  C  CD2 . PHE A 1 356 ? -5.654  -18.351  10.819  1.00 27.73  ? 359  PHE A CD2 1 
ATOM   2653  C  CE1 . PHE A 1 356 ? -4.471  -20.863  10.754  1.00 28.64  ? 359  PHE A CE1 1 
ATOM   2654  C  CE2 . PHE A 1 356 ? -5.491  -19.015  9.613   1.00 28.67  ? 359  PHE A CE2 1 
ATOM   2655  C  CZ  . PHE A 1 356 ? -4.904  -20.274  9.578   1.00 29.54  ? 359  PHE A CZ  1 
ATOM   2656  N  N   . TRP A 1 357 ? -8.415  -17.476  13.320  1.00 30.03  ? 360  TRP A N   1 
ATOM   2657  C  CA  . TRP A 1 357 ? -9.703  -17.338  12.646  1.00 31.71  ? 360  TRP A CA  1 
ATOM   2658  C  C   . TRP A 1 357 ? -9.560  -16.794  11.264  1.00 30.68  ? 360  TRP A C   1 
ATOM   2659  O  O   . TRP A 1 357 ? -8.684  -15.970  10.983  1.00 26.59  ? 360  TRP A O   1 
ATOM   2660  C  CB  . TRP A 1 357 ? -10.658 -16.470  13.445  1.00 34.85  ? 360  TRP A CB  1 
ATOM   2661  C  CG  . TRP A 1 357 ? -10.996 -17.035  14.807  1.00 39.52  ? 360  TRP A CG  1 
ATOM   2662  C  CD1 . TRP A 1 357 ? -10.135 -17.210  15.895  1.00 40.87  ? 360  TRP A CD1 1 
ATOM   2663  C  CD2 . TRP A 1 357 ? -12.301 -17.501  15.278  1.00 38.86  ? 360  TRP A CD2 1 
ATOM   2664  N  NE1 . TRP A 1 357 ? -10.801 -17.747  16.963  1.00 41.40  ? 360  TRP A NE1 1 
ATOM   2665  C  CE2 . TRP A 1 357 ? -12.106 -17.941  16.664  1.00 41.28  ? 360  TRP A CE2 1 
ATOM   2666  C  CE3 . TRP A 1 357 ? -13.561 -17.607  14.712  1.00 39.62  ? 360  TRP A CE3 1 
ATOM   2667  C  CZ2 . TRP A 1 357 ? -13.151 -18.444  17.433  1.00 40.05  ? 360  TRP A CZ2 1 
ATOM   2668  C  CZ3 . TRP A 1 357 ? -14.603 -18.125  15.494  1.00 39.22  ? 360  TRP A CZ3 1 
ATOM   2669  C  CH2 . TRP A 1 357 ? -14.402 -18.530  16.822  1.00 38.45  ? 360  TRP A CH2 1 
ATOM   2670  N  N   . MET A 1 358 ? -10.427 -17.272  10.382  1.00 31.04  ? 361  MET A N   1 
ATOM   2671  C  CA  . MET A 1 358 ? -10.439 -16.823  9.009   1.00 33.75  ? 361  MET A CA  1 
ATOM   2672  C  C   . MET A 1 358 ? -11.851 -16.596  8.535   1.00 33.41  ? 361  MET A C   1 
ATOM   2673  O  O   . MET A 1 358 ? -12.778 -17.267  9.018   1.00 34.81  ? 361  MET A O   1 
ATOM   2674  C  CB  . MET A 1 358 ? -9.771  -17.849  8.118   1.00 32.73  ? 361  MET A CB  1 
ATOM   2675  C  CG  . MET A 1 358 ? -8.269  -17.738  8.145   1.00 35.40  ? 361  MET A CG  1 
ATOM   2676  S  SD  . MET A 1 358 ? -7.576  -18.394  6.622   1.00 40.38  ? 361  MET A SD  1 
ATOM   2677  C  CE  . MET A 1 358 ? -8.218  -20.054  6.638   1.00 40.06  ? 361  MET A CE  1 
ATOM   2678  N  N   . VAL A 1 359 ? -12.011 -15.677  7.582   1.00 31.91  ? 362  VAL A N   1 
ATOM   2679  C  CA  . VAL A 1 359 ? -13.313 -15.477  6.961   1.00 33.47  ? 362  VAL A CA  1 
ATOM   2680  C  C   . VAL A 1 359 ? -13.599 -16.657  6.046   1.00 35.42  ? 362  VAL A C   1 
ATOM   2681  O  O   . VAL A 1 359 ? -12.731 -17.084  5.287   1.00 37.15  ? 362  VAL A O   1 
ATOM   2682  C  CB  . VAL A 1 359 ? -13.495 -14.093  6.239   1.00 33.08  ? 362  VAL A CB  1 
ATOM   2683  C  CG1 . VAL A 1 359 ? -12.471 -13.065  6.706   1.00 30.91  ? 362  VAL A CG1 1 
ATOM   2684  C  CG2 . VAL A 1 359 ? -13.501 -14.223  4.717   1.00 32.43  ? 362  VAL A CG2 1 
ATOM   2685  N  N   . SER A 1 360 ? -14.816 -17.184  6.149   1.00 40.21  ? 363  SER A N   1 
ATOM   2686  C  CA  . SER A 1 360 ? -15.279 -18.306  5.340   1.00 44.42  ? 363  SER A CA  1 
ATOM   2687  C  C   . SER A 1 360 ? -16.727 -18.634  5.659   1.00 48.17  ? 363  SER A C   1 
ATOM   2688  O  O   . SER A 1 360 ? -17.145 -18.566  6.824   1.00 52.49  ? 363  SER A O   1 
ATOM   2689  C  CB  . SER A 1 360 ? -14.430 -19.539  5.618   1.00 45.78  ? 363  SER A CB  1 
ATOM   2690  O  OG  . SER A 1 360 ? -14.270 -19.687  7.008   1.00 47.25  ? 363  SER A OG  1 
ATOM   2691  N  N   . GLY A 1 361 ? -17.476 -19.023  4.631   1.00 48.01  ? 364  GLY A N   1 
ATOM   2692  C  CA  . GLY A 1 361 ? -18.888 -19.375  4.788   1.00 51.91  ? 364  GLY A CA  1 
ATOM   2693  C  C   . GLY A 1 361 ? -19.157 -20.844  4.527   1.00 54.00  ? 364  GLY A C   1 
ATOM   2694  O  O   . GLY A 1 361 ? -18.283 -21.689  4.738   1.00 58.91  ? 364  GLY A O   1 
ATOM   2695  N  N   . GLY B 1 6   ? 8.241   -55.051  18.190  1.00 33.50  ? 9    GLY B N   1 
ATOM   2696  C  CA  . GLY B 1 6   ? 9.435   -55.915  18.450  1.00 32.84  ? 9    GLY B CA  1 
ATOM   2697  C  C   . GLY B 1 6   ? 10.721  -55.416  17.810  1.00 32.53  ? 9    GLY B C   1 
ATOM   2698  O  O   . GLY B 1 6   ? 11.578  -56.210  17.397  1.00 31.07  ? 9    GLY B O   1 
ATOM   2699  N  N   . VAL B 1 7   ? 10.852  -54.092  17.723  1.00 34.40  ? 10   VAL B N   1 
ATOM   2700  C  CA  . VAL B 1 7   ? 12.088  -53.441  17.253  1.00 34.17  ? 10   VAL B CA  1 
ATOM   2701  C  C   . VAL B 1 7   ? 12.558  -52.375  18.252  1.00 33.27  ? 10   VAL B C   1 
ATOM   2702  O  O   . VAL B 1 7   ? 11.757  -51.603  18.776  1.00 32.70  ? 10   VAL B O   1 
ATOM   2703  C  CB  . VAL B 1 7   ? 11.930  -52.818  15.834  1.00 34.99  ? 10   VAL B CB  1 
ATOM   2704  C  CG1 . VAL B 1 7   ? 11.397  -53.846  14.853  1.00 34.94  ? 10   VAL B CG1 1 
ATOM   2705  C  CG2 . VAL B 1 7   ? 10.982  -51.640  15.851  1.00 35.79  ? 10   VAL B CG2 1 
ATOM   2706  N  N   . LEU B 1 8   ? 13.858  -52.336  18.519  1.00 31.90  ? 11   LEU B N   1 
ATOM   2707  C  CA  . LEU B 1 8   ? 14.447  -51.221  19.262  1.00 28.55  ? 11   LEU B CA  1 
ATOM   2708  C  C   . LEU B 1 8   ? 14.150  -49.887  18.564  1.00 30.03  ? 11   LEU B C   1 
ATOM   2709  O  O   . LEU B 1 8   ? 14.096  -49.824  17.329  1.00 30.10  ? 11   LEU B O   1 
ATOM   2710  C  CB  . LEU B 1 8   ? 15.953  -51.408  19.384  1.00 26.89  ? 11   LEU B CB  1 
ATOM   2711  C  CG  . LEU B 1 8   ? 16.393  -52.626  20.205  1.00 26.11  ? 11   LEU B CG  1 
ATOM   2712  C  CD1 . LEU B 1 8   ? 17.902  -52.653  20.337  1.00 25.35  ? 11   LEU B CD1 1 
ATOM   2713  C  CD2 . LEU B 1 8   ? 15.744  -52.594  21.578  1.00 25.28  ? 11   LEU B CD2 1 
ATOM   2714  N  N   . PRO B 1 9   ? 13.930  -48.817  19.351  1.00 30.00  ? 12   PRO B N   1 
ATOM   2715  C  CA  . PRO B 1 9   ? 13.773  -47.457  18.794  1.00 28.31  ? 12   PRO B CA  1 
ATOM   2716  C  C   . PRO B 1 9   ? 15.040  -46.949  18.077  1.00 28.12  ? 12   PRO B C   1 
ATOM   2717  O  O   . PRO B 1 9   ? 16.130  -47.387  18.397  1.00 26.36  ? 12   PRO B O   1 
ATOM   2718  C  CB  . PRO B 1 9   ? 13.483  -46.594  20.032  1.00 28.48  ? 12   PRO B CB  1 
ATOM   2719  C  CG  . PRO B 1 9   ? 13.831  -47.431  21.227  1.00 29.52  ? 12   PRO B CG  1 
ATOM   2720  C  CD  . PRO B 1 9   ? 13.711  -48.867  20.812  1.00 29.16  ? 12   PRO B CD  1 
ATOM   2721  N  N   . ARG B 1 10  ? 14.890  -46.061  17.088  1.00 29.41  ? 13   ARG B N   1 
ATOM   2722  C  CA  . ARG B 1 10  ? 16.045  -45.393  16.470  1.00 29.57  ? 13   ARG B CA  1 
ATOM   2723  C  C   . ARG B 1 10  ? 15.923  -43.860  16.593  1.00 28.65  ? 13   ARG B C   1 
ATOM   2724  O  O   . ARG B 1 10  ? 14.895  -43.303  16.252  1.00 30.55  ? 13   ARG B O   1 
ATOM   2725  C  CB  . ARG B 1 10  ? 16.209  -45.795  15.003  1.00 32.87  ? 13   ARG B CB  1 
ATOM   2726  C  CG  . ARG B 1 10  ? 17.442  -45.161  14.341  1.00 33.92  ? 13   ARG B CG  1 
ATOM   2727  C  CD  . ARG B 1 10  ? 17.434  -45.269  12.824  1.00 33.99  ? 13   ARG B CD  1 
ATOM   2728  N  NE  . ARG B 1 10  ? 18.227  -46.402  12.362  1.00 37.35  ? 13   ARG B NE  1 
ATOM   2729  C  CZ  . ARG B 1 10  ? 19.424  -46.324  11.773  1.00 36.48  ? 13   ARG B CZ  1 
ATOM   2730  N  NH1 . ARG B 1 10  ? 20.002  -45.146  11.539  1.00 35.29  ? 13   ARG B NH1 1 
ATOM   2731  N  NH2 . ARG B 1 10  ? 20.042  -47.445  11.405  1.00 34.53  ? 13   ARG B NH2 1 
ATOM   2732  N  N   . PRO B 1 11  ? 16.938  -43.173  17.143  1.00 27.57  ? 14   PRO B N   1 
ATOM   2733  C  CA  . PRO B 1 11  ? 18.111  -43.625  17.867  1.00 27.09  ? 14   PRO B CA  1 
ATOM   2734  C  C   . PRO B 1 11  ? 17.695  -44.355  19.124  1.00 26.89  ? 14   PRO B C   1 
ATOM   2735  O  O   . PRO B 1 11  ? 16.550  -44.269  19.544  1.00 26.41  ? 14   PRO B O   1 
ATOM   2736  C  CB  . PRO B 1 11  ? 18.799  -42.312  18.265  1.00 28.28  ? 14   PRO B CB  1 
ATOM   2737  C  CG  . PRO B 1 11  ? 18.392  -41.335  17.221  1.00 28.59  ? 14   PRO B CG  1 
ATOM   2738  C  CD  . PRO B 1 11  ? 16.969  -41.714  16.915  1.00 29.46  ? 14   PRO B CD  1 
ATOM   2739  N  N   . CYS B 1 12  ? 18.617  -45.084  19.724  1.00 27.79  ? 15   CYS B N   1 
ATOM   2740  C  CA  . CYS B 1 12  ? 18.335  -45.670  21.020  1.00 29.21  ? 15   CYS B CA  1 
ATOM   2741  C  C   . CYS B 1 12  ? 19.573  -45.578  21.891  1.00 28.80  ? 15   CYS B C   1 
ATOM   2742  O  O   . CYS B 1 12  ? 20.663  -45.215  21.423  1.00 27.96  ? 15   CYS B O   1 
ATOM   2743  C  CB  . CYS B 1 12  ? 17.836  -47.121  20.885  1.00 27.02  ? 15   CYS B CB  1 
ATOM   2744  S  SG  . CYS B 1 12  ? 18.993  -48.274  20.129  1.00 29.42  ? 15   CYS B SG  1 
ATOM   2745  N  N   . ARG B 1 13  ? 19.399  -45.864  23.168  1.00 29.64  ? 16   ARG B N   1 
ATOM   2746  C  CA  . ARG B 1 13  ? 20.556  -45.940  24.042  1.00 30.79  ? 16   ARG B CA  1 
ATOM   2747  C  C   . ARG B 1 13  ? 20.603  -47.276  24.751  1.00 27.21  ? 16   ARG B C   1 
ATOM   2748  O  O   . ARG B 1 13  ? 19.576  -47.896  25.076  1.00 27.56  ? 16   ARG B O   1 
ATOM   2749  C  CB  . ARG B 1 13  ? 20.620  -44.761  25.008  1.00 35.41  ? 16   ARG B CB  1 
ATOM   2750  C  CG  . ARG B 1 13  ? 19.470  -44.721  25.989  1.00 42.18  ? 16   ARG B CG  1 
ATOM   2751  C  CD  . ARG B 1 13  ? 19.542  -43.485  26.869  1.00 46.96  ? 16   ARG B CD  1 
ATOM   2752  N  NE  . ARG B 1 13  ? 18.916  -42.330  26.243  1.00 50.80  ? 16   ARG B NE  1 
ATOM   2753  C  CZ  . ARG B 1 13  ? 19.586  -41.343  25.658  1.00 53.66  ? 16   ARG B CZ  1 
ATOM   2754  N  NH1 . ARG B 1 13  ? 20.916  -41.369  25.619  1.00 54.20  ? 16   ARG B NH1 1 
ATOM   2755  N  NH2 . ARG B 1 13  ? 18.920  -40.327  25.118  1.00 53.11  ? 16   ARG B NH2 1 
ATOM   2756  N  N   . VAL B 1 14  ? 21.825  -47.703  24.986  1.00 23.58  ? 17   VAL B N   1 
ATOM   2757  C  CA  . VAL B 1 14  ? 22.105  -49.052  25.337  1.00 23.05  ? 17   VAL B CA  1 
ATOM   2758  C  C   . VAL B 1 14  ? 23.171  -49.048  26.438  1.00 23.47  ? 17   VAL B C   1 
ATOM   2759  O  O   . VAL B 1 14  ? 24.161  -48.279  26.377  1.00 22.92  ? 17   VAL B O   1 
ATOM   2760  C  CB  . VAL B 1 14  ? 22.544  -49.765  24.021  1.00 23.17  ? 17   VAL B CB  1 
ATOM   2761  C  CG1 . VAL B 1 14  ? 23.773  -50.623  24.180  1.00 21.54  ? 17   VAL B CG1 1 
ATOM   2762  C  CG2 . VAL B 1 14  ? 21.343  -50.445  23.341  1.00 21.69  ? 17   VAL B CG2 1 
ATOM   2763  N  N   . LEU B 1 15  ? 22.950  -49.877  27.455  1.00 22.91  ? 18   LEU B N   1 
ATOM   2764  C  CA  . LEU B 1 15  ? 23.954  -50.132  28.472  1.00 24.50  ? 18   LEU B CA  1 
ATOM   2765  C  C   . LEU B 1 15  ? 24.786  -51.349  28.089  1.00 24.77  ? 18   LEU B C   1 
ATOM   2766  O  O   . LEU B 1 15  ? 24.242  -52.432  27.890  1.00 25.07  ? 18   LEU B O   1 
ATOM   2767  C  CB  . LEU B 1 15  ? 23.304  -50.354  29.846  1.00 25.40  ? 18   LEU B CB  1 
ATOM   2768  C  CG  . LEU B 1 15  ? 24.233  -50.743  30.997  1.00 25.08  ? 18   LEU B CG  1 
ATOM   2769  C  CD1 . LEU B 1 15  ? 25.270  -49.652  31.236  1.00 26.84  ? 18   LEU B CD1 1 
ATOM   2770  C  CD2 . LEU B 1 15  ? 23.410  -50.983  32.248  1.00 26.49  ? 18   LEU B CD2 1 
ATOM   2771  N  N   . VAL B 1 16  ? 26.104  -51.163  28.005  1.00 24.66  ? 19   VAL B N   1 
ATOM   2772  C  CA  . VAL B 1 16  ? 27.005  -52.247  27.684  1.00 24.99  ? 19   VAL B CA  1 
ATOM   2773  C  C   . VAL B 1 16  ? 27.805  -52.682  28.928  1.00 25.34  ? 19   VAL B C   1 
ATOM   2774  O  O   . VAL B 1 16  ? 28.761  -52.014  29.344  1.00 25.44  ? 19   VAL B O   1 
ATOM   2775  C  CB  . VAL B 1 16  ? 27.936  -51.889  26.497  1.00 25.05  ? 19   VAL B CB  1 
ATOM   2776  C  CG1 . VAL B 1 16  ? 28.826  -53.072  26.158  1.00 24.74  ? 19   VAL B CG1 1 
ATOM   2777  C  CG2 . VAL B 1 16  ? 27.128  -51.509  25.255  1.00 23.85  ? 19   VAL B CG2 1 
ATOM   2778  N  N   . LEU B 1 17  ? 27.381  -53.792  29.518  1.00 24.93  ? 20   LEU B N   1 
ATOM   2779  C  CA  . LEU B 1 17  ? 28.138  -54.486  30.555  1.00 25.10  ? 20   LEU B CA  1 
ATOM   2780  C  C   . LEU B 1 17  ? 29.186  -55.366  29.911  1.00 26.27  ? 20   LEU B C   1 
ATOM   2781  O  O   . LEU B 1 17  ? 28.859  -56.333  29.200  1.00 26.10  ? 20   LEU B O   1 
ATOM   2782  C  CB  . LEU B 1 17  ? 27.224  -55.373  31.387  1.00 27.00  ? 20   LEU B CB  1 
ATOM   2783  C  CG  . LEU B 1 17  ? 25.889  -54.853  31.898  1.00 27.09  ? 20   LEU B CG  1 
ATOM   2784  C  CD1 . LEU B 1 17  ? 25.404  -55.866  32.914  1.00 30.01  ? 20   LEU B CD1 1 
ATOM   2785  C  CD2 . LEU B 1 17  ? 26.066  -53.504  32.567  1.00 31.36  ? 20   LEU B CD2 1 
ATOM   2786  N  N   . LEU B 1 18  ? 30.447  -55.033  30.160  1.00 24.68  ? 21   LEU B N   1 
ATOM   2787  C  CA  . LEU B 1 18  ? 31.557  -55.677  29.505  1.00 26.25  ? 21   LEU B CA  1 
ATOM   2788  C  C   . LEU B 1 18  ? 32.532  -56.125  30.567  1.00 29.78  ? 21   LEU B C   1 
ATOM   2789  O  O   . LEU B 1 18  ? 32.920  -55.328  31.452  1.00 31.33  ? 21   LEU B O   1 
ATOM   2790  C  CB  . LEU B 1 18  ? 32.234  -54.674  28.564  1.00 25.81  ? 21   LEU B CB  1 
ATOM   2791  C  CG  . LEU B 1 18  ? 33.376  -55.142  27.657  1.00 26.10  ? 21   LEU B CG  1 
ATOM   2792  C  CD1 . LEU B 1 18  ? 33.334  -54.356  26.352  1.00 26.39  ? 21   LEU B CD1 1 
ATOM   2793  C  CD2 . LEU B 1 18  ? 34.733  -54.978  28.324  1.00 26.43  ? 21   LEU B CD2 1 
ATOM   2794  N  N   . ASN B 1 19  ? 32.935  -57.387  30.490  1.00 29.87  ? 22   ASN B N   1 
ATOM   2795  C  CA  . ASN B 1 19  ? 33.996  -57.896  31.341  1.00 31.91  ? 22   ASN B CA  1 
ATOM   2796  C  C   . ASN B 1 19  ? 35.312  -57.680  30.635  1.00 33.86  ? 22   ASN B C   1 
ATOM   2797  O  O   . ASN B 1 19  ? 35.567  -58.322  29.621  1.00 36.50  ? 22   ASN B O   1 
ATOM   2798  C  CB  . ASN B 1 19  ? 33.781  -59.375  31.651  1.00 32.10  ? 22   ASN B CB  1 
ATOM   2799  C  CG  . ASN B 1 19  ? 34.799  -59.935  32.640  1.00 34.26  ? 22   ASN B CG  1 
ATOM   2800  O  OD1 . ASN B 1 19  ? 34.555  -60.975  33.249  1.00 33.89  ? 22   ASN B OD1 1 
ATOM   2801  N  ND2 . ASN B 1 19  ? 35.952  -59.269  32.788  1.00 34.71  ? 22   ASN B ND2 1 
ATOM   2802  N  N   . PRO B 1 20  ? 36.155  -56.767  31.154  1.00 36.29  ? 23   PRO B N   1 
ATOM   2803  C  CA  . PRO B 1 20  ? 37.391  -56.411  30.442  1.00 37.48  ? 23   PRO B CA  1 
ATOM   2804  C  C   . PRO B 1 20  ? 38.391  -57.552  30.382  1.00 42.11  ? 23   PRO B C   1 
ATOM   2805  O  O   . PRO B 1 20  ? 39.258  -57.564  29.493  1.00 41.57  ? 23   PRO B O   1 
ATOM   2806  C  CB  . PRO B 1 20  ? 37.954  -55.242  31.257  1.00 35.59  ? 23   PRO B CB  1 
ATOM   2807  C  CG  . PRO B 1 20  ? 37.337  -55.370  32.598  1.00 35.06  ? 23   PRO B CG  1 
ATOM   2808  C  CD  . PRO B 1 20  ? 35.989  -55.990  32.399  1.00 35.16  ? 23   PRO B CD  1 
ATOM   2809  N  N   . ARG B 1 21  ? 38.251  -58.495  31.316  1.00 46.78  ? 24   ARG B N   1 
ATOM   2810  C  CA  . ARG B 1 21  ? 39.085  -59.689  31.383  1.00 54.47  ? 24   ARG B CA  1 
ATOM   2811  C  C   . ARG B 1 21  ? 38.678  -60.736  30.348  1.00 57.94  ? 24   ARG B C   1 
ATOM   2812  O  O   . ARG B 1 21  ? 39.409  -61.702  30.115  1.00 60.21  ? 24   ARG B O   1 
ATOM   2813  C  CB  . ARG B 1 21  ? 39.043  -60.288  32.791  1.00 60.20  ? 24   ARG B CB  1 
ATOM   2814  C  CG  . ARG B 1 21  ? 39.961  -59.591  33.786  1.00 65.66  ? 24   ARG B CG  1 
ATOM   2815  C  CD  . ARG B 1 21  ? 40.020  -60.339  35.110  1.00 75.79  ? 24   ARG B CD  1 
ATOM   2816  N  NE  . ARG B 1 21  ? 40.551  -61.701  34.967  1.00 86.02  ? 24   ARG B NE  1 
ATOM   2817  C  CZ  . ARG B 1 21  ? 40.576  -62.622  35.936  1.00 88.18  ? 24   ARG B CZ  1 
ATOM   2818  N  NH1 . ARG B 1 21  ? 40.100  -62.352  37.150  1.00 86.24  ? 24   ARG B NH1 1 
ATOM   2819  N  NH2 . ARG B 1 21  ? 41.081  -63.826  35.687  1.00 86.58  ? 24   ARG B NH2 1 
ATOM   2820  N  N   . GLY B 1 22  ? 37.519  -60.528  29.720  1.00 62.03  ? 25   GLY B N   1 
ATOM   2821  C  CA  . GLY B 1 22  ? 36.986  -61.436  28.698  1.00 64.64  ? 25   GLY B CA  1 
ATOM   2822  C  C   . GLY B 1 22  ? 37.727  -61.391  27.372  1.00 65.39  ? 25   GLY B C   1 
ATOM   2823  O  O   . GLY B 1 22  ? 38.297  -60.358  26.993  1.00 65.34  ? 25   GLY B O   1 
ATOM   2824  N  N   . GLY B 1 23  ? 37.705  -62.517  26.662  1.00 66.48  ? 26   GLY B N   1 
ATOM   2825  C  CA  . GLY B 1 23  ? 38.472  -62.674  25.427  1.00 64.17  ? 26   GLY B CA  1 
ATOM   2826  C  C   . GLY B 1 23  ? 39.953  -62.547  25.712  1.00 62.73  ? 26   GLY B C   1 
ATOM   2827  O  O   . GLY B 1 23  ? 40.632  -61.716  25.104  1.00 63.84  ? 26   GLY B O   1 
ATOM   2828  N  N   . LYS B 1 24  ? 40.439  -63.365  26.650  1.00 57.78  ? 27   LYS B N   1 
ATOM   2829  C  CA  . LYS B 1 24  ? 41.798  -63.252  27.197  1.00 57.54  ? 27   LYS B CA  1 
ATOM   2830  C  C   . LYS B 1 24  ? 42.252  -61.791  27.442  1.00 53.13  ? 27   LYS B C   1 
ATOM   2831  O  O   . LYS B 1 24  ? 43.373  -61.399  27.100  1.00 47.51  ? 27   LYS B O   1 
ATOM   2832  C  CB  . LYS B 1 24  ? 42.807  -64.023  26.324  1.00 63.21  ? 27   LYS B CB  1 
ATOM   2833  C  CG  . LYS B 1 24  ? 43.757  -64.957  27.090  1.00 69.98  ? 27   LYS B CG  1 
ATOM   2834  C  CD  . LYS B 1 24  ? 44.846  -64.242  27.903  1.00 70.92  ? 27   LYS B CD  1 
ATOM   2835  C  CE  . LYS B 1 24  ? 44.466  -64.079  29.375  1.00 71.33  ? 27   LYS B CE  1 
ATOM   2836  N  NZ  . LYS B 1 24  ? 45.443  -63.253  30.141  1.00 67.53  ? 27   LYS B NZ  1 
ATOM   2837  N  N   . GLY B 1 25  ? 41.361  -60.994  28.032  1.00 50.74  ? 28   GLY B N   1 
ATOM   2838  C  CA  . GLY B 1 25  ? 41.656  -59.601  28.383  1.00 46.03  ? 28   GLY B CA  1 
ATOM   2839  C  C   . GLY B 1 25  ? 41.628  -58.644  27.210  1.00 45.46  ? 28   GLY B C   1 
ATOM   2840  O  O   . GLY B 1 25  ? 42.375  -57.661  27.176  1.00 41.06  ? 28   GLY B O   1 
ATOM   2841  N  N   . LYS B 1 26  ? 40.762  -58.922  26.241  1.00 46.90  ? 29   LYS B N   1 
ATOM   2842  C  CA  . LYS B 1 26  ? 40.709  -58.096  25.035  1.00 45.64  ? 29   LYS B CA  1 
ATOM   2843  C  C   . LYS B 1 26  ? 39.342  -57.495  24.742  1.00 39.25  ? 29   LYS B C   1 
ATOM   2844  O  O   . LYS B 1 26  ? 39.197  -56.695  23.812  1.00 40.35  ? 29   LYS B O   1 
ATOM   2845  C  CB  . LYS B 1 26  ? 41.223  -58.888  23.828  1.00 52.29  ? 29   LYS B CB  1 
ATOM   2846  C  CG  . LYS B 1 26  ? 42.630  -58.506  23.393  1.00 58.62  ? 29   LYS B CG  1 
ATOM   2847  C  CD  . LYS B 1 26  ? 42.572  -57.445  22.305  1.00 60.77  ? 29   LYS B CD  1 
ATOM   2848  C  CE  . LYS B 1 26  ? 43.893  -57.347  21.559  1.00 67.62  ? 29   LYS B CE  1 
ATOM   2849  N  NZ  . LYS B 1 26  ? 44.933  -56.613  22.337  1.00 67.41  ? 29   LYS B NZ  1 
ATOM   2850  N  N   . ALA B 1 27  ? 38.347  -57.870  25.539  1.00 35.72  ? 30   ALA B N   1 
ATOM   2851  C  CA  . ALA B 1 27  ? 36.972  -57.494  25.251  1.00 33.78  ? 30   ALA B CA  1 
ATOM   2852  C  C   . ALA B 1 27  ? 36.794  -56.002  24.950  1.00 33.73  ? 30   ALA B C   1 
ATOM   2853  O  O   . ALA B 1 27  ? 36.064  -55.651  24.022  1.00 34.31  ? 30   ALA B O   1 
ATOM   2854  C  CB  . ALA B 1 27  ? 36.050  -57.936  26.363  1.00 31.62  ? 30   ALA B CB  1 
ATOM   2855  N  N   . LEU B 1 28  ? 37.461  -55.133  25.714  1.00 31.94  ? 31   LEU B N   1 
ATOM   2856  C  CA  . LEU B 1 28  ? 37.318  -53.674  25.533  1.00 32.34  ? 31   LEU B CA  1 
ATOM   2857  C  C   . LEU B 1 28  ? 37.878  -53.167  24.197  1.00 31.57  ? 31   LEU B C   1 
ATOM   2858  O  O   . LEU B 1 28  ? 37.240  -52.372  23.502  1.00 31.98  ? 31   LEU B O   1 
ATOM   2859  C  CB  . LEU B 1 28  ? 37.934  -52.904  26.721  1.00 30.17  ? 31   LEU B CB  1 
ATOM   2860  C  CG  . LEU B 1 28  ? 37.710  -51.391  26.828  1.00 31.12  ? 31   LEU B CG  1 
ATOM   2861  C  CD1 . LEU B 1 28  ? 36.262  -50.987  26.594  1.00 30.02  ? 31   LEU B CD1 1 
ATOM   2862  C  CD2 . LEU B 1 28  ? 38.167  -50.890  28.190  1.00 30.93  ? 31   LEU B CD2 1 
ATOM   2863  N  N   . GLN B 1 29  ? 39.079  -53.619  23.864  1.00 34.07  ? 32   GLN B N   1 
ATOM   2864  C  CA  . GLN B 1 29  ? 39.710  -53.327  22.579  1.00 35.96  ? 32   GLN B CA  1 
ATOM   2865  C  C   . GLN B 1 29  ? 38.856  -53.857  21.412  1.00 32.00  ? 32   GLN B C   1 
ATOM   2866  O  O   . GLN B 1 29  ? 38.636  -53.153  20.427  1.00 31.99  ? 32   GLN B O   1 
ATOM   2867  C  CB  . GLN B 1 29  ? 41.105  -53.950  22.573  1.00 42.27  ? 32   GLN B CB  1 
ATOM   2868  C  CG  . GLN B 1 29  ? 42.030  -53.449  21.474  1.00 50.51  ? 32   GLN B CG  1 
ATOM   2869  C  CD  . GLN B 1 29  ? 43.496  -53.800  21.723  1.00 57.03  ? 32   GLN B CD  1 
ATOM   2870  O  OE1 . GLN B 1 29  ? 44.237  -54.122  20.787  1.00 57.57  ? 32   GLN B OE1 1 
ATOM   2871  N  NE2 . GLN B 1 29  ? 43.919  -53.740  22.992  1.00 59.15  ? 32   GLN B NE2 1 
ATOM   2872  N  N   . LEU B 1 30  ? 38.344  -55.077  21.549  1.00 29.09  ? 33   LEU B N   1 
ATOM   2873  C  CA  . LEU B 1 30  ? 37.424  -55.640  20.560  1.00 28.11  ? 33   LEU B CA  1 
ATOM   2874  C  C   . LEU B 1 30  ? 36.156  -54.820  20.434  1.00 27.52  ? 33   LEU B C   1 
ATOM   2875  O  O   . LEU B 1 30  ? 35.685  -54.569  19.316  1.00 28.95  ? 33   LEU B O   1 
ATOM   2876  C  CB  . LEU B 1 30  ? 37.075  -57.091  20.877  1.00 27.84  ? 33   LEU B CB  1 
ATOM   2877  C  CG  . LEU B 1 30  ? 38.177  -58.126  20.620  1.00 28.56  ? 33   LEU B CG  1 
ATOM   2878  C  CD1 . LEU B 1 30  ? 37.729  -59.489  21.125  1.00 27.29  ? 33   LEU B CD1 1 
ATOM   2879  C  CD2 . LEU B 1 30  ? 38.557  -58.172  19.136  1.00 27.46  ? 33   LEU B CD2 1 
ATOM   2880  N  N   . PHE B 1 31  ? 35.609  -54.380  21.564  1.00 25.75  ? 34   PHE B N   1 
ATOM   2881  C  CA  . PHE B 1 31  ? 34.445  -53.515  21.514  1.00 24.71  ? 34   PHE B CA  1 
ATOM   2882  C  C   . PHE B 1 31  ? 34.767  -52.267  20.700  1.00 25.65  ? 34   PHE B C   1 
ATOM   2883  O  O   . PHE B 1 31  ? 33.980  -51.845  19.862  1.00 24.96  ? 34   PHE B O   1 
ATOM   2884  C  CB  . PHE B 1 31  ? 33.954  -53.123  22.904  1.00 23.70  ? 34   PHE B CB  1 
ATOM   2885  C  CG  . PHE B 1 31  ? 32.813  -52.153  22.868  1.00 23.21  ? 34   PHE B CG  1 
ATOM   2886  C  CD1 . PHE B 1 31  ? 31.511  -52.605  22.825  1.00 22.68  ? 34   PHE B CD1 1 
ATOM   2887  C  CD2 . PHE B 1 31  ? 33.048  -50.780  22.817  1.00 23.68  ? 34   PHE B CD2 1 
ATOM   2888  C  CE1 . PHE B 1 31  ? 30.455  -51.720  22.748  1.00 22.20  ? 34   PHE B CE1 1 
ATOM   2889  C  CE2 . PHE B 1 31  ? 31.994  -49.884  22.734  1.00 23.82  ? 34   PHE B CE2 1 
ATOM   2890  C  CZ  . PHE B 1 31  ? 30.695  -50.358  22.706  1.00 23.55  ? 34   PHE B CZ  1 
ATOM   2891  N  N   . ARG B 1 32  ? 35.934  -51.692  20.973  1.00 28.53  ? 35   ARG B N   1 
ATOM   2892  C  CA  . ARG B 1 32  ? 36.457  -50.517  20.274  1.00 30.18  ? 35   ARG B CA  1 
ATOM   2893  C  C   . ARG B 1 32  ? 36.638  -50.734  18.761  1.00 29.05  ? 35   ARG B C   1 
ATOM   2894  O  O   . ARG B 1 32  ? 36.126  -49.969  17.960  1.00 30.23  ? 35   ARG B O   1 
ATOM   2895  C  CB  . ARG B 1 32  ? 37.801  -50.110  20.918  1.00 32.96  ? 35   ARG B CB  1 
ATOM   2896  C  CG  . ARG B 1 32  ? 37.833  -48.831  21.751  1.00 34.66  ? 35   ARG B CG  1 
ATOM   2897  C  CD  . ARG B 1 32  ? 37.073  -48.898  23.067  1.00 34.30  ? 35   ARG B CD  1 
ATOM   2898  N  NE  . ARG B 1 32  ? 35.888  -48.028  23.045  1.00 36.01  ? 35   ARG B NE  1 
ATOM   2899  C  CZ  . ARG B 1 32  ? 35.587  -47.094  23.960  1.00 34.63  ? 35   ARG B CZ  1 
ATOM   2900  N  NH1 . ARG B 1 32  ? 36.370  -46.866  25.015  1.00 34.75  ? 35   ARG B NH1 1 
ATOM   2901  N  NH2 . ARG B 1 32  ? 34.482  -46.383  23.819  1.00 32.32  ? 35   ARG B NH2 1 
ATOM   2902  N  N   . SER B 1 33  ? 37.372  -51.767  18.366  1.00 29.88  ? 36   SER B N   1 
ATOM   2903  C  CA  . SER B 1 33  ? 37.623  -51.999  16.935  1.00 29.47  ? 36   SER B CA  1 
ATOM   2904  C  C   . SER B 1 33  ? 36.390  -52.526  16.184  1.00 30.10  ? 36   SER B C   1 
ATOM   2905  O  O   . SER B 1 33  ? 36.123  -52.086  15.058  1.00 30.13  ? 36   SER B O   1 
ATOM   2906  C  CB  . SER B 1 33  ? 38.841  -52.912  16.715  1.00 29.63  ? 36   SER B CB  1 
ATOM   2907  O  OG  . SER B 1 33  ? 38.764  -54.108  17.481  1.00 29.93  ? 36   SER B OG  1 
ATOM   2908  N  N   . HIS B 1 34  ? 35.618  -53.416  16.821  1.00 28.74  ? 37   HIS B N   1 
ATOM   2909  C  CA  . HIS B 1 34  ? 34.579  -54.203  16.116  1.00 28.64  ? 37   HIS B CA  1 
ATOM   2910  C  C   . HIS B 1 34  ? 33.139  -53.871  16.399  1.00 28.47  ? 37   HIS B C   1 
ATOM   2911  O  O   . HIS B 1 34  ? 32.276  -54.112  15.536  1.00 27.31  ? 37   HIS B O   1 
ATOM   2912  C  CB  . HIS B 1 34  ? 34.806  -55.702  16.341  1.00 30.01  ? 37   HIS B CB  1 
ATOM   2913  C  CG  . HIS B 1 34  ? 35.980  -56.256  15.575  1.00 31.35  ? 37   HIS B CG  1 
ATOM   2914  N  ND1 . HIS B 1 34  ? 37.251  -55.941  15.875  1.00 31.40  ? 37   HIS B ND1 1 
ATOM   2915  C  CD2 . HIS B 1 34  ? 36.036  -57.114  14.463  1.00 32.12  ? 37   HIS B CD2 1 
ATOM   2916  C  CE1 . HIS B 1 34  ? 38.088  -56.568  15.010  1.00 32.19  ? 37   HIS B CE1 1 
ATOM   2917  N  NE2 . HIS B 1 34  ? 37.341  -57.284  14.151  1.00 32.14  ? 37   HIS B NE2 1 
ATOM   2918  N  N   . VAL B 1 35  ? 32.839  -53.348  17.596  1.00 25.83  ? 38   VAL B N   1 
ATOM   2919  C  CA  . VAL B 1 35  ? 31.440  -53.069  17.953  1.00 24.76  ? 38   VAL B CA  1 
ATOM   2920  C  C   . VAL B 1 35  ? 31.115  -51.592  17.782  1.00 25.64  ? 38   VAL B C   1 
ATOM   2921  O  O   . VAL B 1 35  ? 30.173  -51.234  17.081  1.00 25.68  ? 38   VAL B O   1 
ATOM   2922  C  CB  . VAL B 1 35  ? 31.082  -53.541  19.387  1.00 23.66  ? 38   VAL B CB  1 
ATOM   2923  C  CG1 . VAL B 1 35  ? 29.644  -53.154  19.760  1.00 21.45  ? 38   VAL B CG1 1 
ATOM   2924  C  CG2 . VAL B 1 35  ? 31.297  -55.046  19.524  1.00 23.23  ? 38   VAL B CG2 1 
ATOM   2925  N  N   . GLN B 1 36  ? 31.905  -50.743  18.439  1.00 28.29  ? 39   GLN B N   1 
ATOM   2926  C  CA  . GLN B 1 36  ? 31.689  -49.303  18.430  1.00 29.34  ? 39   GLN B CA  1 
ATOM   2927  C  C   . GLN B 1 36  ? 31.414  -48.690  17.040  1.00 28.76  ? 39   GLN B C   1 
ATOM   2928  O  O   . GLN B 1 36  ? 30.391  -48.015  16.875  1.00 28.49  ? 39   GLN B O   1 
ATOM   2929  C  CB  . GLN B 1 36  ? 32.835  -48.567  19.145  1.00 31.07  ? 39   GLN B CB  1 
ATOM   2930  C  CG  . GLN B 1 36  ? 32.543  -47.078  19.295  1.00 31.48  ? 39   GLN B CG  1 
ATOM   2931  C  CD  . GLN B 1 36  ? 33.546  -46.353  20.161  1.00 31.60  ? 39   GLN B CD  1 
ATOM   2932  O  OE1 . GLN B 1 36  ? 34.396  -46.962  20.810  1.00 30.42  ? 39   GLN B OE1 1 
ATOM   2933  N  NE2 . GLN B 1 36  ? 33.452  -45.039  20.168  1.00 31.75  ? 39   GLN B NE2 1 
ATOM   2934  N  N   . PRO B 1 37  ? 32.287  -48.948  16.033  1.00 29.83  ? 40   PRO B N   1 
ATOM   2935  C  CA  . PRO B 1 37  ? 32.055  -48.363  14.690  1.00 30.86  ? 40   PRO B CA  1 
ATOM   2936  C  C   . PRO B 1 37  ? 30.668  -48.676  14.111  1.00 29.31  ? 40   PRO B C   1 
ATOM   2937  O  O   . PRO B 1 37  ? 30.052  -47.806  13.504  1.00 31.12  ? 40   PRO B O   1 
ATOM   2938  C  CB  . PRO B 1 37  ? 33.149  -49.013  13.830  1.00 31.87  ? 40   PRO B CB  1 
ATOM   2939  C  CG  . PRO B 1 37  ? 34.225  -49.337  14.804  1.00 32.64  ? 40   PRO B CG  1 
ATOM   2940  C  CD  . PRO B 1 37  ? 33.479  -49.815  16.023  1.00 30.91  ? 40   PRO B CD  1 
ATOM   2941  N  N   . LEU B 1 38  ? 30.179  -49.891  14.321  1.00 29.72  ? 41   LEU B N   1 
ATOM   2942  C  CA  . LEU B 1 38  ? 28.849  -50.281  13.846  1.00 31.69  ? 41   LEU B CA  1 
ATOM   2943  C  C   . LEU B 1 38  ? 27.747  -49.555  14.622  1.00 32.59  ? 41   LEU B C   1 
ATOM   2944  O  O   . LEU B 1 38  ? 26.792  -49.048  14.025  1.00 34.39  ? 41   LEU B O   1 
ATOM   2945  C  CB  . LEU B 1 38  ? 28.674  -51.811  13.904  1.00 31.95  ? 41   LEU B CB  1 
ATOM   2946  C  CG  . LEU B 1 38  ? 28.955  -52.745  12.694  1.00 35.33  ? 41   LEU B CG  1 
ATOM   2947  C  CD1 . LEU B 1 38  ? 29.679  -52.090  11.522  1.00 35.04  ? 41   LEU B CD1 1 
ATOM   2948  C  CD2 . LEU B 1 38  ? 29.646  -54.059  13.076  1.00 33.19  ? 41   LEU B CD2 1 
ATOM   2949  N  N   . LEU B 1 39  ? 27.895  -49.477  15.951  1.00 31.32  ? 42   LEU B N   1 
ATOM   2950  C  CA  . LEU B 1 39  ? 26.924  -48.779  16.798  1.00 28.09  ? 42   LEU B CA  1 
ATOM   2951  C  C   . LEU B 1 39  ? 26.758  -47.337  16.360  1.00 27.63  ? 42   LEU B C   1 
ATOM   2952  O  O   . LEU B 1 39  ? 25.633  -46.816  16.259  1.00 25.59  ? 42   LEU B O   1 
ATOM   2953  C  CB  . LEU B 1 39  ? 27.352  -48.848  18.274  1.00 27.33  ? 42   LEU B CB  1 
ATOM   2954  C  CG  . LEU B 1 39  ? 27.398  -50.223  18.946  1.00 24.71  ? 42   LEU B CG  1 
ATOM   2955  C  CD1 . LEU B 1 39  ? 27.587  -50.049  20.441  1.00 25.29  ? 42   LEU B CD1 1 
ATOM   2956  C  CD2 . LEU B 1 39  ? 26.149  -51.037  18.658  1.00 23.67  ? 42   LEU B CD2 1 
ATOM   2957  N  N   . ALA B 1 40  ? 27.893  -46.700  16.091  1.00 28.79  ? 43   ALA B N   1 
ATOM   2958  C  CA  . ALA B 1 40  ? 27.925  -45.335  15.577  1.00 31.13  ? 43   ALA B CA  1 
ATOM   2959  C  C   . ALA B 1 40  ? 27.083  -45.207  14.309  1.00 32.00  ? 43   ALA B C   1 
ATOM   2960  O  O   . ALA B 1 40  ? 26.187  -44.368  14.240  1.00 30.92  ? 43   ALA B O   1 
ATOM   2961  C  CB  . ALA B 1 40  ? 29.362  -44.906  15.312  1.00 32.09  ? 43   ALA B CB  1 
ATOM   2962  N  N   . GLU B 1 41  ? 27.343  -46.058  13.317  1.00 34.84  ? 44   GLU B N   1 
ATOM   2963  C  CA  . GLU B 1 41  ? 26.593  -45.985  12.059  1.00 35.01  ? 44   GLU B CA  1 
ATOM   2964  C  C   . GLU B 1 41  ? 25.088  -46.218  12.251  1.00 33.56  ? 44   GLU B C   1 
ATOM   2965  O  O   . GLU B 1 41  ? 24.268  -45.616  11.550  1.00 31.34  ? 44   GLU B O   1 
ATOM   2966  C  CB  . GLU B 1 41  ? 27.164  -46.935  11.017  1.00 39.99  ? 44   GLU B CB  1 
ATOM   2967  C  CG  . GLU B 1 41  ? 26.686  -46.647  9.598   1.00 47.07  ? 44   GLU B CG  1 
ATOM   2968  C  CD  . GLU B 1 41  ? 27.505  -47.374  8.547   1.00 54.84  ? 44   GLU B CD  1 
ATOM   2969  O  OE1 . GLU B 1 41  ? 26.893  -48.025  7.667   1.00 59.58  ? 44   GLU B OE1 1 
ATOM   2970  O  OE2 . GLU B 1 41  ? 28.759  -47.299  8.606   1.00 58.32  ? 44   GLU B OE2 1 
ATOM   2971  N  N   . ALA B 1 42  ? 24.734  -47.052  13.230  1.00 30.34  ? 45   ALA B N   1 
ATOM   2972  C  CA  . ALA B 1 42  ? 23.336  -47.366  13.523  1.00 29.08  ? 45   ALA B CA  1 
ATOM   2973  C  C   . ALA B 1 42  ? 22.651  -46.411  14.528  1.00 29.45  ? 45   ALA B C   1 
ATOM   2974  O  O   . ALA B 1 42  ? 21.494  -46.622  14.914  1.00 28.83  ? 45   ALA B O   1 
ATOM   2975  C  CB  . ALA B 1 42  ? 23.231  -48.804  13.997  1.00 28.92  ? 45   ALA B CB  1 
ATOM   2976  N  N   . GLU B 1 43  ? 23.362  -45.370  14.952  1.00 30.27  ? 46   GLU B N   1 
ATOM   2977  C  CA  . GLU B 1 43  ? 22.833  -44.407  15.938  1.00 32.00  ? 46   GLU B CA  1 
ATOM   2978  C  C   . GLU B 1 43  ? 22.353  -45.098  17.226  1.00 30.23  ? 46   GLU B C   1 
ATOM   2979  O  O   . GLU B 1 43  ? 21.229  -44.884  17.720  1.00 28.49  ? 46   GLU B O   1 
ATOM   2980  C  CB  . GLU B 1 43  ? 21.726  -43.544  15.327  1.00 34.97  ? 46   GLU B CB  1 
ATOM   2981  C  CG  . GLU B 1 43  ? 22.128  -42.812  14.050  1.00 40.25  ? 46   GLU B CG  1 
ATOM   2982  C  CD  . GLU B 1 43  ? 20.922  -42.270  13.319  1.00 44.27  ? 46   GLU B CD  1 
ATOM   2983  O  OE1 . GLU B 1 43  ? 20.722  -41.040  13.356  1.00 50.01  ? 46   GLU B OE1 1 
ATOM   2984  O  OE2 . GLU B 1 43  ? 20.155  -43.074  12.736  1.00 47.48  ? 46   GLU B OE2 1 
ATOM   2985  N  N   . ILE B 1 44  ? 23.227  -45.955  17.738  1.00 28.89  ? 47   ILE B N   1 
ATOM   2986  C  CA  . ILE B 1 44  ? 23.039  -46.593  19.018  1.00 27.67  ? 47   ILE B CA  1 
ATOM   2987  C  C   . ILE B 1 44  ? 24.080  -45.965  19.919  1.00 27.91  ? 47   ILE B C   1 
ATOM   2988  O  O   . ILE B 1 44  ? 25.265  -46.228  19.760  1.00 28.45  ? 47   ILE B O   1 
ATOM   2989  C  CB  . ILE B 1 44  ? 23.187  -48.132  18.907  1.00 26.94  ? 47   ILE B CB  1 
ATOM   2990  C  CG1 . ILE B 1 44  ? 22.140  -48.666  17.920  1.00 24.96  ? 47   ILE B CG1 1 
ATOM   2991  C  CG2 . ILE B 1 44  ? 23.029  -48.813  20.267  1.00 26.03  ? 47   ILE B CG2 1 
ATOM   2992  C  CD1 . ILE B 1 44  ? 22.121  -50.172  17.757  1.00 24.45  ? 47   ILE B CD1 1 
ATOM   2993  N  N   . SER B 1 45  ? 23.642  -45.063  20.798  1.00 28.17  ? 48   SER B N   1 
ATOM   2994  C  CA  . SER B 1 45  ? 24.511  -44.544  21.846  1.00 29.00  ? 48   SER B CA  1 
ATOM   2995  C  C   . SER B 1 45  ? 24.613  -45.639  22.876  1.00 28.12  ? 48   SER B C   1 
ATOM   2996  O  O   . SER B 1 45  ? 23.675  -46.415  23.070  1.00 30.63  ? 48   SER B O   1 
ATOM   2997  C  CB  . SER B 1 45  ? 23.917  -43.326  22.558  1.00 29.23  ? 48   SER B CB  1 
ATOM   2998  O  OG  . SER B 1 45  ? 23.425  -42.397  21.639  1.00 36.85  ? 48   SER B OG  1 
ATOM   2999  N  N   . PHE B 1 46  ? 25.739  -45.663  23.563  1.00 25.65  ? 49   PHE B N   1 
ATOM   3000  C  CA  . PHE B 1 46  ? 26.008  -46.685  24.531  1.00 24.67  ? 49   PHE B CA  1 
ATOM   3001  C  C   . PHE B 1 46  ? 26.772  -46.045  25.691  1.00 23.93  ? 49   PHE B C   1 
ATOM   3002  O  O   . PHE B 1 46  ? 27.450  -45.030  25.528  1.00 21.68  ? 49   PHE B O   1 
ATOM   3003  C  CB  . PHE B 1 46  ? 26.883  -47.761  23.886  1.00 22.69  ? 49   PHE B CB  1 
ATOM   3004  C  CG  . PHE B 1 46  ? 28.218  -47.242  23.449  1.00 23.34  ? 49   PHE B CG  1 
ATOM   3005  C  CD1 . PHE B 1 46  ? 28.370  -46.634  22.206  1.00 23.69  ? 49   PHE B CD1 1 
ATOM   3006  C  CD2 . PHE B 1 46  ? 29.316  -47.331  24.286  1.00 23.01  ? 49   PHE B CD2 1 
ATOM   3007  C  CE1 . PHE B 1 46  ? 29.602  -46.133  21.807  1.00 24.41  ? 49   PHE B CE1 1 
ATOM   3008  C  CE2 . PHE B 1 46  ? 30.546  -46.830  23.899  1.00 24.25  ? 49   PHE B CE2 1 
ATOM   3009  C  CZ  . PHE B 1 46  ? 30.695  -46.234  22.658  1.00 23.71  ? 49   PHE B CZ  1 
ATOM   3010  N  N   . THR B 1 47  ? 26.685  -46.667  26.853  1.00 23.95  ? 50   THR B N   1 
ATOM   3011  C  CA  . THR B 1 47  ? 27.671  -46.403  27.874  1.00 24.81  ? 50   THR B CA  1 
ATOM   3012  C  C   . THR B 1 47  ? 28.190  -47.728  28.367  1.00 24.22  ? 50   THR B C   1 
ATOM   3013  O  O   . THR B 1 47  ? 27.419  -48.656  28.565  1.00 24.64  ? 50   THR B O   1 
ATOM   3014  C  CB  . THR B 1 47  ? 27.164  -45.495  29.025  1.00 24.66  ? 50   THR B CB  1 
ATOM   3015  O  OG1 . THR B 1 47  ? 27.172  -46.201  30.261  1.00 28.47  ? 50   THR B OG1 1 
ATOM   3016  C  CG2 . THR B 1 47  ? 25.820  -44.930  28.750  1.00 24.46  ? 50   THR B CG2 1 
ATOM   3017  N  N   . LEU B 1 48  ? 29.508  -47.816  28.491  1.00 25.05  ? 51   LEU B N   1 
ATOM   3018  C  CA  . LEU B 1 48  ? 30.173  -48.994  28.995  1.00 27.61  ? 51   LEU B CA  1 
ATOM   3019  C  C   . LEU B 1 48  ? 30.281  -48.940  30.506  1.00 29.35  ? 51   LEU B C   1 
ATOM   3020  O  O   . LEU B 1 48  ? 30.603  -47.910  31.091  1.00 31.44  ? 51   LEU B O   1 
ATOM   3021  C  CB  . LEU B 1 48  ? 31.579  -49.114  28.407  1.00 28.20  ? 51   LEU B CB  1 
ATOM   3022  C  CG  . LEU B 1 48  ? 31.698  -49.289  26.889  1.00 28.79  ? 51   LEU B CG  1 
ATOM   3023  C  CD1 . LEU B 1 48  ? 33.026  -48.728  26.396  1.00 27.46  ? 51   LEU B CD1 1 
ATOM   3024  C  CD2 . LEU B 1 48  ? 31.524  -50.747  26.481  1.00 28.71  ? 51   LEU B CD2 1 
ATOM   3025  N  N   . MET B 1 49  ? 30.001  -50.070  31.122  1.00 30.38  ? 52   MET B N   1 
ATOM   3026  C  CA  . MET B 1 49  ? 30.128  -50.250  32.536  1.00 32.21  ? 52   MET B CA  1 
ATOM   3027  C  C   . MET B 1 49  ? 30.945  -51.532  32.664  1.00 32.45  ? 52   MET B C   1 
ATOM   3028  O  O   . MET B 1 49  ? 30.485  -52.605  32.256  1.00 30.88  ? 52   MET B O   1 
ATOM   3029  C  CB  . MET B 1 49  ? 28.745  -50.425  33.135  1.00 34.90  ? 52   MET B CB  1 
ATOM   3030  C  CG  . MET B 1 49  ? 28.694  -50.330  34.640  1.00 41.87  ? 52   MET B CG  1 
ATOM   3031  S  SD  . MET B 1 49  ? 27.034  -50.619  35.306  1.00 52.99  ? 52   MET B SD  1 
ATOM   3032  C  CE  . MET B 1 49  ? 26.163  -49.127  34.837  1.00 47.30  ? 52   MET B CE  1 
ATOM   3033  N  N   . LEU B 1 50  ? 32.165  -51.403  33.188  1.00 30.10  ? 53   LEU B N   1 
ATOM   3034  C  CA  . LEU B 1 50  ? 33.087  -52.517  33.292  1.00 31.39  ? 53   LEU B CA  1 
ATOM   3035  C  C   . LEU B 1 50  ? 32.754  -53.375  34.498  1.00 34.02  ? 53   LEU B C   1 
ATOM   3036  O  O   . LEU B 1 50  ? 32.594  -52.878  35.612  1.00 36.93  ? 53   LEU B O   1 
ATOM   3037  C  CB  . LEU B 1 50  ? 34.542  -52.041  33.340  1.00 29.20  ? 53   LEU B CB  1 
ATOM   3038  C  CG  . LEU B 1 50  ? 35.009  -51.065  32.251  1.00 29.69  ? 53   LEU B CG  1 
ATOM   3039  C  CD1 . LEU B 1 50  ? 36.476  -50.703  32.417  1.00 29.65  ? 53   LEU B CD1 1 
ATOM   3040  C  CD2 . LEU B 1 50  ? 34.767  -51.583  30.847  1.00 30.23  ? 53   LEU B CD2 1 
ATOM   3041  N  N   . THR B 1 51  ? 32.637  -54.673  34.279  1.00 37.06  ? 54   THR B N   1 
ATOM   3042  C  CA  . THR B 1 51  ? 32.183  -55.555  35.336  1.00 41.89  ? 54   THR B CA  1 
ATOM   3043  C  C   . THR B 1 51  ? 32.946  -56.882  35.302  1.00 45.73  ? 54   THR B C   1 
ATOM   3044  O  O   . THR B 1 51  ? 32.797  -57.655  34.358  1.00 44.75  ? 54   THR B O   1 
ATOM   3045  C  CB  . THR B 1 51  ? 30.650  -55.730  35.231  1.00 43.41  ? 54   THR B CB  1 
ATOM   3046  O  OG1 . THR B 1 51  ? 30.102  -56.026  36.518  1.00 50.50  ? 54   THR B OG1 1 
ATOM   3047  C  CG2 . THR B 1 51  ? 30.259  -56.807  34.212  1.00 40.08  ? 54   THR B CG2 1 
ATOM   3048  N  N   . GLU B 1 52  ? 33.784  -57.130  36.313  1.00 52.42  ? 55   GLU B N   1 
ATOM   3049  C  CA  . GLU B 1 52  ? 34.602  -58.373  36.362  1.00 56.08  ? 55   GLU B CA  1 
ATOM   3050  C  C   . GLU B 1 52  ? 34.560  -59.166  37.677  1.00 57.84  ? 55   GLU B C   1 
ATOM   3051  O  O   . GLU B 1 52  ? 34.557  -60.404  37.653  1.00 60.07  ? 55   GLU B O   1 
ATOM   3052  C  CB  . GLU B 1 52  ? 36.062  -58.147  35.905  1.00 58.21  ? 55   GLU B CB  1 
ATOM   3053  C  CG  . GLU B 1 52  ? 36.703  -56.820  36.307  1.00 63.46  ? 55   GLU B CG  1 
ATOM   3054  C  CD  . GLU B 1 52  ? 38.223  -56.830  36.187  1.00 63.94  ? 55   GLU B CD  1 
ATOM   3055  O  OE1 . GLU B 1 52  ? 38.851  -57.810  36.641  1.00 63.44  ? 55   GLU B OE1 1 
ATOM   3056  O  OE2 . GLU B 1 52  ? 38.795  -55.850  35.654  1.00 62.30  ? 55   GLU B OE2 1 
ATOM   3057  N  N   . ARG B 1 53  ? 34.540  -58.460  38.808  1.00 56.37  ? 56   ARG B N   1 
ATOM   3058  C  CA  . ARG B 1 53  ? 34.325  -59.083  40.123  1.00 56.06  ? 56   ARG B CA  1 
ATOM   3059  C  C   . ARG B 1 53  ? 33.002  -59.889  40.167  1.00 55.90  ? 56   ARG B C   1 
ATOM   3060  O  O   . ARG B 1 53  ? 32.101  -59.677  39.342  1.00 50.20  ? 56   ARG B O   1 
ATOM   3061  C  CB  . ARG B 1 53  ? 34.422  -58.014  41.241  1.00 56.47  ? 56   ARG B CB  1 
ATOM   3062  C  CG  . ARG B 1 53  ? 33.339  -58.062  42.326  1.00 58.97  ? 56   ARG B CG  1 
ATOM   3063  C  CD  . ARG B 1 53  ? 33.571  -57.084  43.478  1.00 57.13  ? 56   ARG B CD  1 
ATOM   3064  N  NE  . ARG B 1 53  ? 33.765  -55.697  43.045  1.00 54.67  ? 56   ARG B NE  1 
ATOM   3065  C  CZ  . ARG B 1 53  ? 32.795  -54.788  42.914  1.00 55.07  ? 56   ARG B CZ  1 
ATOM   3066  N  NH1 . ARG B 1 53  ? 31.527  -55.100  43.175  1.00 53.81  ? 56   ARG B NH1 1 
ATOM   3067  N  NH2 . ARG B 1 53  ? 33.097  -53.555  42.517  1.00 50.11  ? 56   ARG B NH2 1 
ATOM   3068  N  N   . ARG B 1 54  ? 32.903  -60.822  41.114  1.00 57.93  ? 57   ARG B N   1 
ATOM   3069  C  CA  . ARG B 1 54  ? 31.715  -61.680  41.240  1.00 59.09  ? 57   ARG B CA  1 
ATOM   3070  C  C   . ARG B 1 54  ? 30.456  -60.972  41.777  1.00 55.01  ? 57   ARG B C   1 
ATOM   3071  O  O   . ARG B 1 54  ? 30.533  -60.143  42.696  1.00 54.35  ? 57   ARG B O   1 
ATOM   3072  C  CB  . ARG B 1 54  ? 32.024  -62.926  42.075  1.00 64.51  ? 57   ARG B CB  1 
ATOM   3073  C  CG  . ARG B 1 54  ? 32.781  -62.663  43.373  1.00 71.40  ? 57   ARG B CG  1 
ATOM   3074  C  CD  . ARG B 1 54  ? 32.330  -63.603  44.489  1.00 78.53  ? 57   ARG B CD  1 
ATOM   3075  N  NE  . ARG B 1 54  ? 32.121  -64.979  44.025  1.00 82.41  ? 57   ARG B NE  1 
ATOM   3076  C  CZ  . ARG B 1 54  ? 31.271  -65.846  44.575  1.00 85.27  ? 57   ARG B CZ  1 
ATOM   3077  N  NH1 . ARG B 1 54  ? 30.525  -65.500  45.623  1.00 83.51  ? 57   ARG B NH1 1 
ATOM   3078  N  NH2 . ARG B 1 54  ? 31.160  -67.067  44.065  1.00 85.69  ? 57   ARG B NH2 1 
ATOM   3079  N  N   . ASN B 1 55  ? 29.307  -61.319  41.187  1.00 50.70  ? 58   ASN B N   1 
ATOM   3080  C  CA  . ASN B 1 55  ? 27.979  -60.758  41.516  1.00 46.92  ? 58   ASN B CA  1 
ATOM   3081  C  C   . ASN B 1 55  ? 27.844  -59.288  41.125  1.00 42.52  ? 58   ASN B C   1 
ATOM   3082  O  O   . ASN B 1 55  ? 26.771  -58.692  41.245  1.00 39.38  ? 58   ASN B O   1 
ATOM   3083  C  CB  . ASN B 1 55  ? 27.628  -60.950  43.005  1.00 51.57  ? 58   ASN B CB  1 
ATOM   3084  C  CG  . ASN B 1 55  ? 28.083  -62.292  43.543  1.00 55.56  ? 58   ASN B CG  1 
ATOM   3085  O  OD1 . ASN B 1 55  ? 27.646  -63.346  43.076  1.00 60.44  ? 58   ASN B OD1 1 
ATOM   3086  N  ND2 . ASN B 1 55  ? 28.980  -62.261  44.522  1.00 55.96  ? 58   ASN B ND2 1 
ATOM   3087  N  N   . HIS B 1 56  ? 28.942  -58.718  40.645  1.00 37.34  ? 59   HIS B N   1 
ATOM   3088  C  CA  . HIS B 1 56  ? 29.015  -57.306  40.335  1.00 36.21  ? 59   HIS B CA  1 
ATOM   3089  C  C   . HIS B 1 56  ? 27.939  -56.907  39.348  1.00 34.10  ? 59   HIS B C   1 
ATOM   3090  O  O   . HIS B 1 56  ? 27.134  -56.007  39.615  1.00 34.03  ? 59   HIS B O   1 
ATOM   3091  C  CB  . HIS B 1 56  ? 30.430  -56.988  39.862  1.00 36.39  ? 59   HIS B CB  1 
ATOM   3092  C  CG  . HIS B 1 56  ? 30.712  -55.522  39.688  1.00 38.37  ? 59   HIS B CG  1 
ATOM   3093  N  ND1 . HIS B 1 56  ? 31.807  -55.071  39.039  1.00 39.38  ? 59   HIS B ND1 1 
ATOM   3094  C  CD2 . HIS B 1 56  ? 30.005  -54.395  40.095  1.00 37.80  ? 59   HIS B CD2 1 
ATOM   3095  C  CE1 . HIS B 1 56  ? 31.803  -53.725  39.038  1.00 38.86  ? 59   HIS B CE1 1 
ATOM   3096  N  NE2 . HIS B 1 56  ? 30.699  -53.314  39.679  1.00 39.16  ? 59   HIS B NE2 1 
ATOM   3097  N  N   . ALA B 1 57  ? 27.882  -57.609  38.222  1.00 33.27  ? 60   ALA B N   1 
ATOM   3098  C  CA  . ALA B 1 57  ? 26.881  -57.358  37.179  1.00 31.38  ? 60   ALA B CA  1 
ATOM   3099  C  C   . ALA B 1 57  ? 25.473  -57.635  37.666  1.00 29.98  ? 60   ALA B C   1 
ATOM   3100  O  O   . ALA B 1 57  ? 24.550  -56.883  37.370  1.00 28.94  ? 60   ALA B O   1 
ATOM   3101  C  CB  . ALA B 1 57  ? 27.189  -58.200  35.945  1.00 31.64  ? 60   ALA B CB  1 
ATOM   3102  N  N   . ARG B 1 58  ? 25.328  -58.717  38.423  1.00 32.42  ? 61   ARG B N   1 
ATOM   3103  C  CA  . ARG B 1 58  ? 24.061  -59.103  39.040  1.00 34.96  ? 61   ARG B CA  1 
ATOM   3104  C  C   . ARG B 1 58  ? 23.529  -57.981  39.919  1.00 36.68  ? 61   ARG B C   1 
ATOM   3105  O  O   . ARG B 1 58  ? 22.358  -57.598  39.812  1.00 40.31  ? 61   ARG B O   1 
ATOM   3106  C  CB  . ARG B 1 58  ? 24.287  -60.331  39.897  1.00 34.89  ? 61   ARG B CB  1 
ATOM   3107  C  CG  . ARG B 1 58  ? 23.061  -61.175  40.196  1.00 36.88  ? 61   ARG B CG  1 
ATOM   3108  C  CD  . ARG B 1 58  ? 23.584  -62.584  40.386  1.00 37.56  ? 61   ARG B CD  1 
ATOM   3109  N  NE  . ARG B 1 58  ? 22.576  -63.561  40.760  1.00 40.58  ? 61   ARG B NE  1 
ATOM   3110  C  CZ  . ARG B 1 58  ? 22.720  -64.875  40.591  1.00 37.77  ? 61   ARG B CZ  1 
ATOM   3111  N  NH1 . ARG B 1 58  ? 23.822  -65.372  40.030  1.00 35.59  ? 61   ARG B NH1 1 
ATOM   3112  N  NH2 . ARG B 1 58  ? 21.750  -65.687  40.968  1.00 39.59  ? 61   ARG B NH2 1 
ATOM   3113  N  N   . GLU B 1 59  ? 24.405  -57.454  40.774  1.00 35.02  ? 62   GLU B N   1 
ATOM   3114  C  CA  . GLU B 1 59  ? 24.047  -56.403  41.716  1.00 34.86  ? 62   GLU B CA  1 
ATOM   3115  C  C   . GLU B 1 59  ? 23.764  -55.083  40.996  1.00 32.62  ? 62   GLU B C   1 
ATOM   3116  O  O   . GLU B 1 59  ? 22.842  -54.358  41.364  1.00 31.10  ? 62   GLU B O   1 
ATOM   3117  C  CB  . GLU B 1 59  ? 25.148  -56.231  42.771  1.00 37.67  ? 62   GLU B CB  1 
ATOM   3118  C  CG  . GLU B 1 59  ? 25.367  -57.441  43.685  1.00 41.69  ? 62   GLU B CG  1 
ATOM   3119  C  CD  . GLU B 1 59  ? 26.555  -57.271  44.644  1.00 46.27  ? 62   GLU B CD  1 
ATOM   3120  O  OE1 . GLU B 1 59  ? 27.131  -56.151  44.705  1.00 46.35  ? 62   GLU B OE1 1 
ATOM   3121  O  OE2 . GLU B 1 59  ? 26.915  -58.258  45.343  1.00 46.79  ? 62   GLU B OE2 1 
ATOM   3122  N  N   . LEU B 1 60  ? 24.536  -54.775  39.955  1.00 32.45  ? 63   LEU B N   1 
ATOM   3123  C  CA  . LEU B 1 60  ? 24.272  -53.554  39.194  1.00 31.74  ? 63   LEU B CA  1 
ATOM   3124  C  C   . LEU B 1 60  ? 22.874  -53.568  38.588  1.00 29.95  ? 63   LEU B C   1 
ATOM   3125  O  O   . LEU B 1 60  ? 22.108  -52.609  38.727  1.00 29.96  ? 63   LEU B O   1 
ATOM   3126  C  CB  . LEU B 1 60  ? 25.330  -53.331  38.121  1.00 35.48  ? 63   LEU B CB  1 
ATOM   3127  C  CG  . LEU B 1 60  ? 26.628  -52.753  38.690  1.00 40.18  ? 63   LEU B CG  1 
ATOM   3128  C  CD1 . LEU B 1 60  ? 27.805  -53.030  37.761  1.00 42.54  ? 63   LEU B CD1 1 
ATOM   3129  C  CD2 . LEU B 1 60  ? 26.495  -51.261  38.994  1.00 39.40  ? 63   LEU B CD2 1 
ATOM   3130  N  N   . VAL B 1 61  ? 22.547  -54.695  37.969  1.00 27.35  ? 64   VAL B N   1 
ATOM   3131  C  CA  . VAL B 1 61  ? 21.309  -54.901  37.251  1.00 26.58  ? 64   VAL B CA  1 
ATOM   3132  C  C   . VAL B 1 61  ? 20.118  -54.896  38.200  1.00 27.48  ? 64   VAL B C   1 
ATOM   3133  O  O   . VAL B 1 61  ? 19.070  -54.311  37.895  1.00 27.86  ? 64   VAL B O   1 
ATOM   3134  C  CB  . VAL B 1 61  ? 21.389  -56.239  36.463  1.00 25.80  ? 64   VAL B CB  1 
ATOM   3135  C  CG1 . VAL B 1 61  ? 20.017  -56.697  36.040  1.00 25.58  ? 64   VAL B CG1 1 
ATOM   3136  C  CG2 . VAL B 1 61  ? 22.296  -56.090  35.246  1.00 24.58  ? 64   VAL B CG2 1 
ATOM   3137  N  N   . ARG B 1 62  ? 20.290  -55.551  39.347  1.00 28.16  ? 65   ARG B N   1 
ATOM   3138  C  CA  . ARG B 1 62  ? 19.284  -55.576  40.401  1.00 30.74  ? 65   ARG B CA  1 
ATOM   3139  C  C   . ARG B 1 62  ? 18.915  -54.176  40.861  1.00 29.98  ? 65   ARG B C   1 
ATOM   3140  O  O   . ARG B 1 62  ? 17.753  -53.902  41.123  1.00 31.33  ? 65   ARG B O   1 
ATOM   3141  C  CB  . ARG B 1 62  ? 19.760  -56.420  41.587  1.00 33.82  ? 65   ARG B CB  1 
ATOM   3142  C  CG  . ARG B 1 62  ? 18.629  -56.923  42.467  1.00 37.63  ? 65   ARG B CG  1 
ATOM   3143  C  CD  . ARG B 1 62  ? 18.990  -58.197  43.234  1.00 40.50  ? 65   ARG B CD  1 
ATOM   3144  N  NE  . ARG B 1 62  ? 19.929  -57.940  44.319  1.00 43.44  ? 65   ARG B NE  1 
ATOM   3145  C  CZ  . ARG B 1 62  ? 21.141  -58.483  44.426  1.00 46.29  ? 65   ARG B CZ  1 
ATOM   3146  N  NH1 . ARG B 1 62  ? 21.590  -59.357  43.528  1.00 49.59  ? 65   ARG B NH1 1 
ATOM   3147  N  NH2 . ARG B 1 62  ? 21.911  -58.156  45.452  1.00 49.40  ? 65   ARG B NH2 1 
ATOM   3148  N  N   . SER B 1 63  ? 19.890  -53.279  40.935  1.00 29.51  ? 66   SER B N   1 
ATOM   3149  C  CA  . SER B 1 63  ? 19.608  -51.910  41.395  1.00 29.55  ? 66   SER B CA  1 
ATOM   3150  C  C   . SER B 1 63  ? 19.460  -50.852  40.284  1.00 29.77  ? 66   SER B C   1 
ATOM   3151  O  O   . SER B 1 63  ? 19.236  -49.679  40.592  1.00 28.35  ? 66   SER B O   1 
ATOM   3152  C  CB  . SER B 1 63  ? 20.669  -51.452  42.401  1.00 28.15  ? 66   SER B CB  1 
ATOM   3153  O  OG  . SER B 1 63  ? 21.937  -51.307  41.780  1.00 27.86  ? 66   SER B OG  1 
ATOM   3154  N  N   . GLU B 1 64  ? 19.582  -51.252  39.014  1.00 28.55  ? 67   GLU B N   1 
ATOM   3155  C  CA  . GLU B 1 64  ? 19.611  -50.284  37.899  1.00 28.46  ? 67   GLU B CA  1 
ATOM   3156  C  C   . GLU B 1 64  ? 18.278  -49.592  37.665  1.00 28.32  ? 67   GLU B C   1 
ATOM   3157  O  O   . GLU B 1 64  ? 17.218  -50.175  37.852  1.00 29.00  ? 67   GLU B O   1 
ATOM   3158  C  CB  . GLU B 1 64  ? 20.099  -50.948  36.594  1.00 28.94  ? 67   GLU B CB  1 
ATOM   3159  C  CG  . GLU B 1 64  ? 20.310  -50.007  35.406  1.00 27.52  ? 67   GLU B CG  1 
ATOM   3160  C  CD  . GLU B 1 64  ? 21.612  -49.221  35.474  1.00 29.87  ? 67   GLU B CD  1 
ATOM   3161  O  OE1 . GLU B 1 64  ? 22.610  -49.706  36.069  1.00 30.82  ? 67   GLU B OE1 1 
ATOM   3162  O  OE2 . GLU B 1 64  ? 21.647  -48.112  34.912  1.00 29.30  ? 67   GLU B OE2 1 
ATOM   3163  N  N   . GLU B 1 65  ? 18.353  -48.323  37.287  1.00 29.87  ? 68   GLU B N   1 
ATOM   3164  C  CA  . GLU B 1 65  ? 17.218  -47.601  36.762  1.00 31.63  ? 68   GLU B CA  1 
ATOM   3165  C  C   . GLU B 1 65  ? 17.074  -48.061  35.304  1.00 31.04  ? 68   GLU B C   1 
ATOM   3166  O  O   . GLU B 1 65  ? 17.804  -47.612  34.425  1.00 29.48  ? 68   GLU B O   1 
ATOM   3167  C  CB  . GLU B 1 65  ? 17.483  -46.095  36.829  1.00 35.04  ? 68   GLU B CB  1 
ATOM   3168  C  CG  . GLU B 1 65  ? 16.457  -45.228  36.106  1.00 38.31  ? 68   GLU B CG  1 
ATOM   3169  C  CD  . GLU B 1 65  ? 15.039  -45.474  36.592  1.00 41.00  ? 68   GLU B CD  1 
ATOM   3170  O  OE1 . GLU B 1 65  ? 14.814  -45.323  37.818  1.00 40.44  ? 68   GLU B OE1 1 
ATOM   3171  O  OE2 . GLU B 1 65  ? 14.160  -45.816  35.750  1.00 40.66  ? 68   GLU B OE2 1 
ATOM   3172  N  N   . LEU B 1 66  ? 16.140  -48.970  35.062  1.00 30.33  ? 69   LEU B N   1 
ATOM   3173  C  CA  . LEU B 1 66  ? 16.012  -49.588  33.741  1.00 28.99  ? 69   LEU B CA  1 
ATOM   3174  C  C   . LEU B 1 66  ? 15.407  -48.659  32.687  1.00 28.29  ? 69   LEU B C   1 
ATOM   3175  O  O   . LEU B 1 66  ? 15.653  -48.834  31.510  1.00 27.97  ? 69   LEU B O   1 
ATOM   3176  C  CB  . LEU B 1 66  ? 15.260  -50.912  33.846  1.00 26.02  ? 69   LEU B CB  1 
ATOM   3177  C  CG  . LEU B 1 66  ? 16.009  -51.954  34.691  1.00 25.87  ? 69   LEU B CG  1 
ATOM   3178  C  CD1 . LEU B 1 66  ? 15.107  -53.148  34.903  1.00 27.41  ? 69   LEU B CD1 1 
ATOM   3179  C  CD2 . LEU B 1 66  ? 17.347  -52.399  34.112  1.00 24.44  ? 69   LEU B CD2 1 
ATOM   3180  N  N   . GLY B 1 67  ? 14.650  -47.658  33.122  1.00 29.67  ? 70   GLY B N   1 
ATOM   3181  C  CA  . GLY B 1 67  ? 14.052  -46.669  32.215  1.00 29.58  ? 70   GLY B CA  1 
ATOM   3182  C  C   . GLY B 1 67  ? 15.030  -45.804  31.436  1.00 31.04  ? 70   GLY B C   1 
ATOM   3183  O  O   . GLY B 1 67  ? 14.647  -45.187  30.447  1.00 33.91  ? 70   GLY B O   1 
ATOM   3184  N  N   . ARG B 1 68  ? 16.291  -45.739  31.869  1.00 31.58  ? 71   ARG B N   1 
ATOM   3185  C  CA  . ARG B 1 68  ? 17.308  -44.993  31.117  1.00 30.39  ? 71   ARG B CA  1 
ATOM   3186  C  C   . ARG B 1 68  ? 17.655  -45.713  29.821  1.00 29.07  ? 71   ARG B C   1 
ATOM   3187  O  O   . ARG B 1 68  ? 18.219  -45.103  28.925  1.00 28.68  ? 71   ARG B O   1 
ATOM   3188  C  CB  . ARG B 1 68  ? 18.632  -44.880  31.872  1.00 31.88  ? 71   ARG B CB  1 
ATOM   3189  C  CG  . ARG B 1 68  ? 18.588  -44.449  33.315  1.00 34.53  ? 71   ARG B CG  1 
ATOM   3190  C  CD  . ARG B 1 68  ? 19.770  -45.090  34.028  1.00 35.67  ? 71   ARG B CD  1 
ATOM   3191  N  NE  . ARG B 1 68  ? 20.776  -44.093  34.303  1.00 36.89  ? 71   ARG B NE  1 
ATOM   3192  C  CZ  . ARG B 1 68  ? 21.981  -44.347  34.784  1.00 36.92  ? 71   ARG B CZ  1 
ATOM   3193  N  NH1 . ARG B 1 68  ? 22.366  -45.587  35.045  1.00 34.14  ? 71   ARG B NH1 1 
ATOM   3194  N  NH2 . ARG B 1 68  ? 22.804  -43.335  35.000  1.00 40.88  ? 71   ARG B NH2 1 
ATOM   3195  N  N   . TRP B 1 69  ? 17.386  -47.017  29.758  1.00 26.04  ? 72   TRP B N   1 
ATOM   3196  C  CA  . TRP B 1 69  ? 17.928  -47.864  28.684  1.00 25.76  ? 72   TRP B CA  1 
ATOM   3197  C  C   . TRP B 1 69  ? 16.873  -48.474  27.802  1.00 24.75  ? 72   TRP B C   1 
ATOM   3198  O  O   . TRP B 1 69  ? 15.828  -48.931  28.276  1.00 24.50  ? 72   TRP B O   1 
ATOM   3199  C  CB  . TRP B 1 69  ? 18.797  -48.976  29.265  1.00 23.85  ? 72   TRP B CB  1 
ATOM   3200  C  CG  . TRP B 1 69  ? 19.797  -48.487  30.270  1.00 22.67  ? 72   TRP B CG  1 
ATOM   3201  C  CD1 . TRP B 1 69  ? 19.808  -48.736  31.637  1.00 22.82  ? 72   TRP B CD1 1 
ATOM   3202  C  CD2 . TRP B 1 69  ? 20.953  -47.625  30.031  1.00 21.79  ? 72   TRP B CD2 1 
ATOM   3203  N  NE1 . TRP B 1 69  ? 20.870  -48.122  32.236  1.00 21.75  ? 72   TRP B NE1 1 
ATOM   3204  C  CE2 . TRP B 1 69  ? 21.591  -47.428  31.338  1.00 22.09  ? 72   TRP B CE2 1 
ATOM   3205  C  CE3 . TRP B 1 69  ? 21.508  -47.012  28.906  1.00 22.07  ? 72   TRP B CE3 1 
ATOM   3206  C  CZ2 . TRP B 1 69  ? 22.740  -46.652  31.494  1.00 21.39  ? 72   TRP B CZ2 1 
ATOM   3207  C  CZ3 . TRP B 1 69  ? 22.659  -46.230  29.076  1.00 22.18  ? 72   TRP B CZ3 1 
ATOM   3208  C  CH2 . TRP B 1 69  ? 23.258  -46.057  30.343  1.00 22.47  ? 72   TRP B CH2 1 
ATOM   3209  N  N   . ASP B 1 70  ? 17.162  -48.510  26.505  1.00 25.19  ? 73   ASP B N   1 
ATOM   3210  C  CA  . ASP B 1 70  ? 16.347  -49.263  25.548  1.00 23.74  ? 73   ASP B CA  1 
ATOM   3211  C  C   . ASP B 1 70  ? 16.700  -50.749  25.474  1.00 23.97  ? 73   ASP B C   1 
ATOM   3212  O  O   . ASP B 1 70  ? 15.894  -51.565  25.008  1.00 23.16  ? 73   ASP B O   1 
ATOM   3213  C  CB  . ASP B 1 70  ? 16.464  -48.603  24.182  1.00 24.78  ? 73   ASP B CB  1 
ATOM   3214  C  CG  . ASP B 1 70  ? 15.975  -47.160  24.210  1.00 24.10  ? 73   ASP B CG  1 
ATOM   3215  O  OD1 . ASP B 1 70  ? 14.789  -46.952  24.530  1.00 22.13  ? 73   ASP B OD1 1 
ATOM   3216  O  OD2 . ASP B 1 70  ? 16.784  -46.254  23.931  1.00 24.55  ? 73   ASP B OD2 1 
ATOM   3217  N  N   . ALA B 1 71  ? 17.902  -51.093  25.944  1.00 23.44  ? 74   ALA B N   1 
ATOM   3218  C  CA  . ALA B 1 71  ? 18.389  -52.467  25.939  1.00 23.66  ? 74   ALA B CA  1 
ATOM   3219  C  C   . ALA B 1 71  ? 19.667  -52.565  26.745  1.00 23.74  ? 74   ALA B C   1 
ATOM   3220  O  O   . ALA B 1 71  ? 20.405  -51.591  26.869  1.00 24.22  ? 74   ALA B O   1 
ATOM   3221  C  CB  . ALA B 1 71  ? 18.667  -52.935  24.501  1.00 23.80  ? 74   ALA B CB  1 
ATOM   3222  N  N   . LEU B 1 72  ? 19.945  -53.759  27.246  1.00 22.81  ? 75   LEU B N   1 
ATOM   3223  C  CA  . LEU B 1 72  ? 21.197  -54.046  27.895  1.00 22.93  ? 75   LEU B CA  1 
ATOM   3224  C  C   . LEU B 1 72  ? 21.993  -55.025  27.032  1.00 24.07  ? 75   LEU B C   1 
ATOM   3225  O  O   . LEU B 1 72  ? 21.475  -56.089  26.662  1.00 22.43  ? 75   LEU B O   1 
ATOM   3226  C  CB  . LEU B 1 72  ? 20.937  -54.684  29.270  1.00 22.69  ? 75   LEU B CB  1 
ATOM   3227  C  CG  . LEU B 1 72  ? 19.887  -54.106  30.232  1.00 22.32  ? 75   LEU B CG  1 
ATOM   3228  C  CD1 . LEU B 1 72  ? 19.910  -54.900  31.534  1.00 20.82  ? 75   LEU B CD1 1 
ATOM   3229  C  CD2 . LEU B 1 72  ? 20.150  -52.624  30.495  1.00 21.44  ? 75   LEU B CD2 1 
ATOM   3230  N  N   . VAL B 1 73  ? 23.243  -54.675  26.724  1.00 24.08  ? 76   VAL B N   1 
ATOM   3231  C  CA  . VAL B 1 73  ? 24.095  -55.580  26.004  1.00 25.25  ? 76   VAL B CA  1 
ATOM   3232  C  C   . VAL B 1 73  ? 25.228  -56.109  26.891  1.00 26.14  ? 76   VAL B C   1 
ATOM   3233  O  O   . VAL B 1 73  ? 25.874  -55.386  27.655  1.00 29.08  ? 76   VAL B O   1 
ATOM   3234  C  CB  . VAL B 1 73  ? 24.499  -55.084  24.556  1.00 27.34  ? 76   VAL B CB  1 
ATOM   3235  C  CG1 . VAL B 1 73  ? 23.777  -53.801  24.154  1.00 25.94  ? 76   VAL B CG1 1 
ATOM   3236  C  CG2 . VAL B 1 73  ? 26.003  -55.040  24.304  1.00 25.07  ? 76   VAL B CG2 1 
ATOM   3237  N  N   . VAL B 1 74  ? 25.404  -57.411  26.803  1.00 24.91  ? 77   VAL B N   1 
ATOM   3238  C  CA  . VAL B 1 74  ? 26.291  -58.167  27.633  1.00 24.29  ? 77   VAL B CA  1 
ATOM   3239  C  C   . VAL B 1 74  ? 27.421  -58.630  26.724  1.00 25.41  ? 77   VAL B C   1 
ATOM   3240  O  O   . VAL B 1 74  ? 27.198  -59.390  25.772  1.00 26.72  ? 77   VAL B O   1 
ATOM   3241  C  CB  . VAL B 1 74  ? 25.503  -59.361  28.189  1.00 24.94  ? 77   VAL B CB  1 
ATOM   3242  C  CG1 . VAL B 1 74  ? 26.364  -60.211  29.093  1.00 27.05  ? 77   VAL B CG1 1 
ATOM   3243  C  CG2 . VAL B 1 74  ? 24.276  -58.871  28.945  1.00 25.47  ? 77   VAL B CG2 1 
ATOM   3244  N  N   . MET B 1 75  ? 28.622  -58.139  26.974  1.00 25.56  ? 78   MET B N   1 
ATOM   3245  C  CA  . MET B 1 75  ? 29.773  -58.519  26.181  1.00 27.40  ? 78   MET B CA  1 
ATOM   3246  C  C   . MET B 1 75  ? 30.760  -59.275  27.043  1.00 28.71  ? 78   MET B C   1 
ATOM   3247  O  O   . MET B 1 75  ? 31.593  -58.690  27.727  1.00 29.24  ? 78   MET B O   1 
ATOM   3248  C  CB  . MET B 1 75  ? 30.425  -57.313  25.489  1.00 27.35  ? 78   MET B CB  1 
ATOM   3249  C  CG  . MET B 1 75  ? 31.593  -57.664  24.585  1.00 28.38  ? 78   MET B CG  1 
ATOM   3250  S  SD  . MET B 1 75  ? 31.838  -56.367  23.354  1.00 31.40  ? 78   MET B SD  1 
ATOM   3251  C  CE  . MET B 1 75  ? 33.354  -56.910  22.576  1.00 31.44  ? 78   MET B CE  1 
ATOM   3252  N  N   . SER B 1 76  ? 30.638  -60.592  26.983  1.00 31.34  ? 79   SER B N   1 
ATOM   3253  C  CA  . SER B 1 76  ? 31.436  -61.531  27.739  1.00 34.40  ? 79   SER B CA  1 
ATOM   3254  C  C   . SER B 1 76  ? 30.893  -62.888  27.330  1.00 36.22  ? 79   SER B C   1 
ATOM   3255  O  O   . SER B 1 76  ? 30.607  -63.112  26.160  1.00 40.14  ? 79   SER B O   1 
ATOM   3256  C  CB  . SER B 1 76  ? 31.246  -61.304  29.242  1.00 36.88  ? 79   SER B CB  1 
ATOM   3257  O  OG  . SER B 1 76  ? 32.266  -61.937  29.999  1.00 40.65  ? 79   SER B OG  1 
ATOM   3258  N  N   . GLY B 1 77  ? 30.718  -63.790  28.279  1.00 36.22  ? 80   GLY B N   1 
ATOM   3259  C  CA  . GLY B 1 77  ? 30.223  -65.109  27.952  1.00 35.29  ? 80   GLY B CA  1 
ATOM   3260  C  C   . GLY B 1 77  ? 28.779  -65.314  28.373  1.00 36.02  ? 80   GLY B C   1 
ATOM   3261  O  O   . GLY B 1 77  ? 28.076  -64.368  28.768  1.00 32.99  ? 80   GLY B O   1 
ATOM   3262  N  N   . ASP B 1 78  ? 28.363  -66.576  28.292  1.00 34.31  ? 81   ASP B N   1 
ATOM   3263  C  CA  . ASP B 1 78  ? 27.047  -67.022  28.693  1.00 33.75  ? 81   ASP B CA  1 
ATOM   3264  C  C   . ASP B 1 78  ? 26.853  -66.766  30.190  1.00 32.85  ? 81   ASP B C   1 
ATOM   3265  O  O   . ASP B 1 78  ? 25.724  -66.566  30.653  1.00 32.53  ? 81   ASP B O   1 
ATOM   3266  C  CB  . ASP B 1 78  ? 26.896  -68.522  28.376  1.00 33.43  ? 81   ASP B CB  1 
ATOM   3267  C  CG  . ASP B 1 78  ? 27.084  -68.845  26.879  1.00 34.25  ? 81   ASP B CG  1 
ATOM   3268  O  OD1 . ASP B 1 78  ? 26.556  -68.098  26.036  1.00 29.81  ? 81   ASP B OD1 1 
ATOM   3269  O  OD2 . ASP B 1 78  ? 27.771  -69.850  26.553  1.00 35.16  ? 81   ASP B OD2 1 
ATOM   3270  N  N   . GLY B 1 79  ? 27.968  -66.779  30.926  1.00 31.80  ? 82   GLY B N   1 
ATOM   3271  C  CA  . GLY B 1 79  ? 27.991  -66.497  32.359  1.00 31.13  ? 82   GLY B CA  1 
ATOM   3272  C  C   . GLY B 1 79  ? 27.468  -65.122  32.707  1.00 31.30  ? 82   GLY B C   1 
ATOM   3273  O  O   . GLY B 1 79  ? 26.597  -64.986  33.564  1.00 32.03  ? 82   GLY B O   1 
ATOM   3274  N  N   . LEU B 1 80  ? 27.989  -64.098  32.033  1.00 31.63  ? 83   LEU B N   1 
ATOM   3275  C  CA  . LEU B 1 80  ? 27.562  -62.729  32.285  1.00 30.39  ? 83   LEU B CA  1 
ATOM   3276  C  C   . LEU B 1 80  ? 26.083  -62.568  32.004  1.00 30.55  ? 83   LEU B C   1 
ATOM   3277  O  O   . LEU B 1 80  ? 25.389  -61.862  32.718  1.00 32.44  ? 83   LEU B O   1 
ATOM   3278  C  CB  . LEU B 1 80  ? 28.333  -61.747  31.416  1.00 31.33  ? 83   LEU B CB  1 
ATOM   3279  C  CG  . LEU B 1 80  ? 29.063  -60.580  32.084  1.00 32.11  ? 83   LEU B CG  1 
ATOM   3280  C  CD1 . LEU B 1 80  ? 28.926  -59.306  31.271  1.00 32.42  ? 83   LEU B CD1 1 
ATOM   3281  C  CD2 . LEU B 1 80  ? 28.600  -60.350  33.515  1.00 33.09  ? 83   LEU B CD2 1 
ATOM   3282  N  N   . MET B 1 81  ? 25.594  -63.228  30.965  1.00 30.73  ? 84   MET B N   1 
ATOM   3283  C  CA  . MET B 1 81  ? 24.185  -63.134  30.623  1.00 29.40  ? 84   MET B CA  1 
ATOM   3284  C  C   . MET B 1 81  ? 23.363  -63.810  31.701  1.00 28.33  ? 84   MET B C   1 
ATOM   3285  O  O   . MET B 1 81  ? 22.296  -63.328  32.065  1.00 27.49  ? 84   MET B O   1 
ATOM   3286  C  CB  . MET B 1 81  ? 23.914  -63.767  29.261  1.00 28.60  ? 84   MET B CB  1 
ATOM   3287  C  CG  . MET B 1 81  ? 22.449  -63.726  28.841  1.00 29.09  ? 84   MET B CG  1 
ATOM   3288  S  SD  . MET B 1 81  ? 21.827  -62.043  28.634  1.00 31.86  ? 84   MET B SD  1 
ATOM   3289  C  CE  . MET B 1 81  ? 22.567  -61.563  27.070  1.00 27.24  ? 84   MET B CE  1 
ATOM   3290  N  N   . HIS B 1 82  ? 23.866  -64.942  32.194  1.00 29.21  ? 85   HIS B N   1 
ATOM   3291  C  CA  . HIS B 1 82  ? 23.285  -65.604  33.358  1.00 30.23  ? 85   HIS B CA  1 
ATOM   3292  C  C   . HIS B 1 82  ? 23.129  -64.616  34.507  1.00 29.75  ? 85   HIS B C   1 
ATOM   3293  O  O   . HIS B 1 82  ? 22.036  -64.456  35.053  1.00 28.93  ? 85   HIS B O   1 
ATOM   3294  C  CB  . HIS B 1 82  ? 24.153  -66.790  33.769  1.00 31.70  ? 85   HIS B CB  1 
ATOM   3295  C  CG  . HIS B 1 82  ? 23.538  -67.645  34.844  1.00 33.76  ? 85   HIS B CG  1 
ATOM   3296  N  ND1 . HIS B 1 82  ? 23.915  -67.567  36.135  1.00 34.04  ? 85   HIS B ND1 1 
ATOM   3297  C  CD2 . HIS B 1 82  ? 22.524  -68.602  34.783  1.00 32.84  ? 85   HIS B CD2 1 
ATOM   3298  C  CE1 . HIS B 1 82  ? 23.186  -68.436  36.860  1.00 34.68  ? 85   HIS B CE1 1 
ATOM   3299  N  NE2 . HIS B 1 82  ? 22.333  -69.067  36.024  1.00 34.27  ? 85   HIS B NE2 1 
ATOM   3300  N  N   . GLU B 1 83  ? 24.205  -63.910  34.844  1.00 29.74  ? 86   GLU B N   1 
ATOM   3301  C  CA  . GLU B 1 83  ? 24.168  -62.959  35.958  1.00 31.85  ? 86   GLU B CA  1 
ATOM   3302  C  C   . GLU B 1 83  ? 23.097  -61.893  35.751  1.00 30.49  ? 86   GLU B C   1 
ATOM   3303  O  O   . GLU B 1 83  ? 22.316  -61.612  36.675  1.00 32.47  ? 86   GLU B O   1 
ATOM   3304  C  CB  . GLU B 1 83  ? 25.541  -62.314  36.207  1.00 35.66  ? 86   GLU B CB  1 
ATOM   3305  C  CG  . GLU B 1 83  ? 26.647  -63.256  36.689  1.00 41.12  ? 86   GLU B CG  1 
ATOM   3306  C  CD  . GLU B 1 83  ? 26.400  -63.851  38.075  1.00 50.03  ? 86   GLU B CD  1 
ATOM   3307  O  OE1 . GLU B 1 83  ? 25.567  -64.789  38.210  1.00 52.79  ? 86   GLU B OE1 1 
ATOM   3308  O  OE2 . GLU B 1 83  ? 27.066  -63.402  39.037  1.00 54.54  ? 86   GLU B OE2 1 
ATOM   3309  N  N   . VAL B 1 84  ? 23.043  -61.317  34.547  1.00 26.02  ? 87   VAL B N   1 
ATOM   3310  C  CA  . VAL B 1 84  ? 22.137  -60.198  34.248  1.00 24.53  ? 87   VAL B CA  1 
ATOM   3311  C  C   . VAL B 1 84  ? 20.665  -60.573  34.423  1.00 25.20  ? 87   VAL B C   1 
ATOM   3312  O  O   . VAL B 1 84  ? 19.892  -59.817  35.012  1.00 26.82  ? 87   VAL B O   1 
ATOM   3313  C  CB  . VAL B 1 84  ? 22.393  -59.627  32.825  1.00 23.99  ? 87   VAL B CB  1 
ATOM   3314  C  CG1 . VAL B 1 84  ? 21.309  -58.641  32.374  1.00 21.41  ? 87   VAL B CG1 1 
ATOM   3315  C  CG2 . VAL B 1 84  ? 23.768  -58.982  32.768  1.00 23.42  ? 87   VAL B CG2 1 
ATOM   3316  N  N   . VAL B 1 85  ? 20.287  -61.737  33.915  1.00 25.21  ? 88   VAL B N   1 
ATOM   3317  C  CA  . VAL B 1 85  ? 18.904  -62.188  33.917  1.00 25.20  ? 88   VAL B CA  1 
ATOM   3318  C  C   . VAL B 1 85  ? 18.418  -62.553  35.316  1.00 25.80  ? 88   VAL B C   1 
ATOM   3319  O  O   . VAL B 1 85  ? 17.280  -62.222  35.684  1.00 27.78  ? 88   VAL B O   1 
ATOM   3320  C  CB  . VAL B 1 85  ? 18.696  -63.380  32.926  1.00 26.16  ? 88   VAL B CB  1 
ATOM   3321  C  CG1 . VAL B 1 85  ? 17.314  -64.009  33.078  1.00 23.99  ? 88   VAL B CG1 1 
ATOM   3322  C  CG2 . VAL B 1 85  ? 18.897  -62.912  31.489  1.00 24.59  ? 88   VAL B CG2 1 
ATOM   3323  N  N   . ASN B 1 86  ? 19.254  -63.245  36.081  1.00 24.86  ? 89   ASN B N   1 
ATOM   3324  C  CA  . ASN B 1 86  ? 18.931  -63.543  37.475  1.00 27.45  ? 89   ASN B CA  1 
ATOM   3325  C  C   . ASN B 1 86  ? 18.837  -62.239  38.300  1.00 29.10  ? 89   ASN B C   1 
ATOM   3326  O  O   . ASN B 1 86  ? 17.879  -62.030  39.060  1.00 31.16  ? 89   ASN B O   1 
ATOM   3327  C  CB  . ASN B 1 86  ? 19.952  -64.523  38.060  1.00 28.34  ? 89   ASN B CB  1 
ATOM   3328  C  CG  . ASN B 1 86  ? 19.740  -65.953  37.573  1.00 29.92  ? 89   ASN B CG  1 
ATOM   3329  O  OD1 . ASN B 1 86  ? 20.455  -66.438  36.688  1.00 31.64  ? 89   ASN B OD1 1 
ATOM   3330  N  ND2 . ASN B 1 86  ? 18.753  -66.635  38.146  1.00 28.88  ? 89   ASN B ND2 1 
ATOM   3331  N  N   . GLY B 1 87  ? 19.807  -61.347  38.103  1.00 28.17  ? 90   GLY B N   1 
ATOM   3332  C  CA  . GLY B 1 87  ? 19.734  -59.990  38.636  1.00 29.02  ? 90   GLY B CA  1 
ATOM   3333  C  C   . GLY B 1 87  ? 18.411  -59.299  38.365  1.00 29.93  ? 90   GLY B C   1 
ATOM   3334  O  O   . GLY B 1 87  ? 17.855  -58.643  39.257  1.00 30.03  ? 90   GLY B O   1 
ATOM   3335  N  N   . LEU B 1 88  ? 17.892  -59.452  37.146  1.00 28.54  ? 91   LEU B N   1 
ATOM   3336  C  CA  . LEU B 1 88  ? 16.589  -58.878  36.810  1.00 29.00  ? 91   LEU B CA  1 
ATOM   3337  C  C   . LEU B 1 88  ? 15.465  -59.667  37.471  1.00 28.98  ? 91   LEU B C   1 
ATOM   3338  O  O   . LEU B 1 88  ? 14.458  -59.098  37.843  1.00 29.29  ? 91   LEU B O   1 
ATOM   3339  C  CB  . LEU B 1 88  ? 16.360  -58.801  35.285  1.00 27.80  ? 91   LEU B CB  1 
ATOM   3340  C  CG  . LEU B 1 88  ? 17.158  -57.837  34.388  1.00 28.50  ? 91   LEU B CG  1 
ATOM   3341  C  CD1 . LEU B 1 88  ? 17.137  -58.316  32.936  1.00 29.35  ? 91   LEU B CD1 1 
ATOM   3342  C  CD2 . LEU B 1 88  ? 16.678  -56.386  34.472  1.00 26.78  ? 91   LEU B CD2 1 
ATOM   3343  N  N   . MET B 1 89  ? 15.621  -60.981  37.594  1.00 31.47  ? 92   MET B N   1 
ATOM   3344  C  CA  . MET B 1 89  ? 14.570  -61.796  38.220  1.00 33.77  ? 92   MET B CA  1 
ATOM   3345  C  C   . MET B 1 89  ? 14.514  -61.622  39.756  1.00 35.50  ? 92   MET B C   1 
ATOM   3346  O  O   . MET B 1 89  ? 13.459  -61.811  40.365  1.00 35.12  ? 92   MET B O   1 
ATOM   3347  C  CB  . MET B 1 89  ? 14.705  -63.278  37.850  1.00 32.96  ? 92   MET B CB  1 
ATOM   3348  C  CG  . MET B 1 89  ? 14.375  -63.628  36.399  1.00 35.00  ? 92   MET B CG  1 
ATOM   3349  S  SD  . MET B 1 89  ? 12.706  -63.182  35.870  1.00 36.55  ? 92   MET B SD  1 
ATOM   3350  C  CE  . MET B 1 89  ? 11.695  -64.385  36.728  1.00 39.25  ? 92   MET B CE  1 
ATOM   3351  N  N   . GLU B 1 90  ? 15.638  -61.250  40.372  1.00 35.39  ? 93   GLU B N   1 
ATOM   3352  C  CA  . GLU B 1 90  ? 15.678  -61.083  41.835  1.00 37.09  ? 93   GLU B CA  1 
ATOM   3353  C  C   . GLU B 1 90  ? 15.094  -59.759  42.296  1.00 38.90  ? 93   GLU B C   1 
ATOM   3354  O  O   . GLU B 1 90  ? 15.043  -59.491  43.497  1.00 44.84  ? 93   GLU B O   1 
ATOM   3355  C  CB  . GLU B 1 90  ? 17.103  -61.225  42.368  1.00 36.12  ? 93   GLU B CB  1 
ATOM   3356  C  CG  . GLU B 1 90  ? 17.654  -62.642  42.305  1.00 35.28  ? 93   GLU B CG  1 
ATOM   3357  C  CD  . GLU B 1 90  ? 19.161  -62.678  42.420  1.00 38.23  ? 93   GLU B CD  1 
ATOM   3358  O  OE1 . GLU B 1 90  ? 19.760  -61.611  42.703  1.00 39.80  ? 93   GLU B OE1 1 
ATOM   3359  O  OE2 . GLU B 1 90  ? 19.755  -63.766  42.207  1.00 39.52  ? 93   GLU B OE2 1 
ATOM   3360  N  N   . ARG B 1 91  ? 14.660  -58.936  41.344  1.00 36.33  ? 94   ARG B N   1 
ATOM   3361  C  CA  . ARG B 1 91  ? 14.097  -57.630  41.624  1.00 36.13  ? 94   ARG B CA  1 
ATOM   3362  C  C   . ARG B 1 91  ? 12.640  -57.756  42.071  1.00 40.22  ? 94   ARG B C   1 
ATOM   3363  O  O   . ARG B 1 91  ? 12.008  -58.787  41.799  1.00 41.30  ? 94   ARG B O   1 
ATOM   3364  C  CB  . ARG B 1 91  ? 14.179  -56.741  40.378  1.00 33.47  ? 94   ARG B CB  1 
ATOM   3365  C  CG  . ARG B 1 91  ? 15.538  -56.120  40.125  1.00 31.91  ? 94   ARG B CG  1 
ATOM   3366  C  CD  . ARG B 1 91  ? 15.634  -55.487  38.739  1.00 29.40  ? 94   ARG B CD  1 
ATOM   3367  N  NE  . ARG B 1 91  ? 14.778  -54.316  38.567  1.00 26.62  ? 94   ARG B NE  1 
ATOM   3368  C  CZ  . ARG B 1 91  ? 15.225  -53.073  38.375  1.00 26.92  ? 94   ARG B CZ  1 
ATOM   3369  N  NH1 . ARG B 1 91  ? 16.529  -52.804  38.328  1.00 25.12  ? 94   ARG B NH1 1 
ATOM   3370  N  NH2 . ARG B 1 91  ? 14.363  -52.089  38.212  1.00 25.64  ? 94   ARG B NH2 1 
ATOM   3371  N  N   . PRO B 1 92  ? 12.112  -56.718  42.781  1.00 40.90  ? 95   PRO B N   1 
ATOM   3372  C  CA  . PRO B 1 92  ? 10.683  -56.583  43.119  1.00 40.55  ? 95   PRO B CA  1 
ATOM   3373  C  C   . PRO B 1 92  ? 9.806   -56.318  41.898  1.00 38.93  ? 95   PRO B C   1 
ATOM   3374  O  O   . PRO B 1 92  ? 8.644   -56.722  41.861  1.00 38.88  ? 95   PRO B O   1 
ATOM   3375  C  CB  . PRO B 1 92  ? 10.649  -55.354  44.044  1.00 41.58  ? 95   PRO B CB  1 
ATOM   3376  C  CG  . PRO B 1 92  ? 12.030  -55.242  44.600  1.00 41.01  ? 95   PRO B CG  1 
ATOM   3377  C  CD  . PRO B 1 92  ? 12.931  -55.716  43.496  1.00 41.30  ? 95   PRO B CD  1 
ATOM   3378  N  N   . ASP B 1 93  ? 10.367  -55.625  40.919  1.00 37.46  ? 96   ASP B N   1 
ATOM   3379  C  CA  . ASP B 1 93  ? 9.655   -55.277  39.707  1.00 36.03  ? 96   ASP B CA  1 
ATOM   3380  C  C   . ASP B 1 93  ? 10.069  -56.243  38.584  1.00 37.11  ? 96   ASP B C   1 
ATOM   3381  O  O   . ASP B 1 93  ? 10.106  -55.872  37.408  1.00 35.56  ? 96   ASP B O   1 
ATOM   3382  C  CB  . ASP B 1 93  ? 9.994   -53.829  39.328  1.00 35.40  ? 96   ASP B CB  1 
ATOM   3383  C  CG  . ASP B 1 93  ? 11.473  -53.647  38.973  1.00 35.27  ? 96   ASP B CG  1 
ATOM   3384  O  OD1 . ASP B 1 93  ? 12.321  -54.476  39.409  1.00 35.26  ? 96   ASP B OD1 1 
ATOM   3385  O  OD2 . ASP B 1 93  ? 11.786  -52.685  38.240  1.00 33.23  ? 96   ASP B OD2 1 
ATOM   3386  N  N   . TRP B 1 94  ? 10.383  -57.481  38.959  1.00 39.35  ? 97   TRP B N   1 
ATOM   3387  C  CA  . TRP B 1 94  ? 10.861  -58.492  38.016  1.00 41.72  ? 97   TRP B CA  1 
ATOM   3388  C  C   . TRP B 1 94  ? 9.981   -58.668  36.795  1.00 42.25  ? 97   TRP B C   1 
ATOM   3389  O  O   . TRP B 1 94  ? 10.494  -58.796  35.675  1.00 43.47  ? 97   TRP B O   1 
ATOM   3390  C  CB  . TRP B 1 94  ? 11.104  -59.822  38.724  1.00 44.48  ? 97   TRP B CB  1 
ATOM   3391  C  CG  . TRP B 1 94  ? 9.838   -60.467  39.210  1.00 45.35  ? 97   TRP B CG  1 
ATOM   3392  C  CD1 . TRP B 1 94  ? 9.202   -60.283  40.433  1.00 48.22  ? 97   TRP B CD1 1 
ATOM   3393  C  CD2 . TRP B 1 94  ? 8.999   -61.411  38.482  1.00 47.71  ? 97   TRP B CD2 1 
ATOM   3394  N  NE1 . TRP B 1 94  ? 8.061   -61.036  40.512  1.00 47.85  ? 97   TRP B NE1 1 
ATOM   3395  C  CE2 . TRP B 1 94  ? 7.875   -61.732  39.372  1.00 49.67  ? 97   TRP B CE2 1 
ATOM   3396  C  CE3 . TRP B 1 94  ? 9.056   -62.002  37.223  1.00 48.12  ? 97   TRP B CE3 1 
ATOM   3397  C  CZ2 . TRP B 1 94  ? 6.872   -62.613  38.998  1.00 50.46  ? 97   TRP B CZ2 1 
ATOM   3398  C  CZ3 . TRP B 1 94  ? 8.038   -62.884  36.855  1.00 48.55  ? 97   TRP B CZ3 1 
ATOM   3399  C  CH2 . TRP B 1 94  ? 6.973   -63.184  37.723  1.00 50.41  ? 97   TRP B CH2 1 
ATOM   3400  N  N   . GLU B 1 95  ? 8.662   -58.644  36.988  1.00 43.12  ? 98   GLU B N   1 
ATOM   3401  C  CA  . GLU B 1 95  ? 7.700   -58.860  35.899  1.00 44.35  ? 98   GLU B CA  1 
ATOM   3402  C  C   . GLU B 1 95  ? 7.886   -57.904  34.715  1.00 42.82  ? 98   GLU B C   1 
ATOM   3403  O  O   . GLU B 1 95  ? 7.692   -58.285  33.560  1.00 39.60  ? 98   GLU B O   1 
ATOM   3404  C  CB  . GLU B 1 95  ? 6.270   -58.744  36.411  1.00 47.09  ? 98   GLU B CB  1 
ATOM   3405  C  CG  . GLU B 1 95  ? 5.604   -60.068  36.731  1.00 54.65  ? 98   GLU B CG  1 
ATOM   3406  C  CD  . GLU B 1 95  ? 4.316   -59.887  37.521  1.00 57.67  ? 98   GLU B CD  1 
ATOM   3407  O  OE1 . GLU B 1 95  ? 4.272   -60.311  38.698  1.00 62.17  ? 98   GLU B OE1 1 
ATOM   3408  O  OE2 . GLU B 1 95  ? 3.357   -59.304  36.978  1.00 55.95  ? 98   GLU B OE2 1 
ATOM   3409  N  N   . THR B 1 96  ? 8.247   -56.663  35.011  1.00 39.70  ? 99   THR B N   1 
ATOM   3410  C  CA  . THR B 1 96  ? 8.462   -55.672  33.964  1.00 38.18  ? 99   THR B CA  1 
ATOM   3411  C  C   . THR B 1 96  ? 9.937   -55.580  33.606  1.00 34.72  ? 99   THR B C   1 
ATOM   3412  O  O   . THR B 1 96  ? 10.285  -55.293  32.472  1.00 37.06  ? 99   THR B O   1 
ATOM   3413  C  CB  . THR B 1 96  ? 7.864   -54.306  34.347  1.00 38.49  ? 99   THR B CB  1 
ATOM   3414  O  OG1 . THR B 1 96  ? 8.249   -53.974  35.688  1.00 43.91  ? 99   THR B OG1 1 
ATOM   3415  C  CG2 . THR B 1 96  ? 6.332   -54.374  34.282  1.00 38.20  ? 99   THR B CG2 1 
ATOM   3416  N  N   . ALA B 1 97  ? 10.793  -55.872  34.570  1.00 31.87  ? 100  ALA B N   1 
ATOM   3417  C  CA  . ALA B 1 97  ? 12.236  -55.806  34.395  1.00 31.32  ? 100  ALA B CA  1 
ATOM   3418  C  C   . ALA B 1 97  ? 12.785  -56.859  33.424  1.00 31.34  ? 100  ALA B C   1 
ATOM   3419  O  O   . ALA B 1 97  ? 13.773  -56.614  32.728  1.00 31.31  ? 100  ALA B O   1 
ATOM   3420  C  CB  . ALA B 1 97  ? 12.914  -55.965  35.745  1.00 30.52  ? 100  ALA B CB  1 
ATOM   3421  N  N   . ILE B 1 98  ? 12.166  -58.038  33.419  1.00 28.58  ? 101  ILE B N   1 
ATOM   3422  C  CA  . ILE B 1 98  ? 12.619  -59.138  32.588  1.00 27.59  ? 101  ILE B CA  1 
ATOM   3423  C  C   . ILE B 1 98  ? 12.273  -58.869  31.118  1.00 28.21  ? 101  ILE B C   1 
ATOM   3424  O  O   . ILE B 1 98  ? 12.760  -59.561  30.235  1.00 28.57  ? 101  ILE B O   1 
ATOM   3425  C  CB  . ILE B 1 98  ? 12.042  -60.486  33.095  1.00 26.00  ? 101  ILE B CB  1 
ATOM   3426  C  CG1 . ILE B 1 98  ? 12.872  -61.694  32.625  1.00 25.01  ? 101  ILE B CG1 1 
ATOM   3427  C  CG2 . ILE B 1 98  ? 10.565  -60.611  32.751  1.00 25.16  ? 101  ILE B CG2 1 
ATOM   3428  C  CD1 . ILE B 1 98  ? 14.371  -61.454  32.577  1.00 24.87  ? 101  ILE B CD1 1 
ATOM   3429  N  N   . GLN B 1 99  ? 11.449  -57.849  30.883  1.00 27.69  ? 102  GLN B N   1 
ATOM   3430  C  CA  . GLN B 1 99  ? 11.001  -57.482  29.555  1.00 29.21  ? 102  GLN B CA  1 
ATOM   3431  C  C   . GLN B 1 99  ? 11.872  -56.429  28.924  1.00 28.94  ? 102  GLN B C   1 
ATOM   3432  O  O   . GLN B 1 99  ? 11.551  -55.916  27.849  1.00 30.13  ? 102  GLN B O   1 
ATOM   3433  C  CB  . GLN B 1 99  ? 9.561   -56.998  29.595  1.00 30.83  ? 102  GLN B CB  1 
ATOM   3434  C  CG  . GLN B 1 99  ? 8.588   -58.120  29.878  1.00 34.21  ? 102  GLN B CG  1 
ATOM   3435  C  CD  . GLN B 1 99  ? 7.171   -57.630  30.009  1.00 38.41  ? 102  GLN B CD  1 
ATOM   3436  O  OE1 . GLN B 1 99  ? 6.792   -56.609  29.428  1.00 42.37  ? 102  GLN B OE1 1 
ATOM   3437  N  NE2 . GLN B 1 99  ? 6.367   -58.363  30.764  1.00 41.74  ? 102  GLN B NE2 1 
ATOM   3438  N  N   . LYS B 1 100 ? 12.976  -56.100  29.585  1.00 26.54  ? 103  LYS B N   1 
ATOM   3439  C  CA  . LYS B 1 100 ? 13.927  -55.181  29.004  1.00 24.70  ? 103  LYS B CA  1 
ATOM   3440  C  C   . LYS B 1 100 ? 14.747  -55.971  27.972  1.00 24.65  ? 103  LYS B C   1 
ATOM   3441  O  O   . LYS B 1 100 ? 15.308  -57.002  28.318  1.00 23.95  ? 103  LYS B O   1 
ATOM   3442  C  CB  . LYS B 1 100 ? 14.834  -54.607  30.096  1.00 22.49  ? 103  LYS B CB  1 
ATOM   3443  C  CG  . LYS B 1 100 ? 15.947  -53.714  29.581  1.00 22.51  ? 103  LYS B CG  1 
ATOM   3444  C  CD  . LYS B 1 100 ? 15.388  -52.441  28.977  1.00 22.20  ? 103  LYS B CD  1 
ATOM   3445  C  CE  . LYS B 1 100 ? 14.814  -51.574  30.080  1.00 22.27  ? 103  LYS B CE  1 
ATOM   3446  N  NZ  . LYS B 1 100 ? 13.965  -50.504  29.511  1.00 21.91  ? 103  LYS B NZ  1 
ATOM   3447  N  N   . PRO B 1 101 ? 14.828  -55.485  26.710  1.00 24.16  ? 104  PRO B N   1 
ATOM   3448  C  CA  . PRO B 1 101 ? 15.587  -56.212  25.685  1.00 24.39  ? 104  PRO B CA  1 
ATOM   3449  C  C   . PRO B 1 101 ? 17.065  -56.442  26.012  1.00 25.84  ? 104  PRO B C   1 
ATOM   3450  O  O   . PRO B 1 101 ? 17.789  -55.516  26.407  1.00 25.39  ? 104  PRO B O   1 
ATOM   3451  C  CB  . PRO B 1 101 ? 15.453  -55.313  24.461  1.00 23.29  ? 104  PRO B CB  1 
ATOM   3452  C  CG  . PRO B 1 101 ? 14.111  -54.716  24.621  1.00 23.19  ? 104  PRO B CG  1 
ATOM   3453  C  CD  . PRO B 1 101 ? 14.018  -54.415  26.102  1.00 23.53  ? 104  PRO B CD  1 
ATOM   3454  N  N   . LEU B 1 102 ? 17.494  -57.685  25.822  1.00 24.60  ? 105  LEU B N   1 
ATOM   3455  C  CA  . LEU B 1 102 ? 18.834  -58.107  26.143  1.00 23.19  ? 105  LEU B CA  1 
ATOM   3456  C  C   . LEU B 1 102 ? 19.569  -58.387  24.845  1.00 24.69  ? 105  LEU B C   1 
ATOM   3457  O  O   . LEU B 1 102 ? 18.943  -58.663  23.835  1.00 25.01  ? 105  LEU B O   1 
ATOM   3458  C  CB  . LEU B 1 102 ? 18.741  -59.364  26.998  1.00 22.63  ? 105  LEU B CB  1 
ATOM   3459  C  CG  . LEU B 1 102 ? 18.727  -59.250  28.532  1.00 23.78  ? 105  LEU B CG  1 
ATOM   3460  C  CD1 . LEU B 1 102 ? 18.345  -57.874  29.070  1.00 23.16  ? 105  LEU B CD1 1 
ATOM   3461  C  CD2 . LEU B 1 102 ? 17.873  -60.321  29.179  1.00 24.48  ? 105  LEU B CD2 1 
ATOM   3462  N  N   . CYS B 1 103 ? 20.895  -58.314  24.864  1.00 24.77  ? 106  CYS B N   1 
ATOM   3463  C  CA  . CYS B 1 103 ? 21.694  -58.640  23.700  1.00 25.79  ? 106  CYS B CA  1 
ATOM   3464  C  C   . CYS B 1 103 ? 23.009  -59.263  24.123  1.00 26.72  ? 106  CYS B C   1 
ATOM   3465  O  O   . CYS B 1 103 ? 23.611  -58.879  25.129  1.00 28.37  ? 106  CYS B O   1 
ATOM   3466  C  CB  . CYS B 1 103 ? 21.930  -57.406  22.823  1.00 27.14  ? 106  CYS B CB  1 
ATOM   3467  S  SG  . CYS B 1 103 ? 23.290  -57.554  21.639  1.00 27.17  ? 106  CYS B SG  1 
ATOM   3468  N  N   . SER B 1 104 ? 23.466  -60.222  23.338  1.00 28.17  ? 107  SER B N   1 
ATOM   3469  C  CA  . SER B 1 104 ? 24.639  -60.999  23.700  1.00 29.83  ? 107  SER B CA  1 
ATOM   3470  C  C   . SER B 1 104 ? 25.740  -60.769  22.670  1.00 31.11  ? 107  SER B C   1 
ATOM   3471  O  O   . SER B 1 104 ? 25.550  -61.082  21.502  1.00 35.15  ? 107  SER B O   1 
ATOM   3472  C  CB  . SER B 1 104 ? 24.246  -62.478  23.788  1.00 30.18  ? 107  SER B CB  1 
ATOM   3473  O  OG  . SER B 1 104 ? 25.304  -63.278  24.281  1.00 33.03  ? 107  SER B OG  1 
ATOM   3474  N  N   . LEU B 1 105 ? 26.870  -60.199  23.086  1.00 30.16  ? 108  LEU B N   1 
ATOM   3475  C  CA  . LEU B 1 105 ? 28.012  -60.024  22.194  1.00 31.11  ? 108  LEU B CA  1 
ATOM   3476  C  C   . LEU B 1 105 ? 29.193  -60.803  22.727  1.00 35.07  ? 108  LEU B C   1 
ATOM   3477  O  O   . LEU B 1 105 ? 29.678  -60.508  23.816  1.00 38.05  ? 108  LEU B O   1 
ATOM   3478  C  CB  . LEU B 1 105 ? 28.391  -58.552  22.007  1.00 28.50  ? 108  LEU B CB  1 
ATOM   3479  C  CG  . LEU B 1 105 ? 27.309  -57.639  21.442  1.00 28.43  ? 108  LEU B CG  1 
ATOM   3480  C  CD1 . LEU B 1 105 ? 27.830  -56.212  21.349  1.00 26.77  ? 108  LEU B CD1 1 
ATOM   3481  C  CD2 . LEU B 1 105 ? 26.833  -58.115  20.074  1.00 26.84  ? 108  LEU B CD2 1 
ATOM   3482  N  N   . PRO B 1 106 ? 29.668  -61.800  21.956  1.00 36.44  ? 109  PRO B N   1 
ATOM   3483  C  CA  . PRO B 1 106 ? 30.688  -62.746  22.412  1.00 37.26  ? 109  PRO B CA  1 
ATOM   3484  C  C   . PRO B 1 106 ? 32.079  -62.131  22.595  1.00 39.35  ? 109  PRO B C   1 
ATOM   3485  O  O   . PRO B 1 106 ? 32.509  -61.304  21.796  1.00 40.90  ? 109  PRO B O   1 
ATOM   3486  C  CB  . PRO B 1 106 ? 30.735  -63.761  21.274  1.00 36.24  ? 109  PRO B CB  1 
ATOM   3487  C  CG  . PRO B 1 106 ? 30.402  -62.956  20.068  1.00 35.57  ? 109  PRO B CG  1 
ATOM   3488  C  CD  . PRO B 1 106 ? 29.350  -61.986  20.528  1.00 35.17  ? 109  PRO B CD  1 
ATOM   3489  N  N   . ALA B 1 107 ? 32.773  -62.541  23.649  1.00 44.55  ? 110  ALA B N   1 
ATOM   3490  C  CA  . ALA B 1 107 ? 34.180  -62.190  23.825  1.00 49.00  ? 110  ALA B CA  1 
ATOM   3491  C  C   . ALA B 1 107 ? 34.935  -63.316  24.517  1.00 53.07  ? 110  ALA B C   1 
ATOM   3492  O  O   . ALA B 1 107 ? 35.957  -63.770  24.006  1.00 59.64  ? 110  ALA B O   1 
ATOM   3493  C  CB  . ALA B 1 107 ? 34.339  -60.884  24.590  1.00 46.88  ? 110  ALA B CB  1 
ATOM   3494  N  N   . GLY B 1 108 ? 34.425  -63.780  25.657  1.00 55.01  ? 111  GLY B N   1 
ATOM   3495  C  CA  . GLY B 1 108 ? 35.112  -64.815  26.440  1.00 63.79  ? 111  GLY B CA  1 
ATOM   3496  C  C   . GLY B 1 108 ? 35.082  -66.215  25.833  1.00 68.94  ? 111  GLY B C   1 
ATOM   3497  O  O   . GLY B 1 108 ? 35.165  -66.400  24.607  1.00 66.18  ? 111  GLY B O   1 
ATOM   3498  N  N   . SER B 1 109 ? 35.008  -67.208  26.711  1.00 71.68  ? 112  SER B N   1 
ATOM   3499  C  CA  . SER B 1 109 ? 34.697  -68.571  26.317  1.00 69.89  ? 112  SER B CA  1 
ATOM   3500  C  C   . SER B 1 109 ? 33.317  -68.886  26.861  1.00 72.10  ? 112  SER B C   1 
ATOM   3501  O  O   . SER B 1 109 ? 32.916  -68.379  27.921  1.00 77.69  ? 112  SER B O   1 
ATOM   3502  C  CB  . SER B 1 109 ? 35.731  -69.555  26.859  1.00 68.65  ? 112  SER B CB  1 
ATOM   3503  O  OG  . SER B 1 109 ? 36.849  -69.616  25.997  1.00 67.80  ? 112  SER B OG  1 
ATOM   3504  N  N   . GLY B 1 110 ? 32.589  -69.724  26.135  1.00 67.15  ? 113  GLY B N   1 
ATOM   3505  C  CA  . GLY B 1 110 ? 31.183  -69.942  26.428  1.00 59.05  ? 113  GLY B CA  1 
ATOM   3506  C  C   . GLY B 1 110 ? 30.437  -68.821  25.744  1.00 53.45  ? 113  GLY B C   1 
ATOM   3507  O  O   . GLY B 1 110 ? 30.032  -67.858  26.392  1.00 52.63  ? 113  GLY B O   1 
ATOM   3508  N  N   . ASN B 1 111 ? 30.303  -68.941  24.423  1.00 46.01  ? 114  ASN B N   1 
ATOM   3509  C  CA  . ASN B 1 111 ? 29.533  -68.008  23.620  1.00 41.92  ? 114  ASN B CA  1 
ATOM   3510  C  C   . ASN B 1 111 ? 28.409  -68.738  22.877  1.00 38.36  ? 114  ASN B C   1 
ATOM   3511  O  O   . ASN B 1 111 ? 28.040  -68.370  21.763  1.00 36.46  ? 114  ASN B O   1 
ATOM   3512  C  CB  . ASN B 1 111 ? 30.455  -67.266  22.660  1.00 44.48  ? 114  ASN B CB  1 
ATOM   3513  C  CG  . ASN B 1 111 ? 31.571  -66.529  23.379  1.00 51.31  ? 114  ASN B CG  1 
ATOM   3514  O  OD1 . ASN B 1 111 ? 31.320  -65.599  24.160  1.00 52.76  ? 114  ASN B OD1 1 
ATOM   3515  N  ND2 . ASN B 1 111 ? 32.816  -66.931  23.114  1.00 51.23  ? 114  ASN B ND2 1 
ATOM   3516  N  N   . ALA B 1 112 ? 27.866  -69.764  23.533  1.00 34.84  ? 115  ALA B N   1 
ATOM   3517  C  CA  . ALA B 1 112 ? 26.817  -70.630  23.000  1.00 33.32  ? 115  ALA B CA  1 
ATOM   3518  C  C   . ALA B 1 112 ? 25.562  -69.879  22.597  1.00 34.15  ? 115  ALA B C   1 
ATOM   3519  O  O   . ALA B 1 112 ? 24.974  -70.149  21.541  1.00 34.77  ? 115  ALA B O   1 
ATOM   3520  C  CB  . ALA B 1 112 ? 26.462  -71.710  24.007  1.00 32.78  ? 115  ALA B CB  1 
ATOM   3521  N  N   . LEU B 1 113 ? 25.147  -68.938  23.437  1.00 31.60  ? 116  LEU B N   1 
ATOM   3522  C  CA  . LEU B 1 113 ? 23.965  -68.151  23.148  1.00 29.72  ? 116  LEU B CA  1 
ATOM   3523  C  C   . LEU B 1 113 ? 24.208  -67.300  21.903  1.00 29.48  ? 116  LEU B C   1 
ATOM   3524  O  O   . LEU B 1 113 ? 23.408  -67.308  20.971  1.00 27.98  ? 116  LEU B O   1 
ATOM   3525  C  CB  . LEU B 1 113 ? 23.596  -67.303  24.366  1.00 29.79  ? 116  LEU B CB  1 
ATOM   3526  C  CG  . LEU B 1 113 ? 22.247  -66.584  24.394  1.00 28.67  ? 116  LEU B CG  1 
ATOM   3527  C  CD1 . LEU B 1 113 ? 21.096  -67.544  24.124  1.00 28.54  ? 116  LEU B CD1 1 
ATOM   3528  C  CD2 . LEU B 1 113 ? 22.068  -65.890  25.734  1.00 26.60  ? 116  LEU B CD2 1 
ATOM   3529  N  N   . ALA B 1 114 ? 25.338  -66.593  21.885  1.00 28.59  ? 117  ALA B N   1 
ATOM   3530  C  CA  . ALA B 1 114 ? 25.720  -65.774  20.741  1.00 27.29  ? 117  ALA B CA  1 
ATOM   3531  C  C   . ALA B 1 114 ? 25.821  -66.658  19.488  1.00 26.06  ? 117  ALA B C   1 
ATOM   3532  O  O   . ALA B 1 114 ? 25.389  -66.269  18.413  1.00 24.93  ? 117  ALA B O   1 
ATOM   3533  C  CB  . ALA B 1 114 ? 27.043  -65.064  21.009  1.00 24.62  ? 117  ALA B CB  1 
ATOM   3534  N  N   . ALA B 1 115 ? 26.393  -67.842  19.648  1.00 25.54  ? 118  ALA B N   1 
ATOM   3535  C  CA  . ALA B 1 115 ? 26.535  -68.784  18.543  1.00 25.78  ? 118  ALA B CA  1 
ATOM   3536  C  C   . ALA B 1 115 ? 25.158  -69.271  18.053  1.00 25.36  ? 118  ALA B C   1 
ATOM   3537  O  O   . ALA B 1 115 ? 24.940  -69.411  16.843  1.00 27.68  ? 118  ALA B O   1 
ATOM   3538  C  CB  . ALA B 1 115 ? 27.433  -69.955  18.948  1.00 23.49  ? 118  ALA B CB  1 
ATOM   3539  N  N   . SER B 1 116 ? 24.229  -69.503  18.979  1.00 24.01  ? 119  SER B N   1 
ATOM   3540  C  CA  . SER B 1 116 ? 22.849  -69.863  18.614  1.00 24.17  ? 119  SER B CA  1 
ATOM   3541  C  C   . SER B 1 116 ? 22.104  -68.773  17.837  1.00 25.59  ? 119  SER B C   1 
ATOM   3542  O  O   . SER B 1 116 ? 21.403  -69.073  16.861  1.00 26.44  ? 119  SER B O   1 
ATOM   3543  C  CB  . SER B 1 116 ? 22.033  -70.285  19.835  1.00 23.01  ? 119  SER B CB  1 
ATOM   3544  O  OG  . SER B 1 116 ? 22.723  -71.290  20.558  1.00 23.72  ? 119  SER B OG  1 
ATOM   3545  N  N   . LEU B 1 117 ? 22.257  -67.519  18.255  1.00 26.15  ? 120  LEU B N   1 
ATOM   3546  C  CA  . LEU B 1 117 ? 21.519  -66.416  17.633  1.00 26.68  ? 120  LEU B CA  1 
ATOM   3547  C  C   . LEU B 1 117 ? 22.069  -66.093  16.245  1.00 26.48  ? 120  LEU B C   1 
ATOM   3548  O  O   . LEU B 1 117 ? 21.330  -65.683  15.365  1.00 25.50  ? 120  LEU B O   1 
ATOM   3549  C  CB  . LEU B 1 117 ? 21.527  -65.172  18.522  1.00 26.56  ? 120  LEU B CB  1 
ATOM   3550  C  CG  . LEU B 1 117 ? 20.975  -65.331  19.946  1.00 29.37  ? 120  LEU B CG  1 
ATOM   3551  C  CD1 . LEU B 1 117 ? 21.166  -64.033  20.721  1.00 28.64  ? 120  LEU B CD1 1 
ATOM   3552  C  CD2 . LEU B 1 117 ? 19.513  -65.776  19.981  1.00 28.93  ? 120  LEU B CD2 1 
ATOM   3553  N  N   . ASN B 1 118 ? 23.378  -66.264  16.082  1.00 27.08  ? 121  ASN B N   1 
ATOM   3554  C  CA  . ASN B 1 118 ? 24.039  -66.151  14.796  1.00 27.64  ? 121  ASN B CA  1 
ATOM   3555  C  C   . ASN B 1 118 ? 23.497  -67.240  13.859  1.00 28.92  ? 121  ASN B C   1 
ATOM   3556  O  O   . ASN B 1 118 ? 23.214  -66.964  12.711  1.00 28.59  ? 121  ASN B O   1 
ATOM   3557  C  CB  . ASN B 1 118 ? 25.545  -66.293  14.991  1.00 27.41  ? 121  ASN B CB  1 
ATOM   3558  C  CG  . ASN B 1 118 ? 26.310  -66.406  13.680  1.00 27.81  ? 121  ASN B CG  1 
ATOM   3559  O  OD1 . ASN B 1 118 ? 26.703  -67.506  13.277  1.00 28.41  ? 121  ASN B OD1 1 
ATOM   3560  N  ND2 . ASN B 1 118 ? 26.573  -65.271  13.040  1.00 25.10  ? 121  ASN B ND2 1 
ATOM   3561  N  N   . HIS B 1 119 ? 23.304  -68.450  14.384  1.00 28.82  ? 122  HIS B N   1 
ATOM   3562  C  CA  . HIS B 1 119 ? 22.680  -69.533  13.627  1.00 29.87  ? 122  HIS B CA  1 
ATOM   3563  C  C   . HIS B 1 119 ? 21.280  -69.192  13.186  1.00 29.20  ? 122  HIS B C   1 
ATOM   3564  O  O   . HIS B 1 119 ? 20.978  -69.257  11.983  1.00 30.63  ? 122  HIS B O   1 
ATOM   3565  C  CB  . HIS B 1 119 ? 22.716  -70.860  14.397  1.00 30.77  ? 122  HIS B CB  1 
ATOM   3566  C  CG  . HIS B 1 119 ? 22.202  -72.040  13.603  1.00 33.23  ? 122  HIS B CG  1 
ATOM   3567  N  ND1 . HIS B 1 119 ? 21.048  -72.674  13.905  1.00 34.57  ? 122  HIS B ND1 1 
ATOM   3568  C  CD2 . HIS B 1 119 ? 22.714  -72.678  12.472  1.00 34.83  ? 122  HIS B CD2 1 
ATOM   3569  C  CE1 . HIS B 1 119 ? 20.839  -73.672  13.024  1.00 32.63  ? 122  HIS B CE1 1 
ATOM   3570  N  NE2 . HIS B 1 119 ? 21.861  -73.676  12.153  1.00 34.45  ? 122  HIS B NE2 1 
ATOM   3571  N  N   . TYR B 1 120 ? 20.430  -68.797  14.129  1.00 26.63  ? 123  TYR B N   1 
ATOM   3572  C  CA  . TYR B 1 120 ? 19.018  -68.515  13.828  1.00 26.77  ? 123  TYR B CA  1 
ATOM   3573  C  C   . TYR B 1 120 ? 18.864  -67.485  12.735  1.00 27.81  ? 123  TYR B C   1 
ATOM   3574  O  O   . TYR B 1 120 ? 17.862  -67.496  12.027  1.00 28.58  ? 123  TYR B O   1 
ATOM   3575  C  CB  . TYR B 1 120 ? 18.250  -68.014  15.061  1.00 25.74  ? 123  TYR B CB  1 
ATOM   3576  C  CG  . TYR B 1 120 ? 18.340  -68.919  16.273  1.00 27.81  ? 123  TYR B CG  1 
ATOM   3577  C  CD1 . TYR B 1 120 ? 18.472  -70.306  16.131  1.00 25.45  ? 123  TYR B CD1 1 
ATOM   3578  C  CD2 . TYR B 1 120 ? 18.276  -68.389  17.569  1.00 26.64  ? 123  TYR B CD2 1 
ATOM   3579  C  CE1 . TYR B 1 120 ? 18.560  -71.128  17.235  1.00 26.01  ? 123  TYR B CE1 1 
ATOM   3580  C  CE2 . TYR B 1 120 ? 18.346  -69.220  18.669  1.00 26.57  ? 123  TYR B CE2 1 
ATOM   3581  C  CZ  . TYR B 1 120 ? 18.482  -70.588  18.495  1.00 26.17  ? 123  TYR B CZ  1 
ATOM   3582  O  OH  . TYR B 1 120 ? 18.573  -71.424  19.591  1.00 25.77  ? 123  TYR B OH  1 
ATOM   3583  N  N   . ALA B 1 121 ? 19.857  -66.594  12.629  1.00 27.99  ? 124  ALA B N   1 
ATOM   3584  C  CA  . ALA B 1 121 ? 19.867  -65.516  11.655  1.00 27.61  ? 124  ALA B CA  1 
ATOM   3585  C  C   . ALA B 1 121 ? 20.333  -65.976  10.272  1.00 27.68  ? 124  ALA B C   1 
ATOM   3586  O  O   . ALA B 1 121 ? 20.343  -65.172  9.343   1.00 26.76  ? 124  ALA B O   1 
ATOM   3587  C  CB  . ALA B 1 121 ? 20.755  -64.382  12.145  1.00 26.43  ? 124  ALA B CB  1 
ATOM   3588  N  N   . GLY B 1 122 ? 20.733  -67.244  10.142  1.00 27.30  ? 125  GLY B N   1 
ATOM   3589  C  CA  . GLY B 1 122 ? 21.133  -67.793  8.841   1.00 28.57  ? 125  GLY B CA  1 
ATOM   3590  C  C   . GLY B 1 122 ? 22.619  -67.686  8.499   1.00 30.67  ? 125  GLY B C   1 
ATOM   3591  O  O   . GLY B 1 122 ? 23.000  -67.872  7.355   1.00 29.34  ? 125  GLY B O   1 
ATOM   3592  N  N   . TYR B 1 123 ? 23.469  -67.404  9.485   1.00 29.99  ? 126  TYR B N   1 
ATOM   3593  C  CA  . TYR B 1 123 ? 24.895  -67.285  9.221   1.00 30.19  ? 126  TYR B CA  1 
ATOM   3594  C  C   . TYR B 1 123 ? 25.646  -68.603  9.322   1.00 30.32  ? 126  TYR B C   1 
ATOM   3595  O  O   . TYR B 1 123 ? 25.216  -69.541  9.980   1.00 31.69  ? 126  TYR B O   1 
ATOM   3596  C  CB  . TYR B 1 123 ? 25.550  -66.270  10.168  1.00 30.31  ? 126  TYR B CB  1 
ATOM   3597  C  CG  . TYR B 1 123 ? 25.192  -64.812  9.933   1.00 31.61  ? 126  TYR B CG  1 
ATOM   3598  C  CD1 . TYR B 1 123 ? 25.639  -64.133  8.794   1.00 32.80  ? 126  TYR B CD1 1 
ATOM   3599  C  CD2 . TYR B 1 123 ? 24.436  -64.100  10.872  1.00 30.96  ? 126  TYR B CD2 1 
ATOM   3600  C  CE1 . TYR B 1 123 ? 25.334  -62.793  8.592   1.00 34.44  ? 126  TYR B CE1 1 
ATOM   3601  C  CE2 . TYR B 1 123 ? 24.120  -62.764  10.683  1.00 31.97  ? 126  TYR B CE2 1 
ATOM   3602  C  CZ  . TYR B 1 123 ? 24.568  -62.114  9.543   1.00 34.38  ? 126  TYR B CZ  1 
ATOM   3603  O  OH  . TYR B 1 123 ? 24.260  -60.786  9.346   1.00 33.31  ? 126  TYR B OH  1 
ATOM   3604  N  N   . GLU B 1 124 ? 26.801  -68.647  8.681   1.00 31.59  ? 127  GLU B N   1 
ATOM   3605  C  CA  . GLU B 1 124 ? 27.732  -69.741  8.843   1.00 35.98  ? 127  GLU B CA  1 
ATOM   3606  C  C   . GLU B 1 124 ? 28.207  -69.813  10.288  1.00 35.17  ? 127  GLU B C   1 
ATOM   3607  O  O   . GLU B 1 124 ? 28.177  -68.828  11.028  1.00 35.21  ? 127  GLU B O   1 
ATOM   3608  C  CB  . GLU B 1 124 ? 28.933  -69.587  7.885   1.00 40.50  ? 127  GLU B CB  1 
ATOM   3609  C  CG  . GLU B 1 124 ? 28.588  -69.600  6.396   1.00 46.00  ? 127  GLU B CG  1 
ATOM   3610  C  CD  . GLU B 1 124 ? 27.519  -70.628  6.043   1.00 53.06  ? 127  GLU B CD  1 
ATOM   3611  O  OE1 . GLU B 1 124 ? 26.460  -70.233  5.508   1.00 61.59  ? 127  GLU B OE1 1 
ATOM   3612  O  OE2 . GLU B 1 124 ? 27.715  -71.831  6.316   1.00 55.19  ? 127  GLU B OE2 1 
ATOM   3613  N  N   . GLN B 1 125 ? 28.662  -70.994  10.670  1.00 35.75  ? 128  GLN B N   1 
ATOM   3614  C  CA  . GLN B 1 125 ? 29.169  -71.234  11.996  1.00 36.69  ? 128  GLN B CA  1 
ATOM   3615  C  C   . GLN B 1 125 ? 30.527  -70.574  12.195  1.00 36.87  ? 128  GLN B C   1 
ATOM   3616  O  O   . GLN B 1 125 ? 31.552  -71.251  12.196  1.00 37.54  ? 128  GLN B O   1 
ATOM   3617  C  CB  . GLN B 1 125 ? 29.265  -72.742  12.245  1.00 36.20  ? 128  GLN B CB  1 
ATOM   3618  C  CG  . GLN B 1 125 ? 29.147  -73.053  13.715  1.00 36.84  ? 128  GLN B CG  1 
ATOM   3619  C  CD  . GLN B 1 125 ? 29.028  -74.510  14.002  1.00 35.88  ? 128  GLN B CD  1 
ATOM   3620  O  OE1 . GLN B 1 125 ? 30.024  -75.221  14.071  1.00 37.49  ? 128  GLN B OE1 1 
ATOM   3621  N  NE2 . GLN B 1 125 ? 27.807  -74.962  14.226  1.00 37.02  ? 128  GLN B NE2 1 
ATOM   3622  N  N   . VAL B 1 126 ? 30.519  -69.251  12.359  1.00 37.92  ? 129  VAL B N   1 
ATOM   3623  C  CA  . VAL B 1 126 ? 31.746  -68.455  12.546  1.00 35.69  ? 129  VAL B CA  1 
ATOM   3624  C  C   . VAL B 1 126 ? 32.199  -68.310  14.010  1.00 37.00  ? 129  VAL B C   1 
ATOM   3625  O  O   . VAL B 1 126 ? 31.442  -68.569  14.952  1.00 34.95  ? 129  VAL B O   1 
ATOM   3626  C  CB  . VAL B 1 126 ? 31.606  -67.044  11.965  1.00 35.54  ? 129  VAL B CB  1 
ATOM   3627  C  CG1 . VAL B 1 126 ? 31.483  -67.096  10.445  1.00 35.58  ? 129  VAL B CG1 1 
ATOM   3628  C  CG2 . VAL B 1 126 ? 30.429  -66.320  12.607  1.00 33.90  ? 129  VAL B CG2 1 
ATOM   3629  N  N   . THR B 1 127 ? 33.439  -67.873  14.184  1.00 36.26  ? 130  THR B N   1 
ATOM   3630  C  CA  . THR B 1 127 ? 34.015  -67.772  15.502  1.00 38.70  ? 130  THR B CA  1 
ATOM   3631  C  C   . THR B 1 127 ? 34.741  -66.434  15.716  1.00 38.08  ? 130  THR B C   1 
ATOM   3632  O  O   . THR B 1 127 ? 34.974  -65.681  14.757  1.00 33.61  ? 130  THR B O   1 
ATOM   3633  C  CB  . THR B 1 127 ? 34.947  -68.974  15.784  1.00 41.83  ? 130  THR B CB  1 
ATOM   3634  O  OG1 . THR B 1 127 ? 35.571  -68.793  17.061  1.00 50.47  ? 130  THR B OG1 1 
ATOM   3635  C  CG2 . THR B 1 127 ? 36.029  -69.096  14.718  1.00 42.29  ? 130  THR B CG2 1 
ATOM   3636  N  N   . ASN B 1 128 ? 35.071  -66.140  16.981  1.00 37.59  ? 131  ASN B N   1 
ATOM   3637  C  CA  . ASN B 1 128 ? 35.856  -64.960  17.340  1.00 37.49  ? 131  ASN B CA  1 
ATOM   3638  C  C   . ASN B 1 128 ? 35.320  -63.671  16.717  1.00 35.99  ? 131  ASN B C   1 
ATOM   3639  O  O   . ASN B 1 128 ? 34.148  -63.342  16.855  1.00 35.35  ? 131  ASN B O   1 
ATOM   3640  C  CB  . ASN B 1 128 ? 37.325  -65.132  16.916  1.00 40.94  ? 131  ASN B CB  1 
ATOM   3641  C  CG  . ASN B 1 128 ? 37.998  -66.342  17.543  1.00 43.56  ? 131  ASN B CG  1 
ATOM   3642  O  OD1 . ASN B 1 128 ? 38.774  -67.027  16.879  1.00 47.35  ? 131  ASN B OD1 1 
ATOM   3643  N  ND2 . ASN B 1 128 ? 37.727  -66.599  18.820  1.00 43.05  ? 131  ASN B ND2 1 
ATOM   3644  N  N   . GLU B 1 129 ? 36.201  -62.980  15.999  1.00 36.26  ? 132  GLU B N   1 
ATOM   3645  C  CA  . GLU B 1 129 ? 35.941  -61.669  15.415  1.00 38.76  ? 132  GLU B CA  1 
ATOM   3646  C  C   . GLU B 1 129 ? 34.723  -61.641  14.501  1.00 37.47  ? 132  GLU B C   1 
ATOM   3647  O  O   . GLU B 1 129 ? 33.980  -60.656  14.483  1.00 34.67  ? 132  GLU B O   1 
ATOM   3648  C  CB  . GLU B 1 129 ? 37.161  -61.193  14.633  1.00 44.22  ? 132  GLU B CB  1 
ATOM   3649  C  CG  . GLU B 1 129 ? 38.460  -61.908  14.999  1.00 53.69  ? 132  GLU B CG  1 
ATOM   3650  C  CD  . GLU B 1 129 ? 39.091  -61.364  16.265  1.00 58.10  ? 132  GLU B CD  1 
ATOM   3651  O  OE1 . GLU B 1 129 ? 39.244  -60.124  16.359  1.00 64.67  ? 132  GLU B OE1 1 
ATOM   3652  O  OE2 . GLU B 1 129 ? 39.438  -62.172  17.158  1.00 60.01  ? 132  GLU B OE2 1 
ATOM   3653  N  N   . ASP B 1 130 ? 34.528  -62.712  13.729  1.00 36.58  ? 133  ASP B N   1 
ATOM   3654  C  CA  . ASP B 1 130 ? 33.444  -62.761  12.759  1.00 34.26  ? 133  ASP B CA  1 
ATOM   3655  C  C   . ASP B 1 130 ? 32.113  -62.943  13.464  1.00 30.95  ? 133  ASP B C   1 
ATOM   3656  O  O   . ASP B 1 130 ? 31.110  -62.385  13.031  1.00 27.99  ? 133  ASP B O   1 
ATOM   3657  C  CB  . ASP B 1 130 ? 33.685  -63.874  11.721  1.00 39.43  ? 133  ASP B CB  1 
ATOM   3658  C  CG  . ASP B 1 130 ? 34.843  -63.552  10.773  1.00 43.38  ? 133  ASP B CG  1 
ATOM   3659  O  OD1 . ASP B 1 130 ? 35.872  -64.261  10.823  1.00 44.44  ? 133  ASP B OD1 1 
ATOM   3660  O  OD2 . ASP B 1 130 ? 34.733  -62.575  9.995   1.00 45.04  ? 133  ASP B OD2 1 
ATOM   3661  N  N   . LEU B 1 131 ? 32.124  -63.720  14.554  1.00 29.26  ? 134  LEU B N   1 
ATOM   3662  C  CA  . LEU B 1 131 ? 30.950  -63.916  15.398  1.00 28.92  ? 134  LEU B CA  1 
ATOM   3663  C  C   . LEU B 1 131 ? 30.563  -62.621  16.138  1.00 29.87  ? 134  LEU B C   1 
ATOM   3664  O  O   . LEU B 1 131 ? 29.385  -62.313  16.285  1.00 30.62  ? 134  LEU B O   1 
ATOM   3665  C  CB  . LEU B 1 131 ? 31.181  -65.059  16.388  1.00 28.43  ? 134  LEU B CB  1 
ATOM   3666  C  CG  . LEU B 1 131 ? 29.947  -65.486  17.200  1.00 27.95  ? 134  LEU B CG  1 
ATOM   3667  C  CD1 . LEU B 1 131 ? 28.859  -66.086  16.317  1.00 27.68  ? 134  LEU B CD1 1 
ATOM   3668  C  CD2 . LEU B 1 131 ? 30.325  -66.452  18.303  1.00 26.86  ? 134  LEU B CD2 1 
ATOM   3669  N  N   . LEU B 1 132 ? 31.554  -61.853  16.568  1.00 29.53  ? 135  LEU B N   1 
ATOM   3670  C  CA  . LEU B 1 132 ? 31.288  -60.605  17.269  1.00 29.67  ? 135  LEU B CA  1 
ATOM   3671  C  C   . LEU B 1 132 ? 30.597  -59.620  16.327  1.00 30.27  ? 135  LEU B C   1 
ATOM   3672  O  O   . LEU B 1 132 ? 29.566  -59.004  16.675  1.00 28.48  ? 135  LEU B O   1 
ATOM   3673  C  CB  . LEU B 1 132 ? 32.594  -60.002  17.808  1.00 29.38  ? 135  LEU B CB  1 
ATOM   3674  C  CG  . LEU B 1 132 ? 32.452  -58.655  18.539  1.00 29.67  ? 135  LEU B CG  1 
ATOM   3675  C  CD1 . LEU B 1 132 ? 31.621  -58.842  19.809  1.00 27.47  ? 135  LEU B CD1 1 
ATOM   3676  C  CD2 . LEU B 1 132 ? 33.813  -58.050  18.862  1.00 27.41  ? 135  LEU B CD2 1 
ATOM   3677  N  N   . THR B 1 133 ? 31.184  -59.495  15.133  1.00 28.79  ? 136  THR B N   1 
ATOM   3678  C  CA  . THR B 1 133 ? 30.671  -58.662  14.057  1.00 28.33  ? 136  THR B CA  1 
ATOM   3679  C  C   . THR B 1 133 ? 29.244  -59.050  13.722  1.00 27.68  ? 136  THR B C   1 
ATOM   3680  O  O   . THR B 1 133 ? 28.368  -58.199  13.713  1.00 29.68  ? 136  THR B O   1 
ATOM   3681  C  CB  . THR B 1 133 ? 31.545  -58.798  12.784  1.00 27.73  ? 136  THR B CB  1 
ATOM   3682  O  OG1 . THR B 1 133 ? 32.886  -58.408  13.090  1.00 28.10  ? 136  THR B OG1 1 
ATOM   3683  C  CG2 . THR B 1 133 ? 31.015  -57.932  11.664  1.00 25.70  ? 136  THR B CG2 1 
ATOM   3684  N  N   . ASN B 1 134 ? 29.022  -60.332  13.440  1.00 27.41  ? 137  ASN B N   1 
ATOM   3685  C  CA  . ASN B 1 134 ? 27.693  -60.803  13.081  1.00 27.48  ? 137  ASN B CA  1 
ATOM   3686  C  C   . ASN B 1 134 ? 26.688  -60.448  14.173  1.00 25.68  ? 137  ASN B C   1 
ATOM   3687  O  O   . ASN B 1 134 ? 25.650  -59.861  13.889  1.00 25.42  ? 137  ASN B O   1 
ATOM   3688  C  CB  . ASN B 1 134 ? 27.684  -62.319  12.819  1.00 28.89  ? 137  ASN B CB  1 
ATOM   3689  C  CG  . ASN B 1 134 ? 28.298  -62.707  11.463  1.00 29.94  ? 137  ASN B CG  1 
ATOM   3690  O  OD1 . ASN B 1 134 ? 28.450  -61.877  10.567  1.00 28.38  ? 137  ASN B OD1 1 
ATOM   3691  N  ND2 . ASN B 1 134 ? 28.656  -63.984  11.324  1.00 26.52  ? 137  ASN B ND2 1 
ATOM   3692  N  N   . CYS B 1 135 ? 26.996  -60.816  15.417  1.00 24.95  ? 138  CYS B N   1 
ATOM   3693  C  CA  . CYS B 1 135 ? 26.131  -60.460  16.544  1.00 23.86  ? 138  CYS B CA  1 
ATOM   3694  C  C   . CYS B 1 135 ? 25.940  -58.968  16.671  1.00 22.29  ? 138  CYS B C   1 
ATOM   3695  O  O   . CYS B 1 135 ? 24.832  -58.522  16.925  1.00 22.23  ? 138  CYS B O   1 
ATOM   3696  C  CB  . CYS B 1 135 ? 26.645  -61.037  17.844  1.00 24.16  ? 138  CYS B CB  1 
ATOM   3697  S  SG  . CYS B 1 135 ? 26.566  -62.825  17.832  1.00 23.92  ? 138  CYS B SG  1 
ATOM   3698  N  N   . THR B 1 136 ? 26.993  -58.190  16.474  1.00 22.08  ? 139  THR B N   1 
ATOM   3699  C  CA  . THR B 1 136 ? 26.822  -56.731  16.467  1.00 23.91  ? 139  THR B CA  1 
ATOM   3700  C  C   . THR B 1 136 ? 25.797  -56.303  15.410  1.00 24.85  ? 139  THR B C   1 
ATOM   3701  O  O   . THR B 1 136 ? 24.936  -55.460  15.677  1.00 23.90  ? 139  THR B O   1 
ATOM   3702  C  CB  . THR B 1 136 ? 28.147  -55.976  16.268  1.00 24.65  ? 139  THR B CB  1 
ATOM   3703  O  OG1 . THR B 1 136 ? 29.089  -56.431  17.250  1.00 27.75  ? 139  THR B OG1 1 
ATOM   3704  C  CG2 . THR B 1 136 ? 27.939  -54.470  16.459  1.00 24.48  ? 139  THR B CG2 1 
ATOM   3705  N  N   . LEU B 1 137 ? 25.883  -56.904  14.220  1.00 25.55  ? 140  LEU B N   1 
ATOM   3706  C  CA  . LEU B 1 137 ? 24.972  -56.573  13.115  1.00 25.94  ? 140  LEU B CA  1 
ATOM   3707  C  C   . LEU B 1 137 ? 23.518  -56.887  13.465  1.00 23.50  ? 140  LEU B C   1 
ATOM   3708  O  O   . LEU B 1 137 ? 22.605  -56.160  13.104  1.00 24.10  ? 140  LEU B O   1 
ATOM   3709  C  CB  . LEU B 1 137 ? 25.404  -57.287  11.824  1.00 27.31  ? 140  LEU B CB  1 
ATOM   3710  C  CG  . LEU B 1 137 ? 26.655  -56.735  11.135  1.00 28.50  ? 140  LEU B CG  1 
ATOM   3711  C  CD1 . LEU B 1 137 ? 27.229  -57.767  10.163  1.00 29.42  ? 140  LEU B CD1 1 
ATOM   3712  C  CD2 . LEU B 1 137 ? 26.327  -55.431  10.414  1.00 28.42  ? 140  LEU B CD2 1 
ATOM   3713  N  N   . LEU B 1 138 ? 23.306  -57.962  14.195  1.00 23.54  ? 141  LEU B N   1 
ATOM   3714  C  CA  . LEU B 1 138 ? 21.978  -58.229  14.729  1.00 23.67  ? 141  LEU B CA  1 
ATOM   3715  C  C   . LEU B 1 138 ? 21.498  -57.053  15.593  1.00 24.13  ? 141  LEU B C   1 
ATOM   3716  O  O   . LEU B 1 138 ? 20.360  -56.571  15.441  1.00 23.78  ? 141  LEU B O   1 
ATOM   3717  C  CB  . LEU B 1 138 ? 21.970  -59.557  15.497  1.00 22.93  ? 141  LEU B CB  1 
ATOM   3718  C  CG  . LEU B 1 138 ? 22.329  -60.789  14.639  1.00 24.17  ? 141  LEU B CG  1 
ATOM   3719  C  CD1 . LEU B 1 138 ? 22.204  -62.082  15.435  1.00 22.81  ? 141  LEU B CD1 1 
ATOM   3720  C  CD2 . LEU B 1 138 ? 21.462  -60.880  13.386  1.00 23.26  ? 141  LEU B CD2 1 
ATOM   3721  N  N   . LEU B 1 139 ? 22.366  -56.550  16.465  1.00 23.94  ? 142  LEU B N   1 
ATOM   3722  C  CA  . LEU B 1 139 ? 21.954  -55.434  17.319  1.00 24.23  ? 142  LEU B CA  1 
ATOM   3723  C  C   . LEU B 1 139 ? 21.628  -54.209  16.485  1.00 24.93  ? 142  LEU B C   1 
ATOM   3724  O  O   . LEU B 1 139 ? 20.627  -53.539  16.741  1.00 24.17  ? 142  LEU B O   1 
ATOM   3725  C  CB  . LEU B 1 139 ? 23.008  -55.126  18.402  1.00 24.91  ? 142  LEU B CB  1 
ATOM   3726  C  CG  . LEU B 1 139 ? 22.830  -53.923  19.349  1.00 24.76  ? 142  LEU B CG  1 
ATOM   3727  C  CD1 . LEU B 1 139 ? 21.525  -53.978  20.131  1.00 24.40  ? 142  LEU B CD1 1 
ATOM   3728  C  CD2 . LEU B 1 139 ? 24.011  -53.914  20.307  1.00 24.88  ? 142  LEU B CD2 1 
ATOM   3729  N  N   . CYS B 1 140 ? 22.452  -53.936  15.469  1.00 25.50  ? 143  CYS B N   1 
ATOM   3730  C  CA  . CYS B 1 140 ? 22.261  -52.761  14.631  1.00 27.46  ? 143  CYS B CA  1 
ATOM   3731  C  C   . CYS B 1 140 ? 20.980  -52.791  13.793  1.00 29.63  ? 143  CYS B C   1 
ATOM   3732  O  O   . CYS B 1 140 ? 20.523  -51.746  13.326  1.00 30.39  ? 143  CYS B O   1 
ATOM   3733  C  CB  . CYS B 1 140 ? 23.458  -52.549  13.721  1.00 28.12  ? 143  CYS B CB  1 
ATOM   3734  S  SG  . CYS B 1 140 ? 24.922  -51.973  14.593  1.00 30.71  ? 143  CYS B SG  1 
ATOM   3735  N  N   . ARG B 1 141 ? 20.414  -53.981  13.609  1.00 30.37  ? 144  ARG B N   1 
ATOM   3736  C  CA  . ARG B 1 141 ? 19.168  -54.146  12.849  1.00 32.31  ? 144  ARG B CA  1 
ATOM   3737  C  C   . ARG B 1 141 ? 17.945  -54.031  13.752  1.00 30.65  ? 144  ARG B C   1 
ATOM   3738  O  O   . ARG B 1 141 ? 16.823  -53.872  13.270  1.00 28.77  ? 144  ARG B O   1 
ATOM   3739  C  CB  . ARG B 1 141 ? 19.182  -55.460  12.038  1.00 36.06  ? 144  ARG B CB  1 
ATOM   3740  C  CG  . ARG B 1 141 ? 20.316  -55.479  11.009  1.00 38.25  ? 144  ARG B CG  1 
ATOM   3741  C  CD  . ARG B 1 141 ? 20.292  -56.665  10.053  1.00 46.12  ? 144  ARG B CD  1 
ATOM   3742  N  NE  . ARG B 1 141 ? 21.441  -56.609  9.126   1.00 51.80  ? 144  ARG B NE  1 
ATOM   3743  C  CZ  . ARG B 1 141 ? 22.357  -57.569  8.978   1.00 50.00  ? 144  ARG B CZ  1 
ATOM   3744  N  NH1 . ARG B 1 141 ? 22.259  -58.699  9.674   1.00 50.44  ? 144  ARG B NH1 1 
ATOM   3745  N  NH2 . ARG B 1 141 ? 23.363  -57.407  8.122   1.00 46.71  ? 144  ARG B NH2 1 
ATOM   3746  N  N   . ARG B 1 142 ? 18.179  -54.120  15.065  1.00 29.72  ? 145  ARG B N   1 
ATOM   3747  C  CA  . ARG B 1 142 ? 17.216  -53.685  16.090  1.00 27.31  ? 145  ARG B CA  1 
ATOM   3748  C  C   . ARG B 1 142 ? 16.007  -54.577  16.263  1.00 27.39  ? 145  ARG B C   1 
ATOM   3749  O  O   . ARG B 1 142 ? 15.091  -54.214  17.025  1.00 27.04  ? 145  ARG B O   1 
ATOM   3750  C  CB  . ARG B 1 142 ? 16.718  -52.259  15.814  1.00 26.68  ? 145  ARG B CB  1 
ATOM   3751  C  CG  . ARG B 1 142 ? 17.763  -51.184  16.015  1.00 27.34  ? 145  ARG B CG  1 
ATOM   3752  C  CD  . ARG B 1 142 ? 17.131  -49.815  15.912  1.00 27.14  ? 145  ARG B CD  1 
ATOM   3753  N  NE  . ARG B 1 142 ? 17.941  -48.811  16.599  1.00 29.31  ? 145  ARG B NE  1 
ATOM   3754  C  CZ  . ARG B 1 142 ? 18.876  -48.049  16.021  1.00 28.81  ? 145  ARG B CZ  1 
ATOM   3755  N  NH1 . ARG B 1 142 ? 19.162  -48.176  14.733  1.00 27.31  ? 145  ARG B NH1 1 
ATOM   3756  N  NH2 . ARG B 1 142 ? 19.526  -47.146  16.743  1.00 26.40  ? 145  ARG B NH2 1 
ATOM   3757  N  N   . LEU B 1 143 ? 15.989  -55.719  15.569  1.00 25.96  ? 146  LEU B N   1 
ATOM   3758  C  CA  . LEU B 1 143 ? 14.847  -56.640  15.641  1.00 26.57  ? 146  LEU B CA  1 
ATOM   3759  C  C   . LEU B 1 143 ? 14.951  -57.494  16.890  1.00 26.36  ? 146  LEU B C   1 
ATOM   3760  O  O   . LEU B 1 143 ? 16.026  -57.977  17.219  1.00 25.66  ? 146  LEU B O   1 
ATOM   3761  C  CB  . LEU B 1 143 ? 14.760  -57.549  14.397  1.00 25.99  ? 146  LEU B CB  1 
ATOM   3762  C  CG  . LEU B 1 143 ? 14.512  -56.961  12.998  1.00 27.88  ? 146  LEU B CG  1 
ATOM   3763  C  CD1 . LEU B 1 143 ? 14.163  -58.048  11.979  1.00 27.42  ? 146  LEU B CD1 1 
ATOM   3764  C  CD2 . LEU B 1 143 ? 13.376  -55.955  13.035  1.00 28.85  ? 146  LEU B CD2 1 
ATOM   3765  N  N   . LEU B 1 144 ? 13.821  -57.698  17.561  1.00 27.70  ? 147  LEU B N   1 
ATOM   3766  C  CA  . LEU B 1 144 ? 13.770  -58.466  18.801  1.00 28.36  ? 147  LEU B CA  1 
ATOM   3767  C  C   . LEU B 1 144 ? 12.897  -59.696  18.627  1.00 29.27  ? 147  LEU B C   1 
ATOM   3768  O  O   . LEU B 1 144 ? 11.874  -59.624  17.945  1.00 29.71  ? 147  LEU B O   1 
ATOM   3769  C  CB  . LEU B 1 144 ? 13.149  -57.596  19.898  1.00 28.26  ? 147  LEU B CB  1 
ATOM   3770  C  CG  . LEU B 1 144 ? 13.971  -56.691  20.827  1.00 29.10  ? 147  LEU B CG  1 
ATOM   3771  C  CD1 . LEU B 1 144 ? 15.425  -56.520  20.410  1.00 29.39  ? 147  LEU B CD1 1 
ATOM   3772  C  CD2 . LEU B 1 144 ? 13.263  -55.357  20.929  1.00 28.67  ? 147  LEU B CD2 1 
ATOM   3773  N  N   . SER B 1 145 ? 13.260  -60.807  19.266  1.00 27.19  ? 148  SER B N   1 
ATOM   3774  C  CA  . SER B 1 145 ? 12.341  -61.935  19.339  1.00 27.23  ? 148  SER B CA  1 
ATOM   3775  C  C   . SER B 1 145 ? 12.380  -62.634  20.703  1.00 28.28  ? 148  SER B C   1 
ATOM   3776  O  O   . SER B 1 145 ? 13.392  -62.562  21.413  1.00 25.78  ? 148  SER B O   1 
ATOM   3777  C  CB  . SER B 1 145 ? 12.601  -62.942  18.211  1.00 27.49  ? 148  SER B CB  1 
ATOM   3778  O  OG  . SER B 1 145 ? 13.619  -63.846  18.556  1.00 26.74  ? 148  SER B OG  1 
ATOM   3779  N  N   . PRO B 1 146 ? 11.276  -63.311  21.069  1.00 28.21  ? 149  PRO B N   1 
ATOM   3780  C  CA  . PRO B 1 146 ? 11.223  -63.890  22.398  1.00 30.06  ? 149  PRO B CA  1 
ATOM   3781  C  C   . PRO B 1 146 ? 12.082  -65.122  22.556  1.00 30.08  ? 149  PRO B C   1 
ATOM   3782  O  O   . PRO B 1 146 ? 12.361  -65.837  21.580  1.00 31.54  ? 149  PRO B O   1 
ATOM   3783  C  CB  . PRO B 1 146 ? 9.745   -64.231  22.573  1.00 30.97  ? 149  PRO B CB  1 
ATOM   3784  C  CG  . PRO B 1 146 ? 9.051   -63.308  21.628  1.00 32.33  ? 149  PRO B CG  1 
ATOM   3785  C  CD  . PRO B 1 146 ? 9.954   -63.335  20.435  1.00 28.54  ? 149  PRO B CD  1 
ATOM   3786  N  N   . MET B 1 147 ? 12.511  -65.328  23.795  1.00 28.54  ? 150  MET B N   1 
ATOM   3787  C  CA  . MET B 1 147 ? 13.333  -66.442  24.199  1.00 28.93  ? 150  MET B CA  1 
ATOM   3788  C  C   . MET B 1 147 ? 12.716  -67.128  25.415  1.00 28.23  ? 150  MET B C   1 
ATOM   3789  O  O   . MET B 1 147 ? 12.112  -66.480  26.287  1.00 26.63  ? 150  MET B O   1 
ATOM   3790  C  CB  . MET B 1 147 ? 14.759  -65.989  24.555  1.00 30.57  ? 150  MET B CB  1 
ATOM   3791  C  CG  . MET B 1 147 ? 15.569  -65.292  23.462  1.00 30.68  ? 150  MET B CG  1 
ATOM   3792  S  SD  . MET B 1 147 ? 15.848  -66.134  21.879  1.00 32.95  ? 150  MET B SD  1 
ATOM   3793  C  CE  . MET B 1 147 ? 15.733  -67.860  22.281  1.00 33.83  ? 150  MET B CE  1 
ATOM   3794  N  N   . ASN B 1 148 ? 12.874  -68.447  25.455  1.00 27.58  ? 151  ASN B N   1 
ATOM   3795  C  CA  . ASN B 1 148 ? 12.462  -69.234  26.604  1.00 27.46  ? 151  ASN B CA  1 
ATOM   3796  C  C   . ASN B 1 148 ? 13.401  -69.004  27.766  1.00 26.54  ? 151  ASN B C   1 
ATOM   3797  O  O   . ASN B 1 148 ? 14.586  -68.753  27.568  1.00 26.13  ? 151  ASN B O   1 
ATOM   3798  C  CB  . ASN B 1 148 ? 12.448  -70.723  26.270  1.00 25.78  ? 151  ASN B CB  1 
ATOM   3799  C  CG  . ASN B 1 148 ? 11.467  -71.068  25.176  1.00 26.39  ? 151  ASN B CG  1 
ATOM   3800  O  OD1 . ASN B 1 148 ? 10.348  -70.545  25.126  1.00 26.38  ? 151  ASN B OD1 1 
ATOM   3801  N  ND2 . ASN B 1 148 ? 11.887  -71.962  24.279  1.00 25.93  ? 151  ASN B ND2 1 
ATOM   3802  N  N   . LEU B 1 149 ? 12.859  -69.132  28.972  1.00 27.37  ? 152  LEU B N   1 
ATOM   3803  C  CA  . LEU B 1 149 ? 13.634  -69.077  30.210  1.00 28.91  ? 152  LEU B CA  1 
ATOM   3804  C  C   . LEU B 1 149 ? 13.376  -70.348  31.019  1.00 28.86  ? 152  LEU B C   1 
ATOM   3805  O  O   . LEU B 1 149 ? 12.225  -70.741  31.206  1.00 28.45  ? 152  LEU B O   1 
ATOM   3806  C  CB  . LEU B 1 149 ? 13.193  -67.867  31.047  1.00 27.92  ? 152  LEU B CB  1 
ATOM   3807  C  CG  . LEU B 1 149 ? 14.193  -66.958  31.782  1.00 29.93  ? 152  LEU B CG  1 
ATOM   3808  C  CD1 . LEU B 1 149 ? 13.601  -66.443  33.102  1.00 28.36  ? 152  LEU B CD1 1 
ATOM   3809  C  CD2 . LEU B 1 149 ? 15.566  -67.567  32.021  1.00 28.50  ? 152  LEU B CD2 1 
ATOM   3810  N  N   . LEU B 1 150 ? 14.439  -70.966  31.524  1.00 31.07  ? 153  LEU B N   1 
ATOM   3811  C  CA  . LEU B 1 150 ? 14.301  -72.143  32.398  1.00 33.83  ? 153  LEU B CA  1 
ATOM   3812  C  C   . LEU B 1 150 ? 14.339  -71.735  33.876  1.00 36.14  ? 153  LEU B C   1 
ATOM   3813  O  O   . LEU B 1 150 ? 15.267  -71.053  34.302  1.00 36.15  ? 153  LEU B O   1 
ATOM   3814  C  CB  . LEU B 1 150 ? 15.432  -73.140  32.136  1.00 33.51  ? 153  LEU B CB  1 
ATOM   3815  C  CG  . LEU B 1 150 ? 15.295  -74.648  32.405  1.00 33.42  ? 153  LEU B CG  1 
ATOM   3816  C  CD1 . LEU B 1 150 ? 16.646  -75.191  32.832  1.00 32.80  ? 153  LEU B CD1 1 
ATOM   3817  C  CD2 . LEU B 1 150 ? 14.215  -75.060  33.385  1.00 32.36  ? 153  LEU B CD2 1 
ATOM   3818  N  N   . SER B 1 151 ? 13.347  -72.188  34.648  1.00 39.72  ? 154  SER B N   1 
ATOM   3819  C  CA  . SER B 1 151 ? 13.261  -71.899  36.077  1.00 40.34  ? 154  SER B CA  1 
ATOM   3820  C  C   . SER B 1 151 ? 13.705  -73.106  36.883  1.00 42.94  ? 154  SER B C   1 
ATOM   3821  O  O   . SER B 1 151 ? 13.138  -74.189  36.735  1.00 43.14  ? 154  SER B O   1 
ATOM   3822  C  CB  . SER B 1 151 ? 11.837  -71.541  36.465  1.00 41.38  ? 154  SER B CB  1 
ATOM   3823  O  OG  . SER B 1 151 ? 11.796  -71.135  37.820  1.00 45.24  ? 154  SER B OG  1 
ATOM   3824  N  N   . LEU B 1 152 ? 14.706  -72.907  37.740  1.00 41.23  ? 155  LEU B N   1 
ATOM   3825  C  CA  . LEU B 1 152 ? 15.315  -74.001  38.500  1.00 41.76  ? 155  LEU B CA  1 
ATOM   3826  C  C   . LEU B 1 152 ? 15.020  -73.958  40.012  1.00 44.34  ? 155  LEU B C   1 
ATOM   3827  O  O   . LEU B 1 152 ? 14.817  -72.880  40.580  1.00 45.79  ? 155  LEU B O   1 
ATOM   3828  C  CB  . LEU B 1 152 ? 16.826  -74.044  38.252  1.00 36.54  ? 155  LEU B CB  1 
ATOM   3829  C  CG  . LEU B 1 152 ? 17.259  -74.470  36.849  1.00 37.60  ? 155  LEU B CG  1 
ATOM   3830  C  CD1 . LEU B 1 152 ? 18.768  -74.383  36.671  1.00 37.13  ? 155  LEU B CD1 1 
ATOM   3831  C  CD2 . LEU B 1 152 ? 16.763  -75.868  36.524  1.00 36.15  ? 155  LEU B CD2 1 
ATOM   3832  N  N   . HIS B 1 153 ? 14.976  -75.139  40.640  1.00 45.60  ? 156  HIS B N   1 
ATOM   3833  C  CA  . HIS B 1 153 ? 14.847  -75.284  42.104  1.00 45.45  ? 156  HIS B CA  1 
ATOM   3834  C  C   . HIS B 1 153 ? 15.836  -76.307  42.596  1.00 47.60  ? 156  HIS B C   1 
ATOM   3835  O  O   . HIS B 1 153 ? 15.938  -77.397  42.026  1.00 51.06  ? 156  HIS B O   1 
ATOM   3836  C  CB  . HIS B 1 153 ? 13.451  -75.743  42.482  1.00 42.73  ? 156  HIS B CB  1 
ATOM   3837  C  CG  . HIS B 1 153 ? 12.350  -74.811  42.043  1.00 43.13  ? 156  HIS B CG  1 
ATOM   3838  N  ND1 . HIS B 1 153 ? 11.726  -73.977  42.895  1.00 44.34  ? 156  HIS B ND1 1 
ATOM   3839  C  CD2 . HIS B 1 153 ? 11.747  -74.628  40.807  1.00 43.03  ? 156  HIS B CD2 1 
ATOM   3840  C  CE1 . HIS B 1 153 ? 10.771  -73.293  42.239  1.00 44.78  ? 156  HIS B CE1 1 
ATOM   3841  N  NE2 . HIS B 1 153 ? 10.783  -73.693  40.961  1.00 43.59  ? 156  HIS B NE2 1 
ATOM   3842  N  N   . THR B 1 154 ? 16.580  -75.988  43.650  1.00 48.76  ? 157  THR B N   1 
ATOM   3843  C  CA  . THR B 1 154 ? 17.596  -76.922  44.156  1.00 50.99  ? 157  THR B CA  1 
ATOM   3844  C  C   . THR B 1 154 ? 17.225  -77.548  45.509  1.00 51.29  ? 157  THR B C   1 
ATOM   3845  O  O   . THR B 1 154 ? 16.226  -77.167  46.135  1.00 49.31  ? 157  THR B O   1 
ATOM   3846  C  CB  . THR B 1 154 ? 19.025  -76.305  44.212  1.00 52.09  ? 157  THR B CB  1 
ATOM   3847  O  OG1 . THR B 1 154 ? 19.202  -75.560  45.425  1.00 54.90  ? 157  THR B OG1 1 
ATOM   3848  C  CG2 . THR B 1 154 ? 19.288  -75.400  43.019  1.00 52.27  ? 157  THR B CG2 1 
ATOM   3849  N  N   . ALA B 1 155 ? 18.045  -78.507  45.939  1.00 51.53  ? 158  ALA B N   1 
ATOM   3850  C  CA  . ALA B 1 155 ? 17.834  -79.245  47.185  1.00 52.97  ? 158  ALA B CA  1 
ATOM   3851  C  C   . ALA B 1 155 ? 17.591  -78.306  48.374  1.00 53.79  ? 158  ALA B C   1 
ATOM   3852  O  O   . ALA B 1 155 ? 16.606  -78.462  49.109  1.00 49.85  ? 158  ALA B O   1 
ATOM   3853  C  CB  . ALA B 1 155 ? 19.024  -80.160  47.456  1.00 54.36  ? 158  ALA B CB  1 
ATOM   3854  N  N   . SER B 1 156 ? 18.481  -77.325  48.530  1.00 52.39  ? 159  SER B N   1 
ATOM   3855  C  CA  . SER B 1 156 ? 18.413  -76.364  49.629  1.00 53.70  ? 159  SER B CA  1 
ATOM   3856  C  C   . SER B 1 156 ? 17.575  -75.115  49.337  1.00 54.59  ? 159  SER B C   1 
ATOM   3857  O  O   . SER B 1 156 ? 17.930  -74.007  49.752  1.00 58.82  ? 159  SER B O   1 
ATOM   3858  C  CB  . SER B 1 156 ? 19.821  -75.994  50.125  1.00 52.86  ? 159  SER B CB  1 
ATOM   3859  O  OG  . SER B 1 156 ? 20.783  -76.103  49.094  1.00 52.17  ? 159  SER B OG  1 
ATOM   3860  N  N   . GLY B 1 157 ? 16.458  -75.304  48.640  1.00 54.11  ? 160  GLY B N   1 
ATOM   3861  C  CA  . GLY B 1 157 ? 15.481  -74.242  48.417  1.00 52.24  ? 160  GLY B CA  1 
ATOM   3862  C  C   . GLY B 1 157 ? 15.932  -73.034  47.609  1.00 53.72  ? 160  GLY B C   1 
ATOM   3863  O  O   . GLY B 1 157 ? 15.260  -72.001  47.630  1.00 55.76  ? 160  GLY B O   1 
ATOM   3864  N  N   . LEU B 1 158 ? 17.060  -73.149  46.903  1.00 54.81  ? 161  LEU B N   1 
ATOM   3865  C  CA  . LEU B 1 158 ? 17.522  -72.086  45.994  1.00 53.27  ? 161  LEU B CA  1 
ATOM   3866  C  C   . LEU B 1 158 ? 16.717  -72.088  44.701  1.00 52.81  ? 161  LEU B C   1 
ATOM   3867  O  O   . LEU B 1 158 ? 16.478  -73.144  44.106  1.00 51.73  ? 161  LEU B O   1 
ATOM   3868  C  CB  . LEU B 1 158 ? 19.024  -72.208  45.683  1.00 52.30  ? 161  LEU B CB  1 
ATOM   3869  C  CG  . LEU B 1 158 ? 19.694  -71.097  44.846  1.00 54.19  ? 161  LEU B CG  1 
ATOM   3870  C  CD1 . LEU B 1 158 ? 19.413  -69.685  45.363  1.00 54.41  ? 161  LEU B CD1 1 
ATOM   3871  C  CD2 . LEU B 1 158 ? 21.195  -71.330  44.734  1.00 52.59  ? 161  LEU B CD2 1 
ATOM   3872  N  N   . ARG B 1 159 ? 16.300  -70.896  44.284  1.00 51.55  ? 162  ARG B N   1 
ATOM   3873  C  CA  . ARG B 1 159 ? 15.543  -70.705  43.056  1.00 47.70  ? 162  ARG B CA  1 
ATOM   3874  C  C   . ARG B 1 159 ? 16.350  -69.790  42.129  1.00 46.90  ? 162  ARG B C   1 
ATOM   3875  O  O   . ARG B 1 159 ? 16.534  -68.605  42.428  1.00 48.95  ? 162  ARG B O   1 
ATOM   3876  C  CB  . ARG B 1 159 ? 14.173  -70.092  43.387  1.00 47.55  ? 162  ARG B CB  1 
ATOM   3877  C  CG  . ARG B 1 159 ? 13.022  -70.510  42.483  1.00 49.67  ? 162  ARG B CG  1 
ATOM   3878  C  CD  . ARG B 1 159 ? 12.945  -69.623  41.248  1.00 48.84  ? 162  ARG B CD  1 
ATOM   3879  N  NE  . ARG B 1 159 ? 11.821  -69.908  40.351  1.00 46.38  ? 162  ARG B NE  1 
ATOM   3880  C  CZ  . ARG B 1 159 ? 10.577  -69.457  40.519  1.00 48.01  ? 162  ARG B CZ  1 
ATOM   3881  N  NH1 . ARG B 1 159 ? 10.266  -68.722  41.577  1.00 47.91  ? 162  ARG B NH1 1 
ATOM   3882  N  NH2 . ARG B 1 159 ? 9.633   -69.754  39.631  1.00 47.46  ? 162  ARG B NH2 1 
ATOM   3883  N  N   . LEU B 1 160 ? 16.859  -70.352  41.025  1.00 43.04  ? 163  LEU B N   1 
ATOM   3884  C  CA  . LEU B 1 160 ? 17.591  -69.579  40.000  1.00 38.85  ? 163  LEU B CA  1 
ATOM   3885  C  C   . LEU B 1 160 ? 17.072  -69.867  38.574  1.00 39.92  ? 163  LEU B C   1 
ATOM   3886  O  O   . LEU B 1 160 ? 16.366  -70.857  38.351  1.00 41.10  ? 163  LEU B O   1 
ATOM   3887  C  CB  . LEU B 1 160 ? 19.103  -69.836  40.092  1.00 35.53  ? 163  LEU B CB  1 
ATOM   3888  C  CG  . LEU B 1 160 ? 19.694  -71.141  39.534  1.00 35.86  ? 163  LEU B CG  1 
ATOM   3889  C  CD1 . LEU B 1 160 ? 21.199  -70.999  39.342  1.00 33.47  ? 163  LEU B CD1 1 
ATOM   3890  C  CD2 . LEU B 1 160 ? 19.374  -72.353  40.405  1.00 33.84  ? 163  LEU B CD2 1 
ATOM   3891  N  N   . PHE B 1 161 ? 17.434  -69.006  37.619  1.00 37.03  ? 164  PHE B N   1 
ATOM   3892  C  CA  . PHE B 1 161 ? 16.978  -69.135  36.232  1.00 32.45  ? 164  PHE B CA  1 
ATOM   3893  C  C   . PHE B 1 161 ? 18.117  -69.375  35.252  1.00 31.99  ? 164  PHE B C   1 
ATOM   3894  O  O   . PHE B 1 161 ? 19.257  -68.940  35.474  1.00 31.48  ? 164  PHE B O   1 
ATOM   3895  C  CB  . PHE B 1 161 ? 16.129  -67.940  35.817  1.00 31.42  ? 164  PHE B CB  1 
ATOM   3896  C  CG  . PHE B 1 161 ? 15.035  -67.629  36.789  1.00 30.96  ? 164  PHE B CG  1 
ATOM   3897  C  CD1 . PHE B 1 161 ? 13.750  -68.116  36.588  1.00 29.50  ? 164  PHE B CD1 1 
ATOM   3898  C  CD2 . PHE B 1 161 ? 15.303  -66.870  37.936  1.00 30.46  ? 164  PHE B CD2 1 
ATOM   3899  C  CE1 . PHE B 1 161 ? 12.745  -67.854  37.505  1.00 30.13  ? 164  PHE B CE1 1 
ATOM   3900  C  CE2 . PHE B 1 161 ? 14.302  -66.606  38.861  1.00 29.09  ? 164  PHE B CE2 1 
ATOM   3901  C  CZ  . PHE B 1 161 ? 13.022  -67.088  38.639  1.00 29.54  ? 164  PHE B CZ  1 
ATOM   3902  N  N   . SER B 1 162 ? 17.794  -70.085  34.174  1.00 30.14  ? 165  SER B N   1 
ATOM   3903  C  CA  . SER B 1 162 ? 18.780  -70.466  33.177  1.00 30.29  ? 165  SER B CA  1 
ATOM   3904  C  C   . SER B 1 162 ? 18.319  -70.000  31.807  1.00 27.93  ? 165  SER B C   1 
ATOM   3905  O  O   . SER B 1 162 ? 17.144  -70.137  31.457  1.00 28.79  ? 165  SER B O   1 
ATOM   3906  C  CB  . SER B 1 162 ? 18.994  -71.989  33.182  1.00 29.54  ? 165  SER B CB  1 
ATOM   3907  O  OG  . SER B 1 162 ? 19.707  -72.408  32.026  1.00 32.68  ? 165  SER B OG  1 
ATOM   3908  N  N   . VAL B 1 163 ? 19.253  -69.466  31.033  1.00 26.07  ? 166  VAL B N   1 
ATOM   3909  C  CA  . VAL B 1 163 ? 18.938  -68.966  29.699  1.00 27.11  ? 166  VAL B CA  1 
ATOM   3910  C  C   . VAL B 1 163 ? 19.481  -69.880  28.600  1.00 28.33  ? 166  VAL B C   1 
ATOM   3911  O  O   . VAL B 1 163 ? 19.209  -69.657  27.419  1.00 27.16  ? 166  VAL B O   1 
ATOM   3912  C  CB  . VAL B 1 163 ? 19.488  -67.542  29.458  1.00 25.40  ? 166  VAL B CB  1 
ATOM   3913  C  CG1 . VAL B 1 163 ? 19.050  -66.598  30.561  1.00 25.82  ? 166  VAL B CG1 1 
ATOM   3914  C  CG2 . VAL B 1 163 ? 21.002  -67.555  29.321  1.00 25.43  ? 166  VAL B CG2 1 
ATOM   3915  N  N   . LEU B 1 164 ? 20.274  -70.874  28.991  1.00 29.17  ? 167  LEU B N   1 
ATOM   3916  C  CA  . LEU B 1 164 ? 21.017  -71.681  28.030  1.00 32.09  ? 167  LEU B CA  1 
ATOM   3917  C  C   . LEU B 1 164 ? 20.988  -73.161  28.323  1.00 32.53  ? 167  LEU B C   1 
ATOM   3918  O  O   . LEU B 1 164 ? 20.461  -73.933  27.521  1.00 34.86  ? 167  LEU B O   1 
ATOM   3919  C  CB  . LEU B 1 164 ? 22.471  -71.227  27.916  1.00 32.06  ? 167  LEU B CB  1 
ATOM   3920  C  CG  . LEU B 1 164 ? 23.307  -72.003  26.900  1.00 32.70  ? 167  LEU B CG  1 
ATOM   3921  C  CD1 . LEU B 1 164 ? 23.046  -71.496  25.487  1.00 32.50  ? 167  LEU B CD1 1 
ATOM   3922  C  CD2 . LEU B 1 164 ? 24.776  -71.860  27.248  1.00 34.77  ? 167  LEU B CD2 1 
ATOM   3923  N  N   . SER B 1 165 ? 21.564  -73.562  29.452  1.00 33.34  ? 168  SER B N   1 
ATOM   3924  C  CA  . SER B 1 165 ? 21.742  -74.983  29.728  1.00 32.99  ? 168  SER B CA  1 
ATOM   3925  C  C   . SER B 1 165 ? 21.908  -75.360  31.196  1.00 35.44  ? 168  SER B C   1 
ATOM   3926  O  O   . SER B 1 165 ? 22.368  -74.566  32.019  1.00 36.69  ? 168  SER B O   1 
ATOM   3927  C  CB  . SER B 1 165 ? 22.907  -75.549  28.915  1.00 30.99  ? 168  SER B CB  1 
ATOM   3928  O  OG  . SER B 1 165 ? 24.115  -74.880  29.213  1.00 30.39  ? 168  SER B OG  1 
ATOM   3929  N  N   . LEU B 1 166 ? 21.495  -76.584  31.500  1.00 36.53  ? 169  LEU B N   1 
ATOM   3930  C  CA  . LEU B 1 166 ? 21.836  -77.241  32.737  1.00 38.73  ? 169  LEU B CA  1 
ATOM   3931  C  C   . LEU B 1 166 ? 22.473  -78.578  32.392  1.00 39.60  ? 169  LEU B C   1 
ATOM   3932  O  O   . LEU B 1 166 ? 21.846  -79.433  31.768  1.00 39.44  ? 169  LEU B O   1 
ATOM   3933  C  CB  . LEU B 1 166 ? 20.608  -77.487  33.579  1.00 39.41  ? 169  LEU B CB  1 
ATOM   3934  C  CG  . LEU B 1 166 ? 21.114  -78.252  34.795  1.00 40.64  ? 169  LEU B CG  1 
ATOM   3935  C  CD1 . LEU B 1 166 ? 21.165  -77.341  36.008  1.00 39.37  ? 169  LEU B CD1 1 
ATOM   3936  C  CD2 . LEU B 1 166 ? 20.251  -79.482  35.035  1.00 41.65  ? 169  LEU B CD2 1 
ATOM   3937  N  N   . ALA B 1 167 ? 23.720  -78.745  32.798  1.00 37.19  ? 170  ALA B N   1 
ATOM   3938  C  CA  . ALA B 1 167 ? 24.472  -79.925  32.457  1.00 39.28  ? 170  ALA B CA  1 
ATOM   3939  C  C   . ALA B 1 167 ? 24.928  -80.633  33.722  1.00 42.47  ? 170  ALA B C   1 
ATOM   3940  O  O   . ALA B 1 167 ? 25.201  -79.996  34.747  1.00 43.82  ? 170  ALA B O   1 
ATOM   3941  C  CB  . ALA B 1 167 ? 25.667  -79.549  31.597  1.00 38.71  ? 170  ALA B CB  1 
ATOM   3942  N  N   . TRP B 1 168 ? 25.004  -81.955  33.635  1.00 45.56  ? 171  TRP B N   1 
ATOM   3943  C  CA  . TRP B 1 168 ? 25.515  -82.792  34.707  1.00 46.57  ? 171  TRP B CA  1 
ATOM   3944  C  C   . TRP B 1 168 ? 26.328  -83.917  34.114  1.00 45.71  ? 171  TRP B C   1 
ATOM   3945  O  O   . TRP B 1 168 ? 26.084  -84.331  32.984  1.00 43.20  ? 171  TRP B O   1 
ATOM   3946  C  CB  . TRP B 1 168 ? 24.350  -83.313  35.525  1.00 50.74  ? 171  TRP B CB  1 
ATOM   3947  C  CG  . TRP B 1 168 ? 24.715  -84.354  36.548  1.00 57.22  ? 171  TRP B CG  1 
ATOM   3948  C  CD1 . TRP B 1 168 ? 25.583  -84.220  37.632  1.00 58.99  ? 171  TRP B CD1 1 
ATOM   3949  C  CD2 . TRP B 1 168 ? 24.210  -85.729  36.632  1.00 59.84  ? 171  TRP B CD2 1 
ATOM   3950  N  NE1 . TRP B 1 168 ? 25.654  -85.384  38.351  1.00 58.79  ? 171  TRP B NE1 1 
ATOM   3951  C  CE2 . TRP B 1 168 ? 24.856  -86.331  37.810  1.00 60.17  ? 171  TRP B CE2 1 
ATOM   3952  C  CE3 . TRP B 1 168 ? 23.327  -86.498  35.877  1.00 58.04  ? 171  TRP B CE3 1 
ATOM   3953  C  CZ2 . TRP B 1 168 ? 24.613  -87.649  38.190  1.00 59.86  ? 171  TRP B CZ2 1 
ATOM   3954  C  CZ3 . TRP B 1 168 ? 23.088  -87.825  36.273  1.00 60.54  ? 171  TRP B CZ3 1 
ATOM   3955  C  CH2 . TRP B 1 168 ? 23.716  -88.383  37.402  1.00 59.68  ? 171  TRP B CH2 1 
ATOM   3956  N  N   . GLY B 1 169 ? 27.309  -84.416  34.859  1.00 43.48  ? 172  GLY B N   1 
ATOM   3957  C  CA  . GLY B 1 169 ? 28.120  -85.525  34.389  1.00 39.85  ? 172  GLY B CA  1 
ATOM   3958  C  C   . GLY B 1 169 ? 29.297  -85.018  33.593  1.00 39.96  ? 172  GLY B C   1 
ATOM   3959  O  O   . GLY B 1 169 ? 29.913  -84.032  33.976  1.00 42.04  ? 172  GLY B O   1 
ATOM   3960  N  N   . PHE B 1 170 ? 29.590  -85.682  32.474  1.00 38.38  ? 173  PHE B N   1 
ATOM   3961  C  CA  . PHE B 1 170 ? 30.760  -85.394  31.638  1.00 41.26  ? 173  PHE B CA  1 
ATOM   3962  C  C   . PHE B 1 170 ? 30.952  -83.889  31.344  1.00 42.60  ? 173  PHE B C   1 
ATOM   3963  O  O   . PHE B 1 170 ? 32.071  -83.355  31.466  1.00 41.62  ? 173  PHE B O   1 
ATOM   3964  C  CB  . PHE B 1 170 ? 30.676  -86.205  30.324  1.00 41.47  ? 173  PHE B CB  1 
ATOM   3965  C  CG  . PHE B 1 170 ? 31.921  -86.152  29.474  1.00 41.89  ? 173  PHE B CG  1 
ATOM   3966  C  CD1 . PHE B 1 170 ? 32.190  -85.054  28.660  1.00 42.97  ? 173  PHE B CD1 1 
ATOM   3967  C  CD2 . PHE B 1 170 ? 32.805  -87.212  29.459  1.00 43.16  ? 173  PHE B CD2 1 
ATOM   3968  C  CE1 . PHE B 1 170 ? 33.330  -85.008  27.873  1.00 42.55  ? 173  PHE B CE1 1 
ATOM   3969  C  CE2 . PHE B 1 170 ? 33.945  -87.176  28.671  1.00 43.20  ? 173  PHE B CE2 1 
ATOM   3970  C  CZ  . PHE B 1 170 ? 34.208  -86.075  27.874  1.00 44.06  ? 173  PHE B CZ  1 
ATOM   3971  N  N   . ILE B 1 171 ? 29.870  -83.219  30.950  1.00 41.26  ? 174  ILE B N   1 
ATOM   3972  C  CA  . ILE B 1 171 ? 29.961  -81.831  30.508  1.00 42.12  ? 174  ILE B CA  1 
ATOM   3973  C  C   . ILE B 1 171 ? 30.342  -80.926  31.679  1.00 40.76  ? 174  ILE B C   1 
ATOM   3974  O  O   . ILE B 1 171 ? 31.323  -80.182  31.588  1.00 40.49  ? 174  ILE B O   1 
ATOM   3975  C  CB  . ILE B 1 171 ? 28.675  -81.365  29.796  1.00 42.20  ? 174  ILE B CB  1 
ATOM   3976  C  CG1 . ILE B 1 171 ? 28.557  -82.065  28.440  1.00 42.56  ? 174  ILE B CG1 1 
ATOM   3977  C  CG2 . ILE B 1 171 ? 28.668  -79.847  29.604  1.00 41.11  ? 174  ILE B CG2 1 
ATOM   3978  C  CD1 . ILE B 1 171 ? 27.125  -82.250  27.981  1.00 44.05  ? 174  ILE B CD1 1 
ATOM   3979  N  N   . ALA B 1 172 ? 29.583  -81.007  32.771  1.00 39.57  ? 175  ALA B N   1 
ATOM   3980  C  CA  . ALA B 1 172 ? 29.946  -80.314  34.010  1.00 44.19  ? 175  ALA B CA  1 
ATOM   3981  C  C   . ALA B 1 172 ? 31.435  -80.508  34.339  1.00 46.25  ? 175  ALA B C   1 
ATOM   3982  O  O   . ALA B 1 172 ? 32.186  -79.535  34.410  1.00 47.42  ? 175  ALA B O   1 
ATOM   3983  C  CB  . ALA B 1 172 ? 29.079  -80.782  35.164  1.00 42.26  ? 175  ALA B CB  1 
ATOM   3984  N  N   . ASP B 1 173 ? 31.858  -81.761  34.503  1.00 46.08  ? 176  ASP B N   1 
ATOM   3985  C  CA  . ASP B 1 173 ? 33.243  -82.069  34.850  1.00 48.83  ? 176  ASP B CA  1 
ATOM   3986  C  C   . ASP B 1 173 ? 34.246  -81.365  33.958  1.00 48.86  ? 176  ASP B C   1 
ATOM   3987  O  O   . ASP B 1 173 ? 35.198  -80.770  34.452  1.00 53.96  ? 176  ASP B O   1 
ATOM   3988  C  CB  . ASP B 1 173 ? 33.497  -83.573  34.830  1.00 51.12  ? 176  ASP B CB  1 
ATOM   3989  C  CG  . ASP B 1 173 ? 32.930  -84.276  36.045  1.00 55.20  ? 176  ASP B CG  1 
ATOM   3990  O  OD1 . ASP B 1 173 ? 32.006  -83.732  36.703  1.00 55.23  ? 176  ASP B OD1 1 
ATOM   3991  O  OD2 . ASP B 1 173 ? 33.415  -85.391  36.339  1.00 57.08  ? 176  ASP B OD2 1 
ATOM   3992  N  N   . VAL B 1 174 ? 34.037  -81.423  32.648  1.00 48.24  ? 177  VAL B N   1 
ATOM   3993  C  CA  . VAL B 1 174 ? 34.923  -80.716  31.727  1.00 46.76  ? 177  VAL B CA  1 
ATOM   3994  C  C   . VAL B 1 174 ? 34.854  -79.197  31.942  1.00 49.43  ? 177  VAL B C   1 
ATOM   3995  O  O   . VAL B 1 174 ? 35.887  -78.524  31.905  1.00 50.98  ? 177  VAL B O   1 
ATOM   3996  C  CB  . VAL B 1 174 ? 34.660  -81.093  30.254  1.00 44.15  ? 177  VAL B CB  1 
ATOM   3997  C  CG1 . VAL B 1 174 ? 35.491  -80.230  29.317  1.00 44.71  ? 177  VAL B CG1 1 
ATOM   3998  C  CG2 . VAL B 1 174 ? 34.985  -82.563  30.019  1.00 44.24  ? 177  VAL B CG2 1 
ATOM   3999  N  N   . ASP B 1 175 ? 33.653  -78.660  32.169  1.00 48.82  ? 178  ASP B N   1 
ATOM   4000  C  CA  . ASP B 1 175 ? 33.507  -77.224  32.436  1.00 54.22  ? 178  ASP B CA  1 
ATOM   4001  C  C   . ASP B 1 175 ? 34.254  -76.815  33.710  1.00 57.56  ? 178  ASP B C   1 
ATOM   4002  O  O   . ASP B 1 175 ? 34.906  -75.762  33.736  1.00 56.20  ? 178  ASP B O   1 
ATOM   4003  C  CB  . ASP B 1 175 ? 32.029  -76.795  32.498  1.00 51.64  ? 178  ASP B CB  1 
ATOM   4004  C  CG  . ASP B 1 175 ? 31.424  -76.548  31.115  1.00 50.89  ? 178  ASP B CG  1 
ATOM   4005  O  OD1 . ASP B 1 175 ? 30.192  -76.337  31.032  1.00 47.87  ? 178  ASP B OD1 1 
ATOM   4006  O  OD2 . ASP B 1 175 ? 32.177  -76.566  30.113  1.00 50.03  ? 178  ASP B OD2 1 
ATOM   4007  N  N   . LEU B 1 176 ? 34.173  -77.671  34.736  1.00 58.23  ? 179  LEU B N   1 
ATOM   4008  C  CA  . LEU B 1 176 ? 34.865  -77.476  36.016  1.00 62.05  ? 179  LEU B CA  1 
ATOM   4009  C  C   . LEU B 1 176 ? 36.384  -77.580  35.864  1.00 63.61  ? 179  LEU B C   1 
ATOM   4010  O  O   . LEU B 1 176 ? 37.114  -76.648  36.206  1.00 64.53  ? 179  LEU B O   1 
ATOM   4011  C  CB  . LEU B 1 176 ? 34.383  -78.502  37.050  1.00 63.06  ? 179  LEU B CB  1 
ATOM   4012  C  CG  . LEU B 1 176 ? 34.319  -78.188  38.559  1.00 65.06  ? 179  LEU B CG  1 
ATOM   4013  C  CD1 . LEU B 1 176 ? 34.532  -79.461  39.374  1.00 61.44  ? 179  LEU B CD1 1 
ATOM   4014  C  CD2 . LEU B 1 176 ? 35.269  -77.087  39.019  1.00 64.32  ? 179  LEU B CD2 1 
ATOM   4015  N  N   . GLU B 1 177 ? 36.847  -78.714  35.347  1.00 64.26  ? 180  GLU B N   1 
ATOM   4016  C  CA  . GLU B 1 177 ? 38.271  -78.976  35.191  1.00 66.80  ? 180  GLU B CA  1 
ATOM   4017  C  C   . GLU B 1 177 ? 38.887  -78.157  34.073  1.00 68.04  ? 180  GLU B C   1 
ATOM   4018  O  O   . GLU B 1 177 ? 40.045  -78.364  33.729  1.00 72.36  ? 180  GLU B O   1 
ATOM   4019  C  CB  . GLU B 1 177 ? 38.511  -80.460  34.909  1.00 72.10  ? 180  GLU B CB  1 
ATOM   4020  C  CG  . GLU B 1 177 ? 37.986  -81.411  35.976  1.00 78.81  ? 180  GLU B CG  1 
ATOM   4021  C  CD  . GLU B 1 177 ? 37.517  -82.743  35.401  1.00 83.37  ? 180  GLU B CD  1 
ATOM   4022  O  OE1 . GLU B 1 177 ? 36.888  -83.522  36.154  1.00 85.70  ? 180  GLU B OE1 1 
ATOM   4023  O  OE2 . GLU B 1 177 ? 37.764  -83.014  34.200  1.00 83.39  ? 180  GLU B OE2 1 
ATOM   4024  N  N   . SER B 1 178 ? 38.127  -77.220  33.514  1.00 70.43  ? 181  SER B N   1 
ATOM   4025  C  CA  . SER B 1 178 ? 38.567  -76.477  32.335  1.00 71.40  ? 181  SER B CA  1 
ATOM   4026  C  C   . SER B 1 178 ? 39.267  -75.150  32.658  1.00 74.44  ? 181  SER B C   1 
ATOM   4027  O  O   . SER B 1 178 ? 39.125  -74.172  31.924  1.00 72.03  ? 181  SER B O   1 
ATOM   4028  C  CB  . SER B 1 178 ? 37.384  -76.255  31.390  1.00 71.31  ? 181  SER B CB  1 
ATOM   4029  O  OG  . SER B 1 178 ? 37.820  -76.153  30.046  1.00 71.32  ? 181  SER B OG  1 
ATOM   4030  N  N   . GLU B 1 179 ? 40.046  -75.136  33.741  1.00 83.33  ? 182  GLU B N   1 
ATOM   4031  C  CA  . GLU B 1 179 ? 40.777  -73.939  34.189  1.00 87.14  ? 182  GLU B CA  1 
ATOM   4032  C  C   . GLU B 1 179 ? 41.831  -73.434  33.187  1.00 90.70  ? 182  GLU B C   1 
ATOM   4033  O  O   . GLU B 1 179 ? 42.341  -72.321  33.334  1.00 93.03  ? 182  GLU B O   1 
ATOM   4034  C  CB  . GLU B 1 179 ? 41.393  -74.173  35.586  1.00 89.09  ? 182  GLU B CB  1 
ATOM   4035  C  CG  . GLU B 1 179 ? 42.902  -74.423  35.639  1.00 89.31  ? 182  GLU B CG  1 
ATOM   4036  C  CD  . GLU B 1 179 ? 43.345  -75.684  34.913  1.00 88.30  ? 182  GLU B CD  1 
ATOM   4037  O  OE1 . GLU B 1 179 ? 44.129  -75.568  33.950  1.00 84.91  ? 182  GLU B OE1 1 
ATOM   4038  O  OE2 . GLU B 1 179 ? 42.916  -76.789  35.304  1.00 91.36  ? 182  GLU B OE2 1 
ATOM   4039  N  N   . LYS B 1 180 ? 42.140  -74.252  32.177  1.00 95.57  ? 183  LYS B N   1 
ATOM   4040  C  CA  . LYS B 1 180 ? 43.156  -73.925  31.161  1.00 97.27  ? 183  LYS B CA  1 
ATOM   4041  C  C   . LYS B 1 180 ? 42.618  -73.093  29.977  1.00 98.79  ? 183  LYS B C   1 
ATOM   4042  O  O   . LYS B 1 180 ? 42.629  -73.540  28.827  1.00 98.19  ? 183  LYS B O   1 
ATOM   4043  C  CB  . LYS B 1 180 ? 43.928  -75.182  30.694  1.00 93.50  ? 183  LYS B CB  1 
ATOM   4044  C  CG  . LYS B 1 180 ? 43.095  -76.367  30.207  1.00 93.82  ? 183  LYS B CG  1 
ATOM   4045  C  CD  . LYS B 1 180 ? 42.580  -77.232  31.352  1.00 93.71  ? 183  LYS B CD  1 
ATOM   4046  C  CE  . LYS B 1 180 ? 42.156  -78.616  30.886  1.00 89.11  ? 183  LYS B CE  1 
ATOM   4047  N  NZ  . LYS B 1 180 ? 43.295  -79.574  30.900  1.00 87.98  ? 183  LYS B NZ  1 
ATOM   4048  N  N   . TYR B 1 181 ? 42.173  -71.874  30.288  1.00 102.24 ? 184  TYR B N   1 
ATOM   4049  C  CA  . TYR B 1 181 ? 41.605  -70.918  29.322  1.00 105.17 ? 184  TYR B CA  1 
ATOM   4050  C  C   . TYR B 1 181 ? 42.390  -70.744  28.010  1.00 107.19 ? 184  TYR B C   1 
ATOM   4051  O  O   . TYR B 1 181 ? 41.796  -70.709  26.925  1.00 104.29 ? 184  TYR B O   1 
ATOM   4052  C  CB  . TYR B 1 181 ? 41.402  -69.555  29.997  1.00 110.34 ? 184  TYR B CB  1 
ATOM   4053  C  CG  . TYR B 1 181 ? 42.521  -69.165  30.945  1.00 117.11 ? 184  TYR B CG  1 
ATOM   4054  C  CD1 . TYR B 1 181 ? 42.350  -69.251  32.327  1.00 120.46 ? 184  TYR B CD1 1 
ATOM   4055  C  CD2 . TYR B 1 181 ? 43.755  -68.717  30.460  1.00 121.76 ? 184  TYR B CD2 1 
ATOM   4056  C  CE1 . TYR B 1 181 ? 43.374  -68.902  33.200  1.00 127.15 ? 184  TYR B CE1 1 
ATOM   4057  C  CE2 . TYR B 1 181 ? 44.784  -68.367  31.322  1.00 126.01 ? 184  TYR B CE2 1 
ATOM   4058  C  CZ  . TYR B 1 181 ? 44.591  -68.459  32.690  1.00 127.70 ? 184  TYR B CZ  1 
ATOM   4059  O  OH  . TYR B 1 181 ? 45.612  -68.109  33.548  1.00 125.51 ? 184  TYR B OH  1 
ATOM   4060  N  N   . ARG B 1 182 ? 43.714  -70.637  28.115  1.00 107.22 ? 185  ARG B N   1 
ATOM   4061  C  CA  . ARG B 1 182 ? 44.578  -70.386  26.957  1.00 105.39 ? 185  ARG B CA  1 
ATOM   4062  C  C   . ARG B 1 182 ? 44.827  -71.652  26.132  1.00 101.96 ? 185  ARG B C   1 
ATOM   4063  O  O   . ARG B 1 182 ? 43.892  -72.349  25.727  1.00 94.77  ? 185  ARG B O   1 
ATOM   4064  C  CB  . ARG B 1 182 ? 45.898  -69.765  27.404  1.00 100.43 ? 185  ARG B CB  1 
ATOM   4065  N  N   . MET B 1 187 ? 40.199  -74.957  21.573  1.00 64.41  ? 190  MET B N   1 
ATOM   4066  C  CA  . MET B 1 187 ? 39.717  -74.312  22.793  1.00 66.71  ? 190  MET B CA  1 
ATOM   4067  C  C   . MET B 1 187 ? 39.728  -75.281  23.983  1.00 65.08  ? 190  MET B C   1 
ATOM   4068  O  O   . MET B 1 187 ? 39.804  -76.496  23.806  1.00 63.84  ? 190  MET B O   1 
ATOM   4069  C  CB  . MET B 1 187 ? 38.315  -73.712  22.577  1.00 68.98  ? 190  MET B CB  1 
ATOM   4070  C  CG  . MET B 1 187 ? 37.769  -72.878  23.735  1.00 69.47  ? 190  MET B CG  1 
ATOM   4071  S  SD  . MET B 1 187 ? 38.911  -71.622  24.373  1.00 77.41  ? 190  MET B SD  1 
ATOM   4072  C  CE  . MET B 1 187 ? 38.998  -70.496  22.976  1.00 73.20  ? 190  MET B CE  1 
ATOM   4073  N  N   . ARG B 1 188 ? 39.646  -74.721  25.189  1.00 62.91  ? 191  ARG B N   1 
ATOM   4074  C  CA  . ARG B 1 188 ? 39.744  -75.473  26.441  1.00 63.21  ? 191  ARG B CA  1 
ATOM   4075  C  C   . ARG B 1 188 ? 38.732  -76.608  26.612  1.00 60.38  ? 191  ARG B C   1 
ATOM   4076  O  O   . ARG B 1 188 ? 38.997  -77.566  27.334  1.00 59.69  ? 191  ARG B O   1 
ATOM   4077  C  CB  . ARG B 1 188 ? 39.675  -74.522  27.651  1.00 66.81  ? 191  ARG B CB  1 
ATOM   4078  C  CG  . ARG B 1 188 ? 38.392  -73.704  27.786  1.00 69.58  ? 191  ARG B CG  1 
ATOM   4079  C  CD  . ARG B 1 188 ? 38.458  -72.782  29.002  1.00 74.04  ? 191  ARG B CD  1 
ATOM   4080  N  NE  . ARG B 1 188 ? 37.244  -71.983  29.214  1.00 72.17  ? 191  ARG B NE  1 
ATOM   4081  C  CZ  . ARG B 1 188 ? 36.304  -72.242  30.127  1.00 70.45  ? 191  ARG B CZ  1 
ATOM   4082  N  NH1 . ARG B 1 188 ? 36.405  -73.292  30.937  1.00 64.57  ? 191  ARG B NH1 1 
ATOM   4083  N  NH2 . ARG B 1 188 ? 35.248  -71.442  30.231  1.00 68.95  ? 191  ARG B NH2 1 
ATOM   4084  N  N   . PHE B 1 189 ? 37.573  -76.497  25.970  1.00 60.64  ? 192  PHE B N   1 
ATOM   4085  C  CA  . PHE B 1 189 ? 36.543  -77.523  26.105  1.00 57.94  ? 192  PHE B CA  1 
ATOM   4086  C  C   . PHE B 1 189 ? 36.924  -78.750  25.297  1.00 55.20  ? 192  PHE B C   1 
ATOM   4087  O  O   . PHE B 1 189 ? 36.461  -79.851  25.582  1.00 53.96  ? 192  PHE B O   1 
ATOM   4088  C  CB  . PHE B 1 189 ? 35.178  -76.993  25.663  1.00 61.29  ? 192  PHE B CB  1 
ATOM   4089  C  CG  . PHE B 1 189 ? 34.768  -75.722  26.356  1.00 65.55  ? 192  PHE B CG  1 
ATOM   4090  C  CD1 . PHE B 1 189 ? 34.478  -75.716  27.725  1.00 64.52  ? 192  PHE B CD1 1 
ATOM   4091  C  CD2 . PHE B 1 189 ? 34.669  -74.526  25.642  1.00 65.55  ? 192  PHE B CD2 1 
ATOM   4092  C  CE1 . PHE B 1 189 ? 34.099  -74.546  28.366  1.00 65.05  ? 192  PHE B CE1 1 
ATOM   4093  C  CE2 . PHE B 1 189 ? 34.288  -73.353  26.277  1.00 66.44  ? 192  PHE B CE2 1 
ATOM   4094  C  CZ  . PHE B 1 189 ? 34.003  -73.362  27.640  1.00 67.70  ? 192  PHE B CZ  1 
ATOM   4095  N  N   . THR B 1 190 ? 37.786  -78.543  24.304  1.00 52.52  ? 193  THR B N   1 
ATOM   4096  C  CA  . THR B 1 190 ? 38.256  -79.609  23.423  1.00 54.93  ? 193  THR B CA  1 
ATOM   4097  C  C   . THR B 1 190 ? 39.421  -80.396  24.022  1.00 55.00  ? 193  THR B C   1 
ATOM   4098  O  O   . THR B 1 190 ? 39.452  -81.622  23.919  1.00 51.85  ? 193  THR B O   1 
ATOM   4099  C  CB  . THR B 1 190 ? 38.562  -79.076  22.000  1.00 54.53  ? 193  THR B CB  1 
ATOM   4100  O  OG1 . THR B 1 190 ? 37.393  -79.234  21.185  1.00 53.31  ? 193  THR B OG1 1 
ATOM   4101  C  CG2 . THR B 1 190 ? 39.723  -79.813  21.339  1.00 53.61  ? 193  THR B CG2 1 
ATOM   4102  N  N   . LEU B 1 191 ? 40.364  -79.697  24.653  1.00 55.99  ? 194  LEU B N   1 
ATOM   4103  C  CA  . LEU B 1 191 ? 41.423  -80.379  25.388  1.00 56.28  ? 194  LEU B CA  1 
ATOM   4104  C  C   . LEU B 1 191 ? 40.817  -81.112  26.583  1.00 55.20  ? 194  LEU B C   1 
ATOM   4105  O  O   . LEU B 1 191 ? 41.116  -82.290  26.817  1.00 53.02  ? 194  LEU B O   1 
ATOM   4106  C  CB  . LEU B 1 191 ? 42.516  -79.402  25.844  1.00 58.85  ? 194  LEU B CB  1 
ATOM   4107  C  CG  . LEU B 1 191 ? 43.660  -79.988  26.704  1.00 60.33  ? 194  LEU B CG  1 
ATOM   4108  C  CD1 . LEU B 1 191 ? 44.575  -80.906  25.892  1.00 57.14  ? 194  LEU B CD1 1 
ATOM   4109  C  CD2 . LEU B 1 191 ? 44.463  -78.888  27.396  1.00 57.99  ? 194  LEU B CD2 1 
ATOM   4110  N  N   . GLY B 1 192 ? 39.946  -80.412  27.309  1.00 51.63  ? 195  GLY B N   1 
ATOM   4111  C  CA  . GLY B 1 192 ? 39.305  -80.947  28.508  1.00 51.99  ? 195  GLY B CA  1 
ATOM   4112  C  C   . GLY B 1 192 ? 38.371  -82.115  28.257  1.00 52.09  ? 195  GLY B C   1 
ATOM   4113  O  O   . GLY B 1 192 ? 38.144  -82.939  29.143  1.00 50.45  ? 195  GLY B O   1 
ATOM   4114  N  N   . THR B 1 193 ? 37.818  -82.175  27.048  1.00 53.18  ? 196  THR B N   1 
ATOM   4115  C  CA  . THR B 1 193 ? 36.978  -83.288  26.645  1.00 51.55  ? 196  THR B CA  1 
ATOM   4116  C  C   . THR B 1 193 ? 37.846  -84.495  26.323  1.00 51.29  ? 196  THR B C   1 
ATOM   4117  O  O   . THR B 1 193 ? 37.615  -85.569  26.872  1.00 47.70  ? 196  THR B O   1 
ATOM   4118  C  CB  . THR B 1 193 ? 36.101  -82.923  25.438  1.00 53.33  ? 196  THR B CB  1 
ATOM   4119  O  OG1 . THR B 1 193 ? 35.153  -81.924  25.833  1.00 53.29  ? 196  THR B OG1 1 
ATOM   4120  C  CG2 . THR B 1 193 ? 35.365  -84.147  24.900  1.00 50.86  ? 196  THR B CG2 1 
ATOM   4121  N  N   . PHE B 1 194 ? 38.849  -84.310  25.458  1.00 51.68  ? 197  PHE B N   1 
ATOM   4122  C  CA  . PHE B 1 194 ? 39.724  -85.415  25.040  1.00 56.05  ? 197  PHE B CA  1 
ATOM   4123  C  C   . PHE B 1 194 ? 40.363  -86.142  26.218  1.00 58.82  ? 197  PHE B C   1 
ATOM   4124  O  O   . PHE B 1 194 ? 40.564  -87.355  26.163  1.00 62.71  ? 197  PHE B O   1 
ATOM   4125  C  CB  . PHE B 1 194 ? 40.834  -84.947  24.094  1.00 55.68  ? 197  PHE B CB  1 
ATOM   4126  C  CG  . PHE B 1 194 ? 40.347  -84.467  22.757  1.00 59.70  ? 197  PHE B CG  1 
ATOM   4127  C  CD1 . PHE B 1 194 ? 39.162  -84.950  22.201  1.00 60.87  ? 197  PHE B CD1 1 
ATOM   4128  C  CD2 . PHE B 1 194 ? 41.092  -83.538  22.037  1.00 60.62  ? 197  PHE B CD2 1 
ATOM   4129  C  CE1 . PHE B 1 194 ? 38.717  -84.494  20.967  1.00 61.64  ? 197  PHE B CE1 1 
ATOM   4130  C  CE2 . PHE B 1 194 ? 40.657  -83.086  20.801  1.00 64.14  ? 197  PHE B CE2 1 
ATOM   4131  C  CZ  . PHE B 1 194 ? 39.467  -83.563  20.265  1.00 64.37  ? 197  PHE B CZ  1 
ATOM   4132  N  N   . LEU B 1 195 ? 40.688  -85.386  27.266  1.00 60.16  ? 198  LEU B N   1 
ATOM   4133  C  CA  . LEU B 1 195 ? 41.335  -85.918  28.468  1.00 62.47  ? 198  LEU B CA  1 
ATOM   4134  C  C   . LEU B 1 195 ? 40.360  -86.728  29.309  1.00 60.57  ? 198  LEU B C   1 
ATOM   4135  O  O   . LEU B 1 195 ? 40.688  -87.814  29.781  1.00 60.48  ? 198  LEU B O   1 
ATOM   4136  C  CB  . LEU B 1 195 ? 41.906  -84.766  29.310  1.00 63.73  ? 198  LEU B CB  1 
ATOM   4137  C  CG  . LEU B 1 195 ? 43.424  -84.432  29.352  1.00 64.67  ? 198  LEU B CG  1 
ATOM   4138  C  CD1 . LEU B 1 195 ? 44.138  -84.561  28.010  1.00 60.95  ? 198  LEU B CD1 1 
ATOM   4139  C  CD2 . LEU B 1 195 ? 43.592  -83.019  29.895  1.00 66.06  ? 198  LEU B CD2 1 
ATOM   4140  N  N   . ARG B 1 196 ? 39.164  -86.177  29.495  1.00 61.02  ? 199  ARG B N   1 
ATOM   4141  C  CA  . ARG B 1 196 ? 38.120  -86.790  30.304  1.00 60.92  ? 199  ARG B CA  1 
ATOM   4142  C  C   . ARG B 1 196 ? 37.547  -88.002  29.567  1.00 61.49  ? 199  ARG B C   1 
ATOM   4143  O  O   . ARG B 1 196 ? 37.032  -88.930  30.184  1.00 58.84  ? 199  ARG B O   1 
ATOM   4144  C  CB  . ARG B 1 196 ? 37.014  -85.764  30.550  1.00 61.21  ? 199  ARG B CB  1 
ATOM   4145  C  CG  . ARG B 1 196 ? 36.550  -85.636  31.990  1.00 64.76  ? 199  ARG B CG  1 
ATOM   4146  C  CD  . ARG B 1 196 ? 35.598  -86.747  32.384  1.00 68.79  ? 199  ARG B CD  1 
ATOM   4147  N  NE  . ARG B 1 196 ? 36.190  -87.657  33.361  1.00 75.04  ? 199  ARG B NE  1 
ATOM   4148  C  CZ  . ARG B 1 196 ? 36.046  -87.545  34.684  1.00 75.75  ? 199  ARG B CZ  1 
ATOM   4149  N  NH1 . ARG B 1 196 ? 35.328  -86.555  35.205  1.00 73.29  ? 199  ARG B NH1 1 
ATOM   4150  N  NH2 . ARG B 1 196 ? 36.621  -88.431  35.491  1.00 72.28  ? 199  ARG B NH2 1 
ATOM   4151  N  N   . LEU B 1 197 ? 37.633  -87.957  28.238  1.00 60.89  ? 200  LEU B N   1 
ATOM   4152  C  CA  . LEU B 1 197 ? 37.147  -89.010  27.359  1.00 61.61  ? 200  LEU B CA  1 
ATOM   4153  C  C   . LEU B 1 197 ? 38.094  -90.201  27.392  1.00 63.06  ? 200  LEU B C   1 
ATOM   4154  O  O   . LEU B 1 197 ? 37.646  -91.349  27.472  1.00 63.40  ? 200  LEU B O   1 
ATOM   4155  C  CB  . LEU B 1 197 ? 37.038  -88.477  25.928  1.00 66.45  ? 200  LEU B CB  1 
ATOM   4156  C  CG  . LEU B 1 197 ? 36.817  -89.444  24.764  1.00 68.06  ? 200  LEU B CG  1 
ATOM   4157  C  CD1 . LEU B 1 197 ? 35.374  -89.385  24.290  1.00 68.57  ? 200  LEU B CD1 1 
ATOM   4158  C  CD2 . LEU B 1 197 ? 37.797  -89.155  23.632  1.00 69.12  ? 200  LEU B CD2 1 
ATOM   4159  N  N   . ALA B 1 198 ? 39.397  -89.920  27.318  1.00 60.81  ? 201  ALA B N   1 
ATOM   4160  C  CA  . ALA B 1 198 ? 40.437  -90.949  27.427  1.00 62.76  ? 201  ALA B CA  1 
ATOM   4161  C  C   . ALA B 1 198 ? 40.411  -91.659  28.789  1.00 65.10  ? 201  ALA B C   1 
ATOM   4162  O  O   . ALA B 1 198 ? 40.721  -92.852  28.885  1.00 68.08  ? 201  ALA B O   1 
ATOM   4163  C  CB  . ALA B 1 198 ? 41.813  -90.355  27.153  1.00 59.90  ? 201  ALA B CB  1 
ATOM   4164  N  N   . ALA B 1 199 ? 40.037  -90.918  29.830  1.00 62.22  ? 202  ALA B N   1 
ATOM   4165  C  CA  . ALA B 1 199 ? 39.839  -91.481  31.154  1.00 58.98  ? 202  ALA B CA  1 
ATOM   4166  C  C   . ALA B 1 199 ? 38.357  -91.400  31.521  1.00 58.58  ? 202  ALA B C   1 
ATOM   4167  O  O   . ALA B 1 199 ? 37.999  -90.990  32.625  1.00 56.26  ? 202  ALA B O   1 
ATOM   4168  C  CB  . ALA B 1 199 ? 40.698  -90.743  32.166  1.00 59.19  ? 202  ALA B CB  1 
ATOM   4169  N  N   . LEU B 1 200 ? 37.502  -91.791  30.575  1.00 57.83  ? 203  LEU B N   1 
ATOM   4170  C  CA  . LEU B 1 200 ? 36.043  -91.799  30.752  1.00 60.59  ? 203  LEU B CA  1 
ATOM   4171  C  C   . LEU B 1 200 ? 35.579  -92.383  32.094  1.00 59.34  ? 203  LEU B C   1 
ATOM   4172  O  O   . LEU B 1 200 ? 36.180  -93.321  32.615  1.00 62.55  ? 203  LEU B O   1 
ATOM   4173  C  CB  . LEU B 1 200 ? 35.404  -92.592  29.611  1.00 61.47  ? 203  LEU B CB  1 
ATOM   4174  C  CG  . LEU B 1 200 ? 34.017  -92.287  29.022  1.00 63.28  ? 203  LEU B CG  1 
ATOM   4175  C  CD1 . LEU B 1 200 ? 33.568  -93.476  28.185  1.00 60.75  ? 203  LEU B CD1 1 
ATOM   4176  C  CD2 . LEU B 1 200 ? 32.945  -91.935  30.044  1.00 60.69  ? 203  LEU B CD2 1 
ATOM   4177  N  N   . ARG B 1 201 ? 34.514  -91.814  32.648  1.00 57.82  ? 204  ARG B N   1 
ATOM   4178  C  CA  . ARG B 1 201 ? 33.844  -92.392  33.812  1.00 57.90  ? 204  ARG B CA  1 
ATOM   4179  C  C   . ARG B 1 201 ? 32.350  -92.083  33.778  1.00 56.58  ? 204  ARG B C   1 
ATOM   4180  O  O   . ARG B 1 201 ? 31.922  -91.156  33.095  1.00 63.36  ? 204  ARG B O   1 
ATOM   4181  C  CB  . ARG B 1 201 ? 34.480  -91.907  35.125  1.00 60.79  ? 204  ARG B CB  1 
ATOM   4182  C  CG  . ARG B 1 201 ? 34.122  -90.486  35.548  1.00 62.59  ? 204  ARG B CG  1 
ATOM   4183  C  CD  . ARG B 1 201 ? 34.331  -90.282  37.045  1.00 64.53  ? 204  ARG B CD  1 
ATOM   4184  N  NE  . ARG B 1 201 ? 33.167  -90.683  37.848  1.00 64.06  ? 204  ARG B NE  1 
ATOM   4185  C  CZ  . ARG B 1 201 ? 32.535  -89.898  38.726  1.00 62.48  ? 204  ARG B CZ  1 
ATOM   4186  N  NH1 . ARG B 1 201 ? 32.949  -88.653  38.944  1.00 64.44  ? 204  ARG B NH1 1 
ATOM   4187  N  NH2 . ARG B 1 201 ? 31.488  -90.360  39.399  1.00 58.40  ? 204  ARG B NH2 1 
ATOM   4188  N  N   . THR B 1 202 ? 31.563  -92.857  34.515  1.00 54.73  ? 205  THR B N   1 
ATOM   4189  C  CA  . THR B 1 202 ? 30.108  -92.680  34.557  1.00 53.54  ? 205  THR B CA  1 
ATOM   4190  C  C   . THR B 1 202 ? 29.663  -92.029  35.865  1.00 52.78  ? 205  THR B C   1 
ATOM   4191  O  O   . THR B 1 202 ? 30.484  -91.779  36.745  1.00 56.35  ? 205  THR B O   1 
ATOM   4192  C  CB  . THR B 1 202 ? 29.384  -94.027  34.395  1.00 56.44  ? 205  THR B CB  1 
ATOM   4193  O  OG1 . THR B 1 202 ? 29.662  -94.859  35.531  1.00 56.98  ? 205  THR B OG1 1 
ATOM   4194  C  CG2 . THR B 1 202 ? 29.841  -94.729  33.116  1.00 55.93  ? 205  THR B CG2 1 
ATOM   4195  N  N   . TYR B 1 203 ? 28.366  -91.757  35.985  1.00 51.67  ? 206  TYR B N   1 
ATOM   4196  C  CA  . TYR B 1 203 ? 27.798  -91.041  37.138  1.00 54.49  ? 206  TYR B CA  1 
ATOM   4197  C  C   . TYR B 1 203 ? 26.439  -91.627  37.488  1.00 56.82  ? 206  TYR B C   1 
ATOM   4198  O  O   . TYR B 1 203 ? 25.684  -92.027  36.601  1.00 57.96  ? 206  TYR B O   1 
ATOM   4199  C  CB  . TYR B 1 203 ? 27.639  -89.536  36.841  1.00 53.76  ? 206  TYR B CB  1 
ATOM   4200  C  CG  . TYR B 1 203 ? 28.896  -88.871  36.323  1.00 52.55  ? 206  TYR B CG  1 
ATOM   4201  C  CD1 . TYR B 1 203 ? 29.275  -89.007  34.988  1.00 51.31  ? 206  TYR B CD1 1 
ATOM   4202  C  CD2 . TYR B 1 203 ? 29.706  -88.108  37.168  1.00 53.97  ? 206  TYR B CD2 1 
ATOM   4203  C  CE1 . TYR B 1 203 ? 30.429  -88.420  34.508  1.00 52.75  ? 206  TYR B CE1 1 
ATOM   4204  C  CE2 . TYR B 1 203 ? 30.864  -87.504  36.695  1.00 54.93  ? 206  TYR B CE2 1 
ATOM   4205  C  CZ  . TYR B 1 203 ? 31.220  -87.666  35.363  1.00 55.63  ? 206  TYR B CZ  1 
ATOM   4206  O  OH  . TYR B 1 203 ? 32.370  -87.084  34.870  1.00 59.44  ? 206  TYR B OH  1 
ATOM   4207  N  N   . ARG B 1 204 ? 26.115  -91.643  38.778  1.00 59.95  ? 207  ARG B N   1 
ATOM   4208  C  CA  . ARG B 1 204 ? 24.871  -92.234  39.258  1.00 61.32  ? 207  ARG B CA  1 
ATOM   4209  C  C   . ARG B 1 204 ? 23.833  -91.182  39.638  1.00 56.89  ? 207  ARG B C   1 
ATOM   4210  O  O   . ARG B 1 204 ? 24.120  -90.268  40.411  1.00 57.99  ? 207  ARG B O   1 
ATOM   4211  C  CB  . ARG B 1 204 ? 25.150  -93.146  40.459  1.00 70.73  ? 207  ARG B CB  1 
ATOM   4212  C  CG  . ARG B 1 204 ? 26.191  -94.234  40.215  1.00 76.80  ? 207  ARG B CG  1 
ATOM   4213  C  CD  . ARG B 1 204 ? 26.211  -95.255  41.345  1.00 81.99  ? 207  ARG B CD  1 
ATOM   4214  N  NE  . ARG B 1 204 ? 25.210  -96.314  41.168  1.00 87.30  ? 207  ARG B NE  1 
ATOM   4215  C  CZ  . ARG B 1 204 ? 23.964  -96.283  41.646  1.00 89.57  ? 207  ARG B CZ  1 
ATOM   4216  N  NH1 . ARG B 1 204 ? 23.523  -95.239  42.339  1.00 91.57  ? 207  ARG B NH1 1 
ATOM   4217  N  NH2 . ARG B 1 204 ? 23.150  -97.305  41.426  1.00 89.55  ? 207  ARG B NH2 1 
ATOM   4218  N  N   . GLY B 1 205 ? 22.624  -91.321  39.101  1.00 55.15  ? 208  GLY B N   1 
ATOM   4219  C  CA  . GLY B 1 205 ? 21.516  -90.420  39.448  1.00 54.43  ? 208  GLY B CA  1 
ATOM   4220  C  C   . GLY B 1 205 ? 20.162  -90.914  38.972  1.00 54.08  ? 208  GLY B C   1 
ATOM   4221  O  O   . GLY B 1 205 ? 20.077  -91.946  38.309  1.00 55.45  ? 208  GLY B O   1 
ATOM   4222  N  N   . ARG B 1 206 ? 19.103  -90.184  39.321  1.00 55.03  ? 209  ARG B N   1 
ATOM   4223  C  CA  . ARG B 1 206 ? 17.745  -90.493  38.850  1.00 56.45  ? 209  ARG B CA  1 
ATOM   4224  C  C   . ARG B 1 206 ? 17.153  -89.323  38.051  1.00 55.06  ? 209  ARG B C   1 
ATOM   4225  O  O   . ARG B 1 206 ? 16.923  -88.233  38.595  1.00 58.22  ? 209  ARG B O   1 
ATOM   4226  C  CB  . ARG B 1 206 ? 16.815  -90.904  40.009  1.00 61.31  ? 209  ARG B CB  1 
ATOM   4227  C  CG  . ARG B 1 206 ? 15.342  -91.005  39.619  1.00 67.61  ? 209  ARG B CG  1 
ATOM   4228  C  CD  . ARG B 1 206 ? 14.424  -91.480  40.741  1.00 73.27  ? 209  ARG B CD  1 
ATOM   4229  N  NE  . ARG B 1 206 ? 13.903  -92.832  40.502  1.00 79.74  ? 209  ARG B NE  1 
ATOM   4230  C  CZ  . ARG B 1 206 ? 13.935  -93.836  41.382  1.00 81.65  ? 209  ARG B CZ  1 
ATOM   4231  N  NH1 . ARG B 1 206 ? 14.453  -93.661  42.595  1.00 79.59  ? 209  ARG B NH1 1 
ATOM   4232  N  NH2 . ARG B 1 206 ? 13.431  -95.021  41.054  1.00 80.61  ? 209  ARG B NH2 1 
ATOM   4233  N  N   . LEU B 1 207 ? 16.906  -89.579  36.764  1.00 51.53  ? 210  LEU B N   1 
ATOM   4234  C  CA  . LEU B 1 207 ? 16.330  -88.618  35.819  1.00 48.23  ? 210  LEU B CA  1 
ATOM   4235  C  C   . LEU B 1 207 ? 14.825  -88.831  35.630  1.00 49.28  ? 210  LEU B C   1 
ATOM   4236  O  O   . LEU B 1 207 ? 14.350  -89.959  35.445  1.00 51.50  ? 210  LEU B O   1 
ATOM   4237  C  CB  . LEU B 1 207 ? 17.018  -88.754  34.452  1.00 45.37  ? 210  LEU B CB  1 
ATOM   4238  C  CG  . LEU B 1 207 ? 17.297  -87.529  33.553  1.00 44.69  ? 210  LEU B CG  1 
ATOM   4239  C  CD1 . LEU B 1 207 ? 17.629  -87.966  32.131  1.00 38.89  ? 210  LEU B CD1 1 
ATOM   4240  C  CD2 . LEU B 1 207 ? 16.185  -86.485  33.548  1.00 41.64  ? 210  LEU B CD2 1 
ATOM   4241  N  N   . ALA B 1 208 ? 14.082  -87.737  35.668  1.00 46.74  ? 211  ALA B N   1 
ATOM   4242  C  CA  . ALA B 1 208 ? 12.674  -87.749  35.304  1.00 47.98  ? 211  ALA B CA  1 
ATOM   4243  C  C   . ALA B 1 208 ? 12.373  -86.492  34.484  1.00 47.60  ? 211  ALA B C   1 
ATOM   4244  O  O   . ALA B 1 208 ? 12.984  -85.453  34.715  1.00 52.77  ? 211  ALA B O   1 
ATOM   4245  C  CB  . ALA B 1 208 ? 11.809  -87.806  36.551  1.00 44.94  ? 211  ALA B CB  1 
ATOM   4246  N  N   . TYR B 1 209 ? 11.454  -86.588  33.527  1.00 47.94  ? 212  TYR B N   1 
ATOM   4247  C  CA  . TYR B 1 209 ? 11.093  -85.450  32.669  1.00 47.09  ? 212  TYR B CA  1 
ATOM   4248  C  C   . TYR B 1 209 ? 9.632   -85.457  32.271  1.00 46.40  ? 212  TYR B C   1 
ATOM   4249  O  O   . TYR B 1 209 ? 8.992   -86.509  32.269  1.00 49.31  ? 212  TYR B O   1 
ATOM   4250  C  CB  . TYR B 1 209 ? 11.961  -85.404  31.404  1.00 48.23  ? 212  TYR B CB  1 
ATOM   4251  C  CG  . TYR B 1 209 ? 11.882  -86.625  30.504  1.00 48.91  ? 212  TYR B CG  1 
ATOM   4252  C  CD1 . TYR B 1 209 ? 12.902  -87.576  30.505  1.00 48.58  ? 212  TYR B CD1 1 
ATOM   4253  C  CD2 . TYR B 1 209 ? 10.805  -86.814  29.633  1.00 50.57  ? 212  TYR B CD2 1 
ATOM   4254  C  CE1 . TYR B 1 209 ? 12.848  -88.688  29.679  1.00 48.79  ? 212  TYR B CE1 1 
ATOM   4255  C  CE2 . TYR B 1 209 ? 10.735  -87.927  28.807  1.00 49.15  ? 212  TYR B CE2 1 
ATOM   4256  C  CZ  . TYR B 1 209 ? 11.759  -88.862  28.836  1.00 51.25  ? 212  TYR B CZ  1 
ATOM   4257  O  OH  . TYR B 1 209 ? 11.708  -89.973  28.015  1.00 53.47  ? 212  TYR B OH  1 
ATOM   4258  N  N   . LEU B 1 210 ? 9.112   -84.276  31.946  1.00 45.54  ? 213  LEU B N   1 
ATOM   4259  C  CA  . LEU B 1 210 ? 7.782   -84.142  31.367  1.00 45.39  ? 213  LEU B CA  1 
ATOM   4260  C  C   . LEU B 1 210 ? 7.931   -83.767  29.895  1.00 47.23  ? 213  LEU B C   1 
ATOM   4261  O  O   . LEU B 1 210 ? 8.277   -82.623  29.580  1.00 48.69  ? 213  LEU B O   1 
ATOM   4262  C  CB  . LEU B 1 210 ? 6.925   -83.119  32.133  1.00 46.39  ? 213  LEU B CB  1 
ATOM   4263  C  CG  . LEU B 1 210 ? 5.510   -82.777  31.615  1.00 47.44  ? 213  LEU B CG  1 
ATOM   4264  C  CD1 . LEU B 1 210 ? 4.649   -84.006  31.333  1.00 46.85  ? 213  LEU B CD1 1 
ATOM   4265  C  CD2 . LEU B 1 210 ? 4.775   -81.828  32.553  1.00 45.12  ? 213  LEU B CD2 1 
ATOM   4266  N  N   . PRO B 1 211 ? 7.692   -84.740  28.988  1.00 47.04  ? 214  PRO B N   1 
ATOM   4267  C  CA  . PRO B 1 211 ? 7.805   -84.539  27.534  1.00 44.99  ? 214  PRO B CA  1 
ATOM   4268  C  C   . PRO B 1 211 ? 6.679   -83.661  27.006  1.00 45.26  ? 214  PRO B C   1 
ATOM   4269  O  O   . PRO B 1 211 ? 5.624   -83.587  27.639  1.00 44.12  ? 214  PRO B O   1 
ATOM   4270  C  CB  . PRO B 1 211 ? 7.655   -85.955  26.976  1.00 46.61  ? 214  PRO B CB  1 
ATOM   4271  C  CG  . PRO B 1 211 ? 6.820   -86.671  27.986  1.00 47.64  ? 214  PRO B CG  1 
ATOM   4272  C  CD  . PRO B 1 211 ? 7.221   -86.100  29.320  1.00 46.66  ? 214  PRO B CD  1 
ATOM   4273  N  N   . VAL B 1 212 ? 6.917   -83.018  25.857  1.00 44.03  ? 215  VAL B N   1 
ATOM   4274  C  CA  . VAL B 1 212 ? 5.979   -82.081  25.199  1.00 44.09  ? 215  VAL B CA  1 
ATOM   4275  C  C   . VAL B 1 212 ? 4.519   -82.548  25.098  1.00 44.93  ? 215  VAL B C   1 
ATOM   4276  O  O   . VAL B 1 212 ? 3.602   -81.748  25.240  1.00 44.98  ? 215  VAL B O   1 
ATOM   4277  C  CB  . VAL B 1 212 ? 6.485   -81.679  23.781  1.00 41.18  ? 215  VAL B CB  1 
ATOM   4278  C  CG1 . VAL B 1 212 ? 5.437   -80.862  23.043  1.00 39.98  ? 215  VAL B CG1 1 
ATOM   4279  C  CG2 . VAL B 1 212 ? 7.777   -80.883  23.876  1.00 40.68  ? 215  VAL B CG2 1 
ATOM   4280  N  N   . GLY B 1 213 ? 4.303   -83.828  24.818  1.00 50.00  ? 216  GLY B N   1 
ATOM   4281  C  CA  . GLY B 1 213 ? 2.947   -84.390  24.862  1.00 58.55  ? 216  GLY B CA  1 
ATOM   4282  C  C   . GLY B 1 213 ? 2.366   -84.441  26.268  1.00 63.95  ? 216  GLY B C   1 
ATOM   4283  O  O   . GLY B 1 213 ? 3.086   -84.272  27.252  1.00 62.84  ? 216  GLY B O   1 
ATOM   4284  N  N   . ARG B 1 214 ? 1.062   -84.690  26.362  1.00 72.19  ? 217  ARG B N   1 
ATOM   4285  C  CA  . ARG B 1 214 ? 0.325   -84.744  27.653  1.00 80.50  ? 217  ARG B CA  1 
ATOM   4286  C  C   . ARG B 1 214 ? 0.387   -83.483  28.545  1.00 87.11  ? 217  ARG B C   1 
ATOM   4287  O  O   . ARG B 1 214 ? 1.275   -83.330  29.397  1.00 83.65  ? 217  ARG B O   1 
ATOM   4288  C  CB  . ARG B 1 214 ? 0.573   -86.055  28.454  1.00 76.40  ? 217  ARG B CB  1 
ATOM   4289  C  CG  . ARG B 1 214 ? 2.020   -86.502  28.651  1.00 70.27  ? 217  ARG B CG  1 
ATOM   4290  C  CD  . ARG B 1 214 ? 2.100   -87.819  29.416  1.00 66.31  ? 217  ARG B CD  1 
ATOM   4291  N  NE  . ARG B 1 214 ? 3.132   -88.719  28.889  1.00 61.86  ? 217  ARG B NE  1 
ATOM   4292  C  CZ  . ARG B 1 214 ? 4.368   -88.853  29.373  1.00 59.04  ? 217  ARG B CZ  1 
ATOM   4293  N  NH1 . ARG B 1 214 ? 5.215   -89.703  28.805  1.00 52.58  ? 217  ARG B NH1 1 
ATOM   4294  N  NH2 . ARG B 1 214 ? 4.770   -88.144  30.419  1.00 58.42  ? 217  ARG B NH2 1 
ATOM   4295  N  N   . VAL B 1 215 ? -0.589  -82.597  28.300  1.00 94.31  ? 218  VAL B N   1 
ATOM   4296  C  CA  . VAL B 1 215 ? -0.851  -81.335  29.033  1.00 91.61  ? 218  VAL B CA  1 
ATOM   4297  C  C   . VAL B 1 215 ? 0.367   -80.675  29.697  1.00 91.49  ? 218  VAL B C   1 
ATOM   4298  O  O   . VAL B 1 215 ? 1.246   -80.147  29.014  1.00 87.26  ? 218  VAL B O   1 
ATOM   4299  C  CB  . VAL B 1 215 ? -2.049  -81.480  30.023  1.00 90.84  ? 218  VAL B CB  1 
ATOM   4300  C  CG1 . VAL B 1 215 ? -1.650  -82.239  31.290  1.00 91.89  ? 218  VAL B CG1 1 
ATOM   4301  C  CG2 . VAL B 1 215 ? -2.674  -80.125  30.341  1.00 87.85  ? 218  VAL B CG2 1 
ATOM   4302  N  N   . GLN B 1 228 ? 8.567   -63.892  45.037  1.00 82.32  ? 231  GLN B N   1 
ATOM   4303  C  CA  . GLN B 1 228 ? 7.420   -64.366  44.276  1.00 81.52  ? 231  GLN B CA  1 
ATOM   4304  C  C   . GLN B 1 228 ? 7.877   -65.250  43.115  1.00 81.36  ? 231  GLN B C   1 
ATOM   4305  O  O   . GLN B 1 228 ? 7.934   -66.476  43.250  1.00 82.29  ? 231  GLN B O   1 
ATOM   4306  C  CB  . GLN B 1 228 ? 6.582   -63.183  43.766  1.00 82.09  ? 231  GLN B CB  1 
ATOM   4307  C  CG  . GLN B 1 228 ? 5.188   -63.566  43.287  1.00 83.70  ? 231  GLN B CG  1 
ATOM   4308  C  CD  . GLN B 1 228 ? 4.238   -63.871  44.431  1.00 84.45  ? 231  GLN B CD  1 
ATOM   4309  O  OE1 . GLN B 1 228 ? 4.066   -65.027  44.824  1.00 81.94  ? 231  GLN B OE1 1 
ATOM   4310  N  NE2 . GLN B 1 228 ? 3.623   -62.828  44.980  1.00 83.59  ? 231  GLN B NE2 1 
ATOM   4311  N  N   . GLY B 1 229 ? 8.207   -64.621  41.986  1.00 76.12  ? 232  GLY B N   1 
ATOM   4312  C  CA  . GLY B 1 229 ? 8.623   -65.330  40.775  1.00 67.39  ? 232  GLY B CA  1 
ATOM   4313  C  C   . GLY B 1 229 ? 7.476   -65.849  39.913  1.00 61.47  ? 232  GLY B C   1 
ATOM   4314  O  O   . GLY B 1 229 ? 6.295   -65.653  40.234  1.00 59.64  ? 232  GLY B O   1 
ATOM   4315  N  N   . PRO B 1 230 ? 7.812   -66.503  38.790  1.00 57.48  ? 233  PRO B N   1 
ATOM   4316  C  CA  . PRO B 1 230 ? 6.768   -67.158  38.012  1.00 55.87  ? 233  PRO B CA  1 
ATOM   4317  C  C   . PRO B 1 230 ? 6.386   -68.461  38.695  1.00 52.74  ? 233  PRO B C   1 
ATOM   4318  O  O   . PRO B 1 230 ? 7.261   -69.204  39.147  1.00 49.47  ? 233  PRO B O   1 
ATOM   4319  C  CB  . PRO B 1 230 ? 7.440   -67.447  36.660  1.00 53.29  ? 233  PRO B CB  1 
ATOM   4320  C  CG  . PRO B 1 230 ? 8.825   -66.893  36.751  1.00 54.00  ? 233  PRO B CG  1 
ATOM   4321  C  CD  . PRO B 1 230 ? 9.144   -66.692  38.197  1.00 54.16  ? 233  PRO B CD  1 
ATOM   4322  N  N   . VAL B 1 231 ? 5.087   -68.717  38.793  1.00 53.87  ? 234  VAL B N   1 
ATOM   4323  C  CA  . VAL B 1 231 ? 4.599   -69.979  39.351  1.00 53.75  ? 234  VAL B CA  1 
ATOM   4324  C  C   . VAL B 1 231 ? 4.989   -71.122  38.409  1.00 49.39  ? 234  VAL B C   1 
ATOM   4325  O  O   . VAL B 1 231 ? 4.678   -71.087  37.216  1.00 46.70  ? 234  VAL B O   1 
ATOM   4326  C  CB  . VAL B 1 231 ? 3.069   -69.934  39.667  1.00 55.85  ? 234  VAL B CB  1 
ATOM   4327  C  CG1 . VAL B 1 231 ? 2.290   -69.171  38.594  1.00 58.51  ? 234  VAL B CG1 1 
ATOM   4328  C  CG2 . VAL B 1 231 ? 2.496   -71.328  39.892  1.00 51.84  ? 234  VAL B CG2 1 
ATOM   4329  N  N   . ASP B 1 232 ? 5.717   -72.098  38.948  1.00 47.84  ? 235  ASP B N   1 
ATOM   4330  C  CA  . ASP B 1 232 ? 6.106   -73.292  38.196  1.00 46.76  ? 235  ASP B CA  1 
ATOM   4331  C  C   . ASP B 1 232 ? 5.035   -74.387  38.325  1.00 47.41  ? 235  ASP B C   1 
ATOM   4332  O  O   . ASP B 1 232 ? 5.221   -75.373  39.043  1.00 45.74  ? 235  ASP B O   1 
ATOM   4333  C  CB  . ASP B 1 232 ? 7.485   -73.804  38.648  1.00 45.57  ? 235  ASP B CB  1 
ATOM   4334  C  CG  . ASP B 1 232 ? 8.627   -72.900  38.207  1.00 45.72  ? 235  ASP B CG  1 
ATOM   4335  O  OD1 . ASP B 1 232 ? 8.516   -72.259  37.151  1.00 48.03  ? 235  ASP B OD1 1 
ATOM   4336  O  OD2 . ASP B 1 232 ? 9.655   -72.834  38.903  1.00 45.30  ? 235  ASP B OD2 1 
ATOM   4337  N  N   . ALA B 1 233 ? 3.929   -74.208  37.599  1.00 50.52  ? 236  ALA B N   1 
ATOM   4338  C  CA  . ALA B 1 233 ? 2.756   -75.105  37.652  1.00 53.98  ? 236  ALA B CA  1 
ATOM   4339  C  C   . ALA B 1 233 ? 3.022   -76.611  37.476  1.00 57.09  ? 236  ALA B C   1 
ATOM   4340  O  O   . ALA B 1 233 ? 2.248   -77.435  37.969  1.00 61.07  ? 236  ALA B O   1 
ATOM   4341  C  CB  . ALA B 1 233 ? 1.697   -74.646  36.658  1.00 51.88  ? 236  ALA B CB  1 
ATOM   4342  N  N   . HIS B 1 234 ? 4.100   -76.962  36.778  1.00 57.25  ? 237  HIS B N   1 
ATOM   4343  C  CA  . HIS B 1 234 ? 4.394   -78.362  36.439  1.00 54.98  ? 237  HIS B CA  1 
ATOM   4344  C  C   . HIS B 1 234 ? 5.146   -79.101  37.504  1.00 52.42  ? 237  HIS B C   1 
ATOM   4345  O  O   . HIS B 1 234 ? 5.182   -80.330  37.503  1.00 50.26  ? 237  HIS B O   1 
ATOM   4346  C  CB  . HIS B 1 234 ? 5.153   -78.453  35.115  1.00 52.78  ? 237  HIS B CB  1 
ATOM   4347  C  CG  . HIS B 1 234 ? 4.309   -78.125  33.910  1.00 52.56  ? 237  HIS B CG  1 
ATOM   4348  N  ND1 . HIS B 1 234 ? 4.661   -77.184  33.011  1.00 51.57  ? 237  HIS B ND1 1 
ATOM   4349  C  CD2 . HIS B 1 234 ? 3.083   -78.642  33.482  1.00 51.38  ? 237  HIS B CD2 1 
ATOM   4350  C  CE1 . HIS B 1 234 ? 3.716   -77.105  32.052  1.00 50.81  ? 237  HIS B CE1 1 
ATOM   4351  N  NE2 . HIS B 1 234 ? 2.748   -77.995  32.345  1.00 52.14  ? 237  HIS B NE2 1 
ATOM   4352  N  N   . LEU B 1 235 ? 5.752   -78.363  38.425  1.00 52.13  ? 238  LEU B N   1 
ATOM   4353  C  CA  . LEU B 1 235 ? 6.597   -78.978  39.442  1.00 52.63  ? 238  LEU B CA  1 
ATOM   4354  C  C   . LEU B 1 235 ? 5.865   -79.237  40.762  1.00 49.88  ? 238  LEU B C   1 
ATOM   4355  O  O   . LEU B 1 235 ? 4.999   -78.469  41.172  1.00 48.40  ? 238  LEU B O   1 
ATOM   4356  C  CB  . LEU B 1 235 ? 7.854   -78.130  39.673  1.00 52.40  ? 238  LEU B CB  1 
ATOM   4357  C  CG  . LEU B 1 235 ? 8.669   -77.802  38.415  1.00 53.08  ? 238  LEU B CG  1 
ATOM   4358  C  CD1 . LEU B 1 235 ? 9.802   -76.821  38.708  1.00 50.22  ? 238  LEU B CD1 1 
ATOM   4359  C  CD2 . LEU B 1 235 ? 9.199   -79.074  37.767  1.00 51.30  ? 238  LEU B CD2 1 
ATOM   4360  N  N   . VAL B 1 236 ? 6.209   -80.343  41.408  1.00 50.83  ? 239  VAL B N   1 
ATOM   4361  C  CA  . VAL B 1 236 ? 5.812   -80.575  42.794  1.00 52.65  ? 239  VAL B CA  1 
ATOM   4362  C  C   . VAL B 1 236 ? 7.086   -80.498  43.635  1.00 55.28  ? 239  VAL B C   1 
ATOM   4363  O  O   . VAL B 1 236 ? 8.192   -80.667  43.091  1.00 51.34  ? 239  VAL B O   1 
ATOM   4364  C  CB  . VAL B 1 236 ? 5.089   -81.931  42.991  1.00 51.84  ? 239  VAL B CB  1 
ATOM   4365  C  CG1 . VAL B 1 236 ? 3.790   -81.966  42.197  1.00 49.94  ? 239  VAL B CG1 1 
ATOM   4366  C  CG2 . VAL B 1 236 ? 5.998   -83.101  42.631  1.00 51.45  ? 239  VAL B CG2 1 
ATOM   4367  N  N   . PRO B 1 237 ? 6.946   -80.231  44.951  1.00 57.54  ? 240  PRO B N   1 
ATOM   4368  C  CA  . PRO B 1 237 ? 8.120   -80.105  45.826  1.00 59.13  ? 240  PRO B CA  1 
ATOM   4369  C  C   . PRO B 1 237 ? 9.055   -81.300  45.716  1.00 58.59  ? 240  PRO B C   1 
ATOM   4370  O  O   . PRO B 1 237 ? 8.591   -82.430  45.585  1.00 57.56  ? 240  PRO B O   1 
ATOM   4371  C  CB  . PRO B 1 237 ? 7.506   -80.031  47.225  1.00 60.01  ? 240  PRO B CB  1 
ATOM   4372  C  CG  . PRO B 1 237 ? 6.169   -79.405  46.998  1.00 60.13  ? 240  PRO B CG  1 
ATOM   4373  C  CD  . PRO B 1 237 ? 5.691   -79.916  45.665  1.00 57.52  ? 240  PRO B CD  1 
ATOM   4374  N  N   . LEU B 1 238 ? 10.359  -81.040  45.763  1.00 61.36  ? 241  LEU B N   1 
ATOM   4375  C  CA  . LEU B 1 238 ? 11.383  -82.081  45.597  1.00 68.77  ? 241  LEU B CA  1 
ATOM   4376  C  C   . LEU B 1 238 ? 11.232  -83.265  46.555  1.00 72.85  ? 241  LEU B C   1 
ATOM   4377  O  O   . LEU B 1 238 ? 11.699  -84.368  46.259  1.00 74.40  ? 241  LEU B O   1 
ATOM   4378  C  CB  . LEU B 1 238 ? 12.789  -81.485  45.736  1.00 68.80  ? 241  LEU B CB  1 
ATOM   4379  C  CG  . LEU B 1 238 ? 13.311  -80.568  44.629  1.00 67.52  ? 241  LEU B CG  1 
ATOM   4380  C  CD1 . LEU B 1 238 ? 14.286  -79.549  45.199  1.00 67.72  ? 241  LEU B CD1 1 
ATOM   4381  C  CD2 . LEU B 1 238 ? 13.964  -81.377  43.522  1.00 67.00  ? 241  LEU B CD2 1 
ATOM   4382  N  N   . GLU B 1 239 ? 10.592  -83.023  47.700  1.00 78.38  ? 242  GLU B N   1 
ATOM   4383  C  CA  . GLU B 1 239 ? 10.288  -84.068  48.682  1.00 80.69  ? 242  GLU B CA  1 
ATOM   4384  C  C   . GLU B 1 239 ? 9.321   -85.074  48.076  1.00 78.50  ? 242  GLU B C   1 
ATOM   4385  O  O   . GLU B 1 239 ? 9.615   -86.269  48.018  1.00 79.65  ? 242  GLU B O   1 
ATOM   4386  C  CB  . GLU B 1 239 ? 9.695   -83.467  49.962  1.00 84.12  ? 242  GLU B CB  1 
ATOM   4387  C  CG  . GLU B 1 239 ? 10.679  -82.648  50.791  1.00 89.68  ? 242  GLU B CG  1 
ATOM   4388  C  CD  . GLU B 1 239 ? 11.065  -81.338  50.125  1.00 91.08  ? 242  GLU B CD  1 
ATOM   4389  O  OE1 . GLU B 1 239 ? 10.152  -80.610  49.671  1.00 92.36  ? 242  GLU B OE1 1 
ATOM   4390  O  OE2 . GLU B 1 239 ? 12.280  -81.041  50.050  1.00 86.72  ? 242  GLU B OE2 1 
ATOM   4391  N  N   . GLU B 1 240 ? 8.178   -84.575  47.613  1.00 74.59  ? 243  GLU B N   1 
ATOM   4392  C  CA  . GLU B 1 240 ? 7.206   -85.382  46.884  1.00 76.55  ? 243  GLU B CA  1 
ATOM   4393  C  C   . GLU B 1 240 ? 7.858   -86.169  45.744  1.00 74.27  ? 243  GLU B C   1 
ATOM   4394  O  O   . GLU B 1 240 ? 8.820   -85.692  45.133  1.00 70.95  ? 243  GLU B O   1 
ATOM   4395  C  CB  . GLU B 1 240 ? 6.114   -84.483  46.300  1.00 79.10  ? 243  GLU B CB  1 
ATOM   4396  C  CG  . GLU B 1 240 ? 5.146   -83.909  47.321  1.00 84.74  ? 243  GLU B CG  1 
ATOM   4397  C  CD  . GLU B 1 240 ? 4.001   -84.851  47.635  1.00 89.95  ? 243  GLU B CD  1 
ATOM   4398  O  OE1 . GLU B 1 240 ? 4.025   -86.008  47.160  1.00 89.35  ? 243  GLU B OE1 1 
ATOM   4399  O  OE2 . GLU B 1 240 ? 3.070   -84.434  48.358  1.00 92.16  ? 243  GLU B OE2 1 
ATOM   4400  N  N   . PRO B 1 241 ? 7.341   -87.384  45.462  1.00 74.01  ? 244  PRO B N   1 
ATOM   4401  C  CA  . PRO B 1 241 ? 7.711   -88.068  44.224  1.00 71.66  ? 244  PRO B CA  1 
ATOM   4402  C  C   . PRO B 1 241 ? 7.083   -87.343  43.038  1.00 71.03  ? 244  PRO B C   1 
ATOM   4403  O  O   . PRO B 1 241 ? 5.992   -86.767  43.168  1.00 70.92  ? 244  PRO B O   1 
ATOM   4404  C  CB  . PRO B 1 241 ? 7.075   -89.449  44.384  1.00 69.72  ? 244  PRO B CB  1 
ATOM   4405  C  CG  . PRO B 1 241 ? 5.915   -89.223  45.293  1.00 70.89  ? 244  PRO B CG  1 
ATOM   4406  C  CD  . PRO B 1 241 ? 6.397   -88.185  46.265  1.00 72.92  ? 244  PRO B CD  1 
ATOM   4407  N  N   . VAL B 1 242 ? 7.765   -87.362  41.899  1.00 67.25  ? 245  VAL B N   1 
ATOM   4408  C  CA  . VAL B 1 242 ? 7.247   -86.727  40.687  1.00 67.29  ? 245  VAL B CA  1 
ATOM   4409  C  C   . VAL B 1 242 ? 5.825   -87.211  40.384  1.00 65.35  ? 245  VAL B C   1 
ATOM   4410  O  O   . VAL B 1 242 ? 5.478   -88.339  40.731  1.00 66.69  ? 245  VAL B O   1 
ATOM   4411  C  CB  . VAL B 1 242 ? 8.175   -86.969  39.475  1.00 70.23  ? 245  VAL B CB  1 
ATOM   4412  C  CG1 . VAL B 1 242 ? 9.445   -86.138  39.608  1.00 72.18  ? 245  VAL B CG1 1 
ATOM   4413  C  CG2 . VAL B 1 242 ? 8.520   -88.447  39.332  1.00 70.65  ? 245  VAL B CG2 1 
ATOM   4414  N  N   . PRO B 1 243 ? 4.986   -86.354  39.763  1.00 64.70  ? 246  PRO B N   1 
ATOM   4415  C  CA  . PRO B 1 243 ? 3.644   -86.818  39.391  1.00 62.72  ? 246  PRO B CA  1 
ATOM   4416  C  C   . PRO B 1 243 ? 3.683   -88.060  38.489  1.00 62.84  ? 246  PRO B C   1 
ATOM   4417  O  O   . PRO B 1 243 ? 4.695   -88.324  37.822  1.00 58.64  ? 246  PRO B O   1 
ATOM   4418  C  CB  . PRO B 1 243 ? 3.051   -85.619  38.648  1.00 61.96  ? 246  PRO B CB  1 
ATOM   4419  C  CG  . PRO B 1 243 ? 3.762   -84.446  39.223  1.00 62.61  ? 246  PRO B CG  1 
ATOM   4420  C  CD  . PRO B 1 243 ? 5.164   -84.918  39.480  1.00 61.63  ? 246  PRO B CD  1 
ATOM   4421  N  N   . SER B 1 244 ? 2.583   -88.811  38.491  1.00 63.55  ? 247  SER B N   1 
ATOM   4422  C  CA  . SER B 1 244 ? 2.494   -90.102  37.799  1.00 64.68  ? 247  SER B CA  1 
ATOM   4423  C  C   . SER B 1 244 ? 2.710   -90.000  36.291  1.00 61.91  ? 247  SER B C   1 
ATOM   4424  O  O   . SER B 1 244 ? 3.366   -90.858  35.693  1.00 59.69  ? 247  SER B O   1 
ATOM   4425  C  CB  . SER B 1 244 ? 1.141   -90.762  38.083  1.00 64.57  ? 247  SER B CB  1 
ATOM   4426  O  OG  . SER B 1 244 ? 0.071   -89.893  37.744  1.00 65.87  ? 247  SER B OG  1 
ATOM   4427  N  N   . HIS B 1 245 ? 2.169   -88.942  35.690  1.00 59.81  ? 248  HIS B N   1 
ATOM   4428  C  CA  . HIS B 1 245 ? 2.180   -88.789  34.236  1.00 57.08  ? 248  HIS B CA  1 
ATOM   4429  C  C   . HIS B 1 245 ? 3.528   -88.464  33.636  1.00 56.32  ? 248  HIS B C   1 
ATOM   4430  O  O   . HIS B 1 245 ? 3.642   -88.324  32.424  1.00 60.30  ? 248  HIS B O   1 
ATOM   4431  C  CB  . HIS B 1 245 ? 1.079   -87.826  33.775  1.00 59.57  ? 248  HIS B CB  1 
ATOM   4432  C  CG  . HIS B 1 245 ? 1.330   -86.369  34.116  1.00 60.03  ? 248  HIS B CG  1 
ATOM   4433  N  ND1 . HIS B 1 245 ? 1.949   -85.977  35.246  1.00 61.35  ? 248  HIS B ND1 1 
ATOM   4434  C  CD2 . HIS B 1 245 ? 0.979   -85.201  33.435  1.00 59.96  ? 248  HIS B CD2 1 
ATOM   4435  C  CE1 . HIS B 1 245 ? 2.017   -84.631  35.276  1.00 60.57  ? 248  HIS B CE1 1 
ATOM   4436  N  NE2 . HIS B 1 245 ? 1.422   -84.159  34.167  1.00 61.88  ? 248  HIS B NE2 1 
ATOM   4437  N  N   . TRP B 1 246 ? 4.560   -88.351  34.471  1.00 52.04  ? 249  TRP B N   1 
ATOM   4438  C  CA  . TRP B 1 246 ? 5.927   -88.116  34.003  1.00 48.51  ? 249  TRP B CA  1 
ATOM   4439  C  C   . TRP B 1 246 ? 6.597   -89.390  33.621  1.00 51.29  ? 249  TRP B C   1 
ATOM   4440  O  O   . TRP B 1 246 ? 6.297   -90.451  34.169  1.00 56.30  ? 249  TRP B O   1 
ATOM   4441  C  CB  . TRP B 1 246 ? 6.780   -87.504  35.104  1.00 44.87  ? 249  TRP B CB  1 
ATOM   4442  C  CG  . TRP B 1 246 ? 6.595   -86.035  35.368  1.00 42.83  ? 249  TRP B CG  1 
ATOM   4443  C  CD1 . TRP B 1 246 ? 5.417   -85.296  35.327  1.00 42.57  ? 249  TRP B CD1 1 
ATOM   4444  C  CD2 . TRP B 1 246 ? 7.632   -85.080  35.781  1.00 42.68  ? 249  TRP B CD2 1 
ATOM   4445  N  NE1 . TRP B 1 246 ? 5.651   -83.986  35.659  1.00 43.23  ? 249  TRP B NE1 1 
ATOM   4446  C  CE2 . TRP B 1 246 ? 6.958   -83.790  35.947  1.00 41.72  ? 249  TRP B CE2 1 
ATOM   4447  C  CE3 . TRP B 1 246 ? 9.004   -85.165  36.020  1.00 43.75  ? 249  TRP B CE3 1 
ATOM   4448  C  CZ2 . TRP B 1 246 ? 7.644   -82.644  36.332  1.00 41.88  ? 249  TRP B CZ2 1 
ATOM   4449  C  CZ3 . TRP B 1 246 ? 9.687   -84.003  36.410  1.00 43.66  ? 249  TRP B CZ3 1 
ATOM   4450  C  CH2 . TRP B 1 246 ? 9.020   -82.774  36.561  1.00 43.54  ? 249  TRP B CH2 1 
ATOM   4451  N  N   . THR B 1 247 ? 7.549   -89.289  32.702  1.00 50.85  ? 250  THR B N   1 
ATOM   4452  C  CA  . THR B 1 247 ? 8.457   -90.382  32.422  1.00 51.41  ? 250  THR B CA  1 
ATOM   4453  C  C   . THR B 1 247 ? 9.570   -90.371  33.465  1.00 53.37  ? 250  THR B C   1 
ATOM   4454  O  O   . THR B 1 247 ? 10.149  -89.319  33.748  1.00 53.18  ? 250  THR B O   1 
ATOM   4455  C  CB  . THR B 1 247 ? 9.061   -90.258  31.008  1.00 49.68  ? 250  THR B CB  1 
ATOM   4456  O  OG1 . THR B 1 247 ? 8.006   -90.263  30.037  1.00 47.58  ? 250  THR B OG1 1 
ATOM   4457  C  CG2 . THR B 1 247 ? 10.035  -91.399  30.720  1.00 48.69  ? 250  THR B CG2 1 
ATOM   4458  N  N   . VAL B 1 248 ? 9.838   -91.540  34.047  1.00 54.48  ? 251  VAL B N   1 
ATOM   4459  C  CA  . VAL B 1 248 ? 11.002  -91.753  34.912  1.00 54.59  ? 251  VAL B CA  1 
ATOM   4460  C  C   . VAL B 1 248 ? 11.956  -92.682  34.166  1.00 56.68  ? 251  VAL B C   1 
ATOM   4461  O  O   . VAL B 1 248 ? 11.583  -93.783  33.763  1.00 59.06  ? 251  VAL B O   1 
ATOM   4462  C  CB  . VAL B 1 248 ? 10.623  -92.354  36.296  1.00 52.83  ? 251  VAL B CB  1 
ATOM   4463  C  CG1 . VAL B 1 248 ? 11.838  -92.402  37.210  1.00 51.65  ? 251  VAL B CG1 1 
ATOM   4464  C  CG2 . VAL B 1 248 ? 9.517   -91.547  36.962  1.00 49.65  ? 251  VAL B CG2 1 
ATOM   4465  N  N   . VAL B 1 249 ? 13.187  -92.233  33.967  1.00 59.71  ? 252  VAL B N   1 
ATOM   4466  C  CA  . VAL B 1 249 ? 14.143  -93.013  33.194  1.00 61.60  ? 252  VAL B CA  1 
ATOM   4467  C  C   . VAL B 1 249 ? 14.505  -94.281  33.983  1.00 64.63  ? 252  VAL B C   1 
ATOM   4468  O  O   . VAL B 1 249 ? 14.796  -94.203  35.178  1.00 62.33  ? 252  VAL B O   1 
ATOM   4469  C  CB  . VAL B 1 249 ? 15.382  -92.173  32.797  1.00 57.73  ? 252  VAL B CB  1 
ATOM   4470  C  CG1 . VAL B 1 249 ? 16.346  -92.984  31.948  1.00 52.81  ? 252  VAL B CG1 1 
ATOM   4471  C  CG2 . VAL B 1 249 ? 14.951  -90.930  32.028  1.00 58.18  ? 252  VAL B CG2 1 
ATOM   4472  N  N   . PRO B 1 250 ? 14.426  -95.458  33.326  1.00 68.52  ? 253  PRO B N   1 
ATOM   4473  C  CA  . PRO B 1 250 ? 14.809  -96.716  33.975  1.00 70.23  ? 253  PRO B CA  1 
ATOM   4474  C  C   . PRO B 1 250 ? 16.318  -96.817  34.245  1.00 71.22  ? 253  PRO B C   1 
ATOM   4475  O  O   . PRO B 1 250 ? 16.726  -97.496  35.187  1.00 70.71  ? 253  PRO B O   1 
ATOM   4476  C  CB  . PRO B 1 250 ? 14.356  -97.787  32.971  1.00 69.09  ? 253  PRO B CB  1 
ATOM   4477  C  CG  . PRO B 1 250 ? 13.339  -97.109  32.111  1.00 68.33  ? 253  PRO B CG  1 
ATOM   4478  C  CD  . PRO B 1 250 ? 13.829  -95.696  31.998  1.00 66.96  ? 253  PRO B CD  1 
ATOM   4479  N  N   . ASP B 1 251 ? 17.133  -96.148  33.432  1.00 73.17  ? 254  ASP B N   1 
ATOM   4480  C  CA  . ASP B 1 251 ? 18.576  -96.084  33.677  1.00 75.25  ? 254  ASP B CA  1 
ATOM   4481  C  C   . ASP B 1 251 ? 18.870  -95.260  34.919  1.00 75.33  ? 254  ASP B C   1 
ATOM   4482  O  O   . ASP B 1 251 ? 18.125  -94.333  35.253  1.00 75.07  ? 254  ASP B O   1 
ATOM   4483  C  CB  . ASP B 1 251 ? 19.313  -95.482  32.484  1.00 79.67  ? 254  ASP B CB  1 
ATOM   4484  C  CG  . ASP B 1 251 ? 19.231  -96.352  31.251  1.00 84.61  ? 254  ASP B CG  1 
ATOM   4485  O  OD1 . ASP B 1 251 ? 20.252  -96.999  30.924  1.00 88.38  ? 254  ASP B OD1 1 
ATOM   4486  O  OD2 . ASP B 1 251 ? 18.150  -96.394  30.616  1.00 81.89  ? 254  ASP B OD2 1 
ATOM   4487  N  N   . GLU B 1 252 ? 19.960  -95.602  35.596  1.00 73.03  ? 255  GLU B N   1 
ATOM   4488  C  CA  . GLU B 1 252 ? 20.341  -94.929  36.827  1.00 72.94  ? 255  GLU B CA  1 
ATOM   4489  C  C   . GLU B 1 252 ? 21.846  -94.655  36.800  1.00 71.05  ? 255  GLU B C   1 
ATOM   4490  O  O   . GLU B 1 252 ? 22.462  -94.339  37.826  1.00 68.70  ? 255  GLU B O   1 
ATOM   4491  C  CB  . GLU B 1 252 ? 19.932  -95.776  38.042  1.00 78.70  ? 255  GLU B CB  1 
ATOM   4492  C  CG  . GLU B 1 252 ? 19.295  -94.993  39.192  1.00 83.94  ? 255  GLU B CG  1 
ATOM   4493  C  CD  . GLU B 1 252 ? 17.802  -94.690  39.012  1.00 86.41  ? 255  GLU B CD  1 
ATOM   4494  O  OE1 . GLU B 1 252 ? 17.229  -94.021  39.901  1.00 88.04  ? 255  GLU B OE1 1 
ATOM   4495  O  OE2 . GLU B 1 252 ? 17.185  -95.110  38.005  1.00 82.86  ? 255  GLU B OE2 1 
ATOM   4496  N  N   . ASP B 1 253 ? 22.421  -94.780  35.606  1.00 67.77  ? 256  ASP B N   1 
ATOM   4497  C  CA  . ASP B 1 253 ? 23.831  -94.488  35.364  1.00 67.41  ? 256  ASP B CA  1 
ATOM   4498  C  C   . ASP B 1 253 ? 24.042  -93.787  34.021  1.00 62.24  ? 256  ASP B C   1 
ATOM   4499  O  O   . ASP B 1 253 ? 23.584  -94.267  32.981  1.00 60.23  ? 256  ASP B O   1 
ATOM   4500  C  CB  . ASP B 1 253 ? 24.671  -95.763  35.430  1.00 73.33  ? 256  ASP B CB  1 
ATOM   4501  C  CG  . ASP B 1 253 ? 25.535  -95.820  36.667  1.00 78.32  ? 256  ASP B CG  1 
ATOM   4502  O  OD1 . ASP B 1 253 ? 24.988  -96.083  37.760  1.00 80.78  ? 256  ASP B OD1 1 
ATOM   4503  O  OD2 . ASP B 1 253 ? 26.763  -95.601  36.539  1.00 79.99  ? 256  ASP B OD2 1 
ATOM   4504  N  N   . PHE B 1 254 ? 24.756  -92.664  34.055  1.00 56.18  ? 257  PHE B N   1 
ATOM   4505  C  CA  . PHE B 1 254 ? 24.869  -91.770  32.905  1.00 52.66  ? 257  PHE B CA  1 
ATOM   4506  C  C   . PHE B 1 254 ? 26.294  -91.288  32.694  1.00 51.76  ? 257  PHE B C   1 
ATOM   4507  O  O   . PHE B 1 254 ? 27.075  -91.233  33.632  1.00 56.40  ? 257  PHE B O   1 
ATOM   4508  C  CB  . PHE B 1 254 ? 23.995  -90.537  33.118  1.00 48.90  ? 257  PHE B CB  1 
ATOM   4509  C  CG  . PHE B 1 254 ? 22.528  -90.831  33.296  1.00 48.47  ? 257  PHE B CG  1 
ATOM   4510  C  CD1 . PHE B 1 254 ? 21.665  -90.813  32.204  1.00 47.03  ? 257  PHE B CD1 1 
ATOM   4511  C  CD2 . PHE B 1 254 ? 21.998  -91.075  34.560  1.00 47.21  ? 257  PHE B CD2 1 
ATOM   4512  C  CE1 . PHE B 1 254 ? 20.308  -91.062  32.370  1.00 47.53  ? 257  PHE B CE1 1 
ATOM   4513  C  CE2 . PHE B 1 254 ? 20.643  -91.317  34.732  1.00 46.38  ? 257  PHE B CE2 1 
ATOM   4514  C  CZ  . PHE B 1 254 ? 19.795  -91.314  33.632  1.00 45.95  ? 257  PHE B CZ  1 
ATOM   4515  N  N   . VAL B 1 255 ? 26.640  -90.931  31.464  1.00 50.72  ? 258  VAL B N   1 
ATOM   4516  C  CA  . VAL B 1 255 ? 27.876  -90.175  31.253  1.00 50.56  ? 258  VAL B CA  1 
ATOM   4517  C  C   . VAL B 1 255 ? 27.617  -88.658  31.209  1.00 48.64  ? 258  VAL B C   1 
ATOM   4518  O  O   . VAL B 1 255 ? 28.519  -87.877  31.509  1.00 46.68  ? 258  VAL B O   1 
ATOM   4519  C  CB  . VAL B 1 255 ? 28.787  -90.729  30.108  1.00 49.93  ? 258  VAL B CB  1 
ATOM   4520  C  CG1 . VAL B 1 255 ? 28.161  -91.928  29.400  1.00 51.90  ? 258  VAL B CG1 1 
ATOM   4521  C  CG2 . VAL B 1 255 ? 29.226  -89.644  29.132  1.00 48.82  ? 258  VAL B CG2 1 
ATOM   4522  N  N   . LEU B 1 256 ? 26.378  -88.271  30.878  1.00 46.85  ? 259  LEU B N   1 
ATOM   4523  C  CA  . LEU B 1 256 ? 25.920  -86.866  30.895  1.00 44.16  ? 259  LEU B CA  1 
ATOM   4524  C  C   . LEU B 1 256 ? 24.393  -86.744  30.826  1.00 43.31  ? 259  LEU B C   1 
ATOM   4525  O  O   . LEU B 1 256 ? 23.740  -87.523  30.128  1.00 43.22  ? 259  LEU B O   1 
ATOM   4526  C  CB  . LEU B 1 256 ? 26.576  -86.057  29.761  1.00 43.97  ? 259  LEU B CB  1 
ATOM   4527  C  CG  . LEU B 1 256 ? 26.209  -86.304  28.285  1.00 44.58  ? 259  LEU B CG  1 
ATOM   4528  C  CD1 . LEU B 1 256 ? 25.055  -85.402  27.880  1.00 43.05  ? 259  LEU B CD1 1 
ATOM   4529  C  CD2 . LEU B 1 256 ? 27.388  -86.102  27.335  1.00 43.28  ? 259  LEU B CD2 1 
ATOM   4530  N  N   . VAL B 1 257 ? 23.833  -85.792  31.576  1.00 43.49  ? 260  VAL B N   1 
ATOM   4531  C  CA  . VAL B 1 257 ? 22.481  -85.266  31.312  1.00 41.64  ? 260  VAL B CA  1 
ATOM   4532  C  C   . VAL B 1 257 ? 22.622  -83.811  30.844  1.00 41.87  ? 260  VAL B C   1 
ATOM   4533  O  O   . VAL B 1 257 ? 23.395  -83.056  31.434  1.00 45.89  ? 260  VAL B O   1 
ATOM   4534  C  CB  . VAL B 1 257 ? 21.551  -85.361  32.541  1.00 41.83  ? 260  VAL B CB  1 
ATOM   4535  C  CG1 . VAL B 1 257 ? 20.245  -84.625  32.299  1.00 43.42  ? 260  VAL B CG1 1 
ATOM   4536  C  CG2 . VAL B 1 257 ? 21.236  -86.813  32.865  1.00 45.77  ? 260  VAL B CG2 1 
ATOM   4537  N  N   . LEU B 1 258 ? 21.903  -83.428  29.781  1.00 39.29  ? 261  LEU B N   1 
ATOM   4538  C  CA  . LEU B 1 258 ? 21.961  -82.061  29.232  1.00 34.03  ? 261  LEU B CA  1 
ATOM   4539  C  C   . LEU B 1 258 ? 20.592  -81.451  28.915  1.00 33.63  ? 261  LEU B C   1 
ATOM   4540  O  O   . LEU B 1 258 ? 19.848  -81.938  28.064  1.00 35.34  ? 261  LEU B O   1 
ATOM   4541  C  CB  . LEU B 1 258 ? 22.855  -82.000  27.995  1.00 32.36  ? 261  LEU B CB  1 
ATOM   4542  C  CG  . LEU B 1 258 ? 22.955  -80.661  27.235  1.00 32.01  ? 261  LEU B CG  1 
ATOM   4543  C  CD1 . LEU B 1 258 ? 23.496  -79.535  28.108  1.00 31.60  ? 261  LEU B CD1 1 
ATOM   4544  C  CD2 . LEU B 1 258 ? 23.825  -80.797  25.996  1.00 30.65  ? 261  LEU B CD2 1 
ATOM   4545  N  N   . ALA B 1 259 ? 20.269  -80.377  29.613  1.00 31.68  ? 262  ALA B N   1 
ATOM   4546  C  CA  . ALA B 1 259 ? 19.079  -79.602  29.313  1.00 31.82  ? 262  ALA B CA  1 
ATOM   4547  C  C   . ALA B 1 259 ? 19.556  -78.383  28.567  1.00 31.63  ? 262  ALA B C   1 
ATOM   4548  O  O   . ALA B 1 259 ? 20.407  -77.650  29.064  1.00 32.54  ? 262  ALA B O   1 
ATOM   4549  C  CB  . ALA B 1 259 ? 18.379  -79.200  30.591  1.00 30.71  ? 262  ALA B CB  1 
ATOM   4550  N  N   . LEU B 1 260 ? 19.027  -78.172  27.367  1.00 30.52  ? 263  LEU B N   1 
ATOM   4551  C  CA  . LEU B 1 260 ? 19.545  -77.128  26.490  1.00 30.21  ? 263  LEU B CA  1 
ATOM   4552  C  C   . LEU B 1 260 ? 18.398  -76.399  25.815  1.00 31.23  ? 263  LEU B C   1 
ATOM   4553  O  O   . LEU B 1 260 ? 17.477  -77.022  25.288  1.00 32.29  ? 263  LEU B O   1 
ATOM   4554  C  CB  . LEU B 1 260 ? 20.501  -77.741  25.466  1.00 30.40  ? 263  LEU B CB  1 
ATOM   4555  C  CG  . LEU B 1 260 ? 21.155  -76.849  24.406  1.00 32.89  ? 263  LEU B CG  1 
ATOM   4556  C  CD1 . LEU B 1 260 ? 22.092  -75.825  25.031  1.00 31.37  ? 263  LEU B CD1 1 
ATOM   4557  C  CD2 . LEU B 1 260 ? 21.885  -77.698  23.359  1.00 31.35  ? 263  LEU B CD2 1 
ATOM   4558  N  N   . LEU B 1 261 ? 18.463  -75.075  25.838  1.00 31.08  ? 264  LEU B N   1 
ATOM   4559  C  CA  . LEU B 1 261 ? 17.393  -74.231  25.349  1.00 29.75  ? 264  LEU B CA  1 
ATOM   4560  C  C   . LEU B 1 261 ? 17.689  -73.687  23.965  1.00 29.48  ? 264  LEU B C   1 
ATOM   4561  O  O   . LEU B 1 261 ? 16.882  -72.972  23.400  1.00 27.78  ? 264  LEU B O   1 
ATOM   4562  C  CB  . LEU B 1 261 ? 17.197  -73.051  26.310  1.00 29.76  ? 264  LEU B CB  1 
ATOM   4563  C  CG  . LEU B 1 261 ? 16.419  -73.281  27.595  1.00 29.06  ? 264  LEU B CG  1 
ATOM   4564  C  CD1 . LEU B 1 261 ? 17.202  -74.195  28.534  1.00 29.83  ? 264  LEU B CD1 1 
ATOM   4565  C  CD2 . LEU B 1 261 ? 16.141  -71.932  28.246  1.00 28.37  ? 264  LEU B CD2 1 
ATOM   4566  N  N   . HIS B 1 262 ? 18.865  -73.999  23.431  1.00 29.18  ? 265  HIS B N   1 
ATOM   4567  C  CA  . HIS B 1 262 ? 19.278  -73.416  22.173  1.00 28.55  ? 265  HIS B CA  1 
ATOM   4568  C  C   . HIS B 1 262 ? 19.939  -74.391  21.245  1.00 29.10  ? 265  HIS B C   1 
ATOM   4569  O  O   . HIS B 1 262 ? 20.127  -75.551  21.595  1.00 29.37  ? 265  HIS B O   1 
ATOM   4570  C  CB  . HIS B 1 262 ? 20.176  -72.211  22.436  1.00 28.92  ? 265  HIS B CB  1 
ATOM   4571  C  CG  . HIS B 1 262 ? 19.432  -71.021  22.983  1.00 30.17  ? 265  HIS B CG  1 
ATOM   4572  N  ND1 . HIS B 1 262 ? 18.716  -70.192  22.196  1.00 29.67  ? 265  HIS B ND1 1 
ATOM   4573  C  CD2 . HIS B 1 262 ? 19.291  -70.549  24.288  1.00 29.28  ? 265  HIS B CD2 1 
ATOM   4574  C  CE1 . HIS B 1 262 ? 18.148  -69.242  22.955  1.00 29.89  ? 265  HIS B CE1 1 
ATOM   4575  N  NE2 . HIS B 1 262 ? 18.494  -69.463  24.235  1.00 29.88  ? 265  HIS B NE2 1 
ATOM   4576  N  N   . SER B 1 263 ? 20.305  -73.929  20.051  1.00 29.10  ? 266  SER B N   1 
ATOM   4577  C  CA  . SER B 1 263 ? 20.943  -74.801  19.074  1.00 31.60  ? 266  SER B CA  1 
ATOM   4578  C  C   . SER B 1 263 ? 22.396  -75.179  19.434  1.00 32.78  ? 266  SER B C   1 
ATOM   4579  O  O   . SER B 1 263 ? 22.849  -76.278  19.114  1.00 36.04  ? 266  SER B O   1 
ATOM   4580  C  CB  . SER B 1 263 ? 20.869  -74.188  17.679  1.00 29.71  ? 266  SER B CB  1 
ATOM   4581  O  OG  . SER B 1 263 ? 21.615  -72.985  17.621  1.00 30.71  ? 266  SER B OG  1 
ATOM   4582  N  N   . HIS B 1 264 ? 23.127  -74.293  20.099  1.00 31.44  ? 267  HIS B N   1 
ATOM   4583  C  CA  . HIS B 1 264 ? 24.557  -74.539  20.305  1.00 31.22  ? 267  HIS B CA  1 
ATOM   4584  C  C   . HIS B 1 264 ? 24.990  -74.604  21.748  1.00 33.59  ? 267  HIS B C   1 
ATOM   4585  O  O   . HIS B 1 264 ? 24.516  -73.831  22.577  1.00 33.30  ? 267  HIS B O   1 
ATOM   4586  C  CB  . HIS B 1 264 ? 25.370  -73.479  19.586  1.00 28.97  ? 267  HIS B CB  1 
ATOM   4587  C  CG  . HIS B 1 264 ? 25.305  -73.567  18.083  1.00 27.89  ? 267  HIS B CG  1 
ATOM   4588  N  ND1 . HIS B 1 264 ? 24.154  -73.427  17.393  1.00 26.82  ? 267  HIS B ND1 1 
ATOM   4589  C  CD2 . HIS B 1 264 ? 26.307  -73.777  17.138  1.00 26.79  ? 267  HIS B CD2 1 
ATOM   4590  C  CE1 . HIS B 1 264 ? 24.407  -73.547  16.078  1.00 25.93  ? 267  HIS B CE1 1 
ATOM   4591  N  NE2 . HIS B 1 264 ? 25.727  -73.740  15.922  1.00 25.37  ? 267  HIS B NE2 1 
ATOM   4592  N  N   . LEU B 1 265 ? 25.894  -75.539  22.045  1.00 35.42  ? 268  LEU B N   1 
ATOM   4593  C  CA  . LEU B 1 265 ? 26.591  -75.636  23.344  1.00 36.15  ? 268  LEU B CA  1 
ATOM   4594  C  C   . LEU B 1 265 ? 27.795  -74.703  23.445  1.00 36.42  ? 268  LEU B C   1 
ATOM   4595  O  O   . LEU B 1 265 ? 28.266  -74.389  24.536  1.00 38.87  ? 268  LEU B O   1 
ATOM   4596  C  CB  . LEU B 1 265 ? 27.106  -77.042  23.558  1.00 35.97  ? 268  LEU B CB  1 
ATOM   4597  C  CG  . LEU B 1 265 ? 26.351  -78.010  24.438  1.00 37.61  ? 268  LEU B CG  1 
ATOM   4598  C  CD1 . LEU B 1 265 ? 27.210  -79.260  24.513  1.00 37.57  ? 268  LEU B CD1 1 
ATOM   4599  C  CD2 . LEU B 1 265 ? 26.092  -77.424  25.824  1.00 36.28  ? 268  LEU B CD2 1 
ATOM   4600  N  N   . GLY B 1 266 ? 28.296  -74.296  22.291  1.00 34.46  ? 269  GLY B N   1 
ATOM   4601  C  CA  . GLY B 1 266 ? 29.431  -73.400  22.168  1.00 34.02  ? 269  GLY B CA  1 
ATOM   4602  C  C   . GLY B 1 266 ? 29.480  -73.061  20.694  1.00 33.34  ? 269  GLY B C   1 
ATOM   4603  O  O   . GLY B 1 266 ? 28.719  -73.625  19.904  1.00 33.68  ? 269  GLY B O   1 
ATOM   4604  N  N   . SER B 1 267 ? 30.364  -72.157  20.300  1.00 32.38  ? 270  SER B N   1 
ATOM   4605  C  CA  . SER B 1 267 ? 30.291  -71.642  18.938  1.00 32.33  ? 270  SER B CA  1 
ATOM   4606  C  C   . SER B 1 267 ? 30.728  -72.658  17.873  1.00 34.12  ? 270  SER B C   1 
ATOM   4607  O  O   . SER B 1 267 ? 30.563  -72.424  16.678  1.00 33.95  ? 270  SER B O   1 
ATOM   4608  C  CB  . SER B 1 267 ? 31.046  -70.328  18.812  1.00 31.48  ? 270  SER B CB  1 
ATOM   4609  O  OG  . SER B 1 267 ? 32.400  -70.510  19.113  1.00 31.54  ? 270  SER B OG  1 
ATOM   4610  N  N   . GLU B 1 268 ? 31.274  -73.785  18.319  1.00 35.73  ? 271  GLU B N   1 
ATOM   4611  C  CA  . GLU B 1 268 ? 31.652  -74.873  17.422  1.00 38.68  ? 271  GLU B CA  1 
ATOM   4612  C  C   . GLU B 1 268 ? 31.127  -76.198  17.940  1.00 37.87  ? 271  GLU B C   1 
ATOM   4613  O  O   . GLU B 1 268 ? 31.750  -77.257  17.765  1.00 39.82  ? 271  GLU B O   1 
ATOM   4614  C  CB  . GLU B 1 268 ? 33.164  -74.900  17.204  1.00 40.46  ? 271  GLU B CB  1 
ATOM   4615  C  CG  . GLU B 1 268 ? 33.600  -73.842  16.208  1.00 42.72  ? 271  GLU B CG  1 
ATOM   4616  C  CD  . GLU B 1 268 ? 35.086  -73.833  15.966  1.00 45.92  ? 271  GLU B CD  1 
ATOM   4617  O  OE1 . GLU B 1 268 ? 35.868  -74.036  16.923  1.00 46.97  ? 271  GLU B OE1 1 
ATOM   4618  O  OE2 . GLU B 1 268 ? 35.463  -73.605  14.803  1.00 49.49  ? 271  GLU B OE2 1 
ATOM   4619  N  N   . MET B 1 269 ? 29.964  -76.115  18.575  1.00 35.37  ? 272  MET B N   1 
ATOM   4620  C  CA  . MET B 1 269 ? 29.264  -77.270  19.082  1.00 35.59  ? 272  MET B CA  1 
ATOM   4621  C  C   . MET B 1 269 ? 27.778  -77.058  18.827  1.00 35.04  ? 272  MET B C   1 
ATOM   4622  O  O   . MET B 1 269 ? 27.044  -76.524  19.668  1.00 34.57  ? 272  MET B O   1 
ATOM   4623  C  CB  . MET B 1 269 ? 29.574  -77.505  20.561  1.00 37.66  ? 272  MET B CB  1 
ATOM   4624  C  CG  . MET B 1 269 ? 31.066  -77.596  20.847  1.00 40.15  ? 272  MET B CG  1 
ATOM   4625  S  SD  . MET B 1 269 ? 31.501  -78.201  22.492  1.00 45.10  ? 272  MET B SD  1 
ATOM   4626  C  CE  . MET B 1 269 ? 30.660  -77.003  23.530  1.00 44.34  ? 272  MET B CE  1 
ATOM   4627  N  N   . PHE B 1 270 ? 27.374  -77.460  17.624  1.00 33.38  ? 273  PHE B N   1 
ATOM   4628  C  CA  . PHE B 1 270 ? 26.009  -77.404  17.128  1.00 33.77  ? 273  PHE B CA  1 
ATOM   4629  C  C   . PHE B 1 270 ? 25.372  -78.618  17.765  1.00 35.13  ? 273  PHE B C   1 
ATOM   4630  O  O   . PHE B 1 270 ? 25.242  -79.653  17.125  1.00 37.92  ? 273  PHE B O   1 
ATOM   4631  C  CB  . PHE B 1 270 ? 26.032  -77.542  15.589  1.00 31.93  ? 273  PHE B CB  1 
ATOM   4632  C  CG  . PHE B 1 270 ? 24.707  -77.271  14.895  1.00 31.96  ? 273  PHE B CG  1 
ATOM   4633  C  CD1 . PHE B 1 270 ? 23.526  -77.075  15.605  1.00 30.49  ? 273  PHE B CD1 1 
ATOM   4634  C  CD2 . PHE B 1 270 ? 24.643  -77.257  13.503  1.00 32.10  ? 273  PHE B CD2 1 
ATOM   4635  C  CE1 . PHE B 1 270 ? 22.329  -76.842  14.946  1.00 30.41  ? 273  PHE B CE1 1 
ATOM   4636  C  CE2 . PHE B 1 270 ? 23.436  -77.037  12.836  1.00 32.29  ? 273  PHE B CE2 1 
ATOM   4637  C  CZ  . PHE B 1 270 ? 22.272  -76.832  13.562  1.00 30.19  ? 273  PHE B CZ  1 
ATOM   4638  N  N   . ALA B 1 271 ? 24.995  -78.489  19.033  1.00 34.13  ? 274  ALA B N   1 
ATOM   4639  C  CA  . ALA B 1 271 ? 24.585  -79.627  19.841  1.00 32.52  ? 274  ALA B CA  1 
ATOM   4640  C  C   . ALA B 1 271 ? 23.149  -80.055  19.556  1.00 31.63  ? 274  ALA B C   1 
ATOM   4641  O  O   . ALA B 1 271 ? 22.787  -81.206  19.767  1.00 31.23  ? 274  ALA B O   1 
ATOM   4642  C  CB  . ALA B 1 271 ? 24.745  -79.295  21.317  1.00 31.46  ? 274  ALA B CB  1 
ATOM   4643  N  N   . ALA B 1 272 ? 22.324  -79.123  19.109  1.00 29.90  ? 275  ALA B N   1 
ATOM   4644  C  CA  . ALA B 1 272 ? 20.936  -79.446  18.833  1.00 31.50  ? 275  ALA B CA  1 
ATOM   4645  C  C   . ALA B 1 272 ? 20.590  -79.185  17.372  1.00 33.53  ? 275  ALA B C   1 
ATOM   4646  O  O   . ALA B 1 272 ? 20.145  -78.080  17.014  1.00 33.53  ? 275  ALA B O   1 
ATOM   4647  C  CB  . ALA B 1 272 ? 20.021  -78.681  19.763  1.00 30.68  ? 275  ALA B CB  1 
ATOM   4648  N  N   . PRO B 1 273 ? 20.816  -80.195  16.510  1.00 34.47  ? 276  PRO B N   1 
ATOM   4649  C  CA  . PRO B 1 273 ? 20.680  -80.038  15.053  1.00 36.04  ? 276  PRO B CA  1 
ATOM   4650  C  C   . PRO B 1 273 ? 19.265  -79.708  14.589  1.00 35.59  ? 276  PRO B C   1 
ATOM   4651  O  O   . PRO B 1 273 ? 19.107  -79.065  13.561  1.00 38.94  ? 276  PRO B O   1 
ATOM   4652  C  CB  . PRO B 1 273 ? 21.124  -81.395  14.507  1.00 36.85  ? 276  PRO B CB  1 
ATOM   4653  C  CG  . PRO B 1 273 ? 20.934  -82.330  15.644  1.00 35.74  ? 276  PRO B CG  1 
ATOM   4654  C  CD  . PRO B 1 273 ? 21.297  -81.538  16.857  1.00 34.89  ? 276  PRO B CD  1 
ATOM   4655  N  N   . MET B 1 274 ? 18.249  -80.148  15.327  1.00 36.46  ? 277  MET B N   1 
ATOM   4656  C  CA  . MET B 1 274 ? 16.902  -79.638  15.110  1.00 38.14  ? 277  MET B CA  1 
ATOM   4657  C  C   . MET B 1 274 ? 17.005  -78.157  15.462  1.00 39.79  ? 277  MET B C   1 
ATOM   4658  O  O   . MET B 1 274 ? 18.028  -77.710  16.008  1.00 40.58  ? 277  MET B O   1 
ATOM   4659  C  CB  . MET B 1 274 ? 15.876  -80.371  15.976  1.00 36.47  ? 277  MET B CB  1 
ATOM   4660  C  CG  . MET B 1 274 ? 16.115  -80.255  17.475  1.00 39.18  ? 277  MET B CG  1 
ATOM   4661  S  SD  . MET B 1 274 ? 17.502  -81.226  18.102  1.00 41.55  ? 277  MET B SD  1 
ATOM   4662  C  CE  . MET B 1 274 ? 16.824  -82.877  17.970  1.00 42.70  ? 277  MET B CE  1 
ATOM   4663  N  N   . GLY B 1 275 ? 15.996  -77.367  15.151  1.00 38.76  ? 278  GLY B N   1 
ATOM   4664  C  CA  . GLY B 1 275 ? 16.236  -75.922  15.229  1.00 41.74  ? 278  GLY B CA  1 
ATOM   4665  C  C   . GLY B 1 275 ? 16.365  -75.261  16.601  1.00 38.10  ? 278  GLY B C   1 
ATOM   4666  O  O   . GLY B 1 275 ? 16.691  -75.878  17.623  1.00 34.58  ? 278  GLY B O   1 
ATOM   4667  N  N   . ARG B 1 276 ? 16.152  -73.957  16.577  1.00 37.29  ? 279  ARG B N   1 
ATOM   4668  C  CA  . ARG B 1 276 ? 15.649  -73.214  17.709  1.00 33.69  ? 279  ARG B CA  1 
ATOM   4669  C  C   . ARG B 1 276 ? 14.491  -74.025  18.311  1.00 33.42  ? 279  ARG B C   1 
ATOM   4670  O  O   . ARG B 1 276 ? 13.694  -74.601  17.564  1.00 35.72  ? 279  ARG B O   1 
ATOM   4671  C  CB  . ARG B 1 276 ? 15.125  -71.898  17.150  1.00 32.80  ? 279  ARG B CB  1 
ATOM   4672  C  CG  . ARG B 1 276 ? 14.885  -70.816  18.167  1.00 31.02  ? 279  ARG B CG  1 
ATOM   4673  C  CD  . ARG B 1 276 ? 14.464  -69.564  17.454  1.00 30.47  ? 279  ARG B CD  1 
ATOM   4674  N  NE  . ARG B 1 276 ? 13.974  -68.600  18.426  1.00 32.92  ? 279  ARG B NE  1 
ATOM   4675  C  CZ  . ARG B 1 276 ? 13.813  -67.310  18.184  1.00 31.84  ? 279  ARG B CZ  1 
ATOM   4676  N  NH1 . ARG B 1 276 ? 14.103  -66.813  16.983  1.00 31.68  ? 279  ARG B NH1 1 
ATOM   4677  N  NH2 . ARG B 1 276 ? 13.351  -66.525  19.143  1.00 31.47  ? 279  ARG B NH2 1 
ATOM   4678  N  N   . CYS B 1 277 ? 14.390  -74.088  19.639  1.00 31.42  ? 280  CYS B N   1 
ATOM   4679  C  CA  . CYS B 1 277 ? 13.217  -74.701  20.264  1.00 29.67  ? 280  CYS B CA  1 
ATOM   4680  C  C   . CYS B 1 277 ? 11.983  -73.856  20.034  1.00 28.06  ? 280  CYS B C   1 
ATOM   4681  O  O   . CYS B 1 277 ? 12.060  -72.628  19.912  1.00 28.16  ? 280  CYS B O   1 
ATOM   4682  C  CB  . CYS B 1 277 ? 13.373  -74.869  21.780  1.00 31.35  ? 280  CYS B CB  1 
ATOM   4683  S  SG  . CYS B 1 277 ? 14.975  -75.451  22.368  1.00 37.42  ? 280  CYS B SG  1 
ATOM   4684  N  N   . ALA B 1 278 ? 10.843  -74.529  19.986  1.00 27.06  ? 281  ALA B N   1 
ATOM   4685  C  CA  . ALA B 1 278 ? 9.549   -73.876  20.056  1.00 26.90  ? 281  ALA B CA  1 
ATOM   4686  C  C   . ALA B 1 278 ? 9.404   -73.197  21.404  1.00 25.97  ? 281  ALA B C   1 
ATOM   4687  O  O   . ALA B 1 278 ? 10.172  -73.453  22.327  1.00 28.24  ? 281  ALA B O   1 
ATOM   4688  C  CB  . ALA B 1 278 ? 8.446   -74.896  19.881  1.00 25.11  ? 281  ALA B CB  1 
ATOM   4689  N  N   . ALA B 1 279 ? 8.406   -72.341  21.505  1.00 25.56  ? 282  ALA B N   1 
ATOM   4690  C  CA  . ALA B 1 279 ? 8.120   -71.615  22.729  1.00 26.12  ? 282  ALA B CA  1 
ATOM   4691  C  C   . ALA B 1 279 ? 7.685   -72.581  23.832  1.00 26.59  ? 282  ALA B C   1 
ATOM   4692  O  O   . ALA B 1 279 ? 6.913   -73.512  23.594  1.00 26.35  ? 282  ALA B O   1 
ATOM   4693  C  CB  . ALA B 1 279 ? 7.060   -70.559  22.460  1.00 22.96  ? 282  ALA B CB  1 
ATOM   4694  N  N   . GLY B 1 280 ? 8.209   -72.374  25.034  1.00 28.19  ? 283  GLY B N   1 
ATOM   4695  C  CA  . GLY B 1 280 ? 7.942   -73.290  26.152  1.00 28.50  ? 283  GLY B CA  1 
ATOM   4696  C  C   . GLY B 1 280 ? 8.492   -74.708  26.012  1.00 29.05  ? 283  GLY B C   1 
ATOM   4697  O  O   . GLY B 1 280 ? 8.020   -75.645  26.682  1.00 30.12  ? 283  GLY B O   1 
ATOM   4698  N  N   . VAL B 1 281 ? 9.503   -74.879  25.170  1.00 27.62  ? 284  VAL B N   1 
ATOM   4699  C  CA  . VAL B 1 281 ? 10.084  -76.200  24.967  1.00 27.54  ? 284  VAL B CA  1 
ATOM   4700  C  C   . VAL B 1 281 ? 11.596  -76.098  25.126  1.00 28.06  ? 284  VAL B C   1 
ATOM   4701  O  O   . VAL B 1 281 ? 12.185  -75.084  24.741  1.00 28.78  ? 284  VAL B O   1 
ATOM   4702  C  CB  . VAL B 1 281 ? 9.704   -76.761  23.563  1.00 27.58  ? 284  VAL B CB  1 
ATOM   4703  C  CG1 . VAL B 1 281 ? 10.479  -78.027  23.229  1.00 25.28  ? 284  VAL B CG1 1 
ATOM   4704  C  CG2 . VAL B 1 281 ? 8.206   -77.004  23.478  1.00 26.54  ? 284  VAL B CG2 1 
ATOM   4705  N  N   . MET B 1 282 ? 12.217  -77.124  25.712  1.00 28.87  ? 285  MET B N   1 
ATOM   4706  C  CA  . MET B 1 282 ? 13.683  -77.232  25.730  1.00 31.27  ? 285  MET B CA  1 
ATOM   4707  C  C   . MET B 1 282 ? 14.151  -78.627  25.286  1.00 32.12  ? 285  MET B C   1 
ATOM   4708  O  O   . MET B 1 282 ? 13.398  -79.603  25.380  1.00 33.55  ? 285  MET B O   1 
ATOM   4709  C  CB  . MET B 1 282 ? 14.286  -76.843  27.100  1.00 32.72  ? 285  MET B CB  1 
ATOM   4710  C  CG  . MET B 1 282 ? 13.977  -77.792  28.246  1.00 36.35  ? 285  MET B CG  1 
ATOM   4711  S  SD  . MET B 1 282 ? 14.267  -77.156  29.927  1.00 39.14  ? 285  MET B SD  1 
ATOM   4712  C  CE  . MET B 1 282 ? 15.849  -77.900  30.251  1.00 38.57  ? 285  MET B CE  1 
ATOM   4713  N  N   . HIS B 1 283 ? 15.386  -78.706  24.793  1.00 31.65  ? 286  HIS B N   1 
ATOM   4714  C  CA  . HIS B 1 283 ? 15.967  -79.967  24.357  1.00 33.13  ? 286  HIS B CA  1 
ATOM   4715  C  C   . HIS B 1 283 ? 16.554  -80.687  25.514  1.00 35.53  ? 286  HIS B C   1 
ATOM   4716  O  O   . HIS B 1 283 ? 17.385  -80.131  26.226  1.00 37.39  ? 286  HIS B O   1 
ATOM   4717  C  CB  . HIS B 1 283 ? 17.076  -79.727  23.339  1.00 31.33  ? 286  HIS B CB  1 
ATOM   4718  C  CG  . HIS B 1 283 ? 16.611  -79.013  22.104  1.00 29.65  ? 286  HIS B CG  1 
ATOM   4719  N  ND1 . HIS B 1 283 ? 17.329  -78.043  21.517  1.00 29.98  ? 286  HIS B ND1 1 
ATOM   4720  C  CD2 . HIS B 1 283 ? 15.435  -79.120  21.386  1.00 28.08  ? 286  HIS B CD2 1 
ATOM   4721  C  CE1 . HIS B 1 283 ? 16.662  -77.579  20.455  1.00 28.20  ? 286  HIS B CE1 1 
ATOM   4722  N  NE2 . HIS B 1 283 ? 15.498  -78.232  20.384  1.00 28.48  ? 286  HIS B NE2 1 
ATOM   4723  N  N   . LEU B 1 284 ? 16.142  -81.933  25.721  1.00 36.46  ? 287  LEU B N   1 
ATOM   4724  C  CA  . LEU B 1 284 ? 16.824  -82.769  26.700  1.00 36.24  ? 287  LEU B CA  1 
ATOM   4725  C  C   . LEU B 1 284 ? 17.623  -83.854  26.011  1.00 36.95  ? 287  LEU B C   1 
ATOM   4726  O  O   . LEU B 1 284 ? 17.095  -84.592  25.183  1.00 38.74  ? 287  LEU B O   1 
ATOM   4727  C  CB  . LEU B 1 284 ? 15.849  -83.371  27.710  1.00 34.77  ? 287  LEU B CB  1 
ATOM   4728  C  CG  . LEU B 1 284 ? 16.480  -84.248  28.792  1.00 35.73  ? 287  LEU B CG  1 
ATOM   4729  C  CD1 . LEU B 1 284 ? 17.417  -83.456  29.692  1.00 34.80  ? 287  LEU B CD1 1 
ATOM   4730  C  CD2 . LEU B 1 284 ? 15.389  -84.933  29.609  1.00 36.38  ? 287  LEU B CD2 1 
ATOM   4731  N  N   . PHE B 1 285 ? 18.903  -83.929  26.350  1.00 37.53  ? 288  PHE B N   1 
ATOM   4732  C  CA  . PHE B 1 285 ? 19.762  -85.027  25.923  1.00 39.02  ? 288  PHE B CA  1 
ATOM   4733  C  C   . PHE B 1 285 ? 20.265  -85.807  27.130  1.00 41.90  ? 288  PHE B C   1 
ATOM   4734  O  O   . PHE B 1 285 ? 20.465  -85.238  28.218  1.00 43.78  ? 288  PHE B O   1 
ATOM   4735  C  CB  . PHE B 1 285 ? 20.984  -84.507  25.182  1.00 38.41  ? 288  PHE B CB  1 
ATOM   4736  C  CG  . PHE B 1 285 ? 20.676  -83.851  23.869  1.00 40.02  ? 288  PHE B CG  1 
ATOM   4737  C  CD1 . PHE B 1 285 ? 20.657  -84.598  22.691  1.00 38.77  ? 288  PHE B CD1 1 
ATOM   4738  C  CD2 . PHE B 1 285 ? 20.434  -82.479  23.802  1.00 38.34  ? 288  PHE B CD2 1 
ATOM   4739  C  CE1 . PHE B 1 285 ? 20.392  -83.989  21.475  1.00 39.96  ? 288  PHE B CE1 1 
ATOM   4740  C  CE2 . PHE B 1 285 ? 20.164  -81.866  22.585  1.00 37.49  ? 288  PHE B CE2 1 
ATOM   4741  C  CZ  . PHE B 1 285 ? 20.145  -82.622  21.422  1.00 38.95  ? 288  PHE B CZ  1 
ATOM   4742  N  N   . TYR B 1 286 ? 20.464  -87.108  26.944  1.00 42.99  ? 289  TYR B N   1 
ATOM   4743  C  CA  . TYR B 1 286 ? 21.315  -87.869  27.848  1.00 45.22  ? 289  TYR B CA  1 
ATOM   4744  C  C   . TYR B 1 286 ? 22.046  -88.993  27.155  1.00 46.46  ? 289  TYR B C   1 
ATOM   4745  O  O   . TYR B 1 286 ? 21.528  -89.601  26.221  1.00 47.46  ? 289  TYR B O   1 
ATOM   4746  C  CB  . TYR B 1 286 ? 20.577  -88.363  29.089  1.00 43.44  ? 289  TYR B CB  1 
ATOM   4747  C  CG  . TYR B 1 286 ? 19.421  -89.308  28.865  1.00 45.58  ? 289  TYR B CG  1 
ATOM   4748  C  CD1 . TYR B 1 286 ? 19.611  -90.695  28.863  1.00 47.25  ? 289  TYR B CD1 1 
ATOM   4749  C  CD2 . TYR B 1 286 ? 18.126  -88.824  28.718  1.00 44.80  ? 289  TYR B CD2 1 
ATOM   4750  C  CE1 . TYR B 1 286 ? 18.543  -91.566  28.685  1.00 46.95  ? 289  TYR B CE1 1 
ATOM   4751  C  CE2 . TYR B 1 286 ? 17.053  -89.680  28.545  1.00 46.30  ? 289  TYR B CE2 1 
ATOM   4752  C  CZ  . TYR B 1 286 ? 17.264  -91.050  28.528  1.00 47.54  ? 289  TYR B CZ  1 
ATOM   4753  O  OH  . TYR B 1 286 ? 16.189  -91.890  28.354  1.00 47.74  ? 289  TYR B OH  1 
ATOM   4754  N  N   . VAL B 1 287 ? 23.274  -89.224  27.603  1.00 48.29  ? 290  VAL B N   1 
ATOM   4755  C  CA  . VAL B 1 287 ? 24.041  -90.392  27.205  1.00 50.46  ? 290  VAL B CA  1 
ATOM   4756  C  C   . VAL B 1 287 ? 23.972  -91.403  28.359  1.00 53.99  ? 290  VAL B C   1 
ATOM   4757  O  O   . VAL B 1 287 ? 24.326  -91.082  29.499  1.00 56.80  ? 290  VAL B O   1 
ATOM   4758  C  CB  . VAL B 1 287 ? 25.488  -90.010  26.824  1.00 49.87  ? 290  VAL B CB  1 
ATOM   4759  C  CG1 . VAL B 1 287 ? 26.276  -91.219  26.338  1.00 48.59  ? 290  VAL B CG1 1 
ATOM   4760  C  CG2 . VAL B 1 287 ? 25.483  -88.942  25.737  1.00 47.74  ? 290  VAL B CG2 1 
ATOM   4761  N  N   . ARG B 1 288 ? 23.455  -92.598  28.073  1.00 55.87  ? 291  ARG B N   1 
ATOM   4762  C  CA  . ARG B 1 288 ? 23.367  -93.665  29.074  1.00 57.02  ? 291  ARG B CA  1 
ATOM   4763  C  C   . ARG B 1 288 ? 24.745  -94.294  29.272  1.00 56.64  ? 291  ARG B C   1 
ATOM   4764  O  O   . ARG B 1 288 ? 25.631  -94.151  28.419  1.00 52.45  ? 291  ARG B O   1 
ATOM   4765  C  CB  . ARG B 1 288 ? 22.349  -94.744  28.677  1.00 61.27  ? 291  ARG B CB  1 
ATOM   4766  C  CG  . ARG B 1 288 ? 21.093  -94.245  27.959  1.00 64.77  ? 291  ARG B CG  1 
ATOM   4767  C  CD  . ARG B 1 288 ? 19.920  -95.221  28.046  1.00 66.94  ? 291  ARG B CD  1 
ATOM   4768  N  NE  . ARG B 1 288 ? 20.331  -96.624  28.184  1.00 72.61  ? 291  ARG B NE  1 
ATOM   4769  C  CZ  . ARG B 1 288 ? 20.457  -97.494  27.182  1.00 74.12  ? 291  ARG B CZ  1 
ATOM   4770  N  NH1 . ARG B 1 288 ? 20.200  -97.131  25.929  1.00 75.99  ? 291  ARG B NH1 1 
ATOM   4771  N  NH2 . ARG B 1 288 ? 20.843  -98.739  27.436  1.00 72.25  ? 291  ARG B NH2 1 
ATOM   4772  N  N   . ALA B 1 289 ? 24.925  -94.968  30.408  1.00 58.64  ? 292  ALA B N   1 
ATOM   4773  C  CA  . ALA B 1 289 ? 26.163  -95.685  30.709  1.00 58.09  ? 292  ALA B CA  1 
ATOM   4774  C  C   . ALA B 1 289 ? 26.308  -96.857  29.754  1.00 58.86  ? 292  ALA B C   1 
ATOM   4775  O  O   . ALA B 1 289 ? 25.349  -97.609  29.538  1.00 60.53  ? 292  ALA B O   1 
ATOM   4776  C  CB  . ALA B 1 289 ? 26.159  -96.179  32.146  1.00 57.94  ? 292  ALA B CB  1 
ATOM   4777  N  N   . GLY B 1 290 ? 27.496  -96.999  29.170  1.00 55.39  ? 293  GLY B N   1 
ATOM   4778  C  CA  . GLY B 1 290 ? 27.754  -98.097  28.261  1.00 50.90  ? 293  GLY B CA  1 
ATOM   4779  C  C   . GLY B 1 290 ? 28.702  -97.752  27.142  1.00 50.86  ? 293  GLY B C   1 
ATOM   4780  O  O   . GLY B 1 290 ? 29.647  -98.489  26.908  1.00 56.19  ? 293  GLY B O   1 
ATOM   4781  N  N   . VAL B 1 291 ? 28.452  -96.636  26.452  1.00 49.75  ? 294  VAL B N   1 
ATOM   4782  C  CA  . VAL B 1 291 ? 29.207  -96.245  25.240  1.00 46.30  ? 294  VAL B CA  1 
ATOM   4783  C  C   . VAL B 1 291 ? 30.700  -96.430  25.389  1.00 46.50  ? 294  VAL B C   1 
ATOM   4784  O  O   . VAL B 1 291 ? 31.278  -96.166  26.456  1.00 46.30  ? 294  VAL B O   1 
ATOM   4785  C  CB  . VAL B 1 291 ? 29.046  -94.745  24.868  1.00 47.08  ? 294  VAL B CB  1 
ATOM   4786  C  CG1 . VAL B 1 291 ? 29.108  -94.553  23.355  1.00 46.25  ? 294  VAL B CG1 1 
ATOM   4787  C  CG2 . VAL B 1 291 ? 27.770  -94.168  25.435  1.00 45.64  ? 294  VAL B CG2 1 
ATOM   4788  N  N   . SER B 1 292 ? 31.316  -96.859  24.295  1.00 46.22  ? 295  SER B N   1 
ATOM   4789  C  CA  . SER B 1 292 ? 32.751  -96.956  24.214  1.00 47.14  ? 295  SER B CA  1 
ATOM   4790  C  C   . SER B 1 292 ? 33.309  -95.549  24.156  1.00 49.74  ? 295  SER B C   1 
ATOM   4791  O  O   . SER B 1 292 ? 32.631  -94.606  23.714  1.00 49.59  ? 295  SER B O   1 
ATOM   4792  C  CB  . SER B 1 292 ? 33.168  -97.733  22.959  1.00 46.32  ? 295  SER B CB  1 
ATOM   4793  O  OG  . SER B 1 292 ? 33.042  -96.931  21.794  1.00 41.61  ? 295  SER B OG  1 
ATOM   4794  N  N   . ARG B 1 293 ? 34.551  -95.422  24.600  1.00 51.00  ? 296  ARG B N   1 
ATOM   4795  C  CA  . ARG B 1 293 ? 35.303  -94.188  24.446  1.00 55.08  ? 296  ARG B CA  1 
ATOM   4796  C  C   . ARG B 1 293 ? 35.343  -93.754  22.977  1.00 53.61  ? 296  ARG B C   1 
ATOM   4797  O  O   . ARG B 1 293 ? 35.155  -92.576  22.677  1.00 53.98  ? 296  ARG B O   1 
ATOM   4798  C  CB  . ARG B 1 293 ? 36.723  -94.346  25.020  1.00 57.36  ? 296  ARG B CB  1 
ATOM   4799  C  CG  . ARG B 1 293 ? 36.781  -94.388  26.542  1.00 57.45  ? 296  ARG B CG  1 
ATOM   4800  C  CD  . ARG B 1 293 ? 37.756  -95.440  27.038  1.00 60.50  ? 296  ARG B CD  1 
ATOM   4801  N  NE  . ARG B 1 293 ? 38.219  -95.183  28.404  1.00 68.59  ? 296  ARG B NE  1 
ATOM   4802  C  CZ  . ARG B 1 293 ? 37.657  -95.663  29.518  1.00 70.70  ? 296  ARG B CZ  1 
ATOM   4803  N  NH1 . ARG B 1 293 ? 38.177  -95.349  30.702  1.00 69.63  ? 296  ARG B NH1 1 
ATOM   4804  N  NH2 . ARG B 1 293 ? 36.582  -96.451  29.461  1.00 68.95  ? 296  ARG B NH2 1 
ATOM   4805  N  N   . ALA B 1 294 ? 35.559  -94.707  22.068  1.00 55.06  ? 297  ALA B N   1 
ATOM   4806  C  CA  . ALA B 1 294 ? 35.735  -94.390  20.637  1.00 56.67  ? 297  ALA B CA  1 
ATOM   4807  C  C   . ALA B 1 294 ? 34.501  -93.745  19.991  1.00 54.08  ? 297  ALA B C   1 
ATOM   4808  O  O   . ALA B 1 294 ? 34.628  -92.814  19.192  1.00 52.33  ? 297  ALA B O   1 
ATOM   4809  C  CB  . ALA B 1 294 ? 36.170  -95.626  19.855  1.00 58.61  ? 297  ALA B CB  1 
ATOM   4810  N  N   . MET B 1 295 ? 33.324  -94.251  20.353  1.00 53.86  ? 298  MET B N   1 
ATOM   4811  C  CA  . MET B 1 295 ? 32.043  -93.759  19.856  1.00 55.39  ? 298  MET B CA  1 
ATOM   4812  C  C   . MET B 1 295 ? 31.742  -92.342  20.356  1.00 56.11  ? 298  MET B C   1 
ATOM   4813  O  O   . MET B 1 295 ? 31.382  -91.461  19.563  1.00 56.64  ? 298  MET B O   1 
ATOM   4814  C  CB  . MET B 1 295 ? 30.922  -94.732  20.253  1.00 56.46  ? 298  MET B CB  1 
ATOM   4815  C  CG  . MET B 1 295 ? 29.510  -94.326  19.850  1.00 58.65  ? 298  MET B CG  1 
ATOM   4816  S  SD  . MET B 1 295 ? 29.250  -94.194  18.068  1.00 64.26  ? 298  MET B SD  1 
ATOM   4817  C  CE  . MET B 1 295 ? 27.557  -94.771  17.932  1.00 64.32  ? 298  MET B CE  1 
ATOM   4818  N  N   . LEU B 1 296 ? 31.887  -92.134  21.667  1.00 54.53  ? 299  LEU B N   1 
ATOM   4819  C  CA  . LEU B 1 296 ? 31.710  -90.819  22.283  1.00 53.27  ? 299  LEU B CA  1 
ATOM   4820  C  C   . LEU B 1 296 ? 32.560  -89.741  21.584  1.00 52.55  ? 299  LEU B C   1 
ATOM   4821  O  O   . LEU B 1 296 ? 32.075  -88.654  21.291  1.00 52.87  ? 299  LEU B O   1 
ATOM   4822  C  CB  . LEU B 1 296 ? 32.050  -90.881  23.772  1.00 51.31  ? 299  LEU B CB  1 
ATOM   4823  C  CG  . LEU B 1 296 ? 31.035  -90.343  24.789  1.00 54.52  ? 299  LEU B CG  1 
ATOM   4824  C  CD1 . LEU B 1 296 ? 31.645  -90.302  26.184  1.00 52.85  ? 299  LEU B CD1 1 
ATOM   4825  C  CD2 . LEU B 1 296 ? 30.496  -88.971  24.411  1.00 54.49  ? 299  LEU B CD2 1 
ATOM   4826  N  N   . LEU B 1 297 ? 33.823  -90.052  21.314  1.00 50.54  ? 300  LEU B N   1 
ATOM   4827  C  CA  . LEU B 1 297 ? 34.680  -89.158  20.557  1.00 52.34  ? 300  LEU B CA  1 
ATOM   4828  C  C   . LEU B 1 297 ? 34.067  -88.854  19.189  1.00 54.86  ? 300  LEU B C   1 
ATOM   4829  O  O   . LEU B 1 297 ? 34.011  -87.693  18.766  1.00 56.33  ? 300  LEU B O   1 
ATOM   4830  C  CB  . LEU B 1 297 ? 36.075  -89.764  20.389  1.00 50.43  ? 300  LEU B CB  1 
ATOM   4831  C  CG  . LEU B 1 297 ? 37.059  -88.995  19.506  1.00 51.97  ? 300  LEU B CG  1 
ATOM   4832  C  CD1 . LEU B 1 297 ? 37.450  -87.669  20.139  1.00 51.70  ? 300  LEU B CD1 1 
ATOM   4833  C  CD2 . LEU B 1 297 ? 38.301  -89.826  19.223  1.00 54.36  ? 300  LEU B CD2 1 
ATOM   4834  N  N   . ARG B 1 298 ? 33.599  -89.903  18.513  1.00 55.24  ? 301  ARG B N   1 
ATOM   4835  C  CA  . ARG B 1 298 ? 33.020  -89.784  17.176  1.00 54.60  ? 301  ARG B CA  1 
ATOM   4836  C  C   . ARG B 1 298 ? 31.794  -88.879  17.209  1.00 49.05  ? 301  ARG B C   1 
ATOM   4837  O  O   . ARG B 1 298 ? 31.575  -88.103  16.287  1.00 47.42  ? 301  ARG B O   1 
ATOM   4838  C  CB  . ARG B 1 298 ? 32.678  -91.173  16.618  1.00 61.97  ? 301  ARG B CB  1 
ATOM   4839  C  CG  . ARG B 1 298 ? 32.204  -91.187  15.171  1.00 66.85  ? 301  ARG B CG  1 
ATOM   4840  C  CD  . ARG B 1 298 ? 32.062  -92.609  14.645  1.00 72.46  ? 301  ARG B CD  1 
ATOM   4841  N  NE  . ARG B 1 298 ? 33.228  -93.025  13.868  1.00 73.72  ? 301  ARG B NE  1 
ATOM   4842  C  CZ  . ARG B 1 298 ? 34.116  -93.932  14.263  1.00 73.49  ? 301  ARG B CZ  1 
ATOM   4843  N  NH1 . ARG B 1 298 ? 33.978  -94.548  15.433  1.00 75.09  ? 301  ARG B NH1 1 
ATOM   4844  N  NH2 . ARG B 1 298 ? 35.143  -94.226  13.478  1.00 72.19  ? 301  ARG B NH2 1 
ATOM   4845  N  N   . LEU B 1 299 ? 31.028  -88.982  18.293  1.00 45.12  ? 302  LEU B N   1 
ATOM   4846  C  CA  . LEU B 1 299 ? 29.900  -88.102  18.572  1.00 43.51  ? 302  LEU B CA  1 
ATOM   4847  C  C   . LEU B 1 299 ? 30.344  -86.654  18.836  1.00 45.29  ? 302  LEU B C   1 
ATOM   4848  O  O   . LEU B 1 299 ? 29.771  -85.702  18.267  1.00 43.97  ? 302  LEU B O   1 
ATOM   4849  C  CB  . LEU B 1 299 ? 29.106  -88.616  19.777  1.00 41.55  ? 302  LEU B CB  1 
ATOM   4850  C  CG  . LEU B 1 299 ? 28.335  -89.935  19.713  1.00 41.88  ? 302  LEU B CG  1 
ATOM   4851  C  CD1 . LEU B 1 299 ? 27.657  -90.197  21.048  1.00 40.45  ? 302  LEU B CD1 1 
ATOM   4852  C  CD2 . LEU B 1 299 ? 27.311  -89.939  18.581  1.00 41.71  ? 302  LEU B CD2 1 
ATOM   4853  N  N   . PHE B 1 300 ? 31.352  -86.494  19.700  1.00 43.81  ? 303  PHE B N   1 
ATOM   4854  C  CA  . PHE B 1 300 ? 31.877  -85.173  20.045  1.00 42.38  ? 303  PHE B CA  1 
ATOM   4855  C  C   . PHE B 1 300 ? 32.366  -84.461  18.794  1.00 40.33  ? 303  PHE B C   1 
ATOM   4856  O  O   . PHE B 1 300 ? 31.880  -83.387  18.467  1.00 38.53  ? 303  PHE B O   1 
ATOM   4857  C  CB  . PHE B 1 300 ? 32.997  -85.253  21.095  1.00 44.95  ? 303  PHE B CB  1 
ATOM   4858  C  CG  . PHE B 1 300 ? 33.574  -83.910  21.460  1.00 43.13  ? 303  PHE B CG  1 
ATOM   4859  C  CD1 . PHE B 1 300 ? 32.860  -83.025  22.280  1.00 43.82  ? 303  PHE B CD1 1 
ATOM   4860  C  CD2 . PHE B 1 300 ? 34.810  -83.515  20.963  1.00 42.33  ? 303  PHE B CD2 1 
ATOM   4861  C  CE1 . PHE B 1 300 ? 33.377  -81.776  22.607  1.00 42.33  ? 303  PHE B CE1 1 
ATOM   4862  C  CE2 . PHE B 1 300 ? 35.334  -82.269  21.283  1.00 45.32  ? 303  PHE B CE2 1 
ATOM   4863  C  CZ  . PHE B 1 300 ? 34.617  -81.401  22.109  1.00 44.09  ? 303  PHE B CZ  1 
ATOM   4864  N  N   . LEU B 1 301 ? 33.291  -85.096  18.081  1.00 40.72  ? 304  LEU B N   1 
ATOM   4865  C  CA  . LEU B 1 301 ? 33.781  -84.600  16.799  1.00 40.50  ? 304  LEU B CA  1 
ATOM   4866  C  C   . LEU B 1 301 ? 32.682  -84.254  15.782  1.00 40.20  ? 304  LEU B C   1 
ATOM   4867  O  O   . LEU B 1 301 ? 32.842  -83.320  14.985  1.00 41.85  ? 304  LEU B O   1 
ATOM   4868  C  CB  . LEU B 1 301 ? 34.748  -85.608  16.183  1.00 41.90  ? 304  LEU B CB  1 
ATOM   4869  C  CG  . LEU B 1 301 ? 36.081  -85.895  16.881  1.00 44.56  ? 304  LEU B CG  1 
ATOM   4870  C  CD1 . LEU B 1 301 ? 36.956  -86.771  15.991  1.00 43.22  ? 304  LEU B CD1 1 
ATOM   4871  C  CD2 . LEU B 1 301 ? 36.806  -84.600  17.225  1.00 47.11  ? 304  LEU B CD2 1 
ATOM   4872  N  N   . ALA B 1 302 ? 31.586  -85.015  15.807  1.00 39.02  ? 305  ALA B N   1 
ATOM   4873  C  CA  . ALA B 1 302 ? 30.488  -84.860  14.848  1.00 38.66  ? 305  ALA B CA  1 
ATOM   4874  C  C   . ALA B 1 302 ? 29.584  -83.680  15.199  1.00 38.79  ? 305  ALA B C   1 
ATOM   4875  O  O   . ALA B 1 302 ? 29.006  -83.038  14.308  1.00 39.23  ? 305  ALA B O   1 
ATOM   4876  C  CB  . ALA B 1 302 ? 29.667  -86.138  14.778  1.00 38.75  ? 305  ALA B CB  1 
ATOM   4877  N  N   . MET B 1 303 ? 29.454  -83.420  16.501  1.00 38.74  ? 306  MET B N   1 
ATOM   4878  C  CA  . MET B 1 303 ? 28.708  -82.279  17.006  1.00 37.74  ? 306  MET B CA  1 
ATOM   4879  C  C   . MET B 1 303 ? 29.170  -80.942  16.421  1.00 36.74  ? 306  MET B C   1 
ATOM   4880  O  O   . MET B 1 303 ? 28.364  -80.027  16.287  1.00 34.78  ? 306  MET B O   1 
ATOM   4881  C  CB  . MET B 1 303 ? 28.736  -82.258  18.527  1.00 38.53  ? 306  MET B CB  1 
ATOM   4882  C  CG  . MET B 1 303 ? 28.107  -81.021  19.159  1.00 38.99  ? 306  MET B CG  1 
ATOM   4883  S  SD  . MET B 1 303 ? 27.860  -81.244  20.931  1.00 44.46  ? 306  MET B SD  1 
ATOM   4884  C  CE  . MET B 1 303 ? 29.537  -81.538  21.485  1.00 38.98  ? 306  MET B CE  1 
ATOM   4885  N  N   . GLU B 1 304 ? 30.443  -80.833  16.044  1.00 37.71  ? 307  GLU B N   1 
ATOM   4886  C  CA  . GLU B 1 304 ? 30.916  -79.609  15.400  1.00 39.54  ? 307  GLU B CA  1 
ATOM   4887  C  C   . GLU B 1 304 ? 30.016  -79.185  14.251  1.00 40.88  ? 307  GLU B C   1 
ATOM   4888  O  O   . GLU B 1 304 ? 29.641  -78.016  14.146  1.00 44.82  ? 307  GLU B O   1 
ATOM   4889  C  CB  . GLU B 1 304 ? 32.362  -79.708  14.910  1.00 39.06  ? 307  GLU B CB  1 
ATOM   4890  C  CG  . GLU B 1 304 ? 32.873  -78.349  14.429  1.00 41.90  ? 307  GLU B CG  1 
ATOM   4891  C  CD  . GLU B 1 304 ? 34.083  -78.410  13.516  1.00 44.57  ? 307  GLU B CD  1 
ATOM   4892  O  OE1 . GLU B 1 304 ? 34.894  -79.357  13.637  1.00 48.59  ? 307  GLU B OE1 1 
ATOM   4893  O  OE2 . GLU B 1 304 ? 34.230  -77.491  12.678  1.00 43.84  ? 307  GLU B OE2 1 
ATOM   4894  N  N   . LYS B 1 305 ? 29.670  -80.141  13.395  1.00 42.19  ? 308  LYS B N   1 
ATOM   4895  C  CA  . LYS B 1 305 ? 28.840  -79.884  12.221  1.00 42.07  ? 308  LYS B CA  1 
ATOM   4896  C  C   . LYS B 1 305 ? 27.405  -80.330  12.497  1.00 40.57  ? 308  LYS B C   1 
ATOM   4897  O  O   . LYS B 1 305 ? 26.566  -80.352  11.594  1.00 40.11  ? 308  LYS B O   1 
ATOM   4898  C  CB  . LYS B 1 305 ? 29.402  -80.628  11.000  1.00 44.34  ? 308  LYS B CB  1 
ATOM   4899  C  CG  . LYS B 1 305 ? 30.848  -80.286  10.653  1.00 48.82  ? 308  LYS B CG  1 
ATOM   4900  C  CD  . LYS B 1 305 ? 30.993  -78.950  9.916   1.00 51.68  ? 308  LYS B CD  1 
ATOM   4901  C  CE  . LYS B 1 305 ? 30.462  -79.016  8.482   1.00 53.18  ? 308  LYS B CE  1 
ATOM   4902  N  NZ  . LYS B 1 305 ? 30.888  -77.868  7.628   1.00 51.85  ? 308  LYS B NZ  1 
ATOM   4903  N  N   . GLY B 1 306 ? 27.142  -80.691  13.751  1.00 38.79  ? 309  GLY B N   1 
ATOM   4904  C  CA  . GLY B 1 306 ? 25.820  -81.119  14.205  1.00 38.00  ? 309  GLY B CA  1 
ATOM   4905  C  C   . GLY B 1 306 ? 25.371  -82.462  13.654  1.00 40.42  ? 309  GLY B C   1 
ATOM   4906  O  O   . GLY B 1 306 ? 24.172  -82.686  13.492  1.00 36.81  ? 309  GLY B O   1 
ATOM   4907  N  N   . ARG B 1 307 ? 26.325  -83.358  13.383  1.00 41.22  ? 310  ARG B N   1 
ATOM   4908  C  CA  . ARG B 1 307 ? 26.016  -84.634  12.731  1.00 42.12  ? 310  ARG B CA  1 
ATOM   4909  C  C   . ARG B 1 307 ? 25.984  -85.828  13.687  1.00 40.62  ? 310  ARG B C   1 
ATOM   4910  O  O   . ARG B 1 307 ? 25.909  -86.974  13.258  1.00 40.89  ? 310  ARG B O   1 
ATOM   4911  C  CB  . ARG B 1 307 ? 26.959  -84.897  11.546  1.00 44.87  ? 310  ARG B CB  1 
ATOM   4912  C  CG  . ARG B 1 307 ? 26.795  -83.935  10.373  1.00 48.39  ? 310  ARG B CG  1 
ATOM   4913  C  CD  . ARG B 1 307 ? 27.459  -84.487  9.115   1.00 55.45  ? 310  ARG B CD  1 
ATOM   4914  N  NE  . ARG B 1 307 ? 27.818  -83.442  8.150   1.00 61.48  ? 310  ARG B NE  1 
ATOM   4915  C  CZ  . ARG B 1 307 ? 29.069  -83.090  7.826   1.00 64.08  ? 310  ARG B CZ  1 
ATOM   4916  N  NH1 . ARG B 1 307 ? 30.114  -83.703  8.383   1.00 61.70  ? 310  ARG B NH1 1 
ATOM   4917  N  NH2 . ARG B 1 307 ? 29.278  -82.121  6.931   1.00 59.08  ? 310  ARG B NH2 1 
ATOM   4918  N  N   . HIS B 1 308 ? 25.984  -85.553  14.982  1.00 37.76  ? 311  HIS B N   1 
ATOM   4919  C  CA  . HIS B 1 308 ? 26.076  -86.602  15.993  1.00 37.64  ? 311  HIS B CA  1 
ATOM   4920  C  C   . HIS B 1 308 ? 24.830  -87.445  16.140  1.00 39.30  ? 311  HIS B C   1 
ATOM   4921  O  O   . HIS B 1 308 ? 24.892  -88.583  16.621  1.00 39.92  ? 311  HIS B O   1 
ATOM   4922  C  CB  . HIS B 1 308 ? 26.518  -86.007  17.333  1.00 35.34  ? 311  HIS B CB  1 
ATOM   4923  C  CG  . HIS B 1 308 ? 25.665  -84.851  17.795  1.00 32.61  ? 311  HIS B CG  1 
ATOM   4924  N  ND1 . HIS B 1 308 ? 25.747  -83.624  17.245  1.00 30.92  ? 311  HIS B ND1 1 
ATOM   4925  C  CD2 . HIS B 1 308 ? 24.684  -84.779  18.776  1.00 31.37  ? 311  HIS B CD2 1 
ATOM   4926  C  CE1 . HIS B 1 308 ? 24.868  -82.810  17.838  1.00 31.86  ? 311  HIS B CE1 1 
ATOM   4927  N  NE2 . HIS B 1 308 ? 24.216  -83.518  18.780  1.00 33.68  ? 311  HIS B NE2 1 
ATOM   4928  N  N   . MET B 1 309 ? 23.691  -86.918  15.705  1.00 39.73  ? 312  MET B N   1 
ATOM   4929  C  CA  . MET B 1 309 ? 22.440  -87.684  15.728  1.00 40.85  ? 312  MET B CA  1 
ATOM   4930  C  C   . MET B 1 309 ? 22.326  -88.596  14.518  1.00 41.24  ? 312  MET B C   1 
ATOM   4931  O  O   . MET B 1 309 ? 21.456  -89.462  14.463  1.00 37.46  ? 312  MET B O   1 
ATOM   4932  C  CB  . MET B 1 309 ? 21.255  -86.742  15.710  1.00 45.25  ? 312  MET B CB  1 
ATOM   4933  C  CG  . MET B 1 309 ? 21.435  -85.523  16.581  1.00 49.35  ? 312  MET B CG  1 
ATOM   4934  S  SD  . MET B 1 309 ? 20.863  -85.909  18.223  1.00 60.17  ? 312  MET B SD  1 
ATOM   4935  C  CE  . MET B 1 309 ? 19.155  -85.389  18.083  1.00 48.38  ? 312  MET B CE  1 
ATOM   4936  N  N   . GLU B 1 310 ? 23.193  -88.381  13.536  1.00 40.85  ? 313  GLU B N   1 
ATOM   4937  C  CA  . GLU B 1 310 ? 23.198  -89.197  12.335  1.00 42.93  ? 313  GLU B CA  1 
ATOM   4938  C  C   . GLU B 1 310 ? 23.832  -90.573  12.546  1.00 44.90  ? 313  GLU B C   1 
ATOM   4939  O  O   . GLU B 1 310 ? 23.799  -91.408  11.636  1.00 45.85  ? 313  GLU B O   1 
ATOM   4940  C  CB  . GLU B 1 310 ? 23.885  -88.444  11.178  1.00 44.04  ? 313  GLU B CB  1 
ATOM   4941  C  CG  . GLU B 1 310 ? 23.174  -87.153  10.788  1.00 41.14  ? 313  GLU B CG  1 
ATOM   4942  C  CD  . GLU B 1 310 ? 23.839  -86.420  9.644   1.00 42.89  ? 313  GLU B CD  1 
ATOM   4943  O  OE1 . GLU B 1 310 ? 24.938  -86.830  9.212   1.00 45.04  ? 313  GLU B OE1 1 
ATOM   4944  O  OE2 . GLU B 1 310 ? 23.257  -85.422  9.173   1.00 43.73  ? 313  GLU B OE2 1 
ATOM   4945  N  N   . TYR B 1 311 ? 24.390  -90.813  13.738  1.00 45.59  ? 314  TYR B N   1 
ATOM   4946  C  CA  . TYR B 1 311 ? 25.117  -92.057  14.031  1.00 47.46  ? 314  TYR B CA  1 
ATOM   4947  C  C   . TYR B 1 311 ? 24.269  -93.103  14.736  1.00 48.36  ? 314  TYR B C   1 
ATOM   4948  O  O   . TYR B 1 311 ? 24.495  -94.310  14.584  1.00 48.95  ? 314  TYR B O   1 
ATOM   4949  C  CB  . TYR B 1 311 ? 26.400  -91.787  14.842  1.00 48.85  ? 314  TYR B CB  1 
ATOM   4950  C  CG  . TYR B 1 311 ? 27.518  -91.189  14.011  1.00 54.06  ? 314  TYR B CG  1 
ATOM   4951  C  CD1 . TYR B 1 311 ? 27.483  -89.846  13.621  1.00 54.03  ? 314  TYR B CD1 1 
ATOM   4952  C  CD2 . TYR B 1 311 ? 28.601  -91.962  13.594  1.00 56.77  ? 314  TYR B CD2 1 
ATOM   4953  C  CE1 . TYR B 1 311 ? 28.488  -89.290  12.845  1.00 54.38  ? 314  TYR B CE1 1 
ATOM   4954  C  CE2 . TYR B 1 311 ? 29.611  -91.412  12.809  1.00 58.01  ? 314  TYR B CE2 1 
ATOM   4955  C  CZ  . TYR B 1 311 ? 29.553  -90.072  12.444  1.00 56.61  ? 314  TYR B CZ  1 
ATOM   4956  O  OH  . TYR B 1 311 ? 30.550  -89.507  11.672  1.00 52.34  ? 314  TYR B OH  1 
ATOM   4957  N  N   . GLU B 1 312 ? 23.271  -92.636  15.473  1.00 50.09  ? 315  GLU B N   1 
ATOM   4958  C  CA  . GLU B 1 312 ? 22.562  -93.450  16.475  1.00 54.79  ? 315  GLU B CA  1 
ATOM   4959  C  C   . GLU B 1 312 ? 23.373  -94.539  17.182  1.00 53.95  ? 315  GLU B C   1 
ATOM   4960  O  O   . GLU B 1 312 ? 24.242  -95.241  16.641  1.00 48.47  ? 315  GLU B O   1 
ATOM   4961  C  CB  . GLU B 1 312 ? 21.140  -93.909  16.060  1.00 59.22  ? 315  GLU B CB  1 
ATOM   4962  C  CG  . GLU B 1 312 ? 20.224  -94.226  17.254  1.00 59.49  ? 315  GLU B CG  1 
ATOM   4963  C  CD  . GLU B 1 312 ? 18.848  -93.546  17.221  1.00 65.28  ? 315  GLU B CD  1 
ATOM   4964  O  OE1 . GLU B 1 312 ? 18.549  -92.737  16.308  1.00 63.01  ? 315  GLU B OE1 1 
ATOM   4965  O  OE2 . GLU B 1 312 ? 18.045  -93.820  18.143  1.00 66.97  ? 315  GLU B OE2 1 
ATOM   4966  N  N   . CYS B 1 313 ? 22.981  -94.673  18.426  1.00 55.07  ? 316  CYS B N   1 
ATOM   4967  C  CA  . CYS B 1 313 ? 23.820  -95.035  19.484  1.00 54.22  ? 316  CYS B CA  1 
ATOM   4968  C  C   . CYS B 1 313 ? 22.666  -95.195  20.426  1.00 56.45  ? 316  CYS B C   1 
ATOM   4969  O  O   . CYS B 1 313 ? 22.026  -94.201  20.782  1.00 60.51  ? 316  CYS B O   1 
ATOM   4970  C  CB  . CYS B 1 313 ? 24.643  -93.798  19.835  1.00 53.56  ? 316  CYS B CB  1 
ATOM   4971  S  SG  . CYS B 1 313 ? 25.837  -93.968  21.169  1.00 53.62  ? 316  CYS B SG  1 
ATOM   4972  N  N   . PRO B 1 314 ? 22.322  -96.447  20.763  1.00 57.12  ? 317  PRO B N   1 
ATOM   4973  C  CA  . PRO B 1 314 ? 21.233  -96.674  21.715  1.00 54.65  ? 317  PRO B CA  1 
ATOM   4974  C  C   . PRO B 1 314 ? 21.423  -95.810  22.961  1.00 52.31  ? 317  PRO B C   1 
ATOM   4975  O  O   . PRO B 1 314 ? 20.456  -95.509  23.669  1.00 51.89  ? 317  PRO B O   1 
ATOM   4976  C  CB  . PRO B 1 314 ? 21.376  -98.164  22.076  1.00 52.69  ? 317  PRO B CB  1 
ATOM   4977  C  CG  . PRO B 1 314 ? 22.703  -98.590  21.543  1.00 53.30  ? 317  PRO B CG  1 
ATOM   4978  C  CD  . PRO B 1 314 ? 22.973  -97.706  20.363  1.00 54.62  ? 317  PRO B CD  1 
ATOM   4979  N  N   . TYR B 1 315 ? 22.672  -95.408  23.191  1.00 48.58  ? 318  TYR B N   1 
ATOM   4980  C  CA  . TYR B 1 315 ? 23.058  -94.669  24.389  1.00 48.19  ? 318  TYR B CA  1 
ATOM   4981  C  C   . TYR B 1 315 ? 22.728  -93.169  24.342  1.00 45.11  ? 318  TYR B C   1 
ATOM   4982  O  O   . TYR B 1 315 ? 22.379  -92.591  25.372  1.00 42.74  ? 318  TYR B O   1 
ATOM   4983  C  CB  . TYR B 1 315 ? 24.543  -94.892  24.704  1.00 49.47  ? 318  TYR B CB  1 
ATOM   4984  C  CG  . TYR B 1 315 ? 24.938  -96.350  24.856  1.00 52.38  ? 318  TYR B CG  1 
ATOM   4985  C  CD1 . TYR B 1 315 ? 24.473  -97.108  25.933  1.00 52.55  ? 318  TYR B CD1 1 
ATOM   4986  C  CD2 . TYR B 1 315 ? 25.777  -96.972  23.921  1.00 53.83  ? 318  TYR B CD2 1 
ATOM   4987  C  CE1 . TYR B 1 315 ? 24.826  -98.436  26.078  1.00 54.91  ? 318  TYR B CE1 1 
ATOM   4988  C  CE2 . TYR B 1 315 ? 26.140  -98.305  24.062  1.00 55.73  ? 318  TYR B CE2 1 
ATOM   4989  C  CZ  . TYR B 1 315 ? 25.660  -99.029  25.145  1.00 57.08  ? 318  TYR B CZ  1 
ATOM   4990  O  OH  . TYR B 1 315 ? 25.999  -100.353 25.306  1.00 62.40  ? 318  TYR B OH  1 
ATOM   4991  N  N   . LEU B 1 316 ? 22.831  -92.543  23.168  1.00 41.11  ? 319  LEU B N   1 
ATOM   4992  C  CA  . LEU B 1 316 ? 22.443  -91.131  23.036  1.00 39.80  ? 319  LEU B CA  1 
ATOM   4993  C  C   . LEU B 1 316 ? 20.932  -91.008  22.870  1.00 38.90  ? 319  LEU B C   1 
ATOM   4994  O  O   . LEU B 1 316 ? 20.377  -91.494  21.892  1.00 40.16  ? 319  LEU B O   1 
ATOM   4995  C  CB  . LEU B 1 316 ? 23.191  -90.454  21.881  1.00 36.36  ? 319  LEU B CB  1 
ATOM   4996  C  CG  . LEU B 1 316 ? 22.901  -88.983  21.547  1.00 36.22  ? 319  LEU B CG  1 
ATOM   4997  C  CD1 . LEU B 1 316 ? 23.163  -88.020  22.707  1.00 35.78  ? 319  LEU B CD1 1 
ATOM   4998  C  CD2 . LEU B 1 316 ? 23.712  -88.585  20.325  1.00 34.43  ? 319  LEU B CD2 1 
ATOM   4999  N  N   . VAL B 1 317 ? 20.266  -90.386  23.842  1.00 39.44  ? 320  VAL B N   1 
ATOM   5000  C  CA  . VAL B 1 317 ? 18.806  -90.205  23.774  1.00 40.62  ? 320  VAL B CA  1 
ATOM   5001  C  C   . VAL B 1 317 ? 18.430  -88.720  23.683  1.00 42.32  ? 320  VAL B C   1 
ATOM   5002  O  O   . VAL B 1 317 ? 19.089  -87.870  24.285  1.00 43.35  ? 320  VAL B O   1 
ATOM   5003  C  CB  . VAL B 1 317 ? 18.078  -90.898  24.950  1.00 39.81  ? 320  VAL B CB  1 
ATOM   5004  C  CG1 . VAL B 1 317 ? 16.589  -90.571  24.950  1.00 39.73  ? 320  VAL B CG1 1 
ATOM   5005  C  CG2 . VAL B 1 317 ? 18.281  -92.407  24.881  1.00 39.15  ? 320  VAL B CG2 1 
ATOM   5006  N  N   . TYR B 1 318 ? 17.388  -88.417  22.910  1.00 41.80  ? 321  TYR B N   1 
ATOM   5007  C  CA  . TYR B 1 318 ? 16.874  -87.058  22.790  1.00 40.28  ? 321  TYR B CA  1 
ATOM   5008  C  C   . TYR B 1 318 ? 15.376  -87.011  23.013  1.00 40.40  ? 321  TYR B C   1 
ATOM   5009  O  O   . TYR B 1 318 ? 14.642  -87.825  22.450  1.00 41.41  ? 321  TYR B O   1 
ATOM   5010  C  CB  . TYR B 1 318 ? 17.207  -86.445  21.423  1.00 40.16  ? 321  TYR B CB  1 
ATOM   5011  C  CG  . TYR B 1 318 ? 16.431  -85.174  21.178  1.00 40.41  ? 321  TYR B CG  1 
ATOM   5012  C  CD1 . TYR B 1 318 ? 16.814  -83.978  21.787  1.00 41.38  ? 321  TYR B CD1 1 
ATOM   5013  C  CD2 . TYR B 1 318 ? 15.285  -85.171  20.382  1.00 38.40  ? 321  TYR B CD2 1 
ATOM   5014  C  CE1 . TYR B 1 318 ? 16.094  -82.804  21.581  1.00 39.41  ? 321  TYR B CE1 1 
ATOM   5015  C  CE2 . TYR B 1 318 ? 14.546  -84.006  20.184  1.00 39.30  ? 321  TYR B CE2 1 
ATOM   5016  C  CZ  . TYR B 1 318 ? 14.962  -82.829  20.789  1.00 38.85  ? 321  TYR B CZ  1 
ATOM   5017  O  OH  . TYR B 1 318 ? 14.259  -81.680  20.600  1.00 37.65  ? 321  TYR B OH  1 
ATOM   5018  N  N   . VAL B 1 319 ? 14.932  -86.049  23.825  1.00 38.88  ? 322  VAL B N   1 
ATOM   5019  C  CA  . VAL B 1 319 ? 13.506  -85.774  24.050  1.00 38.60  ? 322  VAL B CA  1 
ATOM   5020  C  C   . VAL B 1 319 ? 13.254  -84.262  24.165  1.00 38.00  ? 322  VAL B C   1 
ATOM   5021  O  O   . VAL B 1 319 ? 14.032  -83.546  24.799  1.00 37.97  ? 322  VAL B O   1 
ATOM   5022  C  CB  . VAL B 1 319 ? 12.991  -86.387  25.366  1.00 39.89  ? 322  VAL B CB  1 
ATOM   5023  C  CG1 . VAL B 1 319 ? 11.468  -86.446  25.376  1.00 36.93  ? 322  VAL B CG1 1 
ATOM   5024  C  CG2 . VAL B 1 319 ? 13.596  -87.759  25.609  1.00 42.33  ? 322  VAL B CG2 1 
ATOM   5025  N  N   . PRO B 1 320 ? 12.167  -83.771  23.544  1.00 36.43  ? 323  PRO B N   1 
ATOM   5026  C  CA  . PRO B 1 320 ? 11.715  -82.415  23.794  1.00 35.24  ? 323  PRO B CA  1 
ATOM   5027  C  C   . PRO B 1 320 ? 10.889  -82.386  25.061  1.00 34.02  ? 323  PRO B C   1 
ATOM   5028  O  O   . PRO B 1 320 ? 9.957   -83.185  25.193  1.00 33.77  ? 323  PRO B O   1 
ATOM   5029  C  CB  . PRO B 1 320 ? 10.819  -82.098  22.580  1.00 35.12  ? 323  PRO B CB  1 
ATOM   5030  C  CG  . PRO B 1 320 ? 11.001  -83.210  21.615  1.00 35.54  ? 323  PRO B CG  1 
ATOM   5031  C  CD  . PRO B 1 320 ? 11.446  -84.394  22.417  1.00 36.55  ? 323  PRO B CD  1 
ATOM   5032  N  N   . VAL B 1 321 ? 11.214  -81.468  25.975  1.00 35.35  ? 324  VAL B N   1 
ATOM   5033  C  CA  . VAL B 1 321 ? 10.555  -81.413  27.297  1.00 35.34  ? 324  VAL B CA  1 
ATOM   5034  C  C   . VAL B 1 321 ? 10.137  -80.026  27.766  1.00 38.23  ? 324  VAL B C   1 
ATOM   5035  O  O   . VAL B 1 321 ? 10.628  -79.004  27.259  1.00 39.98  ? 324  VAL B O   1 
ATOM   5036  C  CB  . VAL B 1 321 ? 11.436  -82.036  28.399  1.00 36.55  ? 324  VAL B CB  1 
ATOM   5037  C  CG1 . VAL B 1 321 ? 11.731  -83.497  28.081  1.00 34.03  ? 324  VAL B CG1 1 
ATOM   5038  C  CG2 . VAL B 1 321 ? 12.729  -81.236  28.596  1.00 35.72  ? 324  VAL B CG2 1 
ATOM   5039  N  N   . VAL B 1 322 ? 9.237   -80.003  28.751  1.00 38.57  ? 325  VAL B N   1 
ATOM   5040  C  CA  . VAL B 1 322 ? 8.783   -78.764  29.373  1.00 37.49  ? 325  VAL B CA  1 
ATOM   5041  C  C   . VAL B 1 322 ? 9.239   -78.648  30.829  1.00 37.98  ? 325  VAL B C   1 
ATOM   5042  O  O   . VAL B 1 322 ? 9.325   -77.542  31.376  1.00 37.25  ? 325  VAL B O   1 
ATOM   5043  C  CB  . VAL B 1 322 ? 7.246   -78.604  29.309  1.00 39.08  ? 325  VAL B CB  1 
ATOM   5044  C  CG1 . VAL B 1 322 ? 6.777   -78.512  27.866  1.00 35.81  ? 325  VAL B CG1 1 
ATOM   5045  C  CG2 . VAL B 1 322 ? 6.551   -79.739  30.049  1.00 40.45  ? 325  VAL B CG2 1 
ATOM   5046  N  N   . ALA B 1 323 ? 9.515   -79.797  31.448  1.00 38.11  ? 326  ALA B N   1 
ATOM   5047  C  CA  . ALA B 1 323 ? 10.020  -79.878  32.824  1.00 36.42  ? 326  ALA B CA  1 
ATOM   5048  C  C   . ALA B 1 323 ? 10.915  -81.099  32.998  1.00 36.98  ? 326  ALA B C   1 
ATOM   5049  O  O   . ALA B 1 323 ? 10.907  -81.999  32.156  1.00 34.35  ? 326  ALA B O   1 
ATOM   5050  C  CB  . ALA B 1 323 ? 8.875   -79.906  33.820  1.00 34.80  ? 326  ALA B CB  1 
ATOM   5051  N  N   . PHE B 1 324 ? 11.694  -81.108  34.080  1.00 38.44  ? 327  PHE B N   1 
ATOM   5052  C  CA  . PHE B 1 324 ? 12.571  -82.231  34.415  1.00 41.10  ? 327  PHE B CA  1 
ATOM   5053  C  C   . PHE B 1 324 ? 12.997  -82.254  35.894  1.00 45.14  ? 327  PHE B C   1 
ATOM   5054  O  O   . PHE B 1 324 ? 12.832  -81.270  36.618  1.00 43.03  ? 327  PHE B O   1 
ATOM   5055  C  CB  . PHE B 1 324 ? 13.800  -82.249  33.508  1.00 40.18  ? 327  PHE B CB  1 
ATOM   5056  C  CG  . PHE B 1 324 ? 14.864  -81.268  33.900  1.00 42.04  ? 327  PHE B CG  1 
ATOM   5057  C  CD1 . PHE B 1 324 ? 15.969  -81.680  34.637  1.00 43.69  ? 327  PHE B CD1 1 
ATOM   5058  C  CD2 . PHE B 1 324 ? 14.772  -79.930  33.524  1.00 43.28  ? 327  PHE B CD2 1 
ATOM   5059  C  CE1 . PHE B 1 324 ? 16.961  -80.776  35.003  1.00 43.56  ? 327  PHE B CE1 1 
ATOM   5060  C  CE2 . PHE B 1 324 ? 15.757  -79.021  33.889  1.00 43.17  ? 327  PHE B CE2 1 
ATOM   5061  C  CZ  . PHE B 1 324 ? 16.851  -79.442  34.628  1.00 43.30  ? 327  PHE B CZ  1 
ATOM   5062  N  N   . ARG B 1 325 ? 13.523  -83.399  36.333  1.00 47.57  ? 328  ARG B N   1 
ATOM   5063  C  CA  . ARG B 1 325 ? 14.146  -83.525  37.650  1.00 49.19  ? 328  ARG B CA  1 
ATOM   5064  C  C   . ARG B 1 325 ? 15.302  -84.499  37.611  1.00 50.16  ? 328  ARG B C   1 
ATOM   5065  O  O   . ARG B 1 325 ? 15.201  -85.588  37.040  1.00 50.96  ? 328  ARG B O   1 
ATOM   5066  C  CB  . ARG B 1 325 ? 13.164  -83.979  38.728  1.00 50.45  ? 328  ARG B CB  1 
ATOM   5067  C  CG  . ARG B 1 325 ? 13.847  -84.115  40.090  1.00 51.22  ? 328  ARG B CG  1 
ATOM   5068  C  CD  . ARG B 1 325 ? 13.001  -84.842  41.117  1.00 49.56  ? 328  ARG B CD  1 
ATOM   5069  N  NE  . ARG B 1 325 ? 11.828  -84.064  41.495  1.00 49.50  ? 328  ARG B NE  1 
ATOM   5070  C  CZ  . ARG B 1 325 ? 10.972  -84.417  42.446  1.00 49.17  ? 328  ARG B CZ  1 
ATOM   5071  N  NH1 . ARG B 1 325 ? 11.158  -85.543  43.126  1.00 46.60  ? 328  ARG B NH1 1 
ATOM   5072  N  NH2 . ARG B 1 325 ? 9.923   -83.643  42.710  1.00 49.40  ? 328  ARG B NH2 1 
ATOM   5073  N  N   . LEU B 1 326 ? 16.392  -84.098  38.244  1.00 49.56  ? 329  LEU B N   1 
ATOM   5074  C  CA  . LEU B 1 326 ? 17.580  -84.908  38.331  1.00 51.56  ? 329  LEU B CA  1 
ATOM   5075  C  C   . LEU B 1 326 ? 18.019  -84.935  39.797  1.00 55.79  ? 329  LEU B C   1 
ATOM   5076  O  O   . LEU B 1 326 ? 18.172  -83.879  40.419  1.00 53.19  ? 329  LEU B O   1 
ATOM   5077  C  CB  . LEU B 1 326 ? 18.654  -84.294  37.441  1.00 50.05  ? 329  LEU B CB  1 
ATOM   5078  C  CG  . LEU B 1 326 ? 20.008  -84.960  37.222  1.00 49.04  ? 329  LEU B CG  1 
ATOM   5079  C  CD1 . LEU B 1 326 ? 19.860  -86.392  36.732  1.00 46.43  ? 329  LEU B CD1 1 
ATOM   5080  C  CD2 . LEU B 1 326 ? 20.774  -84.115  36.215  1.00 49.70  ? 329  LEU B CD2 1 
ATOM   5081  N  N   . GLU B 1 327 ? 18.166  -86.136  40.360  1.00 60.64  ? 330  GLU B N   1 
ATOM   5082  C  CA  . GLU B 1 327 ? 18.720  -86.283  41.713  1.00 62.35  ? 330  GLU B CA  1 
ATOM   5083  C  C   . GLU B 1 327 ? 19.747  -87.390  41.750  1.00 66.08  ? 330  GLU B C   1 
ATOM   5084  O  O   . GLU B 1 327 ? 19.399  -88.546  41.529  1.00 70.27  ? 330  GLU B O   1 
ATOM   5085  C  CB  . GLU B 1 327 ? 17.663  -86.625  42.769  1.00 59.55  ? 330  GLU B CB  1 
ATOM   5086  C  CG  . GLU B 1 327 ? 16.206  -86.625  42.337  1.00 65.43  ? 330  GLU B CG  1 
ATOM   5087  C  CD  . GLU B 1 327 ? 15.326  -87.453  43.266  1.00 65.34  ? 330  GLU B CD  1 
ATOM   5088  O  OE1 . GLU B 1 327 ? 15.809  -87.840  44.356  1.00 66.07  ? 330  GLU B OE1 1 
ATOM   5089  O  OE2 . GLU B 1 327 ? 14.151  -87.721  42.912  1.00 61.19  ? 330  GLU B OE2 1 
ATOM   5090  N  N   . PRO B 1 328 ? 21.021  -87.044  41.994  1.00 69.36  ? 331  PRO B N   1 
ATOM   5091  C  CA  . PRO B 1 328 ? 21.894  -88.023  42.647  1.00 75.08  ? 331  PRO B CA  1 
ATOM   5092  C  C   . PRO B 1 328 ? 21.607  -87.962  44.165  1.00 82.39  ? 331  PRO B C   1 
ATOM   5093  O  O   . PRO B 1 328 ? 21.598  -86.861  44.716  1.00 85.89  ? 331  PRO B O   1 
ATOM   5094  C  CB  . PRO B 1 328 ? 23.308  -87.521  42.326  1.00 72.53  ? 331  PRO B CB  1 
ATOM   5095  C  CG  . PRO B 1 328 ? 23.148  -86.416  41.330  1.00 67.67  ? 331  PRO B CG  1 
ATOM   5096  C  CD  . PRO B 1 328 ? 21.764  -85.878  41.488  1.00 65.72  ? 331  PRO B CD  1 
ATOM   5097  N  N   . LYS B 1 329 ? 21.378  -89.081  44.867  1.00 90.80  ? 332  LYS B N   1 
ATOM   5098  C  CA  . LYS B 1 329 ? 21.647  -90.467  44.455  1.00 93.17  ? 332  LYS B CA  1 
ATOM   5099  C  C   . LYS B 1 329 ? 23.160  -90.639  44.337  1.00 94.57  ? 332  LYS B C   1 
ATOM   5100  O  O   . LYS B 1 329 ? 23.726  -90.698  43.239  1.00 90.35  ? 332  LYS B O   1 
ATOM   5101  C  CB  . LYS B 1 329 ? 20.876  -90.885  43.194  1.00 93.76  ? 332  LYS B CB  1 
ATOM   5102  C  CG  . LYS B 1 329 ? 19.998  -92.117  43.376  1.00 95.28  ? 332  LYS B CG  1 
ATOM   5103  C  CD  . LYS B 1 329 ? 20.813  -93.399  43.431  1.00 97.22  ? 332  LYS B CD  1 
ATOM   5104  C  CE  . LYS B 1 329 ? 19.929  -94.602  43.718  1.00 97.63  ? 332  LYS B CE  1 
ATOM   5105  N  NZ  . LYS B 1 329 ? 20.690  -95.876  43.600  1.00 94.16  ? 332  LYS B NZ  1 
ATOM   5106  N  N   . ASP B 1 330 ? 23.779  -90.715  45.517  1.00 97.03  ? 333  ASP B N   1 
ATOM   5107  C  CA  . ASP B 1 330 ? 25.218  -90.537  45.741  1.00 100.38 ? 333  ASP B CA  1 
ATOM   5108  C  C   . ASP B 1 330 ? 25.491  -89.090  46.164  1.00 102.62 ? 333  ASP B C   1 
ATOM   5109  O  O   . ASP B 1 330 ? 25.641  -88.203  45.316  1.00 106.54 ? 333  ASP B O   1 
ATOM   5110  C  CB  . ASP B 1 330 ? 26.070  -90.938  44.525  1.00 100.40 ? 333  ASP B CB  1 
ATOM   5111  C  CG  . ASP B 1 330 ? 27.531  -90.556  44.684  1.00 101.07 ? 333  ASP B CG  1 
ATOM   5112  O  OD1 . ASP B 1 330 ? 28.088  -89.948  43.746  1.00 103.16 ? 333  ASP B OD1 1 
ATOM   5113  O  OD2 . ASP B 1 330 ? 28.116  -90.848  45.751  1.00 99.64  ? 333  ASP B OD2 1 
ATOM   5114  N  N   . GLY B 1 331 ? 25.530  -88.873  47.480  1.00 102.07 ? 334  GLY B N   1 
ATOM   5115  C  CA  . GLY B 1 331 ? 25.839  -87.577  48.090  1.00 99.49  ? 334  GLY B CA  1 
ATOM   5116  C  C   . GLY B 1 331 ? 25.481  -86.366  47.253  1.00 102.53 ? 334  GLY B C   1 
ATOM   5117  O  O   . GLY B 1 331 ? 24.307  -86.150  46.932  1.00 100.54 ? 334  GLY B O   1 
ATOM   5118  N  N   . LYS B 1 332 ? 26.505  -85.591  46.889  1.00 101.65 ? 335  LYS B N   1 
ATOM   5119  C  CA  . LYS B 1 332 ? 26.342  -84.357  46.109  1.00 96.77  ? 335  LYS B CA  1 
ATOM   5120  C  C   . LYS B 1 332 ? 26.491  -84.569  44.601  1.00 95.93  ? 335  LYS B C   1 
ATOM   5121  O  O   . LYS B 1 332 ? 26.967  -85.617  44.149  1.00 95.85  ? 335  LYS B O   1 
ATOM   5122  C  CB  . LYS B 1 332 ? 27.329  -83.276  46.579  1.00 95.00  ? 335  LYS B CB  1 
ATOM   5123  C  CG  . LYS B 1 332 ? 26.943  -82.574  47.875  1.00 95.96  ? 335  LYS B CG  1 
ATOM   5124  C  CD  . LYS B 1 332 ? 25.667  -81.758  47.726  1.00 91.34  ? 335  LYS B CD  1 
ATOM   5125  C  CE  . LYS B 1 332 ? 25.161  -81.269  49.075  1.00 92.12  ? 335  LYS B CE  1 
ATOM   5126  N  NZ  . LYS B 1 332 ? 23.781  -80.714  48.976  1.00 86.71  ? 335  LYS B NZ  1 
ATOM   5127  N  N   . GLY B 1 333 ? 26.075  -83.557  43.838  1.00 88.93  ? 336  GLY B N   1 
ATOM   5128  C  CA  . GLY B 1 333 ? 26.214  -83.548  42.385  1.00 76.05  ? 336  GLY B CA  1 
ATOM   5129  C  C   . GLY B 1 333 ? 26.736  -82.214  41.884  1.00 69.44  ? 336  GLY B C   1 
ATOM   5130  O  O   . GLY B 1 333 ? 26.290  -81.150  42.324  1.00 69.32  ? 336  GLY B O   1 
ATOM   5131  N  N   . VAL B 1 334 ? 27.687  -82.280  40.960  1.00 63.34  ? 337  VAL B N   1 
ATOM   5132  C  CA  . VAL B 1 334 ? 28.288  -81.088  40.370  1.00 62.75  ? 337  VAL B CA  1 
ATOM   5133  C  C   . VAL B 1 334 ? 27.632  -80.741  39.020  1.00 60.62  ? 337  VAL B C   1 
ATOM   5134  O  O   . VAL B 1 334 ? 27.653  -81.547  38.081  1.00 61.39  ? 337  VAL B O   1 
ATOM   5135  C  CB  . VAL B 1 334 ? 29.830  -81.231  40.257  1.00 62.42  ? 337  VAL B CB  1 
ATOM   5136  C  CG1 . VAL B 1 334 ? 30.214  -82.606  39.725  1.00 62.22  ? 337  VAL B CG1 1 
ATOM   5137  C  CG2 . VAL B 1 334 ? 30.431  -80.128  39.391  1.00 63.80  ? 337  VAL B CG2 1 
ATOM   5138  N  N   . PHE B 1 335 ? 27.056  -79.542  38.943  1.00 53.66  ? 338  PHE B N   1 
ATOM   5139  C  CA  . PHE B 1 335 ? 26.327  -79.080  37.759  1.00 48.12  ? 338  PHE B CA  1 
ATOM   5140  C  C   . PHE B 1 335 ? 26.988  -77.894  37.069  1.00 45.64  ? 338  PHE B C   1 
ATOM   5141  O  O   . PHE B 1 335 ? 27.821  -77.207  37.658  1.00 49.14  ? 338  PHE B O   1 
ATOM   5142  C  CB  . PHE B 1 335 ? 24.900  -78.685  38.139  1.00 46.16  ? 338  PHE B CB  1 
ATOM   5143  C  CG  . PHE B 1 335 ? 24.097  -79.805  38.708  1.00 46.39  ? 338  PHE B CG  1 
ATOM   5144  C  CD1 . PHE B 1 335 ? 24.027  -79.997  40.079  1.00 50.13  ? 338  PHE B CD1 1 
ATOM   5145  C  CD2 . PHE B 1 335 ? 23.415  -80.674  37.879  1.00 47.26  ? 338  PHE B CD2 1 
ATOM   5146  C  CE1 . PHE B 1 335 ? 23.289  -81.041  40.613  1.00 51.75  ? 338  PHE B CE1 1 
ATOM   5147  C  CE2 . PHE B 1 335 ? 22.674  -81.722  38.400  1.00 49.39  ? 338  PHE B CE2 1 
ATOM   5148  C  CZ  . PHE B 1 335 ? 22.610  -81.908  39.769  1.00 49.87  ? 338  PHE B CZ  1 
ATOM   5149  N  N   . ALA B 1 336 ? 26.614  -77.670  35.810  1.00 42.44  ? 339  ALA B N   1 
ATOM   5150  C  CA  . ALA B 1 336 ? 26.888  -76.403  35.111  1.00 39.22  ? 339  ALA B CA  1 
ATOM   5151  C  C   . ALA B 1 336 ? 25.556  -75.775  34.705  1.00 36.74  ? 339  ALA B C   1 
ATOM   5152  O  O   . ALA B 1 336 ? 24.696  -76.442  34.130  1.00 36.97  ? 339  ALA B O   1 
ATOM   5153  C  CB  . ALA B 1 336 ? 27.783  -76.620  33.900  1.00 36.97  ? 339  ALA B CB  1 
ATOM   5154  N  N   . VAL B 1 337 ? 25.362  -74.512  35.067  1.00 35.24  ? 340  VAL B N   1 
ATOM   5155  C  CA  . VAL B 1 337 ? 24.151  -73.783  34.708  1.00 35.46  ? 340  VAL B CA  1 
ATOM   5156  C  C   . VAL B 1 337 ? 24.635  -72.618  33.880  1.00 36.44  ? 340  VAL B C   1 
ATOM   5157  O  O   . VAL B 1 337 ? 25.406  -71.793  34.374  1.00 38.58  ? 340  VAL B O   1 
ATOM   5158  C  CB  . VAL B 1 337 ? 23.363  -73.277  35.932  1.00 36.07  ? 340  VAL B CB  1 
ATOM   5159  C  CG1 . VAL B 1 337 ? 22.028  -72.690  35.499  1.00 35.99  ? 340  VAL B CG1 1 
ATOM   5160  C  CG2 . VAL B 1 337 ? 23.119  -74.409  36.916  1.00 36.71  ? 340  VAL B CG2 1 
ATOM   5161  N  N   . ASP B 1 338 ? 24.217  -72.583  32.616  1.00 33.62  ? 341  ASP B N   1 
ATOM   5162  C  CA  . ASP B 1 338 ? 24.763  -71.655  31.623  1.00 33.22  ? 341  ASP B CA  1 
ATOM   5163  C  C   . ASP B 1 338 ? 26.285  -71.564  31.727  1.00 33.64  ? 341  ASP B C   1 
ATOM   5164  O  O   . ASP B 1 338 ? 26.863  -70.509  31.496  1.00 33.11  ? 341  ASP B O   1 
ATOM   5165  C  CB  . ASP B 1 338 ? 24.089  -70.278  31.707  1.00 31.85  ? 341  ASP B CB  1 
ATOM   5166  C  CG  . ASP B 1 338 ? 22.568  -70.377  31.719  1.00 33.80  ? 341  ASP B CG  1 
ATOM   5167  O  OD1 . ASP B 1 338 ? 22.026  -71.452  31.342  1.00 31.80  ? 341  ASP B OD1 1 
ATOM   5168  O  OD2 . ASP B 1 338 ? 21.907  -69.384  32.112  1.00 33.62  ? 341  ASP B OD2 1 
ATOM   5169  N  N   . GLY B 1 339 ? 26.921  -72.687  32.067  1.00 33.47  ? 342  GLY B N   1 
ATOM   5170  C  CA  . GLY B 1 339 ? 28.378  -72.745  32.181  1.00 34.12  ? 342  GLY B CA  1 
ATOM   5171  C  C   . GLY B 1 339 ? 28.951  -72.504  33.579  1.00 36.20  ? 342  GLY B C   1 
ATOM   5172  O  O   . GLY B 1 339 ? 30.138  -72.744  33.793  1.00 36.68  ? 342  GLY B O   1 
ATOM   5173  N  N   . GLU B 1 340 ? 28.132  -72.038  34.526  1.00 35.38  ? 343  GLU B N   1 
ATOM   5174  C  CA  . GLU B 1 340 ? 28.603  -71.804  35.897  0.50 39.66  ? 343  GLU B CA  1 
ATOM   5175  C  C   . GLU B 1 340 ? 28.540  -73.056  36.786  1.00 43.00  ? 343  GLU B C   1 
ATOM   5176  O  O   . GLU B 1 340 ? 27.575  -73.832  36.725  1.00 42.81  ? 343  GLU B O   1 
ATOM   5177  C  CB  . GLU B 1 340 ? 27.882  -70.606  36.558  0.50 38.71  ? 343  GLU B CB  1 
ATOM   5178  C  CG  . GLU B 1 340 ? 26.577  -70.914  37.298  0.50 40.18  ? 343  GLU B CG  1 
ATOM   5179  C  CD  . GLU B 1 340 ? 26.360  -70.068  38.560  0.50 39.57  ? 343  GLU B CD  1 
ATOM   5180  O  OE1 . GLU B 1 340 ? 27.009  -69.007  38.707  0.50 38.66  ? 343  GLU B OE1 1 
ATOM   5181  O  OE2 . GLU B 1 340 ? 25.533  -70.468  39.413  0.50 38.26  ? 343  GLU B OE2 1 
ATOM   5182  N  N   . LEU B 1 341 ? 29.580  -73.256  37.596  1.00 48.87  ? 344  LEU B N   1 
ATOM   5183  C  CA  . LEU B 1 341 ? 29.579  -74.298  38.638  1.00 53.74  ? 344  LEU B CA  1 
ATOM   5184  C  C   . LEU B 1 341 ? 28.397  -74.176  39.620  1.00 52.76  ? 344  LEU B C   1 
ATOM   5185  O  O   . LEU B 1 341 ? 28.037  -73.085  40.061  1.00 54.10  ? 344  LEU B O   1 
ATOM   5186  C  CB  . LEU B 1 341 ? 30.906  -74.299  39.414  1.00 59.98  ? 344  LEU B CB  1 
ATOM   5187  C  CG  . LEU B 1 341 ? 30.964  -75.092  40.743  1.00 66.52  ? 344  LEU B CG  1 
ATOM   5188  C  CD1 . LEU B 1 341 ? 31.150  -76.582  40.487  1.00 68.36  ? 344  LEU B CD1 1 
ATOM   5189  C  CD2 . LEU B 1 341 ? 32.022  -74.573  41.716  1.00 65.76  ? 344  LEU B CD2 1 
ATOM   5190  N  N   . MET B 1 342 ? 27.789  -75.308  39.941  1.00 54.17  ? 345  MET B N   1 
ATOM   5191  C  CA  . MET B 1 342 ? 26.765  -75.359  40.968  1.00 56.18  ? 345  MET B CA  1 
ATOM   5192  C  C   . MET B 1 342 ? 26.725  -76.756  41.591  1.00 58.81  ? 345  MET B C   1 
ATOM   5193  O  O   . MET B 1 342 ? 26.514  -77.753  40.897  1.00 59.40  ? 345  MET B O   1 
ATOM   5194  C  CB  . MET B 1 342 ? 25.403  -74.983  40.394  1.00 53.30  ? 345  MET B CB  1 
ATOM   5195  C  CG  . MET B 1 342 ? 24.353  -74.767  41.460  1.00 56.15  ? 345  MET B CG  1 
ATOM   5196  S  SD  . MET B 1 342 ? 22.680  -74.771  40.799  1.00 61.63  ? 345  MET B SD  1 
ATOM   5197  C  CE  . MET B 1 342 ? 22.379  -76.534  40.609  1.00 62.25  ? 345  MET B CE  1 
ATOM   5198  N  N   . VAL B 1 343 ? 26.951  -76.825  42.898  1.00 61.54  ? 346  VAL B N   1 
ATOM   5199  C  CA  . VAL B 1 343 ? 26.887  -78.095  43.616  1.00 62.93  ? 346  VAL B CA  1 
ATOM   5200  C  C   . VAL B 1 343 ? 25.511  -78.189  44.247  1.00 64.12  ? 346  VAL B C   1 
ATOM   5201  O  O   . VAL B 1 343 ? 25.037  -77.221  44.853  1.00 64.35  ? 346  VAL B O   1 
ATOM   5202  C  CB  . VAL B 1 343 ? 27.972  -78.205  44.711  1.00 64.04  ? 346  VAL B CB  1 
ATOM   5203  C  CG1 . VAL B 1 343 ? 28.031  -79.623  45.268  1.00 63.64  ? 346  VAL B CG1 1 
ATOM   5204  C  CG2 . VAL B 1 343 ? 29.336  -77.793  44.166  1.00 64.89  ? 346  VAL B CG2 1 
ATOM   5205  N  N   . SER B 1 344 ? 24.862  -79.339  44.069  1.00 66.58  ? 347  SER B N   1 
ATOM   5206  C  CA  . SER B 1 344 ? 23.586  -79.631  44.735  1.00 67.77  ? 347  SER B CA  1 
ATOM   5207  C  C   . SER B 1 344 ? 23.262  -81.120  44.712  1.00 68.05  ? 347  SER B C   1 
ATOM   5208  O  O   . SER B 1 344 ? 23.816  -81.872  43.913  1.00 67.16  ? 347  SER B O   1 
ATOM   5209  C  CB  . SER B 1 344 ? 22.430  -78.825  44.125  1.00 66.16  ? 347  SER B CB  1 
ATOM   5210  O  OG  . SER B 1 344 ? 21.284  -78.880  44.960  1.00 66.20  ? 347  SER B OG  1 
ATOM   5211  N  N   . GLU B 1 345 ? 22.365  -81.528  45.606  1.00 74.42  ? 348  GLU B N   1 
ATOM   5212  C  CA  . GLU B 1 345 ? 21.917  -82.915  45.708  1.00 74.91  ? 348  GLU B CA  1 
ATOM   5213  C  C   . GLU B 1 345 ? 20.822  -83.236  44.706  1.00 71.26  ? 348  GLU B C   1 
ATOM   5214  O  O   . GLU B 1 345 ? 20.710  -84.376  44.259  1.00 74.11  ? 348  GLU B O   1 
ATOM   5215  C  CB  . GLU B 1 345 ? 21.393  -83.214  47.115  1.00 79.89  ? 348  GLU B CB  1 
ATOM   5216  C  CG  . GLU B 1 345 ? 22.445  -83.714  48.088  1.00 85.19  ? 348  GLU B CG  1 
ATOM   5217  C  CD  . GLU B 1 345 ? 21.853  -84.295  49.357  1.00 87.51  ? 348  GLU B CD  1 
ATOM   5218  O  OE1 . GLU B 1 345 ? 20.622  -84.530  49.404  1.00 89.40  ? 348  GLU B OE1 1 
ATOM   5219  O  OE2 . GLU B 1 345 ? 22.629  -84.523  50.310  1.00 87.00  ? 348  GLU B OE2 1 
ATOM   5220  N  N   . ALA B 1 346 ? 19.998  -82.240  44.384  1.00 64.28  ? 349  ALA B N   1 
ATOM   5221  C  CA  . ALA B 1 346 ? 18.856  -82.438  43.489  1.00 62.31  ? 349  ALA B CA  1 
ATOM   5222  C  C   . ALA B 1 346 ? 18.366  -81.132  42.871  1.00 61.12  ? 349  ALA B C   1 
ATOM   5223  O  O   . ALA B 1 346 ? 18.173  -80.127  43.569  1.00 56.28  ? 349  ALA B O   1 
ATOM   5224  C  CB  . ALA B 1 346 ? 17.711  -83.139  44.210  1.00 57.33  ? 349  ALA B CB  1 
ATOM   5225  N  N   . VAL B 1 347 ? 18.161  -81.173  41.554  1.00 59.50  ? 350  VAL B N   1 
ATOM   5226  C  CA  . VAL B 1 347 ? 17.651  -80.031  40.794  1.00 57.91  ? 350  VAL B CA  1 
ATOM   5227  C  C   . VAL B 1 347 ? 16.398  -80.432  40.022  1.00 55.08  ? 350  VAL B C   1 
ATOM   5228  O  O   . VAL B 1 347 ? 16.269  -81.567  39.561  1.00 58.40  ? 350  VAL B O   1 
ATOM   5229  C  CB  . VAL B 1 347 ? 18.679  -79.499  39.773  1.00 57.62  ? 350  VAL B CB  1 
ATOM   5230  C  CG1 . VAL B 1 347 ? 18.445  -78.019  39.524  1.00 58.53  ? 350  VAL B CG1 1 
ATOM   5231  C  CG2 . VAL B 1 347 ? 20.104  -79.721  40.250  1.00 58.81  ? 350  VAL B CG2 1 
ATOM   5232  N  N   . GLN B 1 348 ? 15.468  -79.501  39.894  1.00 49.61  ? 351  GLN B N   1 
ATOM   5233  C  CA  . GLN B 1 348 ? 14.362  -79.677  38.966  1.00 47.29  ? 351  GLN B CA  1 
ATOM   5234  C  C   . GLN B 1 348 ? 14.036  -78.340  38.303  1.00 45.26  ? 351  GLN B C   1 
ATOM   5235  O  O   . GLN B 1 348 ? 14.480  -77.280  38.764  1.00 43.28  ? 351  GLN B O   1 
ATOM   5236  C  CB  . GLN B 1 348 ? 13.147  -80.284  39.662  1.00 45.89  ? 351  GLN B CB  1 
ATOM   5237  C  CG  . GLN B 1 348 ? 12.442  -79.352  40.625  1.00 46.78  ? 351  GLN B CG  1 
ATOM   5238  C  CD  . GLN B 1 348 ? 11.169  -79.952  41.192  1.00 47.02  ? 351  GLN B CD  1 
ATOM   5239  O  OE1 . GLN B 1 348 ? 10.460  -79.299  41.958  1.00 50.24  ? 351  GLN B OE1 1 
ATOM   5240  N  NE2 . GLN B 1 348 ? 10.866  -81.195  40.815  1.00 44.65  ? 351  GLN B NE2 1 
ATOM   5241  N  N   . GLY B 1 349 ? 13.277  -78.385  37.215  1.00 43.42  ? 352  GLY B N   1 
ATOM   5242  C  CA  . GLY B 1 349 ? 13.018  -77.170  36.472  1.00 42.64  ? 352  GLY B CA  1 
ATOM   5243  C  C   . GLY B 1 349 ? 11.899  -77.264  35.474  1.00 43.05  ? 352  GLY B C   1 
ATOM   5244  O  O   . GLY B 1 349 ? 11.506  -78.349  35.069  1.00 43.86  ? 352  GLY B O   1 
ATOM   5245  N  N   . GLN B 1 350 ? 11.409  -76.100  35.075  1.00 40.61  ? 353  GLN B N   1 
ATOM   5246  C  CA  . GLN B 1 350 ? 10.342  -75.965  34.114  1.00 38.06  ? 353  GLN B CA  1 
ATOM   5247  C  C   . GLN B 1 350 ? 10.676  -74.814  33.151  1.00 38.12  ? 353  GLN B C   1 
ATOM   5248  O  O   . GLN B 1 350 ? 11.138  -73.751  33.586  1.00 35.87  ? 353  GLN B O   1 
ATOM   5249  C  CB  . GLN B 1 350 ? 9.034   -75.701  34.850  1.00 37.91  ? 353  GLN B CB  1 
ATOM   5250  C  CG  . GLN B 1 350 ? 7.982   -74.946  34.049  1.00 40.47  ? 353  GLN B CG  1 
ATOM   5251  C  CD  . GLN B 1 350 ? 6.648   -74.915  34.760  1.00 42.73  ? 353  GLN B CD  1 
ATOM   5252  O  OE1 . GLN B 1 350 ? 6.486   -75.541  35.801  1.00 47.24  ? 353  GLN B OE1 1 
ATOM   5253  N  NE2 . GLN B 1 350 ? 5.686   -74.195  34.201  1.00 42.36  ? 353  GLN B NE2 1 
ATOM   5254  N  N   . VAL B 1 351 ? 10.455  -75.041  31.850  1.00 37.33  ? 354  VAL B N   1 
ATOM   5255  C  CA  . VAL B 1 351 ? 10.637  -74.000  30.836  1.00 35.76  ? 354  VAL B CA  1 
ATOM   5256  C  C   . VAL B 1 351 ? 9.456   -73.052  30.891  1.00 34.82  ? 354  VAL B C   1 
ATOM   5257  O  O   . VAL B 1 351 ? 8.296   -73.479  31.026  1.00 32.39  ? 354  VAL B O   1 
ATOM   5258  C  CB  . VAL B 1 351 ? 10.703  -74.544  29.384  1.00 37.02  ? 354  VAL B CB  1 
ATOM   5259  C  CG1 . VAL B 1 351 ? 11.370  -73.535  28.453  1.00 35.61  ? 354  VAL B CG1 1 
ATOM   5260  C  CG2 . VAL B 1 351 ? 11.447  -75.851  29.321  1.00 38.76  ? 354  VAL B CG2 1 
ATOM   5261  N  N   . HIS B 1 352 ? 9.765   -71.764  30.775  1.00 33.73  ? 355  HIS B N   1 
ATOM   5262  C  CA  . HIS B 1 352 ? 8.752   -70.743  30.556  1.00 33.20  ? 355  HIS B CA  1 
ATOM   5263  C  C   . HIS B 1 352 ? 8.864   -70.171  29.166  1.00 31.62  ? 355  HIS B C   1 
ATOM   5264  O  O   . HIS B 1 352 ? 9.960   -69.817  28.716  1.00 30.59  ? 355  HIS B O   1 
ATOM   5265  C  CB  . HIS B 1 352 ? 8.834   -69.666  31.631  1.00 33.37  ? 355  HIS B CB  1 
ATOM   5266  C  CG  . HIS B 1 352 ? 8.231   -70.094  32.944  1.00 34.44  ? 355  HIS B CG  1 
ATOM   5267  N  ND1 . HIS B 1 352 ? 6.945   -69.848  33.264  1.00 35.01  ? 355  HIS B ND1 1 
ATOM   5268  C  CD2 . HIS B 1 352 ? 8.775   -70.800  34.015  1.00 34.41  ? 355  HIS B CD2 1 
ATOM   5269  C  CE1 . HIS B 1 352 ? 6.685   -70.358  34.479  1.00 35.48  ? 355  HIS B CE1 1 
ATOM   5270  N  NE2 . HIS B 1 352 ? 7.808   -70.936  34.939  1.00 33.87  ? 355  HIS B NE2 1 
ATOM   5271  N  N   . PRO B 1 353 ? 7.730   -70.090  28.457  1.00 30.11  ? 356  PRO B N   1 
ATOM   5272  C  CA  . PRO B 1 353 ? 7.781   -69.678  27.067  1.00 30.38  ? 356  PRO B CA  1 
ATOM   5273  C  C   . PRO B 1 353 ? 7.988   -68.182  26.890  1.00 31.34  ? 356  PRO B C   1 
ATOM   5274  O  O   . PRO B 1 353 ? 7.385   -67.376  27.606  1.00 30.38  ? 356  PRO B O   1 
ATOM   5275  C  CB  . PRO B 1 353 ? 6.395   -70.074  26.538  1.00 30.29  ? 356  PRO B CB  1 
ATOM   5276  C  CG  . PRO B 1 353 ? 5.511   -70.021  27.735  1.00 29.42  ? 356  PRO B CG  1 
ATOM   5277  C  CD  . PRO B 1 353 ? 6.375   -70.506  28.864  1.00 29.36  ? 356  PRO B CD  1 
ATOM   5278  N  N   . ASN B 1 354 ? 8.824   -67.817  25.922  1.00 31.31  ? 357  ASN B N   1 
ATOM   5279  C  CA  . ASN B 1 354 ? 8.854   -66.439  25.438  1.00 30.25  ? 357  ASN B CA  1 
ATOM   5280  C  C   . ASN B 1 354 ? 8.904   -65.414  26.583  1.00 30.13  ? 357  ASN B C   1 
ATOM   5281  O  O   . ASN B 1 354 ? 8.105   -64.484  26.651  1.00 28.67  ? 357  ASN B O   1 
ATOM   5282  C  CB  . ASN B 1 354 ? 7.671   -66.207  24.475  1.00 28.20  ? 357  ASN B CB  1 
ATOM   5283  C  CG  . ASN B 1 354 ? 7.869   -66.920  23.138  1.00 28.95  ? 357  ASN B CG  1 
ATOM   5284  O  OD1 . ASN B 1 354 ? 8.872   -67.601  22.931  1.00 27.35  ? 357  ASN B OD1 1 
ATOM   5285  N  ND2 . ASN B 1 354 ? 6.931   -66.744  22.223  1.00 29.13  ? 357  ASN B ND2 1 
ATOM   5286  N  N   . TYR B 1 355 ? 9.869   -65.595  27.477  1.00 31.48  ? 358  TYR B N   1 
ATOM   5287  C  CA  . TYR B 1 355 ? 9.870   -64.860  28.741  1.00 33.03  ? 358  TYR B CA  1 
ATOM   5288  C  C   . TYR B 1 355 ? 10.688  -63.565  28.718  1.00 31.79  ? 358  TYR B C   1 
ATOM   5289  O  O   . TYR B 1 355 ? 10.411  -62.641  29.477  1.00 31.45  ? 358  TYR B O   1 
ATOM   5290  C  CB  . TYR B 1 355 ? 10.317  -65.767  29.890  1.00 32.38  ? 358  TYR B CB  1 
ATOM   5291  C  CG  . TYR B 1 355 ? 9.533   -65.515  31.153  1.00 33.99  ? 358  TYR B CG  1 
ATOM   5292  C  CD1 . TYR B 1 355 ? 8.184   -65.876  31.233  1.00 34.83  ? 358  TYR B CD1 1 
ATOM   5293  C  CD2 . TYR B 1 355 ? 10.126  -64.910  32.263  1.00 33.99  ? 358  TYR B CD2 1 
ATOM   5294  C  CE1 . TYR B 1 355 ? 7.443   -65.643  32.372  1.00 34.82  ? 358  TYR B CE1 1 
ATOM   5295  C  CE2 . TYR B 1 355 ? 9.393   -64.672  33.420  1.00 36.16  ? 358  TYR B CE2 1 
ATOM   5296  C  CZ  . TYR B 1 355 ? 8.050   -65.045  33.467  1.00 38.06  ? 358  TYR B CZ  1 
ATOM   5297  O  OH  . TYR B 1 355 ? 7.292   -64.821  34.599  1.00 39.69  ? 358  TYR B OH  1 
ATOM   5298  N  N   . PHE B 1 356 ? 11.707  -63.519  27.867  1.00 32.23  ? 359  PHE B N   1 
ATOM   5299  C  CA  . PHE B 1 356 ? 12.456  -62.289  27.633  1.00 30.92  ? 359  PHE B CA  1 
ATOM   5300  C  C   . PHE B 1 356 ? 12.758  -62.042  26.152  1.00 31.21  ? 359  PHE B C   1 
ATOM   5301  O  O   . PHE B 1 356 ? 12.712  -62.967  25.340  1.00 28.11  ? 359  PHE B O   1 
ATOM   5302  C  CB  . PHE B 1 356 ? 13.740  -62.257  28.474  1.00 29.17  ? 359  PHE B CB  1 
ATOM   5303  C  CG  . PHE B 1 356 ? 14.754  -63.308  28.106  1.00 27.46  ? 359  PHE B CG  1 
ATOM   5304  C  CD1 . PHE B 1 356 ? 14.601  -64.622  28.529  1.00 25.99  ? 359  PHE B CD1 1 
ATOM   5305  C  CD2 . PHE B 1 356 ? 15.877  -62.974  27.366  1.00 26.62  ? 359  PHE B CD2 1 
ATOM   5306  C  CE1 . PHE B 1 356 ? 15.549  -65.576  28.219  1.00 24.89  ? 359  PHE B CE1 1 
ATOM   5307  C  CE2 . PHE B 1 356 ? 16.820  -63.933  27.031  1.00 24.98  ? 359  PHE B CE2 1 
ATOM   5308  C  CZ  . PHE B 1 356 ? 16.661  -65.231  27.473  1.00 25.57  ? 359  PHE B CZ  1 
ATOM   5309  N  N   . TRP B 1 357 ? 13.056  -60.779  25.837  1.00 32.47  ? 360  TRP B N   1 
ATOM   5310  C  CA  . TRP B 1 357 ? 13.389  -60.309  24.497  1.00 33.62  ? 360  TRP B CA  1 
ATOM   5311  C  C   . TRP B 1 357 ? 14.881  -60.234  24.272  1.00 33.86  ? 360  TRP B C   1 
ATOM   5312  O  O   . TRP B 1 357 ? 15.640  -59.732  25.127  1.00 31.41  ? 360  TRP B O   1 
ATOM   5313  C  CB  . TRP B 1 357 ? 12.856  -58.902  24.292  1.00 37.22  ? 360  TRP B CB  1 
ATOM   5314  C  CG  . TRP B 1 357 ? 11.359  -58.695  24.303  1.00 42.94  ? 360  TRP B CG  1 
ATOM   5315  C  CD1 . TRP B 1 357 ? 10.596  -58.081  25.298  1.00 45.78  ? 360  TRP B CD1 1 
ATOM   5316  C  CD2 . TRP B 1 357 ? 10.400  -59.009  23.235  1.00 45.39  ? 360  TRP B CD2 1 
ATOM   5317  N  NE1 . TRP B 1 357 ? 9.274   -58.016  24.938  1.00 47.29  ? 360  TRP B NE1 1 
ATOM   5318  C  CE2 . TRP B 1 357 ? 9.084   -58.560  23.719  1.00 46.68  ? 360  TRP B CE2 1 
ATOM   5319  C  CE3 . TRP B 1 357 ? 10.489  -59.602  21.984  1.00 45.13  ? 360  TRP B CE3 1 
ATOM   5320  C  CZ2 . TRP B 1 357 ? 7.932   -58.713  22.966  1.00 48.26  ? 360  TRP B CZ2 1 
ATOM   5321  C  CZ3 . TRP B 1 357 ? 9.314   -59.753  21.233  1.00 46.39  ? 360  TRP B CZ3 1 
ATOM   5322  C  CH2 . TRP B 1 357 ? 8.069   -59.322  21.714  1.00 47.56  ? 360  TRP B CH2 1 
ATOM   5323  N  N   . MET B 1 358 ? 15.319  -60.699  23.104  1.00 32.53  ? 361  MET B N   1 
ATOM   5324  C  CA  . MET B 1 358 ? 16.718  -60.594  22.695  1.00 32.61  ? 361  MET B CA  1 
ATOM   5325  C  C   . MET B 1 358 ? 16.784  -59.986  21.322  1.00 31.54  ? 361  MET B C   1 
ATOM   5326  O  O   . MET B 1 358 ? 15.838  -60.149  20.560  1.00 32.31  ? 361  MET B O   1 
ATOM   5327  C  CB  . MET B 1 358 ? 17.320  -61.978  22.596  1.00 33.51  ? 361  MET B CB  1 
ATOM   5328  C  CG  . MET B 1 358 ? 17.792  -62.536  23.893  1.00 35.28  ? 361  MET B CG  1 
ATOM   5329  S  SD  . MET B 1 358 ? 19.579  -62.695  23.850  1.00 40.13  ? 361  MET B SD  1 
ATOM   5330  C  CE  . MET B 1 358 ? 19.582  -64.334  24.514  1.00 35.60  ? 361  MET B CE  1 
ATOM   5331  N  N   . VAL B 1 359 ? 17.901  -59.333  20.985  1.00 30.83  ? 362  VAL B N   1 
ATOM   5332  C  CA  . VAL B 1 359 ? 18.136  -58.955  19.588  1.00 33.80  ? 362  VAL B CA  1 
ATOM   5333  C  C   . VAL B 1 359 ? 18.559  -60.170  18.751  1.00 36.44  ? 362  VAL B C   1 
ATOM   5334  O  O   . VAL B 1 359 ? 19.449  -60.943  19.127  1.00 38.51  ? 362  VAL B O   1 
ATOM   5335  C  CB  . VAL B 1 359 ? 19.077  -57.722  19.379  1.00 33.45  ? 362  VAL B CB  1 
ATOM   5336  C  CG1 . VAL B 1 359 ? 19.042  -56.760  20.566  1.00 31.63  ? 362  VAL B CG1 1 
ATOM   5337  C  CG2 . VAL B 1 359 ? 20.495  -58.130  19.008  1.00 30.68  ? 362  VAL B CG2 1 
ATOM   5338  N  N   . SER B 1 360 ? 17.893  -60.355  17.623  1.00 40.19  ? 363  SER B N   1 
ATOM   5339  C  CA  . SER B 1 360 ? 18.151  -61.515  16.787  1.00 42.88  ? 363  SER B CA  1 
ATOM   5340  C  C   . SER B 1 360 ? 17.600  -61.334  15.385  1.00 44.53  ? 363  SER B C   1 
ATOM   5341  O  O   . SER B 1 360 ? 17.136  -60.249  15.017  1.00 44.62  ? 363  SER B O   1 
ATOM   5342  C  CB  . SER B 1 360 ? 17.584  -62.785  17.446  1.00 44.44  ? 363  SER B CB  1 
ATOM   5343  O  OG  . SER B 1 360 ? 16.208  -62.647  17.737  1.00 46.53  ? 363  SER B OG  1 
ATOM   5344  N  N   . GLY B 1 361 ? 17.685  -62.406  14.600  1.00 48.82  ? 364  GLY B N   1 
ATOM   5345  C  CA  . GLY B 1 361 ? 17.091  -62.476  13.260  1.00 48.77  ? 364  GLY B CA  1 
ATOM   5346  C  C   . GLY B 1 361 ? 16.621  -63.890  12.947  1.00 49.29  ? 364  GLY B C   1 
ATOM   5347  O  O   . GLY B 1 361 ? 16.508  -64.751  13.842  1.00 44.03  ? 364  GLY B O   1 
ATOM   5348  N  N   . MET C 1 3   ? 24.852  -30.785  52.562  1.00 64.94  ? 6    MET C N   1 
ATOM   5349  C  CA  . MET C 1 3   ? 25.166  -30.376  53.962  1.00 66.49  ? 6    MET C CA  1 
ATOM   5350  C  C   . MET C 1 3   ? 24.414  -31.228  55.014  1.00 65.97  ? 6    MET C C   1 
ATOM   5351  O  O   . MET C 1 3   ? 23.214  -31.024  55.252  1.00 62.28  ? 6    MET C O   1 
ATOM   5352  C  CB  . MET C 1 3   ? 24.894  -28.872  54.159  1.00 70.27  ? 6    MET C CB  1 
ATOM   5353  C  CG  . MET C 1 3   ? 25.084  -27.981  52.924  1.00 74.33  ? 6    MET C CG  1 
ATOM   5354  S  SD  . MET C 1 3   ? 23.521  -27.563  52.100  1.00 74.66  ? 6    MET C SD  1 
ATOM   5355  C  CE  . MET C 1 3   ? 23.838  -25.911  51.475  1.00 66.45  ? 6    MET C CE  1 
ATOM   5356  N  N   . GLY C 1 4   ? 25.128  -32.175  55.632  1.00 63.03  ? 7    GLY C N   1 
ATOM   5357  C  CA  . GLY C 1 4   ? 24.553  -33.090  56.633  1.00 64.83  ? 7    GLY C CA  1 
ATOM   5358  C  C   . GLY C 1 4   ? 25.535  -33.707  57.628  1.00 63.76  ? 7    GLY C C   1 
ATOM   5359  O  O   . GLY C 1 4   ? 25.309  -33.659  58.831  1.00 72.33  ? 7    GLY C O   1 
ATOM   5360  N  N   . SER C 1 5   ? 26.598  -34.323  57.108  1.00 62.92  ? 8    SER C N   1 
ATOM   5361  C  CA  . SER C 1 5   ? 27.786  -34.792  57.857  1.00 58.84  ? 8    SER C CA  1 
ATOM   5362  C  C   . SER C 1 5   ? 28.787  -35.374  56.847  1.00 60.59  ? 8    SER C C   1 
ATOM   5363  O  O   . SER C 1 5   ? 28.418  -35.629  55.697  1.00 62.96  ? 8    SER C O   1 
ATOM   5364  C  CB  . SER C 1 5   ? 27.431  -35.861  58.890  1.00 59.95  ? 8    SER C CB  1 
ATOM   5365  O  OG  . SER C 1 5   ? 28.611  -36.369  59.498  1.00 56.02  ? 8    SER C OG  1 
ATOM   5366  N  N   . GLY C 1 6   ? 30.039  -35.586  57.247  1.00 55.33  ? 9    GLY C N   1 
ATOM   5367  C  CA  . GLY C 1 6   ? 30.891  -36.472  56.448  1.00 52.19  ? 9    GLY C CA  1 
ATOM   5368  C  C   . GLY C 1 6   ? 32.344  -36.117  56.238  1.00 46.91  ? 9    GLY C C   1 
ATOM   5369  O  O   . GLY C 1 6   ? 32.690  -34.938  56.236  1.00 49.26  ? 9    GLY C O   1 
ATOM   5370  N  N   . VAL C 1 7   ? 33.223  -37.105  56.075  1.00 41.84  ? 10   VAL C N   1 
ATOM   5371  C  CA  . VAL C 1 7   ? 33.024  -38.585  56.258  1.00 43.24  ? 10   VAL C CA  1 
ATOM   5372  C  C   . VAL C 1 7   ? 32.168  -39.475  55.325  1.00 43.29  ? 10   VAL C C   1 
ATOM   5373  O  O   . VAL C 1 7   ? 30.927  -39.448  55.326  1.00 43.96  ? 10   VAL C O   1 
ATOM   5374  C  CB  . VAL C 1 7   ? 32.859  -39.020  57.727  1.00 42.86  ? 10   VAL C CB  1 
ATOM   5375  C  CG1 . VAL C 1 7   ? 33.970  -38.393  58.546  1.00 42.69  ? 10   VAL C CG1 1 
ATOM   5376  C  CG2 . VAL C 1 7   ? 31.483  -38.663  58.277  1.00 42.81  ? 10   VAL C CG2 1 
ATOM   5377  N  N   . LEU C 1 8   ? 32.872  -40.294  54.549  1.00 38.26  ? 11   LEU C N   1 
ATOM   5378  C  CA  . LEU C 1 8   ? 32.235  -41.364  53.788  1.00 36.60  ? 11   LEU C CA  1 
ATOM   5379  C  C   . LEU C 1 8   ? 32.199  -42.587  54.688  1.00 33.34  ? 11   LEU C C   1 
ATOM   5380  O  O   . LEU C 1 8   ? 33.136  -42.790  55.453  1.00 32.52  ? 11   LEU C O   1 
ATOM   5381  C  CB  . LEU C 1 8   ? 33.023  -41.672  52.502  1.00 34.78  ? 11   LEU C CB  1 
ATOM   5382  C  CG  . LEU C 1 8   ? 33.176  -40.551  51.478  1.00 33.60  ? 11   LEU C CG  1 
ATOM   5383  C  CD1 . LEU C 1 8   ? 34.091  -40.944  50.326  1.00 32.15  ? 11   LEU C CD1 1 
ATOM   5384  C  CD2 . LEU C 1 8   ? 31.808  -40.130  50.970  1.00 34.64  ? 11   LEU C CD2 1 
ATOM   5385  N  N   . PRO C 1 9   ? 31.129  -43.400  54.599  1.00 32.37  ? 12   PRO C N   1 
ATOM   5386  C  CA  . PRO C 1 9   ? 31.075  -44.676  55.321  1.00 32.77  ? 12   PRO C CA  1 
ATOM   5387  C  C   . PRO C 1 9   ? 32.219  -45.598  54.935  1.00 34.10  ? 12   PRO C C   1 
ATOM   5388  O  O   . PRO C 1 9   ? 32.792  -45.456  53.849  1.00 34.40  ? 12   PRO C O   1 
ATOM   5389  C  CB  . PRO C 1 9   ? 29.751  -45.296  54.862  1.00 32.78  ? 12   PRO C CB  1 
ATOM   5390  C  CG  . PRO C 1 9   ? 28.919  -44.129  54.414  1.00 35.14  ? 12   PRO C CG  1 
ATOM   5391  C  CD  . PRO C 1 9   ? 29.907  -43.162  53.809  1.00 32.81  ? 12   PRO C CD  1 
ATOM   5392  N  N   . ARG C 1 10  ? 32.563  -46.510  55.837  1.00 36.97  ? 13   ARG C N   1 
ATOM   5393  C  CA  . ARG C 1 10  ? 33.513  -47.586  55.566  1.00 40.41  ? 13   ARG C CA  1 
ATOM   5394  C  C   . ARG C 1 10  ? 32.906  -48.931  55.985  1.00 43.74  ? 13   ARG C C   1 
ATOM   5395  O  O   . ARG C 1 10  ? 32.559  -49.116  57.154  1.00 43.71  ? 13   ARG C O   1 
ATOM   5396  C  CB  . ARG C 1 10  ? 34.852  -47.381  56.280  1.00 40.63  ? 13   ARG C CB  1 
ATOM   5397  C  CG  . ARG C 1 10  ? 35.813  -48.536  56.025  1.00 40.98  ? 13   ARG C CG  1 
ATOM   5398  C  CD  . ARG C 1 10  ? 36.880  -48.663  57.092  1.00 40.39  ? 13   ARG C CD  1 
ATOM   5399  N  NE  . ARG C 1 10  ? 38.144  -48.075  56.663  1.00 42.67  ? 13   ARG C NE  1 
ATOM   5400  C  CZ  . ARG C 1 10  ? 39.132  -48.744  56.068  1.00 43.26  ? 13   ARG C CZ  1 
ATOM   5401  N  NH1 . ARG C 1 10  ? 39.006  -50.046  55.821  1.00 44.21  ? 13   ARG C NH1 1 
ATOM   5402  N  NH2 . ARG C 1 10  ? 40.252  -48.110  55.719  1.00 42.18  ? 13   ARG C NH2 1 
ATOM   5403  N  N   . PRO C 1 11  ? 32.779  -49.875  55.030  1.00 44.05  ? 14   PRO C N   1 
ATOM   5404  C  CA  . PRO C 1 11  ? 33.241  -49.734  53.646  1.00 41.76  ? 14   PRO C CA  1 
ATOM   5405  C  C   . PRO C 1 11  ? 32.323  -48.811  52.832  1.00 41.52  ? 14   PRO C C   1 
ATOM   5406  O  O   . PRO C 1 11  ? 31.232  -48.474  53.289  1.00 40.56  ? 14   PRO C O   1 
ATOM   5407  C  CB  . PRO C 1 11  ? 33.165  -51.174  53.105  1.00 43.72  ? 14   PRO C CB  1 
ATOM   5408  C  CG  . PRO C 1 11  ? 32.660  -52.037  54.234  1.00 43.29  ? 14   PRO C CG  1 
ATOM   5409  C  CD  . PRO C 1 11  ? 32.007  -51.113  55.215  1.00 42.29  ? 14   PRO C CD  1 
ATOM   5410  N  N   . CYS C 1 12  ? 32.755  -48.380  51.651  1.00 39.05  ? 15   CYS C N   1 
ATOM   5411  C  CA  . CYS C 1 12  ? 31.813  -47.719  50.756  1.00 38.68  ? 15   CYS C CA  1 
ATOM   5412  C  C   . CYS C 1 12  ? 31.861  -48.197  49.288  1.00 39.52  ? 15   CYS C C   1 
ATOM   5413  O  O   . CYS C 1 12  ? 32.823  -48.851  48.856  1.00 38.95  ? 15   CYS C O   1 
ATOM   5414  C  CB  . CYS C 1 12  ? 31.939  -46.199  50.853  1.00 34.65  ? 15   CYS C CB  1 
ATOM   5415  S  SG  . CYS C 1 12  ? 33.574  -45.572  50.456  1.00 29.91  ? 15   CYS C SG  1 
ATOM   5416  N  N   . ARG C 1 13  ? 30.794  -47.866  48.558  1.00 39.98  ? 16   ARG C N   1 
ATOM   5417  C  CA  . ARG C 1 13  ? 30.645  -48.144  47.131  1.00 39.19  ? 16   ARG C CA  1 
ATOM   5418  C  C   . ARG C 1 13  ? 30.641  -46.822  46.392  1.00 37.32  ? 16   ARG C C   1 
ATOM   5419  O  O   . ARG C 1 13  ? 29.970  -45.860  46.797  1.00 35.09  ? 16   ARG C O   1 
ATOM   5420  C  CB  . ARG C 1 13  ? 29.329  -48.859  46.824  1.00 43.85  ? 16   ARG C CB  1 
ATOM   5421  C  CG  . ARG C 1 13  ? 29.027  -50.091  47.653  1.00 50.37  ? 16   ARG C CG  1 
ATOM   5422  C  CD  . ARG C 1 13  ? 27.769  -50.782  47.129  1.00 57.77  ? 16   ARG C CD  1 
ATOM   5423  N  NE  . ARG C 1 13  ? 27.526  -52.076  47.776  1.00 65.14  ? 16   ARG C NE  1 
ATOM   5424  C  CZ  . ARG C 1 13  ? 28.225  -53.191  47.539  1.00 69.93  ? 16   ARG C CZ  1 
ATOM   5425  N  NH1 . ARG C 1 13  ? 29.232  -53.189  46.664  1.00 66.32  ? 16   ARG C NH1 1 
ATOM   5426  N  NH2 . ARG C 1 13  ? 27.922  -54.316  48.185  1.00 71.06  ? 16   ARG C NH2 1 
ATOM   5427  N  N   . VAL C 1 14  ? 31.350  -46.805  45.271  1.00 35.59  ? 17   VAL C N   1 
ATOM   5428  C  CA  . VAL C 1 14  ? 31.645  -45.586  44.555  1.00 34.05  ? 17   VAL C CA  1 
ATOM   5429  C  C   . VAL C 1 14  ? 31.492  -45.769  43.041  1.00 32.78  ? 17   VAL C C   1 
ATOM   5430  O  O   . VAL C 1 14  ? 31.953  -46.755  42.461  1.00 31.24  ? 17   VAL C O   1 
ATOM   5431  C  CB  . VAL C 1 14  ? 33.054  -45.108  44.976  1.00 35.52  ? 17   VAL C CB  1 
ATOM   5432  C  CG1 . VAL C 1 14  ? 34.023  -44.980  43.812  1.00 33.34  ? 17   VAL C CG1 1 
ATOM   5433  C  CG2 . VAL C 1 14  ? 32.965  -43.851  45.827  1.00 36.06  ? 17   VAL C CG2 1 
ATOM   5434  N  N   . LEU C 1 15  ? 30.802  -44.826  42.420  1.00 29.94  ? 18   LEU C N   1 
ATOM   5435  C  CA  . LEU C 1 15  ? 30.686  -44.779  40.977  1.00 29.99  ? 18   LEU C CA  1 
ATOM   5436  C  C   . LEU C 1 15  ? 31.858  -43.969  40.439  1.00 30.23  ? 18   LEU C C   1 
ATOM   5437  O  O   . LEU C 1 15  ? 32.098  -42.846  40.891  1.00 33.67  ? 18   LEU C O   1 
ATOM   5438  C  CB  . LEU C 1 15  ? 29.361  -44.121  40.567  1.00 27.85  ? 18   LEU C CB  1 
ATOM   5439  C  CG  . LEU C 1 15  ? 29.151  -43.914  39.060  1.00 29.20  ? 18   LEU C CG  1 
ATOM   5440  C  CD1 . LEU C 1 15  ? 28.889  -45.253  38.371  1.00 29.17  ? 18   LEU C CD1 1 
ATOM   5441  C  CD2 . LEU C 1 15  ? 28.036  -42.926  38.754  1.00 26.83  ? 18   LEU C CD2 1 
ATOM   5442  N  N   . VAL C 1 16  ? 32.594  -44.536  39.490  1.00 28.75  ? 19   VAL C N   1 
ATOM   5443  C  CA  . VAL C 1 16  ? 33.715  -43.839  38.886  1.00 27.44  ? 19   VAL C CA  1 
ATOM   5444  C  C   . VAL C 1 16  ? 33.375  -43.559  37.428  1.00 30.33  ? 19   VAL C C   1 
ATOM   5445  O  O   . VAL C 1 16  ? 33.219  -44.487  36.620  1.00 32.63  ? 19   VAL C O   1 
ATOM   5446  C  CB  . VAL C 1 16  ? 35.027  -44.646  38.990  1.00 28.28  ? 19   VAL C CB  1 
ATOM   5447  C  CG1 . VAL C 1 16  ? 36.199  -43.857  38.428  1.00 27.24  ? 19   VAL C CG1 1 
ATOM   5448  C  CG2 . VAL C 1 16  ? 35.310  -45.045  40.436  1.00 26.85  ? 19   VAL C CG2 1 
ATOM   5449  N  N   . LEU C 1 17  ? 33.216  -42.278  37.115  1.00 27.98  ? 20   LEU C N   1 
ATOM   5450  C  CA  . LEU C 1 17  ? 33.030  -41.823  35.761  1.00 27.98  ? 20   LEU C CA  1 
ATOM   5451  C  C   . LEU C 1 17  ? 34.374  -41.431  35.203  1.00 29.30  ? 20   LEU C C   1 
ATOM   5452  O  O   . LEU C 1 17  ? 35.056  -40.557  35.739  1.00 29.30  ? 20   LEU C O   1 
ATOM   5453  C  CB  . LEU C 1 17  ? 32.044  -40.673  35.706  1.00 26.11  ? 20   LEU C CB  1 
ATOM   5454  C  CG  . LEU C 1 17  ? 30.650  -41.070  36.172  1.00 25.59  ? 20   LEU C CG  1 
ATOM   5455  C  CD1 . LEU C 1 17  ? 29.834  -39.832  36.424  1.00 27.24  ? 20   LEU C CD1 1 
ATOM   5456  C  CD2 . LEU C 1 17  ? 29.963  -41.921  35.110  1.00 26.69  ? 20   LEU C CD2 1 
ATOM   5457  N  N   . LEU C 1 18  ? 34.769  -42.121  34.140  1.00 30.74  ? 21   LEU C N   1 
ATOM   5458  C  CA  . LEU C 1 18  ? 36.104  -41.986  33.615  1.00 31.67  ? 21   LEU C CA  1 
ATOM   5459  C  C   . LEU C 1 18  ? 36.068  -41.667  32.121  1.00 32.95  ? 21   LEU C C   1 
ATOM   5460  O  O   . LEU C 1 18  ? 35.315  -42.282  31.367  1.00 33.34  ? 21   LEU C O   1 
ATOM   5461  C  CB  . LEU C 1 18  ? 36.893  -43.253  33.905  1.00 30.50  ? 21   LEU C CB  1 
ATOM   5462  C  CG  . LEU C 1 18  ? 38.378  -43.191  33.569  1.00 32.13  ? 21   LEU C CG  1 
ATOM   5463  C  CD1 . LEU C 1 18  ? 39.148  -44.009  34.587  1.00 32.57  ? 21   LEU C CD1 1 
ATOM   5464  C  CD2 . LEU C 1 18  ? 38.678  -43.665  32.152  1.00 30.62  ? 21   LEU C CD2 1 
ATOM   5465  N  N   . ASN C 1 19  ? 36.862  -40.678  31.716  1.00 33.13  ? 22   ASN C N   1 
ATOM   5466  C  CA  . ASN C 1 19  ? 37.064  -40.371  30.307  1.00 35.48  ? 22   ASN C CA  1 
ATOM   5467  C  C   . ASN C 1 19  ? 38.356  -41.035  29.824  1.00 36.80  ? 22   ASN C C   1 
ATOM   5468  O  O   . ASN C 1 19  ? 39.456  -40.596  30.181  1.00 35.34  ? 22   ASN C O   1 
ATOM   5469  C  CB  . ASN C 1 19  ? 37.130  -38.867  30.091  1.00 37.41  ? 22   ASN C CB  1 
ATOM   5470  C  CG  . ASN C 1 19  ? 37.225  -38.483  28.629  1.00 39.27  ? 22   ASN C CG  1 
ATOM   5471  O  OD1 . ASN C 1 19  ? 36.942  -37.338  28.268  1.00 39.90  ? 22   ASN C OD1 1 
ATOM   5472  N  ND2 . ASN C 1 19  ? 37.615  -39.429  27.777  1.00 40.44  ? 22   ASN C ND2 1 
ATOM   5473  N  N   . PRO C 1 20  ? 38.227  -42.111  29.020  1.00 36.78  ? 23   PRO C N   1 
ATOM   5474  C  CA  . PRO C 1 20  ? 39.422  -42.870  28.648  1.00 37.50  ? 23   PRO C CA  1 
ATOM   5475  C  C   . PRO C 1 20  ? 40.316  -42.111  27.659  1.00 39.20  ? 23   PRO C C   1 
ATOM   5476  O  O   . PRO C 1 20  ? 41.531  -42.332  27.629  1.00 40.04  ? 23   PRO C O   1 
ATOM   5477  C  CB  . PRO C 1 20  ? 38.855  -44.175  28.068  1.00 36.55  ? 23   PRO C CB  1 
ATOM   5478  C  CG  . PRO C 1 20  ? 37.485  -43.827  27.619  1.00 36.83  ? 23   PRO C CG  1 
ATOM   5479  C  CD  . PRO C 1 20  ? 36.990  -42.679  28.450  1.00 35.01  ? 23   PRO C CD  1 
ATOM   5480  N  N   . ARG C 1 21  ? 39.730  -41.199  26.890  1.00 42.29  ? 24   ARG C N   1 
ATOM   5481  C  CA  . ARG C 1 21  ? 40.519  -40.312  26.047  1.00 49.60  ? 24   ARG C CA  1 
ATOM   5482  C  C   . ARG C 1 21  ? 41.474  -39.424  26.868  1.00 53.43  ? 24   ARG C C   1 
ATOM   5483  O  O   . ARG C 1 21  ? 42.579  -39.134  26.420  1.00 53.51  ? 24   ARG C O   1 
ATOM   5484  C  CB  . ARG C 1 21  ? 39.614  -39.483  25.128  1.00 55.20  ? 24   ARG C CB  1 
ATOM   5485  C  CG  . ARG C 1 21  ? 39.358  -40.119  23.765  1.00 60.53  ? 24   ARG C CG  1 
ATOM   5486  C  CD  . ARG C 1 21  ? 37.934  -39.908  23.265  1.00 68.45  ? 24   ARG C CD  1 
ATOM   5487  N  NE  . ARG C 1 21  ? 37.281  -38.759  23.894  1.00 75.67  ? 24   ARG C NE  1 
ATOM   5488  C  CZ  . ARG C 1 21  ? 36.147  -38.196  23.475  1.00 77.67  ? 24   ARG C CZ  1 
ATOM   5489  N  NH1 . ARG C 1 21  ? 35.517  -38.662  22.402  1.00 74.85  ? 24   ARG C NH1 1 
ATOM   5490  N  NH2 . ARG C 1 21  ? 35.644  -37.159  24.140  1.00 76.04  ? 24   ARG C NH2 1 
ATOM   5491  N  N   . GLY C 1 22  ? 41.062  -39.038  28.079  1.00 56.45  ? 25   GLY C N   1 
ATOM   5492  C  CA  . GLY C 1 22  ? 41.873  -38.181  28.959  1.00 60.03  ? 25   GLY C CA  1 
ATOM   5493  C  C   . GLY C 1 22  ? 43.213  -38.765  29.383  1.00 61.24  ? 25   GLY C C   1 
ATOM   5494  O  O   . GLY C 1 22  ? 43.410  -39.984  29.324  1.00 61.27  ? 25   GLY C O   1 
ATOM   5495  N  N   . GLY C 1 23  ? 44.123  -37.889  29.827  1.00 63.05  ? 26   GLY C N   1 
ATOM   5496  C  CA  . GLY C 1 23  ? 45.516  -38.256  30.143  1.00 65.22  ? 26   GLY C CA  1 
ATOM   5497  C  C   . GLY C 1 23  ? 46.132  -38.718  28.843  1.00 70.44  ? 26   GLY C C   1 
ATOM   5498  O  O   . GLY C 1 23  ? 46.852  -39.720  28.791  1.00 68.78  ? 26   GLY C O   1 
ATOM   5499  N  N   . LYS C 1 24  ? 45.868  -37.920  27.808  1.00 75.30  ? 27   LYS C N   1 
ATOM   5500  C  CA  . LYS C 1 24  ? 45.615  -38.418  26.455  1.00 74.20  ? 27   LYS C CA  1 
ATOM   5501  C  C   . LYS C 1 24  ? 46.040  -39.863  26.154  1.00 70.58  ? 27   LYS C C   1 
ATOM   5502  O  O   . LYS C 1 24  ? 47.220  -40.172  25.979  1.00 65.91  ? 27   LYS C O   1 
ATOM   5503  C  CB  . LYS C 1 24  ? 45.961  -37.390  25.365  1.00 83.39  ? 27   LYS C CB  1 
ATOM   5504  C  CG  . LYS C 1 24  ? 44.925  -36.258  25.306  1.00 86.93  ? 27   LYS C CG  1 
ATOM   5505  C  CD  . LYS C 1 24  ? 44.565  -35.810  23.887  1.00 93.40  ? 27   LYS C CD  1 
ATOM   5506  C  CE  . LYS C 1 24  ? 43.447  -36.640  23.257  1.00 92.54  ? 27   LYS C CE  1 
ATOM   5507  N  NZ  . LYS C 1 24  ? 42.091  -36.254  23.745  1.00 86.62  ? 27   LYS C NZ  1 
ATOM   5508  N  N   . GLY C 1 25  ? 45.027  -40.729  26.137  1.00 67.26  ? 28   GLY C N   1 
ATOM   5509  C  CA  . GLY C 1 25  ? 45.194  -42.155  25.927  1.00 63.12  ? 28   GLY C CA  1 
ATOM   5510  C  C   . GLY C 1 25  ? 45.103  -42.982  27.200  1.00 59.31  ? 28   GLY C C   1 
ATOM   5511  O  O   . GLY C 1 25  ? 44.552  -44.078  27.180  1.00 59.71  ? 28   GLY C O   1 
ATOM   5512  N  N   . LYS C 1 26  ? 45.614  -42.454  28.311  1.00 52.66  ? 29   LYS C N   1 
ATOM   5513  C  CA  . LYS C 1 26  ? 45.963  -43.307  29.452  1.00 50.09  ? 29   LYS C CA  1 
ATOM   5514  C  C   . LYS C 1 26  ? 45.030  -43.341  30.688  1.00 46.18  ? 29   LYS C C   1 
ATOM   5515  O  O   . LYS C 1 26  ? 45.266  -44.134  31.603  1.00 43.79  ? 29   LYS C O   1 
ATOM   5516  C  CB  . LYS C 1 26  ? 47.410  -43.040  29.885  1.00 54.03  ? 29   LYS C CB  1 
ATOM   5517  C  CG  . LYS C 1 26  ? 48.477  -43.547  28.925  1.00 57.87  ? 29   LYS C CG  1 
ATOM   5518  C  CD  . LYS C 1 26  ? 49.856  -43.461  29.578  1.00 63.23  ? 29   LYS C CD  1 
ATOM   5519  C  CE  . LYS C 1 26  ? 51.007  -43.635  28.587  1.00 66.99  ? 29   LYS C CE  1 
ATOM   5520  N  NZ  . LYS C 1 26  ? 51.206  -45.040  28.122  1.00 65.54  ? 29   LYS C NZ  1 
ATOM   5521  N  N   . ALA C 1 27  ? 43.978  -42.520  30.713  1.00 40.17  ? 30   ALA C N   1 
ATOM   5522  C  CA  . ALA C 1 27  ? 43.136  -42.390  31.910  1.00 39.24  ? 30   ALA C CA  1 
ATOM   5523  C  C   . ALA C 1 27  ? 42.763  -43.707  32.601  1.00 38.19  ? 30   ALA C C   1 
ATOM   5524  O  O   . ALA C 1 27  ? 42.887  -43.826  33.818  1.00 35.55  ? 30   ALA C O   1 
ATOM   5525  C  CB  . ALA C 1 27  ? 41.892  -41.583  31.616  1.00 39.58  ? 30   ALA C CB  1 
ATOM   5526  N  N   . LEU C 1 28  ? 42.329  -44.700  31.828  1.00 38.67  ? 31   LEU C N   1 
ATOM   5527  C  CA  . LEU C 1 28  ? 41.949  -45.994  32.395  1.00 36.71  ? 31   LEU C CA  1 
ATOM   5528  C  C   . LEU C 1 28  ? 43.150  -46.805  32.882  1.00 35.71  ? 31   LEU C C   1 
ATOM   5529  O  O   . LEU C 1 28  ? 43.066  -47.499  33.891  1.00 36.21  ? 31   LEU C O   1 
ATOM   5530  C  CB  . LEU C 1 28  ? 41.092  -46.787  31.402  1.00 36.66  ? 31   LEU C CB  1 
ATOM   5531  C  CG  . LEU C 1 28  ? 40.752  -48.254  31.688  1.00 35.57  ? 31   LEU C CG  1 
ATOM   5532  C  CD1 . LEU C 1 28  ? 39.960  -48.461  32.973  1.00 35.58  ? 31   LEU C CD1 1 
ATOM   5533  C  CD2 . LEU C 1 28  ? 39.991  -48.798  30.493  1.00 36.82  ? 31   LEU C CD2 1 
ATOM   5534  N  N   . GLN C 1 29  ? 44.258  -46.719  32.156  1.00 37.57  ? 32   GLN C N   1 
ATOM   5535  C  CA  . GLN C 1 29  ? 45.502  -47.381  32.540  1.00 39.28  ? 32   GLN C CA  1 
ATOM   5536  C  C   . GLN C 1 29  ? 45.955  -46.858  33.906  1.00 38.04  ? 32   GLN C C   1 
ATOM   5537  O  O   . GLN C 1 29  ? 46.275  -47.635  34.815  1.00 40.20  ? 32   GLN C O   1 
ATOM   5538  C  CB  . GLN C 1 29  ? 46.569  -47.101  31.483  1.00 44.77  ? 32   GLN C CB  1 
ATOM   5539  C  CG  . GLN C 1 29  ? 47.905  -47.804  31.687  1.00 54.06  ? 32   GLN C CG  1 
ATOM   5540  C  CD  . GLN C 1 29  ? 49.074  -46.988  31.147  1.00 58.87  ? 32   GLN C CD  1 
ATOM   5541  O  OE1 . GLN C 1 29  ? 49.574  -46.077  31.824  1.00 64.51  ? 32   GLN C OE1 1 
ATOM   5542  N  NE2 . GLN C 1 29  ? 49.514  -47.305  29.924  1.00 55.39  ? 32   GLN C NE2 1 
ATOM   5543  N  N   . LEU C 1 30  ? 45.951  -45.535  34.050  1.00 35.01  ? 33   LEU C N   1 
ATOM   5544  C  CA  . LEU C 1 30  ? 46.304  -44.879  35.315  1.00 33.84  ? 33   LEU C CA  1 
ATOM   5545  C  C   . LEU C 1 30  ? 45.359  -45.229  36.462  1.00 32.58  ? 33   LEU C C   1 
ATOM   5546  O  O   . LEU C 1 30  ? 45.809  -45.422  37.582  1.00 32.99  ? 33   LEU C O   1 
ATOM   5547  C  CB  . LEU C 1 30  ? 46.429  -43.366  35.134  1.00 31.96  ? 33   LEU C CB  1 
ATOM   5548  C  CG  . LEU C 1 30  ? 47.620  -42.931  34.260  1.00 32.22  ? 33   LEU C CG  1 
ATOM   5549  C  CD1 . LEU C 1 30  ? 47.497  -41.478  33.816  1.00 33.76  ? 33   LEU C CD1 1 
ATOM   5550  C  CD2 . LEU C 1 30  ? 48.948  -43.165  34.968  1.00 32.12  ? 33   LEU C CD2 1 
ATOM   5551  N  N   . PHE C 1 31  ? 44.062  -45.359  36.185  1.00 31.59  ? 34   PHE C N   1 
ATOM   5552  C  CA  . PHE C 1 31  ? 43.163  -45.901  37.203  1.00 32.60  ? 34   PHE C CA  1 
ATOM   5553  C  C   . PHE C 1 31  ? 43.617  -47.261  37.715  1.00 32.45  ? 34   PHE C C   1 
ATOM   5554  O  O   . PHE C 1 31  ? 43.591  -47.513  38.919  1.00 31.81  ? 34   PHE C O   1 
ATOM   5555  C  CB  . PHE C 1 31  ? 41.726  -46.030  36.703  1.00 30.45  ? 34   PHE C CB  1 
ATOM   5556  C  CG  . PHE C 1 31  ? 40.773  -46.554  37.745  1.00 29.93  ? 34   PHE C CG  1 
ATOM   5557  C  CD1 . PHE C 1 31  ? 40.135  -45.679  38.629  1.00 29.24  ? 34   PHE C CD1 1 
ATOM   5558  C  CD2 . PHE C 1 31  ? 40.498  -47.914  37.838  1.00 29.24  ? 34   PHE C CD2 1 
ATOM   5559  C  CE1 . PHE C 1 31  ? 39.248  -46.154  39.583  1.00 28.69  ? 34   PHE C CE1 1 
ATOM   5560  C  CE2 . PHE C 1 31  ? 39.621  -48.394  38.799  1.00 29.30  ? 34   PHE C CE2 1 
ATOM   5561  C  CZ  . PHE C 1 31  ? 38.992  -47.511  39.674  1.00 28.74  ? 34   PHE C CZ  1 
ATOM   5562  N  N   . ARG C 1 32  ? 43.997  -48.139  36.790  1.00 32.83  ? 35   ARG C N   1 
ATOM   5563  C  CA  . ARG C 1 32  ? 44.243  -49.537  37.113  1.00 33.68  ? 35   ARG C CA  1 
ATOM   5564  C  C   . ARG C 1 32  ? 45.550  -49.676  37.891  1.00 33.47  ? 35   ARG C C   1 
ATOM   5565  O  O   . ARG C 1 32  ? 45.639  -50.472  38.833  1.00 32.98  ? 35   ARG C O   1 
ATOM   5566  C  CB  . ARG C 1 32  ? 44.253  -50.379  35.825  1.00 36.07  ? 35   ARG C CB  1 
ATOM   5567  C  CG  . ARG C 1 32  ? 43.294  -51.572  35.836  1.00 36.77  ? 35   ARG C CG  1 
ATOM   5568  C  CD  . ARG C 1 32  ? 41.897  -51.292  35.253  1.00 35.29  ? 35   ARG C CD  1 
ATOM   5569  N  NE  . ARG C 1 32  ? 40.883  -51.847  36.151  1.00 35.16  ? 35   ARG C NE  1 
ATOM   5570  C  CZ  . ARG C 1 32  ? 39.662  -52.266  35.825  1.00 35.29  ? 35   ARG C CZ  1 
ATOM   5571  N  NH1 . ARG C 1 32  ? 39.218  -52.228  34.579  1.00 35.92  ? 35   ARG C NH1 1 
ATOM   5572  N  NH2 . ARG C 1 32  ? 38.878  -52.749  36.774  1.00 37.03  ? 35   ARG C NH2 1 
ATOM   5573  N  N   . SER C 1 33  ? 46.551  -48.881  37.508  1.00 33.30  ? 36   SER C N   1 
ATOM   5574  C  CA  . SER C 1 33  ? 47.853  -48.901  38.178  1.00 35.71  ? 36   SER C CA  1 
ATOM   5575  C  C   . SER C 1 33  ? 48.019  -47.988  39.423  1.00 37.56  ? 36   SER C C   1 
ATOM   5576  O  O   . SER C 1 33  ? 48.794  -48.327  40.308  1.00 38.72  ? 36   SER C O   1 
ATOM   5577  C  CB  . SER C 1 33  ? 48.982  -48.642  37.182  1.00 34.50  ? 36   SER C CB  1 
ATOM   5578  O  OG  . SER C 1 33  ? 48.844  -47.367  36.599  1.00 37.63  ? 36   SER C OG  1 
ATOM   5579  N  N   . HIS C 1 34  ? 47.302  -46.863  39.507  1.00 37.29  ? 37   HIS C N   1 
ATOM   5580  C  CA  . HIS C 1 34  ? 47.530  -45.882  40.603  1.00 35.98  ? 37   HIS C CA  1 
ATOM   5581  C  C   . HIS C 1 34  ? 46.378  -45.706  41.548  1.00 35.63  ? 37   HIS C C   1 
ATOM   5582  O  O   . HIS C 1 34  ? 46.571  -45.471  42.736  1.00 40.08  ? 37   HIS C O   1 
ATOM   5583  C  CB  . HIS C 1 34  ? 47.935  -44.517  40.048  1.00 35.97  ? 37   HIS C CB  1 
ATOM   5584  C  CG  . HIS C 1 34  ? 49.367  -44.449  39.572  1.00 38.25  ? 37   HIS C CG  1 
ATOM   5585  N  ND1 . HIS C 1 34  ? 49.837  -45.228  38.582  1.00 38.28  ? 37   HIS C ND1 1 
ATOM   5586  C  CD2 . HIS C 1 34  ? 50.432  -43.642  39.979  1.00 38.83  ? 37   HIS C CD2 1 
ATOM   5587  C  CE1 . HIS C 1 34  ? 51.139  -44.941  38.364  1.00 40.15  ? 37   HIS C CE1 1 
ATOM   5588  N  NE2 . HIS C 1 34  ? 51.499  -43.965  39.213  1.00 40.59  ? 37   HIS C NE2 1 
ATOM   5589  N  N   . VAL C 1 35  ? 45.164  -45.798  41.030  1.00 33.87  ? 38   VAL C N   1 
ATOM   5590  C  CA  . VAL C 1 35  ? 43.963  -45.642  41.836  1.00 31.40  ? 38   VAL C CA  1 
ATOM   5591  C  C   . VAL C 1 35  ? 43.489  -46.963  42.451  1.00 30.98  ? 38   VAL C C   1 
ATOM   5592  O  O   . VAL C 1 35  ? 43.352  -47.056  43.668  1.00 31.46  ? 38   VAL C O   1 
ATOM   5593  C  CB  . VAL C 1 35  ? 42.824  -45.016  41.014  1.00 28.90  ? 38   VAL C CB  1 
ATOM   5594  C  CG1 . VAL C 1 35  ? 41.634  -44.681  41.901  1.00 28.55  ? 38   VAL C CG1 1 
ATOM   5595  C  CG2 . VAL C 1 35  ? 43.321  -43.781  40.277  1.00 30.47  ? 38   VAL C CG2 1 
ATOM   5596  N  N   . GLN C 1 36  ? 43.236  -47.971  41.613  1.00 31.45  ? 39   GLN C N   1 
ATOM   5597  C  CA  . GLN C 1 36  ? 42.592  -49.227  42.048  1.00 31.72  ? 39   GLN C CA  1 
ATOM   5598  C  C   . GLN C 1 36  ? 43.266  -49.952  43.228  1.00 31.44  ? 39   GLN C C   1 
ATOM   5599  O  O   . GLN C 1 36  ? 42.562  -50.374  44.152  1.00 34.15  ? 39   GLN C O   1 
ATOM   5600  C  CB  . GLN C 1 36  ? 42.401  -50.198  40.856  1.00 31.95  ? 39   GLN C CB  1 
ATOM   5601  C  CG  . GLN C 1 36  ? 41.801  -51.564  41.199  1.00 29.47  ? 39   GLN C CG  1 
ATOM   5602  C  CD  . GLN C 1 36  ? 41.386  -52.367  39.962  1.00 31.45  ? 39   GLN C CD  1 
ATOM   5603  O  OE1 . GLN C 1 36  ? 41.364  -51.847  38.841  1.00 28.89  ? 39   GLN C OE1 1 
ATOM   5604  N  NE2 . GLN C 1 36  ? 41.041  -53.641  40.166  1.00 29.05  ? 39   GLN C NE2 1 
ATOM   5605  N  N   . PRO C 1 37  ? 44.610  -50.130  43.194  1.00 31.19  ? 40   PRO C N   1 
ATOM   5606  C  CA  . PRO C 1 37  ? 45.210  -50.901  44.288  1.00 33.09  ? 40   PRO C CA  1 
ATOM   5607  C  C   . PRO C 1 37  ? 44.977  -50.227  45.644  1.00 37.24  ? 40   PRO C C   1 
ATOM   5608  O  O   . PRO C 1 37  ? 44.744  -50.915  46.650  1.00 38.50  ? 40   PRO C O   1 
ATOM   5609  C  CB  . PRO C 1 37  ? 46.696  -50.924  43.931  1.00 32.20  ? 40   PRO C CB  1 
ATOM   5610  C  CG  . PRO C 1 37  ? 46.739  -50.716  42.447  1.00 34.34  ? 40   PRO C CG  1 
ATOM   5611  C  CD  . PRO C 1 37  ? 45.619  -49.745  42.189  1.00 32.42  ? 40   PRO C CD  1 
ATOM   5612  N  N   . LEU C 1 38  ? 44.999  -48.893  45.653  1.00 37.57  ? 41   LEU C N   1 
ATOM   5613  C  CA  . LEU C 1 38  ? 44.737  -48.117  46.874  1.00 38.98  ? 41   LEU C CA  1 
ATOM   5614  C  C   . LEU C 1 38  ? 43.286  -48.264  47.332  1.00 38.09  ? 41   LEU C C   1 
ATOM   5615  O  O   . LEU C 1 38  ? 43.031  -48.391  48.520  1.00 39.15  ? 41   LEU C O   1 
ATOM   5616  C  CB  . LEU C 1 38  ? 45.123  -46.635  46.689  1.00 39.29  ? 41   LEU C CB  1 
ATOM   5617  C  CG  . LEU C 1 38  ? 46.560  -46.151  46.969  1.00 39.63  ? 41   LEU C CG  1 
ATOM   5618  C  CD1 . LEU C 1 38  ? 47.655  -47.140  46.578  1.00 41.27  ? 41   LEU C CD1 1 
ATOM   5619  C  CD2 . LEU C 1 38  ? 46.806  -44.821  46.277  1.00 39.88  ? 41   LEU C CD2 1 
ATOM   5620  N  N   . LEU C 1 39  ? 42.341  -48.293  46.393  1.00 37.90  ? 42   LEU C N   1 
ATOM   5621  C  CA  . LEU C 1 39  ? 40.916  -48.434  46.748  1.00 37.39  ? 42   LEU C CA  1 
ATOM   5622  C  C   . LEU C 1 39  ? 40.578  -49.758  47.438  1.00 38.04  ? 42   LEU C C   1 
ATOM   5623  O  O   . LEU C 1 39  ? 39.778  -49.791  48.389  1.00 37.51  ? 42   LEU C O   1 
ATOM   5624  C  CB  . LEU C 1 39  ? 40.022  -48.266  45.517  1.00 35.64  ? 42   LEU C CB  1 
ATOM   5625  C  CG  . LEU C 1 39  ? 40.074  -46.966  44.700  1.00 36.76  ? 42   LEU C CG  1 
ATOM   5626  C  CD1 . LEU C 1 39  ? 38.961  -46.989  43.667  1.00 35.72  ? 42   LEU C CD1 1 
ATOM   5627  C  CD2 . LEU C 1 39  ? 39.928  -45.731  45.581  1.00 35.76  ? 42   LEU C CD2 1 
ATOM   5628  N  N   . ALA C 1 40  ? 41.169  -50.848  46.949  1.00 38.86  ? 43   ALA C N   1 
ATOM   5629  C  CA  . ALA C 1 40  ? 40.894  -52.181  47.506  1.00 40.54  ? 43   ALA C CA  1 
ATOM   5630  C  C   . ALA C 1 40  ? 41.462  -52.247  48.910  1.00 40.31  ? 43   ALA C C   1 
ATOM   5631  O  O   . ALA C 1 40  ? 40.814  -52.746  49.824  1.00 42.28  ? 43   ALA C O   1 
ATOM   5632  C  CB  . ALA C 1 40  ? 41.491  -53.273  46.628  1.00 38.58  ? 43   ALA C CB  1 
ATOM   5633  N  N   . GLU C 1 41  ? 42.674  -51.724  49.065  1.00 42.36  ? 44   GLU C N   1 
ATOM   5634  C  CA  . GLU C 1 41  ? 43.298  -51.552  50.373  1.00 46.53  ? 44   GLU C CA  1 
ATOM   5635  C  C   . GLU C 1 41  ? 42.389  -50.766  51.337  1.00 45.69  ? 44   GLU C C   1 
ATOM   5636  O  O   . GLU C 1 41  ? 42.271  -51.131  52.508  1.00 46.61  ? 44   GLU C O   1 
ATOM   5637  C  CB  . GLU C 1 41  ? 44.679  -50.889  50.208  1.00 51.40  ? 44   GLU C CB  1 
ATOM   5638  C  CG  . GLU C 1 41  ? 45.141  -50.019  51.375  1.00 59.84  ? 44   GLU C CG  1 
ATOM   5639  C  CD  . GLU C 1 41  ? 45.972  -50.773  52.397  1.00 63.26  ? 44   GLU C CD  1 
ATOM   5640  O  OE1 . GLU C 1 41  ? 45.459  -51.027  53.507  1.00 66.59  ? 44   GLU C OE1 1 
ATOM   5641  O  OE2 . GLU C 1 41  ? 47.139  -51.105  52.096  1.00 64.06  ? 44   GLU C OE2 1 
ATOM   5642  N  N   . ALA C 1 42  ? 41.723  -49.722  50.829  1.00 41.75  ? 45   ALA C N   1 
ATOM   5643  C  CA  . ALA C 1 42  ? 40.855  -48.859  51.649  1.00 37.24  ? 45   ALA C CA  1 
ATOM   5644  C  C   . ALA C 1 42  ? 39.432  -49.394  51.840  1.00 35.58  ? 45   ALA C C   1 
ATOM   5645  O  O   . ALA C 1 42  ? 38.628  -48.789  52.549  1.00 35.49  ? 45   ALA C O   1 
ATOM   5646  C  CB  . ALA C 1 42  ? 40.826  -47.438  51.075  1.00 35.90  ? 45   ALA C CB  1 
ATOM   5647  N  N   . GLU C 1 43  ? 39.123  -50.526  51.209  1.00 36.17  ? 46   GLU C N   1 
ATOM   5648  C  CA  . GLU C 1 43  ? 37.756  -51.102  51.187  1.00 34.20  ? 46   GLU C CA  1 
ATOM   5649  C  C   . GLU C 1 43  ? 36.706  -50.212  50.511  1.00 32.07  ? 46   GLU C C   1 
ATOM   5650  O  O   . GLU C 1 43  ? 35.522  -50.264  50.835  1.00 30.95  ? 46   GLU C O   1 
ATOM   5651  C  CB  . GLU C 1 43  ? 37.303  -51.521  52.578  1.00 35.21  ? 46   GLU C CB  1 
ATOM   5652  C  CG  . GLU C 1 43  ? 38.256  -52.515  53.216  1.00 41.79  ? 46   GLU C CG  1 
ATOM   5653  C  CD  . GLU C 1 43  ? 37.740  -53.084  54.527  1.00 44.02  ? 46   GLU C CD  1 
ATOM   5654  O  OE1 . GLU C 1 43  ? 38.543  -53.739  55.228  1.00 50.47  ? 46   GLU C OE1 1 
ATOM   5655  O  OE2 . GLU C 1 43  ? 36.548  -52.889  54.855  1.00 44.42  ? 46   GLU C OE2 1 
ATOM   5656  N  N   . ILE C 1 44  ? 37.160  -49.395  49.568  1.00 31.91  ? 47   ILE C N   1 
ATOM   5657  C  CA  . ILE C 1 44  ? 36.267  -48.654  48.687  1.00 31.04  ? 47   ILE C CA  1 
ATOM   5658  C  C   . ILE C 1 44  ? 36.065  -49.501  47.418  1.00 32.03  ? 47   ILE C C   1 
ATOM   5659  O  O   . ILE C 1 44  ? 36.971  -49.625  46.581  1.00 31.55  ? 47   ILE C O   1 
ATOM   5660  C  CB  . ILE C 1 44  ? 36.871  -47.284  48.329  1.00 30.13  ? 47   ILE C CB  1 
ATOM   5661  C  CG1 . ILE C 1 44  ? 36.922  -46.388  49.571  1.00 30.31  ? 47   ILE C CG1 1 
ATOM   5662  C  CG2 . ILE C 1 44  ? 36.089  -46.621  47.200  1.00 29.92  ? 47   ILE C CG2 1 
ATOM   5663  C  CD1 . ILE C 1 44  ? 37.944  -45.275  49.499  1.00 29.54  ? 47   ILE C CD1 1 
ATOM   5664  N  N   . SER C 1 45  ? 34.894  -50.115  47.292  1.00 32.04  ? 48   SER C N   1 
ATOM   5665  C  CA  . SER C 1 45  ? 34.561  -50.807  46.058  1.00 31.28  ? 48   SER C CA  1 
ATOM   5666  C  C   . SER C 1 45  ? 33.900  -49.825  45.081  1.00 32.93  ? 48   SER C C   1 
ATOM   5667  O  O   . SER C 1 45  ? 33.196  -48.883  45.499  1.00 32.13  ? 48   SER C O   1 
ATOM   5668  C  CB  . SER C 1 45  ? 33.714  -52.051  46.309  1.00 29.91  ? 48   SER C CB  1 
ATOM   5669  O  OG  . SER C 1 45  ? 32.518  -51.750  46.983  1.00 31.68  ? 48   SER C OG  1 
ATOM   5670  N  N   . PHE C 1 46  ? 34.156  -50.046  43.790  1.00 30.24  ? 49   PHE C N   1 
ATOM   5671  C  CA  . PHE C 1 46  ? 33.786  -49.111  42.730  1.00 29.97  ? 49   PHE C CA  1 
ATOM   5672  C  C   . PHE C 1 46  ? 33.147  -49.820  41.537  1.00 30.62  ? 49   PHE C C   1 
ATOM   5673  O  O   . PHE C 1 46  ? 33.296  -51.048  41.374  1.00 27.70  ? 49   PHE C O   1 
ATOM   5674  C  CB  . PHE C 1 46  ? 35.045  -48.385  42.238  1.00 29.51  ? 49   PHE C CB  1 
ATOM   5675  C  CG  . PHE C 1 46  ? 36.072  -49.307  41.634  1.00 28.74  ? 49   PHE C CG  1 
ATOM   5676  C  CD1 . PHE C 1 46  ? 37.042  -49.919  42.438  1.00 29.35  ? 49   PHE C CD1 1 
ATOM   5677  C  CD2 . PHE C 1 46  ? 36.050  -49.598  40.266  1.00 29.56  ? 49   PHE C CD2 1 
ATOM   5678  C  CE1 . PHE C 1 46  ? 37.979  -50.787  41.892  1.00 29.92  ? 49   PHE C CE1 1 
ATOM   5679  C  CE2 . PHE C 1 46  ? 36.991  -50.461  39.708  1.00 29.43  ? 49   PHE C CE2 1 
ATOM   5680  C  CZ  . PHE C 1 46  ? 37.960  -51.053  40.519  1.00 30.99  ? 49   PHE C CZ  1 
ATOM   5681  N  N   . THR C 1 47  ? 32.449  -49.043  40.700  1.00 30.72  ? 50   THR C N   1 
ATOM   5682  C  CA  . THR C 1 47  ? 32.188  -49.473  39.335  1.00 33.02  ? 50   THR C CA  1 
ATOM   5683  C  C   . THR C 1 47  ? 32.625  -48.415  38.345  1.00 32.04  ? 50   THR C C   1 
ATOM   5684  O  O   . THR C 1 47  ? 32.313  -47.236  38.499  1.00 31.19  ? 50   THR C O   1 
ATOM   5685  C  CB  . THR C 1 47  ? 30.736  -49.942  39.066  1.00 34.56  ? 50   THR C CB  1 
ATOM   5686  O  OG1 . THR C 1 47  ? 29.925  -48.848  38.641  1.00 40.66  ? 50   THR C OG1 1 
ATOM   5687  C  CG2 . THR C 1 47  ? 30.137  -50.565  40.269  1.00 34.14  ? 50   THR C CG2 1 
ATOM   5688  N  N   . LEU C 1 48  ? 33.392  -48.842  37.347  1.00 32.03  ? 51   LEU C N   1 
ATOM   5689  C  CA  . LEU C 1 48  ? 33.803  -47.952  36.283  1.00 30.80  ? 51   LEU C CA  1 
ATOM   5690  C  C   . LEU C 1 48  ? 32.673  -47.828  35.267  1.00 30.79  ? 51   LEU C C   1 
ATOM   5691  O  O   . LEU C 1 48  ? 32.034  -48.820  34.889  1.00 28.07  ? 51   LEU C O   1 
ATOM   5692  C  CB  . LEU C 1 48  ? 35.075  -48.445  35.614  1.00 31.95  ? 51   LEU C CB  1 
ATOM   5693  C  CG  . LEU C 1 48  ? 36.404  -48.145  36.306  1.00 33.48  ? 51   LEU C CG  1 
ATOM   5694  C  CD1 . LEU C 1 48  ? 37.461  -49.119  35.807  1.00 32.72  ? 51   LEU C CD1 1 
ATOM   5695  C  CD2 . LEU C 1 48  ? 36.840  -46.706  36.059  1.00 33.17  ? 51   LEU C CD2 1 
ATOM   5696  N  N   . MET C 1 49  ? 32.412  -46.589  34.874  1.00 30.79  ? 52   MET C N   1 
ATOM   5697  C  CA  . MET C 1 49  ? 31.461  -46.279  33.834  1.00 34.02  ? 52   MET C CA  1 
ATOM   5698  C  C   . MET C 1 49  ? 32.244  -45.337  32.948  1.00 34.71  ? 52   MET C C   1 
ATOM   5699  O  O   . MET C 1 49  ? 32.796  -44.345  33.423  1.00 35.18  ? 52   MET C O   1 
ATOM   5700  C  CB  . MET C 1 49  ? 30.218  -45.627  34.441  1.00 35.94  ? 52   MET C CB  1 
ATOM   5701  C  CG  . MET C 1 49  ? 29.005  -45.465  33.536  1.00 38.00  ? 52   MET C CG  1 
ATOM   5702  S  SD  . MET C 1 49  ? 27.409  -45.361  34.419  1.00 45.32  ? 52   MET C SD  1 
ATOM   5703  C  CE  . MET C 1 49  ? 27.512  -46.814  35.447  1.00 35.97  ? 52   MET C CE  1 
ATOM   5704  N  N   . LEU C 1 50  ? 32.362  -45.677  31.670  1.00 35.77  ? 53   LEU C N   1 
ATOM   5705  C  CA  . LEU C 1 50  ? 33.200  -44.879  30.792  1.00 35.92  ? 53   LEU C CA  1 
ATOM   5706  C  C   . LEU C 1 50  ? 32.409  -43.776  30.111  1.00 37.06  ? 53   LEU C C   1 
ATOM   5707  O  O   . LEU C 1 50  ? 31.285  -43.979  29.666  1.00 36.70  ? 53   LEU C O   1 
ATOM   5708  C  CB  . LEU C 1 50  ? 33.975  -45.746  29.795  1.00 35.55  ? 53   LEU C CB  1 
ATOM   5709  C  CG  . LEU C 1 50  ? 34.901  -46.822  30.405  1.00 36.33  ? 53   LEU C CG  1 
ATOM   5710  C  CD1 . LEU C 1 50  ? 35.596  -47.634  29.315  1.00 35.15  ? 53   LEU C CD1 1 
ATOM   5711  C  CD2 . LEU C 1 50  ? 35.934  -46.209  31.338  1.00 36.46  ? 53   LEU C CD2 1 
ATOM   5712  N  N   . THR C 1 51  ? 33.003  -42.599  30.052  1.00 39.72  ? 54   THR C N   1 
ATOM   5713  C  CA  . THR C 1 51  ? 32.330  -41.461  29.491  1.00 47.07  ? 54   THR C CA  1 
ATOM   5714  C  C   . THR C 1 51  ? 32.837  -41.140  28.084  1.00 50.96  ? 54   THR C C   1 
ATOM   5715  O  O   . THR C 1 51  ? 34.027  -40.905  27.874  1.00 56.23  ? 54   THR C O   1 
ATOM   5716  C  CB  . THR C 1 51  ? 32.375  -40.277  30.468  1.00 49.42  ? 54   THR C CB  1 
ATOM   5717  O  OG1 . THR C 1 51  ? 31.127  -40.232  31.174  1.00 49.75  ? 54   THR C OG1 1 
ATOM   5718  C  CG2 . THR C 1 51  ? 32.602  -38.966  29.739  1.00 52.53  ? 54   THR C CG2 1 
ATOM   5719  N  N   . GLU C 1 52  ? 31.892  -41.118  27.146  1.00 52.60  ? 55   GLU C N   1 
ATOM   5720  C  CA  . GLU C 1 52  ? 32.155  -41.185  25.705  1.00 53.45  ? 55   GLU C CA  1 
ATOM   5721  C  C   . GLU C 1 52  ? 32.153  -39.852  24.949  1.00 53.16  ? 55   GLU C C   1 
ATOM   5722  O  O   . GLU C 1 52  ? 32.973  -39.641  24.058  1.00 53.11  ? 55   GLU C O   1 
ATOM   5723  C  CB  . GLU C 1 52  ? 31.148  -42.146  25.048  1.00 50.44  ? 55   GLU C CB  1 
ATOM   5724  C  CG  . GLU C 1 52  ? 31.367  -43.615  25.395  1.00 48.87  ? 55   GLU C CG  1 
ATOM   5725  C  CD  . GLU C 1 52  ? 32.765  -44.101  25.047  1.00 48.39  ? 55   GLU C CD  1 
ATOM   5726  O  OE1 . GLU C 1 52  ? 33.311  -43.653  24.012  1.00 47.87  ? 55   GLU C OE1 1 
ATOM   5727  O  OE2 . GLU C 1 52  ? 33.326  -44.920  25.810  1.00 47.21  ? 55   GLU C OE2 1 
ATOM   5728  N  N   . ARG C 1 53  ? 31.222  -38.969  25.295  1.00 53.15  ? 56   ARG C N   1 
ATOM   5729  C  CA  . ARG C 1 53  ? 30.999  -37.739  24.540  1.00 55.39  ? 56   ARG C CA  1 
ATOM   5730  C  C   . ARG C 1 53  ? 30.584  -36.587  25.466  1.00 55.12  ? 56   ARG C C   1 
ATOM   5731  O  O   . ARG C 1 53  ? 30.433  -36.776  26.677  1.00 48.74  ? 56   ARG C O   1 
ATOM   5732  C  CB  . ARG C 1 53  ? 29.933  -37.983  23.453  1.00 55.21  ? 56   ARG C CB  1 
ATOM   5733  C  CG  . ARG C 1 53  ? 28.520  -38.178  23.996  1.00 56.59  ? 56   ARG C CG  1 
ATOM   5734  C  CD  . ARG C 1 53  ? 27.650  -39.068  23.118  1.00 59.51  ? 56   ARG C CD  1 
ATOM   5735  N  NE  . ARG C 1 53  ? 27.573  -40.453  23.600  1.00 60.06  ? 56   ARG C NE  1 
ATOM   5736  C  CZ  . ARG C 1 53  ? 26.771  -40.881  24.583  1.00 60.75  ? 56   ARG C CZ  1 
ATOM   5737  N  NH1 . ARG C 1 53  ? 25.961  -40.036  25.229  1.00 56.82  ? 56   ARG C NH1 1 
ATOM   5738  N  NH2 . ARG C 1 53  ? 26.783  -42.166  24.928  1.00 55.49  ? 56   ARG C NH2 1 
ATOM   5739  N  N   . ARG C 1 54  ? 30.415  -35.400  24.882  1.00 59.25  ? 57   ARG C N   1 
ATOM   5740  C  CA  . ARG C 1 54  ? 29.846  -34.230  25.569  1.00 61.03  ? 57   ARG C CA  1 
ATOM   5741  C  C   . ARG C 1 54  ? 28.455  -34.532  26.180  1.00 57.80  ? 57   ARG C C   1 
ATOM   5742  O  O   . ARG C 1 54  ? 27.599  -35.166  25.540  1.00 54.32  ? 57   ARG C O   1 
ATOM   5743  C  CB  . ARG C 1 54  ? 29.789  -33.020  24.608  1.00 68.20  ? 57   ARG C CB  1 
ATOM   5744  C  CG  . ARG C 1 54  ? 28.980  -33.233  23.315  1.00 76.17  ? 57   ARG C CG  1 
ATOM   5745  C  CD  . ARG C 1 54  ? 29.114  -32.080  22.312  1.00 81.77  ? 57   ARG C CD  1 
ATOM   5746  N  NE  . ARG C 1 54  ? 30.360  -32.139  21.532  1.00 84.09  ? 57   ARG C NE  1 
ATOM   5747  C  CZ  . ARG C 1 54  ? 30.861  -31.136  20.807  1.00 83.11  ? 57   ARG C CZ  1 
ATOM   5748  N  NH1 . ARG C 1 54  ? 30.235  -29.963  20.741  1.00 81.27  ? 57   ARG C NH1 1 
ATOM   5749  N  NH2 . ARG C 1 54  ? 32.002  -31.305  20.147  1.00 78.51  ? 57   ARG C NH2 1 
ATOM   5750  N  N   . ASN C 1 55  ? 28.249  -34.095  27.423  1.00 53.03  ? 58   ASN C N   1 
ATOM   5751  C  CA  . ASN C 1 55  ? 26.978  -34.312  28.146  1.00 50.58  ? 58   ASN C CA  1 
ATOM   5752  C  C   . ASN C 1 55  ? 26.661  -35.772  28.480  1.00 47.12  ? 58   ASN C C   1 
ATOM   5753  O  O   . ASN C 1 55  ? 25.563  -36.090  28.947  1.00 48.27  ? 58   ASN C O   1 
ATOM   5754  C  CB  . ASN C 1 55  ? 25.789  -33.687  27.405  1.00 51.62  ? 58   ASN C CB  1 
ATOM   5755  C  CG  . ASN C 1 55  ? 25.874  -32.178  27.327  1.00 53.77  ? 58   ASN C CG  1 
ATOM   5756  O  OD1 . ASN C 1 55  ? 26.544  -31.527  28.142  1.00 52.08  ? 58   ASN C OD1 1 
ATOM   5757  N  ND2 . ASN C 1 55  ? 25.191  -31.608  26.339  1.00 54.05  ? 58   ASN C ND2 1 
ATOM   5758  N  N   . HIS C 1 56  ? 27.617  -36.658  28.238  1.00 40.44  ? 59   HIS C N   1 
ATOM   5759  C  CA  . HIS C 1 56  ? 27.420  -38.053  28.558  1.00 36.84  ? 59   HIS C CA  1 
ATOM   5760  C  C   . HIS C 1 56  ? 27.316  -38.216  30.051  1.00 31.36  ? 59   HIS C C   1 
ATOM   5761  O  O   . HIS C 1 56  ? 26.324  -38.737  30.541  1.00 31.02  ? 59   HIS C O   1 
ATOM   5762  C  CB  . HIS C 1 56  ? 28.519  -38.919  27.942  1.00 35.01  ? 59   HIS C CB  1 
ATOM   5763  C  CG  . HIS C 1 56  ? 28.269  -40.395  28.058  1.00 35.04  ? 59   HIS C CG  1 
ATOM   5764  N  ND1 . HIS C 1 56  ? 29.261  -41.304  27.989  1.00 36.59  ? 59   HIS C ND1 1 
ATOM   5765  C  CD2 . HIS C 1 56  ? 27.094  -41.112  28.250  1.00 34.38  ? 59   HIS C CD2 1 
ATOM   5766  C  CE1 . HIS C 1 56  ? 28.750  -42.544  28.126  1.00 34.61  ? 59   HIS C CE1 1 
ATOM   5767  N  NE2 . HIS C 1 56  ? 27.426  -42.429  28.283  1.00 34.33  ? 59   HIS C NE2 1 
ATOM   5768  N  N   . ALA C 1 57  ? 28.312  -37.735  30.786  1.00 30.35  ? 60   ALA C N   1 
ATOM   5769  C  CA  . ALA C 1 57  ? 28.273  -37.775  32.254  1.00 29.01  ? 60   ALA C CA  1 
ATOM   5770  C  C   . ALA C 1 57  ? 27.067  -37.047  32.805  1.00 27.49  ? 60   ALA C C   1 
ATOM   5771  O  O   . ALA C 1 57  ? 26.419  -37.524  33.725  1.00 26.66  ? 60   ALA C O   1 
ATOM   5772  C  CB  . ALA C 1 57  ? 29.540  -37.197  32.837  1.00 29.10  ? 60   ALA C CB  1 
ATOM   5773  N  N   . ARG C 1 58  ? 26.757  -35.904  32.212  1.00 29.00  ? 61   ARG C N   1 
ATOM   5774  C  CA  . ARG C 1 58  ? 25.659  -35.057  32.685  1.00 31.35  ? 61   ARG C CA  1 
ATOM   5775  C  C   . ARG C 1 58  ? 24.329  -35.817  32.683  1.00 31.80  ? 61   ARG C C   1 
ATOM   5776  O  O   . ARG C 1 58  ? 23.611  -35.818  33.688  1.00 30.26  ? 61   ARG C O   1 
ATOM   5777  C  CB  . ARG C 1 58  ? 25.587  -33.787  31.837  1.00 29.78  ? 61   ARG C CB  1 
ATOM   5778  C  CG  . ARG C 1 58  ? 24.458  -32.828  32.139  1.00 32.98  ? 61   ARG C CG  1 
ATOM   5779  C  CD  . ARG C 1 58  ? 24.734  -31.587  31.314  1.00 39.50  ? 61   ARG C CD  1 
ATOM   5780  N  NE  . ARG C 1 58  ? 24.047  -30.383  31.763  1.00 45.38  ? 61   ARG C NE  1 
ATOM   5781  C  CZ  . ARG C 1 58  ? 24.544  -29.148  31.643  1.00 47.05  ? 61   ARG C CZ  1 
ATOM   5782  N  NH1 . ARG C 1 58  ? 25.757  -28.938  31.128  1.00 45.97  ? 61   ARG C NH1 1 
ATOM   5783  N  NH2 . ARG C 1 58  ? 23.839  -28.116  32.077  1.00 46.14  ? 61   ARG C NH2 1 
ATOM   5784  N  N   . GLU C 1 59  ? 24.022  -36.477  31.565  1.00 32.57  ? 62   GLU C N   1 
ATOM   5785  C  CA  . GLU C 1 59  ? 22.786  -37.254  31.441  1.00 34.12  ? 62   GLU C CA  1 
ATOM   5786  C  C   . GLU C 1 59  ? 22.778  -38.460  32.353  1.00 31.61  ? 62   GLU C C   1 
ATOM   5787  O  O   . GLU C 1 59  ? 21.756  -38.770  32.949  1.00 33.12  ? 62   GLU C O   1 
ATOM   5788  C  CB  . GLU C 1 59  ? 22.543  -37.680  29.993  1.00 39.81  ? 62   GLU C CB  1 
ATOM   5789  C  CG  . GLU C 1 59  ? 22.156  -36.529  29.075  1.00 45.28  ? 62   GLU C CG  1 
ATOM   5790  C  CD  . GLU C 1 59  ? 22.180  -36.898  27.603  1.00 53.38  ? 62   GLU C CD  1 
ATOM   5791  O  OE1 . GLU C 1 59  ? 21.822  -38.054  27.263  1.00 57.36  ? 62   GLU C OE1 1 
ATOM   5792  O  OE2 . GLU C 1 59  ? 22.549  -36.020  26.784  1.00 56.68  ? 62   GLU C OE2 1 
ATOM   5793  N  N   . LEU C 1 60  ? 23.916  -39.133  32.482  1.00 31.44  ? 63   LEU C N   1 
ATOM   5794  C  CA  . LEU C 1 60  ? 23.993  -40.304  33.353  1.00 31.93  ? 63   LEU C CA  1 
ATOM   5795  C  C   . LEU C 1 60  ? 23.673  -39.896  34.778  1.00 30.92  ? 63   LEU C C   1 
ATOM   5796  O  O   . LEU C 1 60  ? 22.785  -40.450  35.407  1.00 31.33  ? 63   LEU C O   1 
ATOM   5797  C  CB  . LEU C 1 60  ? 25.376  -40.953  33.288  1.00 33.11  ? 63   LEU C CB  1 
ATOM   5798  C  CG  . LEU C 1 60  ? 25.669  -41.879  32.105  1.00 36.04  ? 63   LEU C CG  1 
ATOM   5799  C  CD1 . LEU C 1 60  ? 27.160  -42.180  32.024  1.00 34.05  ? 63   LEU C CD1 1 
ATOM   5800  C  CD2 . LEU C 1 60  ? 24.858  -43.170  32.195  1.00 35.44  ? 63   LEU C CD2 1 
ATOM   5801  N  N   . VAL C 1 61  ? 24.397  -38.895  35.268  1.00 31.67  ? 64   VAL C N   1 
ATOM   5802  C  CA  . VAL C 1 61  ? 24.233  -38.389  36.633  1.00 30.58  ? 64   VAL C CA  1 
ATOM   5803  C  C   . VAL C 1 61  ? 22.793  -37.915  36.860  1.00 28.52  ? 64   VAL C C   1 
ATOM   5804  O  O   . VAL C 1 61  ? 22.205  -38.165  37.897  1.00 30.18  ? 64   VAL C O   1 
ATOM   5805  C  CB  . VAL C 1 61  ? 25.286  -37.293  36.899  1.00 29.98  ? 64   VAL C CB  1 
ATOM   5806  C  CG1 . VAL C 1 61  ? 24.884  -36.396  38.045  1.00 31.84  ? 64   VAL C CG1 1 
ATOM   5807  C  CG2 . VAL C 1 61  ? 26.651  -37.933  37.143  1.00 28.32  ? 64   VAL C CG2 1 
ATOM   5808  N  N   . ARG C 1 62  ? 22.217  -37.279  35.854  1.00 28.97  ? 65   ARG C N   1 
ATOM   5809  C  CA  . ARG C 1 62  ? 20.836  -36.814  35.910  1.00 29.19  ? 65   ARG C CA  1 
ATOM   5810  C  C   . ARG C 1 62  ? 19.810  -37.931  36.080  1.00 30.26  ? 65   ARG C C   1 
ATOM   5811  O  O   . ARG C 1 62  ? 18.783  -37.721  36.713  1.00 31.13  ? 65   ARG C O   1 
ATOM   5812  C  CB  . ARG C 1 62  ? 20.524  -36.037  34.642  1.00 30.99  ? 65   ARG C CB  1 
ATOM   5813  C  CG  . ARG C 1 62  ? 19.237  -35.236  34.636  1.00 32.89  ? 65   ARG C CG  1 
ATOM   5814  C  CD  . ARG C 1 62  ? 19.367  -34.150  33.575  1.00 35.53  ? 65   ARG C CD  1 
ATOM   5815  N  NE  . ARG C 1 62  ? 19.120  -34.674  32.241  1.00 36.44  ? 65   ARG C NE  1 
ATOM   5816  C  CZ  . ARG C 1 62  ? 19.754  -34.313  31.127  1.00 38.03  ? 65   ARG C CZ  1 
ATOM   5817  N  NH1 . ARG C 1 62  ? 20.727  -33.405  31.139  1.00 36.49  ? 65   ARG C NH1 1 
ATOM   5818  N  NH2 . ARG C 1 62  ? 19.399  -34.886  29.977  1.00 41.07  ? 65   ARG C NH2 1 
ATOM   5819  N  N   . SER C 1 63  ? 20.071  -39.113  35.524  1.00 28.42  ? 66   SER C N   1 
ATOM   5820  C  CA  . SER C 1 63  ? 19.077  -40.193  35.606  1.00 29.03  ? 66   SER C CA  1 
ATOM   5821  C  C   . SER C 1 63  ? 19.513  -41.317  36.525  1.00 27.98  ? 66   SER C C   1 
ATOM   5822  O  O   . SER C 1 63  ? 18.783  -42.284  36.721  1.00 27.43  ? 66   SER C O   1 
ATOM   5823  C  CB  . SER C 1 63  ? 18.728  -40.745  34.211  1.00 28.41  ? 66   SER C CB  1 
ATOM   5824  O  OG  . SER C 1 63  ? 19.876  -41.270  33.575  1.00 28.73  ? 66   SER C OG  1 
ATOM   5825  N  N   . GLU C 1 64  ? 20.701  -41.174  37.096  1.00 29.18  ? 67   GLU C N   1 
ATOM   5826  C  CA  . GLU C 1 64  ? 21.259  -42.183  37.995  1.00 31.42  ? 67   GLU C CA  1 
ATOM   5827  C  C   . GLU C 1 64  ? 20.377  -42.430  39.223  1.00 32.66  ? 67   GLU C C   1 
ATOM   5828  O  O   . GLU C 1 64  ? 19.735  -41.507  39.739  1.00 30.52  ? 67   GLU C O   1 
ATOM   5829  C  CB  . GLU C 1 64  ? 22.679  -41.781  38.418  1.00 32.40  ? 67   GLU C CB  1 
ATOM   5830  C  CG  . GLU C 1 64  ? 23.435  -42.823  39.225  1.00 32.78  ? 67   GLU C CG  1 
ATOM   5831  C  CD  . GLU C 1 64  ? 23.487  -44.174  38.527  1.00 34.60  ? 67   GLU C CD  1 
ATOM   5832  O  OE1 . GLU C 1 64  ? 24.191  -44.308  37.492  1.00 34.64  ? 67   GLU C OE1 1 
ATOM   5833  O  OE2 . GLU C 1 64  ? 22.803  -45.093  39.016  1.00 33.86  ? 67   GLU C OE2 1 
ATOM   5834  N  N   . GLU C 1 65  ? 20.325  -43.693  39.652  1.00 35.18  ? 68   GLU C N   1 
ATOM   5835  C  CA  . GLU C 1 65  ? 19.765  -44.063  40.941  1.00 36.71  ? 68   GLU C CA  1 
ATOM   5836  C  C   . GLU C 1 65  ? 20.863  -43.760  41.960  1.00 36.97  ? 68   GLU C C   1 
ATOM   5837  O  O   . GLU C 1 65  ? 21.809  -44.527  42.106  1.00 36.94  ? 68   GLU C O   1 
ATOM   5838  C  CB  . GLU C 1 65  ? 19.384  -45.552  40.950  1.00 41.31  ? 68   GLU C CB  1 
ATOM   5839  C  CG  . GLU C 1 65  ? 19.215  -46.203  42.324  1.00 42.45  ? 68   GLU C CG  1 
ATOM   5840  C  CD  . GLU C 1 65  ? 18.049  -45.646  43.114  1.00 45.84  ? 68   GLU C CD  1 
ATOM   5841  O  OE1 . GLU C 1 65  ? 16.930  -45.563  42.560  1.00 48.69  ? 68   GLU C OE1 1 
ATOM   5842  O  OE2 . GLU C 1 65  ? 18.254  -45.292  44.296  1.00 45.55  ? 68   GLU C OE2 1 
ATOM   5843  N  N   . LEU C 1 66  ? 20.751  -42.623  42.638  1.00 35.72  ? 69   LEU C N   1 
ATOM   5844  C  CA  . LEU C 1 66  ? 21.838  -42.131  43.491  1.00 36.00  ? 69   LEU C CA  1 
ATOM   5845  C  C   . LEU C 1 66  ? 22.002  -42.927  44.785  1.00 35.03  ? 69   LEU C C   1 
ATOM   5846  O  O   . LEU C 1 66  ? 23.088  -42.965  45.354  1.00 36.56  ? 69   LEU C O   1 
ATOM   5847  C  CB  . LEU C 1 66  ? 21.658  -40.634  43.791  1.00 33.94  ? 69   LEU C CB  1 
ATOM   5848  C  CG  . LEU C 1 66  ? 21.803  -39.685  42.597  1.00 33.49  ? 69   LEU C CG  1 
ATOM   5849  C  CD1 . LEU C 1 66  ? 21.533  -38.242  43.020  1.00 33.98  ? 69   LEU C CD1 1 
ATOM   5850  C  CD2 . LEU C 1 66  ? 23.176  -39.799  41.953  1.00 31.76  ? 69   LEU C CD2 1 
ATOM   5851  N  N   . GLY C 1 67  ? 20.927  -43.574  45.229  1.00 34.86  ? 70   GLY C N   1 
ATOM   5852  C  CA  . GLY C 1 67  ? 20.925  -44.371  46.456  1.00 33.52  ? 70   GLY C CA  1 
ATOM   5853  C  C   . GLY C 1 67  ? 21.893  -45.534  46.492  1.00 34.85  ? 70   GLY C C   1 
ATOM   5854  O  O   . GLY C 1 67  ? 22.179  -46.055  47.566  1.00 36.08  ? 70   GLY C O   1 
ATOM   5855  N  N   . ARG C 1 68  ? 22.399  -45.953  45.330  1.00 34.51  ? 71   ARG C N   1 
ATOM   5856  C  CA  . ARG C 1 68  ? 23.353  -47.072  45.275  1.00 33.33  ? 71   ARG C CA  1 
ATOM   5857  C  C   . ARG C 1 68  ? 24.803  -46.649  45.517  1.00 30.22  ? 71   ARG C C   1 
ATOM   5858  O  O   . ARG C 1 68  ? 25.670  -47.493  45.688  1.00 29.59  ? 71   ARG C O   1 
ATOM   5859  C  CB  . ARG C 1 68  ? 23.254  -47.875  43.948  1.00 37.62  ? 71   ARG C CB  1 
ATOM   5860  C  CG  . ARG C 1 68  ? 22.550  -47.179  42.792  1.00 41.20  ? 71   ARG C CG  1 
ATOM   5861  C  CD  . ARG C 1 68  ? 23.232  -47.366  41.436  1.00 41.36  ? 71   ARG C CD  1 
ATOM   5862  N  NE  . ARG C 1 68  ? 22.776  -48.538  40.695  1.00 40.70  ? 71   ARG C NE  1 
ATOM   5863  C  CZ  . ARG C 1 68  ? 23.038  -48.786  39.410  1.00 40.22  ? 71   ARG C CZ  1 
ATOM   5864  N  NH1 . ARG C 1 68  ? 23.750  -47.946  38.653  1.00 35.35  ? 71   ARG C NH1 1 
ATOM   5865  N  NH2 . ARG C 1 68  ? 22.572  -49.898  38.874  1.00 42.04  ? 71   ARG C NH2 1 
ATOM   5866  N  N   . TRP C 1 69  ? 25.085  -45.353  45.505  1.00 28.25  ? 72   TRP C N   1 
ATOM   5867  C  CA  . TRP C 1 69  ? 26.469  -44.902  45.643  1.00 27.12  ? 72   TRP C CA  1 
ATOM   5868  C  C   . TRP C 1 69  ? 26.671  -44.071  46.878  1.00 26.56  ? 72   TRP C C   1 
ATOM   5869  O  O   . TRP C 1 69  ? 25.751  -43.367  47.313  1.00 26.40  ? 72   TRP C O   1 
ATOM   5870  C  CB  . TRP C 1 69  ? 26.900  -44.114  44.410  1.00 26.76  ? 72   TRP C CB  1 
ATOM   5871  C  CG  . TRP C 1 69  ? 26.627  -44.842  43.121  1.00 28.21  ? 72   TRP C CG  1 
ATOM   5872  C  CD1 . TRP C 1 69  ? 25.773  -44.457  42.099  1.00 27.15  ? 72   TRP C CD1 1 
ATOM   5873  C  CD2 . TRP C 1 69  ? 27.173  -46.129  42.692  1.00 27.37  ? 72   TRP C CD2 1 
ATOM   5874  N  NE1 . TRP C 1 69  ? 25.774  -45.373  41.099  1.00 28.52  ? 72   TRP C NE1 1 
ATOM   5875  C  CE2 . TRP C 1 69  ? 26.575  -46.405  41.389  1.00 27.89  ? 72   TRP C CE2 1 
ATOM   5876  C  CE3 . TRP C 1 69  ? 28.065  -47.048  43.238  1.00 28.67  ? 72   TRP C CE3 1 
ATOM   5877  C  CZ2 . TRP C 1 69  ? 26.869  -47.553  40.669  1.00 27.73  ? 72   TRP C CZ2 1 
ATOM   5878  C  CZ3 . TRP C 1 69  ? 28.354  -48.207  42.510  1.00 29.35  ? 72   TRP C CZ3 1 
ATOM   5879  C  CH2 . TRP C 1 69  ? 27.771  -48.448  41.250  1.00 28.48  ? 72   TRP C CH2 1 
ATOM   5880  N  N   . ASP C 1 70  ? 27.884  -44.124  47.431  1.00 27.09  ? 73   ASP C N   1 
ATOM   5881  C  CA  . ASP C 1 70  ? 28.259  -43.300  48.598  1.00 27.09  ? 73   ASP C CA  1 
ATOM   5882  C  C   . ASP C 1 70  ? 29.006  -42.047  48.168  1.00 28.71  ? 73   ASP C C   1 
ATOM   5883  O  O   . ASP C 1 70  ? 29.040  -41.052  48.890  1.00 31.14  ? 73   ASP C O   1 
ATOM   5884  C  CB  . ASP C 1 70  ? 29.109  -44.112  49.579  1.00 27.75  ? 73   ASP C CB  1 
ATOM   5885  C  CG  . ASP C 1 70  ? 28.326  -45.250  50.224  1.00 26.37  ? 73   ASP C CG  1 
ATOM   5886  O  OD1 . ASP C 1 70  ? 27.175  -45.014  50.616  1.00 25.90  ? 73   ASP C OD1 1 
ATOM   5887  O  OD2 . ASP C 1 70  ? 28.845  -46.383  50.321  1.00 27.46  ? 73   ASP C OD2 1 
ATOM   5888  N  N   . ALA C 1 71  ? 29.613  -42.111  46.987  1.00 29.52  ? 74   ALA C N   1 
ATOM   5889  C  CA  . ALA C 1 71  ? 30.178  -40.942  46.310  1.00 27.75  ? 74   ALA C CA  1 
ATOM   5890  C  C   . ALA C 1 71  ? 30.281  -41.180  44.799  1.00 26.68  ? 74   ALA C C   1 
ATOM   5891  O  O   . ALA C 1 71  ? 30.328  -42.319  44.334  1.00 26.58  ? 74   ALA C O   1 
ATOM   5892  C  CB  . ALA C 1 71  ? 31.551  -40.597  46.870  1.00 27.00  ? 74   ALA C CB  1 
ATOM   5893  N  N   . LEU C 1 72  ? 30.323  -40.083  44.055  1.00 25.51  ? 75   LEU C N   1 
ATOM   5894  C  CA  . LEU C 1 72  ? 30.618  -40.107  42.638  1.00 24.64  ? 75   LEU C CA  1 
ATOM   5895  C  C   . LEU C 1 72  ? 32.041  -39.607  42.487  1.00 24.27  ? 75   LEU C C   1 
ATOM   5896  O  O   . LEU C 1 72  ? 32.370  -38.534  42.990  1.00 25.21  ? 75   LEU C O   1 
ATOM   5897  C  CB  . LEU C 1 72  ? 29.647  -39.185  41.893  1.00 23.59  ? 75   LEU C CB  1 
ATOM   5898  C  CG  . LEU C 1 72  ? 28.151  -39.349  42.224  1.00 22.59  ? 75   LEU C CG  1 
ATOM   5899  C  CD1 . LEU C 1 72  ? 27.344  -38.387  41.363  1.00 21.22  ? 75   LEU C CD1 1 
ATOM   5900  C  CD2 . LEU C 1 72  ? 27.656  -40.794  42.087  1.00 21.89  ? 75   LEU C CD2 1 
ATOM   5901  N  N   . VAL C 1 73  ? 32.904  -40.409  41.868  1.00 24.47  ? 76   VAL C N   1 
ATOM   5902  C  CA  . VAL C 1 73  ? 34.242  -39.952  41.584  1.00 25.85  ? 76   VAL C CA  1 
ATOM   5903  C  C   . VAL C 1 73  ? 34.420  -39.771  40.095  1.00 28.54  ? 76   VAL C C   1 
ATOM   5904  O  O   . VAL C 1 73  ? 33.965  -40.579  39.276  1.00 30.21  ? 76   VAL C O   1 
ATOM   5905  C  CB  . VAL C 1 73  ? 35.382  -40.786  42.237  1.00 26.37  ? 76   VAL C CB  1 
ATOM   5906  C  CG1 . VAL C 1 73  ? 34.868  -41.718  43.327  1.00 25.80  ? 76   VAL C CG1 1 
ATOM   5907  C  CG2 . VAL C 1 73  ? 36.253  -41.466  41.209  1.00 28.40  ? 76   VAL C CG2 1 
ATOM   5908  N  N   . VAL C 1 74  ? 35.078  -38.676  39.768  1.00 27.63  ? 77   VAL C N   1 
ATOM   5909  C  CA  . VAL C 1 74  ? 35.146  -38.186  38.437  1.00 28.67  ? 77   VAL C CA  1 
ATOM   5910  C  C   . VAL C 1 74  ? 36.616  -38.181  38.072  1.00 30.47  ? 77   VAL C C   1 
ATOM   5911  O  O   . VAL C 1 74  ? 37.397  -37.399  38.612  1.00 29.79  ? 77   VAL C O   1 
ATOM   5912  C  CB  . VAL C 1 74  ? 34.532  -36.778  38.365  1.00 29.59  ? 77   VAL C CB  1 
ATOM   5913  C  CG1 . VAL C 1 74  ? 34.316  -36.349  36.932  1.00 30.12  ? 77   VAL C CG1 1 
ATOM   5914  C  CG2 . VAL C 1 74  ? 33.191  -36.752  39.103  1.00 31.10  ? 77   VAL C CG2 1 
ATOM   5915  N  N   . MET C 1 75  ? 36.992  -39.094  37.175  1.00 31.74  ? 78   MET C N   1 
ATOM   5916  C  CA  . MET C 1 75  ? 38.368  -39.221  36.745  1.00 31.89  ? 78   MET C CA  1 
ATOM   5917  C  C   . MET C 1 75  ? 38.559  -38.703  35.329  1.00 34.33  ? 78   MET C C   1 
ATOM   5918  O  O   . MET C 1 75  ? 38.425  -39.449  34.342  1.00 35.77  ? 78   MET C O   1 
ATOM   5919  C  CB  . MET C 1 75  ? 38.833  -40.665  36.857  1.00 30.19  ? 78   MET C CB  1 
ATOM   5920  C  CG  . MET C 1 75  ? 40.297  -40.798  36.521  1.00 30.58  ? 78   MET C CG  1 
ATOM   5921  S  SD  . MET C 1 75  ? 41.002  -42.068  37.552  1.00 31.72  ? 78   MET C SD  1 
ATOM   5922  C  CE  . MET C 1 75  ? 42.650  -42.195  36.834  1.00 28.29  ? 78   MET C CE  1 
ATOM   5923  N  N   . SER C 1 76  ? 38.875  -37.420  35.232  1.00 35.75  ? 79   SER C N   1 
ATOM   5924  C  CA  . SER C 1 76  ? 39.003  -36.767  33.943  1.00 37.54  ? 79   SER C CA  1 
ATOM   5925  C  C   . SER C 1 76  ? 39.684  -35.423  34.119  1.00 40.08  ? 79   SER C C   1 
ATOM   5926  O  O   . SER C 1 76  ? 40.808  -35.356  34.641  1.00 41.35  ? 79   SER C O   1 
ATOM   5927  C  CB  . SER C 1 76  ? 37.618  -36.582  33.316  1.00 39.28  ? 79   SER C CB  1 
ATOM   5928  O  OG  . SER C 1 76  ? 37.706  -36.338  31.927  1.00 40.37  ? 79   SER C OG  1 
ATOM   5929  N  N   . GLY C 1 77  ? 38.998  -34.365  33.682  1.00 39.47  ? 80   GLY C N   1 
ATOM   5930  C  CA  . GLY C 1 77  ? 39.411  -32.980  33.910  1.00 39.22  ? 80   GLY C CA  1 
ATOM   5931  C  C   . GLY C 1 77  ? 38.291  -32.200  34.584  1.00 37.76  ? 80   GLY C C   1 
ATOM   5932  O  O   . GLY C 1 77  ? 37.259  -32.769  34.961  1.00 35.99  ? 80   GLY C O   1 
ATOM   5933  N  N   . ASP C 1 78  ? 38.478  -30.892  34.725  1.00 35.89  ? 81   ASP C N   1 
ATOM   5934  C  CA  . ASP C 1 78  ? 37.493  -30.081  35.434  1.00 34.62  ? 81   ASP C CA  1 
ATOM   5935  C  C   . ASP C 1 78  ? 36.153  -30.111  34.707  1.00 32.61  ? 81   ASP C C   1 
ATOM   5936  O  O   . ASP C 1 78  ? 35.090  -30.039  35.337  1.00 33.90  ? 81   ASP C O   1 
ATOM   5937  C  CB  . ASP C 1 78  ? 37.975  -28.630  35.583  1.00 36.97  ? 81   ASP C CB  1 
ATOM   5938  C  CG  . ASP C 1 78  ? 39.317  -28.520  36.280  1.00 35.20  ? 81   ASP C CG  1 
ATOM   5939  O  OD1 . ASP C 1 78  ? 39.431  -29.014  37.427  1.00 34.67  ? 81   ASP C OD1 1 
ATOM   5940  O  OD2 . ASP C 1 78  ? 40.244  -27.921  35.681  1.00 34.53  ? 81   ASP C OD2 1 
ATOM   5941  N  N   . GLY C 1 79  ? 36.214  -30.220  33.382  1.00 30.23  ? 82   GLY C N   1 
ATOM   5942  C  CA  . GLY C 1 79  ? 35.023  -30.227  32.545  1.00 28.48  ? 82   GLY C CA  1 
ATOM   5943  C  C   . GLY C 1 79  ? 34.048  -31.346  32.873  1.00 29.10  ? 82   GLY C C   1 
ATOM   5944  O  O   . GLY C 1 79  ? 32.836  -31.174  32.751  1.00 28.70  ? 82   GLY C O   1 
ATOM   5945  N  N   . LEU C 1 80  ? 34.567  -32.496  33.298  1.00 29.17  ? 83   LEU C N   1 
ATOM   5946  C  CA  . LEU C 1 80  ? 33.701  -33.596  33.683  1.00 29.97  ? 83   LEU C CA  1 
ATOM   5947  C  C   . LEU C 1 80  ? 32.981  -33.255  34.985  1.00 28.88  ? 83   LEU C C   1 
ATOM   5948  O  O   . LEU C 1 80  ? 31.780  -33.498  35.119  1.00 30.28  ? 83   LEU C O   1 
ATOM   5949  C  CB  . LEU C 1 80  ? 34.481  -34.924  33.796  1.00 30.25  ? 83   LEU C CB  1 
ATOM   5950  C  CG  . LEU C 1 80  ? 33.997  -36.133  32.961  1.00 31.23  ? 83   LEU C CG  1 
ATOM   5951  C  CD1 . LEU C 1 80  ? 34.049  -37.460  33.735  1.00 28.66  ? 83   LEU C CD1 1 
ATOM   5952  C  CD2 . LEU C 1 80  ? 32.606  -35.927  32.392  1.00 28.81  ? 83   LEU C CD2 1 
ATOM   5953  N  N   . MET C 1 81  ? 33.710  -32.683  35.941  1.00 29.63  ? 84   MET C N   1 
ATOM   5954  C  CA  . MET C 1 81  ? 33.087  -32.206  37.185  1.00 30.18  ? 84   MET C CA  1 
ATOM   5955  C  C   . MET C 1 81  ? 31.960  -31.209  36.894  1.00 28.69  ? 84   MET C C   1 
ATOM   5956  O  O   . MET C 1 81  ? 30.854  -31.334  37.419  1.00 29.18  ? 84   MET C O   1 
ATOM   5957  C  CB  . MET C 1 81  ? 34.126  -31.597  38.130  1.00 30.96  ? 84   MET C CB  1 
ATOM   5958  C  CG  . MET C 1 81  ? 33.622  -31.430  39.567  1.00 31.91  ? 84   MET C CG  1 
ATOM   5959  S  SD  . MET C 1 81  ? 32.979  -32.909  40.391  1.00 34.40  ? 84   MET C SD  1 
ATOM   5960  C  CE  . MET C 1 81  ? 34.471  -33.833  40.712  1.00 32.77  ? 84   MET C CE  1 
ATOM   5961  N  N   . HIS C 1 82  ? 32.231  -30.245  36.024  1.00 28.86  ? 85   HIS C N   1 
ATOM   5962  C  CA  . HIS C 1 82  ? 31.188  -29.332  35.565  1.00 29.47  ? 85   HIS C CA  1 
ATOM   5963  C  C   . HIS C 1 82  ? 29.923  -30.034  35.111  1.00 28.63  ? 85   HIS C C   1 
ATOM   5964  O  O   . HIS C 1 82  ? 28.824  -29.665  35.529  1.00 28.05  ? 85   HIS C O   1 
ATOM   5965  C  CB  . HIS C 1 82  ? 31.727  -28.424  34.486  1.00 30.84  ? 85   HIS C CB  1 
ATOM   5966  C  CG  . HIS C 1 82  ? 30.720  -27.430  33.983  1.00 34.45  ? 85   HIS C CG  1 
ATOM   5967  N  ND1 . HIS C 1 82  ? 29.878  -27.705  32.975  1.00 35.43  ? 85   HIS C ND1 1 
ATOM   5968  C  CD2 . HIS C 1 82  ? 30.442  -26.128  34.385  1.00 35.64  ? 85   HIS C CD2 1 
ATOM   5969  C  CE1 . HIS C 1 82  ? 29.102  -26.637  32.736  1.00 36.24  ? 85   HIS C CE1 1 
ATOM   5970  N  NE2 . HIS C 1 82  ? 29.445  -25.674  33.604  1.00 38.36  ? 85   HIS C NE2 1 
ATOM   5971  N  N   . GLU C 1 83  ? 30.061  -31.063  34.274  1.00 28.39  ? 86   GLU C N   1 
ATOM   5972  C  CA  . GLU C 1 83  ? 28.890  -31.816  33.791  1.00 28.74  ? 86   GLU C CA  1 
ATOM   5973  C  C   . GLU C 1 83  ? 28.162  -32.578  34.905  1.00 26.89  ? 86   GLU C C   1 
ATOM   5974  O  O   . GLU C 1 83  ? 26.915  -32.597  34.951  1.00 25.31  ? 86   GLU C O   1 
ATOM   5975  C  CB  . GLU C 1 83  ? 29.263  -32.777  32.656  1.00 30.38  ? 86   GLU C CB  1 
ATOM   5976  C  CG  . GLU C 1 83  ? 29.976  -32.142  31.465  1.00 33.74  ? 86   GLU C CG  1 
ATOM   5977  C  CD  . GLU C 1 83  ? 29.155  -31.127  30.647  1.00 38.40  ? 86   GLU C CD  1 
ATOM   5978  O  OE1 . GLU C 1 83  ? 29.797  -30.225  30.035  1.00 37.88  ? 86   GLU C OE1 1 
ATOM   5979  O  OE2 . GLU C 1 83  ? 27.893  -31.214  30.587  1.00 38.43  ? 86   GLU C OE2 1 
ATOM   5980  N  N   . VAL C 1 84  ? 28.929  -33.196  35.804  1.00 24.72  ? 87   VAL C N   1 
ATOM   5981  C  CA  . VAL C 1 84  ? 28.320  -33.921  36.899  1.00 25.06  ? 87   VAL C CA  1 
ATOM   5982  C  C   . VAL C 1 84  ? 27.483  -32.957  37.750  1.00 25.49  ? 87   VAL C C   1 
ATOM   5983  O  O   . VAL C 1 84  ? 26.289  -33.193  37.970  1.00 25.73  ? 87   VAL C O   1 
ATOM   5984  C  CB  . VAL C 1 84  ? 29.347  -34.675  37.757  1.00 25.61  ? 87   VAL C CB  1 
ATOM   5985  C  CG1 . VAL C 1 84  ? 28.661  -35.267  38.974  1.00 25.89  ? 87   VAL C CG1 1 
ATOM   5986  C  CG2 . VAL C 1 84  ? 30.016  -35.791  36.954  1.00 26.75  ? 87   VAL C CG2 1 
ATOM   5987  N  N   . VAL C 1 85  ? 28.096  -31.851  38.172  1.00 24.79  ? 88   VAL C N   1 
ATOM   5988  C  CA  . VAL C 1 85  ? 27.408  -30.893  39.040  1.00 25.73  ? 88   VAL C CA  1 
ATOM   5989  C  C   . VAL C 1 85  ? 26.139  -30.382  38.373  1.00 24.87  ? 88   VAL C C   1 
ATOM   5990  O  O   . VAL C 1 85  ? 25.074  -30.427  38.963  1.00 24.70  ? 88   VAL C O   1 
ATOM   5991  C  CB  . VAL C 1 85  ? 28.324  -29.729  39.493  1.00 24.54  ? 88   VAL C CB  1 
ATOM   5992  C  CG1 . VAL C 1 85  ? 27.499  -28.642  40.159  1.00 23.89  ? 88   VAL C CG1 1 
ATOM   5993  C  CG2 . VAL C 1 85  ? 29.375  -30.246  40.468  1.00 24.84  ? 88   VAL C CG2 1 
ATOM   5994  N  N   . ASN C 1 86  ? 26.250  -29.957  37.120  1.00 26.80  ? 89   ASN C N   1 
ATOM   5995  C  CA  . ASN C 1 86  ? 25.080  -29.507  36.391  1.00 28.41  ? 89   ASN C CA  1 
ATOM   5996  C  C   . ASN C 1 86  ? 24.016  -30.572  36.224  1.00 29.83  ? 89   ASN C C   1 
ATOM   5997  O  O   . ASN C 1 86  ? 22.813  -30.255  36.273  1.00 31.28  ? 89   ASN C O   1 
ATOM   5998  C  CB  . ASN C 1 86  ? 25.473  -28.870  35.073  1.00 29.67  ? 89   ASN C CB  1 
ATOM   5999  C  CG  . ASN C 1 86  ? 25.974  -27.468  35.268  1.00 31.19  ? 89   ASN C CG  1 
ATOM   6000  O  OD1 . ASN C 1 86  ? 27.161  -27.252  35.486  1.00 31.97  ? 89   ASN C OD1 1 
ATOM   6001  N  ND2 . ASN C 1 86  ? 25.061  -26.506  35.240  1.00 31.56  ? 89   ASN C ND2 1 
ATOM   6002  N  N   . GLY C 1 87  ? 24.457  -31.829  36.080  1.00 30.18  ? 90   GLY C N   1 
ATOM   6003  C  CA  . GLY C 1 87  ? 23.545  -32.957  35.962  1.00 28.94  ? 90   GLY C CA  1 
ATOM   6004  C  C   . GLY C 1 87  ? 22.688  -33.047  37.203  1.00 30.53  ? 90   GLY C C   1 
ATOM   6005  O  O   . GLY C 1 87  ? 21.444  -33.073  37.118  1.00 30.43  ? 90   GLY C O   1 
ATOM   6006  N  N   . LEU C 1 88  ? 23.348  -33.072  38.362  1.00 29.78  ? 91   LEU C N   1 
ATOM   6007  C  CA  . LEU C 1 88  ? 22.649  -33.199  39.654  1.00 28.27  ? 91   LEU C CA  1 
ATOM   6008  C  C   . LEU C 1 88  ? 21.703  -32.036  39.848  1.00 29.50  ? 91   LEU C C   1 
ATOM   6009  O  O   . LEU C 1 88  ? 20.593  -32.212  40.315  1.00 29.73  ? 91   LEU C O   1 
ATOM   6010  C  CB  . LEU C 1 88  ? 23.646  -33.228  40.796  1.00 26.95  ? 91   LEU C CB  1 
ATOM   6011  C  CG  . LEU C 1 88  ? 24.564  -34.433  40.898  1.00 26.31  ? 91   LEU C CG  1 
ATOM   6012  C  CD1 . LEU C 1 88  ? 25.871  -34.045  41.564  1.00 24.81  ? 91   LEU C CD1 1 
ATOM   6013  C  CD2 . LEU C 1 88  ? 23.874  -35.564  41.653  1.00 24.95  ? 91   LEU C CD2 1 
ATOM   6014  N  N   . MET C 1 89  ? 22.142  -30.845  39.454  1.00 32.04  ? 92   MET C N   1 
ATOM   6015  C  CA  . MET C 1 89  ? 21.327  -29.638  39.609  1.00 35.20  ? 92   MET C CA  1 
ATOM   6016  C  C   . MET C 1 89  ? 20.148  -29.578  38.635  1.00 37.68  ? 92   MET C C   1 
ATOM   6017  O  O   . MET C 1 89  ? 19.239  -28.772  38.820  1.00 41.17  ? 92   MET C O   1 
ATOM   6018  C  CB  . MET C 1 89  ? 22.187  -28.370  39.502  1.00 32.51  ? 92   MET C CB  1 
ATOM   6019  C  CG  . MET C 1 89  ? 23.160  -28.172  40.661  1.00 33.34  ? 92   MET C CG  1 
ATOM   6020  S  SD  . MET C 1 89  ? 22.348  -28.095  42.274  1.00 35.16  ? 92   MET C SD  1 
ATOM   6021  C  CE  . MET C 1 89  ? 21.509  -26.516  42.176  1.00 34.06  ? 92   MET C CE  1 
ATOM   6022  N  N   . GLU C 1 90  ? 20.164  -30.420  37.603  1.00 38.15  ? 93   GLU C N   1 
ATOM   6023  C  CA  . GLU C 1 90  ? 19.051  -30.487  36.647  1.00 39.11  ? 93   GLU C CA  1 
ATOM   6024  C  C   . GLU C 1 90  ? 17.964  -31.469  37.068  1.00 39.08  ? 93   GLU C C   1 
ATOM   6025  O  O   . GLU C 1 90  ? 16.936  -31.587  36.401  1.00 42.77  ? 93   GLU C O   1 
ATOM   6026  C  CB  . GLU C 1 90  ? 19.562  -30.857  35.251  1.00 41.24  ? 93   GLU C CB  1 
ATOM   6027  C  CG  . GLU C 1 90  ? 20.079  -29.676  34.441  1.00 42.48  ? 93   GLU C CG  1 
ATOM   6028  C  CD  . GLU C 1 90  ? 21.061  -30.079  33.351  1.00 44.55  ? 93   GLU C CD  1 
ATOM   6029  O  OE1 . GLU C 1 90  ? 21.092  -31.266  32.952  1.00 45.03  ? 93   GLU C OE1 1 
ATOM   6030  O  OE2 . GLU C 1 90  ? 21.810  -29.195  32.884  1.00 45.24  ? 93   GLU C OE2 1 
ATOM   6031  N  N   . ARG C 1 91  ? 18.189  -32.178  38.168  1.00 37.95  ? 94   ARG C N   1 
ATOM   6032  C  CA  . ARG C 1 91  ? 17.238  -33.187  38.637  1.00 37.96  ? 94   ARG C CA  1 
ATOM   6033  C  C   . ARG C 1 91  ? 16.033  -32.554  39.343  1.00 41.38  ? 94   ARG C C   1 
ATOM   6034  O  O   . ARG C 1 91  ? 16.130  -31.434  39.839  1.00 42.78  ? 94   ARG C O   1 
ATOM   6035  C  CB  . ARG C 1 91  ? 17.945  -34.183  39.561  1.00 34.39  ? 94   ARG C CB  1 
ATOM   6036  C  CG  . ARG C 1 91  ? 18.877  -35.142  38.828  1.00 30.92  ? 94   ARG C CG  1 
ATOM   6037  C  CD  . ARG C 1 91  ? 19.737  -35.979  39.758  1.00 29.59  ? 94   ARG C CD  1 
ATOM   6038  N  NE  . ARG C 1 91  ? 18.972  -36.932  40.566  1.00 29.89  ? 94   ARG C NE  1 
ATOM   6039  C  CZ  . ARG C 1 91  ? 19.037  -38.257  40.449  1.00 32.66  ? 94   ARG C CZ  1 
ATOM   6040  N  NH1 . ARG C 1 91  ? 19.831  -38.831  39.537  1.00 33.24  ? 94   ARG C NH1 1 
ATOM   6041  N  NH2 . ARG C 1 91  ? 18.297  -39.016  41.249  1.00 32.71  ? 94   ARG C NH2 1 
ATOM   6042  N  N   . PRO C 1 92  ? 14.876  -33.248  39.351  1.00 43.93  ? 95   PRO C N   1 
ATOM   6043  C  CA  . PRO C 1 92  ? 13.769  -32.787  40.192  1.00 43.37  ? 95   PRO C CA  1 
ATOM   6044  C  C   . PRO C 1 92  ? 14.075  -32.875  41.700  1.00 43.40  ? 95   PRO C C   1 
ATOM   6045  O  O   . PRO C 1 92  ? 13.555  -32.070  42.472  1.00 45.85  ? 95   PRO C O   1 
ATOM   6046  C  CB  . PRO C 1 92  ? 12.612  -33.729  39.820  1.00 44.62  ? 95   PRO C CB  1 
ATOM   6047  C  CG  . PRO C 1 92  ? 13.235  -34.874  39.079  1.00 45.54  ? 95   PRO C CG  1 
ATOM   6048  C  CD  . PRO C 1 92  ? 14.449  -34.307  38.412  1.00 44.61  ? 95   PRO C CD  1 
ATOM   6049  N  N   . ASP C 1 93  ? 14.906  -33.838  42.106  1.00 38.76  ? 96   ASP C N   1 
ATOM   6050  C  CA  . ASP C 1 93  ? 15.293  -34.006  43.505  1.00 33.62  ? 96   ASP C CA  1 
ATOM   6051  C  C   . ASP C 1 93  ? 16.656  -33.372  43.792  1.00 32.75  ? 96   ASP C C   1 
ATOM   6052  O  O   . ASP C 1 93  ? 17.403  -33.837  44.655  1.00 32.20  ? 96   ASP C O   1 
ATOM   6053  C  CB  . ASP C 1 93  ? 15.304  -35.489  43.877  1.00 33.78  ? 96   ASP C CB  1 
ATOM   6054  C  CG  . ASP C 1 93  ? 16.267  -36.311  43.020  1.00 33.83  ? 96   ASP C CG  1 
ATOM   6055  O  OD1 . ASP C 1 93  ? 16.716  -35.813  41.967  1.00 35.06  ? 96   ASP C OD1 1 
ATOM   6056  O  OD2 . ASP C 1 93  ? 16.591  -37.453  43.409  1.00 32.46  ? 96   ASP C OD2 1 
ATOM   6057  N  N   . TRP C 1 94  ? 16.947  -32.290  43.073  1.00 34.56  ? 97   TRP C N   1 
ATOM   6058  C  CA  . TRP C 1 94  ? 18.230  -31.587  43.118  1.00 36.20  ? 97   TRP C CA  1 
ATOM   6059  C  C   . TRP C 1 94  ? 18.660  -31.168  44.502  1.00 38.67  ? 97   TRP C C   1 
ATOM   6060  O  O   . TRP C 1 94  ? 19.863  -31.089  44.768  1.00 38.28  ? 97   TRP C O   1 
ATOM   6061  C  CB  . TRP C 1 94  ? 18.201  -30.373  42.188  1.00 37.76  ? 97   TRP C CB  1 
ATOM   6062  C  CG  . TRP C 1 94  ? 17.237  -29.303  42.638  1.00 40.19  ? 97   TRP C CG  1 
ATOM   6063  C  CD1 . TRP C 1 94  ? 15.891  -29.179  42.311  1.00 41.65  ? 97   TRP C CD1 1 
ATOM   6064  C  CD2 . TRP C 1 94  ? 17.517  -28.168  43.533  1.00 41.82  ? 97   TRP C CD2 1 
ATOM   6065  N  NE1 . TRP C 1 94  ? 15.333  -28.079  42.923  1.00 42.82  ? 97   TRP C NE1 1 
ATOM   6066  C  CE2 . TRP C 1 94  ? 16.252  -27.429  43.669  1.00 42.46  ? 97   TRP C CE2 1 
ATOM   6067  C  CE3 . TRP C 1 94  ? 18.646  -27.707  44.209  1.00 42.23  ? 97   TRP C CE3 1 
ATOM   6068  C  CZ2 . TRP C 1 94  ? 16.145  -26.292  44.457  1.00 42.79  ? 97   TRP C CZ2 1 
ATOM   6069  C  CZ3 . TRP C 1 94  ? 18.525  -26.553  44.996  1.00 42.59  ? 97   TRP C CZ3 1 
ATOM   6070  C  CH2 . TRP C 1 94  ? 17.307  -25.864  45.115  1.00 43.47  ? 97   TRP C CH2 1 
ATOM   6071  N  N   . GLU C 1 95  ? 17.694  -30.897  45.387  1.00 38.61  ? 98   GLU C N   1 
ATOM   6072  C  CA  . GLU C 1 95  ? 17.991  -30.497  46.771  1.00 41.33  ? 98   GLU C CA  1 
ATOM   6073  C  C   . GLU C 1 95  ? 18.666  -31.626  47.518  1.00 39.26  ? 98   GLU C C   1 
ATOM   6074  O  O   . GLU C 1 95  ? 19.608  -31.403  48.277  1.00 40.49  ? 98   GLU C O   1 
ATOM   6075  C  CB  . GLU C 1 95  ? 16.734  -30.053  47.542  1.00 42.67  ? 98   GLU C CB  1 
ATOM   6076  C  CG  . GLU C 1 95  ? 16.269  -28.642  47.234  1.00 46.26  ? 98   GLU C CG  1 
ATOM   6077  C  CD  . GLU C 1 95  ? 15.426  -28.026  48.344  1.00 48.02  ? 98   GLU C CD  1 
ATOM   6078  O  OE1 . GLU C 1 95  ? 14.188  -27.939  48.186  1.00 50.37  ? 98   GLU C OE1 1 
ATOM   6079  O  OE2 . GLU C 1 95  ? 15.999  -27.610  49.371  1.00 46.71  ? 98   GLU C OE2 1 
ATOM   6080  N  N   . THR C 1 96  ? 18.176  -32.839  47.309  1.00 38.77  ? 99   THR C N   1 
ATOM   6081  C  CA  . THR C 1 96  ? 18.807  -34.003  47.907  1.00 39.38  ? 99   THR C CA  1 
ATOM   6082  C  C   . THR C 1 96  ? 19.955  -34.493  47.022  1.00 38.23  ? 99   THR C C   1 
ATOM   6083  O  O   . THR C 1 96  ? 20.984  -34.945  47.526  1.00 34.66  ? 99   THR C O   1 
ATOM   6084  C  CB  . THR C 1 96  ? 17.789  -35.124  48.212  1.00 41.76  ? 99   THR C CB  1 
ATOM   6085  O  OG1 . THR C 1 96  ? 16.697  -35.046  47.289  1.00 45.20  ? 99   THR C OG1 1 
ATOM   6086  C  CG2 . THR C 1 96  ? 17.237  -34.947  49.609  1.00 41.70  ? 99   THR C CG2 1 
ATOM   6087  N  N   . ALA C 1 97  ? 19.786  -34.365  45.706  1.00 37.16  ? 100  ALA C N   1 
ATOM   6088  C  CA  . ALA C 1 97  ? 20.797  -34.840  44.759  1.00 36.83  ? 100  ALA C CA  1 
ATOM   6089  C  C   . ALA C 1 97  ? 22.138  -34.107  44.879  1.00 35.62  ? 100  ALA C C   1 
ATOM   6090  O  O   . ALA C 1 97  ? 23.192  -34.748  44.858  1.00 34.30  ? 100  ALA C O   1 
ATOM   6091  C  CB  . ALA C 1 97  ? 20.274  -34.769  43.334  1.00 37.28  ? 100  ALA C CB  1 
ATOM   6092  N  N   . ILE C 1 98  ? 22.106  -32.781  45.035  1.00 34.04  ? 101  ILE C N   1 
ATOM   6093  C  CA  . ILE C 1 98  ? 23.359  -32.007  45.142  1.00 33.05  ? 101  ILE C CA  1 
ATOM   6094  C  C   . ILE C 1 98  ? 24.173  -32.349  46.401  1.00 32.10  ? 101  ILE C C   1 
ATOM   6095  O  O   . ILE C 1 98  ? 25.332  -31.956  46.521  1.00 31.66  ? 101  ILE C O   1 
ATOM   6096  C  CB  . ILE C 1 98  ? 23.130  -30.481  44.984  1.00 34.69  ? 101  ILE C CB  1 
ATOM   6097  C  CG1 . ILE C 1 98  ? 24.440  -29.747  44.647  1.00 36.18  ? 101  ILE C CG1 1 
ATOM   6098  C  CG2 . ILE C 1 98  ? 22.493  -29.884  46.241  1.00 35.10  ? 101  ILE C CG2 1 
ATOM   6099  C  CD1 . ILE C 1 98  ? 25.242  -30.340  43.503  1.00 33.94  ? 101  ILE C CD1 1 
ATOM   6100  N  N   . GLN C 1 99  ? 23.572  -33.100  47.319  1.00 31.76  ? 102  GLN C N   1 
ATOM   6101  C  CA  . GLN C 1 99  ? 24.263  -33.543  48.543  1.00 33.87  ? 102  GLN C CA  1 
ATOM   6102  C  C   . GLN C 1 99  ? 25.166  -34.760  48.401  1.00 32.01  ? 102  GLN C C   1 
ATOM   6103  O  O   . GLN C 1 99  ? 25.858  -35.109  49.354  1.00 32.32  ? 102  GLN C O   1 
ATOM   6104  C  CB  . GLN C 1 99  ? 23.268  -33.856  49.658  1.00 36.73  ? 102  GLN C CB  1 
ATOM   6105  C  CG  . GLN C 1 99  ? 23.396  -32.972  50.882  1.00 43.42  ? 102  GLN C CG  1 
ATOM   6106  C  CD  . GLN C 1 99  ? 22.204  -32.070  51.055  1.00 47.84  ? 102  GLN C CD  1 
ATOM   6107  O  OE1 . GLN C 1 99  ? 21.078  -32.542  51.252  1.00 52.63  ? 102  GLN C OE1 1 
ATOM   6108  N  NE2 . GLN C 1 99  ? 22.436  -30.762  50.989  1.00 48.81  ? 102  GLN C NE2 1 
ATOM   6109  N  N   . LYS C 1 100 ? 25.139  -35.427  47.248  1.00 28.35  ? 103  LYS C N   1 
ATOM   6110  C  CA  . LYS C 1 100 ? 25.974  -36.606  47.048  1.00 25.48  ? 103  LYS C CA  1 
ATOM   6111  C  C   . LYS C 1 100 ? 27.442  -36.216  46.994  1.00 23.60  ? 103  LYS C C   1 
ATOM   6112  O  O   . LYS C 1 100 ? 27.830  -35.353  46.202  1.00 21.74  ? 103  LYS C O   1 
ATOM   6113  C  CB  . LYS C 1 100 ? 25.597  -37.329  45.747  1.00 25.58  ? 103  LYS C CB  1 
ATOM   6114  C  CG  . LYS C 1 100 ? 26.340  -38.641  45.508  1.00 24.32  ? 103  LYS C CG  1 
ATOM   6115  C  CD  . LYS C 1 100 ? 25.918  -39.740  46.487  1.00 23.66  ? 103  LYS C CD  1 
ATOM   6116  C  CE  . LYS C 1 100 ? 24.410  -39.862  46.589  1.00 24.05  ? 103  LYS C CE  1 
ATOM   6117  N  NZ  . LYS C 1 100 ? 24.043  -40.986  47.503  1.00 24.79  ? 103  LYS C NZ  1 
ATOM   6118  N  N   . PRO C 1 101 ? 28.265  -36.863  47.829  1.00 23.91  ? 104  PRO C N   1 
ATOM   6119  C  CA  . PRO C 1 101 ? 29.685  -36.509  47.860  1.00 23.82  ? 104  PRO C CA  1 
ATOM   6120  C  C   . PRO C 1 101 ? 30.365  -36.793  46.526  1.00 25.38  ? 104  PRO C C   1 
ATOM   6121  O  O   . PRO C 1 101 ? 30.153  -37.851  45.931  1.00 27.01  ? 104  PRO C O   1 
ATOM   6122  C  CB  . PRO C 1 101 ? 30.235  -37.388  48.988  1.00 22.93  ? 104  PRO C CB  1 
ATOM   6123  C  CG  . PRO C 1 101 ? 29.046  -37.597  49.898  1.00 21.52  ? 104  PRO C CG  1 
ATOM   6124  C  CD  . PRO C 1 101 ? 27.905  -37.787  48.929  1.00 22.59  ? 104  PRO C CD  1 
ATOM   6125  N  N   . LEU C 1 102 ? 31.155  -35.826  46.069  1.00 23.95  ? 105  LEU C N   1 
ATOM   6126  C  CA  . LEU C 1 102 ? 31.829  -35.878  44.801  1.00 25.17  ? 105  LEU C CA  1 
ATOM   6127  C  C   . LEU C 1 102 ? 33.325  -35.941  45.040  1.00 26.71  ? 105  LEU C C   1 
ATOM   6128  O  O   . LEU C 1 102 ? 33.798  -35.571  46.102  1.00 29.35  ? 105  LEU C O   1 
ATOM   6129  C  CB  . LEU C 1 102 ? 31.473  -34.622  43.994  1.00 24.45  ? 105  LEU C CB  1 
ATOM   6130  C  CG  . LEU C 1 102 ? 30.271  -34.601  43.032  1.00 25.52  ? 105  LEU C CG  1 
ATOM   6131  C  CD1 . LEU C 1 102 ? 29.199  -35.646  43.342  1.00 24.93  ? 105  LEU C CD1 1 
ATOM   6132  C  CD2 . LEU C 1 102 ? 29.659  -33.196  42.892  1.00 23.37  ? 105  LEU C CD2 1 
ATOM   6133  N  N   . CYS C 1 103 ? 34.075  -36.418  44.053  1.00 27.67  ? 106  CYS C N   1 
ATOM   6134  C  CA  . CYS C 1 103 ? 35.526  -36.540  44.169  1.00 27.55  ? 106  CYS C CA  1 
ATOM   6135  C  C   . CYS C 1 103 ? 36.181  -36.260  42.825  1.00 29.08  ? 106  CYS C C   1 
ATOM   6136  O  O   . CYS C 1 103 ? 35.630  -36.610  41.778  1.00 30.76  ? 106  CYS C O   1 
ATOM   6137  C  CB  . CYS C 1 103 ? 35.905  -37.940  44.646  1.00 27.87  ? 106  CYS C CB  1 
ATOM   6138  S  SG  . CYS C 1 103 ? 37.685  -38.290  44.599  1.00 28.56  ? 106  CYS C SG  1 
ATOM   6139  N  N   . SER C 1 104 ? 37.365  -35.665  42.849  1.00 28.41  ? 107  SER C N   1 
ATOM   6140  C  CA  . SER C 1 104 ? 38.044  -35.321  41.614  1.00 31.64  ? 107  SER C CA  1 
ATOM   6141  C  C   . SER C 1 104 ? 39.394  -36.011  41.507  1.00 31.17  ? 107  SER C C   1 
ATOM   6142  O  O   . SER C 1 104 ? 40.280  -35.787  42.320  1.00 33.42  ? 107  SER C O   1 
ATOM   6143  C  CB  . SER C 1 104 ? 38.184  -33.794  41.483  1.00 33.13  ? 107  SER C CB  1 
ATOM   6144  O  OG  . SER C 1 104 ? 38.928  -33.431  40.328  1.00 37.52  ? 107  SER C OG  1 
ATOM   6145  N  N   . LEU C 1 105 ? 39.540  -36.869  40.505  1.00 31.75  ? 108  LEU C N   1 
ATOM   6146  C  CA  . LEU C 1 105 ? 40.813  -37.560  40.257  1.00 30.54  ? 108  LEU C CA  1 
ATOM   6147  C  C   . LEU C 1 105 ? 41.361  -37.033  38.962  1.00 31.81  ? 108  LEU C C   1 
ATOM   6148  O  O   . LEU C 1 105 ? 40.644  -36.985  37.963  1.00 31.64  ? 108  LEU C O   1 
ATOM   6149  C  CB  . LEU C 1 105 ? 40.640  -39.077  40.230  1.00 28.96  ? 108  LEU C CB  1 
ATOM   6150  C  CG  . LEU C 1 105 ? 40.213  -39.696  41.574  1.00 28.11  ? 108  LEU C CG  1 
ATOM   6151  C  CD1 . LEU C 1 105 ? 40.266  -41.213  41.514  1.00 25.71  ? 108  LEU C CD1 1 
ATOM   6152  C  CD2 . LEU C 1 105 ? 41.071  -39.215  42.734  1.00 28.41  ? 108  LEU C CD2 1 
ATOM   6153  N  N   . PRO C 1 106 ? 42.616  -36.564  38.985  1.00 33.87  ? 109  PRO C N   1 
ATOM   6154  C  CA  . PRO C 1 106 ? 43.135  -35.899  37.792  1.00 35.77  ? 109  PRO C CA  1 
ATOM   6155  C  C   . PRO C 1 106 ? 43.563  -36.915  36.742  1.00 37.80  ? 109  PRO C C   1 
ATOM   6156  O  O   . PRO C 1 106 ? 44.119  -37.949  37.082  1.00 37.15  ? 109  PRO C O   1 
ATOM   6157  C  CB  . PRO C 1 106 ? 44.341  -35.118  38.319  1.00 35.29  ? 109  PRO C CB  1 
ATOM   6158  C  CG  . PRO C 1 106 ? 44.795  -35.887  39.523  1.00 34.92  ? 109  PRO C CG  1 
ATOM   6159  C  CD  . PRO C 1 106 ? 43.592  -36.591  40.096  1.00 33.35  ? 109  PRO C CD  1 
ATOM   6160  N  N   . ALA C 1 107 ? 43.269  -36.627  35.483  1.00 40.83  ? 110  ALA C N   1 
ATOM   6161  C  CA  . ALA C 1 107 ? 43.699  -37.474  34.384  1.00 48.88  ? 110  ALA C CA  1 
ATOM   6162  C  C   . ALA C 1 107 ? 44.169  -36.571  33.255  1.00 55.34  ? 110  ALA C C   1 
ATOM   6163  O  O   . ALA C 1 107 ? 45.380  -36.453  33.012  1.00 60.02  ? 110  ALA C O   1 
ATOM   6164  C  CB  . ALA C 1 107 ? 42.566  -38.379  33.918  1.00 47.35  ? 110  ALA C CB  1 
ATOM   6165  N  N   . GLY C 1 108 ? 43.209  -35.907  32.605  1.00 57.81  ? 111  GLY C N   1 
ATOM   6166  C  CA  . GLY C 1 108 ? 43.469  -35.075  31.427  1.00 61.46  ? 111  GLY C CA  1 
ATOM   6167  C  C   . GLY C 1 108 ? 44.346  -33.863  31.679  1.00 63.75  ? 111  GLY C C   1 
ATOM   6168  O  O   . GLY C 1 108 ? 45.249  -33.877  32.528  1.00 60.99  ? 111  GLY C O   1 
ATOM   6169  N  N   . SER C 1 109 ? 44.096  -32.818  30.903  1.00 64.78  ? 112  SER C N   1 
ATOM   6170  C  CA  . SER C 1 109 ? 44.679  -31.520  31.165  1.00 62.26  ? 112  SER C CA  1 
ATOM   6171  C  C   . SER C 1 109 ? 43.546  -30.667  31.719  1.00 57.84  ? 112  SER C C   1 
ATOM   6172  O  O   . SER C 1 109 ? 42.369  -30.988  31.522  1.00 55.37  ? 112  SER C O   1 
ATOM   6173  C  CB  . SER C 1 109 ? 45.256  -30.925  29.884  1.00 68.42  ? 112  SER C CB  1 
ATOM   6174  O  OG  . SER C 1 109 ? 46.298  -30.012  30.184  1.00 76.95  ? 112  SER C OG  1 
ATOM   6175  N  N   . GLY C 1 110 ? 43.891  -29.592  32.419  1.00 54.56  ? 113  GLY C N   1 
ATOM   6176  C  CA  . GLY C 1 110 ? 42.882  -28.823  33.137  1.00 48.99  ? 113  GLY C CA  1 
ATOM   6177  C  C   . GLY C 1 110 ? 42.423  -29.631  34.336  1.00 44.76  ? 113  GLY C C   1 
ATOM   6178  O  O   . GLY C 1 110 ? 41.303  -30.154  34.358  1.00 44.56  ? 113  GLY C O   1 
ATOM   6179  N  N   . ASN C 1 111 ? 43.313  -29.743  35.319  1.00 40.54  ? 114  ASN C N   1 
ATOM   6180  C  CA  . ASN C 1 111 ? 43.023  -30.424  36.583  1.00 40.48  ? 114  ASN C CA  1 
ATOM   6181  C  C   . ASN C 1 111 ? 43.136  -29.466  37.780  1.00 37.80  ? 114  ASN C C   1 
ATOM   6182  O  O   . ASN C 1 111 ? 43.735  -29.777  38.813  1.00 36.16  ? 114  ASN C O   1 
ATOM   6183  C  CB  . ASN C 1 111 ? 43.924  -31.646  36.718  1.00 40.66  ? 114  ASN C CB  1 
ATOM   6184  C  CG  . ASN C 1 111 ? 43.755  -32.604  35.548  1.00 46.00  ? 114  ASN C CG  1 
ATOM   6185  O  OD1 . ASN C 1 111 ? 42.799  -33.380  35.502  1.00 45.07  ? 114  ASN C OD1 1 
ATOM   6186  N  ND2 . ASN C 1 111 ? 44.664  -32.525  34.574  1.00 44.12  ? 114  ASN C ND2 1 
ATOM   6187  N  N   . ALA C 1 112 ? 42.525  -28.299  37.604  1.00 34.56  ? 115  ALA C N   1 
ATOM   6188  C  CA  . ALA C 1 112 ? 42.592  -27.193  38.550  1.00 34.55  ? 115  ALA C CA  1 
ATOM   6189  C  C   . ALA C 1 112 ? 41.927  -27.518  39.894  1.00 33.97  ? 115  ALA C C   1 
ATOM   6190  O  O   . ALA C 1 112 ? 42.489  -27.252  40.964  1.00 33.44  ? 115  ALA C O   1 
ATOM   6191  C  CB  . ALA C 1 112 ? 41.968  -25.947  37.923  1.00 33.00  ? 115  ALA C CB  1 
ATOM   6192  N  N   . LEU C 1 113 ? 40.733  -28.094  39.832  1.00 33.33  ? 116  LEU C N   1 
ATOM   6193  C  CA  . LEU C 1 113 ? 40.025  -28.492  41.033  1.00 34.81  ? 116  LEU C CA  1 
ATOM   6194  C  C   . LEU C 1 113 ? 40.847  -29.497  41.850  1.00 35.55  ? 116  LEU C C   1 
ATOM   6195  O  O   . LEU C 1 113 ? 41.116  -29.272  43.035  1.00 34.72  ? 116  LEU C O   1 
ATOM   6196  C  CB  . LEU C 1 113 ? 38.635  -29.017  40.674  1.00 36.95  ? 116  LEU C CB  1 
ATOM   6197  C  CG  . LEU C 1 113 ? 37.527  -29.129  41.718  1.00 39.25  ? 116  LEU C CG  1 
ATOM   6198  C  CD1 . LEU C 1 113 ? 37.290  -27.831  42.482  1.00 40.76  ? 116  LEU C CD1 1 
ATOM   6199  C  CD2 . LEU C 1 113 ? 36.263  -29.561  40.994  1.00 39.83  ? 116  LEU C CD2 1 
ATOM   6200  N  N   . ALA C 1 114 ? 41.286  -30.579  41.214  1.00 34.52  ? 117  ALA C N   1 
ATOM   6201  C  CA  . ALA C 1 114 ? 42.172  -31.542  41.881  1.00 32.60  ? 117  ALA C CA  1 
ATOM   6202  C  C   . ALA C 1 114 ? 43.430  -30.866  42.464  1.00 31.01  ? 117  ALA C C   1 
ATOM   6203  O  O   . ALA C 1 114 ? 43.871  -31.200  43.568  1.00 31.73  ? 117  ALA C O   1 
ATOM   6204  C  CB  . ALA C 1 114 ? 42.562  -32.653  40.914  1.00 33.10  ? 117  ALA C CB  1 
ATOM   6205  N  N   . ALA C 1 115 ? 44.000  -29.924  41.721  1.00 29.80  ? 118  ALA C N   1 
ATOM   6206  C  CA  . ALA C 1 115 ? 45.240  -29.274  42.127  1.00 32.04  ? 118  ALA C CA  1 
ATOM   6207  C  C   . ALA C 1 115 ? 45.024  -28.356  43.336  1.00 34.03  ? 118  ALA C C   1 
ATOM   6208  O  O   . ALA C 1 115 ? 45.896  -28.269  44.209  1.00 35.20  ? 118  ALA C O   1 
ATOM   6209  C  CB  . ALA C 1 115 ? 45.815  -28.486  40.977  1.00 31.99  ? 118  ALA C CB  1 
ATOM   6210  N  N   . SER C 1 116 ? 43.861  -27.690  43.359  1.00 32.93  ? 119  SER C N   1 
ATOM   6211  C  CA  . SER C 1 116 ? 43.407  -26.874  44.480  1.00 33.31  ? 119  SER C CA  1 
ATOM   6212  C  C   . SER C 1 116 ? 43.221  -27.699  45.742  1.00 34.61  ? 119  SER C C   1 
ATOM   6213  O  O   . SER C 1 116 ? 43.689  -27.302  46.822  1.00 36.68  ? 119  SER C O   1 
ATOM   6214  C  CB  . SER C 1 116 ? 42.093  -26.173  44.143  1.00 32.54  ? 119  SER C CB  1 
ATOM   6215  O  OG  . SER C 1 116 ? 42.259  -25.303  43.043  1.00 32.75  ? 119  SER C OG  1 
ATOM   6216  N  N   . LEU C 1 117 ? 42.556  -28.845  45.605  1.00 34.23  ? 120  LEU C N   1 
ATOM   6217  C  CA  . LEU C 1 117 ? 42.275  -29.722  46.747  1.00 34.06  ? 120  LEU C CA  1 
ATOM   6218  C  C   . LEU C 1 117 ? 43.548  -30.328  47.281  1.00 33.52  ? 120  LEU C C   1 
ATOM   6219  O  O   . LEU C 1 117 ? 43.707  -30.483  48.494  1.00 34.44  ? 120  LEU C O   1 
ATOM   6220  C  CB  . LEU C 1 117 ? 41.282  -30.815  46.381  1.00 34.41  ? 120  LEU C CB  1 
ATOM   6221  C  CG  . LEU C 1 117 ? 39.888  -30.318  45.985  1.00 37.09  ? 120  LEU C CG  1 
ATOM   6222  C  CD1 . LEU C 1 117 ? 39.093  -31.441  45.340  1.00 37.04  ? 120  LEU C CD1 1 
ATOM   6223  C  CD2 . LEU C 1 117 ? 39.139  -29.735  47.178  1.00 37.01  ? 120  LEU C CD2 1 
ATOM   6224  N  N   . ASN C 1 118 ? 44.460  -30.649  46.371  1.00 32.29  ? 121  ASN C N   1 
ATOM   6225  C  CA  . ASN C 1 118 ? 45.816  -31.049  46.742  1.00 31.85  ? 121  ASN C CA  1 
ATOM   6226  C  C   . ASN C 1 118 ? 46.528  -29.964  47.575  1.00 31.22  ? 121  ASN C C   1 
ATOM   6227  O  O   . ASN C 1 118 ? 47.158  -30.257  48.594  1.00 29.41  ? 121  ASN C O   1 
ATOM   6228  C  CB  . ASN C 1 118 ? 46.625  -31.362  45.481  1.00 30.25  ? 121  ASN C CB  1 
ATOM   6229  C  CG  . ASN C 1 118 ? 47.996  -31.923  45.788  1.00 31.71  ? 121  ASN C CG  1 
ATOM   6230  O  OD1 . ASN C 1 118 ? 49.019  -31.305  45.483  1.00 35.60  ? 121  ASN C OD1 1 
ATOM   6231  N  ND2 . ASN C 1 118 ? 48.030  -33.093  46.397  1.00 30.62  ? 121  ASN C ND2 1 
ATOM   6232  N  N   . HIS C 1 119 ? 46.413  -28.714  47.135  1.00 32.77  ? 122  HIS C N   1 
ATOM   6233  C  CA  . HIS C 1 119 ? 47.058  -27.604  47.829  1.00 35.30  ? 122  HIS C CA  1 
ATOM   6234  C  C   . HIS C 1 119 ? 46.479  -27.398  49.215  1.00 35.24  ? 122  HIS C C   1 
ATOM   6235  O  O   . HIS C 1 119 ? 47.238  -27.357  50.192  1.00 36.00  ? 122  HIS C O   1 
ATOM   6236  C  CB  . HIS C 1 119 ? 47.032  -26.328  46.987  1.00 39.02  ? 122  HIS C CB  1 
ATOM   6237  C  CG  . HIS C 1 119 ? 47.612  -25.128  47.694  1.00 40.97  ? 122  HIS C CG  1 
ATOM   6238  N  ND1 . HIS C 1 119 ? 46.843  -24.162  48.228  1.00 40.67  ? 122  HIS C ND1 1 
ATOM   6239  C  CD2 . HIS C 1 119 ? 48.930  -24.781  47.974  1.00 41.92  ? 122  HIS C CD2 1 
ATOM   6240  C  CE1 . HIS C 1 119 ? 47.625  -23.236  48.805  1.00 41.11  ? 122  HIS C CE1 1 
ATOM   6241  N  NE2 . HIS C 1 119 ? 48.901  -23.617  48.655  1.00 42.39  ? 122  HIS C NE2 1 
ATOM   6242  N  N   . TYR C 1 120 ? 45.142  -27.344  49.317  1.00 33.39  ? 123  TYR C N   1 
ATOM   6243  C  CA  . TYR C 1 120 ? 44.429  -27.271  50.611  1.00 33.15  ? 123  TYR C CA  1 
ATOM   6244  C  C   . TYR C 1 120 ? 44.834  -28.359  51.609  1.00 35.81  ? 123  TYR C C   1 
ATOM   6245  O  O   . TYR C 1 120 ? 44.750  -28.144  52.823  1.00 35.47  ? 123  TYR C O   1 
ATOM   6246  C  CB  . TYR C 1 120 ? 42.900  -27.339  50.447  1.00 30.72  ? 123  TYR C CB  1 
ATOM   6247  C  CG  . TYR C 1 120 ? 42.287  -26.365  49.472  1.00 30.95  ? 123  TYR C CG  1 
ATOM   6248  C  CD1 . TYR C 1 120 ? 42.845  -25.103  49.247  1.00 30.71  ? 123  TYR C CD1 1 
ATOM   6249  C  CD2 . TYR C 1 120 ? 41.127  -26.703  48.783  1.00 30.87  ? 123  TYR C CD2 1 
ATOM   6250  C  CE1 . TYR C 1 120 ? 42.269  -24.215  48.347  1.00 31.68  ? 123  TYR C CE1 1 
ATOM   6251  C  CE2 . TYR C 1 120 ? 40.543  -25.826  47.888  1.00 30.81  ? 123  TYR C CE2 1 
ATOM   6252  C  CZ  . TYR C 1 120 ? 41.110  -24.586  47.669  1.00 32.59  ? 123  TYR C CZ  1 
ATOM   6253  O  OH  . TYR C 1 120 ? 40.510  -23.729  46.758  1.00 35.45  ? 123  TYR C OH  1 
ATOM   6254  N  N   . ALA C 1 121 ? 45.248  -29.521  51.100  1.00 35.40  ? 124  ALA C N   1 
ATOM   6255  C  CA  . ALA C 1 121 ? 45.598  -30.660  51.959  1.00 35.29  ? 124  ALA C CA  1 
ATOM   6256  C  C   . ALA C 1 121 ? 47.041  -30.568  52.478  1.00 36.30  ? 124  ALA C C   1 
ATOM   6257  O  O   . ALA C 1 121 ? 47.442  -31.327  53.372  1.00 36.03  ? 124  ALA C O   1 
ATOM   6258  C  CB  . ALA C 1 121 ? 45.377  -31.978  51.220  1.00 33.37  ? 124  ALA C CB  1 
ATOM   6259  N  N   . GLY C 1 122 ? 47.821  -29.651  51.908  1.00 37.20  ? 125  GLY C N   1 
ATOM   6260  C  CA  . GLY C 1 122 ? 49.183  -29.394  52.395  1.00 37.19  ? 125  GLY C CA  1 
ATOM   6261  C  C   . GLY C 1 122 ? 50.327  -29.964  51.582  1.00 38.18  ? 125  GLY C C   1 
ATOM   6262  O  O   . GLY C 1 122 ? 51.481  -29.836  51.968  1.00 38.42  ? 125  GLY C O   1 
ATOM   6263  N  N   . TYR C 1 123 ? 50.023  -30.579  50.442  1.00 39.38  ? 126  TYR C N   1 
ATOM   6264  C  CA  . TYR C 1 123 ? 51.052  -31.206  49.615  1.00 38.91  ? 126  TYR C CA  1 
ATOM   6265  C  C   . TYR C 1 123 ? 51.786  -30.189  48.758  1.00 41.18  ? 126  TYR C C   1 
ATOM   6266  O  O   . TYR C 1 123 ? 51.252  -29.115  48.442  1.00 38.59  ? 126  TYR C O   1 
ATOM   6267  C  CB  . TYR C 1 123 ? 50.418  -32.223  48.671  1.00 37.92  ? 126  TYR C CB  1 
ATOM   6268  C  CG  . TYR C 1 123 ? 49.852  -33.451  49.337  1.00 36.92  ? 126  TYR C CG  1 
ATOM   6269  C  CD1 . TYR C 1 123 ? 50.699  -34.430  49.856  1.00 35.46  ? 126  TYR C CD1 1 
ATOM   6270  C  CD2 . TYR C 1 123 ? 48.471  -33.659  49.403  1.00 35.65  ? 126  TYR C CD2 1 
ATOM   6271  C  CE1 . TYR C 1 123 ? 50.190  -35.565  50.447  1.00 34.45  ? 126  TYR C CE1 1 
ATOM   6272  C  CE2 . TYR C 1 123 ? 47.952  -34.795  49.998  1.00 35.05  ? 126  TYR C CE2 1 
ATOM   6273  C  CZ  . TYR C 1 123 ? 48.823  -35.737  50.520  1.00 36.18  ? 126  TYR C CZ  1 
ATOM   6274  O  OH  . TYR C 1 123 ? 48.341  -36.881  51.109  1.00 39.84  ? 126  TYR C OH  1 
ATOM   6275  N  N   . GLU C 1 124 ? 53.003  -30.548  48.352  1.00 43.49  ? 127  GLU C N   1 
ATOM   6276  C  CA  . GLU C 1 124 ? 53.697  -29.810  47.303  1.00 47.23  ? 127  GLU C CA  1 
ATOM   6277  C  C   . GLU C 1 124 ? 52.819  -29.720  46.055  1.00 43.90  ? 127  GLU C C   1 
ATOM   6278  O  O   . GLU C 1 124 ? 51.928  -30.548  45.836  1.00 42.27  ? 127  GLU C O   1 
ATOM   6279  C  CB  . GLU C 1 124 ? 55.034  -30.479  46.948  1.00 53.34  ? 127  GLU C CB  1 
ATOM   6280  C  CG  . GLU C 1 124 ? 56.068  -30.533  48.071  1.00 60.53  ? 127  GLU C CG  1 
ATOM   6281  C  CD  . GLU C 1 124 ? 56.386  -29.166  48.658  1.00 66.58  ? 127  GLU C CD  1 
ATOM   6282  O  OE1 . GLU C 1 124 ? 55.597  -28.682  49.500  1.00 69.62  ? 127  GLU C OE1 1 
ATOM   6283  O  OE2 . GLU C 1 124 ? 57.429  -28.579  48.290  1.00 70.27  ? 127  GLU C OE2 1 
ATOM   6284  N  N   . GLN C 1 125 ? 53.074  -28.700  45.249  1.00 40.62  ? 128  GLN C N   1 
ATOM   6285  C  CA  . GLN C 1 125 ? 52.391  -28.504  43.988  1.00 40.10  ? 128  GLN C CA  1 
ATOM   6286  C  C   . GLN C 1 125 ? 52.937  -29.544  43.006  1.00 40.64  ? 128  GLN C C   1 
ATOM   6287  O  O   . GLN C 1 125 ? 53.763  -29.233  42.155  1.00 38.45  ? 128  GLN C O   1 
ATOM   6288  C  CB  . GLN C 1 125 ? 52.639  -27.070  43.501  1.00 38.96  ? 128  GLN C CB  1 
ATOM   6289  C  CG  . GLN C 1 125 ? 51.897  -26.676  42.240  1.00 38.64  ? 128  GLN C CG  1 
ATOM   6290  C  CD  . GLN C 1 125 ? 51.849  -25.170  42.041  1.00 39.67  ? 128  GLN C CD  1 
ATOM   6291  O  OE1 . GLN C 1 125 ? 52.459  -24.626  41.120  1.00 38.34  ? 128  GLN C OE1 1 
ATOM   6292  N  NE2 . GLN C 1 125 ? 51.121  -24.489  42.910  1.00 42.46  ? 128  GLN C NE2 1 
ATOM   6293  N  N   . VAL C 1 126 ? 52.489  -30.791  43.173  1.00 44.15  ? 129  VAL C N   1 
ATOM   6294  C  CA  . VAL C 1 126 ? 52.928  -31.928  42.351  1.00 43.21  ? 129  VAL C CA  1 
ATOM   6295  C  C   . VAL C 1 126 ? 52.092  -32.044  41.078  1.00 43.11  ? 129  VAL C C   1 
ATOM   6296  O  O   . VAL C 1 126 ? 51.068  -31.374  40.923  1.00 38.63  ? 129  VAL C O   1 
ATOM   6297  C  CB  . VAL C 1 126 ? 52.847  -33.276  43.107  1.00 44.85  ? 129  VAL C CB  1 
ATOM   6298  C  CG1 . VAL C 1 126 ? 53.881  -33.350  44.218  1.00 45.54  ? 129  VAL C CG1 1 
ATOM   6299  C  CG2 . VAL C 1 126 ? 51.448  -33.520  43.649  1.00 42.57  ? 129  VAL C CG2 1 
ATOM   6300  N  N   . THR C 1 127 ? 52.520  -32.932  40.187  1.00 45.77  ? 130  THR C N   1 
ATOM   6301  C  CA  . THR C 1 127 ? 51.929  -33.036  38.851  1.00 46.01  ? 130  THR C CA  1 
ATOM   6302  C  C   . THR C 1 127 ? 51.708  -34.508  38.404  1.00 42.93  ? 130  THR C C   1 
ATOM   6303  O  O   . THR C 1 127 ? 52.248  -35.435  39.011  1.00 39.71  ? 130  THR C O   1 
ATOM   6304  C  CB  . THR C 1 127 ? 52.774  -32.204  37.841  1.00 48.95  ? 130  THR C CB  1 
ATOM   6305  O  OG1 . THR C 1 127 ? 51.988  -31.872  36.691  1.00 56.91  ? 130  THR C OG1 1 
ATOM   6306  C  CG2 . THR C 1 127 ? 54.079  -32.918  37.424  1.00 46.80  ? 130  THR C CG2 1 
ATOM   6307  N  N   . ASN C 1 128 ? 50.884  -34.714  37.374  1.00 40.85  ? 131  ASN C N   1 
ATOM   6308  C  CA  . ASN C 1 128 ? 50.772  -36.028  36.716  1.00 42.80  ? 131  ASN C CA  1 
ATOM   6309  C  C   . ASN C 1 128 ? 50.380  -37.164  37.663  1.00 41.63  ? 131  ASN C C   1 
ATOM   6310  O  O   . ASN C 1 128 ? 49.369  -37.067  38.355  1.00 43.44  ? 131  ASN C O   1 
ATOM   6311  C  CB  . ASN C 1 128 ? 52.070  -36.377  35.961  1.00 42.06  ? 131  ASN C CB  1 
ATOM   6312  C  CG  . ASN C 1 128 ? 52.512  -35.274  35.010  1.00 42.76  ? 131  ASN C CG  1 
ATOM   6313  O  OD1 . ASN C 1 128 ? 53.700  -34.961  34.923  1.00 47.61  ? 131  ASN C OD1 1 
ATOM   6314  N  ND2 . ASN C 1 128 ? 51.567  -34.686  34.291  1.00 39.09  ? 131  ASN C ND2 1 
ATOM   6315  N  N   . GLU C 1 129 ? 51.170  -38.236  37.703  1.00 40.72  ? 132  GLU C N   1 
ATOM   6316  C  CA  . GLU C 1 129 ? 50.813  -39.385  38.540  1.00 40.10  ? 132  GLU C CA  1 
ATOM   6317  C  C   . GLU C 1 129 ? 51.009  -39.137  40.038  1.00 38.61  ? 132  GLU C C   1 
ATOM   6318  O  O   . GLU C 1 129 ? 50.273  -39.703  40.849  1.00 39.59  ? 132  GLU C O   1 
ATOM   6319  C  CB  . GLU C 1 129 ? 51.450  -40.712  38.069  1.00 41.84  ? 132  GLU C CB  1 
ATOM   6320  C  CG  . GLU C 1 129 ? 52.883  -40.643  37.564  1.00 46.54  ? 132  GLU C CG  1 
ATOM   6321  C  CD  . GLU C 1 129 ? 52.997  -40.093  36.145  1.00 51.68  ? 132  GLU C CD  1 
ATOM   6322  O  OE1 . GLU C 1 129 ? 52.093  -40.344  35.311  1.00 52.31  ? 132  GLU C OE1 1 
ATOM   6323  O  OE2 . GLU C 1 129 ? 54.002  -39.400  35.863  1.00 55.41  ? 132  GLU C OE2 1 
ATOM   6324  N  N   . ASP C 1 130 ? 51.970  -38.277  40.394  1.00 37.06  ? 133  ASP C N   1 
ATOM   6325  C  CA  . ASP C 1 130 ? 52.135  -37.801  41.776  1.00 36.39  ? 133  ASP C CA  1 
ATOM   6326  C  C   . ASP C 1 130 ? 50.853  -37.121  42.265  1.00 34.66  ? 133  ASP C C   1 
ATOM   6327  O  O   . ASP C 1 130 ? 50.397  -37.358  43.388  1.00 34.45  ? 133  ASP C O   1 
ATOM   6328  C  CB  . ASP C 1 130 ? 53.297  -36.805  41.885  1.00 40.56  ? 133  ASP C CB  1 
ATOM   6329  C  CG  . ASP C 1 130 ? 54.664  -37.453  41.718  1.00 43.96  ? 133  ASP C CG  1 
ATOM   6330  O  OD1 . ASP C 1 130 ? 55.584  -36.742  41.263  1.00 46.24  ? 133  ASP C OD1 1 
ATOM   6331  O  OD2 . ASP C 1 130 ? 54.829  -38.651  42.042  1.00 44.02  ? 133  ASP C OD2 1 
ATOM   6332  N  N   . LEU C 1 131 ? 50.271  -36.281  41.409  1.00 33.75  ? 134  LEU C N   1 
ATOM   6333  C  CA  . LEU C 1 131 ? 49.023  -35.599  41.734  1.00 32.27  ? 134  LEU C CA  1 
ATOM   6334  C  C   . LEU C 1 131 ? 47.896  -36.607  41.846  1.00 32.34  ? 134  LEU C C   1 
ATOM   6335  O  O   . LEU C 1 131 ? 47.116  -36.571  42.795  1.00 32.87  ? 134  LEU C O   1 
ATOM   6336  C  CB  . LEU C 1 131 ? 48.698  -34.507  40.715  1.00 29.55  ? 134  LEU C CB  1 
ATOM   6337  C  CG  . LEU C 1 131 ? 47.480  -33.602  40.980  1.00 30.31  ? 134  LEU C CG  1 
ATOM   6338  C  CD1 . LEU C 1 131 ? 47.610  -32.809  42.277  1.00 28.61  ? 134  LEU C CD1 1 
ATOM   6339  C  CD2 . LEU C 1 131 ? 47.244  -32.661  39.798  1.00 29.40  ? 134  LEU C CD2 1 
ATOM   6340  N  N   . LEU C 1 132 ? 47.834  -37.527  40.884  1.00 35.69  ? 135  LEU C N   1 
ATOM   6341  C  CA  . LEU C 1 132 ? 46.812  -38.572  40.899  1.00 34.33  ? 135  LEU C CA  1 
ATOM   6342  C  C   . LEU C 1 132 ? 46.885  -39.378  42.180  1.00 32.33  ? 135  LEU C C   1 
ATOM   6343  O  O   . LEU C 1 132 ? 45.861  -39.601  42.816  1.00 32.94  ? 135  LEU C O   1 
ATOM   6344  C  CB  . LEU C 1 132 ? 46.893  -39.476  39.662  1.00 34.53  ? 135  LEU C CB  1 
ATOM   6345  C  CG  . LEU C 1 132 ? 45.828  -40.570  39.563  1.00 33.85  ? 135  LEU C CG  1 
ATOM   6346  C  CD1 . LEU C 1 132 ? 44.419  -39.977  39.462  1.00 32.78  ? 135  LEU C CD1 1 
ATOM   6347  C  CD2 . LEU C 1 132 ? 46.148  -41.479  38.375  1.00 33.96  ? 135  LEU C CD2 1 
ATOM   6348  N  N   . THR C 1 133 ? 48.085  -39.793  42.569  1.00 32.94  ? 136  THR C N   1 
ATOM   6349  C  CA  . THR C 1 133 ? 48.254  -40.562  43.811  1.00 34.79  ? 136  THR C CA  1 
ATOM   6350  C  C   . THR C 1 133 ? 47.721  -39.810  45.059  1.00 34.73  ? 136  THR C C   1 
ATOM   6351  O  O   . THR C 1 133 ? 46.905  -40.353  45.821  1.00 36.78  ? 136  THR C O   1 
ATOM   6352  C  CB  . THR C 1 133 ? 49.723  -41.015  43.993  1.00 36.18  ? 136  THR C CB  1 
ATOM   6353  O  OG1 . THR C 1 133 ? 50.153  -41.708  42.814  1.00 38.19  ? 136  THR C OG1 1 
ATOM   6354  C  CG2 . THR C 1 133 ? 49.863  -41.949  45.187  1.00 34.28  ? 136  THR C CG2 1 
ATOM   6355  N  N   . ASN C 1 134 ? 48.147  -38.559  45.249  1.00 33.72  ? 137  ASN C N   1 
ATOM   6356  C  CA  . ASN C 1 134 ? 47.671  -37.743  46.389  1.00 32.33  ? 137  ASN C CA  1 
ATOM   6357  C  C   . ASN C 1 134 ? 46.141  -37.658  46.418  1.00 30.42  ? 137  ASN C C   1 
ATOM   6358  O  O   . ASN C 1 134 ? 45.509  -38.029  47.416  1.00 30.25  ? 137  ASN C O   1 
ATOM   6359  C  CB  . ASN C 1 134 ? 48.247  -36.311  46.359  1.00 33.41  ? 137  ASN C CB  1 
ATOM   6360  C  CG  . ASN C 1 134 ? 49.766  -36.252  46.520  1.00 33.92  ? 137  ASN C CG  1 
ATOM   6361  O  OD1 . ASN C 1 134 ? 50.472  -37.265  46.527  1.00 34.74  ? 137  ASN C OD1 1 
ATOM   6362  N  ND2 . ASN C 1 134 ? 50.274  -35.041  46.621  1.00 33.90  ? 137  ASN C ND2 1 
ATOM   6363  N  N   . CYS C 1 135 ? 45.545  -37.184  45.317  1.00 27.99  ? 138  CYS C N   1 
ATOM   6364  C  CA  . CYS C 1 135 ? 44.102  -37.029  45.257  1.00 26.57  ? 138  CYS C CA  1 
ATOM   6365  C  C   . CYS C 1 135 ? 43.401  -38.346  45.567  1.00 26.70  ? 138  CYS C C   1 
ATOM   6366  O  O   . CYS C 1 135 ? 42.286  -38.339  46.104  1.00 27.96  ? 138  CYS C O   1 
ATOM   6367  C  CB  . CYS C 1 135 ? 43.645  -36.509  43.908  1.00 27.27  ? 138  CYS C CB  1 
ATOM   6368  S  SG  . CYS C 1 135 ? 44.137  -34.825  43.477  1.00 29.29  ? 138  CYS C SG  1 
ATOM   6369  N  N   . THR C 1 136 ? 44.053  -39.465  45.239  1.00 26.50  ? 139  THR C N   1 
ATOM   6370  C  CA  . THR C 1 136 ? 43.493  -40.807  45.493  1.00 26.97  ? 139  THR C CA  1 
ATOM   6371  C  C   . THR C 1 136 ? 43.573  -41.164  46.971  1.00 27.33  ? 139  THR C C   1 
ATOM   6372  O  O   . THR C 1 136 ? 42.639  -41.742  47.532  1.00 28.49  ? 139  THR C O   1 
ATOM   6373  C  CB  . THR C 1 136 ? 44.199  -41.908  44.657  1.00 26.06  ? 139  THR C CB  1 
ATOM   6374  O  OG1 . THR C 1 136 ? 44.128  -41.591  43.252  1.00 23.25  ? 139  THR C OG1 1 
ATOM   6375  C  CG2 . THR C 1 136 ? 43.572  -43.277  44.928  1.00 25.11  ? 139  THR C CG2 1 
ATOM   6376  N  N   . LEU C 1 137 ? 44.707  -40.839  47.587  1.00 30.15  ? 140  LEU C N   1 
ATOM   6377  C  CA  . LEU C 1 137 ? 44.881  -40.959  49.039  1.00 30.51  ? 140  LEU C CA  1 
ATOM   6378  C  C   . LEU C 1 137 ? 43.821  -40.166  49.793  1.00 30.09  ? 140  LEU C C   1 
ATOM   6379  O  O   . LEU C 1 137 ? 43.253  -40.647  50.781  1.00 31.56  ? 140  LEU C O   1 
ATOM   6380  C  CB  . LEU C 1 137 ? 46.269  -40.474  49.436  1.00 33.56  ? 140  LEU C CB  1 
ATOM   6381  C  CG  . LEU C 1 137 ? 47.454  -41.387  49.097  1.00 35.87  ? 140  LEU C CG  1 
ATOM   6382  C  CD1 . LEU C 1 137 ? 48.766  -40.627  49.236  1.00 33.99  ? 140  LEU C CD1 1 
ATOM   6383  C  CD2 . LEU C 1 137 ? 47.429  -42.619  49.999  1.00 35.08  ? 140  LEU C CD2 1 
ATOM   6384  N  N   . LEU C 1 138 ? 43.546  -38.955  49.310  1.00 30.64  ? 141  LEU C N   1 
ATOM   6385  C  CA  . LEU C 1 138 ? 42.498  -38.114  49.879  1.00 28.73  ? 141  LEU C CA  1 
ATOM   6386  C  C   . LEU C 1 138 ? 41.166  -38.845  49.885  1.00 27.56  ? 141  LEU C C   1 
ATOM   6387  O  O   . LEU C 1 138 ? 40.422  -38.786  50.872  1.00 25.11  ? 141  LEU C O   1 
ATOM   6388  C  CB  . LEU C 1 138 ? 42.388  -36.780  49.124  1.00 30.35  ? 141  LEU C CB  1 
ATOM   6389  C  CG  . LEU C 1 138 ? 43.499  -35.739  49.369  1.00 33.20  ? 141  LEU C CG  1 
ATOM   6390  C  CD1 . LEU C 1 138 ? 43.278  -34.483  48.531  1.00 33.03  ? 141  LEU C CD1 1 
ATOM   6391  C  CD2 . LEU C 1 138 ? 43.616  -35.385  50.850  1.00 31.21  ? 141  LEU C CD2 1 
ATOM   6392  N  N   . LEU C 1 139 ? 40.867  -39.546  48.786  1.00 27.39  ? 142  LEU C N   1 
ATOM   6393  C  CA  . LEU C 1 139 ? 39.636  -40.342  48.713  1.00 26.61  ? 142  LEU C CA  1 
ATOM   6394  C  C   . LEU C 1 139 ? 39.686  -41.529  49.678  1.00 25.31  ? 142  LEU C C   1 
ATOM   6395  O  O   . LEU C 1 139 ? 38.697  -41.839  50.332  1.00 23.46  ? 142  LEU C O   1 
ATOM   6396  C  CB  . LEU C 1 139 ? 39.372  -40.805  47.279  1.00 28.34  ? 142  LEU C CB  1 
ATOM   6397  C  CG  . LEU C 1 139 ? 38.226  -41.788  46.995  1.00 29.11  ? 142  LEU C CG  1 
ATOM   6398  C  CD1 . LEU C 1 139 ? 36.897  -41.366  47.615  1.00 27.51  ? 142  LEU C CD1 1 
ATOM   6399  C  CD2 . LEU C 1 139 ? 38.085  -41.917  45.483  1.00 28.67  ? 142  LEU C CD2 1 
ATOM   6400  N  N   . CYS C 1 140 ? 40.842  -42.177  49.757  1.00 26.70  ? 143  CYS C N   1 
ATOM   6401  C  CA  . CYS C 1 140 ? 41.053  -43.310  50.664  1.00 31.40  ? 143  CYS C CA  1 
ATOM   6402  C  C   . CYS C 1 140 ? 40.902  -42.916  52.145  1.00 31.94  ? 143  CYS C C   1 
ATOM   6403  O  O   . CYS C 1 140 ? 40.444  -43.722  52.976  1.00 28.93  ? 143  CYS C O   1 
ATOM   6404  C  CB  . CYS C 1 140 ? 42.432  -43.926  50.407  1.00 32.84  ? 143  CYS C CB  1 
ATOM   6405  S  SG  . CYS C 1 140 ? 42.499  -44.752  48.796  1.00 38.18  ? 143  CYS C SG  1 
ATOM   6406  N  N   . ARG C 1 141 ? 41.264  -41.668  52.454  1.00 31.76  ? 144  ARG C N   1 
ATOM   6407  C  CA  . ARG C 1 141 ? 41.045  -41.114  53.808  1.00 34.00  ? 144  ARG C CA  1 
ATOM   6408  C  C   . ARG C 1 141 ? 39.592  -40.770  54.139  1.00 32.95  ? 144  ARG C C   1 
ATOM   6409  O  O   . ARG C 1 141 ? 39.272  -40.568  55.299  1.00 33.66  ? 144  ARG C O   1 
ATOM   6410  C  CB  . ARG C 1 141 ? 41.979  -39.933  54.080  1.00 35.55  ? 144  ARG C CB  1 
ATOM   6411  C  CG  . ARG C 1 141 ? 43.399  -40.400  54.371  1.00 39.81  ? 144  ARG C CG  1 
ATOM   6412  C  CD  . ARG C 1 141 ? 44.434  -39.334  54.057  1.00 45.10  ? 144  ARG C CD  1 
ATOM   6413  N  NE  . ARG C 1 141 ? 45.774  -39.917  53.915  1.00 49.15  ? 144  ARG C NE  1 
ATOM   6414  C  CZ  . ARG C 1 141 ? 46.767  -39.362  53.218  1.00 51.29  ? 144  ARG C CZ  1 
ATOM   6415  N  NH1 . ARG C 1 141 ? 46.576  -38.209  52.589  1.00 51.97  ? 144  ARG C NH1 1 
ATOM   6416  N  NH2 . ARG C 1 141 ? 47.953  -39.962  53.139  1.00 53.07  ? 144  ARG C NH2 1 
ATOM   6417  N  N   . ARG C 1 142 ? 38.720  -40.709  53.131  1.00 32.31  ? 145  ARG C N   1 
ATOM   6418  C  CA  . ARG C 1 142 ? 37.256  -40.596  53.340  1.00 33.15  ? 145  ARG C CA  1 
ATOM   6419  C  C   . ARG C 1 142 ? 36.662  -39.281  53.894  1.00 34.02  ? 145  ARG C C   1 
ATOM   6420  O  O   . ARG C 1 142 ? 35.481  -39.244  54.262  1.00 36.14  ? 145  ARG C O   1 
ATOM   6421  C  CB  . ARG C 1 142 ? 36.752  -41.752  54.210  1.00 33.13  ? 145  ARG C CB  1 
ATOM   6422  C  CG  . ARG C 1 142 ? 36.558  -43.057  53.478  1.00 33.84  ? 145  ARG C CG  1 
ATOM   6423  C  CD  . ARG C 1 142 ? 35.953  -44.083  54.414  1.00 36.20  ? 145  ARG C CD  1 
ATOM   6424  N  NE  . ARG C 1 142 ? 35.499  -45.287  53.717  1.00 36.41  ? 145  ARG C NE  1 
ATOM   6425  C  CZ  . ARG C 1 142 ? 36.295  -46.273  53.302  1.00 37.75  ? 145  ARG C CZ  1 
ATOM   6426  N  NH1 . ARG C 1 142 ? 37.615  -46.222  53.487  1.00 34.09  ? 145  ARG C NH1 1 
ATOM   6427  N  NH2 . ARG C 1 142 ? 35.760  -47.324  52.694  1.00 39.76  ? 145  ARG C NH2 1 
ATOM   6428  N  N   . LEU C 1 143 ? 37.442  -38.211  53.953  1.00 32.01  ? 146  LEU C N   1 
ATOM   6429  C  CA  . LEU C 1 143 ? 36.927  -36.971  54.537  1.00 32.74  ? 146  LEU C CA  1 
ATOM   6430  C  C   . LEU C 1 143 ? 36.490  -35.995  53.463  1.00 32.09  ? 146  LEU C C   1 
ATOM   6431  O  O   . LEU C 1 143 ? 37.138  -35.889  52.420  1.00 33.30  ? 146  LEU C O   1 
ATOM   6432  C  CB  . LEU C 1 143 ? 37.961  -36.314  55.463  1.00 31.14  ? 146  LEU C CB  1 
ATOM   6433  C  CG  . LEU C 1 143 ? 38.476  -37.173  56.637  1.00 31.31  ? 146  LEU C CG  1 
ATOM   6434  C  CD1 . LEU C 1 143 ? 39.769  -36.610  57.229  1.00 30.89  ? 146  LEU C CD1 1 
ATOM   6435  C  CD2 . LEU C 1 143 ? 37.409  -37.354  57.702  1.00 31.43  ? 146  LEU C CD2 1 
ATOM   6436  N  N   . LEU C 1 144 ? 35.391  -35.295  53.747  1.00 31.92  ? 147  LEU C N   1 
ATOM   6437  C  CA  . LEU C 1 144 ? 34.769  -34.311  52.867  1.00 33.64  ? 147  LEU C CA  1 
ATOM   6438  C  C   . LEU C 1 144 ? 34.888  -32.850  53.393  1.00 36.02  ? 147  LEU C C   1 
ATOM   6439  O  O   . LEU C 1 144 ? 35.073  -32.636  54.582  1.00 35.85  ? 147  LEU C O   1 
ATOM   6440  C  CB  . LEU C 1 144 ? 33.295  -34.671  52.725  1.00 33.00  ? 147  LEU C CB  1 
ATOM   6441  C  CG  . LEU C 1 144 ? 32.793  -35.871  51.899  1.00 36.25  ? 147  LEU C CG  1 
ATOM   6442  C  CD1 . LEU C 1 144 ? 33.861  -36.743  51.222  1.00 34.66  ? 147  LEU C CD1 1 
ATOM   6443  C  CD2 . LEU C 1 144 ? 31.826  -36.693  52.731  1.00 33.68  ? 147  LEU C CD2 1 
ATOM   6444  N  N   . SER C 1 145 ? 34.799  -31.871  52.485  1.00 37.20  ? 148  SER C N   1 
ATOM   6445  C  CA  . SER C 1 145 ? 34.651  -30.448  52.805  1.00 35.60  ? 148  SER C CA  1 
ATOM   6446  C  C   . SER C 1 145 ? 33.520  -29.891  51.960  1.00 34.87  ? 148  SER C C   1 
ATOM   6447  O  O   . SER C 1 145 ? 33.380  -30.266  50.797  1.00 34.11  ? 148  SER C O   1 
ATOM   6448  C  CB  . SER C 1 145 ? 35.900  -29.652  52.446  1.00 36.69  ? 148  SER C CB  1 
ATOM   6449  O  OG  . SER C 1 145 ? 37.033  -30.131  53.134  1.00 42.89  ? 148  SER C OG  1 
ATOM   6450  N  N   . PRO C 1 146 ? 32.709  -28.984  52.533  1.00 33.63  ? 149  PRO C N   1 
ATOM   6451  C  CA  . PRO C 1 146 ? 31.741  -28.337  51.668  1.00 31.32  ? 149  PRO C CA  1 
ATOM   6452  C  C   . PRO C 1 146 ? 32.481  -27.365  50.741  1.00 31.28  ? 149  PRO C C   1 
ATOM   6453  O  O   . PRO C 1 146 ? 33.586  -26.939  51.067  1.00 29.48  ? 149  PRO C O   1 
ATOM   6454  C  CB  . PRO C 1 146 ? 30.797  -27.629  52.654  1.00 32.37  ? 149  PRO C CB  1 
ATOM   6455  C  CG  . PRO C 1 146 ? 31.597  -27.421  53.892  1.00 33.67  ? 149  PRO C CG  1 
ATOM   6456  C  CD  . PRO C 1 146 ? 32.647  -28.503  53.933  1.00 33.09  ? 149  PRO C CD  1 
ATOM   6457  N  N   . MET C 1 147 ? 31.914  -27.077  49.568  1.00 30.63  ? 150  MET C N   1 
ATOM   6458  C  CA  . MET C 1 147 ? 32.561  -26.200  48.601  1.00 30.49  ? 150  MET C CA  1 
ATOM   6459  C  C   . MET C 1 147 ? 31.560  -25.198  48.082  1.00 28.81  ? 150  MET C C   1 
ATOM   6460  O  O   . MET C 1 147 ? 30.364  -25.490  48.023  1.00 28.93  ? 150  MET C O   1 
ATOM   6461  C  CB  . MET C 1 147 ? 33.124  -26.982  47.400  1.00 33.97  ? 150  MET C CB  1 
ATOM   6462  C  CG  . MET C 1 147 ? 34.070  -28.140  47.694  1.00 36.87  ? 150  MET C CG  1 
ATOM   6463  S  SD  . MET C 1 147 ? 35.653  -27.848  48.526  1.00 46.17  ? 150  MET C SD  1 
ATOM   6464  C  CE  . MET C 1 147 ? 35.973  -26.116  48.261  1.00 43.43  ? 150  MET C CE  1 
ATOM   6465  N  N   . ASN C 1 148 ? 32.050  -24.026  47.689  1.00 26.16  ? 151  ASN C N   1 
ATOM   6466  C  CA  . ASN C 1 148 ? 31.197  -23.028  47.078  1.00 26.69  ? 151  ASN C CA  1 
ATOM   6467  C  C   . ASN C 1 148 ? 30.770  -23.429  45.659  1.00 27.20  ? 151  ASN C C   1 
ATOM   6468  O  O   . ASN C 1 148 ? 31.521  -24.090  44.937  1.00 27.30  ? 151  ASN C O   1 
ATOM   6469  C  CB  . ASN C 1 148 ? 31.906  -21.656  47.072  1.00 27.58  ? 151  ASN C CB  1 
ATOM   6470  C  CG  . ASN C 1 148 ? 32.259  -21.155  48.484  1.00 28.33  ? 151  ASN C CG  1 
ATOM   6471  O  OD1 . ASN C 1 148 ? 31.515  -21.385  49.454  1.00 29.09  ? 151  ASN C OD1 1 
ATOM   6472  N  ND2 . ASN C 1 148 ? 33.404  -20.472  48.602  1.00 25.64  ? 151  ASN C ND2 1 
ATOM   6473  N  N   . LEU C 1 149 ? 29.573  -23.014  45.261  1.00 27.31  ? 152  LEU C N   1 
ATOM   6474  C  CA  . LEU C 1 149 ? 29.091  -23.226  43.920  1.00 28.70  ? 152  LEU C CA  1 
ATOM   6475  C  C   . LEU C 1 149 ? 28.657  -21.883  43.328  1.00 29.69  ? 152  LEU C C   1 
ATOM   6476  O  O   . LEU C 1 149 ? 27.948  -21.114  43.993  1.00 29.46  ? 152  LEU C O   1 
ATOM   6477  C  CB  . LEU C 1 149 ? 27.886  -24.155  43.956  1.00 28.94  ? 152  LEU C CB  1 
ATOM   6478  C  CG  . LEU C 1 149 ? 27.595  -25.265  42.936  1.00 29.64  ? 152  LEU C CG  1 
ATOM   6479  C  CD1 . LEU C 1 149 ? 26.090  -25.390  42.749  1.00 27.34  ? 152  LEU C CD1 1 
ATOM   6480  C  CD2 . LEU C 1 149 ? 28.305  -25.135  41.592  1.00 28.80  ? 152  LEU C CD2 1 
ATOM   6481  N  N   . LEU C 1 150 ? 29.050  -21.620  42.080  1.00 28.96  ? 153  LEU C N   1 
ATOM   6482  C  CA  . LEU C 1 150 ? 28.672  -20.384  41.372  1.00 29.10  ? 153  LEU C CA  1 
ATOM   6483  C  C   . LEU C 1 150 ? 27.381  -20.601  40.573  1.00 30.55  ? 153  LEU C C   1 
ATOM   6484  O  O   . LEU C 1 150 ? 27.288  -21.546  39.783  1.00 31.91  ? 153  LEU C O   1 
ATOM   6485  C  CB  . LEU C 1 150 ? 29.802  -19.946  40.424  1.00 26.67  ? 153  LEU C CB  1 
ATOM   6486  C  CG  . LEU C 1 150 ? 30.163  -18.474  40.171  1.00 27.56  ? 153  LEU C CG  1 
ATOM   6487  C  CD1 . LEU C 1 150 ? 30.927  -18.345  38.869  1.00 25.63  ? 153  LEU C CD1 1 
ATOM   6488  C  CD2 . LEU C 1 150 ? 28.978  -17.509  40.208  1.00 26.09  ? 153  LEU C CD2 1 
ATOM   6489  N  N   . SER C 1 151 ? 26.385  -19.746  40.779  1.00 31.15  ? 154  SER C N   1 
ATOM   6490  C  CA  . SER C 1 151 ? 25.156  -19.798  39.999  1.00 33.29  ? 154  SER C CA  1 
ATOM   6491  C  C   . SER C 1 151 ? 25.250  -18.739  38.908  1.00 37.68  ? 154  SER C C   1 
ATOM   6492  O  O   . SER C 1 151 ? 25.550  -17.582  39.213  1.00 40.98  ? 154  SER C O   1 
ATOM   6493  C  CB  . SER C 1 151 ? 23.938  -19.553  40.902  1.00 34.69  ? 154  SER C CB  1 
ATOM   6494  O  OG  . SER C 1 151 ? 22.715  -19.516  40.170  1.00 32.80  ? 154  SER C OG  1 
ATOM   6495  N  N   . LEU C 1 152 ? 25.008  -19.127  37.647  1.00 37.34  ? 155  LEU C N   1 
ATOM   6496  C  CA  . LEU C 1 152 ? 25.163  -18.214  36.503  1.00 38.75  ? 155  LEU C CA  1 
ATOM   6497  C  C   . LEU C 1 152 ? 23.886  -17.996  35.712  1.00 40.67  ? 155  LEU C C   1 
ATOM   6498  O  O   . LEU C 1 152 ? 23.064  -18.896  35.593  1.00 42.46  ? 155  LEU C O   1 
ATOM   6499  C  CB  . LEU C 1 152 ? 26.242  -18.714  35.546  1.00 38.13  ? 155  LEU C CB  1 
ATOM   6500  C  CG  . LEU C 1 152 ? 27.659  -18.729  36.098  1.00 37.68  ? 155  LEU C CG  1 
ATOM   6501  C  CD1 . LEU C 1 152 ? 28.504  -19.724  35.320  1.00 36.25  ? 155  LEU C CD1 1 
ATOM   6502  C  CD2 . LEU C 1 152 ? 28.260  -17.327  36.070  1.00 36.50  ? 155  LEU C CD2 1 
ATOM   6503  N  N   . HIS C 1 153 ? 23.730  -16.794  35.169  1.00 43.86  ? 156  HIS C N   1 
ATOM   6504  C  CA  . HIS C 1 153 ? 22.607  -16.499  34.279  1.00 45.12  ? 156  HIS C CA  1 
ATOM   6505  C  C   . HIS C 1 153 ? 23.116  -15.858  33.033  1.00 45.98  ? 156  HIS C C   1 
ATOM   6506  O  O   . HIS C 1 153 ? 23.987  -14.987  33.091  1.00 47.62  ? 156  HIS C O   1 
ATOM   6507  C  CB  . HIS C 1 153 ? 21.574  -15.606  34.958  1.00 46.51  ? 156  HIS C CB  1 
ATOM   6508  C  CG  . HIS C 1 153 ? 20.886  -16.254  36.139  1.00 47.06  ? 156  HIS C CG  1 
ATOM   6509  N  ND1 . HIS C 1 153 ? 19.629  -16.740  36.070  1.00 46.94  ? 156  HIS C ND1 1 
ATOM   6510  C  CD2 . HIS C 1 153 ? 21.328  -16.486  37.444  1.00 48.00  ? 156  HIS C CD2 1 
ATOM   6511  C  CE1 . HIS C 1 153 ? 19.279  -17.253  37.270  1.00 48.22  ? 156  HIS C CE1 1 
ATOM   6512  N  NE2 . HIS C 1 153 ? 20.319  -17.097  38.109  1.00 48.95  ? 156  HIS C NE2 1 
ATOM   6513  N  N   . THR C 1 154 ? 22.596  -16.296  31.888  1.00 47.21  ? 157  THR C N   1 
ATOM   6514  C  CA  . THR C 1 154 ? 22.976  -15.704  30.611  1.00 48.97  ? 157  THR C CA  1 
ATOM   6515  C  C   . THR C 1 154 ? 21.843  -14.856  30.043  1.00 51.53  ? 157  THR C C   1 
ATOM   6516  O  O   . THR C 1 154 ? 20.676  -15.039  30.405  1.00 51.06  ? 157  THR C O   1 
ATOM   6517  C  CB  . THR C 1 154 ? 23.380  -16.766  29.555  1.00 48.78  ? 157  THR C CB  1 
ATOM   6518  O  OG1 . THR C 1 154 ? 22.219  -17.486  29.118  1.00 47.85  ? 157  THR C OG1 1 
ATOM   6519  C  CG2 . THR C 1 154 ? 24.441  -17.731  30.096  1.00 43.70  ? 157  THR C CG2 1 
ATOM   6520  N  N   . ALA C 1 155 ? 22.202  -13.944  29.139  1.00 54.36  ? 158  ALA C N   1 
ATOM   6521  C  CA  . ALA C 1 155 ? 21.241  -13.136  28.384  1.00 55.65  ? 158  ALA C CA  1 
ATOM   6522  C  C   . ALA C 1 155 ? 20.121  -13.985  27.793  1.00 55.54  ? 158  ALA C C   1 
ATOM   6523  O  O   . ALA C 1 155 ? 18.961  -13.584  27.812  1.00 58.77  ? 158  ALA C O   1 
ATOM   6524  C  CB  . ALA C 1 155 ? 21.950  -12.357  27.283  1.00 53.39  ? 158  ALA C CB  1 
ATOM   6525  N  N   . SER C 1 156 ? 20.476  -15.164  27.287  1.00 56.46  ? 159  SER C N   1 
ATOM   6526  C  CA  . SER C 1 156 ? 19.512  -16.080  26.671  1.00 54.44  ? 159  SER C CA  1 
ATOM   6527  C  C   . SER C 1 156 ? 18.545  -16.679  27.695  1.00 54.35  ? 159  SER C C   1 
ATOM   6528  O  O   . SER C 1 156 ? 17.536  -17.274  27.328  1.00 53.06  ? 159  SER C O   1 
ATOM   6529  C  CB  . SER C 1 156 ? 20.242  -17.185  25.900  1.00 53.76  ? 159  SER C CB  1 
ATOM   6530  O  OG  . SER C 1 156 ? 21.172  -17.857  26.729  1.00 53.64  ? 159  SER C OG  1 
ATOM   6531  N  N   . GLY C 1 157 ? 18.855  -16.511  28.978  1.00 54.01  ? 160  GLY C N   1 
ATOM   6532  C  CA  . GLY C 1 157 ? 17.984  -16.984  30.047  1.00 51.55  ? 160  GLY C CA  1 
ATOM   6533  C  C   . GLY C 1 157 ? 18.318  -18.399  30.461  1.00 50.68  ? 160  GLY C C   1 
ATOM   6534  O  O   . GLY C 1 157 ? 17.515  -19.074  31.103  1.00 53.58  ? 160  GLY C O   1 
ATOM   6535  N  N   . LEU C 1 158 ? 19.506  -18.853  30.088  1.00 47.34  ? 161  LEU C N   1 
ATOM   6536  C  CA  . LEU C 1 158 ? 19.985  -20.148  30.535  1.00 47.77  ? 161  LEU C CA  1 
ATOM   6537  C  C   . LEU C 1 158 ? 20.529  -19.996  31.946  1.00 47.52  ? 161  LEU C C   1 
ATOM   6538  O  O   . LEU C 1 158 ? 21.255  -19.036  32.250  1.00 43.28  ? 161  LEU C O   1 
ATOM   6539  C  CB  . LEU C 1 158 ? 21.094  -20.681  29.619  1.00 47.69  ? 161  LEU C CB  1 
ATOM   6540  C  CG  . LEU C 1 158 ? 21.671  -22.041  30.021  1.00 49.04  ? 161  LEU C CG  1 
ATOM   6541  C  CD1 . LEU C 1 158 ? 20.742  -23.161  29.573  1.00 51.61  ? 161  LEU C CD1 1 
ATOM   6542  C  CD2 . LEU C 1 158 ? 23.074  -22.246  29.468  1.00 48.71  ? 161  LEU C CD2 1 
ATOM   6543  N  N   . ARG C 1 159 ? 20.174  -20.948  32.799  1.00 44.71  ? 162  ARG C N   1 
ATOM   6544  C  CA  . ARG C 1 159 ? 20.791  -21.032  34.101  1.00 45.45  ? 162  ARG C CA  1 
ATOM   6545  C  C   . ARG C 1 159 ? 21.747  -22.227  34.188  1.00 43.76  ? 162  ARG C C   1 
ATOM   6546  O  O   . ARG C 1 159 ? 21.364  -23.359  33.877  1.00 45.80  ? 162  ARG C O   1 
ATOM   6547  C  CB  . ARG C 1 159 ? 19.728  -21.113  35.194  1.00 45.66  ? 162  ARG C CB  1 
ATOM   6548  C  CG  . ARG C 1 159 ? 20.267  -20.590  36.505  1.00 45.89  ? 162  ARG C CG  1 
ATOM   6549  C  CD  . ARG C 1 159 ? 19.563  -21.182  37.698  1.00 45.71  ? 162  ARG C CD  1 
ATOM   6550  N  NE  . ARG C 1 159 ? 20.302  -20.811  38.889  1.00 45.88  ? 162  ARG C NE  1 
ATOM   6551  C  CZ  . ARG C 1 159 ? 19.831  -20.891  40.124  1.00 47.09  ? 162  ARG C CZ  1 
ATOM   6552  N  NH1 . ARG C 1 159 ? 18.603  -21.344  40.351  1.00 49.38  ? 162  ARG C NH1 1 
ATOM   6553  N  NH2 . ARG C 1 159 ? 20.603  -20.523  41.133  1.00 47.95  ? 162  ARG C NH2 1 
ATOM   6554  N  N   . LEU C 1 160 ? 22.982  -21.976  34.614  1.00 39.68  ? 163  LEU C N   1 
ATOM   6555  C  CA  . LEU C 1 160 ? 23.956  -23.058  34.796  1.00 38.51  ? 163  LEU C CA  1 
ATOM   6556  C  C   . LEU C 1 160 ? 24.860  -22.870  36.027  1.00 36.61  ? 163  LEU C C   1 
ATOM   6557  O  O   . LEU C 1 160 ? 24.931  -21.782  36.599  1.00 38.36  ? 163  LEU C O   1 
ATOM   6558  C  CB  . LEU C 1 160 ? 24.798  -23.242  33.526  1.00 36.47  ? 163  LEU C CB  1 
ATOM   6559  C  CG  . LEU C 1 160 ? 25.857  -22.196  33.160  1.00 40.07  ? 163  LEU C CG  1 
ATOM   6560  C  CD1 . LEU C 1 160 ? 26.866  -22.802  32.194  1.00 39.17  ? 163  LEU C CD1 1 
ATOM   6561  C  CD2 . LEU C 1 160 ? 25.256  -20.916  32.576  1.00 39.55  ? 163  LEU C CD2 1 
ATOM   6562  N  N   . PHE C 1 161 ? 25.569  -23.926  36.406  1.00 32.53  ? 164  PHE C N   1 
ATOM   6563  C  CA  . PHE C 1 161 ? 26.404  -23.904  37.591  1.00 29.95  ? 164  PHE C CA  1 
ATOM   6564  C  C   . PHE C 1 161 ? 27.853  -24.143  37.291  1.00 28.42  ? 164  PHE C C   1 
ATOM   6565  O  O   . PHE C 1 161 ? 28.194  -24.788  36.320  1.00 31.52  ? 164  PHE C O   1 
ATOM   6566  C  CB  . PHE C 1 161 ? 25.875  -24.899  38.604  1.00 29.98  ? 164  PHE C CB  1 
ATOM   6567  C  CG  . PHE C 1 161 ? 24.475  -24.598  39.015  1.00 30.07  ? 164  PHE C CG  1 
ATOM   6568  C  CD1 . PHE C 1 161 ? 24.220  -23.618  39.960  1.00 30.04  ? 164  PHE C CD1 1 
ATOM   6569  C  CD2 . PHE C 1 161 ? 23.409  -25.241  38.408  1.00 30.55  ? 164  PHE C CD2 1 
ATOM   6570  C  CE1 . PHE C 1 161 ? 22.930  -23.308  40.316  1.00 29.71  ? 164  PHE C CE1 1 
ATOM   6571  C  CE2 . PHE C 1 161 ? 22.107  -24.937  38.756  1.00 31.09  ? 164  PHE C CE2 1 
ATOM   6572  C  CZ  . PHE C 1 161 ? 21.871  -23.969  39.719  1.00 31.96  ? 164  PHE C CZ  1 
ATOM   6573  N  N   . SER C 1 162 ? 28.707  -23.605  38.140  1.00 29.18  ? 165  SER C N   1 
ATOM   6574  C  CA  . SER C 1 162 ? 30.137  -23.547  37.882  1.00 28.96  ? 165  SER C CA  1 
ATOM   6575  C  C   . SER C 1 162 ? 30.852  -23.876  39.172  1.00 28.85  ? 165  SER C C   1 
ATOM   6576  O  O   . SER C 1 162 ? 30.570  -23.247  40.201  1.00 31.92  ? 165  SER C O   1 
ATOM   6577  C  CB  . SER C 1 162 ? 30.505  -22.140  37.418  1.00 27.65  ? 165  SER C CB  1 
ATOM   6578  O  OG  . SER C 1 162 ? 31.894  -21.907  37.553  1.00 30.37  ? 165  SER C OG  1 
ATOM   6579  N  N   . VAL C 1 163 ? 31.745  -24.863  39.137  1.00 26.46  ? 166  VAL C N   1 
ATOM   6580  C  CA  . VAL C 1 163 ? 32.461  -25.303  40.348  1.00 27.20  ? 166  VAL C CA  1 
ATOM   6581  C  C   . VAL C 1 163 ? 33.832  -24.642  40.514  1.00 27.13  ? 166  VAL C C   1 
ATOM   6582  O  O   . VAL C 1 163 ? 34.457  -24.777  41.558  1.00 28.38  ? 166  VAL C O   1 
ATOM   6583  C  CB  . VAL C 1 163 ? 32.658  -26.848  40.430  1.00 26.17  ? 166  VAL C CB  1 
ATOM   6584  C  CG1 . VAL C 1 163 ? 31.322  -27.568  40.517  1.00 24.86  ? 166  VAL C CG1 1 
ATOM   6585  C  CG2 . VAL C 1 163 ? 33.474  -27.362  39.246  1.00 27.39  ? 166  VAL C CG2 1 
ATOM   6586  N  N   . LEU C 1 164 ? 34.298  -23.940  39.488  1.00 26.40  ? 167  LEU C N   1 
ATOM   6587  C  CA  . LEU C 1 164 ? 35.686  -23.508  39.454  1.00 27.68  ? 167  LEU C CA  1 
ATOM   6588  C  C   . LEU C 1 164 ? 35.880  -22.079  38.921  1.00 29.00  ? 167  LEU C C   1 
ATOM   6589  O  O   . LEU C 1 164 ? 36.433  -21.217  39.621  1.00 26.81  ? 167  LEU C O   1 
ATOM   6590  C  CB  . LEU C 1 164 ? 36.510  -24.487  38.617  1.00 28.92  ? 167  LEU C CB  1 
ATOM   6591  C  CG  . LEU C 1 164 ? 37.964  -24.108  38.346  1.00 29.31  ? 167  LEU C CG  1 
ATOM   6592  C  CD1 . LEU C 1 164 ? 38.824  -24.496  39.544  1.00 29.27  ? 167  LEU C CD1 1 
ATOM   6593  C  CD2 . LEU C 1 164 ? 38.464  -24.743  37.056  1.00 28.64  ? 167  LEU C CD2 1 
ATOM   6594  N  N   . SER C 1 165 ? 35.439  -21.836  37.687  1.00 30.09  ? 168  SER C N   1 
ATOM   6595  C  CA  . SER C 1 165 ? 35.751  -20.570  37.040  1.00 30.85  ? 168  SER C CA  1 
ATOM   6596  C  C   . SER C 1 165 ? 34.802  -20.125  35.967  1.00 32.54  ? 168  SER C C   1 
ATOM   6597  O  O   . SER C 1 165 ? 34.020  -20.902  35.427  1.00 37.13  ? 168  SER C O   1 
ATOM   6598  C  CB  . SER C 1 165 ? 37.162  -20.576  36.470  1.00 30.81  ? 168  SER C CB  1 
ATOM   6599  O  OG  . SER C 1 165 ? 37.389  -21.745  35.720  1.00 34.45  ? 168  SER C OG  1 
ATOM   6600  N  N   . LEU C 1 166 ? 34.886  -18.837  35.686  1.00 33.73  ? 169  LEU C N   1 
ATOM   6601  C  CA  . LEU C 1 166 ? 34.307  -18.243  34.514  1.00 34.46  ? 169  LEU C CA  1 
ATOM   6602  C  C   . LEU C 1 166 ? 35.372  -17.268  34.012  1.00 36.65  ? 169  LEU C C   1 
ATOM   6603  O  O   . LEU C 1 166 ? 35.794  -16.364  34.747  1.00 38.09  ? 169  LEU C O   1 
ATOM   6604  C  CB  . LEU C 1 166 ? 32.984  -17.545  34.841  1.00 33.81  ? 169  LEU C CB  1 
ATOM   6605  C  CG  . LEU C 1 166 ? 32.304  -16.841  33.660  1.00 36.36  ? 169  LEU C CG  1 
ATOM   6606  C  CD1 . LEU C 1 166 ? 30.817  -17.127  33.635  1.00 38.82  ? 169  LEU C CD1 1 
ATOM   6607  C  CD2 . LEU C 1 166 ? 32.555  -15.335  33.642  1.00 35.46  ? 169  LEU C CD2 1 
ATOM   6608  N  N   . ALA C 1 167 ? 35.842  -17.494  32.783  1.00 37.15  ? 170  ALA C N   1 
ATOM   6609  C  CA  . ALA C 1 167 ? 36.820  -16.609  32.153  1.00 36.79  ? 170  ALA C CA  1 
ATOM   6610  C  C   . ALA C 1 167 ? 36.260  -15.973  30.894  1.00 38.98  ? 170  ALA C C   1 
ATOM   6611  O  O   . ALA C 1 167 ? 35.336  -16.503  30.268  1.00 38.73  ? 170  ALA C O   1 
ATOM   6612  C  CB  . ALA C 1 167 ? 38.117  -17.342  31.856  1.00 35.41  ? 170  ALA C CB  1 
ATOM   6613  N  N   . TRP C 1 168 ? 36.819  -14.818  30.547  1.00 42.11  ? 171  TRP C N   1 
ATOM   6614  C  CA  . TRP C 1 168 ? 36.402  -14.048  29.380  1.00 42.86  ? 171  TRP C CA  1 
ATOM   6615  C  C   . TRP C 1 168 ? 37.577  -13.234  28.977  1.00 42.72  ? 171  TRP C C   1 
ATOM   6616  O  O   . TRP C 1 168 ? 38.253  -12.648  29.822  1.00 42.40  ? 171  TRP C O   1 
ATOM   6617  C  CB  . TRP C 1 168 ? 35.232  -13.143  29.716  1.00 45.89  ? 171  TRP C CB  1 
ATOM   6618  C  CG  . TRP C 1 168 ? 34.871  -12.184  28.612  1.00 49.17  ? 171  TRP C CG  1 
ATOM   6619  C  CD1 . TRP C 1 168 ? 34.186  -12.465  27.429  1.00 51.08  ? 171  TRP C CD1 1 
ATOM   6620  C  CD2 . TRP C 1 168 ? 35.168  -10.746  28.548  1.00 52.23  ? 171  TRP C CD2 1 
ATOM   6621  N  NE1 . TRP C 1 168 ? 34.034  -11.333  26.666  1.00 52.86  ? 171  TRP C NE1 1 
ATOM   6622  C  CE2 . TRP C 1 168 ? 34.601  -10.265  27.275  1.00 53.22  ? 171  TRP C CE2 1 
ATOM   6623  C  CE3 . TRP C 1 168 ? 35.811  -9.835   29.390  1.00 51.27  ? 171  TRP C CE3 1 
ATOM   6624  C  CZ2 . TRP C 1 168 ? 34.695  -8.932   26.884  1.00 51.99  ? 171  TRP C CZ2 1 
ATOM   6625  C  CZ3 . TRP C 1 168 ? 35.899  -8.495   28.984  1.00 51.46  ? 171  TRP C CZ3 1 
ATOM   6626  C  CH2 . TRP C 1 168 ? 35.359  -8.056   27.759  1.00 51.48  ? 171  TRP C CH2 1 
ATOM   6627  N  N   . GLY C 1 169 ? 37.863  -13.215  27.682  1.00 41.55  ? 172  GLY C N   1 
ATOM   6628  C  CA  . GLY C 1 169 ? 39.072  -12.575  27.212  1.00 40.54  ? 172  GLY C CA  1 
ATOM   6629  C  C   . GLY C 1 169 ? 40.223  -13.547  27.044  1.00 40.65  ? 172  GLY C C   1 
ATOM   6630  O  O   . GLY C 1 169 ? 40.020  -14.700  26.655  1.00 42.09  ? 172  GLY C O   1 
ATOM   6631  N  N   . PHE C 1 170 ? 41.434  -13.083  27.338  1.00 37.86  ? 173  PHE C N   1 
ATOM   6632  C  CA  . PHE C 1 170 ? 42.640  -13.846  27.064  1.00 36.30  ? 173  PHE C CA  1 
ATOM   6633  C  C   . PHE C 1 170 ? 42.482  -15.330  27.407  1.00 37.47  ? 173  PHE C C   1 
ATOM   6634  O  O   . PHE C 1 170 ? 42.635  -16.184  26.535  1.00 37.10  ? 173  PHE C O   1 
ATOM   6635  C  CB  . PHE C 1 170 ? 43.833  -13.241  27.800  1.00 34.13  ? 173  PHE C CB  1 
ATOM   6636  C  CG  . PHE C 1 170 ? 45.154  -13.882  27.462  1.00 34.69  ? 173  PHE C CG  1 
ATOM   6637  C  CD1 . PHE C 1 170 ? 45.565  -15.055  28.100  1.00 33.44  ? 173  PHE C CD1 1 
ATOM   6638  C  CD2 . PHE C 1 170 ? 46.015  -13.296  26.526  1.00 34.78  ? 173  PHE C CD2 1 
ATOM   6639  C  CE1 . PHE C 1 170 ? 46.792  -15.637  27.802  1.00 34.00  ? 173  PHE C CE1 1 
ATOM   6640  C  CE2 . PHE C 1 170 ? 47.253  -13.878  26.227  1.00 34.51  ? 173  PHE C CE2 1 
ATOM   6641  C  CZ  . PHE C 1 170 ? 47.640  -15.052  26.867  1.00 35.07  ? 173  PHE C CZ  1 
ATOM   6642  N  N   . ILE C 1 171 ? 42.160  -15.623  28.665  1.00 36.37  ? 174  ILE C N   1 
ATOM   6643  C  CA  . ILE C 1 171 ? 42.104  -16.996  29.162  1.00 37.43  ? 174  ILE C CA  1 
ATOM   6644  C  C   . ILE C 1 171 ? 41.083  -17.832  28.403  1.00 36.99  ? 174  ILE C C   1 
ATOM   6645  O  O   . ILE C 1 171 ? 41.378  -18.953  27.999  1.00 35.84  ? 174  ILE C O   1 
ATOM   6646  C  CB  . ILE C 1 171 ? 41.787  -17.038  30.670  1.00 37.74  ? 174  ILE C CB  1 
ATOM   6647  C  CG1 . ILE C 1 171 ? 42.857  -16.284  31.472  1.00 39.07  ? 174  ILE C CG1 1 
ATOM   6648  C  CG2 . ILE C 1 171 ? 41.640  -18.477  31.153  1.00 38.76  ? 174  ILE C CG2 1 
ATOM   6649  C  CD1 . ILE C 1 171 ? 42.539  -16.126  32.956  1.00 37.76  ? 174  ILE C CD1 1 
ATOM   6650  N  N   . ALA C 1 172 ? 39.884  -17.282  28.215  1.00 37.24  ? 175  ALA C N   1 
ATOM   6651  C  CA  . ALA C 1 172 ? 38.832  -17.968  27.462  1.00 39.78  ? 175  ALA C CA  1 
ATOM   6652  C  C   . ALA C 1 172 ? 39.277  -18.287  26.031  1.00 42.25  ? 175  ALA C C   1 
ATOM   6653  O  O   . ALA C 1 172 ? 38.968  -19.363  25.504  1.00 44.12  ? 175  ALA C O   1 
ATOM   6654  C  CB  . ALA C 1 172 ? 37.544  -17.151  27.454  1.00 39.39  ? 175  ALA C CB  1 
ATOM   6655  N  N   . ASP C 1 173 ? 40.011  -17.357  25.415  1.00 42.23  ? 176  ASP C N   1 
ATOM   6656  C  CA  . ASP C 1 173 ? 40.518  -17.555  24.063  1.00 43.41  ? 176  ASP C CA  1 
ATOM   6657  C  C   . ASP C 1 173 ? 41.609  -18.628  24.006  1.00 42.36  ? 176  ASP C C   1 
ATOM   6658  O  O   . ASP C 1 173 ? 41.651  -19.412  23.053  1.00 45.23  ? 176  ASP C O   1 
ATOM   6659  C  CB  . ASP C 1 173 ? 40.998  -16.236  23.437  1.00 46.92  ? 176  ASP C CB  1 
ATOM   6660  C  CG  . ASP C 1 173 ? 39.844  -15.334  22.979  1.00 50.08  ? 176  ASP C CG  1 
ATOM   6661  O  OD1 . ASP C 1 173 ? 38.662  -15.645  23.255  1.00 54.72  ? 176  ASP C OD1 1 
ATOM   6662  O  OD2 . ASP C 1 173 ? 40.123  -14.299  22.334  1.00 52.28  ? 176  ASP C OD2 1 
ATOM   6663  N  N   . VAL C 1 174 ? 42.479  -18.682  25.011  1.00 38.74  ? 177  VAL C N   1 
ATOM   6664  C  CA  . VAL C 1 174 ? 43.479  -19.751  25.056  1.00 39.07  ? 177  VAL C CA  1 
ATOM   6665  C  C   . VAL C 1 174 ? 42.812  -21.120  25.250  1.00 41.83  ? 177  VAL C C   1 
ATOM   6666  O  O   . VAL C 1 174 ? 43.280  -22.122  24.716  1.00 42.21  ? 177  VAL C O   1 
ATOM   6667  C  CB  . VAL C 1 174 ? 44.533  -19.539  26.145  1.00 37.13  ? 177  VAL C CB  1 
ATOM   6668  C  CG1 . VAL C 1 174 ? 45.499  -20.711  26.176  1.00 40.59  ? 177  VAL C CG1 1 
ATOM   6669  C  CG2 . VAL C 1 174 ? 45.307  -18.262  25.909  1.00 37.69  ? 177  VAL C CG2 1 
ATOM   6670  N  N   . ASP C 1 175 ? 41.716  -21.154  26.006  1.00 44.18  ? 178  ASP C N   1 
ATOM   6671  C  CA  . ASP C 1 175 ? 40.983  -22.400  26.264  1.00 44.26  ? 178  ASP C CA  1 
ATOM   6672  C  C   . ASP C 1 175 ? 40.311  -22.990  25.010  1.00 43.35  ? 178  ASP C C   1 
ATOM   6673  O  O   . ASP C 1 175 ? 40.366  -24.199  24.787  1.00 44.14  ? 178  ASP C O   1 
ATOM   6674  C  CB  . ASP C 1 175 ? 39.961  -22.196  27.392  1.00 44.93  ? 178  ASP C CB  1 
ATOM   6675  C  CG  . ASP C 1 175 ? 40.579  -22.313  28.792  1.00 44.17  ? 178  ASP C CG  1 
ATOM   6676  O  OD1 . ASP C 1 175 ? 39.795  -22.476  29.749  1.00 45.59  ? 178  ASP C OD1 1 
ATOM   6677  O  OD2 . ASP C 1 175 ? 41.821  -22.254  28.948  1.00 42.37  ? 178  ASP C OD2 1 
ATOM   6678  N  N   . LEU C 1 176 ? 39.681  -22.140  24.202  1.00 44.66  ? 179  LEU C N   1 
ATOM   6679  C  CA  . LEU C 1 176 ? 39.066  -22.577  22.946  1.00 45.44  ? 179  LEU C CA  1 
ATOM   6680  C  C   . LEU C 1 176 ? 40.130  -22.918  21.887  1.00 47.90  ? 179  LEU C C   1 
ATOM   6681  O  O   . LEU C 1 176 ? 40.086  -24.003  21.308  1.00 47.53  ? 179  LEU C O   1 
ATOM   6682  C  CB  . LEU C 1 176 ? 38.096  -21.519  22.405  1.00 44.74  ? 179  LEU C CB  1 
ATOM   6683  C  CG  . LEU C 1 176 ? 36.786  -21.907  21.688  1.00 46.49  ? 179  LEU C CG  1 
ATOM   6684  C  CD1 . LEU C 1 176 ? 36.554  -21.006  20.480  1.00 44.10  ? 179  LEU C CD1 1 
ATOM   6685  C  CD2 . LEU C 1 176 ? 36.645  -23.387  21.308  1.00 44.67  ? 179  LEU C CD2 1 
ATOM   6686  N  N   . GLU C 1 177 ? 41.076  -22.002  21.643  1.00 49.36  ? 180  GLU C N   1 
ATOM   6687  C  CA  . GLU C 1 177 ? 42.158  -22.230  20.674  1.00 53.52  ? 180  GLU C CA  1 
ATOM   6688  C  C   . GLU C 1 177 ? 43.059  -23.417  21.048  1.00 55.72  ? 180  GLU C C   1 
ATOM   6689  O  O   . GLU C 1 177 ? 43.598  -24.085  20.165  1.00 56.72  ? 180  GLU C O   1 
ATOM   6690  C  CB  . GLU C 1 177 ? 42.989  -20.953  20.399  1.00 58.68  ? 180  GLU C CB  1 
ATOM   6691  C  CG  . GLU C 1 177 ? 44.484  -21.216  20.130  1.00 64.31  ? 180  GLU C CG  1 
ATOM   6692  C  CD  . GLU C 1 177 ? 45.134  -20.328  19.061  1.00 65.76  ? 180  GLU C CD  1 
ATOM   6693  O  OE1 . GLU C 1 177 ? 44.511  -20.076  18.002  1.00 67.90  ? 180  GLU C OE1 1 
ATOM   6694  O  OE2 . GLU C 1 177 ? 46.299  -19.911  19.264  1.00 63.02  ? 180  GLU C OE2 1 
ATOM   6695  N  N   . SER C 1 178 ? 43.222  -23.676  22.343  1.00 55.28  ? 181  SER C N   1 
ATOM   6696  C  CA  . SER C 1 178 ? 43.986  -24.832  22.794  1.00 56.66  ? 181  SER C CA  1 
ATOM   6697  C  C   . SER C 1 178 ? 43.313  -26.145  22.363  1.00 57.77  ? 181  SER C C   1 
ATOM   6698  O  O   . SER C 1 178 ? 42.079  -26.270  22.374  1.00 55.97  ? 181  SER C O   1 
ATOM   6699  C  CB  . SER C 1 178 ? 44.162  -24.792  24.305  1.00 56.26  ? 181  SER C CB  1 
ATOM   6700  O  OG  . SER C 1 178 ? 45.512  -24.990  24.637  1.00 55.30  ? 181  SER C OG  1 
ATOM   6701  N  N   . GLU C 1 179 ? 44.146  -27.108  21.974  1.00 59.54  ? 182  GLU C N   1 
ATOM   6702  C  CA  . GLU C 1 179 ? 43.716  -28.366  21.339  1.00 62.38  ? 182  GLU C CA  1 
ATOM   6703  C  C   . GLU C 1 179 ? 45.008  -29.059  20.892  1.00 63.33  ? 182  GLU C C   1 
ATOM   6704  O  O   . GLU C 1 179 ? 45.486  -28.860  19.775  1.00 55.71  ? 182  GLU C O   1 
ATOM   6705  C  CB  . GLU C 1 179 ? 42.705  -28.113  20.187  1.00 60.25  ? 182  GLU C CB  1 
ATOM   6706  C  CG  . GLU C 1 179 ? 43.138  -28.347  18.729  1.00 63.32  ? 182  GLU C CG  1 
ATOM   6707  C  CD  . GLU C 1 179 ? 44.090  -27.299  18.141  1.00 62.12  ? 182  GLU C CD  1 
ATOM   6708  O  OE1 . GLU C 1 179 ? 45.322  -27.451  18.299  1.00 62.13  ? 182  GLU C OE1 1 
ATOM   6709  O  OE2 . GLU C 1 179 ? 43.626  -26.352  17.470  1.00 57.75  ? 182  GLU C OE2 1 
ATOM   6710  N  N   . LYS C 1 180 ? 45.610  -29.820  21.807  1.00 67.00  ? 183  LYS C N   1 
ATOM   6711  C  CA  . LYS C 1 180 ? 46.942  -30.395  21.584  1.00 68.23  ? 183  LYS C CA  1 
ATOM   6712  C  C   . LYS C 1 180 ? 47.507  -31.116  22.806  1.00 76.31  ? 183  LYS C C   1 
ATOM   6713  O  O   . LYS C 1 180 ? 48.723  -31.129  23.021  1.00 79.80  ? 183  LYS C O   1 
ATOM   6714  C  CB  . LYS C 1 180 ? 47.935  -29.343  21.045  1.00 63.72  ? 183  LYS C CB  1 
ATOM   6715  C  CG  . LYS C 1 180 ? 48.008  -28.025  21.805  1.00 60.36  ? 183  LYS C CG  1 
ATOM   6716  C  CD  . LYS C 1 180 ? 47.876  -26.839  20.851  1.00 57.26  ? 183  LYS C CD  1 
ATOM   6717  C  CE  . LYS C 1 180 ? 48.255  -25.530  21.530  1.00 54.74  ? 183  LYS C CE  1 
ATOM   6718  N  NZ  . LYS C 1 180 ? 47.695  -24.333  20.844  1.00 52.50  ? 183  LYS C NZ  1 
ATOM   6719  N  N   . TYR C 1 181 ? 46.616  -31.732  23.584  1.00 77.62  ? 184  TYR C N   1 
ATOM   6720  C  CA  . TYR C 1 181 ? 46.993  -32.588  24.725  1.00 83.80  ? 184  TYR C CA  1 
ATOM   6721  C  C   . TYR C 1 181 ? 48.015  -32.021  25.735  1.00 83.89  ? 184  TYR C C   1 
ATOM   6722  O  O   . TYR C 1 181 ? 47.626  -31.410  26.737  1.00 85.89  ? 184  TYR C O   1 
ATOM   6723  C  CB  . TYR C 1 181 ? 47.405  -34.003  24.268  1.00 88.55  ? 184  TYR C CB  1 
ATOM   6724  C  CG  . TYR C 1 181 ? 47.884  -34.152  22.831  1.00 92.26  ? 184  TYR C CG  1 
ATOM   6725  C  CD1 . TYR C 1 181 ? 46.973  -34.354  21.789  1.00 93.86  ? 184  TYR C CD1 1 
ATOM   6726  C  CD2 . TYR C 1 181 ? 49.248  -34.131  22.519  1.00 92.46  ? 184  TYR C CD2 1 
ATOM   6727  C  CE1 . TYR C 1 181 ? 47.402  -34.509  20.477  1.00 95.00  ? 184  TYR C CE1 1 
ATOM   6728  C  CE2 . TYR C 1 181 ? 49.685  -34.284  21.208  1.00 95.31  ? 184  TYR C CE2 1 
ATOM   6729  C  CZ  . TYR C 1 181 ? 48.758  -34.474  20.191  1.00 93.85  ? 184  TYR C CZ  1 
ATOM   6730  O  OH  . TYR C 1 181 ? 49.176  -34.631  18.890  1.00 91.10  ? 184  TYR C OH  1 
ATOM   6731  N  N   . ARG C 1 182 ? 49.305  -32.238  25.476  1.00 78.88  ? 185  ARG C N   1 
ATOM   6732  C  CA  . ARG C 1 182 ? 50.374  -31.706  26.321  1.00 74.78  ? 185  ARG C CA  1 
ATOM   6733  C  C   . ARG C 1 182 ? 51.452  -31.011  25.490  1.00 75.55  ? 185  ARG C C   1 
ATOM   6734  O  O   . ARG C 1 182 ? 51.251  -30.704  24.311  1.00 72.26  ? 185  ARG C O   1 
ATOM   6735  C  CB  . ARG C 1 182 ? 50.983  -32.806  27.179  1.00 72.78  ? 185  ARG C CB  1 
ATOM   6736  N  N   . MET C 1 187 ? 52.585  -27.721  28.042  1.00 61.33  ? 190  MET C N   1 
ATOM   6737  C  CA  . MET C 1 187 ? 51.159  -28.032  28.026  1.00 59.41  ? 190  MET C CA  1 
ATOM   6738  C  C   . MET C 1 187 ? 50.411  -27.163  27.016  1.00 57.39  ? 190  MET C C   1 
ATOM   6739  O  O   . MET C 1 187 ? 50.852  -26.060  26.688  1.00 56.42  ? 190  MET C O   1 
ATOM   6740  C  CB  . MET C 1 187 ? 50.561  -27.851  29.426  1.00 63.90  ? 190  MET C CB  1 
ATOM   6741  C  CG  . MET C 1 187 ? 49.205  -28.513  29.625  1.00 69.30  ? 190  MET C CG  1 
ATOM   6742  S  SD  . MET C 1 187 ? 49.137  -30.263  29.144  1.00 81.68  ? 190  MET C SD  1 
ATOM   6743  C  CE  . MET C 1 187 ? 49.717  -31.081  30.631  1.00 76.56  ? 190  MET C CE  1 
ATOM   6744  N  N   . ARG C 1 188 ? 49.275  -27.659  26.528  1.00 54.83  ? 191  ARG C N   1 
ATOM   6745  C  CA  . ARG C 1 188 ? 48.426  -26.886  25.621  1.00 52.85  ? 191  ARG C CA  1 
ATOM   6746  C  C   . ARG C 1 188 ? 48.178  -25.445  26.118  1.00 52.28  ? 191  ARG C C   1 
ATOM   6747  O  O   . ARG C 1 188 ? 48.012  -24.526  25.309  1.00 49.80  ? 191  ARG C O   1 
ATOM   6748  C  CB  . ARG C 1 188 ? 47.104  -27.620  25.319  1.00 52.39  ? 191  ARG C CB  1 
ATOM   6749  C  CG  . ARG C 1 188 ? 46.133  -27.764  26.490  1.00 55.49  ? 191  ARG C CG  1 
ATOM   6750  C  CD  . ARG C 1 188 ? 44.927  -28.613  26.110  1.00 56.96  ? 191  ARG C CD  1 
ATOM   6751  N  NE  . ARG C 1 188 ? 43.778  -28.394  26.994  1.00 62.43  ? 191  ARG C NE  1 
ATOM   6752  C  CZ  . ARG C 1 188 ? 42.628  -27.810  26.635  1.00 64.40  ? 191  ARG C CZ  1 
ATOM   6753  N  NH1 . ARG C 1 188 ? 42.434  -27.379  25.395  1.00 64.43  ? 191  ARG C NH1 1 
ATOM   6754  N  NH2 . ARG C 1 188 ? 41.650  -27.667  27.521  1.00 63.08  ? 191  ARG C NH2 1 
ATOM   6755  N  N   . PHE C 1 189 ? 48.182  -25.248  27.438  1.00 50.15  ? 192  PHE C N   1 
ATOM   6756  C  CA  . PHE C 1 189 ? 47.882  -23.928  28.016  1.00 50.50  ? 192  PHE C CA  1 
ATOM   6757  C  C   . PHE C 1 189 ? 49.064  -22.973  27.948  1.00 49.17  ? 192  PHE C C   1 
ATOM   6758  O  O   . PHE C 1 189 ? 48.881  -21.767  27.780  1.00 48.28  ? 192  PHE C O   1 
ATOM   6759  C  CB  . PHE C 1 189 ? 47.340  -24.050  29.448  1.00 50.27  ? 192  PHE C CB  1 
ATOM   6760  C  CG  . PHE C 1 189 ? 46.083  -24.870  29.542  1.00 49.63  ? 192  PHE C CG  1 
ATOM   6761  C  CD1 . PHE C 1 189 ? 44.921  -24.468  28.881  1.00 48.07  ? 192  PHE C CD1 1 
ATOM   6762  C  CD2 . PHE C 1 189 ? 46.065  -26.055  30.271  1.00 49.03  ? 192  PHE C CD2 1 
ATOM   6763  C  CE1 . PHE C 1 189 ? 43.768  -25.231  28.950  1.00 48.71  ? 192  PHE C CE1 1 
ATOM   6764  C  CE2 . PHE C 1 189 ? 44.912  -26.818  30.346  1.00 46.22  ? 192  PHE C CE2 1 
ATOM   6765  C  CZ  . PHE C 1 189 ? 43.768  -26.407  29.685  1.00 47.93  ? 192  PHE C CZ  1 
ATOM   6766  N  N   . THR C 1 190 ? 50.265  -23.533  28.058  1.00 49.08  ? 193  THR C N   1 
ATOM   6767  C  CA  . THR C 1 190 ? 51.510  -22.795  27.903  1.00 49.95  ? 193  THR C CA  1 
ATOM   6768  C  C   . THR C 1 190 ? 51.721  -22.287  26.465  1.00 53.64  ? 193  THR C C   1 
ATOM   6769  O  O   . THR C 1 190 ? 51.726  -21.065  26.240  1.00 47.96  ? 193  THR C O   1 
ATOM   6770  C  CB  . THR C 1 190 ? 52.693  -23.661  28.351  1.00 51.78  ? 193  THR C CB  1 
ATOM   6771  O  OG1 . THR C 1 190 ? 52.622  -23.837  29.771  1.00 52.44  ? 193  THR C OG1 1 
ATOM   6772  C  CG2 . THR C 1 190 ? 54.018  -23.012  27.984  1.00 51.67  ? 193  THR C CG2 1 
ATOM   6773  N  N   . LEU C 1 191 ? 51.891  -23.208  25.504  1.00 51.69  ? 194  LEU C N   1 
ATOM   6774  C  CA  . LEU C 1 191 ? 52.072  -22.805  24.111  1.00 51.68  ? 194  LEU C CA  1 
ATOM   6775  C  C   . LEU C 1 191 ? 50.918  -21.904  23.715  1.00 51.14  ? 194  LEU C C   1 
ATOM   6776  O  O   . LEU C 1 191 ? 51.123  -20.856  23.095  1.00 51.97  ? 194  LEU C O   1 
ATOM   6777  C  CB  . LEU C 1 191 ? 52.164  -24.009  23.149  1.00 54.40  ? 194  LEU C CB  1 
ATOM   6778  C  CG  . LEU C 1 191 ? 52.058  -23.726  21.623  1.00 54.35  ? 194  LEU C CG  1 
ATOM   6779  C  CD1 . LEU C 1 191 ? 53.179  -22.834  21.093  1.00 53.55  ? 194  LEU C CD1 1 
ATOM   6780  C  CD2 . LEU C 1 191 ? 51.979  -25.002  20.786  1.00 54.98  ? 194  LEU C CD2 1 
ATOM   6781  N  N   . GLY C 1 192 ? 49.710  -22.317  24.096  1.00 49.19  ? 195  GLY C N   1 
ATOM   6782  C  CA  . GLY C 1 192 ? 48.496  -21.561  23.798  1.00 50.57  ? 195  GLY C CA  1 
ATOM   6783  C  C   . GLY C 1 192 ? 48.577  -20.120  24.271  1.00 50.30  ? 195  GLY C C   1 
ATOM   6784  O  O   . GLY C 1 192 ? 48.127  -19.213  23.570  1.00 47.04  ? 195  GLY C O   1 
ATOM   6785  N  N   . THR C 1 193 ? 49.164  -19.917  25.456  1.00 48.06  ? 196  THR C N   1 
ATOM   6786  C  CA  . THR C 1 193 ? 49.371  -18.574  25.997  1.00 49.17  ? 196  THR C CA  1 
ATOM   6787  C  C   . THR C 1 193 ? 50.456  -17.805  25.228  1.00 47.60  ? 196  THR C C   1 
ATOM   6788  O  O   . THR C 1 193 ? 50.215  -16.684  24.776  1.00 43.05  ? 196  THR C O   1 
ATOM   6789  C  CB  . THR C 1 193 ? 49.574  -18.586  27.541  1.00 49.81  ? 196  THR C CB  1 
ATOM   6790  O  OG1 . THR C 1 193 ? 48.333  -18.245  28.167  1.00 51.51  ? 196  THR C OG1 1 
ATOM   6791  C  CG2 . THR C 1 193 ? 50.615  -17.586  28.006  1.00 48.77  ? 196  THR C CG2 1 
ATOM   6792  N  N   . PHE C 1 194 ? 51.621  -18.420  25.048  1.00 47.90  ? 197  PHE C N   1 
ATOM   6793  C  CA  . PHE C 1 194 ? 52.681  -17.795  24.259  1.00 49.82  ? 197  PHE C CA  1 
ATOM   6794  C  C   . PHE C 1 194 ? 52.163  -17.269  22.927  1.00 49.58  ? 197  PHE C C   1 
ATOM   6795  O  O   . PHE C 1 194 ? 52.546  -16.183  22.497  1.00 48.32  ? 197  PHE C O   1 
ATOM   6796  C  CB  . PHE C 1 194 ? 53.831  -18.760  24.033  1.00 47.47  ? 197  PHE C CB  1 
ATOM   6797  C  CG  . PHE C 1 194 ? 54.494  -19.199  25.292  1.00 49.37  ? 197  PHE C CG  1 
ATOM   6798  C  CD1 . PHE C 1 194 ? 54.300  -18.496  26.480  1.00 49.93  ? 197  PHE C CD1 1 
ATOM   6799  C  CD2 . PHE C 1 194 ? 55.329  -20.312  25.297  1.00 51.84  ? 197  PHE C CD2 1 
ATOM   6800  C  CE1 . PHE C 1 194 ? 54.918  -18.903  27.653  1.00 50.15  ? 197  PHE C CE1 1 
ATOM   6801  C  CE2 . PHE C 1 194 ? 55.955  -20.721  26.466  1.00 51.18  ? 197  PHE C CE2 1 
ATOM   6802  C  CZ  . PHE C 1 194 ? 55.748  -20.016  27.646  1.00 50.42  ? 197  PHE C CZ  1 
ATOM   6803  N  N   . LEU C 1 195 ? 51.272  -18.040  22.305  1.00 48.54  ? 198  LEU C N   1 
ATOM   6804  C  CA  . LEU C 1 195 ? 50.640  -17.674  21.037  1.00 49.36  ? 198  LEU C CA  1 
ATOM   6805  C  C   . LEU C 1 195 ? 49.719  -16.440  21.173  1.00 48.55  ? 198  LEU C C   1 
ATOM   6806  O  O   . LEU C 1 195 ? 49.759  -15.526  20.347  1.00 43.70  ? 198  LEU C O   1 
ATOM   6807  C  CB  . LEU C 1 195 ? 49.859  -18.882  20.502  1.00 50.52  ? 198  LEU C CB  1 
ATOM   6808  C  CG  . LEU C 1 195 ? 50.007  -19.453  19.087  1.00 52.43  ? 198  LEU C CG  1 
ATOM   6809  C  CD1 . LEU C 1 195 ? 51.443  -19.483  18.567  1.00 52.08  ? 198  LEU C CD1 1 
ATOM   6810  C  CD2 . LEU C 1 195 ? 49.426  -20.855  19.105  1.00 51.39  ? 198  LEU C CD2 1 
ATOM   6811  N  N   . ARG C 1 196 ? 48.890  -16.420  22.215  1.00 50.31  ? 199  ARG C N   1 
ATOM   6812  C  CA  . ARG C 1 196 ? 48.008  -15.278  22.474  1.00 50.84  ? 199  ARG C CA  1 
ATOM   6813  C  C   . ARG C 1 196 ? 48.765  -14.038  22.955  1.00 49.09  ? 199  ARG C C   1 
ATOM   6814  O  O   . ARG C 1 196 ? 48.345  -12.912  22.687  1.00 49.81  ? 199  ARG C O   1 
ATOM   6815  C  CB  . ARG C 1 196 ? 46.927  -15.644  23.488  1.00 51.24  ? 199  ARG C CB  1 
ATOM   6816  C  CG  . ARG C 1 196 ? 45.629  -16.136  22.886  1.00 55.44  ? 199  ARG C CG  1 
ATOM   6817  C  CD  . ARG C 1 196 ? 44.662  -14.996  22.610  1.00 56.33  ? 199  ARG C CD  1 
ATOM   6818  N  NE  . ARG C 1 196 ? 45.018  -14.210  21.431  1.00 58.23  ? 199  ARG C NE  1 
ATOM   6819  C  CZ  . ARG C 1 196 ? 44.851  -14.602  20.165  1.00 62.05  ? 199  ARG C CZ  1 
ATOM   6820  N  NH1 . ARG C 1 196 ? 44.346  -15.799  19.876  1.00 61.83  ? 199  ARG C NH1 1 
ATOM   6821  N  NH2 . ARG C 1 196 ? 45.204  -13.788  19.174  1.00 61.71  ? 199  ARG C NH2 1 
ATOM   6822  N  N   . LEU C 1 197 ? 49.864  -14.256  23.672  1.00 48.83  ? 200  LEU C N   1 
ATOM   6823  C  CA  . LEU C 1 197 ? 50.744  -13.181  24.098  1.00 51.47  ? 200  LEU C CA  1 
ATOM   6824  C  C   . LEU C 1 197 ? 51.214  -12.361  22.902  1.00 52.78  ? 200  LEU C C   1 
ATOM   6825  O  O   . LEU C 1 197 ? 50.833  -11.190  22.754  1.00 52.28  ? 200  LEU C O   1 
ATOM   6826  C  CB  . LEU C 1 197 ? 51.953  -13.740  24.854  1.00 52.46  ? 200  LEU C CB  1 
ATOM   6827  C  CG  . LEU C 1 197 ? 52.028  -13.517  26.363  1.00 56.82  ? 200  LEU C CG  1 
ATOM   6828  C  CD1 . LEU C 1 197 ? 51.664  -12.083  26.724  1.00 57.82  ? 200  LEU C CD1 1 
ATOM   6829  C  CD2 . LEU C 1 197 ? 51.144  -14.496  27.115  1.00 57.43  ? 200  LEU C CD2 1 
ATOM   6830  N  N   . ALA C 1 198 ? 52.022  -12.997  22.050  1.00 52.22  ? 201  ALA C N   1 
ATOM   6831  C  CA  . ALA C 1 198 ? 52.569  -12.374  20.845  1.00 51.23  ? 201  ALA C CA  1 
ATOM   6832  C  C   . ALA C 1 198 ? 51.491  -11.623  20.061  1.00 51.71  ? 201  ALA C C   1 
ATOM   6833  O  O   . ALA C 1 198 ? 51.692  -10.478  19.653  1.00 52.26  ? 201  ALA C O   1 
ATOM   6834  C  CB  . ALA C 1 198 ? 53.255  -13.418  19.970  1.00 47.73  ? 201  ALA C CB  1 
ATOM   6835  N  N   . ALA C 1 199 ? 50.341  -12.262  19.878  1.00 53.40  ? 202  ALA C N   1 
ATOM   6836  C  CA  . ALA C 1 199 ? 49.231  -11.650  19.153  1.00 54.95  ? 202  ALA C CA  1 
ATOM   6837  C  C   . ALA C 1 199 ? 48.165  -11.174  20.129  1.00 54.94  ? 202  ALA C C   1 
ATOM   6838  O  O   . ALA C 1 199 ? 47.006  -11.598  20.050  1.00 57.05  ? 202  ALA C O   1 
ATOM   6839  C  CB  . ALA C 1 199 ? 48.643  -12.640  18.158  1.00 53.68  ? 202  ALA C CB  1 
ATOM   6840  N  N   . LEU C 1 200 ? 48.565  -10.305  21.055  1.00 53.32  ? 203  LEU C N   1 
ATOM   6841  C  CA  . LEU C 1 200 ? 47.673  -9.842   22.119  1.00 52.84  ? 203  LEU C CA  1 
ATOM   6842  C  C   . LEU C 1 200 ? 46.458  -9.115   21.553  1.00 51.11  ? 203  LEU C C   1 
ATOM   6843  O  O   . LEU C 1 200 ? 46.585  -8.299   20.646  1.00 54.33  ? 203  LEU C O   1 
ATOM   6844  C  CB  . LEU C 1 200 ? 48.423  -8.920   23.082  1.00 53.34  ? 203  LEU C CB  1 
ATOM   6845  C  CG  . LEU C 1 200 ? 48.112  -8.917   24.582  1.00 53.03  ? 203  LEU C CG  1 
ATOM   6846  C  CD1 . LEU C 1 200 ? 48.038  -7.481   25.072  1.00 51.18  ? 203  LEU C CD1 1 
ATOM   6847  C  CD2 . LEU C 1 200 ? 46.858  -9.696   24.969  1.00 53.14  ? 203  LEU C CD2 1 
ATOM   6848  N  N   . ARG C 1 201 ? 45.277  -9.433   22.065  1.00 49.82  ? 204  ARG C N   1 
ATOM   6849  C  CA  . ARG C 1 201 ? 44.095  -8.644   21.746  1.00 52.19  ? 204  ARG C CA  1 
ATOM   6850  C  C   . ARG C 1 201 ? 43.448  -8.139   23.038  1.00 51.85  ? 204  ARG C C   1 
ATOM   6851  O  O   . ARG C 1 201 ? 43.817  -8.580   24.133  1.00 52.96  ? 204  ARG C O   1 
ATOM   6852  C  CB  . ARG C 1 201 ? 43.120  -9.423   20.843  1.00 56.84  ? 204  ARG C CB  1 
ATOM   6853  C  CG  . ARG C 1 201 ? 42.465  -10.654  21.460  1.00 62.63  ? 204  ARG C CG  1 
ATOM   6854  C  CD  . ARG C 1 201 ? 42.213  -11.780  20.453  1.00 63.84  ? 204  ARG C CD  1 
ATOM   6855  N  NE  . ARG C 1 201 ? 41.539  -11.336  19.231  1.00 68.45  ? 204  ARG C NE  1 
ATOM   6856  C  CZ  . ARG C 1 201 ? 41.552  -11.996  18.070  1.00 70.39  ? 204  ARG C CZ  1 
ATOM   6857  N  NH1 . ARG C 1 201 ? 42.209  -13.148  17.947  1.00 66.92  ? 204  ARG C NH1 1 
ATOM   6858  N  NH2 . ARG C 1 201 ? 40.912  -11.494  17.020  1.00 67.47  ? 204  ARG C NH2 1 
ATOM   6859  N  N   . THR C 1 202 ? 42.538  -7.179   22.919  1.00 47.26  ? 205  THR C N   1 
ATOM   6860  C  CA  . THR C 1 202 ? 41.752  -6.737   24.063  1.00 49.27  ? 205  THR C CA  1 
ATOM   6861  C  C   . THR C 1 202 ? 40.282  -6.840   23.704  1.00 48.97  ? 205  THR C C   1 
ATOM   6862  O  O   . THR C 1 202 ? 39.947  -7.063   22.544  1.00 47.98  ? 205  THR C O   1 
ATOM   6863  C  CB  . THR C 1 202 ? 42.104  -5.302   24.529  1.00 50.24  ? 205  THR C CB  1 
ATOM   6864  O  OG1 . THR C 1 202 ? 41.781  -4.361   23.501  1.00 52.40  ? 205  THR C OG1 1 
ATOM   6865  C  CG2 . THR C 1 202 ? 43.587  -5.185   24.884  1.00 49.32  ? 205  THR C CG2 1 
ATOM   6866  N  N   . TYR C 1 203 ? 39.408  -6.708   24.702  1.00 52.55  ? 206  TYR C N   1 
ATOM   6867  C  CA  . TYR C 1 203 ? 37.962  -6.865   24.488  1.00 54.09  ? 206  TYR C CA  1 
ATOM   6868  C  C   . TYR C 1 203 ? 37.184  -5.799   25.248  1.00 54.03  ? 206  TYR C C   1 
ATOM   6869  O  O   . TYR C 1 203 ? 37.523  -5.456   26.380  1.00 56.64  ? 206  TYR C O   1 
ATOM   6870  C  CB  . TYR C 1 203 ? 37.474  -8.271   24.893  1.00 52.07  ? 206  TYR C CB  1 
ATOM   6871  C  CG  . TYR C 1 203 ? 38.445  -9.395   24.588  1.00 52.60  ? 206  TYR C CG  1 
ATOM   6872  C  CD1 . TYR C 1 203 ? 39.549  -9.619   25.410  1.00 51.69  ? 206  TYR C CD1 1 
ATOM   6873  C  CD2 . TYR C 1 203 ? 38.263  -10.231  23.480  1.00 55.24  ? 206  TYR C CD2 1 
ATOM   6874  C  CE1 . TYR C 1 203 ? 40.454  -10.625  25.141  1.00 52.33  ? 206  TYR C CE1 1 
ATOM   6875  C  CE2 . TYR C 1 203 ? 39.163  -11.257  23.204  1.00 55.63  ? 206  TYR C CE2 1 
ATOM   6876  C  CZ  . TYR C 1 203 ? 40.256  -11.449  24.047  1.00 55.59  ? 206  TYR C CZ  1 
ATOM   6877  O  OH  . TYR C 1 203 ? 41.172  -12.451  23.815  1.00 53.84  ? 206  TYR C OH  1 
ATOM   6878  N  N   . ARG C 1 204 ? 36.136  -5.290   24.614  1.00 56.55  ? 207  ARG C N   1 
ATOM   6879  C  CA  . ARG C 1 204 ? 35.314  -4.229   25.182  1.00 61.08  ? 207  ARG C CA  1 
ATOM   6880  C  C   . ARG C 1 204 ? 34.090  -4.808   25.897  1.00 61.03  ? 207  ARG C C   1 
ATOM   6881  O  O   . ARG C 1 204 ? 33.403  -5.686   25.360  1.00 61.84  ? 207  ARG C O   1 
ATOM   6882  C  CB  . ARG C 1 204 ? 34.881  -3.259   24.075  1.00 64.99  ? 207  ARG C CB  1 
ATOM   6883  C  CG  . ARG C 1 204 ? 36.006  -2.431   23.459  1.00 68.76  ? 207  ARG C CG  1 
ATOM   6884  C  CD  . ARG C 1 204 ? 35.518  -1.573   22.291  1.00 76.63  ? 207  ARG C CD  1 
ATOM   6885  N  NE  . ARG C 1 204 ? 34.291  -0.820   22.597  1.00 81.43  ? 207  ARG C NE  1 
ATOM   6886  C  CZ  . ARG C 1 204 ? 33.090  -1.058   22.059  1.00 82.41  ? 207  ARG C CZ  1 
ATOM   6887  N  NH1 . ARG C 1 204 ? 32.929  -2.027   21.165  1.00 86.15  ? 207  ARG C NH1 1 
ATOM   6888  N  NH2 . ARG C 1 204 ? 32.043  -0.321   22.412  1.00 79.87  ? 207  ARG C NH2 1 
ATOM   6889  N  N   . GLY C 1 205 ? 33.824  -4.317   27.106  1.00 58.86  ? 208  GLY C N   1 
ATOM   6890  C  CA  . GLY C 1 205 ? 32.680  -4.773   27.898  1.00 59.55  ? 208  GLY C CA  1 
ATOM   6891  C  C   . GLY C 1 205 ? 32.579  -4.105   29.259  1.00 63.02  ? 208  GLY C C   1 
ATOM   6892  O  O   . GLY C 1 205 ? 33.562  -3.557   29.760  1.00 63.47  ? 208  GLY C O   1 
ATOM   6893  N  N   . ARG C 1 206 ? 31.391  -4.164   29.863  1.00 63.62  ? 209  ARG C N   1 
ATOM   6894  C  CA  . ARG C 1 206 ? 31.146  -3.545   31.167  1.00 63.77  ? 209  ARG C CA  1 
ATOM   6895  C  C   . ARG C 1 206 ? 31.142  -4.585   32.285  1.00 59.02  ? 209  ARG C C   1 
ATOM   6896  O  O   . ARG C 1 206 ? 30.222  -5.402   32.385  1.00 57.65  ? 209  ARG C O   1 
ATOM   6897  C  CB  . ARG C 1 206 ? 29.809  -2.790   31.180  1.00 71.90  ? 209  ARG C CB  1 
ATOM   6898  C  CG  . ARG C 1 206 ? 29.499  -1.972   29.935  1.00 81.48  ? 209  ARG C CG  1 
ATOM   6899  C  CD  . ARG C 1 206 ? 27.992  -1.853   29.743  1.00 90.70  ? 209  ARG C CD  1 
ATOM   6900  N  NE  . ARG C 1 206 ? 27.624  -1.258   28.455  1.00 97.88  ? 209  ARG C NE  1 
ATOM   6901  C  CZ  . ARG C 1 206 ? 27.385  -1.941   27.335  1.00 98.49  ? 209  ARG C CZ  1 
ATOM   6902  N  NH1 . ARG C 1 206 ? 27.474  -3.268   27.312  1.00 97.65  ? 209  ARG C NH1 1 
ATOM   6903  N  NH2 . ARG C 1 206 ? 27.060  -1.288   26.228  1.00 99.83  ? 209  ARG C NH2 1 
ATOM   6904  N  N   . LEU C 1 207 ? 32.174  -4.541   33.122  1.00 54.26  ? 210  LEU C N   1 
ATOM   6905  C  CA  . LEU C 1 207 ? 32.245  -5.362   34.328  1.00 50.90  ? 210  LEU C CA  1 
ATOM   6906  C  C   . LEU C 1 207 ? 31.556  -4.640   35.488  1.00 50.99  ? 210  LEU C C   1 
ATOM   6907  O  O   . LEU C 1 207 ? 31.792  -3.452   35.705  1.00 55.17  ? 210  LEU C O   1 
ATOM   6908  C  CB  . LEU C 1 207 ? 33.706  -5.603   34.708  1.00 46.53  ? 210  LEU C CB  1 
ATOM   6909  C  CG  . LEU C 1 207 ? 34.155  -6.860   35.461  1.00 47.01  ? 210  LEU C CG  1 
ATOM   6910  C  CD1 . LEU C 1 207 ? 35.414  -6.516   36.218  1.00 46.95  ? 210  LEU C CD1 1 
ATOM   6911  C  CD2 . LEU C 1 207 ? 33.137  -7.453   36.425  1.00 45.06  ? 210  LEU C CD2 1 
ATOM   6912  N  N   . ALA C 1 208 ? 30.706  -5.358   36.221  1.00 47.08  ? 211  ALA C N   1 
ATOM   6913  C  CA  . ALA C 1 208 ? 30.191  -4.901   37.516  1.00 46.30  ? 211  ALA C CA  1 
ATOM   6914  C  C   . ALA C 1 208 ? 30.241  -6.047   38.529  1.00 45.81  ? 211  ALA C C   1 
ATOM   6915  O  O   . ALA C 1 208 ? 30.312  -7.210   38.140  1.00 46.71  ? 211  ALA C O   1 
ATOM   6916  C  CB  . ALA C 1 208 ? 28.774  -4.370   37.375  1.00 46.86  ? 211  ALA C CB  1 
ATOM   6917  N  N   . TYR C 1 209 ? 30.207  -5.720   39.821  1.00 47.25  ? 212  TYR C N   1 
ATOM   6918  C  CA  . TYR C 1 209 ? 30.329  -6.727   40.885  1.00 47.10  ? 212  TYR C CA  1 
ATOM   6919  C  C   . TYR C 1 209 ? 29.996  -6.215   42.290  1.00 46.49  ? 212  TYR C C   1 
ATOM   6920  O  O   . TYR C 1 209 ? 29.990  -5.018   42.543  1.00 46.48  ? 212  TYR C O   1 
ATOM   6921  C  CB  . TYR C 1 209 ? 31.743  -7.301   40.906  1.00 46.00  ? 212  TYR C CB  1 
ATOM   6922  C  CG  . TYR C 1 209 ? 32.799  -6.314   41.332  1.00 47.18  ? 212  TYR C CG  1 
ATOM   6923  C  CD1 . TYR C 1 209 ? 33.493  -5.570   40.388  1.00 47.58  ? 212  TYR C CD1 1 
ATOM   6924  C  CD2 . TYR C 1 209 ? 33.114  -6.128   42.681  1.00 48.42  ? 212  TYR C CD2 1 
ATOM   6925  C  CE1 . TYR C 1 209 ? 34.472  -4.671   40.767  1.00 48.93  ? 212  TYR C CE1 1 
ATOM   6926  C  CE2 . TYR C 1 209 ? 34.093  -5.221   43.072  1.00 49.24  ? 212  TYR C CE2 1 
ATOM   6927  C  CZ  . TYR C 1 209 ? 34.771  -4.501   42.106  1.00 49.70  ? 212  TYR C CZ  1 
ATOM   6928  O  OH  . TYR C 1 209 ? 35.749  -3.603   42.456  1.00 52.52  ? 212  TYR C OH  1 
ATOM   6929  N  N   . LEU C 1 210 ? 29.779  -7.157   43.202  1.00 45.72  ? 213  LEU C N   1 
ATOM   6930  C  CA  . LEU C 1 210 ? 29.450  -6.877   44.590  1.00 45.28  ? 213  LEU C CA  1 
ATOM   6931  C  C   . LEU C 1 210 ? 30.519  -7.461   45.517  1.00 45.51  ? 213  LEU C C   1 
ATOM   6932  O  O   . LEU C 1 210 ? 30.533  -8.666   45.752  1.00 42.80  ? 213  LEU C O   1 
ATOM   6933  C  CB  . LEU C 1 210 ? 28.074  -7.471   44.923  1.00 43.80  ? 213  LEU C CB  1 
ATOM   6934  C  CG  . LEU C 1 210 ? 27.532  -7.231   46.336  1.00 45.89  ? 213  LEU C CG  1 
ATOM   6935  C  CD1 . LEU C 1 210 ? 27.365  -5.741   46.588  1.00 44.91  ? 213  LEU C CD1 1 
ATOM   6936  C  CD2 . LEU C 1 210 ? 26.218  -7.968   46.557  1.00 44.09  ? 213  LEU C CD2 1 
ATOM   6937  N  N   . PRO C 1 211 ? 31.404  -6.605   46.075  1.00 47.84  ? 214  PRO C N   1 
ATOM   6938  C  CA  . PRO C 1 211 ? 32.500  -7.127   46.894  1.00 47.07  ? 214  PRO C CA  1 
ATOM   6939  C  C   . PRO C 1 211 ? 32.018  -7.624   48.253  1.00 47.33  ? 214  PRO C C   1 
ATOM   6940  O  O   . PRO C 1 211 ? 30.874  -7.380   48.644  1.00 45.29  ? 214  PRO C O   1 
ATOM   6941  C  CB  . PRO C 1 211 ? 33.441  -5.926   47.060  1.00 46.43  ? 214  PRO C CB  1 
ATOM   6942  C  CG  . PRO C 1 211 ? 32.775  -4.772   46.369  1.00 47.13  ? 214  PRO C CG  1 
ATOM   6943  C  CD  . PRO C 1 211 ? 31.336  -5.139   46.163  1.00 47.00  ? 214  PRO C CD  1 
ATOM   6944  N  N   . VAL C 1 212 ? 32.913  -8.311   48.951  1.00 50.55  ? 215  VAL C N   1 
ATOM   6945  C  CA  . VAL C 1 212 ? 32.608  -9.076   50.154  1.00 54.86  ? 215  VAL C CA  1 
ATOM   6946  C  C   . VAL C 1 212 ? 32.063  -8.252   51.336  1.00 59.85  ? 215  VAL C C   1 
ATOM   6947  O  O   . VAL C 1 212 ? 31.155  -8.700   52.056  1.00 64.26  ? 215  VAL C O   1 
ATOM   6948  C  CB  . VAL C 1 212 ? 33.857  -9.892   50.558  1.00 55.00  ? 215  VAL C CB  1 
ATOM   6949  C  CG1 . VAL C 1 212 ? 33.829  -10.296  52.017  1.00 57.02  ? 215  VAL C CG1 1 
ATOM   6950  C  CG2 . VAL C 1 212 ? 33.974  -11.119  49.680  1.00 57.01  ? 215  VAL C CG2 1 
ATOM   6951  N  N   . GLY C 1 213 ? 32.602  -7.049   51.514  1.00 60.79  ? 216  GLY C N   1 
ATOM   6952  C  CA  . GLY C 1 213 ? 32.306  -6.223   52.693  1.00 68.30  ? 216  GLY C CA  1 
ATOM   6953  C  C   . GLY C 1 213 ? 30.892  -5.693   52.892  1.00 66.47  ? 216  GLY C C   1 
ATOM   6954  O  O   . GLY C 1 213 ? 30.459  -5.502   54.028  1.00 67.47  ? 216  GLY C O   1 
ATOM   6955  N  N   . ARG C 1 214 ? 30.170  -5.454   51.802  1.00 64.83  ? 217  ARG C N   1 
ATOM   6956  C  CA  . ARG C 1 214 ? 28.903  -4.717   51.872  1.00 67.63  ? 217  ARG C CA  1 
ATOM   6957  C  C   . ARG C 1 214 ? 27.685  -5.613   52.111  1.00 69.69  ? 217  ARG C C   1 
ATOM   6958  O  O   . ARG C 1 214 ? 27.376  -6.496   51.310  1.00 68.79  ? 217  ARG C O   1 
ATOM   6959  C  CB  . ARG C 1 214 ? 28.713  -3.845   50.620  1.00 67.30  ? 217  ARG C CB  1 
ATOM   6960  C  CG  . ARG C 1 214 ? 30.019  -3.301   50.057  1.00 65.16  ? 217  ARG C CG  1 
ATOM   6961  C  CD  . ARG C 1 214 ? 29.846  -2.051   49.207  1.00 64.41  ? 217  ARG C CD  1 
ATOM   6962  N  NE  . ARG C 1 214 ? 31.149  -1.616   48.695  1.00 66.85  ? 217  ARG C NE  1 
ATOM   6963  C  CZ  . ARG C 1 214 ? 31.469  -1.474   47.406  1.00 67.01  ? 217  ARG C CZ  1 
ATOM   6964  N  NH1 . ARG C 1 214 ? 32.701  -1.090   47.081  1.00 63.73  ? 217  ARG C NH1 1 
ATOM   6965  N  NH2 . ARG C 1 214 ? 30.573  -1.699   46.440  1.00 64.07  ? 217  ARG C NH2 1 
ATOM   6966  N  N   . GLN C 1 228 ? 13.019  -25.628  42.027  1.00 74.61  ? 231  GLN C N   1 
ATOM   6967  C  CA  . GLN C 1 228 ? 13.263  -24.564  41.050  1.00 80.56  ? 231  GLN C CA  1 
ATOM   6968  C  C   . GLN C 1 228 ? 14.755  -24.318  40.794  1.00 79.96  ? 231  GLN C C   1 
ATOM   6969  O  O   . GLN C 1 228 ? 15.163  -23.997  39.670  1.00 81.33  ? 231  GLN C O   1 
ATOM   6970  C  CB  . GLN C 1 228 ? 12.556  -23.264  41.484  1.00 85.36  ? 231  GLN C CB  1 
ATOM   6971  C  CG  . GLN C 1 228 ? 13.193  -21.946  41.017  1.00 85.81  ? 231  GLN C CG  1 
ATOM   6972  C  CD  . GLN C 1 228 ? 12.977  -21.612  39.537  1.00 85.31  ? 231  GLN C CD  1 
ATOM   6973  O  OE1 . GLN C 1 228 ? 12.880  -20.437  39.171  1.00 81.06  ? 231  GLN C OE1 1 
ATOM   6974  N  NE2 . GLN C 1 228 ? 12.918  -22.634  38.683  1.00 82.73  ? 231  GLN C NE2 1 
ATOM   6975  N  N   . GLY C 1 229 ? 15.556  -24.490  41.841  1.00 77.84  ? 232  GLY C N   1 
ATOM   6976  C  CA  . GLY C 1 229 ? 16.961  -24.086  41.852  1.00 69.82  ? 232  GLY C CA  1 
ATOM   6977  C  C   . GLY C 1 229 ? 17.127  -23.085  42.981  1.00 64.05  ? 232  GLY C C   1 
ATOM   6978  O  O   . GLY C 1 229 ? 16.145  -22.460  43.383  1.00 66.79  ? 232  GLY C O   1 
ATOM   6979  N  N   . PRO C 1 230 ? 18.358  -22.929  43.509  1.00 59.47  ? 233  PRO C N   1 
ATOM   6980  C  CA  . PRO C 1 230 ? 18.601  -21.998  44.618  1.00 57.68  ? 233  PRO C CA  1 
ATOM   6981  C  C   . PRO C 1 230 ? 18.344  -20.544  44.240  1.00 57.13  ? 233  PRO C C   1 
ATOM   6982  O  O   . PRO C 1 230 ? 18.649  -20.126  43.122  1.00 55.59  ? 233  PRO C O   1 
ATOM   6983  C  CB  . PRO C 1 230 ? 20.085  -22.193  44.934  1.00 54.85  ? 233  PRO C CB  1 
ATOM   6984  C  CG  . PRO C 1 230 ? 20.670  -22.775  43.697  1.00 57.49  ? 233  PRO C CG  1 
ATOM   6985  C  CD  . PRO C 1 230 ? 19.589  -23.628  43.104  1.00 58.26  ? 233  PRO C CD  1 
ATOM   6986  N  N   . VAL C 1 231 ? 17.783  -19.794  45.185  1.00 57.05  ? 234  VAL C N   1 
ATOM   6987  C  CA  . VAL C 1 231 ? 17.482  -18.373  45.009  1.00 52.49  ? 234  VAL C CA  1 
ATOM   6988  C  C   . VAL C 1 231 ? 18.760  -17.538  44.965  1.00 48.23  ? 234  VAL C C   1 
ATOM   6989  O  O   . VAL C 1 231 ? 19.626  -17.668  45.827  1.00 48.25  ? 234  VAL C O   1 
ATOM   6990  C  CB  . VAL C 1 231 ? 16.526  -17.860  46.117  1.00 56.07  ? 234  VAL C CB  1 
ATOM   6991  C  CG1 . VAL C 1 231 ? 15.082  -18.207  45.781  1.00 57.20  ? 234  VAL C CG1 1 
ATOM   6992  C  CG2 . VAL C 1 231 ? 16.899  -18.446  47.478  1.00 58.82  ? 234  VAL C CG2 1 
ATOM   6993  N  N   . ASP C 1 232 ? 18.877  -16.701  43.941  1.00 46.59  ? 235  ASP C N   1 
ATOM   6994  C  CA  . ASP C 1 232 ? 20.029  -15.818  43.775  1.00 47.54  ? 235  ASP C CA  1 
ATOM   6995  C  C   . ASP C 1 232 ? 19.687  -14.410  44.281  1.00 47.60  ? 235  ASP C C   1 
ATOM   6996  O  O   . ASP C 1 232 ? 19.470  -13.491  43.486  1.00 46.02  ? 235  ASP C O   1 
ATOM   6997  C  CB  . ASP C 1 232 ? 20.458  -15.767  42.299  1.00 49.55  ? 235  ASP C CB  1 
ATOM   6998  C  CG  . ASP C 1 232 ? 21.267  -16.994  41.865  1.00 50.90  ? 235  ASP C CG  1 
ATOM   6999  O  OD1 . ASP C 1 232 ? 21.923  -17.638  42.711  1.00 49.61  ? 235  ASP C OD1 1 
ATOM   7000  O  OD2 . ASP C 1 232 ? 21.252  -17.309  40.657  1.00 51.78  ? 235  ASP C OD2 1 
ATOM   7001  N  N   . ALA C 1 233 ? 19.661  -14.252  45.605  1.00 47.57  ? 236  ALA C N   1 
ATOM   7002  C  CA  . ALA C 1 233 ? 19.143  -13.044  46.255  1.00 47.39  ? 236  ALA C CA  1 
ATOM   7003  C  C   . ALA C 1 233 ? 19.942  -11.761  45.969  1.00 48.13  ? 236  ALA C C   1 
ATOM   7004  O  O   . ALA C 1 233 ? 19.398  -10.662  46.059  1.00 49.56  ? 236  ALA C O   1 
ATOM   7005  C  CB  . ALA C 1 233 ? 19.009  -13.272  47.760  1.00 46.60  ? 236  ALA C CB  1 
ATOM   7006  N  N   . HIS C 1 234 ? 21.218  -11.898  45.618  1.00 47.87  ? 237  HIS C N   1 
ATOM   7007  C  CA  . HIS C 1 234 ? 22.053  -10.737  45.297  1.00 47.32  ? 237  HIS C CA  1 
ATOM   7008  C  C   . HIS C 1 234 ? 21.917  -10.235  43.886  1.00 47.13  ? 237  HIS C C   1 
ATOM   7009  O  O   . HIS C 1 234 ? 22.591  -9.268   43.514  1.00 47.51  ? 237  HIS C O   1 
ATOM   7010  C  CB  . HIS C 1 234 ? 23.516  -11.030  45.603  1.00 50.30  ? 237  HIS C CB  1 
ATOM   7011  C  CG  . HIS C 1 234 ? 23.787  -11.248  47.066  1.00 55.06  ? 237  HIS C CG  1 
ATOM   7012  N  ND1 . HIS C 1 234 ? 23.705  -12.460  47.643  1.00 56.58  ? 237  HIS C ND1 1 
ATOM   7013  C  CD2 . HIS C 1 234 ? 24.123  -10.351  48.080  1.00 56.63  ? 237  HIS C CD2 1 
ATOM   7014  C  CE1 . HIS C 1 234 ? 23.981  -12.351  48.958  1.00 59.43  ? 237  HIS C CE1 1 
ATOM   7015  N  NE2 . HIS C 1 234 ? 24.242  -11.060  49.222  1.00 59.90  ? 237  HIS C NE2 1 
ATOM   7016  N  N   . LEU C 1 235 ? 21.046  -10.864  43.090  1.00 45.55  ? 238  LEU C N   1 
ATOM   7017  C  CA  . LEU C 1 235 ? 20.950  -10.554  41.662  1.00 43.00  ? 238  LEU C CA  1 
ATOM   7018  C  C   . LEU C 1 235 ? 19.598  -9.990   41.234  1.00 42.65  ? 238  LEU C C   1 
ATOM   7019  O  O   . LEU C 1 235 ? 18.547  -10.392  41.728  1.00 41.48  ? 238  LEU C O   1 
ATOM   7020  C  CB  . LEU C 1 235 ? 21.323  -11.774  40.791  1.00 44.60  ? 238  LEU C CB  1 
ATOM   7021  C  CG  . LEU C 1 235 ? 22.716  -12.419  40.939  1.00 46.27  ? 238  LEU C CG  1 
ATOM   7022  C  CD1 . LEU C 1 235 ? 22.825  -13.699  40.118  1.00 47.47  ? 238  LEU C CD1 1 
ATOM   7023  C  CD2 . LEU C 1 235 ? 23.847  -11.474  40.569  1.00 42.68  ? 238  LEU C CD2 1 
ATOM   7024  N  N   . VAL C 1 236 ? 19.652  -9.050   40.297  1.00 43.91  ? 239  VAL C N   1 
ATOM   7025  C  CA  . VAL C 1 236 ? 18.457  -8.475   39.690  1.00 45.53  ? 239  VAL C CA  1 
ATOM   7026  C  C   . VAL C 1 236 ? 18.565  -8.710   38.190  1.00 46.39  ? 239  VAL C C   1 
ATOM   7027  O  O   . VAL C 1 236 ? 19.654  -8.557   37.627  1.00 45.60  ? 239  VAL C O   1 
ATOM   7028  C  CB  . VAL C 1 236 ? 18.307  -6.952   39.993  1.00 45.60  ? 239  VAL C CB  1 
ATOM   7029  C  CG1 . VAL C 1 236 ? 18.184  -6.698   41.498  1.00 44.45  ? 239  VAL C CG1 1 
ATOM   7030  C  CG2 . VAL C 1 236 ? 19.461  -6.146   39.401  1.00 43.38  ? 239  VAL C CG2 1 
ATOM   7031  N  N   . PRO C 1 237 ? 17.448  -9.098   37.538  1.00 49.17  ? 240  PRO C N   1 
ATOM   7032  C  CA  . PRO C 1 237 ? 17.381  -9.340   36.094  1.00 49.94  ? 240  PRO C CA  1 
ATOM   7033  C  C   . PRO C 1 237 ? 18.346  -8.500   35.242  1.00 53.44  ? 240  PRO C C   1 
ATOM   7034  O  O   . PRO C 1 237 ? 18.607  -7.333   35.557  1.00 52.38  ? 240  PRO C O   1 
ATOM   7035  C  CB  . PRO C 1 237 ? 15.928  -8.989   35.770  1.00 49.55  ? 240  PRO C CB  1 
ATOM   7036  C  CG  . PRO C 1 237 ? 15.171  -9.338   37.021  1.00 46.52  ? 240  PRO C CG  1 
ATOM   7037  C  CD  . PRO C 1 237 ? 16.149  -9.393   38.174  1.00 48.08  ? 240  PRO C CD  1 
ATOM   7038  N  N   . LEU C 1 238 ? 18.866  -9.099   34.169  1.00 56.07  ? 241  LEU C N   1 
ATOM   7039  C  CA  . LEU C 1 238 ? 19.836  -8.432   33.291  1.00 60.16  ? 241  LEU C CA  1 
ATOM   7040  C  C   . LEU C 1 238 ? 19.280  -7.185   32.572  1.00 64.35  ? 241  LEU C C   1 
ATOM   7041  O  O   . LEU C 1 238 ? 20.056  -6.321   32.133  1.00 58.62  ? 241  LEU C O   1 
ATOM   7042  C  CB  . LEU C 1 238 ? 20.449  -9.435   32.302  1.00 59.94  ? 241  LEU C CB  1 
ATOM   7043  C  CG  . LEU C 1 238 ? 21.612  -10.249  32.891  1.00 59.02  ? 241  LEU C CG  1 
ATOM   7044  C  CD1 . LEU C 1 238 ? 21.637  -11.681  32.371  1.00 58.02  ? 241  LEU C CD1 1 
ATOM   7045  C  CD2 . LEU C 1 238 ? 22.946  -9.548   32.656  1.00 57.80  ? 241  LEU C CD2 1 
ATOM   7046  N  N   . GLU C 1 239 ? 17.946  -7.101   32.485  1.00 68.77  ? 242  GLU C N   1 
ATOM   7047  C  CA  . GLU C 1 239 ? 17.234  -5.931   31.940  1.00 74.18  ? 242  GLU C CA  1 
ATOM   7048  C  C   . GLU C 1 239 ? 17.503  -4.642   32.734  1.00 75.53  ? 242  GLU C C   1 
ATOM   7049  O  O   . GLU C 1 239 ? 17.931  -3.642   32.151  1.00 75.66  ? 242  GLU C O   1 
ATOM   7050  C  CB  . GLU C 1 239 ? 15.719  -6.178   31.849  1.00 77.47  ? 242  GLU C CB  1 
ATOM   7051  C  CG  . GLU C 1 239 ? 15.295  -7.399   31.042  1.00 79.31  ? 242  GLU C CG  1 
ATOM   7052  C  CD  . GLU C 1 239 ? 15.152  -8.643   31.900  1.00 81.06  ? 242  GLU C CD  1 
ATOM   7053  O  OE1 . GLU C 1 239 ? 14.002  -9.012   32.225  1.00 81.31  ? 242  GLU C OE1 1 
ATOM   7054  O  OE2 . GLU C 1 239 ? 16.187  -9.244   32.263  1.00 80.85  ? 242  GLU C OE2 1 
ATOM   7055  N  N   . GLU C 1 240 ? 17.248  -4.659   34.048  1.00 75.06  ? 243  GLU C N   1 
ATOM   7056  C  CA  . GLU C 1 240 ? 17.592  -3.506   34.899  1.00 75.25  ? 243  GLU C CA  1 
ATOM   7057  C  C   . GLU C 1 240 ? 19.086  -3.447   35.218  1.00 72.01  ? 243  GLU C C   1 
ATOM   7058  O  O   . GLU C 1 240 ? 19.768  -4.476   35.174  1.00 69.77  ? 243  GLU C O   1 
ATOM   7059  C  CB  . GLU C 1 240 ? 16.746  -3.416   36.187  1.00 75.45  ? 243  GLU C CB  1 
ATOM   7060  C  CG  . GLU C 1 240 ? 16.464  -4.722   36.907  1.00 78.24  ? 243  GLU C CG  1 
ATOM   7061  C  CD  . GLU C 1 240 ? 15.020  -5.172   36.747  1.00 80.11  ? 243  GLU C CD  1 
ATOM   7062  O  OE1 . GLU C 1 240 ? 14.377  -5.490   37.772  1.00 74.13  ? 243  GLU C OE1 1 
ATOM   7063  O  OE2 . GLU C 1 240 ? 14.523  -5.202   35.599  1.00 83.91  ? 243  GLU C OE2 1 
ATOM   7064  N  N   . PRO C 1 241 ? 19.601  -2.236   35.520  1.00 71.59  ? 244  PRO C N   1 
ATOM   7065  C  CA  . PRO C 1 241 ? 21.005  -2.082   35.884  1.00 70.53  ? 244  PRO C CA  1 
ATOM   7066  C  C   . PRO C 1 241 ? 21.278  -2.618   37.280  1.00 67.76  ? 244  PRO C C   1 
ATOM   7067  O  O   . PRO C 1 241 ? 20.345  -2.916   38.034  1.00 64.61  ? 244  PRO C O   1 
ATOM   7068  C  CB  . PRO C 1 241 ? 21.210  -0.564   35.856  1.00 73.96  ? 244  PRO C CB  1 
ATOM   7069  C  CG  . PRO C 1 241 ? 19.867  -0.002   36.170  1.00 74.18  ? 244  PRO C CG  1 
ATOM   7070  C  CD  . PRO C 1 241 ? 18.896  -0.937   35.506  1.00 74.27  ? 244  PRO C CD  1 
ATOM   7071  N  N   . VAL C 1 242 ? 22.558  -2.731   37.608  1.00 66.37  ? 245  VAL C N   1 
ATOM   7072  C  CA  . VAL C 1 242 ? 22.988  -3.287   38.880  1.00 66.74  ? 245  VAL C CA  1 
ATOM   7073  C  C   . VAL C 1 242 ? 22.565  -2.383   40.037  1.00 68.42  ? 245  VAL C C   1 
ATOM   7074  O  O   . VAL C 1 242 ? 22.606  -1.153   39.900  1.00 69.96  ? 245  VAL C O   1 
ATOM   7075  C  CB  . VAL C 1 242 ? 24.516  -3.531   38.899  1.00 67.28  ? 245  VAL C CB  1 
ATOM   7076  C  CG1 . VAL C 1 242 ? 24.897  -4.525   37.811  1.00 68.05  ? 245  VAL C CG1 1 
ATOM   7077  C  CG2 . VAL C 1 242 ? 25.296  -2.232   38.722  1.00 62.30  ? 245  VAL C CG2 1 
ATOM   7078  N  N   . PRO C 1 243 ? 22.136  -2.983   41.170  1.00 68.01  ? 246  PRO C N   1 
ATOM   7079  C  CA  . PRO C 1 243 ? 21.830  -2.183   42.364  1.00 65.59  ? 246  PRO C CA  1 
ATOM   7080  C  C   . PRO C 1 243 ? 23.061  -1.377   42.784  1.00 65.43  ? 246  PRO C C   1 
ATOM   7081  O  O   . PRO C 1 243 ? 24.190  -1.881   42.712  1.00 62.82  ? 246  PRO C O   1 
ATOM   7082  C  CB  . PRO C 1 243 ? 21.464  -3.234   43.419  1.00 66.22  ? 246  PRO C CB  1 
ATOM   7083  C  CG  . PRO C 1 243 ? 22.015  -4.525   42.902  1.00 66.31  ? 246  PRO C CG  1 
ATOM   7084  C  CD  . PRO C 1 243 ? 21.935  -4.422   41.410  1.00 66.28  ? 246  PRO C CD  1 
ATOM   7085  N  N   . SER C 1 244 ? 22.844  -0.136   43.211  1.00 64.99  ? 247  SER C N   1 
ATOM   7086  C  CA  . SER C 1 244 ? 23.936  0.841    43.311  1.00 62.41  ? 247  SER C CA  1 
ATOM   7087  C  C   . SER C 1 244 ? 24.954  0.662    44.449  1.00 60.18  ? 247  SER C C   1 
ATOM   7088  O  O   . SER C 1 244 ? 25.874  1.477    44.572  1.00 61.05  ? 247  SER C O   1 
ATOM   7089  C  CB  . SER C 1 244 ? 23.405  2.283    43.251  1.00 66.00  ? 247  SER C CB  1 
ATOM   7090  O  OG  . SER C 1 244 ? 22.091  2.383    43.774  1.00 69.41  ? 247  SER C OG  1 
ATOM   7091  N  N   . HIS C 1 245 ? 24.822  -0.397   45.253  1.00 56.41  ? 248  HIS C N   1 
ATOM   7092  C  CA  . HIS C 1 245 ? 25.897  -0.746   46.206  1.00 57.53  ? 248  HIS C CA  1 
ATOM   7093  C  C   . HIS C 1 245 ? 26.977  -1.641   45.615  1.00 55.74  ? 248  HIS C C   1 
ATOM   7094  O  O   . HIS C 1 245 ? 27.970  -1.978   46.281  1.00 50.29  ? 248  HIS C O   1 
ATOM   7095  C  CB  . HIS C 1 245 ? 25.343  -1.285   47.526  1.00 60.05  ? 248  HIS C CB  1 
ATOM   7096  C  CG  . HIS C 1 245 ? 24.610  -2.603   47.409  1.00 61.92  ? 248  HIS C CG  1 
ATOM   7097  N  ND1 . HIS C 1 245 ? 23.486  -2.750   46.678  1.00 62.95  ? 248  HIS C ND1 1 
ATOM   7098  C  CD2 . HIS C 1 245 ? 24.854  -3.839   48.010  1.00 61.76  ? 248  HIS C CD2 1 
ATOM   7099  C  CE1 . HIS C 1 245 ? 23.045  -4.023   46.786  1.00 61.76  ? 248  HIS C CE1 1 
ATOM   7100  N  NE2 . HIS C 1 245 ? 23.884  -4.687   47.602  1.00 60.80  ? 248  HIS C NE2 1 
ATOM   7101  N  N   . TRP C 1 246 ? 26.784  -2.004   44.345  1.00 53.47  ? 249  TRP C N   1 
ATOM   7102  C  CA  . TRP C 1 246 ? 27.772  -2.722   43.543  1.00 54.78  ? 249  TRP C CA  1 
ATOM   7103  C  C   . TRP C 1 246 ? 28.751  -1.736   42.976  1.00 54.17  ? 249  TRP C C   1 
ATOM   7104  O  O   . TRP C 1 246 ? 28.371  -0.620   42.629  1.00 53.98  ? 249  TRP C O   1 
ATOM   7105  C  CB  . TRP C 1 246 ? 27.092  -3.424   42.363  1.00 52.86  ? 249  TRP C CB  1 
ATOM   7106  C  CG  . TRP C 1 246 ? 26.307  -4.690   42.654  1.00 53.34  ? 249  TRP C CG  1 
ATOM   7107  C  CD1 . TRP C 1 246 ? 25.446  -4.942   43.720  1.00 54.87  ? 249  TRP C CD1 1 
ATOM   7108  C  CD2 . TRP C 1 246 ? 26.235  -5.908   41.816  1.00 55.28  ? 249  TRP C CD2 1 
ATOM   7109  N  NE1 . TRP C 1 246 ? 24.891  -6.198   43.622  1.00 55.01  ? 249  TRP C NE1 1 
ATOM   7110  C  CE2 . TRP C 1 246 ? 25.321  -6.829   42.505  1.00 54.44  ? 249  TRP C CE2 1 
ATOM   7111  C  CE3 . TRP C 1 246 ? 26.828  -6.314   40.619  1.00 52.30  ? 249  TRP C CE3 1 
ATOM   7112  C  CZ2 . TRP C 1 246 ? 25.030  -8.094   42.000  1.00 52.91  ? 249  TRP C CZ2 1 
ATOM   7113  C  CZ3 . TRP C 1 246 ? 26.525  -7.588   40.120  1.00 53.13  ? 249  TRP C CZ3 1 
ATOM   7114  C  CH2 . TRP C 1 246 ? 25.647  -8.454   40.796  1.00 53.22  ? 249  TRP C CH2 1 
ATOM   7115  N  N   . THR C 1 247 ? 30.012  -2.147   42.856  1.00 53.98  ? 250  THR C N   1 
ATOM   7116  C  CA  . THR C 1 247 ? 31.024  -1.386   42.118  1.00 54.70  ? 250  THR C CA  1 
ATOM   7117  C  C   . THR C 1 247 ? 30.880  -1.596   40.596  1.00 58.17  ? 250  THR C C   1 
ATOM   7118  O  O   . THR C 1 247 ? 30.998  -2.728   40.112  1.00 62.70  ? 250  THR C O   1 
ATOM   7119  C  CB  . THR C 1 247 ? 32.447  -1.822   42.527  1.00 53.29  ? 250  THR C CB  1 
ATOM   7120  O  OG1 . THR C 1 247 ? 32.572  -1.818   43.957  1.00 52.65  ? 250  THR C OG1 1 
ATOM   7121  C  CG2 . THR C 1 247 ? 33.510  -0.911   41.894  1.00 52.32  ? 250  THR C CG2 1 
ATOM   7122  N  N   . VAL C 1 248 ? 30.613  -0.517   39.854  1.00 54.84  ? 251  VAL C N   1 
ATOM   7123  C  CA  . VAL C 1 248 ? 30.722  -0.522   38.389  1.00 51.72  ? 251  VAL C CA  1 
ATOM   7124  C  C   . VAL C 1 248 ? 32.136  -0.066   38.016  1.00 52.36  ? 251  VAL C C   1 
ATOM   7125  O  O   . VAL C 1 248 ? 32.526  1.058    38.314  1.00 51.90  ? 251  VAL C O   1 
ATOM   7126  C  CB  . VAL C 1 248 ? 29.653  0.373    37.699  1.00 51.51  ? 251  VAL C CB  1 
ATOM   7127  C  CG1 . VAL C 1 248 ? 29.951  0.564    36.212  1.00 49.58  ? 251  VAL C CG1 1 
ATOM   7128  C  CG2 . VAL C 1 248 ? 28.256  -0.209   37.873  1.00 50.23  ? 251  VAL C CG2 1 
ATOM   7129  N  N   . VAL C 1 249 ? 32.897  -0.955   37.380  1.00 55.20  ? 252  VAL C N   1 
ATOM   7130  C  CA  . VAL C 1 249 ? 34.291  -0.691   36.999  1.00 57.43  ? 252  VAL C CA  1 
ATOM   7131  C  C   . VAL C 1 249 ? 34.372  0.346    35.862  1.00 58.63  ? 252  VAL C C   1 
ATOM   7132  O  O   . VAL C 1 249 ? 33.659  0.225    34.858  1.00 54.93  ? 252  VAL C O   1 
ATOM   7133  C  CB  . VAL C 1 249 ? 35.039  -1.996   36.621  1.00 57.08  ? 252  VAL C CB  1 
ATOM   7134  C  CG1 . VAL C 1 249 ? 36.498  -1.713   36.279  1.00 56.38  ? 252  VAL C CG1 1 
ATOM   7135  C  CG2 . VAL C 1 249 ? 34.955  -3.015   37.754  1.00 55.59  ? 252  VAL C CG2 1 
ATOM   7136  N  N   . PRO C 1 250 ? 35.240  1.369    36.023  1.00 61.65  ? 253  PRO C N   1 
ATOM   7137  C  CA  . PRO C 1 250 ? 35.276  2.482    35.069  1.00 62.95  ? 253  PRO C CA  1 
ATOM   7138  C  C   . PRO C 1 250 ? 35.734  2.045    33.677  1.00 64.25  ? 253  PRO C C   1 
ATOM   7139  O  O   . PRO C 1 250 ? 35.003  2.256    32.705  1.00 63.78  ? 253  PRO C O   1 
ATOM   7140  C  CB  . PRO C 1 250 ? 36.278  3.462    35.702  1.00 64.02  ? 253  PRO C CB  1 
ATOM   7141  C  CG  . PRO C 1 250 ? 37.137  2.622    36.594  1.00 63.28  ? 253  PRO C CG  1 
ATOM   7142  C  CD  . PRO C 1 250 ? 36.239  1.532    37.102  1.00 61.90  ? 253  PRO C CD  1 
ATOM   7143  N  N   . ASP C 1 251 ? 36.919  1.432    33.600  1.00 64.39  ? 254  ASP C N   1 
ATOM   7144  C  CA  . ASP C 1 251 ? 37.512  0.966    32.345  1.00 67.01  ? 254  ASP C CA  1 
ATOM   7145  C  C   . ASP C 1 251 ? 36.565  0.002    31.647  1.00 66.23  ? 254  ASP C C   1 
ATOM   7146  O  O   . ASP C 1 251 ? 36.129  -0.976   32.249  1.00 67.00  ? 254  ASP C O   1 
ATOM   7147  C  CB  . ASP C 1 251 ? 38.837  0.241    32.611  1.00 72.34  ? 254  ASP C CB  1 
ATOM   7148  C  CG  . ASP C 1 251 ? 39.591  0.802    33.806  1.00 78.93  ? 254  ASP C CG  1 
ATOM   7149  O  OD1 . ASP C 1 251 ? 40.658  1.418    33.589  1.00 82.68  ? 254  ASP C OD1 1 
ATOM   7150  O  OD2 . ASP C 1 251 ? 39.126  0.625    34.959  1.00 77.19  ? 254  ASP C OD2 1 
ATOM   7151  N  N   . GLU C 1 252 ? 36.231  0.289    30.391  1.00 65.84  ? 255  GLU C N   1 
ATOM   7152  C  CA  . GLU C 1 252 ? 35.400  -0.622   29.600  1.00 64.66  ? 255  GLU C CA  1 
ATOM   7153  C  C   . GLU C 1 252 ? 36.183  -1.368   28.500  1.00 64.52  ? 255  GLU C C   1 
ATOM   7154  O  O   . GLU C 1 252 ? 35.635  -1.755   27.457  1.00 63.56  ? 255  GLU C O   1 
ATOM   7155  C  CB  . GLU C 1 252 ? 34.125  0.071    29.109  1.00 65.91  ? 255  GLU C CB  1 
ATOM   7156  C  CG  . GLU C 1 252 ? 32.939  -0.266   30.006  1.00 69.83  ? 255  GLU C CG  1 
ATOM   7157  C  CD  . GLU C 1 252 ? 32.101  0.932    30.409  1.00 70.42  ? 255  GLU C CD  1 
ATOM   7158  O  OE1 . GLU C 1 252 ? 31.278  1.383    29.584  1.00 67.45  ? 255  GLU C OE1 1 
ATOM   7159  O  OE2 . GLU C 1 252 ? 32.247  1.396    31.568  1.00 69.58  ? 255  GLU C OE2 1 
ATOM   7160  N  N   . ASP C 1 253 ? 37.468  -1.583   28.783  1.00 64.06  ? 256  ASP C N   1 
ATOM   7161  C  CA  . ASP C 1 253 ? 38.376  -2.320   27.919  1.00 64.30  ? 256  ASP C CA  1 
ATOM   7162  C  C   . ASP C 1 253 ? 39.275  -3.191   28.790  1.00 62.43  ? 256  ASP C C   1 
ATOM   7163  O  O   . ASP C 1 253 ? 39.852  -2.710   29.773  1.00 65.65  ? 256  ASP C O   1 
ATOM   7164  C  CB  . ASP C 1 253 ? 39.226  -1.348   27.102  1.00 70.43  ? 256  ASP C CB  1 
ATOM   7165  C  CG  . ASP C 1 253 ? 39.381  -1.781   25.655  1.00 78.28  ? 256  ASP C CG  1 
ATOM   7166  O  OD1 . ASP C 1 253 ? 38.828  -1.082   24.777  1.00 82.49  ? 256  ASP C OD1 1 
ATOM   7167  O  OD2 . ASP C 1 253 ? 40.037  -2.820   25.392  1.00 82.10  ? 256  ASP C OD2 1 
ATOM   7168  N  N   . PHE C 1 254 ? 39.385  -4.468   28.423  1.00 57.04  ? 257  PHE C N   1 
ATOM   7169  C  CA  . PHE C 1 254 ? 40.102  -5.469   29.220  1.00 53.95  ? 257  PHE C CA  1 
ATOM   7170  C  C   . PHE C 1 254 ? 40.911  -6.422   28.351  1.00 52.28  ? 257  PHE C C   1 
ATOM   7171  O  O   . PHE C 1 254 ? 40.606  -6.612   27.170  1.00 51.47  ? 257  PHE C O   1 
ATOM   7172  C  CB  . PHE C 1 254 ? 39.107  -6.343   29.992  1.00 51.52  ? 257  PHE C CB  1 
ATOM   7173  C  CG  . PHE C 1 254 ? 38.177  -5.585   30.886  1.00 50.10  ? 257  PHE C CG  1 
ATOM   7174  C  CD1 . PHE C 1 254 ? 38.491  -5.394   32.233  1.00 48.78  ? 257  PHE C CD1 1 
ATOM   7175  C  CD2 . PHE C 1 254 ? 36.972  -5.084   30.395  1.00 49.76  ? 257  PHE C CD2 1 
ATOM   7176  C  CE1 . PHE C 1 254 ? 37.627  -4.705   33.072  1.00 46.92  ? 257  PHE C CE1 1 
ATOM   7177  C  CE2 . PHE C 1 254 ? 36.105  -4.390   31.229  1.00 50.19  ? 257  PHE C CE2 1 
ATOM   7178  C  CZ  . PHE C 1 254 ? 36.428  -4.210   32.570  1.00 48.56  ? 257  PHE C CZ  1 
ATOM   7179  N  N   . VAL C 1 255 ? 41.916  -7.058   28.945  1.00 51.18  ? 258  VAL C N   1 
ATOM   7180  C  CA  . VAL C 1 255 ? 42.444  -8.278   28.337  1.00 50.33  ? 258  VAL C CA  1 
ATOM   7181  C  C   . VAL C 1 255 ? 41.688  -9.497   28.894  1.00 48.93  ? 258  VAL C C   1 
ATOM   7182  O  O   . VAL C 1 255 ? 41.346  -10.404  28.136  1.00 50.93  ? 258  VAL C O   1 
ATOM   7183  C  CB  . VAL C 1 255 ? 43.990  -8.441   28.429  1.00 50.12  ? 258  VAL C CB  1 
ATOM   7184  C  CG1 . VAL C 1 255 ? 44.691  -7.090   28.457  1.00 49.57  ? 258  VAL C CG1 1 
ATOM   7185  C  CG2 . VAL C 1 255 ? 44.401  -9.298   29.619  1.00 51.43  ? 258  VAL C CG2 1 
ATOM   7186  N  N   . LEU C 1 256 ? 41.407  -9.507   30.200  1.00 46.96  ? 259  LEU C N   1 
ATOM   7187  C  CA  . LEU C 1 256 ? 40.760  -10.666  30.833  1.00 42.84  ? 259  LEU C CA  1 
ATOM   7188  C  C   . LEU C 1 256 ? 39.887  -10.357  32.054  1.00 43.17  ? 259  LEU C C   1 
ATOM   7189  O  O   . LEU C 1 256 ? 40.133  -9.403   32.793  1.00 44.70  ? 259  LEU C O   1 
ATOM   7190  C  CB  . LEU C 1 256 ? 41.797  -11.753  31.168  1.00 39.66  ? 259  LEU C CB  1 
ATOM   7191  C  CG  . LEU C 1 256 ? 42.748  -11.661  32.358  1.00 38.23  ? 259  LEU C CG  1 
ATOM   7192  C  CD1 . LEU C 1 256 ? 42.082  -12.196  33.633  1.00 37.18  ? 259  LEU C CD1 1 
ATOM   7193  C  CD2 . LEU C 1 256 ? 44.019  -12.435  32.050  1.00 35.03  ? 259  LEU C CD2 1 
ATOM   7194  N  N   . VAL C 1 257 ? 38.848  -11.165  32.234  1.00 41.10  ? 260  VAL C N   1 
ATOM   7195  C  CA  . VAL C 1 257 ? 38.098  -11.207  33.481  1.00 39.22  ? 260  VAL C CA  1 
ATOM   7196  C  C   . VAL C 1 257 ? 38.067  -12.664  33.926  1.00 39.16  ? 260  VAL C C   1 
ATOM   7197  O  O   . VAL C 1 257 ? 37.809  -13.555  33.116  1.00 39.52  ? 260  VAL C O   1 
ATOM   7198  C  CB  . VAL C 1 257 ? 36.666  -10.658  33.340  1.00 37.36  ? 260  VAL C CB  1 
ATOM   7199  C  CG1 . VAL C 1 257 ? 35.935  -10.735  34.670  1.00 36.42  ? 260  VAL C CG1 1 
ATOM   7200  C  CG2 . VAL C 1 257 ? 36.700  -9.218   32.856  1.00 40.12  ? 260  VAL C CG2 1 
ATOM   7201  N  N   . LEU C 1 258 ? 38.349  -12.892  35.208  1.00 35.87  ? 261  LEU C N   1 
ATOM   7202  C  CA  . LEU C 1 258 ? 38.365  -14.226  35.783  1.00 33.46  ? 261  LEU C CA  1 
ATOM   7203  C  C   . LEU C 1 258 ? 37.713  -14.253  37.172  1.00 35.06  ? 261  LEU C C   1 
ATOM   7204  O  O   . LEU C 1 258 ? 38.281  -13.760  38.162  1.00 36.20  ? 261  LEU C O   1 
ATOM   7205  C  CB  . LEU C 1 258 ? 39.803  -14.747  35.863  1.00 31.09  ? 261  LEU C CB  1 
ATOM   7206  C  CG  . LEU C 1 258 ? 40.055  -15.985  36.729  1.00 29.79  ? 261  LEU C CG  1 
ATOM   7207  C  CD1 . LEU C 1 258 ? 39.325  -17.200  36.177  1.00 29.68  ? 261  LEU C CD1 1 
ATOM   7208  C  CD2 . LEU C 1 258 ? 41.543  -16.248  36.830  1.00 28.87  ? 261  LEU C CD2 1 
ATOM   7209  N  N   . ALA C 1 259 ? 36.511  -14.815  37.237  1.00 34.19  ? 262  ALA C N   1 
ATOM   7210  C  CA  . ALA C 1 259 ? 35.924  -15.198  38.513  1.00 33.89  ? 262  ALA C CA  1 
ATOM   7211  C  C   . ALA C 1 259 ? 36.352  -16.635  38.820  1.00 36.03  ? 262  ALA C C   1 
ATOM   7212  O  O   . ALA C 1 259 ? 36.017  -17.563  38.074  1.00 39.96  ? 262  ALA C O   1 
ATOM   7213  C  CB  . ALA C 1 259 ? 34.418  -15.082  38.459  1.00 30.81  ? 262  ALA C CB  1 
ATOM   7214  N  N   . LEU C 1 260 ? 37.100  -16.800  39.909  1.00 33.79  ? 263  LEU C N   1 
ATOM   7215  C  CA  . LEU C 1 260 ? 37.722  -18.064  40.285  1.00 31.63  ? 263  LEU C CA  1 
ATOM   7216  C  C   . LEU C 1 260 ? 37.360  -18.431  41.721  1.00 31.70  ? 263  LEU C C   1 
ATOM   7217  O  O   . LEU C 1 260 ? 37.484  -17.601  42.636  1.00 32.32  ? 263  LEU C O   1 
ATOM   7218  C  CB  . LEU C 1 260 ? 39.249  -17.951  40.151  1.00 30.84  ? 263  LEU C CB  1 
ATOM   7219  C  CG  . LEU C 1 260 ? 40.067  -19.177  40.568  1.00 30.60  ? 263  LEU C CG  1 
ATOM   7220  C  CD1 . LEU C 1 260 ? 39.674  -20.419  39.769  1.00 30.34  ? 263  LEU C CD1 1 
ATOM   7221  C  CD2 . LEU C 1 260 ? 41.551  -18.874  40.420  1.00 28.98  ? 263  LEU C CD2 1 
ATOM   7222  N  N   . LEU C 1 261 ? 36.932  -19.676  41.921  1.00 29.64  ? 264  LEU C N   1 
ATOM   7223  C  CA  . LEU C 1 261 ? 36.442  -20.123  43.219  1.00 26.87  ? 264  LEU C CA  1 
ATOM   7224  C  C   . LEU C 1 261 ? 37.482  -20.815  44.068  1.00 26.62  ? 264  LEU C C   1 
ATOM   7225  O  O   . LEU C 1 261 ? 37.227  -21.136  45.237  1.00 25.29  ? 264  LEU C O   1 
ATOM   7226  C  CB  . LEU C 1 261 ? 35.248  -21.055  43.059  1.00 26.21  ? 264  LEU C CB  1 
ATOM   7227  C  CG  . LEU C 1 261 ? 33.863  -20.440  43.027  1.00 24.76  ? 264  LEU C CG  1 
ATOM   7228  C  CD1 . LEU C 1 261 ? 33.718  -19.476  41.862  1.00 26.12  ? 264  LEU C CD1 1 
ATOM   7229  C  CD2 . LEU C 1 261 ? 32.853  -21.568  42.962  1.00 25.44  ? 264  LEU C CD2 1 
ATOM   7230  N  N   . HIS C 1 262 ? 38.655  -21.039  43.494  1.00 26.53  ? 265  HIS C N   1 
ATOM   7231  C  CA  . HIS C 1 262 ? 39.648  -21.889  44.140  1.00 27.92  ? 265  HIS C CA  1 
ATOM   7232  C  C   . HIS C 1 262 ? 41.033  -21.338  44.017  1.00 27.37  ? 265  HIS C C   1 
ATOM   7233  O  O   . HIS C 1 262 ? 41.235  -20.308  43.368  1.00 29.49  ? 265  HIS C O   1 
ATOM   7234  C  CB  . HIS C 1 262 ? 39.541  -23.308  43.574  1.00 27.90  ? 265  HIS C CB  1 
ATOM   7235  C  CG  . HIS C 1 262 ? 38.359  -24.066  44.106  1.00 27.28  ? 265  HIS C CG  1 
ATOM   7236  N  ND1 . HIS C 1 262 ? 38.420  -24.786  45.242  1.00 28.55  ? 265  HIS C ND1 1 
ATOM   7237  C  CD2 . HIS C 1 262 ? 37.051  -24.174  43.635  1.00 26.38  ? 265  HIS C CD2 1 
ATOM   7238  C  CE1 . HIS C 1 262 ? 37.211  -25.343  45.483  1.00 28.49  ? 265  HIS C CE1 1 
ATOM   7239  N  NE2 . HIS C 1 262 ? 36.373  -24.959  44.501  1.00 28.55  ? 265  HIS C NE2 1 
ATOM   7240  N  N   . SER C 1 263 ? 41.995  -21.990  44.652  1.00 25.98  ? 266  SER C N   1 
ATOM   7241  C  CA  . SER C 1 263 ? 43.377  -21.514  44.631  1.00 28.96  ? 266  SER C CA  1 
ATOM   7242  C  C   . SER C 1 263 ? 44.049  -21.596  43.260  1.00 31.90  ? 266  SER C C   1 
ATOM   7243  O  O   . SER C 1 263 ? 44.903  -20.761  42.937  1.00 33.93  ? 266  SER C O   1 
ATOM   7244  C  CB  . SER C 1 263 ? 44.215  -22.284  45.647  1.00 28.63  ? 266  SER C CB  1 
ATOM   7245  O  OG  . SER C 1 263 ? 43.920  -23.669  45.568  1.00 29.16  ? 266  SER C OG  1 
ATOM   7246  N  N   . HIS C 1 264 ? 43.651  -22.590  42.457  1.00 33.79  ? 267  HIS C N   1 
ATOM   7247  C  CA  . HIS C 1 264 ? 44.390  -22.974  41.242  1.00 34.86  ? 267  HIS C CA  1 
ATOM   7248  C  C   . HIS C 1 264 ? 43.603  -22.906  39.956  1.00 35.52  ? 267  HIS C C   1 
ATOM   7249  O  O   . HIS C 1 264 ? 42.426  -23.296  39.902  1.00 35.43  ? 267  HIS C O   1 
ATOM   7250  C  CB  . HIS C 1 264 ? 44.986  -24.367  41.411  1.00 34.78  ? 267  HIS C CB  1 
ATOM   7251  C  CG  . HIS C 1 264 ? 46.216  -24.393  42.278  1.00 36.99  ? 267  HIS C CG  1 
ATOM   7252  N  ND1 . HIS C 1 264 ? 46.160  -24.264  43.624  1.00 37.86  ? 267  HIS C ND1 1 
ATOM   7253  C  CD2 . HIS C 1 264 ? 47.564  -24.518  41.949  1.00 36.80  ? 267  HIS C CD2 1 
ATOM   7254  C  CE1 . HIS C 1 264 ? 47.409  -24.318  44.128  1.00 37.00  ? 267  HIS C CE1 1 
ATOM   7255  N  NE2 . HIS C 1 264 ? 48.265  -24.474  43.105  1.00 38.26  ? 267  HIS C NE2 1 
ATOM   7256  N  N   . LEU C 1 265 ? 44.265  -22.401  38.918  1.00 33.68  ? 268  LEU C N   1 
ATOM   7257  C  CA  . LEU C 1 265 ? 43.747  -22.416  37.559  1.00 34.84  ? 268  LEU C CA  1 
ATOM   7258  C  C   . LEU C 1 265 ? 44.216  -23.665  36.836  1.00 35.13  ? 268  LEU C C   1 
ATOM   7259  O  O   . LEU C 1 265 ? 43.669  -24.033  35.817  1.00 33.41  ? 268  LEU C O   1 
ATOM   7260  C  CB  . LEU C 1 265 ? 44.267  -21.216  36.782  1.00 34.84  ? 268  LEU C CB  1 
ATOM   7261  C  CG  . LEU C 1 265 ? 43.493  -19.918  36.647  1.00 34.02  ? 268  LEU C CG  1 
ATOM   7262  C  CD1 . LEU C 1 265 ? 44.291  -19.031  35.697  1.00 32.18  ? 268  LEU C CD1 1 
ATOM   7263  C  CD2 . LEU C 1 265 ? 42.086  -20.161  36.123  1.00 31.70  ? 268  LEU C CD2 1 
ATOM   7264  N  N   . GLY C 1 266 ? 45.249  -24.299  37.369  1.00 37.91  ? 269  GLY C N   1 
ATOM   7265  C  CA  . GLY C 1 266 ? 45.794  -25.519  36.795  1.00 38.94  ? 269  GLY C CA  1 
ATOM   7266  C  C   . GLY C 1 266 ? 46.740  -26.088  37.823  1.00 42.19  ? 269  GLY C C   1 
ATOM   7267  O  O   . GLY C 1 266 ? 47.057  -25.416  38.801  1.00 43.19  ? 269  GLY C O   1 
ATOM   7268  N  N   . SER C 1 267 ? 47.198  -27.317  37.609  1.00 41.97  ? 270  SER C N   1 
ATOM   7269  C  CA  . SER C 1 267 ? 48.105  -27.966  38.540  1.00 41.99  ? 270  SER C CA  1 
ATOM   7270  C  C   . SER C 1 267 ? 49.420  -27.200  38.702  1.00 42.68  ? 270  SER C C   1 
ATOM   7271  O  O   . SER C 1 267 ? 50.214  -27.504  39.582  1.00 41.13  ? 270  SER C O   1 
ATOM   7272  C  CB  . SER C 1 267 ? 48.395  -29.381  38.067  1.00 43.22  ? 270  SER C CB  1 
ATOM   7273  O  OG  . SER C 1 267 ? 49.164  -29.325  36.882  1.00 43.58  ? 270  SER C OG  1 
ATOM   7274  N  N   . GLU C 1 268 ? 49.666  -26.230  37.826  1.00 43.66  ? 271  GLU C N   1 
ATOM   7275  C  CA  . GLU C 1 268 ? 50.893  -25.433  37.903  1.00 43.98  ? 271  GLU C CA  1 
ATOM   7276  C  C   . GLU C 1 268 ? 50.622  -23.943  37.701  1.00 42.08  ? 271  GLU C C   1 
ATOM   7277  O  O   . GLU C 1 268 ? 51.519  -23.166  37.390  1.00 44.34  ? 271  GLU C O   1 
ATOM   7278  C  CB  . GLU C 1 268 ? 51.952  -25.969  36.938  1.00 43.89  ? 271  GLU C CB  1 
ATOM   7279  C  CG  . GLU C 1 268 ? 52.586  -27.252  37.455  1.00 46.87  ? 271  GLU C CG  1 
ATOM   7280  C  CD  . GLU C 1 268 ? 53.753  -27.730  36.623  1.00 49.37  ? 271  GLU C CD  1 
ATOM   7281  O  OE1 . GLU C 1 268 ? 53.659  -27.687  35.375  1.00 49.83  ? 271  GLU C OE1 1 
ATOM   7282  O  OE2 . GLU C 1 268 ? 54.759  -28.157  37.231  1.00 50.08  ? 271  GLU C OE2 1 
ATOM   7283  N  N   . MET C 1 269 ? 49.370  -23.561  37.908  1.00 38.14  ? 272  MET C N   1 
ATOM   7284  C  CA  . MET C 1 269 ? 48.971  -22.176  37.862  1.00 37.03  ? 272  MET C CA  1 
ATOM   7285  C  C   . MET C 1 269 ? 48.371  -21.760  39.222  1.00 34.29  ? 272  MET C C   1 
ATOM   7286  O  O   . MET C 1 269 ? 47.154  -21.806  39.417  1.00 33.18  ? 272  MET C O   1 
ATOM   7287  C  CB  . MET C 1 269 ? 47.993  -21.968  36.699  1.00 38.58  ? 272  MET C CB  1 
ATOM   7288  C  CG  . MET C 1 269 ? 48.596  -22.253  35.323  1.00 41.06  ? 272  MET C CG  1 
ATOM   7289  S  SD  . MET C 1 269 ? 47.598  -21.605  33.961  1.00 48.93  ? 272  MET C SD  1 
ATOM   7290  C  CE  . MET C 1 269 ? 46.416  -22.936  33.719  1.00 48.43  ? 272  MET C CE  1 
ATOM   7291  N  N   . PHE C 1 270 ? 49.229  -21.369  40.162  1.00 32.10  ? 273  PHE C N   1 
ATOM   7292  C  CA  . PHE C 1 270 ? 48.786  -21.004  41.527  1.00 33.66  ? 273  PHE C CA  1 
ATOM   7293  C  C   . PHE C 1 270 ? 48.260  -19.563  41.501  1.00 33.07  ? 273  PHE C C   1 
ATOM   7294  O  O   . PHE C 1 270 ? 48.946  -18.615  41.887  1.00 34.28  ? 273  PHE C O   1 
ATOM   7295  C  CB  . PHE C 1 270 ? 49.945  -21.211  42.526  1.00 34.71  ? 273  PHE C CB  1 
ATOM   7296  C  CG  . PHE C 1 270 ? 49.579  -21.044  43.984  1.00 34.33  ? 273  PHE C CG  1 
ATOM   7297  C  CD1 . PHE C 1 270 ? 48.254  -21.004  44.412  1.00 33.31  ? 273  PHE C CD1 1 
ATOM   7298  C  CD2 . PHE C 1 270 ? 50.597  -20.957  44.950  1.00 36.49  ? 273  PHE C CD2 1 
ATOM   7299  C  CE1 . PHE C 1 270 ? 47.950  -20.880  45.761  1.00 33.56  ? 273  PHE C CE1 1 
ATOM   7300  C  CE2 . PHE C 1 270 ? 50.297  -20.816  46.302  1.00 34.02  ? 273  PHE C CE2 1 
ATOM   7301  C  CZ  . PHE C 1 270 ? 48.969  -20.775  46.705  1.00 34.18  ? 273  PHE C CZ  1 
ATOM   7302  N  N   . ALA C 1 271 ? 47.023  -19.423  41.043  1.00 31.30  ? 274  ALA C N   1 
ATOM   7303  C  CA  . ALA C 1 271 ? 46.487  -18.131  40.634  1.00 33.43  ? 274  ALA C CA  1 
ATOM   7304  C  C   . ALA C 1 271 ? 45.951  -17.266  41.776  1.00 32.74  ? 274  ALA C C   1 
ATOM   7305  O  O   . ALA C 1 271 ? 45.859  -16.046  41.641  1.00 33.09  ? 274  ALA C O   1 
ATOM   7306  C  CB  . ALA C 1 271 ? 45.406  -18.329  39.590  1.00 31.37  ? 274  ALA C CB  1 
ATOM   7307  N  N   . ALA C 1 272 ? 45.567  -17.901  42.876  1.00 32.67  ? 275  ALA C N   1 
ATOM   7308  C  CA  . ALA C 1 272 ? 44.968  -17.177  43.996  1.00 33.19  ? 275  ALA C CA  1 
ATOM   7309  C  C   . ALA C 1 272 ? 45.648  -17.591  45.305  1.00 32.90  ? 275  ALA C C   1 
ATOM   7310  O  O   . ALA C 1 272 ? 45.117  -18.404  46.070  1.00 30.77  ? 275  ALA C O   1 
ATOM   7311  C  CB  . ALA C 1 272 ? 43.466  -17.389  44.032  1.00 32.79  ? 275  ALA C CB  1 
ATOM   7312  N  N   . PRO C 1 273 ? 46.853  -17.037  45.542  1.00 33.59  ? 276  PRO C N   1 
ATOM   7313  C  CA  . PRO C 1 273 ? 47.732  -17.452  46.621  1.00 35.96  ? 276  PRO C CA  1 
ATOM   7314  C  C   . PRO C 1 273 ? 47.498  -16.651  47.905  1.00 38.13  ? 276  PRO C C   1 
ATOM   7315  O  O   . PRO C 1 273 ? 48.296  -16.754  48.844  1.00 36.82  ? 276  PRO C O   1 
ATOM   7316  C  CB  . PRO C 1 273 ? 49.120  -17.144  46.055  1.00 36.34  ? 276  PRO C CB  1 
ATOM   7317  C  CG  . PRO C 1 273 ? 48.903  -15.959  45.146  1.00 35.39  ? 276  PRO C CG  1 
ATOM   7318  C  CD  . PRO C 1 273 ? 47.439  -15.918  44.776  1.00 33.15  ? 276  PRO C CD  1 
ATOM   7319  N  N   . MET C 1 274 ? 46.422  -15.862  47.932  1.00 39.79  ? 277  MET C N   1 
ATOM   7320  C  CA  . MET C 1 274 ? 46.030  -15.171  49.147  1.00 44.26  ? 277  MET C CA  1 
ATOM   7321  C  C   . MET C 1 274 ? 45.568  -16.246  50.151  1.00 47.13  ? 277  MET C C   1 
ATOM   7322  O  O   . MET C 1 274 ? 46.405  -16.934  50.749  1.00 55.72  ? 277  MET C O   1 
ATOM   7323  C  CB  . MET C 1 274 ? 45.035  -14.003  48.881  1.00 43.27  ? 277  MET C CB  1 
ATOM   7324  C  CG  . MET C 1 274 ? 43.835  -14.251  47.956  1.00 44.09  ? 277  MET C CG  1 
ATOM   7325  S  SD  . MET C 1 274 ? 44.056  -14.369  46.152  1.00 41.67  ? 277  MET C SD  1 
ATOM   7326  C  CE  . MET C 1 274 ? 44.817  -12.807  45.723  1.00 41.66  ? 277  MET C CE  1 
ATOM   7327  N  N   . GLY C 1 275 ? 44.280  -16.459  50.326  1.00 44.38  ? 278  GLY C N   1 
ATOM   7328  C  CA  . GLY C 1 275 ? 43.883  -17.584  51.157  1.00 40.66  ? 278  GLY C CA  1 
ATOM   7329  C  C   . GLY C 1 275 ? 42.802  -18.400  50.492  1.00 39.14  ? 278  GLY C C   1 
ATOM   7330  O  O   . GLY C 1 275 ? 42.219  -17.973  49.484  1.00 40.46  ? 278  GLY C O   1 
ATOM   7331  N  N   . ARG C 1 276 ? 42.524  -19.568  51.059  1.00 35.32  ? 279  ARG C N   1 
ATOM   7332  C  CA  . ARG C 1 276 ? 41.396  -20.370  50.625  1.00 37.63  ? 279  ARG C CA  1 
ATOM   7333  C  C   . ARG C 1 276 ? 40.118  -19.537  50.749  1.00 38.05  ? 279  ARG C C   1 
ATOM   7334  O  O   . ARG C 1 276 ? 39.911  -18.876  51.763  1.00 40.33  ? 279  ARG C O   1 
ATOM   7335  C  CB  . ARG C 1 276 ? 41.301  -21.643  51.462  1.00 36.28  ? 279  ARG C CB  1 
ATOM   7336  C  CG  . ARG C 1 276 ? 40.181  -22.562  51.020  1.00 36.73  ? 279  ARG C CG  1 
ATOM   7337  C  CD  . ARG C 1 276 ? 40.329  -23.928  51.663  1.00 34.24  ? 279  ARG C CD  1 
ATOM   7338  N  NE  . ARG C 1 276 ? 39.147  -24.731  51.398  1.00 34.90  ? 279  ARG C NE  1 
ATOM   7339  C  CZ  . ARG C 1 276 ? 38.951  -25.959  51.873  1.00 35.27  ? 279  ARG C CZ  1 
ATOM   7340  N  NH1 . ARG C 1 276 ? 39.873  -26.532  52.656  1.00 34.44  ? 279  ARG C NH1 1 
ATOM   7341  N  NH2 . ARG C 1 276 ? 37.831  -26.613  51.562  1.00 31.64  ? 279  ARG C NH2 1 
ATOM   7342  N  N   . CYS C 1 277 ? 39.290  -19.536  49.711  1.00 36.31  ? 280  CYS C N   1 
ATOM   7343  C  CA  . CYS C 1 277 ? 38.038  -18.799  49.753  1.00 36.64  ? 280  CYS C CA  1 
ATOM   7344  C  C   . CYS C 1 277 ? 37.191  -19.279  50.917  1.00 37.47  ? 280  CYS C C   1 
ATOM   7345  O  O   . CYS C 1 277 ? 37.070  -20.485  51.141  1.00 38.13  ? 280  CYS C O   1 
ATOM   7346  C  CB  . CYS C 1 277 ? 37.250  -18.985  48.464  1.00 36.04  ? 280  CYS C CB  1 
ATOM   7347  S  SG  . CYS C 1 277 ? 37.883  -18.046  47.077  1.00 38.70  ? 280  CYS C SG  1 
ATOM   7348  N  N   . ALA C 1 278 ? 36.613  -18.332  51.653  1.00 35.75  ? 281  ALA C N   1 
ATOM   7349  C  CA  . ALA C 1 278 ? 35.649  -18.655  52.700  1.00 35.35  ? 281  ALA C CA  1 
ATOM   7350  C  C   . ALA C 1 278 ? 34.315  -19.014  52.063  1.00 31.35  ? 281  ALA C C   1 
ATOM   7351  O  O   . ALA C 1 278 ? 34.060  -18.682  50.901  1.00 29.79  ? 281  ALA C O   1 
ATOM   7352  C  CB  . ALA C 1 278 ? 35.471  -17.467  53.646  1.00 36.14  ? 281  ALA C CB  1 
ATOM   7353  N  N   . ALA C 1 279 ? 33.462  -19.666  52.840  1.00 29.28  ? 282  ALA C N   1 
ATOM   7354  C  CA  . ALA C 1 279 ? 32.071  -19.859  52.474  1.00 29.30  ? 282  ALA C CA  1 
ATOM   7355  C  C   . ALA C 1 279 ? 31.501  -18.611  51.790  1.00 29.97  ? 282  ALA C C   1 
ATOM   7356  O  O   . ALA C 1 279 ? 31.495  -17.539  52.382  1.00 31.06  ? 282  ALA C O   1 
ATOM   7357  C  CB  . ALA C 1 279 ? 31.263  -20.194  53.711  1.00 28.96  ? 282  ALA C CB  1 
ATOM   7358  N  N   . GLY C 1 280 ? 31.055  -18.752  50.540  1.00 28.55  ? 283  GLY C N   1 
ATOM   7359  C  CA  . GLY C 1 280 ? 30.262  -17.724  49.869  1.00 28.50  ? 283  GLY C CA  1 
ATOM   7360  C  C   . GLY C 1 280 ? 31.029  -16.591  49.220  1.00 30.03  ? 283  GLY C C   1 
ATOM   7361  O  O   . GLY C 1 280 ? 30.431  -15.613  48.771  1.00 31.29  ? 283  GLY C O   1 
ATOM   7362  N  N   . VAL C 1 281 ? 32.350  -16.724  49.196  1.00 29.76  ? 284  VAL C N   1 
ATOM   7363  C  CA  . VAL C 1 281 ? 33.239  -15.740  48.607  1.00 31.22  ? 284  VAL C CA  1 
ATOM   7364  C  C   . VAL C 1 281 ? 33.919  -16.380  47.412  1.00 31.93  ? 284  VAL C C   1 
ATOM   7365  O  O   . VAL C 1 281 ? 34.288  -17.561  47.473  1.00 28.74  ? 284  VAL C O   1 
ATOM   7366  C  CB  . VAL C 1 281 ? 34.357  -15.335  49.605  1.00 32.44  ? 284  VAL C CB  1 
ATOM   7367  C  CG1 . VAL C 1 281 ? 35.304  -14.296  48.999  1.00 30.76  ? 284  VAL C CG1 1 
ATOM   7368  C  CG2 . VAL C 1 281 ? 33.750  -14.831  50.915  1.00 32.72  ? 284  VAL C CG2 1 
ATOM   7369  N  N   . MET C 1 282 ? 34.111  -15.600  46.345  1.00 31.96  ? 285  MET C N   1 
ATOM   7370  C  CA  . MET C 1 282 ? 34.964  -16.035  45.244  1.00 33.16  ? 285  MET C CA  1 
ATOM   7371  C  C   . MET C 1 282 ? 35.922  -14.927  44.800  1.00 32.64  ? 285  MET C C   1 
ATOM   7372  O  O   . MET C 1 282 ? 35.613  -13.746  44.960  1.00 32.16  ? 285  MET C O   1 
ATOM   7373  C  CB  . MET C 1 282 ? 34.114  -16.591  44.086  1.00 33.77  ? 285  MET C CB  1 
ATOM   7374  C  CG  . MET C 1 282 ? 33.728  -15.588  43.008  1.00 36.74  ? 285  MET C CG  1 
ATOM   7375  S  SD  . MET C 1 282 ? 32.103  -15.881  42.290  1.00 38.93  ? 285  MET C SD  1 
ATOM   7376  C  CE  . MET C 1 282 ? 32.332  -15.246  40.654  1.00 38.71  ? 285  MET C CE  1 
ATOM   7377  N  N   . HIS C 1 283 ? 37.080  -15.317  44.258  1.00 32.18  ? 286  HIS C N   1 
ATOM   7378  C  CA  . HIS C 1 283 ? 38.055  -14.370  43.724  1.00 31.56  ? 286  HIS C CA  1 
ATOM   7379  C  C   . HIS C 1 283 ? 37.610  -13.797  42.411  1.00 34.71  ? 286  HIS C C   1 
ATOM   7380  O  O   . HIS C 1 283 ? 37.078  -14.516  41.558  1.00 35.72  ? 286  HIS C O   1 
ATOM   7381  C  CB  . HIS C 1 283 ? 39.383  -15.051  43.481  1.00 31.97  ? 286  HIS C CB  1 
ATOM   7382  C  CG  . HIS C 1 283 ? 39.947  -15.758  44.682  1.00 32.78  ? 286  HIS C CG  1 
ATOM   7383  N  ND1 . HIS C 1 283 ? 40.197  -17.076  44.686  1.00 34.44  ? 286  HIS C ND1 1 
ATOM   7384  C  CD2 . HIS C 1 283 ? 40.350  -15.279  45.921  1.00 32.68  ? 286  HIS C CD2 1 
ATOM   7385  C  CE1 . HIS C 1 283 ? 40.712  -17.431  45.879  1.00 34.56  ? 286  HIS C CE1 1 
ATOM   7386  N  NE2 . HIS C 1 283 ? 40.816  -16.328  46.629  1.00 32.56  ? 286  HIS C NE2 1 
ATOM   7387  N  N   . LEU C 1 284 ? 37.836  -12.498  42.221  1.00 34.51  ? 287  LEU C N   1 
ATOM   7388  C  CA  . LEU C 1 284 ? 37.607  -11.849  40.934  1.00 35.25  ? 287  LEU C CA  1 
ATOM   7389  C  C   . LEU C 1 284 ? 38.878  -11.127  40.501  1.00 36.28  ? 287  LEU C C   1 
ATOM   7390  O  O   . LEU C 1 284 ? 39.428  -10.316  41.240  1.00 36.53  ? 287  LEU C O   1 
ATOM   7391  C  CB  . LEU C 1 284 ? 36.422  -10.879  41.000  1.00 34.29  ? 287  LEU C CB  1 
ATOM   7392  C  CG  . LEU C 1 284 ? 36.000  -10.135  39.728  1.00 34.97  ? 287  LEU C CG  1 
ATOM   7393  C  CD1 . LEU C 1 284 ? 35.522  -11.078  38.619  1.00 34.10  ? 287  LEU C CD1 1 
ATOM   7394  C  CD2 . LEU C 1 284 ? 34.896  -9.147   40.051  1.00 34.10  ? 287  LEU C CD2 1 
ATOM   7395  N  N   . PHE C 1 285 ? 39.366  -11.464  39.316  1.00 37.64  ? 288  PHE C N   1 
ATOM   7396  C  CA  . PHE C 1 285 ? 40.522  -10.804  38.759  1.00 37.12  ? 288  PHE C CA  1 
ATOM   7397  C  C   . PHE C 1 285 ? 40.105  -10.116  37.465  1.00 40.89  ? 288  PHE C C   1 
ATOM   7398  O  O   . PHE C 1 285 ? 39.226  -10.599  36.735  1.00 39.74  ? 288  PHE C O   1 
ATOM   7399  C  CB  . PHE C 1 285 ? 41.599  -11.810  38.411  1.00 34.67  ? 288  PHE C CB  1 
ATOM   7400  C  CG  . PHE C 1 285 ? 42.154  -12.559  39.576  1.00 33.97  ? 288  PHE C CG  1 
ATOM   7401  C  CD1 . PHE C 1 285 ? 43.268  -12.082  40.257  1.00 34.47  ? 288  PHE C CD1 1 
ATOM   7402  C  CD2 . PHE C 1 285 ? 41.611  -13.774  39.958  1.00 32.43  ? 288  PHE C CD2 1 
ATOM   7403  C  CE1 . PHE C 1 285 ? 43.806  -12.794  41.317  1.00 33.07  ? 288  PHE C CE1 1 
ATOM   7404  C  CE2 . PHE C 1 285 ? 42.152  -14.492  41.010  1.00 30.10  ? 288  PHE C CE2 1 
ATOM   7405  C  CZ  . PHE C 1 285 ? 43.253  -14.008  41.683  1.00 31.61  ? 288  PHE C CZ  1 
ATOM   7406  N  N   . TYR C 1 286 ? 40.722  -8.978   37.186  1.00 42.15  ? 289  TYR C N   1 
ATOM   7407  C  CA  . TYR C 1 286 ? 40.728  -8.476   35.823  1.00 45.83  ? 289  TYR C CA  1 
ATOM   7408  C  C   . TYR C 1 286 ? 42.050  -7.836   35.495  1.00 46.34  ? 289  TYR C C   1 
ATOM   7409  O  O   . TYR C 1 286 ? 42.774  -7.388   36.384  1.00 46.14  ? 289  TYR C O   1 
ATOM   7410  C  CB  . TYR C 1 286 ? 39.524  -7.585   35.471  1.00 48.46  ? 289  TYR C CB  1 
ATOM   7411  C  CG  . TYR C 1 286 ? 39.298  -6.347   36.313  1.00 54.56  ? 289  TYR C CG  1 
ATOM   7412  C  CD1 . TYR C 1 286 ? 39.884  -5.122   35.973  1.00 56.53  ? 289  TYR C CD1 1 
ATOM   7413  C  CD2 . TYR C 1 286 ? 38.440  -6.381   37.416  1.00 56.43  ? 289  TYR C CD2 1 
ATOM   7414  C  CE1 . TYR C 1 286 ? 39.638  -3.975   36.728  1.00 57.85  ? 289  TYR C CE1 1 
ATOM   7415  C  CE2 . TYR C 1 286 ? 38.189  -5.244   38.176  1.00 57.50  ? 289  TYR C CE2 1 
ATOM   7416  C  CZ  . TYR C 1 286 ? 38.790  -4.044   37.834  1.00 57.92  ? 289  TYR C CZ  1 
ATOM   7417  O  OH  . TYR C 1 286 ? 38.540  -2.924   38.602  1.00 57.44  ? 289  TYR C OH  1 
ATOM   7418  N  N   . VAL C 1 287 ? 42.376  -7.851   34.210  1.00 46.11  ? 290  VAL C N   1 
ATOM   7419  C  CA  . VAL C 1 287 ? 43.511  -7.134   33.700  1.00 46.79  ? 290  VAL C CA  1 
ATOM   7420  C  C   . VAL C 1 287 ? 42.970  -6.133   32.685  1.00 50.14  ? 290  VAL C C   1 
ATOM   7421  O  O   . VAL C 1 287 ? 42.359  -6.506   31.671  1.00 49.91  ? 290  VAL C O   1 
ATOM   7422  C  CB  . VAL C 1 287 ? 44.545  -8.080   33.081  1.00 47.72  ? 290  VAL C CB  1 
ATOM   7423  C  CG1 . VAL C 1 287 ? 45.652  -7.282   32.414  1.00 48.84  ? 290  VAL C CG1 1 
ATOM   7424  C  CG2 . VAL C 1 287 ? 45.115  -9.018   34.143  1.00 47.65  ? 290  VAL C CG2 1 
ATOM   7425  N  N   . ARG C 1 288 ? 43.174  -4.853   32.990  1.00 53.00  ? 291  ARG C N   1 
ATOM   7426  C  CA  . ARG C 1 288 ? 42.692  -3.760   32.146  1.00 52.41  ? 291  ARG C CA  1 
ATOM   7427  C  C   . ARG C 1 288 ? 43.539  -3.667   30.890  1.00 50.74  ? 291  ARG C C   1 
ATOM   7428  O  O   . ARG C 1 288 ? 44.756  -3.954   30.915  1.00 44.42  ? 291  ARG C O   1 
ATOM   7429  C  CB  . ARG C 1 288 ? 42.728  -2.425   32.901  1.00 55.63  ? 291  ARG C CB  1 
ATOM   7430  C  CG  . ARG C 1 288 ? 42.221  -2.502   34.336  1.00 62.55  ? 291  ARG C CG  1 
ATOM   7431  C  CD  . ARG C 1 288 ? 41.881  -1.135   34.907  1.00 66.18  ? 291  ARG C CD  1 
ATOM   7432  N  NE  . ARG C 1 288 ? 43.040  -0.250   34.991  1.00 70.78  ? 291  ARG C NE  1 
ATOM   7433  C  CZ  . ARG C 1 288 ? 43.730  -0.014   36.105  1.00 73.19  ? 291  ARG C CZ  1 
ATOM   7434  N  NH1 . ARG C 1 288 ? 43.383  -0.593   37.249  1.00 74.91  ? 291  ARG C NH1 1 
ATOM   7435  N  NH2 . ARG C 1 288 ? 44.772  0.804    36.076  1.00 73.93  ? 291  ARG C NH2 1 
ATOM   7436  N  N   . ALA C 1 289 ? 42.891  -3.278   29.791  1.00 52.00  ? 292  ALA C N   1 
ATOM   7437  C  CA  . ALA C 1 289 ? 43.600  -3.033   28.532  1.00 54.18  ? 292  ALA C CA  1 
ATOM   7438  C  C   . ALA C 1 289 ? 44.669  -1.962   28.754  1.00 53.31  ? 292  ALA C C   1 
ATOM   7439  O  O   . ALA C 1 289 ? 44.401  -0.917   29.363  1.00 54.62  ? 292  ALA C O   1 
ATOM   7440  C  CB  . ALA C 1 289 ? 42.632  -2.621   27.436  1.00 54.73  ? 292  ALA C CB  1 
ATOM   7441  N  N   . GLY C 1 290 ? 45.887  -2.247   28.304  1.00 51.68  ? 293  GLY C N   1 
ATOM   7442  C  CA  . GLY C 1 290 ? 47.000  -1.344   28.525  1.00 50.33  ? 293  GLY C CA  1 
ATOM   7443  C  C   . GLY C 1 290 ? 48.306  -2.041   28.823  1.00 50.05  ? 293  GLY C C   1 
ATOM   7444  O  O   . GLY C 1 290 ? 49.368  -1.514   28.500  1.00 53.10  ? 293  GLY C O   1 
ATOM   7445  N  N   . VAL C 1 291 ? 48.241  -3.219   29.436  1.00 49.28  ? 294  VAL C N   1 
ATOM   7446  C  CA  . VAL C 1 291 ? 49.461  -3.964   29.797  1.00 52.11  ? 294  VAL C CA  1 
ATOM   7447  C  C   . VAL C 1 291 ? 50.288  -4.346   28.577  1.00 52.42  ? 294  VAL C C   1 
ATOM   7448  O  O   . VAL C 1 291 ? 49.743  -4.670   27.509  1.00 48.87  ? 294  VAL C O   1 
ATOM   7449  C  CB  . VAL C 1 291 ? 49.168  -5.286   30.543  1.00 52.81  ? 294  VAL C CB  1 
ATOM   7450  C  CG1 . VAL C 1 291 ? 50.227  -5.545   31.610  1.00 51.25  ? 294  VAL C CG1 1 
ATOM   7451  C  CG2 . VAL C 1 291 ? 47.774  -5.269   31.141  1.00 56.16  ? 294  VAL C CG2 1 
ATOM   7452  N  N   . SER C 1 292 ? 51.604  -4.325   28.766  1.00 53.26  ? 295  SER C N   1 
ATOM   7453  C  CA  . SER C 1 292 ? 52.546  -4.767   27.756  1.00 56.95  ? 295  SER C CA  1 
ATOM   7454  C  C   . SER C 1 292 ? 52.527  -6.293   27.686  1.00 60.63  ? 295  SER C C   1 
ATOM   7455  O  O   . SER C 1 292 ? 52.196  -6.966   28.672  1.00 62.68  ? 295  SER C O   1 
ATOM   7456  C  CB  . SER C 1 292 ? 53.965  -4.265   28.084  1.00 58.24  ? 295  SER C CB  1 
ATOM   7457  O  OG  . SER C 1 292 ? 54.564  -4.993   29.156  1.00 57.33  ? 295  SER C OG  1 
ATOM   7458  N  N   . ARG C 1 293 ? 52.881  -6.826   26.518  1.00 61.83  ? 296  ARG C N   1 
ATOM   7459  C  CA  . ARG C 1 293 ? 53.072  -8.263   26.336  1.00 63.46  ? 296  ARG C CA  1 
ATOM   7460  C  C   . ARG C 1 293 ? 54.088  -8.791   27.359  1.00 61.92  ? 296  ARG C C   1 
ATOM   7461  O  O   . ARG C 1 293 ? 53.854  -9.820   28.000  1.00 64.07  ? 296  ARG C O   1 
ATOM   7462  C  CB  . ARG C 1 293 ? 53.514  -8.575   24.891  1.00 65.14  ? 296  ARG C CB  1 
ATOM   7463  C  CG  . ARG C 1 293 ? 52.435  -8.381   23.823  1.00 65.72  ? 296  ARG C CG  1 
ATOM   7464  C  CD  . ARG C 1 293 ? 52.905  -7.465   22.695  1.00 69.47  ? 296  ARG C CD  1 
ATOM   7465  N  NE  . ARG C 1 293 ? 52.563  -6.053   22.947  1.00 73.79  ? 296  ARG C NE  1 
ATOM   7466  C  CZ  . ARG C 1 293 ? 53.337  -5.156   23.574  1.00 69.00  ? 296  ARG C CZ  1 
ATOM   7467  N  NH1 . ARG C 1 293 ? 52.897  -3.915   23.736  1.00 66.87  ? 296  ARG C NH1 1 
ATOM   7468  N  NH2 . ARG C 1 293 ? 54.541  -5.480   24.044  1.00 64.53  ? 296  ARG C NH2 1 
ATOM   7469  N  N   . ALA C 1 294 ? 55.195  -8.068   27.530  1.00 59.87  ? 297  ALA C N   1 
ATOM   7470  C  CA  . ALA C 1 294 ? 56.265  -8.486   28.443  1.00 59.40  ? 297  ALA C CA  1 
ATOM   7471  C  C   . ALA C 1 294 ? 55.811  -8.607   29.907  1.00 57.54  ? 297  ALA C C   1 
ATOM   7472  O  O   . ALA C 1 294 ? 56.210  -9.547   30.598  1.00 56.08  ? 297  ALA C O   1 
ATOM   7473  C  CB  . ALA C 1 294 ? 57.467  -7.558   28.321  1.00 59.53  ? 297  ALA C CB  1 
ATOM   7474  N  N   . MET C 1 295 ? 54.982  -7.663   30.364  1.00 57.04  ? 298  MET C N   1 
ATOM   7475  C  CA  . MET C 1 295 ? 54.466  -7.677   31.736  1.00 58.61  ? 298  MET C CA  1 
ATOM   7476  C  C   . MET C 1 295 ? 53.471  -8.823   31.970  1.00 54.40  ? 298  MET C C   1 
ATOM   7477  O  O   . MET C 1 295 ? 53.622  -9.578   32.938  1.00 49.08  ? 298  MET C O   1 
ATOM   7478  C  CB  . MET C 1 295 ? 53.864  -6.315   32.128  1.00 62.42  ? 298  MET C CB  1 
ATOM   7479  C  CG  . MET C 1 295 ? 53.334  -6.231   33.563  1.00 68.16  ? 298  MET C CG  1 
ATOM   7480  S  SD  . MET C 1 295 ? 54.521  -6.458   34.923  1.00 75.62  ? 298  MET C SD  1 
ATOM   7481  C  CE  . MET C 1 295 ? 55.001  -4.767   35.299  1.00 67.15  ? 298  MET C CE  1 
ATOM   7482  N  N   . LEU C 1 296 ? 52.475  -8.953   31.087  1.00 50.90  ? 299  LEU C N   1 
ATOM   7483  C  CA  . LEU C 1 296 ? 51.562  -10.105  31.096  1.00 49.50  ? 299  LEU C CA  1 
ATOM   7484  C  C   . LEU C 1 296 ? 52.315  -11.426  31.170  1.00 49.53  ? 299  LEU C C   1 
ATOM   7485  O  O   . LEU C 1 296 ? 51.932  -12.322  31.929  1.00 48.79  ? 299  LEU C O   1 
ATOM   7486  C  CB  . LEU C 1 296 ? 50.677  -10.127  29.856  1.00 48.37  ? 299  LEU C CB  1 
ATOM   7487  C  CG  . LEU C 1 296 ? 49.171  -9.884   29.945  1.00 50.00  ? 299  LEU C CG  1 
ATOM   7488  C  CD1 . LEU C 1 296 ? 48.547  -10.243  28.601  1.00 51.94  ? 299  LEU C CD1 1 
ATOM   7489  C  CD2 . LEU C 1 296 ? 48.500  -10.677  31.064  1.00 48.14  ? 299  LEU C CD2 1 
ATOM   7490  N  N   . LEU C 1 297 ? 53.386  -11.531  30.386  1.00 46.61  ? 300  LEU C N   1 
ATOM   7491  C  CA  . LEU C 1 297 ? 54.247  -12.701  30.401  1.00 47.37  ? 300  LEU C CA  1 
ATOM   7492  C  C   . LEU C 1 297 ? 54.874  -12.952  31.764  1.00 47.36  ? 300  LEU C C   1 
ATOM   7493  O  O   . LEU C 1 297 ? 54.884  -14.087  32.232  1.00 44.74  ? 300  LEU C O   1 
ATOM   7494  C  CB  . LEU C 1 297 ? 55.342  -12.595  29.335  1.00 47.57  ? 300  LEU C CB  1 
ATOM   7495  C  CG  . LEU C 1 297 ? 56.368  -13.736  29.332  1.00 49.65  ? 300  LEU C CG  1 
ATOM   7496  C  CD1 . LEU C 1 297 ? 55.703  -15.085  29.085  1.00 49.86  ? 300  LEU C CD1 1 
ATOM   7497  C  CD2 . LEU C 1 297 ? 57.454  -13.488  28.297  1.00 52.63  ? 300  LEU C CD2 1 
ATOM   7498  N  N   . ARG C 1 298 ? 55.419  -11.906  32.385  1.00 50.91  ? 301  ARG C N   1 
ATOM   7499  C  CA  . ARG C 1 298 ? 56.044  -12.054  33.707  1.00 53.95  ? 301  ARG C CA  1 
ATOM   7500  C  C   . ARG C 1 298 ? 55.051  -12.539  34.760  1.00 49.68  ? 301  ARG C C   1 
ATOM   7501  O  O   . ARG C 1 298 ? 55.392  -13.371  35.608  1.00 48.82  ? 301  ARG C O   1 
ATOM   7502  C  CB  . ARG C 1 298 ? 56.725  -10.755  34.163  1.00 60.12  ? 301  ARG C CB  1 
ATOM   7503  C  CG  . ARG C 1 298 ? 58.233  -10.747  33.933  1.00 67.07  ? 301  ARG C CG  1 
ATOM   7504  C  CD  . ARG C 1 298 ? 58.877  -9.408   34.282  1.00 72.07  ? 301  ARG C CD  1 
ATOM   7505  N  NE  . ARG C 1 298 ? 58.674  -8.391   33.248  1.00 76.19  ? 301  ARG C NE  1 
ATOM   7506  C  CZ  . ARG C 1 298 ? 58.102  -7.203   33.450  1.00 78.56  ? 301  ARG C CZ  1 
ATOM   7507  N  NH1 . ARG C 1 298 ? 57.682  -6.854   34.664  1.00 78.34  ? 301  ARG C NH1 1 
ATOM   7508  N  NH2 . ARG C 1 298 ? 57.962  -6.354   32.433  1.00 75.36  ? 301  ARG C NH2 1 
ATOM   7509  N  N   . LEU C 1 299 ? 53.825  -12.028  34.683  1.00 47.91  ? 302  LEU C N   1 
ATOM   7510  C  CA  . LEU C 1 299 ? 52.754  -12.422  35.600  1.00 50.06  ? 302  LEU C CA  1 
ATOM   7511  C  C   . LEU C 1 299 ? 52.389  -13.892  35.437  1.00 48.63  ? 302  LEU C C   1 
ATOM   7512  O  O   . LEU C 1 299 ? 52.332  -14.628  36.431  1.00 44.51  ? 302  LEU C O   1 
ATOM   7513  C  CB  . LEU C 1 299 ? 51.509  -11.547  35.411  1.00 50.96  ? 302  LEU C CB  1 
ATOM   7514  C  CG  . LEU C 1 299 ? 51.548  -10.091  35.891  1.00 54.31  ? 302  LEU C CG  1 
ATOM   7515  C  CD1 . LEU C 1 299 ? 50.264  -9.372   35.483  1.00 53.12  ? 302  LEU C CD1 1 
ATOM   7516  C  CD2 . LEU C 1 299 ? 51.783  -9.988   37.397  1.00 51.20  ? 302  LEU C CD2 1 
ATOM   7517  N  N   . PHE C 1 300 ? 52.166  -14.301  34.183  1.00 48.35  ? 303  PHE C N   1 
ATOM   7518  C  CA  . PHE C 1 300 ? 51.831  -15.686  33.840  1.00 49.54  ? 303  PHE C CA  1 
ATOM   7519  C  C   . PHE C 1 300 ? 52.857  -16.672  34.377  1.00 46.61  ? 303  PHE C C   1 
ATOM   7520  O  O   . PHE C 1 300 ? 52.490  -17.672  34.976  1.00 43.33  ? 303  PHE C O   1 
ATOM   7521  C  CB  . PHE C 1 300 ? 51.654  -15.868  32.323  1.00 52.63  ? 303  PHE C CB  1 
ATOM   7522  C  CG  . PHE C 1 300 ? 51.278  -17.273  31.917  1.00 53.34  ? 303  PHE C CG  1 
ATOM   7523  C  CD1 . PHE C 1 300 ? 49.994  -17.761  32.150  1.00 52.46  ? 303  PHE C CD1 1 
ATOM   7524  C  CD2 . PHE C 1 300 ? 52.205  -18.108  31.307  1.00 55.52  ? 303  PHE C CD2 1 
ATOM   7525  C  CE1 . PHE C 1 300 ? 49.640  -19.049  31.782  1.00 53.17  ? 303  PHE C CE1 1 
ATOM   7526  C  CE2 . PHE C 1 300 ? 51.859  -19.404  30.934  1.00 55.52  ? 303  PHE C CE2 1 
ATOM   7527  C  CZ  . PHE C 1 300 ? 50.575  -19.874  31.174  1.00 54.86  ? 303  PHE C CZ  1 
ATOM   7528  N  N   . LEU C 1 301 ? 54.136  -16.368  34.179  1.00 47.13  ? 304  LEU C N   1 
ATOM   7529  C  CA  . LEU C 1 301 ? 55.214  -17.238  34.649  1.00 48.86  ? 304  LEU C CA  1 
ATOM   7530  C  C   . LEU C 1 301 ? 55.354  -17.198  36.168  1.00 49.48  ? 304  LEU C C   1 
ATOM   7531  O  O   . LEU C 1 301 ? 55.705  -18.208  36.792  1.00 46.90  ? 304  LEU C O   1 
ATOM   7532  C  CB  . LEU C 1 301 ? 56.540  -16.864  33.981  1.00 49.61  ? 304  LEU C CB  1 
ATOM   7533  C  CG  . LEU C 1 301 ? 56.520  -16.622  32.463  1.00 52.85  ? 304  LEU C CG  1 
ATOM   7534  C  CD1 . LEU C 1 301 ? 57.906  -16.226  31.982  1.00 54.68  ? 304  LEU C CD1 1 
ATOM   7535  C  CD2 . LEU C 1 301 ? 56.003  -17.817  31.670  1.00 51.46  ? 304  LEU C CD2 1 
ATOM   7536  N  N   . ALA C 1 302 ? 55.086  -16.026  36.753  1.00 49.37  ? 305  ALA C N   1 
ATOM   7537  C  CA  . ALA C 1 302 ? 55.146  -15.856  38.206  1.00 48.72  ? 305  ALA C CA  1 
ATOM   7538  C  C   . ALA C 1 302 ? 54.074  -16.698  38.878  1.00 45.90  ? 305  ALA C C   1 
ATOM   7539  O  O   . ALA C 1 302 ? 54.313  -17.277  39.934  1.00 42.69  ? 305  ALA C O   1 
ATOM   7540  C  CB  . ALA C 1 302 ? 54.997  -14.391  38.599  1.00 50.11  ? 305  ALA C CB  1 
ATOM   7541  N  N   . MET C 1 303 ? 52.907  -16.776  38.236  1.00 45.85  ? 306  MET C N   1 
ATOM   7542  C  CA  . MET C 1 303 ? 51.772  -17.578  38.715  1.00 49.52  ? 306  MET C CA  1 
ATOM   7543  C  C   . MET C 1 303 ? 52.113  -19.055  39.000  1.00 48.25  ? 306  MET C C   1 
ATOM   7544  O  O   . MET C 1 303 ? 51.366  -19.740  39.691  1.00 48.05  ? 306  MET C O   1 
ATOM   7545  C  CB  . MET C 1 303 ? 50.603  -17.448  37.723  1.00 52.56  ? 306  MET C CB  1 
ATOM   7546  C  CG  . MET C 1 303 ? 49.347  -18.257  38.029  1.00 53.11  ? 306  MET C CG  1 
ATOM   7547  S  SD  . MET C 1 303 ? 47.921  -17.664  37.093  1.00 59.61  ? 306  MET C SD  1 
ATOM   7548  C  CE  . MET C 1 303 ? 48.550  -17.668  35.414  1.00 56.86  ? 306  MET C CE  1 
ATOM   7549  N  N   . GLU C 1 304 ? 53.244  -19.527  38.478  1.00 49.04  ? 307  GLU C N   1 
ATOM   7550  C  CA  . GLU C 1 304 ? 53.687  -20.902  38.681  1.00 50.71  ? 307  GLU C CA  1 
ATOM   7551  C  C   . GLU C 1 304 ? 53.797  -21.240  40.172  1.00 50.39  ? 307  GLU C C   1 
ATOM   7552  O  O   . GLU C 1 304 ? 53.365  -22.306  40.598  1.00 45.60  ? 307  GLU C O   1 
ATOM   7553  C  CB  . GLU C 1 304 ? 55.010  -21.161  37.944  1.00 54.17  ? 307  GLU C CB  1 
ATOM   7554  C  CG  . GLU C 1 304 ? 55.238  -22.609  37.514  1.00 63.00  ? 307  GLU C CG  1 
ATOM   7555  C  CD  . GLU C 1 304 ? 55.944  -23.459  38.567  1.00 66.16  ? 307  GLU C CD  1 
ATOM   7556  O  OE1 . GLU C 1 304 ? 57.171  -23.284  38.757  1.00 69.74  ? 307  GLU C OE1 1 
ATOM   7557  O  OE2 . GLU C 1 304 ? 55.280  -24.319  39.193  1.00 65.55  ? 307  GLU C OE2 1 
ATOM   7558  N  N   . LYS C 1 305 ? 54.369  -20.332  40.962  1.00 52.76  ? 308  LYS C N   1 
ATOM   7559  C  CA  . LYS C 1 305 ? 54.397  -20.515  42.427  1.00 55.76  ? 308  LYS C CA  1 
ATOM   7560  C  C   . LYS C 1 305 ? 53.708  -19.376  43.189  1.00 50.88  ? 308  LYS C C   1 
ATOM   7561  O  O   . LYS C 1 305 ? 54.090  -19.037  44.311  1.00 51.59  ? 308  LYS C O   1 
ATOM   7562  C  CB  . LYS C 1 305 ? 55.817  -20.795  42.958  1.00 58.25  ? 308  LYS C CB  1 
ATOM   7563  C  CG  . LYS C 1 305 ? 56.893  -19.860  42.434  1.00 60.97  ? 308  LYS C CG  1 
ATOM   7564  C  CD  . LYS C 1 305 ? 57.753  -20.525  41.368  1.00 63.12  ? 308  LYS C CD  1 
ATOM   7565  C  CE  . LYS C 1 305 ? 59.079  -21.013  41.936  1.00 64.14  ? 308  LYS C CE  1 
ATOM   7566  N  NZ  . LYS C 1 305 ? 60.066  -21.312  40.857  1.00 64.30  ? 308  LYS C NZ  1 
ATOM   7567  N  N   . GLY C 1 306 ? 52.694  -18.796  42.548  1.00 46.14  ? 309  GLY C N   1 
ATOM   7568  C  CA  . GLY C 1 306 ? 51.829  -17.791  43.150  1.00 44.52  ? 309  GLY C CA  1 
ATOM   7569  C  C   . GLY C 1 306 ? 52.537  -16.542  43.629  1.00 44.42  ? 309  GLY C C   1 
ATOM   7570  O  O   . GLY C 1 306 ? 52.265  -16.056  44.719  1.00 40.95  ? 309  GLY C O   1 
ATOM   7571  N  N   . ARG C 1 307 ? 53.441  -16.023  42.804  1.00 45.37  ? 310  ARG C N   1 
ATOM   7572  C  CA  . ARG C 1 307 ? 54.201  -14.834  43.140  1.00 44.93  ? 310  ARG C CA  1 
ATOM   7573  C  C   . ARG C 1 307 ? 53.795  -13.628  42.292  1.00 45.45  ? 310  ARG C C   1 
ATOM   7574  O  O   . ARG C 1 307 ? 54.445  -12.581  42.343  1.00 43.86  ? 310  ARG C O   1 
ATOM   7575  C  CB  . ARG C 1 307 ? 55.704  -15.107  43.023  1.00 47.93  ? 310  ARG C CB  1 
ATOM   7576  C  CG  . ARG C 1 307 ? 56.242  -16.072  44.071  1.00 52.84  ? 310  ARG C CG  1 
ATOM   7577  C  CD  . ARG C 1 307 ? 57.750  -15.947  44.243  1.00 58.76  ? 310  ARG C CD  1 
ATOM   7578  N  NE  . ARG C 1 307 ? 58.279  -16.937  45.191  1.00 66.67  ? 310  ARG C NE  1 
ATOM   7579  C  CZ  . ARG C 1 307 ? 59.153  -17.899  44.886  1.00 69.13  ? 310  ARG C CZ  1 
ATOM   7580  N  NH1 . ARG C 1 307 ? 59.635  -18.014  43.651  1.00 69.43  ? 310  ARG C NH1 1 
ATOM   7581  N  NH2 . ARG C 1 307 ? 59.561  -18.746  45.825  1.00 68.49  ? 310  ARG C NH2 1 
ATOM   7582  N  N   . HIS C 1 308 ? 52.711  -13.767  41.531  1.00 45.70  ? 311  HIS C N   1 
ATOM   7583  C  CA  . HIS C 1 308 ? 52.293  -12.717  40.584  1.00 48.28  ? 311  HIS C CA  1 
ATOM   7584  C  C   . HIS C 1 308 ? 51.640  -11.523  41.236  1.00 51.64  ? 311  HIS C C   1 
ATOM   7585  O  O   . HIS C 1 308 ? 51.635  -10.422  40.663  1.00 53.92  ? 311  HIS C O   1 
ATOM   7586  C  CB  . HIS C 1 308 ? 51.397  -13.290  39.474  1.00 43.91  ? 311  HIS C CB  1 
ATOM   7587  C  CG  . HIS C 1 308 ? 50.127  -13.941  39.984  1.00 41.65  ? 311  HIS C CG  1 
ATOM   7588  N  ND1 . HIS C 1 308 ? 50.137  -15.075  40.728  1.00 39.94  ? 311  HIS C ND1 1 
ATOM   7589  C  CD2 . HIS C 1 308 ? 48.786  -13.575  39.840  1.00 38.59  ? 311  HIS C CD2 1 
ATOM   7590  C  CE1 . HIS C 1 308 ? 48.870  -15.412  41.044  1.00 38.33  ? 311  HIS C CE1 1 
ATOM   7591  N  NE2 . HIS C 1 308 ? 48.045  -14.499  40.496  1.00 37.34  ? 311  HIS C NE2 1 
ATOM   7592  N  N   . MET C 1 309 ? 51.085  -11.722  42.433  1.00 54.86  ? 312  MET C N   1 
ATOM   7593  C  CA  . MET C 1 309 ? 50.454  -10.629  43.190  1.00 57.35  ? 312  MET C CA  1 
ATOM   7594  C  C   . MET C 1 309 ? 51.511  -9.681   43.771  1.00 58.72  ? 312  MET C C   1 
ATOM   7595  O  O   . MET C 1 309 ? 51.244  -8.491   43.979  1.00 58.60  ? 312  MET C O   1 
ATOM   7596  C  CB  . MET C 1 309 ? 49.537  -11.175  44.296  1.00 57.61  ? 312  MET C CB  1 
ATOM   7597  C  CG  . MET C 1 309 ? 48.464  -12.156  43.830  1.00 55.70  ? 312  MET C CG  1 
ATOM   7598  S  SD  . MET C 1 309 ? 47.304  -11.447  42.638  1.00 61.44  ? 312  MET C SD  1 
ATOM   7599  C  CE  . MET C 1 309 ? 46.500  -10.151  43.586  1.00 58.11  ? 312  MET C CE  1 
ATOM   7600  N  N   . GLU C 1 310 ? 52.712  -10.217  43.997  1.00 56.78  ? 313  GLU C N   1 
ATOM   7601  C  CA  . GLU C 1 310 ? 53.845  -9.455   44.518  1.00 61.05  ? 313  GLU C CA  1 
ATOM   7602  C  C   . GLU C 1 310 ? 54.285  -8.330   43.600  1.00 65.87  ? 313  GLU C C   1 
ATOM   7603  O  O   . GLU C 1 310 ? 55.035  -7.457   44.025  1.00 73.56  ? 313  GLU C O   1 
ATOM   7604  C  CB  . GLU C 1 310 ? 55.049  -10.365  44.742  1.00 58.74  ? 313  GLU C CB  1 
ATOM   7605  C  CG  . GLU C 1 310 ? 54.858  -11.461  45.773  1.00 59.40  ? 313  GLU C CG  1 
ATOM   7606  C  CD  . GLU C 1 310 ? 56.052  -12.391  45.829  1.00 61.24  ? 313  GLU C CD  1 
ATOM   7607  O  OE1 . GLU C 1 310 ? 57.103  -12.024  45.264  1.00 63.14  ? 313  GLU C OE1 1 
ATOM   7608  O  OE2 . GLU C 1 310 ? 55.947  -13.487  46.430  1.00 62.53  ? 313  GLU C OE2 1 
ATOM   7609  N  N   . TYR C 1 311 ? 53.833  -8.356   42.348  1.00 70.13  ? 314  TYR C N   1 
ATOM   7610  C  CA  . TYR C 1 311 ? 54.287  -7.401   41.329  1.00 73.66  ? 314  TYR C CA  1 
ATOM   7611  C  C   . TYR C 1 311 ? 53.480  -6.100   41.297  1.00 74.60  ? 314  TYR C C   1 
ATOM   7612  O  O   . TYR C 1 311 ? 53.944  -5.093   40.759  1.00 73.20  ? 314  TYR C O   1 
ATOM   7613  C  CB  . TYR C 1 311 ? 54.292  -8.057   39.938  1.00 75.48  ? 314  TYR C CB  1 
ATOM   7614  C  CG  . TYR C 1 311 ? 55.498  -8.941   39.655  1.00 78.43  ? 314  TYR C CG  1 
ATOM   7615  C  CD1 . TYR C 1 311 ? 56.053  -9.757   40.654  1.00 82.03  ? 314  TYR C CD1 1 
ATOM   7616  C  CD2 . TYR C 1 311 ? 56.071  -8.981   38.383  1.00 76.80  ? 314  TYR C CD2 1 
ATOM   7617  C  CE1 . TYR C 1 311 ? 57.150  -10.570  40.397  1.00 80.40  ? 314  TYR C CE1 1 
ATOM   7618  C  CE2 . TYR C 1 311 ? 57.166  -9.793   38.116  1.00 78.44  ? 314  TYR C CE2 1 
ATOM   7619  C  CZ  . TYR C 1 311 ? 57.700  -10.585  39.124  1.00 78.03  ? 314  TYR C CZ  1 
ATOM   7620  O  OH  . TYR C 1 311 ? 58.783  -11.391  38.870  1.00 74.00  ? 314  TYR C OH  1 
ATOM   7621  N  N   . GLU C 1 312 ? 52.284  -6.124   41.883  1.00 78.76  ? 315  GLU C N   1 
ATOM   7622  C  CA  . GLU C 1 312 ? 51.361  -4.979   41.849  1.00 81.88  ? 315  GLU C CA  1 
ATOM   7623  C  C   . GLU C 1 312 ? 51.409  -4.223   40.511  1.00 77.20  ? 315  GLU C C   1 
ATOM   7624  O  O   . GLU C 1 312 ? 51.733  -3.032   40.442  1.00 77.39  ? 315  GLU C O   1 
ATOM   7625  C  CB  . GLU C 1 312 ? 51.560  -4.043   43.060  1.00 87.23  ? 315  GLU C CB  1 
ATOM   7626  C  CG  . GLU C 1 312 ? 50.745  -4.431   44.297  1.00 89.66  ? 315  GLU C CG  1 
ATOM   7627  C  CD  . GLU C 1 312 ? 50.752  -3.377   45.407  1.00 93.86  ? 315  GLU C CD  1 
ATOM   7628  O  OE1 . GLU C 1 312 ? 50.144  -3.634   46.471  1.00 89.24  ? 315  GLU C OE1 1 
ATOM   7629  O  OE2 . GLU C 1 312 ? 51.353  -2.293   45.231  1.00 94.04  ? 315  GLU C OE2 1 
ATOM   7630  N  N   . CYS C 1 313 ? 51.116  -4.956   39.445  1.00 71.81  ? 316  CYS C N   1 
ATOM   7631  C  CA  . CYS C 1 313 ? 50.860  -4.367   38.146  1.00 65.58  ? 316  CYS C CA  1 
ATOM   7632  C  C   . CYS C 1 313 ? 49.535  -3.608   38.242  1.00 61.02  ? 316  CYS C C   1 
ATOM   7633  O  O   . CYS C 1 313 ? 48.530  -4.169   38.688  1.00 59.46  ? 316  CYS C O   1 
ATOM   7634  C  CB  . CYS C 1 313 ? 50.807  -5.463   37.076  1.00 64.72  ? 316  CYS C CB  1 
ATOM   7635  S  SG  . CYS C 1 313 ? 49.889  -5.058   35.572  1.00 63.01  ? 316  CYS C SG  1 
ATOM   7636  N  N   . PRO C 1 314 ? 49.542  -2.319   37.856  1.00 58.96  ? 317  PRO C N   1 
ATOM   7637  C  CA  . PRO C 1 314 ? 48.364  -1.451   37.968  1.00 57.30  ? 317  PRO C CA  1 
ATOM   7638  C  C   . PRO C 1 314 ? 47.162  -1.893   37.134  1.00 57.80  ? 317  PRO C C   1 
ATOM   7639  O  O   . PRO C 1 314 ? 46.034  -1.531   37.461  1.00 59.44  ? 317  PRO C O   1 
ATOM   7640  C  CB  . PRO C 1 314 ? 48.873  -0.086   37.479  1.00 56.73  ? 317  PRO C CB  1 
ATOM   7641  C  CG  . PRO C 1 314 ? 50.133  -0.369   36.738  1.00 57.91  ? 317  PRO C CG  1 
ATOM   7642  C  CD  . PRO C 1 314 ? 50.729  -1.574   37.397  1.00 58.72  ? 317  PRO C CD  1 
ATOM   7643  N  N   . TYR C 1 315 ? 47.394  -2.661   36.070  1.00 57.37  ? 318  TYR C N   1 
ATOM   7644  C  CA  . TYR C 1 315 ? 46.291  -3.143   35.234  1.00 57.24  ? 318  TYR C CA  1 
ATOM   7645  C  C   . TYR C 1 315 ? 45.606  -4.385   35.830  1.00 52.92  ? 318  TYR C C   1 
ATOM   7646  O  O   . TYR C 1 315 ? 44.433  -4.640   35.537  1.00 48.60  ? 318  TYR C O   1 
ATOM   7647  C  CB  . TYR C 1 315 ? 46.744  -3.417   33.795  1.00 62.33  ? 318  TYR C CB  1 
ATOM   7648  C  CG  . TYR C 1 315 ? 47.620  -2.342   33.166  1.00 64.31  ? 318  TYR C CG  1 
ATOM   7649  C  CD1 . TYR C 1 315 ? 47.060  -1.294   32.429  1.00 62.27  ? 318  TYR C CD1 1 
ATOM   7650  C  CD2 . TYR C 1 315 ? 49.017  -2.393   33.290  1.00 66.68  ? 318  TYR C CD2 1 
ATOM   7651  C  CE1 . TYR C 1 315 ? 47.863  -0.321   31.846  1.00 64.03  ? 318  TYR C CE1 1 
ATOM   7652  C  CE2 . TYR C 1 315 ? 49.828  -1.427   32.712  1.00 66.96  ? 318  TYR C CE2 1 
ATOM   7653  C  CZ  . TYR C 1 315 ? 49.250  -0.395   31.988  1.00 65.87  ? 318  TYR C CZ  1 
ATOM   7654  O  OH  . TYR C 1 315 ? 50.067  0.561    31.416  1.00 63.90  ? 318  TYR C OH  1 
ATOM   7655  N  N   . LEU C 1 316 ? 46.344  -5.137   36.658  1.00 48.74  ? 319  LEU C N   1 
ATOM   7656  C  CA  . LEU C 1 316 ? 45.809  -6.312   37.374  1.00 46.48  ? 319  LEU C CA  1 
ATOM   7657  C  C   . LEU C 1 316 ? 45.114  -5.935   38.678  1.00 45.54  ? 319  LEU C C   1 
ATOM   7658  O  O   . LEU C 1 316 ? 45.759  -5.579   39.670  1.00 45.67  ? 319  LEU C O   1 
ATOM   7659  C  CB  . LEU C 1 316 ? 46.896  -7.375   37.644  1.00 43.35  ? 319  LEU C CB  1 
ATOM   7660  C  CG  . LEU C 1 316 ? 46.548  -8.555   38.589  1.00 43.40  ? 319  LEU C CG  1 
ATOM   7661  C  CD1 . LEU C 1 316 ? 45.286  -9.311   38.161  1.00 41.89  ? 319  LEU C CD1 1 
ATOM   7662  C  CD2 . LEU C 1 316 ? 47.724  -9.514   38.762  1.00 39.95  ? 319  LEU C CD2 1 
ATOM   7663  N  N   . VAL C 1 317 ? 43.792  -6.032   38.660  1.00 46.24  ? 320  VAL C N   1 
ATOM   7664  C  CA  . VAL C 1 317 ? 42.976  -5.785   39.838  1.00 47.06  ? 320  VAL C CA  1 
ATOM   7665  C  C   . VAL C 1 317 ? 42.537  -7.114   40.428  1.00 48.59  ? 320  VAL C C   1 
ATOM   7666  O  O   . VAL C 1 317 ? 42.285  -8.065   39.694  1.00 51.79  ? 320  VAL C O   1 
ATOM   7667  C  CB  . VAL C 1 317 ? 41.749  -4.923   39.477  1.00 47.19  ? 320  VAL C CB  1 
ATOM   7668  C  CG1 . VAL C 1 317 ? 40.775  -4.805   40.646  1.00 47.86  ? 320  VAL C CG1 1 
ATOM   7669  C  CG2 . VAL C 1 317 ? 42.207  -3.544   39.023  1.00 50.89  ? 320  VAL C CG2 1 
ATOM   7670  N  N   . TYR C 1 318 ? 42.477  -7.177   41.756  1.00 51.00  ? 321  TYR C N   1 
ATOM   7671  C  CA  . TYR C 1 318 ? 41.882  -8.305   42.463  1.00 49.08  ? 321  TYR C CA  1 
ATOM   7672  C  C   . TYR C 1 318 ? 40.886  -7.846   43.549  1.00 48.39  ? 321  TYR C C   1 
ATOM   7673  O  O   . TYR C 1 318 ? 41.210  -6.966   44.352  1.00 51.54  ? 321  TYR C O   1 
ATOM   7674  C  CB  . TYR C 1 318 ? 42.955  -9.203   43.079  1.00 47.55  ? 321  TYR C CB  1 
ATOM   7675  C  CG  . TYR C 1 318 ? 42.355  -10.112  44.117  1.00 47.33  ? 321  TYR C CG  1 
ATOM   7676  C  CD1 . TYR C 1 318 ? 41.616  -11.227  43.738  1.00 47.11  ? 321  TYR C CD1 1 
ATOM   7677  C  CD2 . TYR C 1 318 ? 42.472  -9.827   45.475  1.00 46.41  ? 321  TYR C CD2 1 
ATOM   7678  C  CE1 . TYR C 1 318 ? 41.030  -12.049  44.681  1.00 47.95  ? 321  TYR C CE1 1 
ATOM   7679  C  CE2 . TYR C 1 318 ? 41.894  -10.650  46.431  1.00 45.98  ? 321  TYR C CE2 1 
ATOM   7680  C  CZ  . TYR C 1 318 ? 41.176  -11.757  46.023  1.00 46.49  ? 321  TYR C CZ  1 
ATOM   7681  O  OH  . TYR C 1 318 ? 40.591  -12.573  46.941  1.00 45.84  ? 321  TYR C OH  1 
ATOM   7682  N  N   . VAL C 1 319 ? 39.690  -8.442   43.562  1.00 43.65  ? 322  VAL C N   1 
ATOM   7683  C  CA  . VAL C 1 319 ? 38.652  -8.151   44.561  1.00 44.12  ? 322  VAL C CA  1 
ATOM   7684  C  C   . VAL C 1 319 ? 37.900  -9.446   44.930  1.00 42.20  ? 322  VAL C C   1 
ATOM   7685  O  O   . VAL C 1 319 ? 37.428  -10.141  44.019  1.00 38.66  ? 322  VAL C O   1 
ATOM   7686  C  CB  . VAL C 1 319 ? 37.601  -7.113   44.054  1.00 46.74  ? 322  VAL C CB  1 
ATOM   7687  C  CG1 . VAL C 1 319 ? 36.672  -6.678   45.187  1.00 45.34  ? 322  VAL C CG1 1 
ATOM   7688  C  CG2 . VAL C 1 319 ? 38.257  -5.889   43.422  1.00 49.08  ? 322  VAL C CG2 1 
ATOM   7689  N  N   . PRO C 1 320 ? 37.772  -9.763   46.250  1.00 37.77  ? 323  PRO C N   1 
ATOM   7690  C  CA  . PRO C 1 320 ? 36.902  -10.867  46.673  1.00 37.59  ? 323  PRO C CA  1 
ATOM   7691  C  C   . PRO C 1 320 ? 35.456  -10.447  46.541  1.00 35.85  ? 323  PRO C C   1 
ATOM   7692  O  O   . PRO C 1 320 ? 35.112  -9.359   46.985  1.00 37.73  ? 323  PRO C O   1 
ATOM   7693  C  CB  . PRO C 1 320 ? 37.263  -11.083  48.148  1.00 38.12  ? 323  PRO C CB  1 
ATOM   7694  C  CG  . PRO C 1 320 ? 38.560  -10.373  48.355  1.00 39.93  ? 323  PRO C CG  1 
ATOM   7695  C  CD  . PRO C 1 320 ? 38.542  -9.222   47.381  1.00 39.53  ? 323  PRO C CD  1 
ATOM   7696  N  N   . VAL C 1 321 ? 34.624  -11.276  45.898  1.00 33.82  ? 324  VAL C N   1 
ATOM   7697  C  CA  . VAL C 1 321 ? 33.226  -10.897  45.598  1.00 31.65  ? 324  VAL C CA  1 
ATOM   7698  C  C   . VAL C 1 321 ? 32.210  -11.984  45.969  1.00 31.54  ? 324  VAL C C   1 
ATOM   7699  O  O   . VAL C 1 321 ? 32.587  -13.108  46.304  1.00 31.18  ? 324  VAL C O   1 
ATOM   7700  C  CB  . VAL C 1 321 ? 33.027  -10.465  44.110  1.00 30.63  ? 324  VAL C CB  1 
ATOM   7701  C  CG1 . VAL C 1 321 ? 34.072  -9.441   43.685  1.00 30.26  ? 324  VAL C CG1 1 
ATOM   7702  C  CG2 . VAL C 1 321 ? 33.062  -11.664  43.164  1.00 30.55  ? 324  VAL C CG2 1 
ATOM   7703  N  N   . VAL C 1 322 ? 30.929  -11.629  45.925  1.00 31.11  ? 325  VAL C N   1 
ATOM   7704  C  CA  . VAL C 1 322 ? 29.855  -12.593  46.117  1.00 34.18  ? 325  VAL C CA  1 
ATOM   7705  C  C   . VAL C 1 322 ? 29.004  -12.704  44.858  1.00 34.99  ? 325  VAL C C   1 
ATOM   7706  O  O   . VAL C 1 322 ? 28.177  -13.602  44.746  1.00 35.90  ? 325  VAL C O   1 
ATOM   7707  C  CB  . VAL C 1 322 ? 28.921  -12.246  47.309  1.00 33.98  ? 325  VAL C CB  1 
ATOM   7708  C  CG1 . VAL C 1 322 ? 29.700  -12.120  48.605  1.00 34.64  ? 325  VAL C CG1 1 
ATOM   7709  C  CG2 . VAL C 1 322 ? 28.104  -10.995  47.031  1.00 34.62  ? 325  VAL C CG2 1 
ATOM   7710  N  N   . ALA C 1 323 ? 29.192  -11.765  43.933  1.00 36.09  ? 326  ALA C N   1 
ATOM   7711  C  CA  . ALA C 1 323 ? 28.383  -11.675  42.721  1.00 37.72  ? 326  ALA C CA  1 
ATOM   7712  C  C   . ALA C 1 323 ? 29.096  -10.781  41.703  1.00 40.60  ? 326  ALA C C   1 
ATOM   7713  O  O   . ALA C 1 323 ? 29.900  -9.918   42.083  1.00 43.54  ? 326  ALA C O   1 
ATOM   7714  C  CB  . ALA C 1 323 ? 27.002  -11.117  43.042  1.00 36.29  ? 326  ALA C CB  1 
ATOM   7715  N  N   . PHE C 1 324 ? 28.815  -10.994  40.419  1.00 39.65  ? 327  PHE C N   1 
ATOM   7716  C  CA  . PHE C 1 324 ? 29.333  -10.121  39.356  1.00 39.56  ? 327  PHE C CA  1 
ATOM   7717  C  C   . PHE C 1 324 ? 28.378  -10.071  38.143  1.00 40.44  ? 327  PHE C C   1 
ATOM   7718  O  O   . PHE C 1 324 ? 27.404  -10.827  38.073  1.00 40.15  ? 327  PHE C O   1 
ATOM   7719  C  CB  . PHE C 1 324 ? 30.717  -10.593  38.921  1.00 39.80  ? 327  PHE C CB  1 
ATOM   7720  C  CG  . PHE C 1 324 ? 30.685  -11.874  38.140  1.00 42.06  ? 327  PHE C CG  1 
ATOM   7721  C  CD1 . PHE C 1 324 ? 30.648  -11.852  36.743  1.00 41.89  ? 327  PHE C CD1 1 
ATOM   7722  C  CD2 . PHE C 1 324 ? 30.658  -13.101  38.795  1.00 41.46  ? 327  PHE C CD2 1 
ATOM   7723  C  CE1 . PHE C 1 324 ? 30.587  -13.035  36.017  1.00 43.38  ? 327  PHE C CE1 1 
ATOM   7724  C  CE2 . PHE C 1 324 ? 30.601  -14.291  38.074  1.00 43.49  ? 327  PHE C CE2 1 
ATOM   7725  C  CZ  . PHE C 1 324 ? 30.567  -14.258  36.686  1.00 43.04  ? 327  PHE C CZ  1 
ATOM   7726  N  N   . ARG C 1 325 ? 28.661  -9.166   37.206  1.00 40.67  ? 328  ARG C N   1 
ATOM   7727  C  CA  . ARG C 1 325 ? 27.934  -9.070   35.952  1.00 42.37  ? 328  ARG C CA  1 
ATOM   7728  C  C   . ARG C 1 325 ? 28.899  -8.618   34.859  1.00 45.85  ? 328  ARG C C   1 
ATOM   7729  O  O   . ARG C 1 325 ? 29.600  -7.616   35.011  1.00 47.01  ? 328  ARG C O   1 
ATOM   7730  C  CB  . ARG C 1 325 ? 26.754  -8.110   36.067  1.00 42.42  ? 328  ARG C CB  1 
ATOM   7731  C  CG  . ARG C 1 325 ? 25.981  -7.945   34.772  1.00 43.48  ? 328  ARG C CG  1 
ATOM   7732  C  CD  . ARG C 1 325 ? 24.925  -6.854   34.834  1.00 41.60  ? 328  ARG C CD  1 
ATOM   7733  N  NE  . ARG C 1 325 ? 23.728  -7.263   35.560  1.00 41.30  ? 328  ARG C NE  1 
ATOM   7734  C  CZ  . ARG C 1 325 ? 22.568  -6.599   35.536  1.00 44.76  ? 328  ARG C CZ  1 
ATOM   7735  N  NH1 . ARG C 1 325 ? 22.440  -5.494   34.810  1.00 44.88  ? 328  ARG C NH1 1 
ATOM   7736  N  NH2 . ARG C 1 325 ? 21.525  -7.039   36.236  1.00 43.10  ? 328  ARG C NH2 1 
ATOM   7737  N  N   . LEU C 1 326 ? 28.947  -9.377   33.765  1.00 47.38  ? 329  LEU C N   1 
ATOM   7738  C  CA  . LEU C 1 326 ? 29.853  -9.072   32.662  1.00 50.81  ? 329  LEU C CA  1 
ATOM   7739  C  C   . LEU C 1 326 ? 29.121  -9.079   31.317  1.00 52.87  ? 329  LEU C C   1 
ATOM   7740  O  O   . LEU C 1 326 ? 28.540  -10.098  30.930  1.00 50.14  ? 329  LEU C O   1 
ATOM   7741  C  CB  . LEU C 1 326 ? 31.029  -10.045  32.663  1.00 47.60  ? 329  LEU C CB  1 
ATOM   7742  C  CG  . LEU C 1 326 ? 32.160  -9.888   31.651  1.00 47.08  ? 329  LEU C CG  1 
ATOM   7743  C  CD1 . LEU C 1 326 ? 32.656  -8.455   31.535  1.00 48.32  ? 329  LEU C CD1 1 
ATOM   7744  C  CD2 . LEU C 1 326 ? 33.294  -10.817  32.047  1.00 45.91  ? 329  LEU C CD2 1 
ATOM   7745  N  N   . GLU C 1 327 ? 29.134  -7.931   30.632  1.00 54.28  ? 330  GLU C N   1 
ATOM   7746  C  CA  . GLU C 1 327 ? 28.494  -7.797   29.317  1.00 59.76  ? 330  GLU C CA  1 
ATOM   7747  C  C   . GLU C 1 327 ? 29.411  -7.163   28.268  1.00 62.35  ? 330  GLU C C   1 
ATOM   7748  O  O   . GLU C 1 327 ? 29.824  -6.011   28.423  1.00 60.75  ? 330  GLU C O   1 
ATOM   7749  C  CB  . GLU C 1 327 ? 27.205  -6.963   29.373  1.00 60.07  ? 330  GLU C CB  1 
ATOM   7750  C  CG  . GLU C 1 327 ? 26.700  -6.555   30.746  1.00 63.06  ? 330  GLU C CG  1 
ATOM   7751  C  CD  . GLU C 1 327 ? 25.610  -5.494   30.668  1.00 66.59  ? 330  GLU C CD  1 
ATOM   7752  O  OE1 . GLU C 1 327 ? 25.223  -5.104   29.541  1.00 70.75  ? 330  GLU C OE1 1 
ATOM   7753  O  OE2 . GLU C 1 327 ? 25.133  -5.048   31.734  1.00 65.85  ? 330  GLU C OE2 1 
ATOM   7754  N  N   . PRO C 1 328 ? 29.752  -7.921   27.211  1.00 68.32  ? 331  PRO C N   1 
ATOM   7755  C  CA  . PRO C 1 328 ? 30.136  -7.281   25.944  1.00 73.21  ? 331  PRO C CA  1 
ATOM   7756  C  C   . PRO C 1 328 ? 28.828  -7.038   25.175  1.00 77.97  ? 331  PRO C C   1 
ATOM   7757  O  O   . PRO C 1 328 ? 27.976  -7.928   25.186  1.00 80.10  ? 331  PRO C O   1 
ATOM   7758  C  CB  . PRO C 1 328 ? 31.001  -8.348   25.255  1.00 72.43  ? 331  PRO C CB  1 
ATOM   7759  C  CG  . PRO C 1 328 ? 31.137  -9.489   26.232  1.00 69.36  ? 331  PRO C CG  1 
ATOM   7760  C  CD  . PRO C 1 328 ? 29.994  -9.374   27.190  1.00 65.05  ? 331  PRO C CD  1 
ATOM   7761  N  N   . LYS C 1 329 ? 28.611  -5.903   24.496  1.00 86.56  ? 332  LYS C N   1 
ATOM   7762  C  CA  . LYS C 1 329 ? 29.578  -4.903   23.978  1.00 88.88  ? 332  LYS C CA  1 
ATOM   7763  C  C   . LYS C 1 329 ? 30.314  -5.399   22.729  1.00 88.44  ? 332  LYS C C   1 
ATOM   7764  O  O   . LYS C 1 329 ? 31.364  -6.045   22.805  1.00 85.69  ? 332  LYS C O   1 
ATOM   7765  C  CB  . LYS C 1 329 ? 30.500  -4.271   25.033  1.00 90.44  ? 332  LYS C CB  1 
ATOM   7766  C  CG  . LYS C 1 329 ? 31.246  -3.044   24.504  1.00 91.59  ? 332  LYS C CG  1 
ATOM   7767  C  CD  . LYS C 1 329 ? 31.662  -2.064   25.594  1.00 89.07  ? 332  LYS C CD  1 
ATOM   7768  C  CE  . LYS C 1 329 ? 30.576  -1.034   25.873  1.00 89.67  ? 332  LYS C CE  1 
ATOM   7769  N  NZ  . LYS C 1 329 ? 30.986  -0.080   26.940  1.00 90.27  ? 332  LYS C NZ  1 
ATOM   7770  N  N   . ASP C 1 330 ? 29.725  -5.060   21.583  1.00 91.35  ? 333  ASP C N   1 
ATOM   7771  C  CA  . ASP C 1 330 ? 30.055  -5.643   20.279  1.00 95.30  ? 333  ASP C CA  1 
ATOM   7772  C  C   . ASP C 1 330 ? 29.718  -7.140   20.261  1.00 93.63  ? 333  ASP C C   1 
ATOM   7773  O  O   . ASP C 1 330 ? 30.612  -7.997   20.276  1.00 95.25  ? 333  ASP C O   1 
ATOM   7774  C  CB  . ASP C 1 330 ? 31.515  -5.368   19.868  1.00 98.18  ? 333  ASP C CB  1 
ATOM   7775  C  CG  . ASP C 1 330 ? 31.706  -5.297   18.346  1.00 100.66 ? 333  ASP C CG  1 
ATOM   7776  O  OD1 . ASP C 1 330 ? 32.775  -4.814   17.916  1.00 103.21 ? 333  ASP C OD1 1 
ATOM   7777  O  OD2 . ASP C 1 330 ? 30.803  -5.713   17.580  1.00 96.21  ? 333  ASP C OD2 1 
ATOM   7778  N  N   . GLY C 1 331 ? 28.416  -7.431   20.260  1.00 89.47  ? 334  GLY C N   1 
ATOM   7779  C  CA  . GLY C 1 331 ? 27.893  -8.791   20.088  1.00 89.78  ? 334  GLY C CA  1 
ATOM   7780  C  C   . GLY C 1 331 ? 28.223  -9.786   21.187  1.00 87.59  ? 334  GLY C C   1 
ATOM   7781  O  O   . GLY C 1 331 ? 28.521  -9.403   22.324  1.00 88.64  ? 334  GLY C O   1 
ATOM   7782  N  N   . LYS C 1 332 ? 28.160  -11.070  20.838  1.00 81.30  ? 335  LYS C N   1 
ATOM   7783  C  CA  . LYS C 1 332 ? 28.467  -12.158  21.766  1.00 75.93  ? 335  LYS C CA  1 
ATOM   7784  C  C   . LYS C 1 332 ? 29.967  -12.275  22.038  1.00 72.14  ? 335  LYS C C   1 
ATOM   7785  O  O   . LYS C 1 332 ? 30.789  -12.131  21.128  1.00 75.13  ? 335  LYS C O   1 
ATOM   7786  C  CB  . LYS C 1 332 ? 27.925  -13.487  21.229  1.00 74.27  ? 335  LYS C CB  1 
ATOM   7787  C  CG  . LYS C 1 332 ? 26.439  -13.702  21.471  1.00 76.38  ? 335  LYS C CG  1 
ATOM   7788  C  CD  . LYS C 1 332 ? 25.882  -14.824  20.608  1.00 77.90  ? 335  LYS C CD  1 
ATOM   7789  C  CE  . LYS C 1 332 ? 24.524  -15.295  21.108  1.00 78.89  ? 335  LYS C CE  1 
ATOM   7790  N  NZ  . LYS C 1 332 ? 23.922  -16.303  20.190  1.00 79.13  ? 335  LYS C NZ  1 
ATOM   7791  N  N   . GLY C 1 333 ? 30.311  -12.524  23.299  1.00 64.83  ? 336  GLY C N   1 
ATOM   7792  C  CA  . GLY C 1 333 ? 31.684  -12.835  23.691  1.00 58.50  ? 336  GLY C CA  1 
ATOM   7793  C  C   . GLY C 1 333 ? 31.814  -14.314  24.016  1.00 55.06  ? 336  GLY C C   1 
ATOM   7794  O  O   . GLY C 1 333 ? 30.826  -14.972  24.377  1.00 50.54  ? 336  GLY C O   1 
ATOM   7795  N  N   . VAL C 1 334 ? 33.036  -14.829  23.873  1.00 53.02  ? 337  VAL C N   1 
ATOM   7796  C  CA  . VAL C 1 334 ? 33.363  -16.226  24.176  1.00 52.75  ? 337  VAL C CA  1 
ATOM   7797  C  C   . VAL C 1 334 ? 33.792  -16.409  25.645  1.00 50.61  ? 337  VAL C C   1 
ATOM   7798  O  O   . VAL C 1 334 ? 34.795  -15.839  26.088  1.00 50.55  ? 337  VAL C O   1 
ATOM   7799  C  CB  . VAL C 1 334 ? 34.419  -16.796  23.180  1.00 52.54  ? 337  VAL C CB  1 
ATOM   7800  C  CG1 . VAL C 1 334 ? 35.281  -15.676  22.607  1.00 54.47  ? 337  VAL C CG1 1 
ATOM   7801  C  CG2 . VAL C 1 334 ? 35.308  -17.861  23.825  1.00 46.63  ? 337  VAL C CG2 1 
ATOM   7802  N  N   . PHE C 1 335 ? 33.016  -17.201  26.384  1.00 45.82  ? 338  PHE C N   1 
ATOM   7803  C  CA  . PHE C 1 335 ? 33.310  -17.527  27.786  1.00 45.62  ? 338  PHE C CA  1 
ATOM   7804  C  C   . PHE C 1 335 ? 33.842  -18.947  27.968  1.00 45.60  ? 338  PHE C C   1 
ATOM   7805  O  O   . PHE C 1 335 ? 33.522  -19.856  27.186  1.00 44.93  ? 338  PHE C O   1 
ATOM   7806  C  CB  . PHE C 1 335 ? 32.062  -17.351  28.664  1.00 43.91  ? 338  PHE C CB  1 
ATOM   7807  C  CG  . PHE C 1 335 ? 31.548  -15.945  28.706  1.00 44.47  ? 338  PHE C CG  1 
ATOM   7808  C  CD1 . PHE C 1 335 ? 30.515  -15.542  27.863  1.00 46.79  ? 338  PHE C CD1 1 
ATOM   7809  C  CD2 . PHE C 1 335 ? 32.106  -15.017  29.565  1.00 44.33  ? 338  PHE C CD2 1 
ATOM   7810  C  CE1 . PHE C 1 335 ? 30.035  -14.238  27.889  1.00 49.85  ? 338  PHE C CE1 1 
ATOM   7811  C  CE2 . PHE C 1 335 ? 31.635  -13.712  29.603  1.00 48.90  ? 338  PHE C CE2 1 
ATOM   7812  C  CZ  . PHE C 1 335 ? 30.595  -13.319  28.764  1.00 48.92  ? 338  PHE C CZ  1 
ATOM   7813  N  N   . ALA C 1 336 ? 34.668  -19.120  28.999  1.00 42.09  ? 339  ALA C N   1 
ATOM   7814  C  CA  . ALA C 1 336 ? 35.055  -20.434  29.467  1.00 40.30  ? 339  ALA C CA  1 
ATOM   7815  C  C   . ALA C 1 336 ? 34.434  -20.636  30.849  1.00 40.61  ? 339  ALA C C   1 
ATOM   7816  O  O   . ALA C 1 336 ? 34.726  -19.881  31.784  1.00 40.85  ? 339  ALA C O   1 
ATOM   7817  C  CB  . ALA C 1 336 ? 36.567  -20.556  29.522  1.00 39.81  ? 339  ALA C CB  1 
ATOM   7818  N  N   . VAL C 1 337 ? 33.550  -21.628  30.951  1.00 38.68  ? 340  VAL C N   1 
ATOM   7819  C  CA  . VAL C 1 337 ? 32.925  -22.026  32.212  1.00 37.44  ? 340  VAL C CA  1 
ATOM   7820  C  C   . VAL C 1 337 ? 33.522  -23.343  32.660  1.00 36.75  ? 340  VAL C C   1 
ATOM   7821  O  O   . VAL C 1 337 ? 33.247  -24.386  32.066  1.00 36.07  ? 340  VAL C O   1 
ATOM   7822  C  CB  . VAL C 1 337 ? 31.403  -22.224  32.093  1.00 37.47  ? 340  VAL C CB  1 
ATOM   7823  C  CG1 . VAL C 1 337 ? 30.807  -22.424  33.481  1.00 40.43  ? 340  VAL C CG1 1 
ATOM   7824  C  CG2 . VAL C 1 337 ? 30.748  -21.042  31.403  1.00 38.96  ? 340  VAL C CG2 1 
ATOM   7825  N  N   . ASP C 1 338 ? 34.324  -23.288  33.721  1.00 36.24  ? 341  ASP C N   1 
ATOM   7826  C  CA  . ASP C 1 338 ? 35.119  -24.430  34.170  1.00 34.89  ? 341  ASP C CA  1 
ATOM   7827  C  C   . ASP C 1 338 ? 35.898  -25.036  32.990  1.00 35.63  ? 341  ASP C C   1 
ATOM   7828  O  O   . ASP C 1 338 ? 36.035  -26.256  32.878  1.00 34.61  ? 341  ASP C O   1 
ATOM   7829  C  CB  . ASP C 1 338 ? 34.240  -25.488  34.859  1.00 35.54  ? 341  ASP C CB  1 
ATOM   7830  C  CG  . ASP C 1 338 ? 33.442  -24.935  36.039  1.00 35.75  ? 341  ASP C CG  1 
ATOM   7831  O  OD1 . ASP C 1 338 ? 33.865  -23.932  36.662  1.00 35.57  ? 341  ASP C OD1 1 
ATOM   7832  O  OD2 . ASP C 1 338 ? 32.378  -25.517  36.346  1.00 34.88  ? 341  ASP C OD2 1 
ATOM   7833  N  N   . GLY C 1 339 ? 36.402  -24.173  32.109  1.00 35.04  ? 342  GLY C N   1 
ATOM   7834  C  CA  . GLY C 1 339 ? 37.063  -24.631  30.898  1.00 36.74  ? 342  GLY C CA  1 
ATOM   7835  C  C   . GLY C 1 339 ? 36.158  -24.964  29.710  1.00 38.23  ? 342  GLY C C   1 
ATOM   7836  O  O   . GLY C 1 339 ? 36.646  -24.988  28.580  1.00 40.66  ? 342  GLY C O   1 
ATOM   7837  N  N   . GLU C 1 340 ? 34.867  -25.243  29.939  1.00 37.22  ? 343  GLU C N   1 
ATOM   7838  C  CA  . GLU C 1 340 ? 33.916  -25.518  28.850  0.50 37.38  ? 343  GLU C CA  1 
ATOM   7839  C  C   . GLU C 1 340 ? 33.628  -24.231  28.085  1.00 39.95  ? 343  GLU C C   1 
ATOM   7840  O  O   . GLU C 1 340 ? 33.381  -23.179  28.703  1.00 41.06  ? 343  GLU C O   1 
ATOM   7841  C  CB  . GLU C 1 340 ? 32.607  -26.126  29.390  0.50 37.78  ? 343  GLU C CB  1 
ATOM   7842  C  CG  . GLU C 1 340 ? 31.351  -25.792  28.570  0.50 38.36  ? 343  GLU C CG  1 
ATOM   7843  C  CD  . GLU C 1 340 ? 30.041  -26.254  29.208  0.50 38.93  ? 343  GLU C CD  1 
ATOM   7844  O  OE1 . GLU C 1 340 ? 29.857  -27.485  29.358  0.50 38.02  ? 343  GLU C OE1 1 
ATOM   7845  O  OE2 . GLU C 1 340 ? 29.183  -25.391  29.533  0.50 37.17  ? 343  GLU C OE2 1 
ATOM   7846  N  N   . LEU C 1 341 ? 33.657  -24.293  26.754  1.00 39.54  ? 344  LEU C N   1 
ATOM   7847  C  CA  . LEU C 1 341 ? 33.328  -23.117  25.943  1.00 40.58  ? 344  LEU C CA  1 
ATOM   7848  C  C   . LEU C 1 341 ? 31.870  -22.702  26.121  1.00 40.87  ? 344  LEU C C   1 
ATOM   7849  O  O   . LEU C 1 341 ? 30.972  -23.533  26.166  1.00 38.54  ? 344  LEU C O   1 
ATOM   7850  C  CB  . LEU C 1 341 ? 33.631  -23.341  24.451  1.00 44.78  ? 344  LEU C CB  1 
ATOM   7851  C  CG  . LEU C 1 341 ? 32.913  -22.394  23.450  1.00 49.21  ? 344  LEU C CG  1 
ATOM   7852  C  CD1 . LEU C 1 341 ? 33.550  -21.001  23.390  1.00 45.79  ? 344  LEU C CD1 1 
ATOM   7853  C  CD2 . LEU C 1 341 ? 32.738  -22.992  22.049  1.00 48.35  ? 344  LEU C CD2 1 
ATOM   7854  N  N   . MET C 1 342 ? 31.646  -21.399  26.198  1.00 45.21  ? 345  MET C N   1 
ATOM   7855  C  CA  . MET C 1 342 ? 30.306  -20.852  26.297  1.00 48.00  ? 345  MET C CA  1 
ATOM   7856  C  C   . MET C 1 342 ? 30.263  -19.551  25.517  1.00 49.50  ? 345  MET C C   1 
ATOM   7857  O  O   . MET C 1 342 ? 31.206  -18.762  25.563  1.00 49.14  ? 345  MET C O   1 
ATOM   7858  C  CB  . MET C 1 342 ? 29.978  -20.580  27.755  1.00 49.78  ? 345  MET C CB  1 
ATOM   7859  C  CG  . MET C 1 342 ? 28.633  -21.118  28.186  1.00 52.70  ? 345  MET C CG  1 
ATOM   7860  S  SD  . MET C 1 342 ? 27.906  -20.008  29.392  1.00 59.95  ? 345  MET C SD  1 
ATOM   7861  C  CE  . MET C 1 342 ? 27.470  -18.647  28.304  1.00 60.24  ? 345  MET C CE  1 
ATOM   7862  N  N   . VAL C 1 343 ? 29.184  -19.320  24.787  1.00 50.05  ? 346  VAL C N   1 
ATOM   7863  C  CA  . VAL C 1 343 ? 29.082  -18.081  24.034  1.00 53.77  ? 346  VAL C CA  1 
ATOM   7864  C  C   . VAL C 1 343 ? 27.846  -17.351  24.518  1.00 55.62  ? 346  VAL C C   1 
ATOM   7865  O  O   . VAL C 1 343 ? 26.751  -17.912  24.506  1.00 57.85  ? 346  VAL C O   1 
ATOM   7866  C  CB  . VAL C 1 343 ? 29.096  -18.340  22.497  1.00 55.97  ? 346  VAL C CB  1 
ATOM   7867  C  CG1 . VAL C 1 343 ? 28.381  -17.243  21.712  1.00 54.69  ? 346  VAL C CG1 1 
ATOM   7868  C  CG2 . VAL C 1 343 ? 30.528  -18.496  21.997  1.00 53.01  ? 346  VAL C CG2 1 
ATOM   7869  N  N   . SER C 1 344 ? 28.027  -16.120  24.987  1.00 58.88  ? 347  SER C N   1 
ATOM   7870  C  CA  . SER C 1 344 ? 26.887  -15.304  25.413  1.00 64.77  ? 347  SER C CA  1 
ATOM   7871  C  C   . SER C 1 344 ? 27.125  -13.808  25.274  1.00 67.40  ? 347  SER C C   1 
ATOM   7872  O  O   . SER C 1 344 ? 28.270  -13.342  25.266  1.00 65.24  ? 347  SER C O   1 
ATOM   7873  C  CB  . SER C 1 344 ? 26.469  -15.625  26.855  1.00 65.98  ? 347  SER C CB  1 
ATOM   7874  O  OG  . SER C 1 344 ? 25.183  -15.082  27.140  1.00 66.75  ? 347  SER C OG  1 
ATOM   7875  N  N   . GLU C 1 345 ? 26.019  -13.074  25.165  1.00 72.42  ? 348  GLU C N   1 
ATOM   7876  C  CA  . GLU C 1 345 ? 26.027  -11.612  25.143  1.00 78.15  ? 348  GLU C CA  1 
ATOM   7877  C  C   . GLU C 1 345 ? 26.154  -11.020  26.551  1.00 77.22  ? 348  GLU C C   1 
ATOM   7878  O  O   . GLU C 1 345 ? 26.742  -9.948   26.721  1.00 81.17  ? 348  GLU C O   1 
ATOM   7879  C  CB  . GLU C 1 345 ? 24.770  -11.068  24.443  1.00 82.41  ? 348  GLU C CB  1 
ATOM   7880  C  CG  . GLU C 1 345 ? 24.954  -10.795  22.954  1.00 88.08  ? 348  GLU C CG  1 
ATOM   7881  C  CD  . GLU C 1 345 ? 23.641  -10.678  22.194  1.00 94.66  ? 348  GLU C CD  1 
ATOM   7882  O  OE1 . GLU C 1 345 ? 22.804  -11.605  22.284  1.00 96.62  ? 348  GLU C OE1 1 
ATOM   7883  O  OE2 . GLU C 1 345 ? 23.451  -9.661   21.489  1.00 96.42  ? 348  GLU C OE2 1 
ATOM   7884  N  N   . ALA C 1 346 ? 25.604  -11.717  27.549  1.00 69.42  ? 349  ALA C N   1 
ATOM   7885  C  CA  . ALA C 1 346 ? 25.640  -11.251  28.939  1.00 61.42  ? 349  ALA C CA  1 
ATOM   7886  C  C   . ALA C 1 346 ? 25.613  -12.391  29.958  1.00 56.89  ? 349  ALA C C   1 
ATOM   7887  O  O   . ALA C 1 346 ? 24.844  -13.348  29.820  1.00 56.36  ? 349  ALA C O   1 
ATOM   7888  C  CB  . ALA C 1 346 ? 24.500  -10.274  29.206  1.00 61.16  ? 349  ALA C CB  1 
ATOM   7889  N  N   . VAL C 1 347 ? 26.458  -12.278  30.981  1.00 51.77  ? 350  VAL C N   1 
ATOM   7890  C  CA  . VAL C 1 347 ? 26.483  -13.240  32.084  1.00 48.68  ? 350  VAL C CA  1 
ATOM   7891  C  C   . VAL C 1 347 ? 26.641  -12.541  33.427  1.00 46.69  ? 350  VAL C C   1 
ATOM   7892  O  O   . VAL C 1 347 ? 27.509  -11.687  33.598  1.00 48.86  ? 350  VAL C O   1 
ATOM   7893  C  CB  . VAL C 1 347 ? 27.625  -14.276  31.953  1.00 46.16  ? 350  VAL C CB  1 
ATOM   7894  C  CG1 . VAL C 1 347 ? 27.422  -15.417  32.942  1.00 43.08  ? 350  VAL C CG1 1 
ATOM   7895  C  CG2 . VAL C 1 347 ? 27.702  -14.835  30.536  1.00 48.25  ? 350  VAL C CG2 1 
ATOM   7896  N  N   . GLN C 1 348 ? 25.795  -12.914  34.378  1.00 44.49  ? 351  GLN C N   1 
ATOM   7897  C  CA  . GLN C 1 348 ? 26.026  -12.575  35.774  1.00 43.46  ? 351  GLN C CA  1 
ATOM   7898  C  C   . GLN C 1 348 ? 25.983  -13.840  36.628  1.00 42.76  ? 351  GLN C C   1 
ATOM   7899  O  O   . GLN C 1 348 ? 25.376  -14.851  36.234  1.00 44.22  ? 351  GLN C O   1 
ATOM   7900  C  CB  . GLN C 1 348 ? 25.018  -11.531  36.264  1.00 41.47  ? 351  GLN C CB  1 
ATOM   7901  C  CG  . GLN C 1 348 ? 23.565  -11.971  36.220  1.00 40.86  ? 351  GLN C CG  1 
ATOM   7902  C  CD  . GLN C 1 348 ? 22.600  -10.856  36.587  1.00 39.63  ? 351  GLN C CD  1 
ATOM   7903  O  OE1 . GLN C 1 348 ? 21.374  -11.033  36.540  1.00 39.77  ? 351  GLN C OE1 1 
ATOM   7904  N  NE2 . GLN C 1 348 ? 23.143  -9.703   36.952  1.00 35.30  ? 351  GLN C NE2 1 
ATOM   7905  N  N   . GLY C 1 349 ? 26.641  -13.790  37.783  1.00 40.68  ? 352  GLY C N   1 
ATOM   7906  C  CA  . GLY C 1 349 ? 26.656  -14.921  38.697  1.00 41.88  ? 352  GLY C CA  1 
ATOM   7907  C  C   . GLY C 1 349 ? 26.711  -14.577  40.181  1.00 42.48  ? 352  GLY C C   1 
ATOM   7908  O  O   . GLY C 1 349 ? 27.099  -13.471  40.564  1.00 40.92  ? 352  GLY C O   1 
ATOM   7909  N  N   . GLN C 1 350 ? 26.328  -15.547  41.010  1.00 41.63  ? 353  GLN C N   1 
ATOM   7910  C  CA  . GLN C 1 350 ? 26.364  -15.408  42.458  1.00 39.32  ? 353  GLN C CA  1 
ATOM   7911  C  C   . GLN C 1 350 ? 26.975  -16.659  43.084  1.00 38.64  ? 353  GLN C C   1 
ATOM   7912  O  O   . GLN C 1 350 ? 26.627  -17.778  42.703  1.00 36.45  ? 353  GLN C O   1 
ATOM   7913  C  CB  . GLN C 1 350 ? 24.955  -15.193  43.010  1.00 39.16  ? 353  GLN C CB  1 
ATOM   7914  C  CG  . GLN C 1 350 ? 24.892  -15.150  44.540  1.00 42.91  ? 353  GLN C CG  1 
ATOM   7915  C  CD  . GLN C 1 350 ? 23.486  -14.919  45.067  1.00 43.46  ? 353  GLN C CD  1 
ATOM   7916  O  OE1 . GLN C 1 350 ? 22.729  -14.101  44.532  1.00 41.31  ? 353  GLN C OE1 1 
ATOM   7917  N  NE2 . GLN C 1 350 ? 23.128  -15.641  46.124  1.00 42.90  ? 353  GLN C NE2 1 
ATOM   7918  N  N   . VAL C 1 351 ? 27.884  -16.460  44.038  1.00 37.80  ? 354  VAL C N   1 
ATOM   7919  C  CA  . VAL C 1 351 ? 28.461  -17.559  44.820  1.00 36.95  ? 354  VAL C CA  1 
ATOM   7920  C  C   . VAL C 1 351 ? 27.473  -18.007  45.879  1.00 36.80  ? 354  VAL C C   1 
ATOM   7921  O  O   . VAL C 1 351 ? 26.940  -17.177  46.608  1.00 39.40  ? 354  VAL C O   1 
ATOM   7922  C  CB  . VAL C 1 351 ? 29.708  -17.106  45.588  1.00 36.27  ? 354  VAL C CB  1 
ATOM   7923  C  CG1 . VAL C 1 351 ? 30.549  -18.298  45.987  1.00 36.09  ? 354  VAL C CG1 1 
ATOM   7924  C  CG2 . VAL C 1 351 ? 30.522  -16.159  44.745  1.00 38.28  ? 354  VAL C CG2 1 
ATOM   7925  N  N   . HIS C 1 352 ? 27.236  -19.313  45.958  1.00 34.86  ? 355  HIS C N   1 
ATOM   7926  C  CA  . HIS C 1 352 ? 26.464  -19.909  47.049  1.00 32.92  ? 355  HIS C CA  1 
ATOM   7927  C  C   . HIS C 1 352 ? 27.381  -20.607  47.975  1.00 33.19  ? 355  HIS C C   1 
ATOM   7928  O  O   . HIS C 1 352 ? 28.195  -21.421  47.539  1.00 34.11  ? 355  HIS C O   1 
ATOM   7929  C  CB  . HIS C 1 352 ? 25.408  -20.873  46.548  1.00 32.12  ? 355  HIS C CB  1 
ATOM   7930  C  CG  . HIS C 1 352 ? 24.281  -20.194  45.852  1.00 32.83  ? 355  HIS C CG  1 
ATOM   7931  N  ND1 . HIS C 1 352 ? 23.088  -20.020  46.425  1.00 33.60  ? 355  HIS C ND1 1 
ATOM   7932  C  CD2 . HIS C 1 352 ? 24.212  -19.597  44.601  1.00 32.88  ? 355  HIS C CD2 1 
ATOM   7933  C  CE1 . HIS C 1 352 ? 22.282  -19.361  45.579  1.00 34.95  ? 355  HIS C CE1 1 
ATOM   7934  N  NE2 . HIS C 1 352 ? 22.971  -19.110  44.460  1.00 34.19  ? 355  HIS C NE2 1 
ATOM   7935  N  N   . PRO C 1 353 ? 27.261  -20.302  49.280  1.00 31.74  ? 356  PRO C N   1 
ATOM   7936  C  CA  . PRO C 1 353 ? 28.242  -20.775  50.237  1.00 31.15  ? 356  PRO C CA  1 
ATOM   7937  C  C   . PRO C 1 353 ? 28.046  -22.253  50.559  1.00 29.39  ? 356  PRO C C   1 
ATOM   7938  O  O   . PRO C 1 353 ? 26.908  -22.701  50.707  1.00 28.22  ? 356  PRO C O   1 
ATOM   7939  C  CB  . PRO C 1 353 ? 27.958  -19.901  51.478  1.00 31.58  ? 356  PRO C CB  1 
ATOM   7940  C  CG  . PRO C 1 353 ? 26.494  -19.614  51.403  1.00 30.69  ? 356  PRO C CG  1 
ATOM   7941  C  CD  . PRO C 1 353 ? 26.130  -19.606  49.932  1.00 31.18  ? 356  PRO C CD  1 
ATOM   7942  N  N   . ASN C 1 354 ? 29.154  -22.990  50.635  1.00 30.98  ? 357  ASN C N   1 
ATOM   7943  C  CA  . ASN C 1 354 ? 29.176  -24.366  51.148  1.00 31.14  ? 357  ASN C CA  1 
ATOM   7944  C  C   . ASN C 1 354 ? 27.974  -25.178  50.702  1.00 31.86  ? 357  ASN C C   1 
ATOM   7945  O  O   . ASN C 1 354 ? 27.194  -25.660  51.521  1.00 33.73  ? 357  ASN C O   1 
ATOM   7946  C  CB  . ASN C 1 354 ? 29.258  -24.340  52.679  1.00 31.78  ? 357  ASN C CB  1 
ATOM   7947  C  CG  . ASN C 1 354 ? 30.604  -23.839  53.189  1.00 32.03  ? 357  ASN C CG  1 
ATOM   7948  O  OD1 . ASN C 1 354 ? 31.454  -23.359  52.421  1.00 31.79  ? 357  ASN C OD1 1 
ATOM   7949  N  ND2 . ASN C 1 354 ? 30.809  -23.958  54.494  1.00 32.66  ? 357  ASN C ND2 1 
ATOM   7950  N  N   . TYR C 1 355 ? 27.836  -25.314  49.388  1.00 32.70  ? 358  TYR C N   1 
ATOM   7951  C  CA  . TYR C 1 355 ? 26.616  -25.831  48.782  1.00 32.60  ? 358  TYR C CA  1 
ATOM   7952  C  C   . TYR C 1 355 ? 26.606  -27.350  48.508  1.00 30.39  ? 358  TYR C C   1 
ATOM   7953  O  O   . TYR C 1 355 ? 25.539  -27.947  48.401  1.00 29.23  ? 358  TYR C O   1 
ATOM   7954  C  CB  . TYR C 1 355 ? 26.305  -25.065  47.495  1.00 34.15  ? 358  TYR C CB  1 
ATOM   7955  C  CG  . TYR C 1 355 ? 24.837  -25.026  47.202  1.00 36.26  ? 358  TYR C CG  1 
ATOM   7956  C  CD1 . TYR C 1 355 ? 24.006  -24.123  47.873  1.00 36.27  ? 358  TYR C CD1 1 
ATOM   7957  C  CD2 . TYR C 1 355 ? 24.267  -25.897  46.281  1.00 35.22  ? 358  TYR C CD2 1 
ATOM   7958  C  CE1 . TYR C 1 355 ? 22.652  -24.082  47.623  1.00 38.23  ? 358  TYR C CE1 1 
ATOM   7959  C  CE2 . TYR C 1 355 ? 22.910  -25.867  46.026  1.00 38.39  ? 358  TYR C CE2 1 
ATOM   7960  C  CZ  . TYR C 1 355 ? 22.110  -24.961  46.702  1.00 40.95  ? 358  TYR C CZ  1 
ATOM   7961  O  OH  . TYR C 1 355 ? 20.759  -24.922  46.467  1.00 46.32  ? 358  TYR C OH  1 
ATOM   7962  N  N   . PHE C 1 356 ? 27.782  -27.958  48.404  1.00 29.21  ? 359  PHE C N   1 
ATOM   7963  C  CA  . PHE C 1 356 ? 27.900  -29.396  48.079  1.00 29.05  ? 359  PHE C CA  1 
ATOM   7964  C  C   . PHE C 1 356 ? 29.209  -29.938  48.635  1.00 27.17  ? 359  PHE C C   1 
ATOM   7965  O  O   . PHE C 1 356 ? 30.085  -29.163  49.009  1.00 29.54  ? 359  PHE C O   1 
ATOM   7966  C  CB  . PHE C 1 356 ? 27.795  -29.633  46.546  1.00 27.81  ? 359  PHE C CB  1 
ATOM   7967  C  CG  . PHE C 1 356 ? 29.031  -29.233  45.766  1.00 27.10  ? 359  PHE C CG  1 
ATOM   7968  C  CD1 . PHE C 1 356 ? 29.226  -27.922  45.354  1.00 28.18  ? 359  PHE C CD1 1 
ATOM   7969  C  CD2 . PHE C 1 356 ? 29.990  -30.174  45.428  1.00 26.84  ? 359  PHE C CD2 1 
ATOM   7970  C  CE1 . PHE C 1 356 ? 30.356  -27.553  44.633  1.00 27.73  ? 359  PHE C CE1 1 
ATOM   7971  C  CE2 . PHE C 1 356 ? 31.118  -29.811  44.709  1.00 27.31  ? 359  PHE C CE2 1 
ATOM   7972  C  CZ  . PHE C 1 356 ? 31.303  -28.503  44.304  1.00 26.77  ? 359  PHE C CZ  1 
ATOM   7973  N  N   . TRP C 1 357 ? 29.345  -31.254  48.677  1.00 27.29  ? 360  TRP C N   1 
ATOM   7974  C  CA  . TRP C 1 357 ? 30.492  -31.913  49.310  1.00 27.84  ? 360  TRP C CA  1 
ATOM   7975  C  C   . TRP C 1 357 ? 31.527  -32.387  48.333  1.00 30.06  ? 360  TRP C C   1 
ATOM   7976  O  O   . TRP C 1 357 ? 31.198  -33.008  47.308  1.00 32.26  ? 360  TRP C O   1 
ATOM   7977  C  CB  . TRP C 1 357 ? 30.023  -33.128  50.093  1.00 27.19  ? 360  TRP C CB  1 
ATOM   7978  C  CG  . TRP C 1 357 ? 29.169  -32.830  51.299  1.00 29.45  ? 360  TRP C CG  1 
ATOM   7979  C  CD1 . TRP C 1 357 ? 27.782  -32.958  51.417  1.00 30.35  ? 360  TRP C CD1 1 
ATOM   7980  C  CD2 . TRP C 1 357 ? 29.623  -32.380  52.619  1.00 28.61  ? 360  TRP C CD2 1 
ATOM   7981  N  NE1 . TRP C 1 357 ? 27.361  -32.618  52.671  1.00 29.65  ? 360  TRP C NE1 1 
ATOM   7982  C  CE2 . TRP C 1 357 ? 28.419  -32.253  53.444  1.00 30.45  ? 360  TRP C CE2 1 
ATOM   7983  C  CE3 . TRP C 1 357 ? 30.861  -32.075  53.176  1.00 29.07  ? 360  TRP C CE3 1 
ATOM   7984  C  CZ2 . TRP C 1 357 ? 28.478  -31.828  54.771  1.00 29.63  ? 360  TRP C CZ2 1 
ATOM   7985  C  CZ3 . TRP C 1 357 ? 30.908  -31.658  54.517  1.00 28.54  ? 360  TRP C CZ3 1 
ATOM   7986  C  CH2 . TRP C 1 357 ? 29.746  -31.539  55.289  1.00 28.00  ? 360  TRP C CH2 1 
ATOM   7987  N  N   . MET C 1 358 ? 32.796  -32.146  48.639  1.00 30.17  ? 361  MET C N   1 
ATOM   7988  C  CA  . MET C 1 358 ? 33.854  -32.819  47.906  1.00 32.06  ? 361  MET C CA  1 
ATOM   7989  C  C   . MET C 1 358 ? 34.850  -33.473  48.833  1.00 32.86  ? 361  MET C C   1 
ATOM   7990  O  O   . MET C 1 358 ? 35.007  -33.037  49.979  1.00 33.45  ? 361  MET C O   1 
ATOM   7991  C  CB  . MET C 1 358 ? 34.566  -31.883  46.948  1.00 35.79  ? 361  MET C CB  1 
ATOM   7992  C  CG  . MET C 1 358 ? 35.001  -32.605  45.679  1.00 40.19  ? 361  MET C CG  1 
ATOM   7993  S  SD  . MET C 1 358 ? 35.428  -31.507  44.328  1.00 48.03  ? 361  MET C SD  1 
ATOM   7994  C  CE  . MET C 1 358 ? 34.340  -30.125  44.602  1.00 42.17  ? 361  MET C CE  1 
ATOM   7995  N  N   . VAL C 1 359 ? 35.509  -34.530  48.353  1.00 32.22  ? 362  VAL C N   1 
ATOM   7996  C  CA  . VAL C 1 359 ? 36.510  -35.199  49.168  1.00 32.57  ? 362  VAL C CA  1 
ATOM   7997  C  C   . VAL C 1 359 ? 37.754  -34.330  49.215  1.00 36.10  ? 362  VAL C C   1 
ATOM   7998  O  O   . VAL C 1 359 ? 38.156  -33.740  48.207  1.00 36.62  ? 362  VAL C O   1 
ATOM   7999  C  CB  . VAL C 1 359 ? 36.825  -36.685  48.778  1.00 30.67  ? 362  VAL C CB  1 
ATOM   8000  C  CG1 . VAL C 1 359 ? 35.606  -37.417  48.232  1.00 28.02  ? 362  VAL C CG1 1 
ATOM   8001  C  CG2 . VAL C 1 359 ? 38.023  -36.806  47.859  1.00 29.22  ? 362  VAL C CG2 1 
ATOM   8002  N  N   . SER C 1 360 ? 38.321  -34.222  50.412  1.00 42.07  ? 363  SER C N   1 
ATOM   8003  C  CA  . SER C 1 360 ? 39.505  -33.402  50.672  1.00 46.98  ? 363  SER C CA  1 
ATOM   8004  C  C   . SER C 1 360 ? 40.093  -33.750  52.024  1.00 50.75  ? 363  SER C C   1 
ATOM   8005  O  O   . SER C 1 360 ? 39.754  -34.789  52.602  1.00 53.66  ? 363  SER C O   1 
ATOM   8006  C  CB  . SER C 1 360 ? 39.193  -31.897  50.577  1.00 48.82  ? 363  SER C CB  1 
ATOM   8007  O  OG  . SER C 1 360 ? 37.851  -31.609  50.921  1.00 47.67  ? 363  SER C OG  1 
ATOM   8008  N  N   . GLY C 1 361 ? 40.994  -32.895  52.505  1.00 56.60  ? 364  GLY C N   1 
ATOM   8009  C  CA  . GLY C 1 361 ? 41.666  -33.091  53.797  1.00 58.61  ? 364  GLY C CA  1 
ATOM   8010  C  C   . GLY C 1 361 ? 42.381  -31.840  54.273  1.00 59.48  ? 364  GLY C C   1 
ATOM   8011  O  O   . GLY C 1 361 ? 42.197  -30.754  53.711  1.00 60.44  ? 364  GLY C O   1 
ATOM   8012  N  N   . MET D 1 3   ? 22.606  -81.686  9.896   1.00 67.01  ? 6    MET D N   1 
ATOM   8013  C  CA  . MET D 1 3   ? 21.277  -81.642  9.211   1.00 67.69  ? 6    MET D CA  1 
ATOM   8014  C  C   . MET D 1 3   ? 20.304  -82.713  9.722   1.00 62.56  ? 6    MET D C   1 
ATOM   8015  O  O   . MET D 1 3   ? 19.139  -82.418  9.980   1.00 63.97  ? 6    MET D O   1 
ATOM   8016  C  CB  . MET D 1 3   ? 21.442  -81.737  7.683   1.00 72.93  ? 6    MET D CB  1 
ATOM   8017  C  CG  . MET D 1 3   ? 20.164  -81.524  6.874   1.00 77.55  ? 6    MET D CG  1 
ATOM   8018  S  SD  . MET D 1 3   ? 19.621  -79.802  6.735   1.00 94.33  ? 6    MET D SD  1 
ATOM   8019  C  CE  . MET D 1 3   ? 18.500  -79.638  8.130   1.00 80.89  ? 6    MET D CE  1 
ATOM   8020  N  N   . GLY D 1 4   ? 20.770  -83.951  9.853   1.00 56.63  ? 7    GLY D N   1 
ATOM   8021  C  CA  . GLY D 1 4   ? 19.920  -85.029  10.356  1.00 55.25  ? 7    GLY D CA  1 
ATOM   8022  C  C   . GLY D 1 4   ? 19.838  -85.055  11.875  1.00 51.91  ? 7    GLY D C   1 
ATOM   8023  O  O   . GLY D 1 4   ? 20.812  -84.755  12.550  1.00 51.27  ? 7    GLY D O   1 
ATOM   8024  N  N   . SER D 1 5   ? 18.676  -85.427  12.411  1.00 52.04  ? 8    SER D N   1 
ATOM   8025  C  CA  . SER D 1 5   ? 18.447  -85.454  13.863  1.00 50.97  ? 8    SER D CA  1 
ATOM   8026  C  C   . SER D 1 5   ? 18.135  -86.853  14.404  1.00 51.10  ? 8    SER D C   1 
ATOM   8027  O  O   . SER D 1 5   ? 17.840  -87.004  15.590  1.00 50.12  ? 8    SER D O   1 
ATOM   8028  C  CB  . SER D 1 5   ? 17.320  -84.498  14.264  1.00 50.44  ? 8    SER D CB  1 
ATOM   8029  O  OG  . SER D 1 5   ? 17.568  -83.175  13.826  1.00 56.65  ? 8    SER D OG  1 
ATOM   8030  N  N   . GLY D 1 6   ? 18.192  -87.865  13.537  1.00 51.25  ? 9    GLY D N   1 
ATOM   8031  C  CA  . GLY D 1 6   ? 18.004  -89.269  13.944  1.00 47.42  ? 9    GLY D CA  1 
ATOM   8032  C  C   . GLY D 1 6   ? 18.474  -90.232  12.868  1.00 43.06  ? 9    GLY D C   1 
ATOM   8033  O  O   . GLY D 1 6   ? 18.954  -89.806  11.826  1.00 43.09  ? 9    GLY D O   1 
ATOM   8034  N  N   . VAL D 1 7   ? 18.368  -91.530  13.138  1.00 40.36  ? 10   VAL D N   1 
ATOM   8035  C  CA  . VAL D 1 7   ? 18.642  -92.554  12.134  1.00 39.37  ? 10   VAL D CA  1 
ATOM   8036  C  C   . VAL D 1 7   ? 17.802  -93.783  12.349  1.00 37.15  ? 10   VAL D C   1 
ATOM   8037  O  O   . VAL D 1 7   ? 17.489  -94.132  13.481  1.00 37.30  ? 10   VAL D O   1 
ATOM   8038  C  CB  . VAL D 1 7   ? 20.102  -93.043  12.110  1.00 41.18  ? 10   VAL D CB  1 
ATOM   8039  C  CG1 . VAL D 1 7   ? 20.808  -92.579  10.849  1.00 39.59  ? 10   VAL D CG1 1 
ATOM   8040  C  CG2 . VAL D 1 7   ? 20.851  -92.636  13.356  1.00 43.31  ? 10   VAL D CG2 1 
ATOM   8041  N  N   . LEU D 1 8   ? 17.442  -94.442  11.249  1.00 35.70  ? 11   LEU D N   1 
ATOM   8042  C  CA  . LEU D 1 8   ? 16.895  -95.789  11.334  1.00 34.18  ? 11   LEU D CA  1 
ATOM   8043  C  C   . LEU D 1 8   ? 18.064  -96.729  11.581  1.00 33.91  ? 11   LEU D C   1 
ATOM   8044  O  O   . LEU D 1 8   ? 19.177  -96.446  11.147  1.00 33.45  ? 11   LEU D O   1 
ATOM   8045  C  CB  . LEU D 1 8   ? 16.162  -96.159  10.050  1.00 33.92  ? 11   LEU D CB  1 
ATOM   8046  C  CG  . LEU D 1 8   ? 14.993  -95.257  9.620   1.00 32.73  ? 11   LEU D CG  1 
ATOM   8047  C  CD1 . LEU D 1 8   ? 14.577  -95.585  8.192   1.00 32.29  ? 11   LEU D CD1 1 
ATOM   8048  C  CD2 . LEU D 1 8   ? 13.813  -95.367  10.573  1.00 31.00  ? 11   LEU D CD2 1 
ATOM   8049  N  N   . PRO D 1 9   ? 17.830  -97.839  12.294  1.00 34.58  ? 12   PRO D N   1 
ATOM   8050  C  CA  . PRO D 1 9   ? 18.866  -98.883  12.404  1.00 36.56  ? 12   PRO D CA  1 
ATOM   8051  C  C   . PRO D 1 9   ? 19.285  -99.455  11.041  1.00 39.12  ? 12   PRO D C   1 
ATOM   8052  O  O   . PRO D 1 9   ? 18.524  -99.366  10.078  1.00 39.92  ? 12   PRO D O   1 
ATOM   8053  C  CB  . PRO D 1 9   ? 18.178  -99.990  13.215  1.00 36.75  ? 12   PRO D CB  1 
ATOM   8054  C  CG  . PRO D 1 9   ? 16.991  -99.359  13.859  1.00 36.02  ? 12   PRO D CG  1 
ATOM   8055  C  CD  . PRO D 1 9   ? 16.591  -98.186  13.010  1.00 34.71  ? 12   PRO D CD  1 
ATOM   8056  N  N   . ARG D 1 10  ? 20.500  -100.004 10.964  1.00 42.79  ? 13   ARG D N   1 
ATOM   8057  C  CA  . ARG D 1 10  ? 20.904  -100.900 9.873   1.00 44.00  ? 13   ARG D CA  1 
ATOM   8058  C  C   . ARG D 1 10  ? 21.300  -102.253 10.477  1.00 47.83  ? 13   ARG D C   1 
ATOM   8059  O  O   . ARG D 1 10  ? 22.165  -102.303 11.363  1.00 48.96  ? 13   ARG D O   1 
ATOM   8060  C  CB  . ARG D 1 10  ? 22.060  -100.334 9.041   1.00 45.20  ? 13   ARG D CB  1 
ATOM   8061  C  CG  . ARG D 1 10  ? 22.521  -101.267 7.920   1.00 45.01  ? 13   ARG D CG  1 
ATOM   8062  C  CD  . ARG D 1 10  ? 23.818  -100.821 7.257   1.00 45.12  ? 13   ARG D CD  1 
ATOM   8063  N  NE  . ARG D 1 10  ? 23.607  -99.887  6.151   1.00 46.66  ? 13   ARG D NE  1 
ATOM   8064  C  CZ  . ARG D 1 10  ? 23.636  -100.204 4.852   1.00 48.74  ? 13   ARG D CZ  1 
ATOM   8065  N  NH1 . ARG D 1 10  ? 23.870  -101.454 4.459   1.00 48.42  ? 13   ARG D NH1 1 
ATOM   8066  N  NH2 . ARG D 1 10  ? 23.429  -99.259  3.934   1.00 47.21  ? 13   ARG D NH2 1 
ATOM   8067  N  N   . PRO D 1 11  ? 20.649  -103.354 10.030  1.00 47.53  ? 14   PRO D N   1 
ATOM   8068  C  CA  . PRO D 1 11  ? 19.530  -103.344 9.084   1.00 44.89  ? 14   PRO D CA  1 
ATOM   8069  C  C   . PRO D 1 11  ? 18.229  -102.917 9.787   1.00 43.41  ? 14   PRO D C   1 
ATOM   8070  O  O   . PRO D 1 11  ? 18.220  -102.735 11.008  1.00 41.52  ? 14   PRO D O   1 
ATOM   8071  C  CB  . PRO D 1 11  ? 19.459  -104.804 8.616   1.00 44.65  ? 14   PRO D CB  1 
ATOM   8072  C  CG  . PRO D 1 11  ? 19.990  -105.597 9.766   1.00 46.25  ? 14   PRO D CG  1 
ATOM   8073  C  CD  . PRO D 1 11  ? 20.976  -104.721 10.492  1.00 46.17  ? 14   PRO D CD  1 
ATOM   8074  N  N   . CYS D 1 12  ? 17.154  -102.733 9.022   1.00 39.79  ? 15   CYS D N   1 
ATOM   8075  C  CA  . CYS D 1 12  ? 15.858  -102.399 9.611   1.00 37.33  ? 15   CYS D CA  1 
ATOM   8076  C  C   . CYS D 1 12  ? 14.720  -103.028 8.818   1.00 37.42  ? 15   CYS D C   1 
ATOM   8077  O  O   . CYS D 1 12  ? 14.902  -103.382 7.657   1.00 36.47  ? 15   CYS D O   1 
ATOM   8078  C  CB  . CYS D 1 12  ? 15.676  -100.878 9.695   1.00 36.19  ? 15   CYS D CB  1 
ATOM   8079  S  SG  . CYS D 1 12  ? 15.705  -99.985  8.115   1.00 35.70  ? 15   CYS D SG  1 
ATOM   8080  N  N   . ARG D 1 13  ? 13.560  -103.195 9.454   1.00 40.60  ? 16   ARG D N   1 
ATOM   8081  C  CA  . ARG D 1 13  ? 12.341  -103.562 8.724   1.00 42.12  ? 16   ARG D CA  1 
ATOM   8082  C  C   . ARG D 1 13  ? 11.296  -102.452 8.677   1.00 40.10  ? 16   ARG D C   1 
ATOM   8083  O  O   . ARG D 1 13  ? 11.081  -101.704 9.633   1.00 41.53  ? 16   ARG D O   1 
ATOM   8084  C  CB  . ARG D 1 13  ? 11.725  -104.912 9.139   1.00 45.27  ? 16   ARG D CB  1 
ATOM   8085  C  CG  . ARG D 1 13  ? 11.898  -105.358 10.582  1.00 54.29  ? 16   ARG D CG  1 
ATOM   8086  C  CD  . ARG D 1 13  ? 11.383  -106.791 10.742  1.00 58.65  ? 16   ARG D CD  1 
ATOM   8087  N  NE  . ARG D 1 13  ? 12.179  -107.678 11.611  1.00 65.15  ? 16   ARG D NE  1 
ATOM   8088  C  CZ  . ARG D 1 13  ? 13.509  -107.655 11.772  1.00 68.66  ? 16   ARG D CZ  1 
ATOM   8089  N  NH1 . ARG D 1 13  ? 14.278  -106.777 11.129  1.00 68.33  ? 16   ARG D NH1 1 
ATOM   8090  N  NH2 . ARG D 1 13  ? 14.083  -108.529 12.594  1.00 67.36  ? 16   ARG D NH2 1 
ATOM   8091  N  N   . VAL D 1 14  ? 10.625  -102.396 7.539   1.00 37.41  ? 17   VAL D N   1 
ATOM   8092  C  CA  . VAL D 1 14  ? 9.844   -101.254 7.147   1.00 33.43  ? 17   VAL D CA  1 
ATOM   8093  C  C   . VAL D 1 14  ? 8.516   -101.754 6.607   1.00 30.47  ? 17   VAL D C   1 
ATOM   8094  O  O   . VAL D 1 14  ? 8.478   -102.663 5.782   1.00 31.11  ? 17   VAL D O   1 
ATOM   8095  C  CB  . VAL D 1 14  ? 10.661  -100.485 6.081   1.00 34.05  ? 17   VAL D CB  1 
ATOM   8096  C  CG1 . VAL D 1 14  ? 9.814   -100.011 4.915   1.00 32.60  ? 17   VAL D CG1 1 
ATOM   8097  C  CG2 . VAL D 1 14  ? 11.490  -99.390  6.728   1.00 31.53  ? 17   VAL D CG2 1 
ATOM   8098  N  N   . LEU D 1 15  ? 7.422   -101.188 7.088   1.00 27.35  ? 18   LEU D N   1 
ATOM   8099  C  CA  . LEU D 1 15  ? 6.117   -101.486 6.506   1.00 27.00  ? 18   LEU D CA  1 
ATOM   8100  C  C   . LEU D 1 15  ? 5.879   -100.552 5.334   1.00 27.52  ? 18   LEU D C   1 
ATOM   8101  O  O   . LEU D 1 15  ? 6.115   -99.354  5.446   1.00 28.84  ? 18   LEU D O   1 
ATOM   8102  C  CB  . LEU D 1 15  ? 5.017   -101.326 7.547   1.00 26.41  ? 18   LEU D CB  1 
ATOM   8103  C  CG  . LEU D 1 15  ? 3.571   -101.463 7.079   1.00 26.91  ? 18   LEU D CG  1 
ATOM   8104  C  CD1 . LEU D 1 15  ? 3.300   -102.813 6.436   1.00 27.24  ? 18   LEU D CD1 1 
ATOM   8105  C  CD2 . LEU D 1 15  ? 2.640   -101.219 8.247   1.00 25.60  ? 18   LEU D CD2 1 
ATOM   8106  N  N   . VAL D 1 16  ? 5.430   -101.094 4.207   1.00 28.35  ? 19   VAL D N   1 
ATOM   8107  C  CA  . VAL D 1 16  ? 5.164   -100.273 3.033   1.00 28.67  ? 19   VAL D CA  1 
ATOM   8108  C  C   . VAL D 1 16  ? 3.678   -100.243 2.728   1.00 28.88  ? 19   VAL D C   1 
ATOM   8109  O  O   . VAL D 1 16  ? 3.096   -101.263 2.390   1.00 30.30  ? 19   VAL D O   1 
ATOM   8110  C  CB  . VAL D 1 16  ? 5.934   -100.743 1.783   1.00 27.92  ? 19   VAL D CB  1 
ATOM   8111  C  CG1 . VAL D 1 16  ? 5.660   -99.790  0.631   1.00 27.90  ? 19   VAL D CG1 1 
ATOM   8112  C  CG2 . VAL D 1 16  ? 7.426   -100.785 2.051   1.00 26.76  ? 19   VAL D CG2 1 
ATOM   8113  N  N   . LEU D 1 17  ? 3.064   -99.075  2.863   1.00 30.23  ? 20   LEU D N   1 
ATOM   8114  C  CA  . LEU D 1 17  ? 1.667   -98.920  2.481   1.00 30.46  ? 20   LEU D CA  1 
ATOM   8115  C  C   . LEU D 1 17  ? 1.595   -98.261  1.103   1.00 30.65  ? 20   LEU D C   1 
ATOM   8116  O  O   . LEU D 1 17  ? 2.086   -97.156  0.907   1.00 28.64  ? 20   LEU D O   1 
ATOM   8117  C  CB  . LEU D 1 17  ? 0.880   -98.124  3.518   1.00 29.97  ? 20   LEU D CB  1 
ATOM   8118  C  CG  . LEU D 1 17  ? 0.954   -98.561  4.976   1.00 31.22  ? 20   LEU D CG  1 
ATOM   8119  C  CD1 . LEU D 1 17  ? -0.059  -97.762  5.775   1.00 31.45  ? 20   LEU D CD1 1 
ATOM   8120  C  CD2 . LEU D 1 17  ? 0.666   -100.054 5.114   1.00 34.35  ? 20   LEU D CD2 1 
ATOM   8121  N  N   . LEU D 1 18  ? 0.990   -98.970  0.155   1.00 30.98  ? 21   LEU D N   1 
ATOM   8122  C  CA  . LEU D 1 18  ? 1.001   -98.572  -1.231  1.00 29.81  ? 21   LEU D CA  1 
ATOM   8123  C  C   . LEU D 1 18  ? -0.414  -98.564  -1.768  1.00 31.59  ? 21   LEU D C   1 
ATOM   8124  O  O   . LEU D 1 18  ? -1.203  -99.503  -1.548  1.00 30.22  ? 21   LEU D O   1 
ATOM   8125  C  CB  . LEU D 1 18  ? 1.883   -99.525  -2.027  1.00 30.28  ? 21   LEU D CB  1 
ATOM   8126  C  CG  . LEU D 1 18  ? 2.120   -99.255  -3.513  1.00 31.17  ? 21   LEU D CG  1 
ATOM   8127  C  CD1 . LEU D 1 18  ? 3.565   -99.581  -3.877  1.00 30.58  ? 21   LEU D CD1 1 
ATOM   8128  C  CD2 . LEU D 1 18  ? 1.139   -100.056 -4.352  1.00 30.13  ? 21   LEU D CD2 1 
ATOM   8129  N  N   . ASN D 1 19  ? -0.741  -97.478  -2.456  1.00 32.16  ? 22   ASN D N   1 
ATOM   8130  C  CA  . ASN D 1 19  ? -2.002  -97.366  -3.131  1.00 34.67  ? 22   ASN D CA  1 
ATOM   8131  C  C   . ASN D 1 19  ? -1.750  -97.725  -4.580  1.00 39.04  ? 22   ASN D C   1 
ATOM   8132  O  O   . ASN D 1 19  ? -1.141  -96.939  -5.308  1.00 41.15  ? 22   ASN D O   1 
ATOM   8133  C  CB  . ASN D 1 19  ? -2.547  -95.946  -3.021  1.00 35.69  ? 22   ASN D CB  1 
ATOM   8134  C  CG  . ASN D 1 19  ? -3.932  -95.796  -3.625  1.00 34.30  ? 22   ASN D CG  1 
ATOM   8135  O  OD1 . ASN D 1 19  ? -4.658  -94.864  -3.291  1.00 35.01  ? 22   ASN D OD1 1 
ATOM   8136  N  ND2 . ASN D 1 19  ? -4.313  -96.714  -4.499  1.00 33.37  ? 22   ASN D ND2 1 
ATOM   8137  N  N   . PRO D 1 20  ? -2.218  -98.918  -5.003  1.00 39.45  ? 23   PRO D N   1 
ATOM   8138  C  CA  . PRO D 1 20  ? -1.951  -99.438  -6.348  1.00 39.87  ? 23   PRO D CA  1 
ATOM   8139  C  C   . PRO D 1 20  ? -2.641  -98.653  -7.470  1.00 44.33  ? 23   PRO D C   1 
ATOM   8140  O  O   . PRO D 1 20  ? -2.215  -98.751  -8.629  1.00 47.68  ? 23   PRO D O   1 
ATOM   8141  C  CB  . PRO D 1 20  ? -2.481  -100.871 -6.286  1.00 38.15  ? 23   PRO D CB  1 
ATOM   8142  C  CG  . PRO D 1 20  ? -3.553  -100.818 -5.248  1.00 38.79  ? 23   PRO D CG  1 
ATOM   8143  C  CD  . PRO D 1 20  ? -3.145  -99.779  -4.245  1.00 36.40  ? 23   PRO D CD  1 
ATOM   8144  N  N   . ARG D 1 21  ? -3.688  -97.890  -7.153  1.00 44.04  ? 24   ARG D N   1 
ATOM   8145  C  CA  . ARG D 1 21  ? -4.280  -96.996  -8.157  1.00 49.71  ? 24   ARG D CA  1 
ATOM   8146  C  C   . ARG D 1 21  ? -3.422  -95.759  -8.457  1.00 51.05  ? 24   ARG D C   1 
ATOM   8147  O  O   . ARG D 1 21  ? -3.777  -94.957  -9.322  1.00 49.73  ? 24   ARG D O   1 
ATOM   8148  C  CB  . ARG D 1 21  ? -5.721  -96.616  -7.805  1.00 53.07  ? 24   ARG D CB  1 
ATOM   8149  C  CG  . ARG D 1 21  ? -6.711  -97.746  -8.067  1.00 60.48  ? 24   ARG D CG  1 
ATOM   8150  C  CD  . ARG D 1 21  ? -8.149  -97.336  -7.797  1.00 67.25  ? 24   ARG D CD  1 
ATOM   8151  N  NE  . ARG D 1 21  ? -8.696  -96.473  -8.847  1.00 74.95  ? 24   ARG D NE  1 
ATOM   8152  C  CZ  . ARG D 1 21  ? -9.807  -95.745  -8.726  1.00 76.47  ? 24   ARG D CZ  1 
ATOM   8153  N  NH1 . ARG D 1 21  ? -10.508 -95.761  -7.594  1.00 76.11  ? 24   ARG D NH1 1 
ATOM   8154  N  NH2 . ARG D 1 21  ? -10.216 -94.990  -9.737  1.00 73.90  ? 24   ARG D NH2 1 
ATOM   8155  N  N   . GLY D 1 22  ? -2.278  -95.634  -7.770  1.00 52.84  ? 25   GLY D N   1 
ATOM   8156  C  CA  . GLY D 1 22  ? -1.380  -94.480  -7.909  1.00 53.21  ? 25   GLY D CA  1 
ATOM   8157  C  C   . GLY D 1 22  ? -0.349  -94.574  -9.024  1.00 55.65  ? 25   GLY D C   1 
ATOM   8158  O  O   . GLY D 1 22  ? 0.070   -95.671  -9.414  1.00 51.94  ? 25   GLY D O   1 
ATOM   8159  N  N   . GLY D 1 23  ? 0.073   -93.411  -9.522  1.00 59.95  ? 26   GLY D N   1 
ATOM   8160  C  CA  . GLY D 1 23  ? 1.011   -93.316  -10.651 1.00 62.87  ? 26   GLY D CA  1 
ATOM   8161  C  C   . GLY D 1 23  ? 0.366   -93.777  -11.952 1.00 66.88  ? 26   GLY D C   1 
ATOM   8162  O  O   . GLY D 1 23  ? 0.966   -94.549  -12.715 1.00 65.57  ? 26   GLY D O   1 
ATOM   8163  N  N   . LYS D 1 24  ? -0.859  -93.300  -12.195 1.00 65.78  ? 27   LYS D N   1 
ATOM   8164  C  CA  . LYS D 1 24  ? -1.717  -93.802  -13.270 1.00 66.06  ? 27   LYS D CA  1 
ATOM   8165  C  C   . LYS D 1 24  ? -1.861  -95.332  -13.139 1.00 62.90  ? 27   LYS D C   1 
ATOM   8166  O  O   . LYS D 1 24  ? -1.909  -96.074  -14.131 1.00 62.31  ? 27   LYS D O   1 
ATOM   8167  C  CB  . LYS D 1 24  ? -1.193  -93.359  -14.651 1.00 73.64  ? 27   LYS D CB  1 
ATOM   8168  C  CG  . LYS D 1 24  ? -2.265  -93.100  -15.716 1.00 80.37  ? 27   LYS D CG  1 
ATOM   8169  C  CD  . LYS D 1 24  ? -2.333  -94.181  -16.799 1.00 80.33  ? 27   LYS D CD  1 
ATOM   8170  C  CE  . LYS D 1 24  ? -3.442  -95.203  -16.560 1.00 79.65  ? 27   LYS D CE  1 
ATOM   8171  N  NZ  . LYS D 1 24  ? -4.807  -94.629  -16.715 1.00 80.63  ? 27   LYS D NZ  1 
ATOM   8172  N  N   . GLY D 1 25  ? -1.925  -95.791  -11.891 1.00 55.75  ? 28   GLY D N   1 
ATOM   8173  C  CA  . GLY D 1 25  ? -2.141  -97.207  -11.586 1.00 51.59  ? 28   GLY D CA  1 
ATOM   8174  C  C   . GLY D 1 25  ? -0.924  -98.109  -11.709 1.00 45.94  ? 28   GLY D C   1 
ATOM   8175  O  O   . GLY D 1 25  ? -1.065  -99.321  -11.841 1.00 43.98  ? 28   GLY D O   1 
ATOM   8176  N  N   . LYS D 1 26  ? 0.271   -97.527  -11.660 1.00 43.23  ? 29   LYS D N   1 
ATOM   8177  C  CA  . LYS D 1 26  ? 1.491   -98.323  -11.779 1.00 43.35  ? 29   LYS D CA  1 
ATOM   8178  C  C   . LYS D 1 26  ? 2.453   -98.181  -10.569 1.00 39.79  ? 29   LYS D C   1 
ATOM   8179  O  O   . LYS D 1 26  ? 3.629   -98.597  -10.628 1.00 36.60  ? 29   LYS D O   1 
ATOM   8180  C  CB  . LYS D 1 26  ? 2.207   -98.042  -13.114 1.00 50.27  ? 29   LYS D CB  1 
ATOM   8181  C  CG  . LYS D 1 26  ? 1.308   -97.906  -14.345 1.00 55.27  ? 29   LYS D CG  1 
ATOM   8182  C  CD  . LYS D 1 26  ? 2.026   -98.371  -15.610 1.00 58.48  ? 29   LYS D CD  1 
ATOM   8183  C  CE  . LYS D 1 26  ? 1.906   -97.381  -16.764 1.00 59.57  ? 29   LYS D CE  1 
ATOM   8184  N  NZ  . LYS D 1 26  ? 0.536   -97.282  -17.343 1.00 61.34  ? 29   LYS D NZ  1 
ATOM   8185  N  N   . ALA D 1 27  ? 1.941   -97.611  -9.476  1.00 35.50  ? 30   ALA D N   1 
ATOM   8186  C  CA  . ALA D 1 27  ? 2.679   -97.516  -8.210  1.00 34.92  ? 30   ALA D CA  1 
ATOM   8187  C  C   . ALA D 1 27  ? 3.387   -98.826  -7.812  1.00 32.51  ? 30   ALA D C   1 
ATOM   8188  O  O   . ALA D 1 27  ? 4.566   -98.816  -7.440  1.00 32.20  ? 30   ALA D O   1 
ATOM   8189  C  CB  . ALA D 1 27  ? 1.751   -97.044  -7.094  1.00 33.86  ? 30   ALA D CB  1 
ATOM   8190  N  N   . LEU D 1 28  ? 2.672   -99.948  -7.906  1.00 32.44  ? 31   LEU D N   1 
ATOM   8191  C  CA  . LEU D 1 28  ? 3.265   -101.266 -7.642  1.00 33.59  ? 31   LEU D CA  1 
ATOM   8192  C  C   . LEU D 1 28  ? 4.455   -101.583 -8.551  1.00 33.12  ? 31   LEU D C   1 
ATOM   8193  O  O   . LEU D 1 28  ? 5.533   -101.940 -8.079  1.00 34.89  ? 31   LEU D O   1 
ATOM   8194  C  CB  . LEU D 1 28  ? 2.210   -102.370 -7.730  1.00 32.40  ? 31   LEU D CB  1 
ATOM   8195  C  CG  . LEU D 1 28  ? 2.687   -103.776 -7.350  1.00 33.09  ? 31   LEU D CG  1 
ATOM   8196  C  CD1 . LEU D 1 28  ? 3.255   -103.780 -5.944  1.00 31.55  ? 31   LEU D CD1 1 
ATOM   8197  C  CD2 . LEU D 1 28  ? 1.561   -104.795 -7.468  1.00 32.42  ? 31   LEU D CD2 1 
ATOM   8198  N  N   . GLN D 1 29  ? 4.254   -101.428 -9.851  1.00 35.92  ? 32   GLN D N   1 
ATOM   8199  C  CA  . GLN D 1 29  ? 5.315   -101.590 -10.844 1.00 37.03  ? 32   GLN D CA  1 
ATOM   8200  C  C   . GLN D 1 29  ? 6.469   -100.596 -10.605 1.00 35.20  ? 32   GLN D C   1 
ATOM   8201  O  O   . GLN D 1 29  ? 7.652   -100.957 -10.721 1.00 37.19  ? 32   GLN D O   1 
ATOM   8202  C  CB  . GLN D 1 29  ? 4.704   -101.471 -12.257 1.00 41.93  ? 32   GLN D CB  1 
ATOM   8203  C  CG  . GLN D 1 29  ? 5.659   -101.141 -13.401 1.00 48.01  ? 32   GLN D CG  1 
ATOM   8204  C  CD  . GLN D 1 29  ? 4.962   -100.422 -14.560 1.00 51.80  ? 32   GLN D CD  1 
ATOM   8205  O  OE1 . GLN D 1 29  ? 5.151   -99.214  -14.768 1.00 54.58  ? 32   GLN D OE1 1 
ATOM   8206  N  NE2 . GLN D 1 29  ? 4.145   -101.158 -15.308 1.00 51.09  ? 32   GLN D NE2 1 
ATOM   8207  N  N   . LEU D 1 30  ? 6.145   -99.360  -10.243 1.00 32.45  ? 33   LEU D N   1 
ATOM   8208  C  CA  . LEU D 1 30  ? 7.206   -98.395  -9.911  1.00 31.00  ? 33   LEU D CA  1 
ATOM   8209  C  C   . LEU D 1 30  ? 7.938   -98.819  -8.645  1.00 29.85  ? 33   LEU D C   1 
ATOM   8210  O  O   . LEU D 1 30  ? 9.156   -98.613  -8.509  1.00 27.64  ? 33   LEU D O   1 
ATOM   8211  C  CB  . LEU D 1 30  ? 6.669   -96.970  -9.765  1.00 30.82  ? 33   LEU D CB  1 
ATOM   8212  C  CG  . LEU D 1 30  ? 6.092   -96.271  -11.000 1.00 32.10  ? 33   LEU D CG  1 
ATOM   8213  C  CD1 . LEU D 1 30  ? 5.196   -95.113  -10.581 1.00 32.78  ? 33   LEU D CD1 1 
ATOM   8214  C  CD2 . LEU D 1 30  ? 7.176   -95.825  -11.981 1.00 32.34  ? 33   LEU D CD2 1 
ATOM   8215  N  N   . PHE D 1 31  ? 7.210   -99.440  -7.720  1.00 29.65  ? 34   PHE D N   1 
ATOM   8216  C  CA  . PHE D 1 31  ? 7.872   -99.921  -6.524  1.00 30.04  ? 34   PHE D CA  1 
ATOM   8217  C  C   . PHE D 1 31  ? 8.898   -100.975 -6.918  1.00 32.01  ? 34   PHE D C   1 
ATOM   8218  O  O   . PHE D 1 31  ? 10.060  -100.919 -6.478  1.00 31.39  ? 34   PHE D O   1 
ATOM   8219  C  CB  . PHE D 1 31  ? 6.889   -100.482 -5.496  1.00 29.01  ? 34   PHE D CB  1 
ATOM   8220  C  CG  . PHE D 1 31  ? 7.568   -101.067 -4.291  1.00 29.23  ? 34   PHE D CG  1 
ATOM   8221  C  CD1 . PHE D 1 31  ? 7.964   -100.246 -3.234  1.00 27.76  ? 34   PHE D CD1 1 
ATOM   8222  C  CD2 . PHE D 1 31  ? 7.847   -102.433 -4.220  1.00 28.46  ? 34   PHE D CD2 1 
ATOM   8223  C  CE1 . PHE D 1 31  ? 8.621   -100.773 -2.130  1.00 28.68  ? 34   PHE D CE1 1 
ATOM   8224  C  CE2 . PHE D 1 31  ? 8.497   -102.965 -3.110  1.00 30.22  ? 34   PHE D CE2 1 
ATOM   8225  C  CZ  . PHE D 1 31  ? 8.890   -102.132 -2.061  1.00 29.02  ? 34   PHE D CZ  1 
ATOM   8226  N  N   . ARG D 1 32  ? 8.473   -101.924 -7.760  1.00 33.27  ? 35   ARG D N   1 
ATOM   8227  C  CA  . ARG D 1 32  ? 9.328   -103.074 -8.079  1.00 35.77  ? 35   ARG D CA  1 
ATOM   8228  C  C   . ARG D 1 32  ? 10.575  -102.710 -8.870  1.00 34.52  ? 35   ARG D C   1 
ATOM   8229  O  O   . ARG D 1 32  ? 11.629  -103.304 -8.653  1.00 37.28  ? 35   ARG D O   1 
ATOM   8230  C  CB  . ARG D 1 32  ? 8.527   -104.236 -8.696  1.00 36.61  ? 35   ARG D CB  1 
ATOM   8231  C  CG  . ARG D 1 32  ? 7.684   -104.893 -7.614  1.00 39.31  ? 35   ARG D CG  1 
ATOM   8232  C  CD  . ARG D 1 32  ? 6.778   -106.040 -8.036  1.00 42.29  ? 35   ARG D CD  1 
ATOM   8233  N  NE  . ARG D 1 32  ? 6.367   -106.759 -6.825  1.00 43.84  ? 35   ARG D NE  1 
ATOM   8234  C  CZ  . ARG D 1 32  ? 5.203   -107.392 -6.632  1.00 45.39  ? 35   ARG D CZ  1 
ATOM   8235  N  NH1 . ARG D 1 32  ? 4.246   -107.430 -7.576  1.00 36.95  ? 35   ARG D NH1 1 
ATOM   8236  N  NH2 . ARG D 1 32  ? 5.007   -107.990 -5.450  1.00 43.71  ? 35   ARG D NH2 1 
ATOM   8237  N  N   . SER D 1 33  ? 10.466  -101.706 -9.733  1.00 32.49  ? 36   SER D N   1 
ATOM   8238  C  CA  . SER D 1 33  ? 11.595  -101.256 -10.530 1.00 33.59  ? 36   SER D CA  1 
ATOM   8239  C  C   . SER D 1 33  ? 12.450  -100.128 -9.904  1.00 34.74  ? 36   SER D C   1 
ATOM   8240  O  O   . SER D 1 33  ? 13.669  -100.091 -10.089 1.00 34.48  ? 36   SER D O   1 
ATOM   8241  C  CB  . SER D 1 33  ? 11.098  -100.824 -11.903 1.00 33.50  ? 36   SER D CB  1 
ATOM   8242  O  OG  . SER D 1 33  ? 10.151  -99.782  -11.779 1.00 37.12  ? 36   SER D OG  1 
ATOM   8243  N  N   . HIS D 1 34  ? 11.826  -99.195  -9.190  1.00 34.01  ? 37   HIS D N   1 
ATOM   8244  C  CA  . HIS D 1 34  ? 12.563  -98.021  -8.727  1.00 34.93  ? 37   HIS D CA  1 
ATOM   8245  C  C   . HIS D 1 34  ? 12.901  -98.004  -7.268  1.00 36.06  ? 37   HIS D C   1 
ATOM   8246  O  O   . HIS D 1 34  ? 13.795  -97.269  -6.856  1.00 39.77  ? 37   HIS D O   1 
ATOM   8247  C  CB  . HIS D 1 34  ? 11.830  -96.741  -9.115  1.00 36.03  ? 37   HIS D CB  1 
ATOM   8248  C  CG  . HIS D 1 34  ? 11.981  -96.382  -10.569 1.00 36.96  ? 37   HIS D CG  1 
ATOM   8249  N  ND1 . HIS D 1 34  ? 11.178  -96.880  -11.524 1.00 38.12  ? 37   HIS D ND1 1 
ATOM   8250  C  CD2 . HIS D 1 34  ? 12.902  -95.566  -11.216 1.00 37.47  ? 37   HIS D CD2 1 
ATOM   8251  C  CE1 . HIS D 1 34  ? 11.546  -96.386  -12.717 1.00 36.81  ? 37   HIS D CE1 1 
ATOM   8252  N  NE2 . HIS D 1 34  ? 12.607  -95.589  -12.525 1.00 38.19  ? 37   HIS D NE2 1 
ATOM   8253  N  N   . VAL D 1 35  ? 12.208  -98.813  -6.472  1.00 34.00  ? 38   VAL D N   1 
ATOM   8254  C  CA  . VAL D 1 35  ? 12.368  -98.768  -5.024  1.00 32.36  ? 38   VAL D CA  1 
ATOM   8255  C  C   . VAL D 1 35  ? 12.964  -100.051 -4.484  1.00 31.99  ? 38   VAL D C   1 
ATOM   8256  O  O   . VAL D 1 35  ? 13.991  -100.024 -3.810  1.00 31.30  ? 38   VAL D O   1 
ATOM   8257  C  CB  . VAL D 1 35  ? 11.028  -98.514  -4.301  1.00 30.60  ? 38   VAL D CB  1 
ATOM   8258  C  CG1 . VAL D 1 35  ? 11.264  -98.302  -2.815  1.00 29.26  ? 38   VAL D CG1 1 
ATOM   8259  C  CG2 . VAL D 1 35  ? 10.299  -97.333  -4.920  1.00 30.67  ? 38   VAL D CG2 1 
ATOM   8260  N  N   . GLN D 1 36  ? 12.314  -101.174 -4.784  1.00 33.61  ? 39   GLN D N   1 
ATOM   8261  C  CA  . GLN D 1 36  ? 12.704  -102.466 -4.212  1.00 34.10  ? 39   GLN D CA  1 
ATOM   8262  C  C   . GLN D 1 36  ? 14.202  -102.792 -4.339  1.00 33.44  ? 39   GLN D C   1 
ATOM   8263  O  O   . GLN D 1 36  ? 14.796  -103.267 -3.378  1.00 33.41  ? 39   GLN D O   1 
ATOM   8264  C  CB  . GLN D 1 36  ? 11.834  -103.605 -4.772  1.00 35.60  ? 39   GLN D CB  1 
ATOM   8265  C  CG  . GLN D 1 36  ? 12.301  -105.001 -4.381  1.00 36.52  ? 39   GLN D CG  1 
ATOM   8266  C  CD  . GLN D 1 36  ? 11.334  -106.103 -4.791  1.00 39.84  ? 39   GLN D CD  1 
ATOM   8267  O  OE1 . GLN D 1 36  ? 10.136  -105.867 -5.010  1.00 37.22  ? 39   GLN D OE1 1 
ATOM   8268  N  NE2 . GLN D 1 36  ? 11.851  -107.328 -4.880  1.00 39.24  ? 39   GLN D NE2 1 
ATOM   8269  N  N   . PRO D 1 37  ? 14.823  -102.535 -5.511  1.00 34.68  ? 40   PRO D N   1 
ATOM   8270  C  CA  . PRO D 1 37  ? 16.225  -102.981 -5.592  1.00 35.98  ? 40   PRO D CA  1 
ATOM   8271  C  C   . PRO D 1 37  ? 17.211  -102.081 -4.855  1.00 38.05  ? 40   PRO D C   1 
ATOM   8272  O  O   . PRO D 1 37  ? 18.265  -102.554 -4.434  1.00 41.58  ? 40   PRO D O   1 
ATOM   8273  C  CB  . PRO D 1 37  ? 16.509  -103.023 -7.099  1.00 36.90  ? 40   PRO D CB  1 
ATOM   8274  C  CG  . PRO D 1 37  ? 15.520  -102.091 -7.709  1.00 34.93  ? 40   PRO D CG  1 
ATOM   8275  C  CD  . PRO D 1 37  ? 14.315  -102.046 -6.807  1.00 33.19  ? 40   PRO D CD  1 
ATOM   8276  N  N   . LEU D 1 38  ? 16.870  -100.802 -4.692  1.00 40.80  ? 41   LEU D N   1 
ATOM   8277  C  CA  . LEU D 1 38  ? 17.633  -99.895  -3.815  1.00 38.81  ? 41   LEU D CA  1 
ATOM   8278  C  C   . LEU D 1 38  ? 17.556  -100.333 -2.347  1.00 39.22  ? 41   LEU D C   1 
ATOM   8279  O  O   . LEU D 1 38  ? 18.569  -100.336 -1.636  1.00 40.28  ? 41   LEU D O   1 
ATOM   8280  C  CB  . LEU D 1 38  ? 17.154  -98.449  -3.991  1.00 38.97  ? 41   LEU D CB  1 
ATOM   8281  C  CG  . LEU D 1 38  ? 17.877  -97.489  -4.957  1.00 38.08  ? 41   LEU D CG  1 
ATOM   8282  C  CD1 . LEU D 1 38  ? 18.838  -98.145  -5.940  1.00 40.96  ? 41   LEU D CD1 1 
ATOM   8283  C  CD2 . LEU D 1 38  ? 16.886  -96.612  -5.714  1.00 38.35  ? 41   LEU D CD2 1 
ATOM   8284  N  N   . LEU D 1 39  ? 16.361  -100.736 -1.919  1.00 38.32  ? 42   LEU D N   1 
ATOM   8285  C  CA  . LEU D 1 39  ? 16.134  -101.295 -0.582  1.00 37.95  ? 42   LEU D CA  1 
ATOM   8286  C  C   . LEU D 1 39  ? 16.952  -102.549 -0.254  1.00 40.62  ? 42   LEU D C   1 
ATOM   8287  O  O   . LEU D 1 39  ? 17.447  -102.686 0.869   1.00 42.08  ? 42   LEU D O   1 
ATOM   8288  C  CB  . LEU D 1 39  ? 14.637  -101.569 -0.353  1.00 36.52  ? 42   LEU D CB  1 
ATOM   8289  C  CG  . LEU D 1 39  ? 13.652  -100.389 -0.410  1.00 36.38  ? 42   LEU D CG  1 
ATOM   8290  C  CD1 . LEU D 1 39  ? 12.288  -100.813 0.117   1.00 34.41  ? 42   LEU D CD1 1 
ATOM   8291  C  CD2 . LEU D 1 39  ? 14.155  -99.196  0.384   1.00 34.86  ? 42   LEU D CD2 1 
ATOM   8292  N  N   . ALA D 1 40  ? 17.091  -103.470 -1.210  1.00 39.99  ? 43   ALA D N   1 
ATOM   8293  C  CA  . ALA D 1 40  ? 17.866  -104.694 -0.965  1.00 40.15  ? 43   ALA D CA  1 
ATOM   8294  C  C   . ALA D 1 40  ? 19.328  -104.377 -0.650  1.00 39.92  ? 43   ALA D C   1 
ATOM   8295  O  O   . ALA D 1 40  ? 19.908  -104.959 0.264   1.00 39.97  ? 43   ALA D O   1 
ATOM   8296  C  CB  . ALA D 1 40  ? 17.771  -105.645 -2.153  1.00 39.08  ? 43   ALA D CB  1 
ATOM   8297  N  N   . GLU D 1 41  ? 19.905  -103.451 -1.412  1.00 42.88  ? 44   GLU D N   1 
ATOM   8298  C  CA  . GLU D 1 41  ? 21.279  -102.990 -1.203  1.00 47.44  ? 44   GLU D CA  1 
ATOM   8299  C  C   . GLU D 1 41  ? 21.465  -102.323 0.174   1.00 47.74  ? 44   GLU D C   1 
ATOM   8300  O  O   . GLU D 1 41  ? 22.463  -102.577 0.861   1.00 47.77  ? 44   GLU D O   1 
ATOM   8301  C  CB  . GLU D 1 41  ? 21.710  -102.072 -2.365  1.00 51.86  ? 44   GLU D CB  1 
ATOM   8302  C  CG  . GLU D 1 41  ? 22.834  -101.072 -2.078  1.00 61.55  ? 44   GLU D CG  1 
ATOM   8303  C  CD  . GLU D 1 41  ? 24.246  -101.663 -2.107  1.00 67.08  ? 44   GLU D CD  1 
ATOM   8304  O  OE1 . GLU D 1 41  ? 25.140  -101.017 -2.701  1.00 66.58  ? 44   GLU D OE1 1 
ATOM   8305  O  OE2 . GLU D 1 41  ? 24.483  -102.748 -1.522  1.00 69.84  ? 44   GLU D OE2 1 
ATOM   8306  N  N   . ALA D 1 42  ? 20.488  -101.506 0.581   1.00 45.98  ? 45   ALA D N   1 
ATOM   8307  C  CA  . ALA D 1 42  ? 20.518  -100.814 1.882   1.00 42.14  ? 45   ALA D CA  1 
ATOM   8308  C  C   . ALA D 1 42  ? 20.151  -101.717 3.054   1.00 41.46  ? 45   ALA D C   1 
ATOM   8309  O  O   . ALA D 1 42  ? 20.066  -101.258 4.203   1.00 42.00  ? 45   ALA D O   1 
ATOM   8310  C  CB  . ALA D 1 42  ? 19.616  -99.583  1.859   1.00 41.28  ? 45   ALA D CB  1 
ATOM   8311  N  N   . GLU D 1 43  ? 19.932  -103.000 2.772   1.00 39.81  ? 46   GLU D N   1 
ATOM   8312  C  CA  . GLU D 1 43  ? 19.620  -103.971 3.819   1.00 41.38  ? 46   GLU D CA  1 
ATOM   8313  C  C   . GLU D 1 43  ? 18.347  -103.562 4.556   1.00 40.43  ? 46   GLU D C   1 
ATOM   8314  O  O   . GLU D 1 43  ? 18.217  -103.730 5.771   1.00 41.53  ? 46   GLU D O   1 
ATOM   8315  C  CB  . GLU D 1 43  ? 20.803  -104.140 4.783   1.00 44.22  ? 46   GLU D CB  1 
ATOM   8316  C  CG  . GLU D 1 43  ? 22.109  -104.474 4.070   1.00 49.46  ? 46   GLU D CG  1 
ATOM   8317  C  CD  . GLU D 1 43  ? 23.222  -104.933 4.998   1.00 53.60  ? 46   GLU D CD  1 
ATOM   8318  O  OE1 . GLU D 1 43  ? 22.971  -105.148 6.205   1.00 53.78  ? 46   GLU D OE1 1 
ATOM   8319  O  OE2 . GLU D 1 43  ? 24.360  -105.090 4.505   1.00 56.76  ? 46   GLU D OE2 1 
ATOM   8320  N  N   . ILE D 1 44  ? 17.413  -103.006 3.792   1.00 38.28  ? 47   ILE D N   1 
ATOM   8321  C  CA  . ILE D 1 44  ? 16.109  -102.635 4.304   1.00 37.43  ? 47   ILE D CA  1 
ATOM   8322  C  C   . ILE D 1 44  ? 15.102  -103.680 3.858   1.00 35.82  ? 47   ILE D C   1 
ATOM   8323  O  O   . ILE D 1 44  ? 14.737  -103.728 2.693   1.00 37.20  ? 47   ILE D O   1 
ATOM   8324  C  CB  . ILE D 1 44  ? 15.696  -101.205 3.850   1.00 36.35  ? 47   ILE D CB  1 
ATOM   8325  C  CG1 . ILE D 1 44  ? 16.677  -100.164 4.413   1.00 35.79  ? 47   ILE D CG1 1 
ATOM   8326  C  CG2 . ILE D 1 44  ? 14.275  -100.877 4.288   1.00 35.76  ? 47   ILE D CG2 1 
ATOM   8327  C  CD1 . ILE D 1 44  ? 16.438  -98.733  3.971   1.00 36.25  ? 47   ILE D CD1 1 
ATOM   8328  N  N   . SER D 1 45  ? 14.685  -104.531 4.792   1.00 36.00  ? 48   SER D N   1 
ATOM   8329  C  CA  . SER D 1 45  ? 13.571  -105.463 4.562   1.00 36.03  ? 48   SER D CA  1 
ATOM   8330  C  C   . SER D 1 45  ? 12.267  -104.700 4.578   1.00 34.55  ? 48   SER D C   1 
ATOM   8331  O  O   . SER D 1 45  ? 12.165  -103.671 5.228   1.00 36.23  ? 48   SER D O   1 
ATOM   8332  C  CB  . SER D 1 45  ? 13.514  -106.522 5.653   1.00 34.00  ? 48   SER D CB  1 
ATOM   8333  O  OG  . SER D 1 45  ? 14.727  -107.235 5.689   1.00 35.86  ? 48   SER D OG  1 
ATOM   8334  N  N   . PHE D 1 46  ? 11.262  -105.216 3.886   1.00 33.53  ? 49   PHE D N   1 
ATOM   8335  C  CA  . PHE D 1 46  ? 9.983   -104.545 3.818   1.00 32.15  ? 49   PHE D CA  1 
ATOM   8336  C  C   . PHE D 1 46  ? 8.873   -105.562 3.664   1.00 33.92  ? 49   PHE D C   1 
ATOM   8337  O  O   . PHE D 1 46  ? 9.102   -106.669 3.173   1.00 34.37  ? 49   PHE D O   1 
ATOM   8338  C  CB  . PHE D 1 46  ? 9.962   -103.588 2.616   1.00 31.95  ? 49   PHE D CB  1 
ATOM   8339  C  CG  . PHE D 1 46  ? 10.018  -104.289 1.276   1.00 31.58  ? 49   PHE D CG  1 
ATOM   8340  C  CD1 . PHE D 1 46  ? 11.238  -104.501 0.642   1.00 29.98  ? 49   PHE D CD1 1 
ATOM   8341  C  CD2 . PHE D 1 46  ? 8.848   -104.734 0.656   1.00 31.04  ? 49   PHE D CD2 1 
ATOM   8342  C  CE1 . PHE D 1 46  ? 11.299  -105.158 -0.576  1.00 31.57  ? 49   PHE D CE1 1 
ATOM   8343  C  CE2 . PHE D 1 46  ? 8.897   -105.397 -0.566  1.00 32.62  ? 49   PHE D CE2 1 
ATOM   8344  C  CZ  . PHE D 1 46  ? 10.126  -105.603 -1.187  1.00 32.76  ? 49   PHE D CZ  1 
ATOM   8345  N  N   . THR D 1 47  ? 7.665   -105.184 4.073   1.00 33.74  ? 50   THR D N   1 
ATOM   8346  C  CA  . THR D 1 47  ? 6.470   -105.879 3.617   1.00 33.15  ? 50   THR D CA  1 
ATOM   8347  C  C   . THR D 1 47  ? 5.429   -104.927 3.045   1.00 33.18  ? 50   THR D C   1 
ATOM   8348  O  O   . THR D 1 47  ? 5.152   -103.878 3.611   1.00 33.11  ? 50   THR D O   1 
ATOM   8349  C  CB  . THR D 1 47  ? 5.884   -106.896 4.641   1.00 33.79  ? 50   THR D CB  1 
ATOM   8350  O  OG1 . THR D 1 47  ? 4.493   -106.640 4.885   1.00 36.67  ? 50   THR D OG1 1 
ATOM   8351  C  CG2 . THR D 1 47  ? 6.641   -106.923 5.924   1.00 31.73  ? 50   THR D CG2 1 
ATOM   8352  N  N   . LEU D 1 48  ? 4.885   -105.309 1.895   1.00 34.95  ? 51   LEU D N   1 
ATOM   8353  C  CA  . LEU D 1 48  ? 3.950   -104.499 1.136   1.00 35.34  ? 51   LEU D CA  1 
ATOM   8354  C  C   . LEU D 1 48  ? 2.528   -104.753 1.557   1.00 35.61  ? 51   LEU D C   1 
ATOM   8355  O  O   . LEU D 1 48  ? 2.053   -105.876 1.471   1.00 35.56  ? 51   LEU D O   1 
ATOM   8356  C  CB  . LEU D 1 48  ? 4.050   -104.849 -0.344  1.00 36.82  ? 51   LEU D CB  1 
ATOM   8357  C  CG  . LEU D 1 48  ? 5.077   -104.161 -1.229  1.00 38.12  ? 51   LEU D CG  1 
ATOM   8358  C  CD1 . LEU D 1 48  ? 5.201   -104.955 -2.521  1.00 38.60  ? 51   LEU D CD1 1 
ATOM   8359  C  CD2 . LEU D 1 48  ? 4.662   -102.721 -1.503  1.00 37.17  ? 51   LEU D CD2 1 
ATOM   8360  N  N   . MET D 1 49  ? 1.843   -103.703 1.984   1.00 37.21  ? 52   MET D N   1 
ATOM   8361  C  CA  . MET D 1 49  ? 0.410   -103.762 2.234   1.00 39.59  ? 52   MET D CA  1 
ATOM   8362  C  C   . MET D 1 49  ? -0.228  -102.856 1.206   1.00 36.60  ? 52   MET D C   1 
ATOM   8363  O  O   . MET D 1 49  ? 0.303   -101.797 0.929   1.00 38.62  ? 52   MET D O   1 
ATOM   8364  C  CB  . MET D 1 49  ? 0.098   -103.277 3.649   1.00 43.54  ? 52   MET D CB  1 
ATOM   8365  C  CG  . MET D 1 49  ? -0.781  -104.238 4.436   1.00 55.18  ? 52   MET D CG  1 
ATOM   8366  S  SD  . MET D 1 49  ? -0.582  -104.306 6.245   1.00 61.69  ? 52   MET D SD  1 
ATOM   8367  C  CE  . MET D 1 49  ? 1.109   -104.867 6.426   1.00 57.86  ? 52   MET D CE  1 
ATOM   8368  N  N   . LEU D 1 50  ? -1.341  -103.276 0.619   1.00 37.21  ? 53   LEU D N   1 
ATOM   8369  C  CA  . LEU D 1 50  ? -2.016  -102.486 -0.404  1.00 37.31  ? 53   LEU D CA  1 
ATOM   8370  C  C   . LEU D 1 50  ? -3.234  -101.810 0.189   1.00 40.69  ? 53   LEU D C   1 
ATOM   8371  O  O   . LEU D 1 50  ? -3.993  -102.427 0.939   1.00 42.01  ? 53   LEU D O   1 
ATOM   8372  C  CB  . LEU D 1 50  ? -2.426  -103.330 -1.615  1.00 35.80  ? 53   LEU D CB  1 
ATOM   8373  C  CG  . LEU D 1 50  ? -1.369  -104.122 -2.400  1.00 37.18  ? 53   LEU D CG  1 
ATOM   8374  C  CD1 . LEU D 1 50  ? -1.987  -104.673 -3.678  1.00 36.87  ? 53   LEU D CD1 1 
ATOM   8375  C  CD2 . LEU D 1 50  ? -0.097  -103.342 -2.729  1.00 35.78  ? 53   LEU D CD2 1 
ATOM   8376  N  N   . THR D 1 51  ? -3.416  -100.538 -0.149  1.00 41.97  ? 54   THR D N   1 
ATOM   8377  C  CA  . THR D 1 51  ? -4.408  -99.709  0.517   1.00 46.05  ? 54   THR D CA  1 
ATOM   8378  C  C   . THR D 1 51  ? -5.014  -98.689  -0.432  1.00 49.11  ? 54   THR D C   1 
ATOM   8379  O  O   . THR D 1 51  ? -4.379  -97.683  -0.778  1.00 46.32  ? 54   THR D O   1 
ATOM   8380  C  CB  . THR D 1 51  ? -3.809  -99.006  1.758   1.00 46.04  ? 54   THR D CB  1 
ATOM   8381  O  OG1 . THR D 1 51  ? -4.839  -98.276  2.428   1.00 50.64  ? 54   THR D OG1 1 
ATOM   8382  C  CG2 . THR D 1 51  ? -2.678  -98.050  1.374   1.00 46.78  ? 54   THR D CG2 1 
ATOM   8383  N  N   . GLU D 1 52  ? -6.247  -98.952  -0.855  1.00 55.46  ? 55   GLU D N   1 
ATOM   8384  C  CA  . GLU D 1 52  ? -6.918  -98.061  -1.806  1.00 58.64  ? 55   GLU D CA  1 
ATOM   8385  C  C   . GLU D 1 52  ? -8.283  -97.513  -1.355  1.00 60.56  ? 55   GLU D C   1 
ATOM   8386  O  O   . GLU D 1 52  ? -8.552  -96.324  -1.544  1.00 63.44  ? 55   GLU D O   1 
ATOM   8387  C  CB  . GLU D 1 52  ? -7.011  -98.708  -3.190  1.00 60.45  ? 55   GLU D CB  1 
ATOM   8388  C  CG  . GLU D 1 52  ? -7.694  -100.068 -3.215  1.00 64.46  ? 55   GLU D CG  1 
ATOM   8389  C  CD  . GLU D 1 52  ? -8.471  -100.297 -4.493  1.00 69.40  ? 55   GLU D CD  1 
ATOM   8390  O  OE1 . GLU D 1 52  ? -9.241  -101.282 -4.552  1.00 74.92  ? 55   GLU D OE1 1 
ATOM   8391  O  OE2 . GLU D 1 52  ? -8.321  -99.486  -5.433  1.00 69.22  ? 55   GLU D OE2 1 
ATOM   8392  N  N   . ARG D 1 53  ? -9.132  -98.363  -0.768  1.00 60.87  ? 56   ARG D N   1 
ATOM   8393  C  CA  . ARG D 1 53  ? -10.469 -97.939  -0.328  1.00 62.42  ? 56   ARG D CA  1 
ATOM   8394  C  C   . ARG D 1 53  ? -10.364 -96.837  0.727   1.00 65.79  ? 56   ARG D C   1 
ATOM   8395  O  O   . ARG D 1 53  ? -9.312  -96.669  1.355   1.00 64.65  ? 56   ARG D O   1 
ATOM   8396  C  CB  . ARG D 1 53  ? -11.310 -99.124  0.186   1.00 63.91  ? 56   ARG D CB  1 
ATOM   8397  C  CG  . ARG D 1 53  ? -11.096 -99.501  1.647   1.00 64.74  ? 56   ARG D CG  1 
ATOM   8398  C  CD  . ARG D 1 53  ? -12.223 -100.362 2.205   1.00 64.92  ? 56   ARG D CD  1 
ATOM   8399  N  NE  . ARG D 1 53  ? -11.998 -101.788 1.964   1.00 69.43  ? 56   ARG D NE  1 
ATOM   8400  C  CZ  . ARG D 1 53  ? -11.462 -102.641 2.842   1.00 69.08  ? 56   ARG D CZ  1 
ATOM   8401  N  NH1 . ARG D 1 53  ? -11.085 -102.242 4.056   1.00 65.00  ? 56   ARG D NH1 1 
ATOM   8402  N  NH2 . ARG D 1 53  ? -11.309 -103.912 2.500   1.00 68.24  ? 56   ARG D NH2 1 
ATOM   8403  N  N   . ARG D 1 54  ? -11.447 -96.086  0.911   1.00 68.84  ? 57   ARG D N   1 
ATOM   8404  C  CA  . ARG D 1 54  ? -11.426 -94.935  1.818   1.00 73.59  ? 57   ARG D CA  1 
ATOM   8405  C  C   . ARG D 1 54  ? -11.213 -95.332  3.276   1.00 68.41  ? 57   ARG D C   1 
ATOM   8406  O  O   . ARG D 1 54  ? -11.754 -96.343  3.736   1.00 68.83  ? 57   ARG D O   1 
ATOM   8407  C  CB  . ARG D 1 54  ? -12.684 -94.059  1.659   1.00 84.38  ? 57   ARG D CB  1 
ATOM   8408  C  CG  . ARG D 1 54  ? -14.021 -94.783  1.804   1.00 93.22  ? 57   ARG D CG  1 
ATOM   8409  C  CD  . ARG D 1 54  ? -15.200 -93.812  1.853   1.00 98.52  ? 57   ARG D CD  1 
ATOM   8410  N  NE  . ARG D 1 54  ? -15.484 -93.183  0.558   1.00 101.14 ? 57   ARG D NE  1 
ATOM   8411  C  CZ  . ARG D 1 54  ? -15.141 -91.939  0.222   1.00 101.14 ? 57   ARG D CZ  1 
ATOM   8412  N  NH1 . ARG D 1 54  ? -14.491 -91.159  1.080   1.00 99.60  ? 57   ARG D NH1 1 
ATOM   8413  N  NH2 . ARG D 1 54  ? -15.452 -91.472  -0.980  1.00 99.84  ? 57   ARG D NH2 1 
ATOM   8414  N  N   . ASN D 1 55  ? -10.390 -94.545  3.972   1.00 62.18  ? 58   ASN D N   1 
ATOM   8415  C  CA  . ASN D 1 55  ? -10.117 -94.702  5.413   1.00 58.41  ? 58   ASN D CA  1 
ATOM   8416  C  C   . ASN D 1 55  ? -9.336  -95.959  5.805   1.00 55.66  ? 58   ASN D C   1 
ATOM   8417  O  O   . ASN D 1 55  ? -9.042  -96.177  6.984   1.00 55.61  ? 58   ASN D O   1 
ATOM   8418  C  CB  . ASN D 1 55  ? -11.410 -94.603  6.231   1.00 58.75  ? 58   ASN D CB  1 
ATOM   8419  C  CG  . ASN D 1 55  ? -12.068 -93.243  6.122   1.00 60.79  ? 58   ASN D CG  1 
ATOM   8420  O  OD1 . ASN D 1 55  ? -11.415 -92.205  6.272   1.00 60.33  ? 58   ASN D OD1 1 
ATOM   8421  N  ND2 . ASN D 1 55  ? -13.372 -93.239  5.867   1.00 61.76  ? 58   ASN D ND2 1 
ATOM   8422  N  N   . HIS D 1 56  ? -8.987  -96.768  4.810   1.00 49.80  ? 59   HIS D N   1 
ATOM   8423  C  CA  . HIS D 1 56  ? -8.409  -98.083  5.044   1.00 45.45  ? 59   HIS D CA  1 
ATOM   8424  C  C   . HIS D 1 56  ? -7.051  -97.995  5.672   1.00 41.06  ? 59   HIS D C   1 
ATOM   8425  O  O   . HIS D 1 56  ? -6.807  -98.613  6.703   1.00 37.06  ? 59   HIS D O   1 
ATOM   8426  C  CB  . HIS D 1 56  ? -8.378  -98.876  3.734   1.00 47.09  ? 59   HIS D CB  1 
ATOM   8427  C  CG  . HIS D 1 56  ? -7.790  -100.260 3.860   1.00 47.26  ? 59   HIS D CG  1 
ATOM   8428  N  ND1 . HIS D 1 56  ? -7.288  -100.925 2.805   1.00 48.52  ? 59   HIS D ND1 1 
ATOM   8429  C  CD2 . HIS D 1 56  ? -7.624  -101.094 4.970   1.00 47.53  ? 59   HIS D CD2 1 
ATOM   8430  C  CE1 . HIS D 1 56  ? -6.826  -102.123 3.212   1.00 50.66  ? 59   HIS D CE1 1 
ATOM   8431  N  NE2 . HIS D 1 56  ? -7.024  -102.219 4.541   1.00 47.88  ? 59   HIS D NE2 1 
ATOM   8432  N  N   . ALA D 1 57  ? -6.159  -97.216  5.062   1.00 38.07  ? 60   ALA D N   1 
ATOM   8433  C  CA  . ALA D 1 57  ? -4.808  -97.035  5.588   1.00 36.02  ? 60   ALA D CA  1 
ATOM   8434  C  C   . ALA D 1 57  ? -4.854  -96.418  6.989   1.00 33.88  ? 60   ALA D C   1 
ATOM   8435  O  O   . ALA D 1 57  ? -4.020  -96.729  7.842   1.00 30.98  ? 60   ALA D O   1 
ATOM   8436  C  CB  . ALA D 1 57  ? -3.986  -96.168  4.650   1.00 32.52  ? 60   ALA D CB  1 
ATOM   8437  N  N   . ARG D 1 58  ? -5.841  -95.548  7.193   1.00 34.51  ? 61   ARG D N   1 
ATOM   8438  C  CA  . ARG D 1 58  ? -6.122  -94.914  8.484   1.00 39.11  ? 61   ARG D CA  1 
ATOM   8439  C  C   . ARG D 1 58  ? -6.446  -95.986  9.536   1.00 38.27  ? 61   ARG D C   1 
ATOM   8440  O  O   . ARG D 1 58  ? -5.919  -95.947  10.641  1.00 35.04  ? 61   ARG D O   1 
ATOM   8441  C  CB  . ARG D 1 58  ? -7.306  -93.962  8.322   1.00 39.13  ? 61   ARG D CB  1 
ATOM   8442  C  CG  . ARG D 1 58  ? -7.504  -92.920  9.404   1.00 41.82  ? 61   ARG D CG  1 
ATOM   8443  C  CD  . ARG D 1 58  ? -8.812  -92.209  9.101   1.00 45.39  ? 61   ARG D CD  1 
ATOM   8444  N  NE  . ARG D 1 58  ? -8.984  -90.963  9.827   1.00 48.75  ? 61   ARG D NE  1 
ATOM   8445  C  CZ  . ARG D 1 58  ? -8.891  -89.740  9.302   1.00 49.37  ? 61   ARG D CZ  1 
ATOM   8446  N  NH1 . ARG D 1 58  ? -8.596  -89.542  8.015   1.00 46.23  ? 61   ARG D NH1 1 
ATOM   8447  N  NH2 . ARG D 1 58  ? -9.087  -88.700  10.091  1.00 51.18  ? 61   ARG D NH2 1 
ATOM   8448  N  N   . GLU D 1 59  ? -7.289  -96.950  9.167   1.00 40.40  ? 62   GLU D N   1 
ATOM   8449  C  CA  . GLU D 1 59  ? -7.689  -98.023  10.078  1.00 42.86  ? 62   GLU D CA  1 
ATOM   8450  C  C   . GLU D 1 59  ? -6.551  -99.003  10.371  1.00 40.30  ? 62   GLU D C   1 
ATOM   8451  O  O   . GLU D 1 59  ? -6.378  -99.430  11.522  1.00 39.79  ? 62   GLU D O   1 
ATOM   8452  C  CB  . GLU D 1 59  ? -8.935  -98.738  9.554   1.00 45.49  ? 62   GLU D CB  1 
ATOM   8453  C  CG  . GLU D 1 59  ? -10.212 -97.991  9.907   1.00 52.24  ? 62   GLU D CG  1 
ATOM   8454  C  CD  . GLU D 1 59  ? -11.304 -98.120  8.860   1.00 59.07  ? 62   GLU D CD  1 
ATOM   8455  O  OE1 . GLU D 1 59  ? -11.383 -99.178  8.183   1.00 60.40  ? 62   GLU D OE1 1 
ATOM   8456  O  OE2 . GLU D 1 59  ? -12.091 -97.153  8.722   1.00 59.75  ? 62   GLU D OE2 1 
ATOM   8457  N  N   . LEU D 1 60  ? -5.776  -99.333  9.337   1.00 37.88  ? 63   LEU D N   1 
ATOM   8458  C  CA  . LEU D 1 60  ? -4.590  -100.185 9.475   1.00 36.08  ? 63   LEU D CA  1 
ATOM   8459  C  C   . LEU D 1 60  ? -3.641  -99.656  10.531  1.00 35.78  ? 63   LEU D C   1 
ATOM   8460  O  O   . LEU D 1 60  ? -3.315  -100.338 11.507  1.00 35.93  ? 63   LEU D O   1 
ATOM   8461  C  CB  . LEU D 1 60  ? -3.821  -100.266 8.158   1.00 36.05  ? 63   LEU D CB  1 
ATOM   8462  C  CG  . LEU D 1 60  ? -3.863  -101.536 7.290   1.00 41.24  ? 63   LEU D CG  1 
ATOM   8463  C  CD1 . LEU D 1 60  ? -2.511  -101.677 6.597   1.00 39.59  ? 63   LEU D CD1 1 
ATOM   8464  C  CD2 . LEU D 1 60  ? -4.201  -102.811 8.066   1.00 37.47  ? 63   LEU D CD2 1 
ATOM   8465  N  N   . VAL D 1 61  ? -3.207  -98.423  10.302  1.00 33.90  ? 64   VAL D N   1 
ATOM   8466  C  CA  . VAL D 1 61  ? -2.231  -97.719  11.112  1.00 32.25  ? 64   VAL D CA  1 
ATOM   8467  C  C   . VAL D 1 61  ? -2.754  -97.547  12.550  1.00 31.90  ? 64   VAL D C   1 
ATOM   8468  O  O   . VAL D 1 61  ? -1.980  -97.600  13.502  1.00 32.62  ? 64   VAL D O   1 
ATOM   8469  C  CB  . VAL D 1 61  ? -1.917  -96.375  10.400  1.00 33.91  ? 64   VAL D CB  1 
ATOM   8470  C  CG1 . VAL D 1 61  ? -1.366  -95.327  11.329  1.00 31.97  ? 64   VAL D CG1 1 
ATOM   8471  C  CG2 . VAL D 1 61  ? -0.987  -96.600  9.209   1.00 35.25  ? 64   VAL D CG2 1 
ATOM   8472  N  N   . ARG D 1 62  ? -4.066  -97.378  12.698  1.00 31.90  ? 65   ARG D N   1 
ATOM   8473  C  CA  . ARG D 1 62  ? -4.709  -97.271  14.010  1.00 35.90  ? 65   ARG D CA  1 
ATOM   8474  C  C   . ARG D 1 62  ? -4.616  -98.536  14.871  1.00 37.61  ? 65   ARG D C   1 
ATOM   8475  O  O   . ARG D 1 62  ? -4.524  -98.456  16.104  1.00 36.28  ? 65   ARG D O   1 
ATOM   8476  C  CB  . ARG D 1 62  ? -6.177  -96.888  13.843  1.00 37.84  ? 65   ARG D CB  1 
ATOM   8477  C  CG  . ARG D 1 62  ? -6.826  -96.305  15.083  1.00 38.38  ? 65   ARG D CG  1 
ATOM   8478  C  CD  . ARG D 1 62  ? -7.952  -95.369  14.689  1.00 42.24  ? 65   ARG D CD  1 
ATOM   8479  N  NE  . ARG D 1 62  ? -9.149  -96.085  14.264  1.00 44.68  ? 65   ARG D NE  1 
ATOM   8480  C  CZ  . ARG D 1 62  ? -9.931  -95.722  13.248  1.00 49.27  ? 65   ARG D CZ  1 
ATOM   8481  N  NH1 . ARG D 1 62  ? -9.648  -94.647  12.511  1.00 48.30  ? 65   ARG D NH1 1 
ATOM   8482  N  NH2 . ARG D 1 62  ? -10.999 -96.451  12.955  1.00 51.97  ? 65   ARG D NH2 1 
ATOM   8483  N  N   . SER D 1 63  ? -4.643  -99.698  14.218  1.00 38.09  ? 66   SER D N   1 
ATOM   8484  C  CA  . SER D 1 63  ? -4.645  -100.985 14.921  1.00 36.43  ? 66   SER D CA  1 
ATOM   8485  C  C   . SER D 1 63  ? -3.274  -101.678 14.926  1.00 38.24  ? 66   SER D C   1 
ATOM   8486  O  O   . SER D 1 63  ? -3.035  -102.590 15.719  1.00 42.58  ? 66   SER D O   1 
ATOM   8487  C  CB  . SER D 1 63  ? -5.705  -101.896 14.311  1.00 34.64  ? 66   SER D CB  1 
ATOM   8488  O  OG  . SER D 1 63  ? -5.428  -102.168 12.944  1.00 36.33  ? 66   SER D OG  1 
ATOM   8489  N  N   . GLU D 1 64  ? -2.376  -101.230 14.056  1.00 36.50  ? 67   GLU D N   1 
ATOM   8490  C  CA  . GLU D 1 64  ? -1.061  -101.845 13.886  1.00 37.33  ? 67   GLU D CA  1 
ATOM   8491  C  C   . GLU D 1 64  ? -0.274  -101.985 15.189  1.00 40.60  ? 67   GLU D C   1 
ATOM   8492  O  O   . GLU D 1 64  ? -0.259  -101.076 16.032  1.00 41.45  ? 67   GLU D O   1 
ATOM   8493  C  CB  . GLU D 1 64  ? -0.251  -101.037 12.861  1.00 35.77  ? 67   GLU D CB  1 
ATOM   8494  C  CG  . GLU D 1 64  ? 1.057   -101.646 12.368  1.00 35.74  ? 67   GLU D CG  1 
ATOM   8495  C  CD  . GLU D 1 64  ? 0.884   -102.876 11.470  1.00 38.10  ? 67   GLU D CD  1 
ATOM   8496  O  OE1 . GLU D 1 64  ? 0.020   -102.882 10.549  1.00 37.10  ? 67   GLU D OE1 1 
ATOM   8497  O  OE2 . GLU D 1 64  ? 1.639   -103.845 11.689  1.00 37.78  ? 67   GLU D OE2 1 
ATOM   8498  N  N   . GLU D 1 65  ? 0.368   -103.140 15.346  1.00 42.31  ? 68   GLU D N   1 
ATOM   8499  C  CA  . GLU D 1 65  ? 1.426   -103.324 16.337  1.00 42.30  ? 68   GLU D CA  1 
ATOM   8500  C  C   . GLU D 1 65  ? 2.697   -102.649 15.785  1.00 40.57  ? 68   GLU D C   1 
ATOM   8501  O  O   . GLU D 1 65  ? 3.478   -103.262 15.043  1.00 37.59  ? 68   GLU D O   1 
ATOM   8502  C  CB  . GLU D 1 65  ? 1.634   -104.824 16.635  1.00 43.63  ? 68   GLU D CB  1 
ATOM   8503  C  CG  . GLU D 1 65  ? 2.881   -105.182 17.429  1.00 48.99  ? 68   GLU D CG  1 
ATOM   8504  C  CD  . GLU D 1 65  ? 2.893   -104.583 18.817  1.00 54.26  ? 68   GLU D CD  1 
ATOM   8505  O  OE1 . GLU D 1 65  ? 2.075   -105.023 19.660  1.00 59.42  ? 68   GLU D OE1 1 
ATOM   8506  O  OE2 . GLU D 1 65  ? 3.723   -103.678 19.058  1.00 55.44  ? 68   GLU D OE2 1 
ATOM   8507  N  N   . LEU D 1 66  ? 2.888   -101.382 16.153  1.00 38.87  ? 69   LEU D N   1 
ATOM   8508  C  CA  . LEU D 1 66  ? 3.967   -100.554 15.602  1.00 36.63  ? 69   LEU D CA  1 
ATOM   8509  C  C   . LEU D 1 66  ? 5.377   -101.025 15.972  1.00 36.24  ? 69   LEU D C   1 
ATOM   8510  O  O   . LEU D 1 66  ? 6.362   -100.611 15.347  1.00 35.35  ? 69   LEU D O   1 
ATOM   8511  C  CB  . LEU D 1 66  ? 3.757   -99.089  15.995  1.00 36.81  ? 69   LEU D CB  1 
ATOM   8512  C  CG  . LEU D 1 66  ? 2.502   -98.385  15.455  1.00 38.28  ? 69   LEU D CG  1 
ATOM   8513  C  CD1 . LEU D 1 66  ? 2.267   -97.085  16.208  1.00 36.66  ? 69   LEU D CD1 1 
ATOM   8514  C  CD2 . LEU D 1 66  ? 2.581   -98.128  13.950  1.00 35.15  ? 69   LEU D CD2 1 
ATOM   8515  N  N   . GLY D 1 67  ? 5.460   -101.907 16.971  1.00 36.59  ? 70   GLY D N   1 
ATOM   8516  C  CA  . GLY D 1 67  ? 6.730   -102.437 17.474  1.00 34.59  ? 70   GLY D CA  1 
ATOM   8517  C  C   . GLY D 1 67  ? 7.525   -103.280 16.496  1.00 36.00  ? 70   GLY D C   1 
ATOM   8518  O  O   . GLY D 1 67  ? 8.752   -103.344 16.607  1.00 37.03  ? 70   GLY D O   1 
ATOM   8519  N  N   . ARG D 1 68  ? 6.847   -103.923 15.537  1.00 35.72  ? 71   ARG D N   1 
ATOM   8520  C  CA  . ARG D 1 68  ? 7.536   -104.759 14.522  1.00 37.26  ? 71   ARG D CA  1 
ATOM   8521  C  C   . ARG D 1 68  ? 8.266   -103.939 13.470  1.00 36.27  ? 71   ARG D C   1 
ATOM   8522  O  O   . ARG D 1 68  ? 9.088   -104.481 12.714  1.00 35.88  ? 71   ARG D O   1 
ATOM   8523  C  CB  . ARG D 1 68  ? 6.574   -105.671 13.758  1.00 37.63  ? 71   ARG D CB  1 
ATOM   8524  C  CG  . ARG D 1 68  ? 5.270   -105.975 14.443  1.00 38.17  ? 71   ARG D CG  1 
ATOM   8525  C  CD  . ARG D 1 68  ? 4.187   -105.991 13.390  1.00 38.70  ? 71   ARG D CD  1 
ATOM   8526  N  NE  . ARG D 1 68  ? 4.104   -107.281 12.722  1.00 40.31  ? 71   ARG D NE  1 
ATOM   8527  C  CZ  . ARG D 1 68  ? 3.241   -107.572 11.758  1.00 38.72  ? 71   ARG D CZ  1 
ATOM   8528  N  NH1 . ARG D 1 68  ? 2.383   -106.651 11.320  1.00 39.66  ? 71   ARG D NH1 1 
ATOM   8529  N  NH2 . ARG D 1 68  ? 3.243   -108.785 11.235  1.00 33.46  ? 71   ARG D NH2 1 
ATOM   8530  N  N   . TRP D 1 69  ? 7.961   -102.647 13.404  1.00 34.55  ? 72   TRP D N   1 
ATOM   8531  C  CA  . TRP D 1 69  ? 8.472   -101.819 12.310  1.00 33.95  ? 72   TRP D CA  1 
ATOM   8532  C  C   . TRP D 1 69  ? 9.412   -100.755 12.782  1.00 33.37  ? 72   TRP D C   1 
ATOM   8533  O  O   . TRP D 1 69  ? 9.180   -100.137 13.824  1.00 34.25  ? 72   TRP D O   1 
ATOM   8534  C  CB  . TRP D 1 69  ? 7.320   -101.188 11.551  1.00 32.44  ? 72   TRP D CB  1 
ATOM   8535  C  CG  . TRP D 1 69  ? 6.246   -102.160 11.145  1.00 33.27  ? 72   TRP D CG  1 
ATOM   8536  C  CD1 . TRP D 1 69  ? 4.940   -102.229 11.619  1.00 33.06  ? 72   TRP D CD1 1 
ATOM   8537  C  CD2 . TRP D 1 69  ? 6.348   -103.236 10.154  1.00 32.25  ? 72   TRP D CD2 1 
ATOM   8538  N  NE1 . TRP D 1 69  ? 4.250   -103.243 11.008  1.00 32.47  ? 72   TRP D NE1 1 
ATOM   8539  C  CE2 . TRP D 1 69  ? 5.034   -103.886 10.120  1.00 32.58  ? 72   TRP D CE2 1 
ATOM   8540  C  CE3 . TRP D 1 69  ? 7.352   -103.706 9.330   1.00 34.15  ? 72   TRP D CE3 1 
ATOM   8541  C  CZ2 . TRP D 1 69  ? 4.763   -104.954 9.282   1.00 35.06  ? 72   TRP D CZ2 1 
ATOM   8542  C  CZ3 . TRP D 1 69  ? 7.071   -104.792 8.486   1.00 35.25  ? 72   TRP D CZ3 1 
ATOM   8543  C  CH2 . TRP D 1 69  ? 5.806   -105.401 8.467   1.00 35.33  ? 72   TRP D CH2 1 
ATOM   8544  N  N   . ASP D 1 70  ? 10.483  -100.522 12.026  1.00 32.14  ? 73   ASP D N   1 
ATOM   8545  C  CA  . ASP D 1 70  ? 11.357  -99.389  12.320  1.00 31.39  ? 73   ASP D CA  1 
ATOM   8546  C  C   . ASP D 1 70  ? 10.809  -98.131  11.680  1.00 31.72  ? 73   ASP D C   1 
ATOM   8547  O  O   . ASP D 1 70  ? 11.077  -97.018  12.151  1.00 34.58  ? 73   ASP D O   1 
ATOM   8548  C  CB  . ASP D 1 70  ? 12.771  -99.653  11.840  1.00 31.29  ? 73   ASP D CB  1 
ATOM   8549  C  CG  . ASP D 1 70  ? 13.405  -100.814 12.560  1.00 32.47  ? 73   ASP D CG  1 
ATOM   8550  O  OD1 . ASP D 1 70  ? 13.567  -100.693 13.787  1.00 31.99  ? 73   ASP D OD1 1 
ATOM   8551  O  OD2 . ASP D 1 70  ? 13.719  -101.850 11.915  1.00 33.43  ? 73   ASP D OD2 1 
ATOM   8552  N  N   . ALA D 1 71  ? 10.033  -98.313  10.615  1.00 30.05  ? 74   ALA D N   1 
ATOM   8553  C  CA  . ALA D 1 71  ? 9.438   -97.200  9.882   1.00 29.96  ? 74   ALA D CA  1 
ATOM   8554  C  C   . ALA D 1 71  ? 8.156   -97.581  9.137   1.00 30.21  ? 74   ALA D C   1 
ATOM   8555  O  O   . ALA D 1 71  ? 7.879   -98.769  8.883   1.00 27.78  ? 74   ALA D O   1 
ATOM   8556  C  CB  . ALA D 1 71  ? 10.452  -96.600  8.922   1.00 29.47  ? 74   ALA D CB  1 
ATOM   8557  N  N   . LEU D 1 72  ? 7.363   -96.563  8.818   1.00 28.42  ? 75   LEU D N   1 
ATOM   8558  C  CA  . LEU D 1 72  ? 6.247   -96.731  7.913   1.00 29.21  ? 75   LEU D CA  1 
ATOM   8559  C  C   . LEU D 1 72  ? 6.553   -95.978  6.625   1.00 28.32  ? 75   LEU D C   1 
ATOM   8560  O  O   . LEU D 1 72  ? 6.752   -94.760  6.662   1.00 30.77  ? 75   LEU D O   1 
ATOM   8561  C  CB  . LEU D 1 72  ? 4.952   -96.206  8.548   1.00 27.46  ? 75   LEU D CB  1 
ATOM   8562  C  CG  . LEU D 1 72  ? 4.592   -96.789  9.909   1.00 29.54  ? 75   LEU D CG  1 
ATOM   8563  C  CD1 . LEU D 1 72  ? 3.240   -96.266  10.379  1.00 29.44  ? 75   LEU D CD1 1 
ATOM   8564  C  CD2 . LEU D 1 72  ? 4.603   -98.314  9.899   1.00 29.38  ? 75   LEU D CD2 1 
ATOM   8565  N  N   . VAL D 1 73  ? 6.619   -96.678  5.496   1.00 27.88  ? 76   VAL D N   1 
ATOM   8566  C  CA  . VAL D 1 73  ? 6.762   -95.965  4.225   1.00 27.74  ? 76   VAL D CA  1 
ATOM   8567  C  C   . VAL D 1 73  ? 5.486   -95.892  3.409   1.00 28.77  ? 76   VAL D C   1 
ATOM   8568  O  O   . VAL D 1 73  ? 4.805   -96.902  3.149   1.00 29.38  ? 76   VAL D O   1 
ATOM   8569  C  CB  . VAL D 1 73  ? 8.048   -96.292  3.430   1.00 28.77  ? 76   VAL D CB  1 
ATOM   8570  C  CG1 . VAL D 1 73  ? 8.976   -97.165  4.245   1.00 27.47  ? 76   VAL D CG1 1 
ATOM   8571  C  CG2 . VAL D 1 73  ? 7.776   -96.819  2.028   1.00 29.54  ? 76   VAL D CG2 1 
ATOM   8572  N  N   . VAL D 1 74  ? 5.146   -94.664  3.062   1.00 27.14  ? 77   VAL D N   1 
ATOM   8573  C  CA  . VAL D 1 74  ? 3.859   -94.353  2.494   1.00 27.74  ? 77   VAL D CA  1 
ATOM   8574  C  C   . VAL D 1 74  ? 4.166   -94.036  1.037   1.00 29.54  ? 77   VAL D C   1 
ATOM   8575  O  O   . VAL D 1 74  ? 4.860   -93.067  0.745   1.00 28.82  ? 77   VAL D O   1 
ATOM   8576  C  CB  . VAL D 1 74  ? 3.239   -93.153  3.235   1.00 28.11  ? 77   VAL D CB  1 
ATOM   8577  C  CG1 . VAL D 1 74  ? 1.767   -93.014  2.928   1.00 29.17  ? 77   VAL D CG1 1 
ATOM   8578  C  CG2 . VAL D 1 74  ? 3.427   -93.302  4.741   1.00 26.64  ? 77   VAL D CG2 1 
ATOM   8579  N  N   . MET D 1 75  ? 3.719   -94.910  0.134   1.00 31.43  ? 78   MET D N   1 
ATOM   8580  C  CA  . MET D 1 75  ? 3.994   -94.784  -1.302  1.00 31.17  ? 78   MET D CA  1 
ATOM   8581  C  C   . MET D 1 75  ? 2.696   -94.496  -2.049  1.00 31.10  ? 78   MET D C   1 
ATOM   8582  O  O   . MET D 1 75  ? 1.944   -95.408  -2.400  1.00 32.58  ? 78   MET D O   1 
ATOM   8583  C  CB  . MET D 1 75  ? 4.686   -96.044  -1.841  1.00 32.38  ? 78   MET D CB  1 
ATOM   8584  C  CG  . MET D 1 75  ? 4.921   -96.030  -3.341  1.00 33.39  ? 78   MET D CG  1 
ATOM   8585  S  SD  . MET D 1 75  ? 6.477   -96.783  -3.857  1.00 35.57  ? 78   MET D SD  1 
ATOM   8586  C  CE  . MET D 1 75  ? 6.422   -96.305  -5.584  1.00 35.39  ? 78   MET D CE  1 
ATOM   8587  N  N   . SER D 1 76  ? 2.439   -93.215  -2.266  1.00 29.62  ? 79   SER D N   1 
ATOM   8588  C  CA  . SER D 1 76  ? 1.203   -92.728  -2.856  1.00 31.09  ? 79   SER D CA  1 
ATOM   8589  C  C   . SER D 1 76  ? 1.378   -91.223  -2.969  1.00 32.67  ? 79   SER D C   1 
ATOM   8590  O  O   . SER D 1 76  ? 2.391   -90.762  -3.471  1.00 37.13  ? 79   SER D O   1 
ATOM   8591  C  CB  . SER D 1 76  ? 0.019   -93.058  -1.958  1.00 31.32  ? 79   SER D CB  1 
ATOM   8592  O  OG  . SER D 1 76  ? -1.210  -92.625  -2.527  1.00 34.28  ? 79   SER D OG  1 
ATOM   8593  N  N   . GLY D 1 77  ? 0.423   -90.456  -2.464  1.00 33.04  ? 80   GLY D N   1 
ATOM   8594  C  CA  . GLY D 1 77  ? 0.563   -89.019  -2.413  1.00 32.16  ? 80   GLY D CA  1 
ATOM   8595  C  C   . GLY D 1 77  ? 0.546   -88.393  -1.029  1.00 32.02  ? 80   GLY D C   1 
ATOM   8596  O  O   . GLY D 1 77  ? 0.717   -89.055  -0.002  1.00 32.84  ? 80   GLY D O   1 
ATOM   8597  N  N   . ASP D 1 78  ? 0.348   -87.087  -1.021  1.00 31.03  ? 81   ASP D N   1 
ATOM   8598  C  CA  . ASP D 1 78  ? 0.194   -86.343  0.210   1.00 29.73  ? 81   ASP D CA  1 
ATOM   8599  C  C   . ASP D 1 78  ? -1.030  -86.842  0.956   1.00 27.58  ? 81   ASP D C   1 
ATOM   8600  O  O   . ASP D 1 78  ? -1.010  -86.897  2.176   1.00 27.23  ? 81   ASP D O   1 
ATOM   8601  C  CB  . ASP D 1 78  ? 0.074   -84.848  -0.094  1.00 29.69  ? 81   ASP D CB  1 
ATOM   8602  C  CG  . ASP D 1 78  ? 1.320   -84.290  -0.763  1.00 30.39  ? 81   ASP D CG  1 
ATOM   8603  O  OD1 . ASP D 1 78  ? 2.442   -84.684  -0.376  1.00 28.18  ? 81   ASP D OD1 1 
ATOM   8604  O  OD2 . ASP D 1 78  ? 1.176   -83.448  -1.686  1.00 31.57  ? 81   ASP D OD2 1 
ATOM   8605  N  N   . GLY D 1 79  ? -2.067  -87.236  0.215   1.00 26.67  ? 82   GLY D N   1 
ATOM   8606  C  CA  . GLY D 1 79  ? -3.332  -87.678  0.796   1.00 27.11  ? 82   GLY D CA  1 
ATOM   8607  C  C   . GLY D 1 79  ? -3.188  -88.926  1.667   1.00 30.39  ? 82   GLY D C   1 
ATOM   8608  O  O   . GLY D 1 79  ? -3.825  -89.028  2.727   1.00 29.62  ? 82   GLY D O   1 
ATOM   8609  N  N   . LEU D 1 80  ? -2.348  -89.872  1.242   1.00 29.61  ? 83   LEU D N   1 
ATOM   8610  C  CA  . LEU D 1 80  ? -2.131  -91.078  2.036   1.00 29.62  ? 83   LEU D CA  1 
ATOM   8611  C  C   . LEU D 1 80  ? -1.319  -90.800  3.299   1.00 30.47  ? 83   LEU D C   1 
ATOM   8612  O  O   . LEU D 1 80  ? -1.612  -91.361  4.366   1.00 32.52  ? 83   LEU D O   1 
ATOM   8613  C  CB  . LEU D 1 80  ? -1.501  -92.189  1.208   1.00 28.90  ? 83   LEU D CB  1 
ATOM   8614  C  CG  . LEU D 1 80  ? -2.036  -93.623  1.390   1.00 31.39  ? 83   LEU D CG  1 
ATOM   8615  C  CD1 . LEU D 1 80  ? -1.107  -94.482  2.216   1.00 30.00  ? 83   LEU D CD1 1 
ATOM   8616  C  CD2 . LEU D 1 80  ? -3.460  -93.697  1.937   1.00 28.88  ? 83   LEU D CD2 1 
ATOM   8617  N  N   . MET D 1 81  ? -0.322  -89.924  3.202   1.00 28.90  ? 84   MET D N   1 
ATOM   8618  C  CA  . MET D 1 81  ? 0.441   -89.546  4.394   1.00 30.00  ? 84   MET D CA  1 
ATOM   8619  C  C   . MET D 1 81  ? -0.485  -88.909  5.444   1.00 27.54  ? 84   MET D C   1 
ATOM   8620  O  O   . MET D 1 81  ? -0.419  -89.209  6.625   1.00 29.11  ? 84   MET D O   1 
ATOM   8621  C  CB  . MET D 1 81  ? 1.599   -88.618  4.027   1.00 30.84  ? 84   MET D CB  1 
ATOM   8622  C  CG  . MET D 1 81  ? 2.462   -88.244  5.213   1.00 33.04  ? 84   MET D CG  1 
ATOM   8623  S  SD  . MET D 1 81  ? 3.295   -89.638  6.002   1.00 36.90  ? 84   MET D SD  1 
ATOM   8624  C  CE  . MET D 1 81  ? 4.741   -89.784  4.962   1.00 31.12  ? 84   MET D CE  1 
ATOM   8625  N  N   . HIS D 1 82  ? -1.377  -88.062  4.976   1.00 26.78  ? 85   HIS D N   1 
ATOM   8626  C  CA  . HIS D 1 82  ? -2.435  -87.499  5.782   1.00 27.31  ? 85   HIS D CA  1 
ATOM   8627  C  C   . HIS D 1 82  ? -3.233  -88.541  6.522   1.00 27.13  ? 85   HIS D C   1 
ATOM   8628  O  O   . HIS D 1 82  ? -3.524  -88.364  7.703   1.00 26.31  ? 85   HIS D O   1 
ATOM   8629  C  CB  . HIS D 1 82  ? -3.349  -86.677  4.893   1.00 25.20  ? 85   HIS D CB  1 
ATOM   8630  C  CG  . HIS D 1 82  ? -4.455  -85.981  5.636   1.00 26.88  ? 85   HIS D CG  1 
ATOM   8631  N  ND1 . HIS D 1 82  ? -5.720  -86.453  5.671   1.00 27.42  ? 85   HIS D ND1 1 
ATOM   8632  C  CD2 . HIS D 1 82  ? -4.454  -84.808  6.377   1.00 25.75  ? 85   HIS D CD2 1 
ATOM   8633  C  CE1 . HIS D 1 82  ? -6.489  -85.618  6.378   1.00 26.54  ? 85   HIS D CE1 1 
ATOM   8634  N  NE2 . HIS D 1 82  ? -5.710  -84.616  6.824   1.00 27.66  ? 85   HIS D NE2 1 
ATOM   8635  N  N   . GLU D 1 83  ? -3.608  -89.624  5.843   1.00 27.41  ? 86   GLU D N   1 
ATOM   8636  C  CA  . GLU D 1 83  ? -4.417  -90.677  6.478   1.00 28.62  ? 86   GLU D CA  1 
ATOM   8637  C  C   . GLU D 1 83  ? -3.631  -91.404  7.560   1.00 26.48  ? 86   GLU D C   1 
ATOM   8638  O  O   . GLU D 1 83  ? -4.149  -91.685  8.634   1.00 24.84  ? 86   GLU D O   1 
ATOM   8639  C  CB  . GLU D 1 83  ? -4.932  -91.688  5.453   1.00 30.57  ? 86   GLU D CB  1 
ATOM   8640  C  CG  . GLU D 1 83  ? -5.918  -91.115  4.450   1.00 34.88  ? 86   GLU D CG  1 
ATOM   8641  C  CD  . GLU D 1 83  ? -7.253  -90.693  5.061   1.00 38.77  ? 86   GLU D CD  1 
ATOM   8642  O  OE1 . GLU D 1 83  ? -7.792  -89.649  4.623   1.00 40.92  ? 86   GLU D OE1 1 
ATOM   8643  O  OE2 . GLU D 1 83  ? -7.781  -91.400  5.960   1.00 40.16  ? 86   GLU D OE2 1 
ATOM   8644  N  N   . VAL D 1 84  ? -2.374  -91.703  7.256   1.00 26.46  ? 87   VAL D N   1 
ATOM   8645  C  CA  . VAL D 1 84  ? -1.504  -92.409  8.167   1.00 26.03  ? 87   VAL D CA  1 
ATOM   8646  C  C   . VAL D 1 84  ? -1.328  -91.576  9.434   1.00 26.97  ? 87   VAL D C   1 
ATOM   8647  O  O   . VAL D 1 84  ? -1.552  -92.087  10.537  1.00 28.13  ? 87   VAL D O   1 
ATOM   8648  C  CB  . VAL D 1 84  ? -0.158  -92.772  7.493   1.00 24.59  ? 87   VAL D CB  1 
ATOM   8649  C  CG1 . VAL D 1 84  ? 0.887   -93.195  8.509   1.00 25.16  ? 87   VAL D CG1 1 
ATOM   8650  C  CG2 . VAL D 1 84  ? -0.366  -93.896  6.495   1.00 24.84  ? 87   VAL D CG2 1 
ATOM   8651  N  N   . VAL D 1 85  ? -0.965  -90.299  9.274   1.00 25.89  ? 88   VAL D N   1 
ATOM   8652  C  CA  . VAL D 1 85  ? -0.736  -89.405  10.427  1.00 25.33  ? 88   VAL D CA  1 
ATOM   8653  C  C   . VAL D 1 85  ? -1.989  -89.243  11.280  1.00 24.98  ? 88   VAL D C   1 
ATOM   8654  O  O   . VAL D 1 85  ? -1.928  -89.381  12.496  1.00 26.60  ? 88   VAL D O   1 
ATOM   8655  C  CB  . VAL D 1 85  ? -0.169  -88.031  10.016  1.00 24.75  ? 88   VAL D CB  1 
ATOM   8656  C  CG1 . VAL D 1 85  ? -0.311  -87.022  11.156  1.00 26.16  ? 88   VAL D CG1 1 
ATOM   8657  C  CG2 . VAL D 1 85  ? 1.296   -88.165  9.640   1.00 24.54  ? 88   VAL D CG2 1 
ATOM   8658  N  N   . ASN D 1 86  ? -3.128  -88.991  10.648  1.00 26.08  ? 89   ASN D N   1 
ATOM   8659  C  CA  . ASN D 1 86  ? -4.395  -88.977  11.371  1.00 26.87  ? 89   ASN D CA  1 
ATOM   8660  C  C   . ASN D 1 86  ? -4.728  -90.306  12.015  1.00 27.97  ? 89   ASN D C   1 
ATOM   8661  O  O   . ASN D 1 86  ? -5.339  -90.327  13.072  1.00 29.38  ? 89   ASN D O   1 
ATOM   8662  C  CB  . ASN D 1 86  ? -5.542  -88.488  10.502  1.00 26.65  ? 89   ASN D CB  1 
ATOM   8663  C  CG  . ASN D 1 86  ? -5.573  -86.971  10.397  1.00 28.50  ? 89   ASN D CG  1 
ATOM   8664  O  OD1 . ASN D 1 86  ? -5.144  -86.399  9.399   1.00 29.87  ? 89   ASN D OD1 1 
ATOM   8665  N  ND2 . ASN D 1 86  ? -6.039  -86.313  11.449  1.00 27.95  ? 89   ASN D ND2 1 
ATOM   8666  N  N   . GLY D 1 87  ? -4.304  -91.408  11.394  1.00 27.24  ? 90   GLY D N   1 
ATOM   8667  C  CA  . GLY D 1 87  ? -4.488  -92.718  11.978  1.00 25.75  ? 90   GLY D CA  1 
ATOM   8668  C  C   . GLY D 1 87  ? -3.686  -92.854  13.258  1.00 27.18  ? 90   GLY D C   1 
ATOM   8669  O  O   . GLY D 1 87  ? -4.208  -93.315  14.280  1.00 26.62  ? 90   GLY D O   1 
ATOM   8670  N  N   . LEU D 1 88  ? -2.409  -92.476  13.207  1.00 25.88  ? 91   LEU D N   1 
ATOM   8671  C  CA  . LEU D 1 88  ? -1.553  -92.595  14.378  1.00 26.92  ? 91   LEU D CA  1 
ATOM   8672  C  C   . LEU D 1 88  ? -2.070  -91.750  15.537  1.00 28.68  ? 91   LEU D C   1 
ATOM   8673  O  O   . LEU D 1 88  ? -2.084  -92.201  16.670  1.00 30.82  ? 91   LEU D O   1 
ATOM   8674  C  CB  . LEU D 1 88  ? -0.108  -92.216  14.052  1.00 25.92  ? 91   LEU D CB  1 
ATOM   8675  C  CG  . LEU D 1 88  ? 0.631   -93.108  13.050  1.00 24.81  ? 91   LEU D CG  1 
ATOM   8676  C  CD1 . LEU D 1 88  ? 1.817   -92.372  12.450  1.00 23.99  ? 91   LEU D CD1 1 
ATOM   8677  C  CD2 . LEU D 1 88  ? 1.073   -94.403  13.701  1.00 24.88  ? 91   LEU D CD2 1 
ATOM   8678  N  N   . MET D 1 89  ? -2.526  -90.539  15.236  1.00 29.84  ? 92   MET D N   1 
ATOM   8679  C  CA  . MET D 1 89  ? -2.981  -89.603  16.257  1.00 32.01  ? 92   MET D CA  1 
ATOM   8680  C  C   . MET D 1 89  ? -4.252  -90.073  16.938  1.00 33.06  ? 92   MET D C   1 
ATOM   8681  O  O   . MET D 1 89  ? -4.478  -89.760  18.110  1.00 31.86  ? 92   MET D O   1 
ATOM   8682  C  CB  . MET D 1 89  ? -3.199  -88.198  15.664  1.00 30.74  ? 92   MET D CB  1 
ATOM   8683  C  CG  . MET D 1 89  ? -1.909  -87.495  15.285  1.00 29.67  ? 92   MET D CG  1 
ATOM   8684  S  SD  . MET D 1 89  ? -0.791  -87.353  16.695  1.00 31.25  ? 92   MET D SD  1 
ATOM   8685  C  CE  . MET D 1 89  ? -1.684  -86.129  17.667  1.00 29.58  ? 92   MET D CE  1 
ATOM   8686  N  N   . GLU D 1 90  ? -5.074  -90.818  16.202  1.00 33.38  ? 93   GLU D N   1 
ATOM   8687  C  CA  . GLU D 1 90  ? -6.375  -91.251  16.703  1.00 35.41  ? 93   GLU D CA  1 
ATOM   8688  C  C   . GLU D 1 90  ? -6.249  -92.393  17.687  1.00 35.04  ? 93   GLU D C   1 
ATOM   8689  O  O   . GLU D 1 90  ? -7.253  -92.915  18.170  1.00 34.98  ? 93   GLU D O   1 
ATOM   8690  C  CB  . GLU D 1 90  ? -7.276  -91.696  15.568  1.00 38.58  ? 93   GLU D CB  1 
ATOM   8691  C  CG  . GLU D 1 90  ? -8.077  -90.581  14.929  1.00 41.28  ? 93   GLU D CG  1 
ATOM   8692  C  CD  . GLU D 1 90  ? -8.591  -90.984  13.558  1.00 45.51  ? 93   GLU D CD  1 
ATOM   8693  O  OE1 . GLU D 1 90  ? -9.073  -92.137  13.412  1.00 47.31  ? 93   GLU D OE1 1 
ATOM   8694  O  OE2 . GLU D 1 90  ? -8.505  -90.151  12.626  1.00 45.57  ? 93   GLU D OE2 1 
ATOM   8695  N  N   . ARG D 1 91  ? -5.022  -92.782  17.987  1.00 32.86  ? 94   ARG D N   1 
ATOM   8696  C  CA  . ARG D 1 91  ? -4.825  -93.897  18.871  1.00 34.50  ? 94   ARG D CA  1 
ATOM   8697  C  C   . ARG D 1 91  ? -4.815  -93.447  20.331  1.00 36.16  ? 94   ARG D C   1 
ATOM   8698  O  O   . ARG D 1 91  ? -4.412  -92.312  20.632  1.00 36.84  ? 94   ARG D O   1 
ATOM   8699  C  CB  . ARG D 1 91  ? -3.541  -94.624  18.509  1.00 33.93  ? 94   ARG D CB  1 
ATOM   8700  C  CG  . ARG D 1 91  ? -3.646  -95.435  17.223  1.00 32.82  ? 94   ARG D CG  1 
ATOM   8701  C  CD  . ARG D 1 91  ? -2.258  -95.803  16.734  1.00 32.21  ? 94   ARG D CD  1 
ATOM   8702  N  NE  . ARG D 1 91  ? -1.532  -96.594  17.720  1.00 32.62  ? 94   ARG D NE  1 
ATOM   8703  C  CZ  . ARG D 1 91  ? -1.080  -97.823  17.508  1.00 34.43  ? 94   ARG D CZ  1 
ATOM   8704  N  NH1 . ARG D 1 91  ? -1.262  -98.421  16.333  1.00 33.52  ? 94   ARG D NH1 1 
ATOM   8705  N  NH2 . ARG D 1 91  ? -0.433  -98.454  18.472  1.00 35.02  ? 94   ARG D NH2 1 
ATOM   8706  N  N   . PRO D 1 92  ? -5.273  -94.327  21.246  1.00 35.11  ? 95   PRO D N   1 
ATOM   8707  C  CA  . PRO D 1 92  ? -5.146  -94.038  22.680  1.00 34.27  ? 95   PRO D CA  1 
ATOM   8708  C  C   . PRO D 1 92  ? -3.678  -93.833  23.091  1.00 33.90  ? 95   PRO D C   1 
ATOM   8709  O  O   . PRO D 1 92  ? -3.391  -92.970  23.930  1.00 34.64  ? 95   PRO D O   1 
ATOM   8710  C  CB  . PRO D 1 92  ? -5.743  -95.286  23.350  1.00 34.85  ? 95   PRO D CB  1 
ATOM   8711  C  CG  . PRO D 1 92  ? -5.643  -96.362  22.310  1.00 36.27  ? 95   PRO D CG  1 
ATOM   8712  C  CD  . PRO D 1 92  ? -5.878  -95.651  21.003  1.00 34.67  ? 95   PRO D CD  1 
ATOM   8713  N  N   . ASP D 1 93  ? -2.764  -94.597  22.491  1.00 32.50  ? 96   ASP D N   1 
ATOM   8714  C  CA  . ASP D 1 93  ? -1.326  -94.399  22.689  1.00 32.44  ? 96   ASP D CA  1 
ATOM   8715  C  C   . ASP D 1 93  ? -0.685  -93.421  21.676  1.00 31.43  ? 96   ASP D C   1 
ATOM   8716  O  O   . ASP D 1 93  ? 0.498   -93.546  21.324  1.00 29.52  ? 96   ASP D O   1 
ATOM   8717  C  CB  . ASP D 1 93  ? -0.590  -95.750  22.707  1.00 33.74  ? 96   ASP D CB  1 
ATOM   8718  C  CG  . ASP D 1 93  ? -0.571  -96.454  21.330  1.00 35.72  ? 96   ASP D CG  1 
ATOM   8719  O  OD1 . ASP D 1 93  ? -1.451  -96.199  20.477  1.00 35.08  ? 96   ASP D OD1 1 
ATOM   8720  O  OD2 . ASP D 1 93  ? 0.343   -97.280  21.118  1.00 35.97  ? 96   ASP D OD2 1 
ATOM   8721  N  N   . TRP D 1 94  ? -1.461  -92.429  21.237  1.00 32.34  ? 97   TRP D N   1 
ATOM   8722  C  CA  . TRP D 1 94  ? -0.997  -91.478  20.227  1.00 33.09  ? 97   TRP D CA  1 
ATOM   8723  C  C   . TRP D 1 94  ? 0.370   -90.905  20.495  1.00 36.00  ? 97   TRP D C   1 
ATOM   8724  O  O   . TRP D 1 94  ? 1.144   -90.716  19.555  1.00 36.02  ? 97   TRP D O   1 
ATOM   8725  C  CB  . TRP D 1 94  ? -2.008  -90.371  20.009  1.00 33.03  ? 97   TRP D CB  1 
ATOM   8726  C  CG  . TRP D 1 94  ? -2.165  -89.441  21.183  1.00 34.46  ? 97   TRP D CG  1 
ATOM   8727  C  CD1 . TRP D 1 94  ? -3.128  -89.489  22.182  1.00 35.36  ? 97   TRP D CD1 1 
ATOM   8728  C  CD2 . TRP D 1 94  ? -1.335  -88.279  21.514  1.00 35.37  ? 97   TRP D CD2 1 
ATOM   8729  N  NE1 . TRP D 1 94  ? -2.951  -88.472  23.081  1.00 34.77  ? 97   TRP D NE1 1 
ATOM   8730  C  CE2 . TRP D 1 94  ? -1.890  -87.717  22.745  1.00 35.12  ? 97   TRP D CE2 1 
ATOM   8731  C  CE3 . TRP D 1 94  ? -0.218  -87.672  20.938  1.00 35.78  ? 97   TRP D CE3 1 
ATOM   8732  C  CZ2 . TRP D 1 94  ? -1.344  -86.593  23.352  1.00 35.46  ? 97   TRP D CZ2 1 
ATOM   8733  C  CZ3 . TRP D 1 94  ? 0.329   -86.549  21.564  1.00 36.19  ? 97   TRP D CZ3 1 
ATOM   8734  C  CH2 . TRP D 1 94  ? -0.224  -86.021  22.740  1.00 34.08  ? 97   TRP D CH2 1 
ATOM   8735  N  N   . GLU D 1 95  ? 0.700   -90.634  21.761  1.00 37.32  ? 98   GLU D N   1 
ATOM   8736  C  CA  . GLU D 1 95  ? 1.941   -89.906  22.058  1.00 41.10  ? 98   GLU D CA  1 
ATOM   8737  C  C   . GLU D 1 95  ? 3.212   -90.689  21.779  1.00 39.07  ? 98   GLU D C   1 
ATOM   8738  O  O   . GLU D 1 95  ? 4.249   -90.079  21.519  1.00 39.29  ? 98   GLU D O   1 
ATOM   8739  C  CB  . GLU D 1 95  ? 1.952   -89.240  23.455  1.00 48.31  ? 98   GLU D CB  1 
ATOM   8740  C  CG  . GLU D 1 95  ? 1.903   -90.177  24.654  1.00 57.46  ? 98   GLU D CG  1 
ATOM   8741  C  CD  . GLU D 1 95  ? 1.886   -89.424  25.975  1.00 64.01  ? 98   GLU D CD  1 
ATOM   8742  O  OE1 . GLU D 1 95  ? 0.909   -89.575  26.747  1.00 66.00  ? 98   GLU D OE1 1 
ATOM   8743  O  OE2 . GLU D 1 95  ? 2.851   -88.668  26.233  1.00 69.68  ? 98   GLU D OE2 1 
ATOM   8744  N  N   . THR D 1 96  ? 3.124   -92.020  21.805  1.00 36.98  ? 99   THR D N   1 
ATOM   8745  C  CA  . THR D 1 96  ? 4.215   -92.887  21.309  1.00 37.38  ? 99   THR D CA  1 
ATOM   8746  C  C   . THR D 1 96  ? 4.046   -93.309  19.845  1.00 34.98  ? 99   THR D C   1 
ATOM   8747  O  O   . THR D 1 96  ? 5.032   -93.563  19.149  1.00 32.95  ? 99   THR D O   1 
ATOM   8748  C  CB  . THR D 1 96  ? 4.384   -94.191  22.133  1.00 37.94  ? 99   THR D CB  1 
ATOM   8749  O  OG1 . THR D 1 96  ? 3.174   -94.470  22.844  1.00 35.94  ? 99   THR D OG1 1 
ATOM   8750  C  CG2 . THR D 1 96  ? 5.537   -94.066  23.115  1.00 40.70  ? 99   THR D CG2 1 
ATOM   8751  N  N   . ALA D 1 97  ? 2.800   -93.424  19.400  1.00 33.32  ? 100  ALA D N   1 
ATOM   8752  C  CA  . ALA D 1 97  ? 2.528   -93.824  18.024  1.00 34.81  ? 100  ALA D CA  1 
ATOM   8753  C  C   . ALA D 1 97  ? 3.149   -92.809  17.045  1.00 33.44  ? 100  ALA D C   1 
ATOM   8754  O  O   . ALA D 1 97  ? 3.896   -93.182  16.137  1.00 31.41  ? 100  ALA D O   1 
ATOM   8755  C  CB  . ALA D 1 97  ? 1.029   -93.955  17.800  1.00 34.52  ? 100  ALA D CB  1 
ATOM   8756  N  N   . ILE D 1 98  ? 2.886   -91.524  17.284  1.00 31.93  ? 101  ILE D N   1 
ATOM   8757  C  CA  . ILE D 1 98  ? 3.322   -90.464  16.381  1.00 31.48  ? 101  ILE D CA  1 
ATOM   8758  C  C   . ILE D 1 98  ? 4.857   -90.332  16.289  1.00 33.11  ? 101  ILE D C   1 
ATOM   8759  O  O   . ILE D 1 98  ? 5.367   -89.607  15.426  1.00 30.60  ? 101  ILE D O   1 
ATOM   8760  C  CB  . ILE D 1 98  ? 2.592   -89.144  16.696  1.00 32.48  ? 101  ILE D CB  1 
ATOM   8761  C  CG1 . ILE D 1 98  ? 2.662   -88.185  15.508  1.00 32.24  ? 101  ILE D CG1 1 
ATOM   8762  C  CG2 . ILE D 1 98  ? 3.073   -88.531  18.016  1.00 31.99  ? 101  ILE D CG2 1 
ATOM   8763  C  CD1 . ILE D 1 98  ? 1.866   -88.632  14.305  1.00 31.48  ? 101  ILE D CD1 1 
ATOM   8764  N  N   . GLN D 1 99  ? 5.586   -91.079  17.127  1.00 32.86  ? 102  GLN D N   1 
ATOM   8765  C  CA  . GLN D 1 99  ? 7.062   -91.112  17.046  1.00 33.48  ? 102  GLN D CA  1 
ATOM   8766  C  C   . GLN D 1 99  ? 7.662   -92.133  16.075  1.00 31.86  ? 102  GLN D C   1 
ATOM   8767  O  O   . GLN D 1 99  ? 8.885   -92.129  15.827  1.00 29.18  ? 102  GLN D O   1 
ATOM   8768  C  CB  . GLN D 1 99  ? 7.672   -91.308  18.421  1.00 38.24  ? 102  GLN D CB  1 
ATOM   8769  C  CG  . GLN D 1 99  ? 7.921   -89.994  19.143  1.00 43.74  ? 102  GLN D CG  1 
ATOM   8770  C  CD  . GLN D 1 99  ? 7.754   -90.123  20.636  1.00 46.76  ? 102  GLN D CD  1 
ATOM   8771  O  OE1 . GLN D 1 99  ? 7.773   -91.229  21.189  1.00 50.07  ? 102  GLN D OE1 1 
ATOM   8772  N  NE2 . GLN D 1 99  ? 7.574   -88.992  21.300  1.00 48.83  ? 102  GLN D NE2 1 
ATOM   8773  N  N   . LYS D 1 100 ? 6.807   -93.004  15.542  1.00 28.70  ? 103  LYS D N   1 
ATOM   8774  C  CA  . LYS D 1 100 ? 7.229   -93.966  14.543  1.00 27.17  ? 103  LYS D CA  1 
ATOM   8775  C  C   . LYS D 1 100 ? 7.678   -93.244  13.265  1.00 25.41  ? 103  LYS D C   1 
ATOM   8776  O  O   . LYS D 1 100 ? 6.878   -92.569  12.612  1.00 23.41  ? 103  LYS D O   1 
ATOM   8777  C  CB  . LYS D 1 100 ? 6.086   -94.944  14.245  1.00 27.45  ? 103  LYS D CB  1 
ATOM   8778  C  CG  . LYS D 1 100 ? 6.467   -96.091  13.323  1.00 28.04  ? 103  LYS D CG  1 
ATOM   8779  C  CD  . LYS D 1 100 ? 7.595   -96.963  13.862  1.00 28.58  ? 103  LYS D CD  1 
ATOM   8780  C  CE  . LYS D 1 100 ? 7.246   -97.634  15.189  1.00 29.56  ? 103  LYS D CE  1 
ATOM   8781  N  NZ  . LYS D 1 100 ? 8.400   -98.423  15.713  1.00 28.56  ? 103  LYS D NZ  1 
ATOM   8782  N  N   . PRO D 1 101 ? 8.968   -93.380  12.907  1.00 23.79  ? 104  PRO D N   1 
ATOM   8783  C  CA  . PRO D 1 101 ? 9.448   -92.701  11.707  1.00 24.06  ? 104  PRO D CA  1 
ATOM   8784  C  C   . PRO D 1 101 ? 8.619   -92.981  10.427  1.00 27.13  ? 104  PRO D C   1 
ATOM   8785  O  O   . PRO D 1 101 ? 8.267   -94.142  10.116  1.00 26.19  ? 104  PRO D O   1 
ATOM   8786  C  CB  . PRO D 1 101 ? 10.888  -93.188  11.584  1.00 24.20  ? 104  PRO D CB  1 
ATOM   8787  C  CG  . PRO D 1 101 ? 11.292  -93.538  12.990  1.00 23.02  ? 104  PRO D CG  1 
ATOM   8788  C  CD  . PRO D 1 101 ? 10.052  -94.049  13.654  1.00 22.75  ? 104  PRO D CD  1 
ATOM   8789  N  N   . LEU D 1 102 ? 8.296   -91.905  9.715   1.00 27.31  ? 105  LEU D N   1 
ATOM   8790  C  CA  . LEU D 1 102 ? 7.485   -91.974  8.518   1.00 27.61  ? 105  LEU D CA  1 
ATOM   8791  C  C   . LEU D 1 102 ? 8.334   -91.582  7.327   1.00 28.62  ? 105  LEU D C   1 
ATOM   8792  O  O   . LEU D 1 102 ? 9.341   -90.895  7.483   1.00 29.17  ? 105  LEU D O   1 
ATOM   8793  C  CB  . LEU D 1 102 ? 6.282   -91.047  8.652   1.00 26.42  ? 105  LEU D CB  1 
ATOM   8794  C  CG  . LEU D 1 102 ? 4.957   -91.509  9.279   1.00 28.20  ? 105  LEU D CG  1 
ATOM   8795  C  CD1 . LEU D 1 102 ? 4.978   -92.815  10.084  1.00 26.78  ? 105  LEU D CD1 1 
ATOM   8796  C  CD2 . LEU D 1 102 ? 4.363   -90.371  10.086  1.00 26.10  ? 105  LEU D CD2 1 
ATOM   8797  N  N   . CYS D 1 103 ? 7.945   -92.049  6.143   1.00 29.66  ? 106  CYS D N   1 
ATOM   8798  C  CA  . CYS D 1 103 ? 8.712   -91.811  4.925   1.00 30.13  ? 106  CYS D CA  1 
ATOM   8799  C  C   . CYS D 1 103 ? 7.765   -91.671  3.755   1.00 30.12  ? 106  CYS D C   1 
ATOM   8800  O  O   . CYS D 1 103 ? 6.863   -92.492  3.589   1.00 32.45  ? 106  CYS D O   1 
ATOM   8801  C  CB  . CYS D 1 103 ? 9.675   -92.966  4.641   1.00 31.07  ? 106  CYS D CB  1 
ATOM   8802  S  SG  . CYS D 1 103 ? 10.389  -92.867  2.979   1.00 33.57  ? 106  CYS D SG  1 
ATOM   8803  N  N   . SER D 1 104 ? 7.991   -90.650  2.936   1.00 29.85  ? 107  SER D N   1 
ATOM   8804  C  CA  . SER D 1 104 ? 7.082   -90.330  1.842   1.00 31.00  ? 107  SER D CA  1 
ATOM   8805  C  C   . SER D 1 104 ? 7.702   -90.685  0.499   1.00 31.77  ? 107  SER D C   1 
ATOM   8806  O  O   . SER D 1 104 ? 8.689   -90.079  0.079   1.00 33.35  ? 107  SER D O   1 
ATOM   8807  C  CB  . SER D 1 104 ? 6.694   -88.855  1.871   1.00 30.92  ? 107  SER D CB  1 
ATOM   8808  O  OG  . SER D 1 104 ? 5.600   -88.613  1.005   1.00 36.10  ? 107  SER D OG  1 
ATOM   8809  N  N   . LEU D 1 105 ? 7.136   -91.693  -0.157  1.00 32.43  ? 108  LEU D N   1 
ATOM   8810  C  CA  . LEU D 1 105 ? 7.576   -92.081  -1.497  1.00 32.50  ? 108  LEU D CA  1 
ATOM   8811  C  C   . LEU D 1 105 ? 6.538   -91.626  -2.511  1.00 35.11  ? 108  LEU D C   1 
ATOM   8812  O  O   . LEU D 1 105 ? 5.366   -91.985  -2.406  1.00 37.23  ? 108  LEU D O   1 
ATOM   8813  C  CB  . LEU D 1 105 ? 7.849   -93.581  -1.586  1.00 30.12  ? 108  LEU D CB  1 
ATOM   8814  C  CG  . LEU D 1 105 ? 9.115   -94.054  -0.842  1.00 29.47  ? 108  LEU D CG  1 
ATOM   8815  C  CD1 . LEU D 1 105 ? 9.391   -95.520  -1.135  1.00 27.93  ? 108  LEU D CD1 1 
ATOM   8816  C  CD2 . LEU D 1 105 ? 10.363  -93.218  -1.145  1.00 28.05  ? 108  LEU D CD2 1 
ATOM   8817  N  N   . PRO D 1 106 ? 6.953   -90.798  -3.480  1.00 34.66  ? 109  PRO D N   1 
ATOM   8818  C  CA  . PRO D 1 106 ? 5.966   -90.226  -4.376  1.00 38.20  ? 109  PRO D CA  1 
ATOM   8819  C  C   . PRO D 1 106 ? 5.537   -91.217  -5.468  1.00 41.83  ? 109  PRO D C   1 
ATOM   8820  O  O   . PRO D 1 106 ? 6.380   -91.790  -6.165  1.00 41.39  ? 109  PRO D O   1 
ATOM   8821  C  CB  . PRO D 1 106 ? 6.699   -89.022  -4.974  1.00 36.15  ? 109  PRO D CB  1 
ATOM   8822  C  CG  . PRO D 1 106 ? 8.141   -89.402  -4.935  1.00 35.25  ? 109  PRO D CG  1 
ATOM   8823  C  CD  . PRO D 1 106 ? 8.328   -90.467  -3.885  1.00 34.65  ? 109  PRO D CD  1 
ATOM   8824  N  N   . ALA D 1 107 ? 4.232   -91.440  -5.573  1.00 44.95  ? 110  ALA D N   1 
ATOM   8825  C  CA  . ALA D 1 107 ? 3.667   -92.185  -6.686  1.00 51.33  ? 110  ALA D CA  1 
ATOM   8826  C  C   . ALA D 1 107 ? 2.524   -91.363  -7.279  1.00 58.40  ? 110  ALA D C   1 
ATOM   8827  O  O   . ALA D 1 107 ? 2.685   -90.766  -8.356  1.00 62.74  ? 110  ALA D O   1 
ATOM   8828  C  CB  . ALA D 1 107 ? 3.196   -93.560  -6.246  1.00 49.45  ? 110  ALA D CB  1 
ATOM   8829  N  N   . GLY D 1 108 ? 1.403   -91.295  -6.555  1.00 59.68  ? 111  GLY D N   1 
ATOM   8830  C  CA  . GLY D 1 108 ? 0.193   -90.583  -6.994  1.00 64.64  ? 111  GLY D CA  1 
ATOM   8831  C  C   . GLY D 1 108 ? 0.371   -89.137  -7.430  1.00 68.99  ? 111  GLY D C   1 
ATOM   8832  O  O   . GLY D 1 108 ? 1.471   -88.705  -7.792  1.00 71.36  ? 111  GLY D O   1 
ATOM   8833  N  N   . SER D 1 109 ? -0.722  -88.381  -7.420  1.00 72.75  ? 112  SER D N   1 
ATOM   8834  C  CA  . SER D 1 109 ? -0.640  -86.961  -7.762  1.00 74.50  ? 112  SER D CA  1 
ATOM   8835  C  C   . SER D 1 109 ? -0.736  -86.122  -6.498  1.00 69.42  ? 112  SER D C   1 
ATOM   8836  O  O   . SER D 1 109 ? -1.494  -86.448  -5.578  1.00 71.71  ? 112  SER D O   1 
ATOM   8837  C  CB  . SER D 1 109 ? -1.713  -86.552  -8.777  1.00 77.87  ? 112  SER D CB  1 
ATOM   8838  O  OG  . SER D 1 109 ? -1.293  -85.411  -9.519  1.00 76.47  ? 112  SER D OG  1 
ATOM   8839  N  N   . GLY D 1 110 ? 0.034   -85.041  -6.461  1.00 61.45  ? 113  GLY D N   1 
ATOM   8840  C  CA  . GLY D 1 110 ? 0.178   -84.257  -5.243  1.00 51.72  ? 113  GLY D CA  1 
ATOM   8841  C  C   . GLY D 1 110 ? 1.228   -84.932  -4.384  1.00 44.58  ? 113  GLY D C   1 
ATOM   8842  O  O   . GLY D 1 110 ? 0.907   -85.787  -3.547  1.00 41.72  ? 113  GLY D O   1 
ATOM   8843  N  N   . ASN D 1 111 ? 2.484   -84.563  -4.634  1.00 38.46  ? 114  ASN D N   1 
ATOM   8844  C  CA  . ASN D 1 111 ? 3.636   -85.032  -3.872  1.00 35.43  ? 114  ASN D CA  1 
ATOM   8845  C  C   . ASN D 1 111 ? 4.414   -83.854  -3.285  1.00 31.69  ? 114  ASN D C   1 
ATOM   8846  O  O   . ASN D 1 111 ? 5.655   -83.785  -3.363  1.00 31.61  ? 114  ASN D O   1 
ATOM   8847  C  CB  . ASN D 1 111 ? 4.522   -85.893  -4.772  1.00 37.53  ? 114  ASN D CB  1 
ATOM   8848  C  CG  . ASN D 1 111 ? 3.783   -87.101  -5.317  1.00 41.28  ? 114  ASN D CG  1 
ATOM   8849  O  OD1 . ASN D 1 111 ? 3.387   -87.992  -4.558  1.00 41.36  ? 114  ASN D OD1 1 
ATOM   8850  N  ND2 . ASN D 1 111 ? 3.588   -87.136  -6.635  1.00 39.77  ? 114  ASN D ND2 1 
ATOM   8851  N  N   . ALA D 1 112 ? 3.676   -82.920  -2.694  1.00 28.80  ? 115  ALA D N   1 
ATOM   8852  C  CA  . ALA D 1 112 ? 4.283   -81.702  -2.163  1.00 28.15  ? 115  ALA D CA  1 
ATOM   8853  C  C   . ALA D 1 112 ? 5.235   -81.998  -1.032  1.00 26.30  ? 115  ALA D C   1 
ATOM   8854  O  O   . ALA D 1 112 ? 6.264   -81.348  -0.898  1.00 28.45  ? 115  ALA D O   1 
ATOM   8855  C  CB  . ALA D 1 112 ? 3.218   -80.720  -1.723  1.00 28.05  ? 115  ALA D CB  1 
ATOM   8856  N  N   . LEU D 1 113 ? 4.902   -83.001  -0.230  1.00 26.66  ? 116  LEU D N   1 
ATOM   8857  C  CA  . LEU D 1 113 ? 5.718   -83.361  0.917   1.00 25.97  ? 116  LEU D CA  1 
ATOM   8858  C  C   . LEU D 1 113 ? 7.040   -83.958  0.442   1.00 26.50  ? 116  LEU D C   1 
ATOM   8859  O  O   . LEU D 1 113 ? 8.105   -83.615  0.959   1.00 26.25  ? 116  LEU D O   1 
ATOM   8860  C  CB  . LEU D 1 113 ? 4.948   -84.323  1.839   1.00 25.60  ? 116  LEU D CB  1 
ATOM   8861  C  CG  . LEU D 1 113 ? 5.419   -84.541  3.290   1.00 26.67  ? 116  LEU D CG  1 
ATOM   8862  C  CD1 . LEU D 1 113 ? 5.311   -83.271  4.124   1.00 27.35  ? 116  LEU D CD1 1 
ATOM   8863  C  CD2 . LEU D 1 113 ? 4.649   -85.663  3.978   1.00 25.89  ? 116  LEU D CD2 1 
ATOM   8864  N  N   . ALA D 1 114 ? 6.957   -84.844  -0.550  1.00 25.13  ? 117  ALA D N   1 
ATOM   8865  C  CA  . ALA D 1 114 ? 8.134   -85.480  -1.139  1.00 25.11  ? 117  ALA D CA  1 
ATOM   8866  C  C   . ALA D 1 114 ? 9.022   -84.439  -1.834  1.00 25.25  ? 117  ALA D C   1 
ATOM   8867  O  O   . ALA D 1 114 ? 10.242  -84.437  -1.658  1.00 25.71  ? 117  ALA D O   1 
ATOM   8868  C  CB  . ALA D 1 114 ? 7.703   -86.556  -2.130  1.00 24.67  ? 117  ALA D CB  1 
ATOM   8869  N  N   . ALA D 1 115 ? 8.401   -83.563  -2.628  1.00 24.83  ? 118  ALA D N   1 
ATOM   8870  C  CA  . ALA D 1 115 ? 9.119   -82.452  -3.274  1.00 25.03  ? 118  ALA D CA  1 
ATOM   8871  C  C   . ALA D 1 115 ? 9.863   -81.609  -2.232  1.00 24.58  ? 118  ALA D C   1 
ATOM   8872  O  O   . ALA D 1 115 ? 11.060  -81.339  -2.394  1.00 23.46  ? 118  ALA D O   1 
ATOM   8873  C  CB  . ALA D 1 115 ? 8.166   -81.585  -4.080  1.00 23.57  ? 118  ALA D CB  1 
ATOM   8874  N  N   . SER D 1 116 ? 9.168   -81.251  -1.142  1.00 25.00  ? 119  SER D N   1 
ATOM   8875  C  CA  . SER D 1 116 ? 9.788   -80.458  -0.060  1.00 24.82  ? 119  SER D CA  1 
ATOM   8876  C  C   . SER D 1 116 ? 11.004  -81.160  0.537   1.00 25.52  ? 119  SER D C   1 
ATOM   8877  O  O   . SER D 1 116 ? 12.061  -80.549  0.685   1.00 25.89  ? 119  SER D O   1 
ATOM   8878  C  CB  . SER D 1 116 ? 8.778   -80.087  1.028   1.00 24.32  ? 119  SER D CB  1 
ATOM   8879  O  OG  . SER D 1 116 ? 7.593   -79.517  0.472   1.00 24.31  ? 119  SER D OG  1 
ATOM   8880  N  N   . LEU D 1 117 ? 10.876  -82.446  0.857   1.00 25.88  ? 120  LEU D N   1 
ATOM   8881  C  CA  . LEU D 1 117 ? 11.997  -83.168  1.460   1.00 27.95  ? 120  LEU D CA  1 
ATOM   8882  C  C   . LEU D 1 117 ? 13.116  -83.309  0.467   1.00 27.85  ? 120  LEU D C   1 
ATOM   8883  O  O   . LEU D 1 117 ? 14.278  -83.298  0.839   1.00 29.94  ? 120  LEU D O   1 
ATOM   8884  C  CB  . LEU D 1 117 ? 11.589  -84.565  1.933   1.00 28.68  ? 120  LEU D CB  1 
ATOM   8885  C  CG  . LEU D 1 117 ? 10.496  -84.582  2.994   1.00 29.41  ? 120  LEU D CG  1 
ATOM   8886  C  CD1 . LEU D 1 117 ? 9.593   -85.782  2.794   1.00 31.05  ? 120  LEU D CD1 1 
ATOM   8887  C  CD2 . LEU D 1 117 ? 11.101  -84.551  4.382   1.00 30.49  ? 120  LEU D CD2 1 
ATOM   8888  N  N   . ASN D 1 118 ? 12.755  -83.455  -0.801  1.00 29.92  ? 121  ASN D N   1 
ATOM   8889  C  CA  . ASN D 1 118 ? 13.748  -83.546  -1.856  1.00 30.70  ? 121  ASN D CA  1 
ATOM   8890  C  C   . ASN D 1 118 ? 14.539  -82.252  -1.925  1.00 31.14  ? 121  ASN D C   1 
ATOM   8891  O  O   . ASN D 1 118 ? 15.774  -82.271  -2.013  1.00 30.93  ? 121  ASN D O   1 
ATOM   8892  C  CB  . ASN D 1 118 ? 13.083  -83.851  -3.186  1.00 30.55  ? 121  ASN D CB  1 
ATOM   8893  C  CG  . ASN D 1 118 ? 14.049  -83.770  -4.341  1.00 32.20  ? 121  ASN D CG  1 
ATOM   8894  O  OD1 . ASN D 1 118 ? 14.089  -82.771  -5.049  1.00 32.65  ? 121  ASN D OD1 1 
ATOM   8895  N  ND2 . ASN D 1 118 ? 14.865  -84.802  -4.509  1.00 31.63  ? 121  ASN D ND2 1 
ATOM   8896  N  N   . HIS D 1 119 ? 13.817  -81.133  -1.860  1.00 32.44  ? 122  HIS D N   1 
ATOM   8897  C  CA  . HIS D 1 119 ? 14.439  -79.816  -1.691  1.00 34.33  ? 122  HIS D CA  1 
ATOM   8898  C  C   . HIS D 1 119 ? 15.297  -79.675  -0.444  1.00 34.55  ? 122  HIS D C   1 
ATOM   8899  O  O   . HIS D 1 119 ? 16.458  -79.247  -0.542  1.00 35.45  ? 122  HIS D O   1 
ATOM   8900  C  CB  . HIS D 1 119 ? 13.418  -78.690  -1.743  1.00 34.82  ? 122  HIS D CB  1 
ATOM   8901  C  CG  . HIS D 1 119 ? 14.033  -77.340  -1.502  1.00 37.54  ? 122  HIS D CG  1 
ATOM   8902  N  ND1 . HIS D 1 119 ? 13.941  -76.706  -0.322  1.00 38.99  ? 122  HIS D ND1 1 
ATOM   8903  C  CD2 . HIS D 1 119 ? 14.843  -76.549  -2.313  1.00 37.49  ? 122  HIS D CD2 1 
ATOM   8904  C  CE1 . HIS D 1 119 ? 14.627  -75.548  -0.382  1.00 40.35  ? 122  HIS D CE1 1 
ATOM   8905  N  NE2 . HIS D 1 119 ? 15.177  -75.455  -1.602  1.00 39.81  ? 122  HIS D NE2 1 
ATOM   8906  N  N   . TYR D 1 120 ? 14.763  -80.029  0.729   1.00 32.39  ? 123  TYR D N   1 
ATOM   8907  C  CA  . TYR D 1 120 ? 15.546  -79.898  1.969   1.00 33.52  ? 123  TYR D CA  1 
ATOM   8908  C  C   . TYR D 1 120 ? 16.897  -80.598  1.846   1.00 34.47  ? 123  TYR D C   1 
ATOM   8909  O  O   . TYR D 1 120 ? 17.898  -80.116  2.369   1.00 35.81  ? 123  TYR D O   1 
ATOM   8910  C  CB  . TYR D 1 120 ? 14.788  -80.396  3.214   1.00 32.37  ? 123  TYR D CB  1 
ATOM   8911  C  CG  . TYR D 1 120 ? 13.454  -79.704  3.471   1.00 33.43  ? 123  TYR D CG  1 
ATOM   8912  C  CD1 . TYR D 1 120 ? 13.224  -78.396  3.049   1.00 33.17  ? 123  TYR D CD1 1 
ATOM   8913  C  CD2 . TYR D 1 120 ? 12.425  -80.360  4.160   1.00 33.78  ? 123  TYR D CD2 1 
ATOM   8914  C  CE1 . TYR D 1 120 ? 12.009  -77.770  3.275   1.00 34.72  ? 123  TYR D CE1 1 
ATOM   8915  C  CE2 . TYR D 1 120 ? 11.205  -79.745  4.393   1.00 32.76  ? 123  TYR D CE2 1 
ATOM   8916  C  CZ  . TYR D 1 120 ? 11.002  -78.451  3.950   1.00 36.26  ? 123  TYR D CZ  1 
ATOM   8917  O  OH  . TYR D 1 120 ? 9.794   -77.831  4.168   1.00 36.80  ? 123  TYR D OH  1 
ATOM   8918  N  N   . ALA D 1 121 ? 16.926  -81.714  1.123   1.00 34.04  ? 124  ALA D N   1 
ATOM   8919  C  CA  . ALA D 1 121 ? 18.143  -82.525  0.990   1.00 35.69  ? 124  ALA D CA  1 
ATOM   8920  C  C   . ALA D 1 121 ? 19.195  -81.916  0.051   1.00 36.13  ? 124  ALA D C   1 
ATOM   8921  O  O   . ALA D 1 121 ? 20.347  -82.362  0.026   1.00 36.15  ? 124  ALA D O   1 
ATOM   8922  C  CB  . ALA D 1 121 ? 17.789  -83.947  0.550   1.00 33.10  ? 124  ALA D CB  1 
ATOM   8923  N  N   . GLY D 1 122 ? 18.789  -80.910  -0.721  1.00 35.85  ? 125  GLY D N   1 
ATOM   8924  C  CA  . GLY D 1 122 ? 19.692  -80.247  -1.656  1.00 37.69  ? 125  GLY D CA  1 
ATOM   8925  C  C   . GLY D 1 122 ? 19.612  -80.754  -3.086  1.00 40.18  ? 125  GLY D C   1 
ATOM   8926  O  O   . GLY D 1 122 ? 20.474  -80.437  -3.896  1.00 42.24  ? 125  GLY D O   1 
ATOM   8927  N  N   . TYR D 1 123 ? 18.584  -81.542  -3.397  1.00 39.43  ? 126  TYR D N   1 
ATOM   8928  C  CA  . TYR D 1 123 ? 18.387  -82.049  -4.751  1.00 40.63  ? 126  TYR D CA  1 
ATOM   8929  C  C   . TYR D 1 123 ? 17.724  -81.022  -5.634  1.00 41.89  ? 126  TYR D C   1 
ATOM   8930  O  O   . TYR D 1 123 ? 17.003  -80.143  -5.147  1.00 41.97  ? 126  TYR D O   1 
ATOM   8931  C  CB  . TYR D 1 123 ? 17.513  -83.302  -4.740  1.00 41.53  ? 126  TYR D CB  1 
ATOM   8932  C  CG  . TYR D 1 123 ? 18.226  -84.560  -4.325  1.00 41.12  ? 126  TYR D CG  1 
ATOM   8933  C  CD1 . TYR D 1 123 ? 19.209  -85.123  -5.141  1.00 42.05  ? 126  TYR D CD1 1 
ATOM   8934  C  CD2 . TYR D 1 123 ? 17.918  -85.199  -3.121  1.00 41.07  ? 126  TYR D CD2 1 
ATOM   8935  C  CE1 . TYR D 1 123 ? 19.876  -86.283  -4.763  1.00 43.32  ? 126  TYR D CE1 1 
ATOM   8936  C  CE2 . TYR D 1 123 ? 18.573  -86.361  -2.738  1.00 41.29  ? 126  TYR D CE2 1 
ATOM   8937  C  CZ  . TYR D 1 123 ? 19.544  -86.901  -3.567  1.00 42.80  ? 126  TYR D CZ  1 
ATOM   8938  O  OH  . TYR D 1 123 ? 20.210  -88.048  -3.211  1.00 44.51  ? 126  TYR D OH  1 
ATOM   8939  N  N   . GLU D 1 124 ? 17.954  -81.155  -6.939  1.00 40.99  ? 127  GLU D N   1 
ATOM   8940  C  CA  . GLU D 1 124 ? 17.287  -80.335  -7.945  1.00 39.76  ? 127  GLU D CA  1 
ATOM   8941  C  C   . GLU D 1 124 ? 15.788  -80.589  -7.899  1.00 37.60  ? 127  GLU D C   1 
ATOM   8942  O  O   . GLU D 1 124 ? 15.328  -81.626  -7.426  1.00 33.53  ? 127  GLU D O   1 
ATOM   8943  C  CB  . GLU D 1 124 ? 17.813  -80.649  -9.353  1.00 46.52  ? 127  GLU D CB  1 
ATOM   8944  C  CG  . GLU D 1 124 ? 19.325  -80.833  -9.479  1.00 53.59  ? 127  GLU D CG  1 
ATOM   8945  C  CD  . GLU D 1 124 ? 20.066  -79.537  -9.766  1.00 62.40  ? 127  GLU D CD  1 
ATOM   8946  O  OE1 . GLU D 1 124 ? 20.990  -79.562  -10.611 1.00 65.77  ? 127  GLU D OE1 1 
ATOM   8947  O  OE2 . GLU D 1 124 ? 19.732  -78.493  -9.154  1.00 65.26  ? 127  GLU D OE2 1 
ATOM   8948  N  N   . GLN D 1 125 ? 15.010  -79.644  -8.397  1.00 36.70  ? 128  GLN D N   1 
ATOM   8949  C  CA  . GLN D 1 125 ? 13.574  -79.801  -8.317  1.00 37.14  ? 128  GLN D CA  1 
ATOM   8950  C  C   . GLN D 1 125 ? 13.084  -80.818  -9.352  1.00 39.80  ? 128  GLN D C   1 
ATOM   8951  O  O   . GLN D 1 125 ? 12.634  -80.443  -10.437 1.00 37.96  ? 128  GLN D O   1 
ATOM   8952  C  CB  . GLN D 1 125 ? 12.910  -78.463  -8.526  1.00 37.60  ? 128  GLN D CB  1 
ATOM   8953  C  CG  . GLN D 1 125 ? 11.485  -78.410  -8.048  1.00 37.70  ? 128  GLN D CG  1 
ATOM   8954  C  CD  . GLN D 1 125 ? 10.932  -77.028  -8.206  1.00 37.42  ? 128  GLN D CD  1 
ATOM   8955  O  OE1 . GLN D 1 125 ? 10.550  -76.623  -9.302  1.00 37.37  ? 128  GLN D OE1 1 
ATOM   8956  N  NE2 . GLN D 1 125 ? 10.909  -76.280  -7.114  1.00 38.90  ? 128  GLN D NE2 1 
ATOM   8957  N  N   . VAL D 1 126 ? 13.166  -82.101  -9.009  1.00 38.61  ? 129  VAL D N   1 
ATOM   8958  C  CA  . VAL D 1 126 ? 12.861  -83.159  -9.973  1.00 39.48  ? 129  VAL D CA  1 
ATOM   8959  C  C   . VAL D 1 126 ? 11.436  -83.700  -9.852  1.00 42.07  ? 129  VAL D C   1 
ATOM   8960  O  O   . VAL D 1 126 ? 10.749  -83.486  -8.847  1.00 40.74  ? 129  VAL D O   1 
ATOM   8961  C  CB  . VAL D 1 126 ? 13.892  -84.304  -9.922  1.00 38.95  ? 129  VAL D CB  1 
ATOM   8962  C  CG1 . VAL D 1 126 ? 15.252  -83.817  -10.418 1.00 37.95  ? 129  VAL D CG1 1 
ATOM   8963  C  CG2 . VAL D 1 126 ? 14.000  -84.868  -8.520  1.00 35.21  ? 129  VAL D CG2 1 
ATOM   8964  N  N   . THR D 1 127 ? 11.006  -84.414  -10.888 1.00 43.11  ? 130  THR D N   1 
ATOM   8965  C  CA  . THR D 1 127 ? 9.620   -84.842  -11.006 1.00 42.71  ? 130  THR D CA  1 
ATOM   8966  C  C   . THR D 1 127 ? 9.503   -86.340  -11.274 1.00 41.56  ? 130  THR D C   1 
ATOM   8967  O  O   . THR D 1 127 ? 10.486  -86.994  -11.625 1.00 41.57  ? 130  THR D O   1 
ATOM   8968  C  CB  . THR D 1 127 ? 8.899   -84.044  -12.111 1.00 46.19  ? 130  THR D CB  1 
ATOM   8969  O  OG1 . THR D 1 127 ? 7.498   -84.314  -12.052 1.00 50.98  ? 130  THR D OG1 1 
ATOM   8970  C  CG2 . THR D 1 127 ? 9.442   -84.400  -13.507 1.00 46.33  ? 130  THR D CG2 1 
ATOM   8971  N  N   . ASN D 1 128 ? 8.305   -86.880  -11.075 1.00 41.28  ? 131  ASN D N   1 
ATOM   8972  C  CA  . ASN D 1 128 ? 8.020   -88.292  -11.347 1.00 43.63  ? 131  ASN D CA  1 
ATOM   8973  C  C   . ASN D 1 128 ? 9.071   -89.272  -10.806 1.00 42.53  ? 131  ASN D C   1 
ATOM   8974  O  O   . ASN D 1 128 ? 9.359   -89.256  -9.615  1.00 42.10  ? 131  ASN D O   1 
ATOM   8975  C  CB  . ASN D 1 128 ? 7.734   -88.501  -12.840 1.00 46.63  ? 131  ASN D CB  1 
ATOM   8976  C  CG  . ASN D 1 128 ? 6.535   -87.692  -13.322 1.00 50.29  ? 131  ASN D CG  1 
ATOM   8977  O  OD1 . ASN D 1 128 ? 6.665   -86.825  -14.188 1.00 52.25  ? 131  ASN D OD1 1 
ATOM   8978  N  ND2 . ASN D 1 128 ? 5.360   -87.959  -12.747 1.00 54.03  ? 131  ASN D ND2 1 
ATOM   8979  N  N   . GLU D 1 129 ? 9.645   -90.113  -11.665 1.00 43.93  ? 132  GLU D N   1 
ATOM   8980  C  CA  . GLU D 1 129 ? 10.549  -91.177  -11.200 1.00 44.26  ? 132  GLU D CA  1 
ATOM   8981  C  C   . GLU D 1 129 ? 11.918  -90.709  -10.710 1.00 40.75  ? 132  GLU D C   1 
ATOM   8982  O  O   . GLU D 1 129 ? 12.550  -91.393  -9.894  1.00 43.49  ? 132  GLU D O   1 
ATOM   8983  C  CB  . GLU D 1 129 ? 10.693  -92.330  -12.220 1.00 49.99  ? 132  GLU D CB  1 
ATOM   8984  C  CG  . GLU D 1 129 ? 10.496  -91.970  -13.686 1.00 56.11  ? 132  GLU D CG  1 
ATOM   8985  C  CD  . GLU D 1 129 ? 9.064   -92.186  -14.149 1.00 60.29  ? 132  GLU D CD  1 
ATOM   8986  O  OE1 . GLU D 1 129 ? 8.489   -93.249  -13.819 1.00 60.07  ? 132  GLU D OE1 1 
ATOM   8987  O  OE2 . GLU D 1 129 ? 8.518   -91.299  -14.854 1.00 62.86  ? 132  GLU D OE2 1 
ATOM   8988  N  N   . ASP D 1 130 ? 12.376  -89.568  -11.220 1.00 38.01  ? 133  ASP D N   1 
ATOM   8989  C  CA  . ASP D 1 130 ? 13.570  -88.888  -10.701 1.00 38.85  ? 133  ASP D CA  1 
ATOM   8990  C  C   . ASP D 1 130 ? 13.374  -88.545  -9.209  1.00 36.47  ? 133  ASP D C   1 
ATOM   8991  O  O   . ASP D 1 130 ? 14.288  -88.691  -8.402  1.00 35.53  ? 133  ASP D O   1 
ATOM   8992  C  CB  . ASP D 1 130 ? 13.843  -87.587  -11.480 1.00 42.40  ? 133  ASP D CB  1 
ATOM   8993  C  CG  . ASP D 1 130 ? 14.588  -87.812  -12.800 1.00 45.04  ? 133  ASP D CG  1 
ATOM   8994  O  OD1 . ASP D 1 130 ? 14.375  -87.002  -13.722 1.00 45.36  ? 133  ASP D OD1 1 
ATOM   8995  O  OD2 . ASP D 1 130 ? 15.389  -88.767  -12.920 1.00 46.04  ? 133  ASP D OD2 1 
ATOM   8996  N  N   . LEU D 1 131 ? 12.172  -88.084  -8.870  1.00 33.67  ? 134  LEU D N   1 
ATOM   8997  C  CA  . LEU D 1 131 ? 11.805  -87.753  -7.497  1.00 33.56  ? 134  LEU D CA  1 
ATOM   8998  C  C   . LEU D 1 131 ? 11.606  -89.018  -6.653  1.00 32.06  ? 134  LEU D C   1 
ATOM   8999  O  O   . LEU D 1 131 ? 12.006  -89.060  -5.494  1.00 30.40  ? 134  LEU D O   1 
ATOM   9000  C  CB  . LEU D 1 131 ? 10.536  -86.889  -7.493  1.00 34.05  ? 134  LEU D CB  1 
ATOM   9001  C  CG  . LEU D 1 131 ? 10.019  -86.370  -6.152  1.00 33.27  ? 134  LEU D CG  1 
ATOM   9002  C  CD1 . LEU D 1 131 ? 11.027  -85.410  -5.538  1.00 33.54  ? 134  LEU D CD1 1 
ATOM   9003  C  CD2 . LEU D 1 131 ? 8.676   -85.703  -6.353  1.00 31.24  ? 134  LEU D CD2 1 
ATOM   9004  N  N   . LEU D 1 132 ? 11.023  -90.058  -7.253  1.00 32.55  ? 135  LEU D N   1 
ATOM   9005  C  CA  . LEU D 1 132 ? 10.858  -91.352  -6.575  1.00 31.40  ? 135  LEU D CA  1 
ATOM   9006  C  C   . LEU D 1 132 ? 12.206  -91.969  -6.206  1.00 31.78  ? 135  LEU D C   1 
ATOM   9007  O  O   . LEU D 1 132 ? 12.389  -92.506  -5.090  1.00 30.19  ? 135  LEU D O   1 
ATOM   9008  C  CB  . LEU D 1 132 ? 10.042  -92.310  -7.439  1.00 32.36  ? 135  LEU D CB  1 
ATOM   9009  C  CG  . LEU D 1 132 ? 9.877   -93.745  -6.926  1.00 32.15  ? 135  LEU D CG  1 
ATOM   9010  C  CD1 . LEU D 1 132 ? 9.243   -93.737  -5.535  1.00 33.45  ? 135  LEU D CD1 1 
ATOM   9011  C  CD2 . LEU D 1 132 ? 9.036   -94.545  -7.912  1.00 29.57  ? 135  LEU D CD2 1 
ATOM   9012  N  N   . THR D 1 133 ? 13.156  -91.877  -7.131  1.00 30.89  ? 136  THR D N   1 
ATOM   9013  C  CA  . THR D 1 133 ? 14.499  -92.366  -6.859  1.00 30.81  ? 136  THR D CA  1 
ATOM   9014  C  C   . THR D 1 133 ? 15.200  -91.567  -5.761  1.00 30.32  ? 136  THR D C   1 
ATOM   9015  O  O   . THR D 1 133 ? 15.795  -92.159  -4.846  1.00 31.85  ? 136  THR D O   1 
ATOM   9016  C  CB  . THR D 1 133 ? 15.352  -92.401  -8.129  1.00 30.82  ? 136  THR D CB  1 
ATOM   9017  O  OG1 . THR D 1 133 ? 14.740  -93.299  -9.055  1.00 33.26  ? 136  THR D OG1 1 
ATOM   9018  C  CG2 . THR D 1 133 ? 16.766  -92.892  -7.810  1.00 30.06  ? 136  THR D CG2 1 
ATOM   9019  N  N   . ASN D 1 134 ? 15.138  -90.239  -5.845  1.00 30.18  ? 137  ASN D N   1 
ATOM   9020  C  CA  . ASN D 1 134 ? 15.731  -89.384  -4.801  1.00 31.42  ? 137  ASN D CA  1 
ATOM   9021  C  C   . ASN D 1 134 ? 15.139  -89.643  -3.397  1.00 30.47  ? 137  ASN D C   1 
ATOM   9022  O  O   . ASN D 1 134 ? 15.866  -89.864  -2.437  1.00 28.79  ? 137  ASN D O   1 
ATOM   9023  C  CB  . ASN D 1 134 ? 15.617  -87.906  -5.179  1.00 32.49  ? 137  ASN D CB  1 
ATOM   9024  C  CG  . ASN D 1 134 ? 16.572  -87.508  -6.297  1.00 34.08  ? 137  ASN D CG  1 
ATOM   9025  O  OD1 . ASN D 1 134 ? 17.457  -88.275  -6.676  1.00 35.30  ? 137  ASN D OD1 1 
ATOM   9026  N  ND2 . ASN D 1 134 ? 16.399  -86.300  -6.825  1.00 32.08  ? 137  ASN D ND2 1 
ATOM   9027  N  N   . CYS D 1 135 ? 13.812  -89.643  -3.301  1.00 30.90  ? 138  CYS D N   1 
ATOM   9028  C  CA  . CYS D 1 135 ? 13.135  -89.956  -2.051  1.00 30.49  ? 138  CYS D CA  1 
ATOM   9029  C  C   . CYS D 1 135 ? 13.514  -91.334  -1.504  1.00 30.53  ? 138  CYS D C   1 
ATOM   9030  O  O   . CYS D 1 135 ? 13.788  -91.461  -0.300  1.00 32.30  ? 138  CYS D O   1 
ATOM   9031  C  CB  . CYS D 1 135 ? 11.631  -89.806  -2.220  1.00 29.14  ? 138  CYS D CB  1 
ATOM   9032  S  SG  . CYS D 1 135 ? 11.187  -88.083  -2.533  1.00 32.58  ? 138  CYS D SG  1 
ATOM   9033  N  N   . THR D 1 136 ? 13.561  -92.344  -2.383  1.00 29.69  ? 139  THR D N   1 
ATOM   9034  C  CA  . THR D 1 136 ? 14.029  -93.696  -2.030  1.00 29.30  ? 139  THR D CA  1 
ATOM   9035  C  C   . THR D 1 136 ? 15.466  -93.659  -1.512  1.00 31.00  ? 139  THR D C   1 
ATOM   9036  O  O   . THR D 1 136 ? 15.786  -94.288  -0.503  1.00 33.03  ? 139  THR D O   1 
ATOM   9037  C  CB  . THR D 1 136 ? 13.916  -94.676  -3.227  1.00 29.20  ? 139  THR D CB  1 
ATOM   9038  O  OG1 . THR D 1 136 ? 12.549  -94.768  -3.667  1.00 27.40  ? 139  THR D OG1 1 
ATOM   9039  C  CG2 . THR D 1 136 ? 14.435  -96.079  -2.866  1.00 28.76  ? 139  THR D CG2 1 
ATOM   9040  N  N   . LEU D 1 137 ? 16.328  -92.907  -2.195  1.00 34.37  ? 140  LEU D N   1 
ATOM   9041  C  CA  . LEU D 1 137 ? 17.735  -92.747  -1.770  1.00 34.84  ? 140  LEU D CA  1 
ATOM   9042  C  C   . LEU D 1 137 ? 17.826  -92.117  -0.382  1.00 32.80  ? 140  LEU D C   1 
ATOM   9043  O  O   . LEU D 1 137 ? 18.739  -92.425  0.370   1.00 33.78  ? 140  LEU D O   1 
ATOM   9044  C  CB  . LEU D 1 137 ? 18.542  -91.921  -2.786  1.00 35.51  ? 140  LEU D CB  1 
ATOM   9045  C  CG  . LEU D 1 137 ? 19.046  -92.579  -4.078  1.00 37.59  ? 140  LEU D CG  1 
ATOM   9046  C  CD1 . LEU D 1 137 ? 19.212  -91.559  -5.201  1.00 36.52  ? 140  LEU D CD1 1 
ATOM   9047  C  CD2 . LEU D 1 137 ? 20.355  -93.320  -3.838  1.00 37.72  ? 140  LEU D CD2 1 
ATOM   9048  N  N   . LEU D 1 138 ? 16.876  -91.246  -0.042  1.00 31.95  ? 141  LEU D N   1 
ATOM   9049  C  CA  . LEU D 1 138 ? 16.813  -90.695  1.322   1.00 32.55  ? 141  LEU D CA  1 
ATOM   9050  C  C   . LEU D 1 138 ? 16.474  -91.797  2.311   1.00 30.38  ? 141  LEU D C   1 
ATOM   9051  O  O   . LEU D 1 138 ? 17.115  -91.935  3.328   1.00 30.61  ? 141  LEU D O   1 
ATOM   9052  C  CB  . LEU D 1 138 ? 15.845  -89.499  1.433   1.00 32.01  ? 141  LEU D CB  1 
ATOM   9053  C  CG  . LEU D 1 138 ? 16.265  -88.201  0.706   1.00 35.15  ? 141  LEU D CG  1 
ATOM   9054  C  CD1 . LEU D 1 138 ? 15.162  -87.142  0.713   1.00 34.74  ? 141  LEU D CD1 1 
ATOM   9055  C  CD2 . LEU D 1 138 ? 17.577  -87.634  1.254   1.00 33.97  ? 141  LEU D CD2 1 
ATOM   9056  N  N   . LEU D 1 139 ? 15.488  -92.610  1.974   1.00 31.18  ? 142  LEU D N   1 
ATOM   9057  C  CA  . LEU D 1 139 ? 15.148  -93.761  2.781   1.00 31.13  ? 142  LEU D CA  1 
ATOM   9058  C  C   . LEU D 1 139 ? 16.352  -94.674  2.982   1.00 32.27  ? 142  LEU D C   1 
ATOM   9059  O  O   . LEU D 1 139 ? 16.574  -95.190  4.085   1.00 31.42  ? 142  LEU D O   1 
ATOM   9060  C  CB  . LEU D 1 139 ? 13.993  -94.526  2.131   1.00 30.29  ? 142  LEU D CB  1 
ATOM   9061  C  CG  . LEU D 1 139 ? 13.547  -95.823  2.807   1.00 29.15  ? 142  LEU D CG  1 
ATOM   9062  C  CD1 . LEU D 1 139 ? 13.429  -95.686  4.332   1.00 27.55  ? 142  LEU D CD1 1 
ATOM   9063  C  CD2 . LEU D 1 139 ? 12.226  -96.254  2.199   1.00 28.27  ? 142  LEU D CD2 1 
ATOM   9064  N  N   . CYS D 1 140 ? 17.132  -94.880  1.929   1.00 33.56  ? 143  CYS D N   1 
ATOM   9065  C  CA  . CYS D 1 140 ? 18.298  -95.750  2.047   1.00 36.38  ? 143  CYS D CA  1 
ATOM   9066  C  C   . CYS D 1 140 ? 19.379  -95.177  2.978   1.00 39.15  ? 143  CYS D C   1 
ATOM   9067  O  O   . CYS D 1 140 ? 20.056  -95.933  3.692   1.00 39.85  ? 143  CYS D O   1 
ATOM   9068  C  CB  . CYS D 1 140 ? 18.857  -96.103  0.666   1.00 36.75  ? 143  CYS D CB  1 
ATOM   9069  S  SG  . CYS D 1 140 ? 17.712  -97.133  -0.294  1.00 37.74  ? 143  CYS D SG  1 
ATOM   9070  N  N   . ARG D 1 141 ? 19.513  -93.846  2.997   1.00 40.28  ? 144  ARG D N   1 
ATOM   9071  C  CA  . ARG D 1 141 ? 20.516  -93.176  3.837   1.00 38.25  ? 144  ARG D CA  1 
ATOM   9072  C  C   . ARG D 1 141 ? 20.101  -93.072  5.301   1.00 35.69  ? 144  ARG D C   1 
ATOM   9073  O  O   . ARG D 1 141 ? 20.952  -92.919  6.176   1.00 35.11  ? 144  ARG D O   1 
ATOM   9074  C  CB  . ARG D 1 141 ? 20.903  -91.814  3.259   1.00 42.75  ? 144  ARG D CB  1 
ATOM   9075  C  CG  . ARG D 1 141 ? 21.553  -91.939  1.896   1.00 47.28  ? 144  ARG D CG  1 
ATOM   9076  C  CD  . ARG D 1 141 ? 22.326  -90.707  1.481   1.00 52.51  ? 144  ARG D CD  1 
ATOM   9077  N  NE  . ARG D 1 141 ? 22.397  -90.633  0.022   1.00 58.15  ? 144  ARG D NE  1 
ATOM   9078  C  CZ  . ARG D 1 141 ? 21.591  -89.884  -0.730  1.00 60.62  ? 144  ARG D CZ  1 
ATOM   9079  N  NH1 . ARG D 1 141 ? 20.654  -89.122  -0.171  1.00 63.55  ? 144  ARG D NH1 1 
ATOM   9080  N  NH2 . ARG D 1 141 ? 21.726  -89.888  -2.046  1.00 59.72  ? 144  ARG D NH2 1 
ATOM   9081  N  N   . ARG D 1 142 ? 18.796  -93.159  5.556   1.00 34.79  ? 145  ARG D N   1 
ATOM   9082  C  CA  . ARG D 1 142 ? 18.249  -93.453  6.903   1.00 35.33  ? 145  ARG D CA  1 
ATOM   9083  C  C   . ARG D 1 142 ? 18.092  -92.285  7.896   1.00 33.83  ? 145  ARG D C   1 
ATOM   9084  O  O   . ARG D 1 142 ? 17.611  -92.488  9.018   1.00 32.58  ? 145  ARG D O   1 
ATOM   9085  C  CB  . ARG D 1 142 ? 19.039  -94.583  7.575   1.00 36.26  ? 145  ARG D CB  1 
ATOM   9086  C  CG  . ARG D 1 142 ? 18.783  -95.970  7.009   1.00 39.39  ? 145  ARG D CG  1 
ATOM   9087  C  CD  . ARG D 1 142 ? 19.725  -96.976  7.642   1.00 39.81  ? 145  ARG D CD  1 
ATOM   9088  N  NE  . ARG D 1 142 ? 19.223  -98.354  7.580   1.00 45.67  ? 145  ARG D NE  1 
ATOM   9089  C  CZ  . ARG D 1 142 ? 19.465  -99.210  6.582   1.00 43.51  ? 145  ARG D CZ  1 
ATOM   9090  N  NH1 . ARG D 1 142 ? 20.187  -98.826  5.537   1.00 43.63  ? 145  ARG D NH1 1 
ATOM   9091  N  NH2 . ARG D 1 142 ? 18.985  -100.451 6.630   1.00 41.78  ? 145  ARG D NH2 1 
ATOM   9092  N  N   . LEU D 1 143 ? 18.474  -91.078  7.484   1.00 32.42  ? 146  LEU D N   1 
ATOM   9093  C  CA  . LEU D 1 143 ? 18.442  -89.906  8.376   1.00 32.84  ? 146  LEU D CA  1 
ATOM   9094  C  C   . LEU D 1 143 ? 17.019  -89.430  8.659   1.00 32.37  ? 146  LEU D C   1 
ATOM   9095  O  O   . LEU D 1 143 ? 16.164  -89.456  7.778   1.00 33.67  ? 146  LEU D O   1 
ATOM   9096  C  CB  . LEU D 1 143 ? 19.306  -88.771  7.823   1.00 30.36  ? 146  LEU D CB  1 
ATOM   9097  C  CG  . LEU D 1 143 ? 20.787  -89.130  7.579   1.00 32.34  ? 146  LEU D CG  1 
ATOM   9098  C  CD1 . LEU D 1 143 ? 21.603  -87.914  7.171   1.00 30.50  ? 146  LEU D CD1 1 
ATOM   9099  C  CD2 . LEU D 1 143 ? 21.438  -89.827  8.777   1.00 30.84  ? 146  LEU D CD2 1 
ATOM   9100  N  N   . LEU D 1 144 ? 16.777  -89.036  9.904   1.00 32.31  ? 147  LEU D N   1 
ATOM   9101  C  CA  . LEU D 1 144 ? 15.462  -88.603  10.377  1.00 32.46  ? 147  LEU D CA  1 
ATOM   9102  C  C   . LEU D 1 144 ? 15.484  -87.127  10.771  1.00 33.25  ? 147  LEU D C   1 
ATOM   9103  O  O   . LEU D 1 144 ? 16.495  -86.627  11.300  1.00 33.25  ? 147  LEU D O   1 
ATOM   9104  C  CB  . LEU D 1 144 ? 15.053  -89.441  11.592  1.00 34.73  ? 147  LEU D CB  1 
ATOM   9105  C  CG  . LEU D 1 144 ? 14.289  -90.772  11.473  1.00 36.08  ? 147  LEU D CG  1 
ATOM   9106  C  CD1 . LEU D 1 144 ? 14.257  -91.331  10.057  1.00 36.41  ? 147  LEU D CD1 1 
ATOM   9107  C  CD2 . LEU D 1 144 ? 14.794  -91.820  12.454  1.00 33.51  ? 147  LEU D CD2 1 
ATOM   9108  N  N   . SER D 1 145 ? 14.375  -86.434  10.510  1.00 32.07  ? 148  SER D N   1 
ATOM   9109  C  CA  . SER D 1 145 ? 14.166  -85.051  10.964  1.00 30.35  ? 148  SER D CA  1 
ATOM   9110  C  C   . SER D 1 145 ? 12.746  -84.925  11.472  1.00 30.22  ? 148  SER D C   1 
ATOM   9111  O  O   . SER D 1 145 ? 11.821  -85.410  10.817  1.00 29.94  ? 148  SER D O   1 
ATOM   9112  C  CB  . SER D 1 145 ? 14.358  -84.039  9.829   1.00 29.99  ? 148  SER D CB  1 
ATOM   9113  O  OG  . SER D 1 145 ? 15.661  -84.100  9.279   1.00 31.03  ? 148  SER D OG  1 
ATOM   9114  N  N   . PRO D 1 146 ? 12.555  -84.250  12.624  1.00 29.86  ? 149  PRO D N   1 
ATOM   9115  C  CA  . PRO D 1 146 ? 11.204  -84.044  13.148  1.00 28.12  ? 149  PRO D CA  1 
ATOM   9116  C  C   . PRO D 1 146 ? 10.454  -83.036  12.298  1.00 26.48  ? 149  PRO D C   1 
ATOM   9117  O  O   . PRO D 1 146 ? 11.075  -82.190  11.699  1.00 26.87  ? 149  PRO D O   1 
ATOM   9118  C  CB  . PRO D 1 146 ? 11.445  -83.464  14.556  1.00 29.23  ? 149  PRO D CB  1 
ATOM   9119  C  CG  . PRO D 1 146 ? 12.918  -83.548  14.803  1.00 30.05  ? 149  PRO D CG  1 
ATOM   9120  C  CD  . PRO D 1 146 ? 13.576  -83.590  13.460  1.00 30.15  ? 149  PRO D CD  1 
ATOM   9121  N  N   . MET D 1 147 ? 9.133   -83.128  12.235  1.00 26.22  ? 150  MET D N   1 
ATOM   9122  C  CA  . MET D 1 147 ? 8.351   -82.163  11.479  1.00 26.73  ? 150  MET D CA  1 
ATOM   9123  C  C   . MET D 1 147 ? 7.248   -81.554  12.330  1.00 24.96  ? 150  MET D C   1 
ATOM   9124  O  O   . MET D 1 147 ? 6.712   -82.202  13.219  1.00 25.58  ? 150  MET D O   1 
ATOM   9125  C  CB  . MET D 1 147 ? 7.683   -82.806  10.249  1.00 28.91  ? 150  MET D CB  1 
ATOM   9126  C  CG  . MET D 1 147 ? 8.565   -83.535  9.237   1.00 31.86  ? 150  MET D CG  1 
ATOM   9127  S  SD  . MET D 1 147 ? 10.074  -82.803  8.560   1.00 35.82  ? 150  MET D SD  1 
ATOM   9128  C  CE  . MET D 1 147 ? 9.829   -81.053  8.676   1.00 39.92  ? 150  MET D CE  1 
ATOM   9129  N  N   . ASN D 1 148 ? 6.881   -80.320  12.017  1.00 23.93  ? 151  ASN D N   1 
ATOM   9130  C  CA  . ASN D 1 148 ? 5.677   -79.705  12.575  1.00 23.91  ? 151  ASN D CA  1 
ATOM   9131  C  C   . ASN D 1 148 ? 4.415   -80.388  12.086  1.00 24.42  ? 151  ASN D C   1 
ATOM   9132  O  O   . ASN D 1 148 ? 4.431   -81.039  11.028  1.00 25.55  ? 151  ASN D O   1 
ATOM   9133  C  CB  . ASN D 1 148 ? 5.653   -78.222  12.223  1.00 23.36  ? 151  ASN D CB  1 
ATOM   9134  C  CG  . ASN D 1 148 ? 6.831   -77.482  12.809  1.00 24.06  ? 151  ASN D CG  1 
ATOM   9135  O  OD1 . ASN D 1 148 ? 7.308   -77.821  13.904  1.00 24.35  ? 151  ASN D OD1 1 
ATOM   9136  N  ND2 . ASN D 1 148 ? 7.334   -76.494  12.080  1.00 23.01  ? 151  ASN D ND2 1 
ATOM   9137  N  N   . LEU D 1 149 ? 3.329   -80.249  12.846  1.00 23.87  ? 152  LEU D N   1 
ATOM   9138  C  CA  . LEU D 1 149 ? 2.042   -80.870  12.506  1.00 23.40  ? 152  LEU D CA  1 
ATOM   9139  C  C   . LEU D 1 149 ? 1.003   -79.821  12.803  1.00 24.28  ? 152  LEU D C   1 
ATOM   9140  O  O   . LEU D 1 149 ? 1.116   -79.109  13.794  1.00 24.22  ? 152  LEU D O   1 
ATOM   9141  C  CB  . LEU D 1 149 ? 1.783   -82.084  13.417  1.00 24.16  ? 152  LEU D CB  1 
ATOM   9142  C  CG  . LEU D 1 149 ? 1.020   -83.382  13.089  1.00 25.69  ? 152  LEU D CG  1 
ATOM   9143  C  CD1 . LEU D 1 149 ? 0.532   -84.074  14.361  1.00 24.39  ? 152  LEU D CD1 1 
ATOM   9144  C  CD2 . LEU D 1 149 ? -0.140  -83.196  12.145  1.00 25.53  ? 152  LEU D CD2 1 
ATOM   9145  N  N   . LEU D 1 150 ? -0.037  -79.741  11.984  1.00 25.39  ? 153  LEU D N   1 
ATOM   9146  C  CA  . LEU D 1 150 ? -1.072  -78.724  12.181  1.00 25.99  ? 153  LEU D CA  1 
ATOM   9147  C  C   . LEU D 1 150 ? -2.328  -79.352  12.755  1.00 25.94  ? 153  LEU D C   1 
ATOM   9148  O  O   . LEU D 1 150 ? -2.905  -80.241  12.138  1.00 25.59  ? 153  LEU D O   1 
ATOM   9149  C  CB  . LEU D 1 150 ? -1.413  -78.076  10.834  1.00 25.40  ? 153  LEU D CB  1 
ATOM   9150  C  CG  . LEU D 1 150 ? -1.872  -76.631  10.680  1.00 27.16  ? 153  LEU D CG  1 
ATOM   9151  C  CD1 . LEU D 1 150 ? -2.588  -76.466  9.336   1.00 25.80  ? 153  LEU D CD1 1 
ATOM   9152  C  CD2 . LEU D 1 150 ? -2.736  -76.128  11.824  1.00 25.87  ? 153  LEU D CD2 1 
ATOM   9153  N  N   . SER D 1 151 ? -2.773  -78.872  13.916  1.00 27.46  ? 154  SER D N   1 
ATOM   9154  C  CA  . SER D 1 151 ? -4.052  -79.317  14.476  1.00 26.39  ? 154  SER D CA  1 
ATOM   9155  C  C   . SER D 1 151 ? -5.198  -78.419  13.990  1.00 27.89  ? 154  SER D C   1 
ATOM   9156  O  O   . SER D 1 151 ? -5.086  -77.195  14.009  1.00 26.94  ? 154  SER D O   1 
ATOM   9157  C  CB  . SER D 1 151 ? -3.982  -79.352  15.999  1.00 25.28  ? 154  SER D CB  1 
ATOM   9158  O  OG  . SER D 1 151 ? -5.257  -79.638  16.538  1.00 25.15  ? 154  SER D OG  1 
ATOM   9159  N  N   . LEU D 1 152 ? -6.297  -79.027  13.550  1.00 28.21  ? 155  LEU D N   1 
ATOM   9160  C  CA  . LEU D 1 152 ? -7.389  -78.276  12.938  1.00 28.38  ? 155  LEU D CA  1 
ATOM   9161  C  C   . LEU D 1 152 ? -8.714  -78.618  13.584  1.00 28.40  ? 155  LEU D C   1 
ATOM   9162  O  O   . LEU D 1 152 ? -8.930  -79.750  13.960  1.00 27.61  ? 155  LEU D O   1 
ATOM   9163  C  CB  . LEU D 1 152 ? -7.479  -78.558  11.437  1.00 27.10  ? 155  LEU D CB  1 
ATOM   9164  C  CG  . LEU D 1 152 ? -6.329  -78.141  10.521  1.00 28.69  ? 155  LEU D CG  1 
ATOM   9165  C  CD1 . LEU D 1 152 ? -6.457  -78.814  9.149   1.00 28.72  ? 155  LEU D CD1 1 
ATOM   9166  C  CD2 . LEU D 1 152 ? -6.246  -76.620  10.366  1.00 27.51  ? 155  LEU D CD2 1 
ATOM   9167  N  N   . HIS D 1 153 ? -9.590  -77.618  13.687  1.00 28.82  ? 156  HIS D N   1 
ATOM   9168  C  CA  . HIS D 1 153 ? -10.900 -77.743  14.294  1.00 29.06  ? 156  HIS D CA  1 
ATOM   9169  C  C   . HIS D 1 153 ? -11.850 -77.106  13.341  1.00 32.57  ? 156  HIS D C   1 
ATOM   9170  O  O   . HIS D 1 153 ? -11.603 -76.007  12.841  1.00 34.89  ? 156  HIS D O   1 
ATOM   9171  C  CB  . HIS D 1 153 ? -10.967 -76.987  15.621  1.00 28.83  ? 156  HIS D CB  1 
ATOM   9172  C  CG  . HIS D 1 153 ? -10.029 -77.509  16.681  1.00 28.59  ? 156  HIS D CG  1 
ATOM   9173  N  ND1 . HIS D 1 153 ? -10.462 -78.200  17.749  1.00 29.27  ? 156  HIS D ND1 1 
ATOM   9174  C  CD2 . HIS D 1 153 ? -8.644  -77.418  16.808  1.00 29.23  ? 156  HIS D CD2 1 
ATOM   9175  C  CE1 . HIS D 1 153 ? -9.408  -78.528  18.536  1.00 29.26  ? 156  HIS D CE1 1 
ATOM   9176  N  NE2 . HIS D 1 153 ? -8.298  -78.053  17.959  1.00 29.03  ? 156  HIS D NE2 1 
ATOM   9177  N  N   . THR D 1 154 ? -12.950 -77.786  13.066  1.00 33.57  ? 157  THR D N   1 
ATOM   9178  C  CA  . THR D 1 154 ? -13.945 -77.266  12.161  1.00 33.51  ? 157  THR D CA  1 
ATOM   9179  C  C   . THR D 1 154 ? -15.146 -76.840  12.980  1.00 35.58  ? 157  THR D C   1 
ATOM   9180  O  O   . THR D 1 154 ? -15.309 -77.271  14.134  1.00 35.01  ? 157  THR D O   1 
ATOM   9181  C  CB  . THR D 1 154 ? -14.387 -78.331  11.143  1.00 33.67  ? 157  THR D CB  1 
ATOM   9182  O  OG1 . THR D 1 154 ? -15.204 -79.305  11.805  1.00 34.21  ? 157  THR D OG1 1 
ATOM   9183  C  CG2 . THR D 1 154 ? -13.178 -79.011  10.518  1.00 33.28  ? 157  THR D CG2 1 
ATOM   9184  N  N   . ALA D 1 155 ? -15.987 -76.003  12.374  1.00 36.67  ? 158  ALA D N   1 
ATOM   9185  C  CA  . ALA D 1 155 ? -17.190 -75.478  13.022  1.00 38.68  ? 158  ALA D CA  1 
ATOM   9186  C  C   . ALA D 1 155 ? -18.121 -76.586  13.526  1.00 39.91  ? 158  ALA D C   1 
ATOM   9187  O  O   . ALA D 1 155 ? -18.787 -76.423  14.552  1.00 41.84  ? 158  ALA D O   1 
ATOM   9188  C  CB  . ALA D 1 155 ? -17.931 -74.556  12.072  1.00 38.57  ? 158  ALA D CB  1 
ATOM   9189  N  N   . SER D 1 156 ? -18.150 -77.713  12.819  1.00 37.41  ? 159  SER D N   1 
ATOM   9190  C  CA  . SER D 1 156 ? -19.002 -78.832  13.212  1.00 38.61  ? 159  SER D CA  1 
ATOM   9191  C  C   . SER D 1 156 ? -18.415 -79.670  14.363  1.00 38.52  ? 159  SER D C   1 
ATOM   9192  O  O   . SER D 1 156 ? -18.970 -80.701  14.717  1.00 40.21  ? 159  SER D O   1 
ATOM   9193  C  CB  . SER D 1 156 ? -19.289 -79.729  12.002  1.00 38.14  ? 159  SER D CB  1 
ATOM   9194  O  OG  . SER D 1 156 ? -18.172 -80.557  11.724  1.00 36.17  ? 159  SER D OG  1 
ATOM   9195  N  N   . GLY D 1 157 ? -17.294 -79.234  14.930  1.00 38.80  ? 160  GLY D N   1 
ATOM   9196  C  CA  . GLY D 1 157 ? -16.673 -79.930  16.055  1.00 38.58  ? 160  GLY D CA  1 
ATOM   9197  C  C   . GLY D 1 157 ? -15.622 -80.972  15.698  1.00 40.62  ? 160  GLY D C   1 
ATOM   9198  O  O   . GLY D 1 157 ? -15.057 -81.615  16.583  1.00 41.26  ? 160  GLY D O   1 
ATOM   9199  N  N   . LEU D 1 158 ? -15.343 -81.158  14.412  1.00 39.35  ? 161  LEU D N   1 
ATOM   9200  C  CA  . LEU D 1 158 ? -14.335 -82.141  14.033  1.00 39.32  ? 161  LEU D CA  1 
ATOM   9201  C  C   . LEU D 1 158 ? -12.916 -81.626  14.325  1.00 39.21  ? 161  LEU D C   1 
ATOM   9202  O  O   . LEU D 1 158 ? -12.634 -80.422  14.201  1.00 38.64  ? 161  LEU D O   1 
ATOM   9203  C  CB  . LEU D 1 158 ? -14.487 -82.538  12.565  1.00 40.65  ? 161  LEU D CB  1 
ATOM   9204  C  CG  . LEU D 1 158 ? -13.496 -83.579  12.037  1.00 43.62  ? 161  LEU D CG  1 
ATOM   9205  C  CD1 . LEU D 1 158 ? -13.678 -84.909  12.749  1.00 44.77  ? 161  LEU D CD1 1 
ATOM   9206  C  CD2 . LEU D 1 158 ? -13.656 -83.756  10.538  1.00 44.08  ? 161  LEU D CD2 1 
ATOM   9207  N  N   . ARG D 1 159 ? -12.038 -82.544  14.720  1.00 35.37  ? 162  ARG D N   1 
ATOM   9208  C  CA  . ARG D 1 159 ? -10.648 -82.236  14.976  1.00 33.57  ? 162  ARG D CA  1 
ATOM   9209  C  C   . ARG D 1 159 ? -9.795  -83.158  14.129  1.00 32.30  ? 162  ARG D C   1 
ATOM   9210  O  O   . ARG D 1 159 ? -9.938  -84.374  14.200  1.00 33.72  ? 162  ARG D O   1 
ATOM   9211  C  CB  . ARG D 1 159 ? -10.318 -82.439  16.459  1.00 35.02  ? 162  ARG D CB  1 
ATOM   9212  C  CG  . ARG D 1 159 ? -9.115  -81.643  16.948  1.00 36.94  ? 162  ARG D CG  1 
ATOM   9213  C  CD  . ARG D 1 159 ? -7.841  -82.467  17.041  1.00 37.51  ? 162  ARG D CD  1 
ATOM   9214  N  NE  . ARG D 1 159 ? -6.736  -81.666  17.577  1.00 39.34  ? 162  ARG D NE  1 
ATOM   9215  C  CZ  . ARG D 1 159 ? -6.239  -81.760  18.813  1.00 37.42  ? 162  ARG D CZ  1 
ATOM   9216  N  NH1 . ARG D 1 159 ? -6.731  -82.636  19.670  1.00 35.77  ? 162  ARG D NH1 1 
ATOM   9217  N  NH2 . ARG D 1 159 ? -5.226  -80.979  19.189  1.00 36.02  ? 162  ARG D NH2 1 
ATOM   9218  N  N   . LEU D 1 160 ? -8.898  -82.590  13.330  1.00 29.50  ? 163  LEU D N   1 
ATOM   9219  C  CA  . LEU D 1 160 ? -8.055  -83.407  12.462  1.00 28.98  ? 163  LEU D CA  1 
ATOM   9220  C  C   . LEU D 1 160 ? -6.659  -82.808  12.340  1.00 26.96  ? 163  LEU D C   1 
ATOM   9221  O  O   . LEU D 1 160 ? -6.411  -81.721  12.844  1.00 25.41  ? 163  LEU D O   1 
ATOM   9222  C  CB  . LEU D 1 160 ? -8.722  -83.617  11.082  1.00 28.35  ? 163  LEU D CB  1 
ATOM   9223  C  CG  . LEU D 1 160 ? -8.722  -82.429  10.109  1.00 29.88  ? 163  LEU D CG  1 
ATOM   9224  C  CD1 . LEU D 1 160 ? -8.819  -82.913  8.666   1.00 29.45  ? 163  LEU D CD1 1 
ATOM   9225  C  CD2 . LEU D 1 160 ? -9.823  -81.412  10.426  1.00 29.05  ? 163  LEU D CD2 1 
ATOM   9226  N  N   . PHE D 1 161 ? -5.752  -83.529  11.688  1.00 26.66  ? 164  PHE D N   1 
ATOM   9227  C  CA  . PHE D 1 161 ? -4.367  -83.080  11.543  1.00 26.88  ? 164  PHE D CA  1 
ATOM   9228  C  C   . PHE D 1 161 ? -3.951  -82.960  10.096  1.00 26.73  ? 164  PHE D C   1 
ATOM   9229  O  O   . PHE D 1 161 ? -4.467  -83.661  9.218   1.00 26.17  ? 164  PHE D O   1 
ATOM   9230  C  CB  . PHE D 1 161 ? -3.406  -83.973  12.328  1.00 27.05  ? 164  PHE D CB  1 
ATOM   9231  C  CG  . PHE D 1 161 ? -3.745  -84.056  13.786  1.00 29.16  ? 164  PHE D CG  1 
ATOM   9232  C  CD1 . PHE D 1 161 ? -3.168  -83.176  14.701  1.00 29.73  ? 164  PHE D CD1 1 
ATOM   9233  C  CD2 . PHE D 1 161 ? -4.686  -84.975  14.241  1.00 28.69  ? 164  PHE D CD2 1 
ATOM   9234  C  CE1 . PHE D 1 161 ? -3.506  -83.229  16.044  1.00 29.30  ? 164  PHE D CE1 1 
ATOM   9235  C  CE2 . PHE D 1 161 ? -5.031  -85.034  15.583  1.00 30.37  ? 164  PHE D CE2 1 
ATOM   9236  C  CZ  . PHE D 1 161 ? -4.442  -84.157  16.487  1.00 30.88  ? 164  PHE D CZ  1 
ATOM   9237  N  N   . SER D 1 162 ? -3.006  -82.057  9.867   1.00 26.55  ? 165  SER D N   1 
ATOM   9238  C  CA  . SER D 1 162 ? -2.561  -81.681  8.542   1.00 24.65  ? 165  SER D CA  1 
ATOM   9239  C  C   . SER D 1 162 ? -1.046  -81.701  8.603   1.00 25.86  ? 165  SER D C   1 
ATOM   9240  O  O   . SER D 1 162 ? -0.447  -81.190  9.565   1.00 24.34  ? 165  SER D O   1 
ATOM   9241  C  CB  . SER D 1 162 ? -3.093  -80.285  8.251   1.00 25.68  ? 165  SER D CB  1 
ATOM   9242  O  OG  . SER D 1 162 ? -2.415  -79.651  7.186   1.00 29.36  ? 165  SER D OG  1 
ATOM   9243  N  N   . VAL D 1 163 ? -0.416  -82.330  7.615   1.00 25.22  ? 166  VAL D N   1 
ATOM   9244  C  CA  . VAL D 1 163 ? 1.037   -82.458  7.631   1.00 25.87  ? 166  VAL D CA  1 
ATOM   9245  C  C   . VAL D 1 163 ? 1.657   -81.536  6.614   1.00 25.64  ? 166  VAL D C   1 
ATOM   9246  O  O   . VAL D 1 163 ? 2.874   -81.360  6.568   1.00 28.66  ? 166  VAL D O   1 
ATOM   9247  C  CB  . VAL D 1 163 ? 1.495   -83.889  7.320   1.00 26.12  ? 166  VAL D CB  1 
ATOM   9248  C  CG1 . VAL D 1 163 ? 0.942   -84.846  8.371   1.00 25.68  ? 166  VAL D CG1 1 
ATOM   9249  C  CG2 . VAL D 1 163 ? 1.072   -84.292  5.914   1.00 24.55  ? 166  VAL D CG2 1 
ATOM   9250  N  N   . LEU D 1 164 ? 0.812   -80.948  5.790   1.00 25.27  ? 167  LEU D N   1 
ATOM   9251  C  CA  . LEU D 1 164 ? 1.292   -80.181  4.655   1.00 24.93  ? 167  LEU D CA  1 
ATOM   9252  C  C   . LEU D 1 164 ? 0.593   -78.822  4.502   1.00 24.03  ? 167  LEU D C   1 
ATOM   9253  O  O   . LEU D 1 164 ? 1.253   -77.796  4.516   1.00 27.08  ? 167  LEU D O   1 
ATOM   9254  C  CB  . LEU D 1 164 ? 1.186   -81.025  3.374   1.00 25.10  ? 167  LEU D CB  1 
ATOM   9255  C  CG  . LEU D 1 164 ? 1.446   -80.242  2.092   1.00 26.45  ? 167  LEU D CG  1 
ATOM   9256  C  CD1 . LEU D 1 164 ? 2.939   -79.914  1.953   1.00 24.40  ? 167  LEU D CD1 1 
ATOM   9257  C  CD2 . LEU D 1 164 ? 0.894   -81.050  0.917   1.00 27.46  ? 167  LEU D CD2 1 
ATOM   9258  N  N   . SER D 1 165 ? -0.727  -78.795  4.380   1.00 24.65  ? 168  SER D N   1 
ATOM   9259  C  CA  . SER D 1 165 ? -1.397  -77.531  4.085   1.00 25.22  ? 168  SER D CA  1 
ATOM   9260  C  C   . SER D 1 165 ? -2.908  -77.497  4.297   1.00 25.48  ? 168  SER D C   1 
ATOM   9261  O  O   . SER D 1 165 ? -3.590  -78.525  4.258   1.00 25.67  ? 168  SER D O   1 
ATOM   9262  C  CB  . SER D 1 165 ? -1.121  -77.137  2.631   1.00 24.98  ? 168  SER D CB  1 
ATOM   9263  O  OG  . SER D 1 165 ? -1.483  -78.202  1.792   1.00 24.96  ? 168  SER D OG  1 
ATOM   9264  N  N   . LEU D 1 166 ? -3.401  -76.279  4.513   1.00 25.80  ? 169  LEU D N   1 
ATOM   9265  C  CA  . LEU D 1 166 ? -4.806  -75.944  4.399   1.00 26.99  ? 169  LEU D CA  1 
ATOM   9266  C  C   . LEU D 1 166 ? -4.894  -74.814  3.382   1.00 26.81  ? 169  LEU D C   1 
ATOM   9267  O  O   . LEU D 1 166 ? -4.260  -73.763  3.546   1.00 25.68  ? 169  LEU D O   1 
ATOM   9268  C  CB  . LEU D 1 166 ? -5.417  -75.478  5.729   1.00 28.17  ? 169  LEU D CB  1 
ATOM   9269  C  CG  . LEU D 1 166 ? -6.906  -75.150  5.500   1.00 30.32  ? 169  LEU D CG  1 
ATOM   9270  C  CD1 . LEU D 1 166 ? -7.819  -76.323  5.813   1.00 29.64  ? 169  LEU D CD1 1 
ATOM   9271  C  CD2 . LEU D 1 166 ? -7.386  -73.902  6.220   1.00 29.32  ? 169  LEU D CD2 1 
ATOM   9272  N  N   . ALA D 1 167 ? -5.668  -75.051  2.330   1.00 26.93  ? 170  ALA D N   1 
ATOM   9273  C  CA  . ALA D 1 167 ? -5.878  -74.053  1.304   1.00 28.19  ? 170  ALA D CA  1 
ATOM   9274  C  C   . ALA D 1 167 ? -7.335  -73.697  1.256   1.00 28.22  ? 170  ALA D C   1 
ATOM   9275  O  O   . ALA D 1 167 ? -8.197  -74.566  1.416   1.00 28.29  ? 170  ALA D O   1 
ATOM   9276  C  CB  . ALA D 1 167 ? -5.425  -74.572  -0.042  1.00 29.55  ? 170  ALA D CB  1 
ATOM   9277  N  N   . TRP D 1 168 ? -7.600  -72.412  1.051   1.00 29.12  ? 171  TRP D N   1 
ATOM   9278  C  CA  . TRP D 1 168 ? -8.950  -71.921  0.818   1.00 31.23  ? 171  TRP D CA  1 
ATOM   9279  C  C   . TRP D 1 168 ? -8.956  -70.982  -0.346  1.00 32.21  ? 171  TRP D C   1 
ATOM   9280  O  O   . TRP D 1 168 ? -7.971  -70.265  -0.586  1.00 32.99  ? 171  TRP D O   1 
ATOM   9281  C  CB  . TRP D 1 168 ? -9.449  -71.190  2.051   1.00 30.77  ? 171  TRP D CB  1 
ATOM   9282  C  CG  . TRP D 1 168 ? -10.830 -70.602  1.924   1.00 29.64  ? 171  TRP D CG  1 
ATOM   9283  C  CD1 . TRP D 1 168 ? -12.039 -71.286  1.781   1.00 30.92  ? 171  TRP D CD1 1 
ATOM   9284  C  CD2 . TRP D 1 168 ? -11.195 -69.186  1.955   1.00 29.53  ? 171  TRP D CD2 1 
ATOM   9285  N  NE1 . TRP D 1 168 ? -13.093 -70.410  1.717   1.00 29.53  ? 171  TRP D NE1 1 
ATOM   9286  C  CE2 . TRP D 1 168 ? -12.654 -69.134  1.831   1.00 29.96  ? 171  TRP D CE2 1 
ATOM   9287  C  CE3 . TRP D 1 168 ? -10.488 -67.999  2.088   1.00 30.57  ? 171  TRP D CE3 1 
ATOM   9288  C  CZ2 . TRP D 1 168 ? -13.348 -67.933  1.833   1.00 29.90  ? 171  TRP D CZ2 1 
ATOM   9289  C  CZ3 . TRP D 1 168 ? -11.201 -66.800  2.096   1.00 32.71  ? 171  TRP D CZ3 1 
ATOM   9290  C  CH2 . TRP D 1 168 ? -12.598 -66.770  1.964   1.00 31.10  ? 171  TRP D CH2 1 
ATOM   9291  N  N   . GLY D 1 169 ? -10.070 -70.962  -1.070  1.00 32.27  ? 172  GLY D N   1 
ATOM   9292  C  CA  . GLY D 1 169 ? -10.216 -70.056  -2.196  1.00 35.57  ? 172  GLY D CA  1 
ATOM   9293  C  C   . GLY D 1 169 ? -9.704  -70.646  -3.497  1.00 35.42  ? 172  GLY D C   1 
ATOM   9294  O  O   . GLY D 1 169 ? -9.996  -71.796  -3.817  1.00 33.92  ? 172  GLY D O   1 
ATOM   9295  N  N   . PHE D 1 170 ? -8.938  -69.845  -4.236  1.00 39.03  ? 173  PHE D N   1 
ATOM   9296  C  CA  . PHE D 1 170 ? -8.440  -70.222  -5.573  1.00 42.39  ? 173  PHE D CA  1 
ATOM   9297  C  C   . PHE D 1 170 ? -7.798  -71.610  -5.597  1.00 39.63  ? 173  PHE D C   1 
ATOM   9298  O  O   . PHE D 1 170 ? -8.220  -72.485  -6.352  1.00 40.10  ? 173  PHE D O   1 
ATOM   9299  C  CB  . PHE D 1 170 ? -7.453  -69.163  -6.110  1.00 43.94  ? 173  PHE D CB  1 
ATOM   9300  C  CG  . PHE D 1 170 ? -7.064  -69.359  -7.553  1.00 48.40  ? 173  PHE D CG  1 
ATOM   9301  C  CD1 . PHE D 1 170 ? -6.009  -70.204  -7.902  1.00 49.00  ? 173  PHE D CD1 1 
ATOM   9302  C  CD2 . PHE D 1 170 ? -7.749  -68.691  -8.571  1.00 51.88  ? 173  PHE D CD2 1 
ATOM   9303  C  CE1 . PHE D 1 170 ? -5.653  -70.387  -9.228  1.00 49.47  ? 173  PHE D CE1 1 
ATOM   9304  C  CE2 . PHE D 1 170 ? -7.396  -68.870  -9.903  1.00 52.09  ? 173  PHE D CE2 1 
ATOM   9305  C  CZ  . PHE D 1 170 ? -6.345  -69.719  -10.231 1.00 51.33  ? 173  PHE D CZ  1 
ATOM   9306  N  N   . ILE D 1 171 ? -6.780  -71.801  -4.763  1.00 41.82  ? 174  ILE D N   1 
ATOM   9307  C  CA  . ILE D 1 171 ? -6.035  -73.063  -4.713  1.00 41.47  ? 174  ILE D CA  1 
ATOM   9308  C  C   . ILE D 1 171 ? -6.947  -74.245  -4.419  1.00 41.04  ? 174  ILE D C   1 
ATOM   9309  O  O   . ILE D 1 171 ? -6.805  -75.294  -5.032  1.00 43.07  ? 174  ILE D O   1 
ATOM   9310  C  CB  . ILE D 1 171 ? -4.878  -72.997  -3.699  1.00 40.32  ? 174  ILE D CB  1 
ATOM   9311  C  CG1 . ILE D 1 171 ? -3.861  -71.949  -4.132  1.00 39.29  ? 174  ILE D CG1 1 
ATOM   9312  C  CG2 . ILE D 1 171 ? -4.207  -74.357  -3.537  1.00 40.40  ? 174  ILE D CG2 1 
ATOM   9313  C  CD1 . ILE D 1 171 ? -2.951  -71.486  -3.013  1.00 41.58  ? 174  ILE D CD1 1 
ATOM   9314  N  N   . ALA D 1 172 ? -7.890  -74.069  -3.499  1.00 41.15  ? 175  ALA D N   1 
ATOM   9315  C  CA  . ALA D 1 172 ? -8.814  -75.154  -3.149  1.00 42.14  ? 175  ALA D CA  1 
ATOM   9316  C  C   . ALA D 1 172 ? -9.779  -75.448  -4.281  1.00 42.03  ? 175  ALA D C   1 
ATOM   9317  O  O   . ALA D 1 172 ? -10.109 -76.604  -4.548  1.00 39.95  ? 175  ALA D O   1 
ATOM   9318  C  CB  . ALA D 1 172 ? -9.582  -74.825  -1.879  1.00 40.70  ? 175  ALA D CB  1 
ATOM   9319  N  N   . ASP D 1 173 ? -10.240 -74.392  -4.937  1.00 44.82  ? 176  ASP D N   1 
ATOM   9320  C  CA  . ASP D 1 173 ? -11.158 -74.542  -6.064  1.00 49.19  ? 176  ASP D CA  1 
ATOM   9321  C  C   . ASP D 1 173 ? -10.535 -75.369  -7.195  1.00 50.53  ? 176  ASP D C   1 
ATOM   9322  O  O   . ASP D 1 173 ? -11.140 -76.334  -7.665  1.00 50.55  ? 176  ASP D O   1 
ATOM   9323  C  CB  . ASP D 1 173 ? -11.629 -73.175  -6.560  1.00 50.90  ? 176  ASP D CB  1 
ATOM   9324  C  CG  . ASP D 1 173 ? -12.892 -72.697  -5.854  1.00 54.65  ? 176  ASP D CG  1 
ATOM   9325  O  OD1 . ASP D 1 173 ? -13.470 -73.457  -5.041  1.00 54.66  ? 176  ASP D OD1 1 
ATOM   9326  O  OD2 . ASP D 1 173 ? -13.320 -71.554  -6.129  1.00 58.08  ? 176  ASP D OD2 1 
ATOM   9327  N  N   . VAL D 1 174 ? -9.316  -74.995  -7.593  1.00 50.80  ? 177  VAL D N   1 
ATOM   9328  C  CA  . VAL D 1 174 ? -8.531  -75.720  -8.601  1.00 50.47  ? 177  VAL D CA  1 
ATOM   9329  C  C   . VAL D 1 174 ? -8.244  -77.162  -8.167  1.00 50.17  ? 177  VAL D C   1 
ATOM   9330  O  O   . VAL D 1 174 ? -8.283  -78.075  -8.983  1.00 52.40  ? 177  VAL D O   1 
ATOM   9331  C  CB  . VAL D 1 174 ? -7.205  -74.977  -8.926  1.00 48.87  ? 177  VAL D CB  1 
ATOM   9332  C  CG1 . VAL D 1 174 ? -6.342  -75.770  -9.898  1.00 51.74  ? 177  VAL D CG1 1 
ATOM   9333  C  CG2 . VAL D 1 174 ? -7.484  -73.604  -9.502  1.00 47.41  ? 177  VAL D CG2 1 
ATOM   9334  N  N   . ASP D 1 175 ? -7.967  -77.363  -6.883  1.00 51.83  ? 178  ASP D N   1 
ATOM   9335  C  CA  . ASP D 1 175 ? -7.715  -78.705  -6.360  1.00 54.37  ? 178  ASP D CA  1 
ATOM   9336  C  C   . ASP D 1 175 ? -8.926  -79.596  -6.534  1.00 56.11  ? 178  ASP D C   1 
ATOM   9337  O  O   . ASP D 1 175 ? -8.784  -80.777  -6.824  1.00 59.42  ? 178  ASP D O   1 
ATOM   9338  C  CB  . ASP D 1 175 ? -7.313  -78.659  -4.886  1.00 53.96  ? 178  ASP D CB  1 
ATOM   9339  C  CG  . ASP D 1 175 ? -5.811  -78.634  -4.692  1.00 57.14  ? 178  ASP D CG  1 
ATOM   9340  O  OD1 . ASP D 1 175 ? -5.330  -79.287  -3.742  1.00 60.14  ? 178  ASP D OD1 1 
ATOM   9341  O  OD2 . ASP D 1 175 ? -5.101  -77.979  -5.485  1.00 55.52  ? 178  ASP D OD2 1 
ATOM   9342  N  N   . LEU D 1 176 ? -10.112 -79.018  -6.354  1.00 60.56  ? 179  LEU D N   1 
ATOM   9343  C  CA  . LEU D 1 176 ? -11.370 -79.745  -6.508  1.00 64.14  ? 179  LEU D CA  1 
ATOM   9344  C  C   . LEU D 1 176 ? -11.671 -79.993  -7.986  1.00 67.42  ? 179  LEU D C   1 
ATOM   9345  O  O   . LEU D 1 176 ? -11.828 -81.147  -8.392  1.00 67.22  ? 179  LEU D O   1 
ATOM   9346  C  CB  . LEU D 1 176 ? -12.531 -79.005  -5.811  1.00 63.72  ? 179  LEU D CB  1 
ATOM   9347  C  CG  . LEU D 1 176 ? -13.979 -79.546  -5.713  1.00 62.38  ? 179  LEU D CG  1 
ATOM   9348  C  CD1 . LEU D 1 176 ? -14.816 -79.158  -6.927  1.00 62.84  ? 179  LEU D CD1 1 
ATOM   9349  C  CD2 . LEU D 1 176 ? -14.058 -81.050  -5.463  1.00 56.87  ? 179  LEU D CD2 1 
ATOM   9350  N  N   . GLU D 1 177 ? -11.736 -78.922  -8.782  1.00 70.95  ? 180  GLU D N   1 
ATOM   9351  C  CA  . GLU D 1 177 ? -11.979 -79.047  -10.222 1.00 76.09  ? 180  GLU D CA  1 
ATOM   9352  C  C   . GLU D 1 177 ? -10.776 -79.697  -10.927 1.00 73.79  ? 180  GLU D C   1 
ATOM   9353  O  O   . GLU D 1 177 ? -10.127 -79.087  -11.776 1.00 71.58  ? 180  GLU D O   1 
ATOM   9354  C  CB  . GLU D 1 177 ? -12.336 -77.691  -10.850 1.00 82.34  ? 180  GLU D CB  1 
ATOM   9355  C  CG  . GLU D 1 177 ? -13.085 -77.814  -12.179 1.00 95.54  ? 180  GLU D CG  1 
ATOM   9356  C  CD  . GLU D 1 177 ? -13.149 -76.516  -12.978 1.00 100.01 ? 180  GLU D CD  1 
ATOM   9357  O  OE1 . GLU D 1 177 ? -13.750 -75.533  -12.493 1.00 103.89 ? 180  GLU D OE1 1 
ATOM   9358  O  OE2 . GLU D 1 177 ? -12.616 -76.483  -14.109 1.00 97.30  ? 180  GLU D OE2 1 
ATOM   9359  N  N   . SER D 1 178 ? -10.487 -80.940  -10.550 1.00 70.63  ? 181  SER D N   1 
ATOM   9360  C  CA  . SER D 1 178 ? -9.362  -81.687  -11.083 1.00 69.22  ? 181  SER D CA  1 
ATOM   9361  C  C   . SER D 1 178 ? -9.637  -83.177  -10.935 1.00 72.53  ? 181  SER D C   1 
ATOM   9362  O  O   . SER D 1 178 ? -9.839  -83.684  -9.827  1.00 73.17  ? 181  SER D O   1 
ATOM   9363  C  CB  . SER D 1 178 ? -8.064  -81.288  -10.379 1.00 69.72  ? 181  SER D CB  1 
ATOM   9364  O  OG  . SER D 1 178 ? -7.671  -79.968  -10.730 1.00 63.57  ? 181  SER D OG  1 
ATOM   9365  N  N   . GLU D 1 179 ? -9.664  -83.862  -12.075 1.00 75.89  ? 182  GLU D N   1 
ATOM   9366  C  CA  . GLU D 1 179 ? -10.030 -85.272  -12.152 1.00 76.56  ? 182  GLU D CA  1 
ATOM   9367  C  C   . GLU D 1 179 ? -9.244  -85.968  -13.284 1.00 82.31  ? 182  GLU D C   1 
ATOM   9368  O  O   . GLU D 1 179 ? -9.762  -86.839  -14.001 1.00 82.80  ? 182  GLU D O   1 
ATOM   9369  C  CB  . GLU D 1 179 ? -11.557 -85.399  -12.327 1.00 77.05  ? 182  GLU D CB  1 
ATOM   9370  C  CG  . GLU D 1 179 ? -12.115 -85.279  -13.749 1.00 72.68  ? 182  GLU D CG  1 
ATOM   9371  C  CD  . GLU D 1 179 ? -11.947 -83.909  -14.376 1.00 71.52  ? 182  GLU D CD  1 
ATOM   9372  O  OE1 . GLU D 1 179 ? -10.795 -83.497  -14.615 1.00 73.27  ? 182  GLU D OE1 1 
ATOM   9373  O  OE2 . GLU D 1 179 ? -12.970 -83.254  -14.663 1.00 68.15  ? 182  GLU D OE2 1 
ATOM   9374  N  N   . LYS D 1 180 ? -7.977  -85.584  -13.421 1.00 81.17  ? 183  LYS D N   1 
ATOM   9375  C  CA  . LYS D 1 180 ? -7.167  -85.990  -14.564 1.00 78.44  ? 183  LYS D CA  1 
ATOM   9376  C  C   . LYS D 1 180 ? -5.865  -86.671  -14.140 1.00 81.23  ? 183  LYS D C   1 
ATOM   9377  O  O   . LYS D 1 180 ? -5.421  -86.529  -13.001 1.00 82.05  ? 183  LYS D O   1 
ATOM   9378  C  CB  . LYS D 1 180 ? -6.864  -84.771  -15.447 1.00 73.07  ? 183  LYS D CB  1 
ATOM   9379  C  CG  . LYS D 1 180 ? -7.843  -83.622  -15.267 1.00 65.74  ? 183  LYS D CG  1 
ATOM   9380  C  CD  . LYS D 1 180 ? -7.981  -82.765  -16.510 1.00 64.28  ? 183  LYS D CD  1 
ATOM   9381  C  CE  . LYS D 1 180 ? -8.845  -81.551  -16.210 1.00 62.13  ? 183  LYS D CE  1 
ATOM   9382  N  NZ  . LYS D 1 180 ? -9.485  -81.009  -17.436 1.00 60.52  ? 183  LYS D NZ  1 
ATOM   9383  N  N   . TYR D 1 181 ? -5.283  -87.439  -15.059 1.00 84.43  ? 184  TYR D N   1 
ATOM   9384  C  CA  . TYR D 1 181 ? -3.904  -87.910  -14.924 1.00 88.66  ? 184  TYR D CA  1 
ATOM   9385  C  C   . TYR D 1 181 ? -2.965  -86.953  -15.660 1.00 84.06  ? 184  TYR D C   1 
ATOM   9386  O  O   . TYR D 1 181 ? -1.917  -86.579  -15.130 1.00 79.21  ? 184  TYR D O   1 
ATOM   9387  C  CB  . TYR D 1 181 ? -3.740  -89.351  -15.432 1.00 99.44  ? 184  TYR D CB  1 
ATOM   9388  C  CG  . TYR D 1 181 ? -4.875  -89.854  -16.310 1.00 112.64 ? 184  TYR D CG  1 
ATOM   9389  C  CD1 . TYR D 1 181 ? -5.875  -90.681  -15.783 1.00 115.46 ? 184  TYR D CD1 1 
ATOM   9390  C  CD2 . TYR D 1 181 ? -4.952  -89.508  -17.664 1.00 116.20 ? 184  TYR D CD2 1 
ATOM   9391  C  CE1 . TYR D 1 181 ? -6.917  -91.145  -16.578 1.00 118.36 ? 184  TYR D CE1 1 
ATOM   9392  C  CE2 . TYR D 1 181 ? -5.991  -89.968  -18.466 1.00 117.50 ? 184  TYR D CE2 1 
ATOM   9393  C  CZ  . TYR D 1 181 ? -6.969  -90.785  -17.919 1.00 117.96 ? 184  TYR D CZ  1 
ATOM   9394  O  OH  . TYR D 1 181 ? -7.998  -91.241  -18.710 1.00 113.43 ? 184  TYR D OH  1 
ATOM   9395  N  N   . ARG D 1 182 ? -3.371  -86.556  -16.867 1.00 79.75  ? 185  ARG D N   1 
ATOM   9396  C  CA  . ARG D 1 182 ? -2.680  -85.554  -17.690 1.00 80.46  ? 185  ARG D CA  1 
ATOM   9397  C  C   . ARG D 1 182 ? -1.339  -85.078  -17.125 1.00 80.24  ? 185  ARG D C   1 
ATOM   9398  O  O   . ARG D 1 182 ? -1.288  -84.285  -16.183 1.00 79.68  ? 185  ARG D O   1 
ATOM   9399  C  CB  . ARG D 1 182 ? -3.602  -84.370  -17.970 1.00 78.31  ? 185  ARG D CB  1 
ATOM   9400  N  N   . MET D 1 187 ? 0.859   -80.597  -15.534 1.00 52.01  ? 190  MET D N   1 
ATOM   9401  C  CA  . MET D 1 187 ? -0.060  -81.180  -14.560 1.00 51.34  ? 190  MET D CA  1 
ATOM   9402  C  C   . MET D 1 187 ? -1.453  -80.558  -14.617 1.00 48.91  ? 190  MET D C   1 
ATOM   9403  O  O   . MET D 1 187 ? -1.647  -79.450  -15.140 1.00 43.32  ? 190  MET D O   1 
ATOM   9404  C  CB  . MET D 1 187 ? 0.502   -81.083  -13.126 1.00 53.62  ? 190  MET D CB  1 
ATOM   9405  C  CG  . MET D 1 187 ? 1.139   -82.373  -12.611 1.00 57.64  ? 190  MET D CG  1 
ATOM   9406  S  SD  . MET D 1 187 ? 0.018   -83.787  -12.755 1.00 61.54  ? 190  MET D SD  1 
ATOM   9407  C  CE  . MET D 1 187 ? 1.131   -85.166  -12.490 1.00 63.59  ? 190  MET D CE  1 
ATOM   9408  N  N   . ARG D 1 188 ? -2.418  -81.290  -14.066 1.00 49.78  ? 191  ARG D N   1 
ATOM   9409  C  CA  . ARG D 1 188 ? -3.791  -80.809  -13.907 1.00 48.97  ? 191  ARG D CA  1 
ATOM   9410  C  C   . ARG D 1 188 ? -3.862  -79.437  -13.237 1.00 48.15  ? 191  ARG D C   1 
ATOM   9411  O  O   . ARG D 1 188 ? -4.748  -78.633  -13.542 1.00 46.10  ? 191  ARG D O   1 
ATOM   9412  C  CB  . ARG D 1 188 ? -4.605  -81.819  -13.104 1.00 52.39  ? 191  ARG D CB  1 
ATOM   9413  C  CG  . ARG D 1 188 ? -3.839  -82.483  -11.971 1.00 55.02  ? 191  ARG D CG  1 
ATOM   9414  C  CD  . ARG D 1 188 ? -4.574  -83.716  -11.497 1.00 57.69  ? 191  ARG D CD  1 
ATOM   9415  N  NE  . ARG D 1 188 ? -4.168  -84.138  -10.159 1.00 60.24  ? 191  ARG D NE  1 
ATOM   9416  C  CZ  . ARG D 1 188 ? -4.801  -83.809  -9.034  1.00 62.96  ? 191  ARG D CZ  1 
ATOM   9417  N  NH1 . ARG D 1 188 ? -5.876  -83.028  -9.061  1.00 62.52  ? 191  ARG D NH1 1 
ATOM   9418  N  NH2 . ARG D 1 188 ? -4.353  -84.263  -7.870  1.00 65.66  ? 191  ARG D NH2 1 
ATOM   9419  N  N   . PHE D 1 189 ? -2.905  -79.175  -12.348 1.00 46.51  ? 192  PHE D N   1 
ATOM   9420  C  CA  . PHE D 1 189 ? -2.887  -77.945  -11.562 1.00 45.67  ? 192  PHE D CA  1 
ATOM   9421  C  C   . PHE D 1 189 ? -2.641  -76.717  -12.416 1.00 42.99  ? 192  PHE D C   1 
ATOM   9422  O  O   . PHE D 1 189 ? -3.313  -75.714  -12.231 1.00 44.91  ? 192  PHE D O   1 
ATOM   9423  C  CB  . PHE D 1 189 ? -1.871  -78.030  -10.401 1.00 46.34  ? 192  PHE D CB  1 
ATOM   9424  C  CG  . PHE D 1 189 ? -2.132  -79.170  -9.449  1.00 44.85  ? 192  PHE D CG  1 
ATOM   9425  C  CD1 . PHE D 1 189 ? -3.324  -79.232  -8.721  1.00 43.47  ? 192  PHE D CD1 1 
ATOM   9426  C  CD2 . PHE D 1 189 ? -1.193  -80.183  -9.286  1.00 44.15  ? 192  PHE D CD2 1 
ATOM   9427  C  CE1 . PHE D 1 189 ? -3.575  -80.289  -7.862  1.00 43.91  ? 192  PHE D CE1 1 
ATOM   9428  C  CE2 . PHE D 1 189 ? -1.437  -81.241  -8.420  1.00 44.07  ? 192  PHE D CE2 1 
ATOM   9429  C  CZ  . PHE D 1 189 ? -2.630  -81.293  -7.709  1.00 44.31  ? 192  PHE D CZ  1 
ATOM   9430  N  N   . THR D 1 190 ? -1.696  -76.791  -13.348 1.00 42.16  ? 193  THR D N   1 
ATOM   9431  C  CA  . THR D 1 190 ? -1.462  -75.672  -14.277 1.00 42.24  ? 193  THR D CA  1 
ATOM   9432  C  C   . THR D 1 190 ? -2.702  -75.370  -15.136 1.00 41.86  ? 193  THR D C   1 
ATOM   9433  O  O   . THR D 1 190 ? -3.096  -74.213  -15.288 1.00 44.71  ? 193  THR D O   1 
ATOM   9434  C  CB  . THR D 1 190 ? -0.224  -75.895  -15.165 1.00 43.34  ? 193  THR D CB  1 
ATOM   9435  O  OG1 . THR D 1 190 ? 0.915   -76.142  -14.336 1.00 45.50  ? 193  THR D OG1 1 
ATOM   9436  C  CG2 . THR D 1 190 ? 0.060   -74.660  -16.031 1.00 44.73  ? 193  THR D CG2 1 
ATOM   9437  N  N   . LEU D 1 191 ? -3.323  -76.413  -15.667 1.00 39.76  ? 194  LEU D N   1 
ATOM   9438  C  CA  . LEU D 1 191 ? -4.533  -76.271  -16.456 1.00 41.30  ? 194  LEU D CA  1 
ATOM   9439  C  C   . LEU D 1 191 ? -5.687  -75.677  -15.630 1.00 43.09  ? 194  LEU D C   1 
ATOM   9440  O  O   . LEU D 1 191 ? -6.265  -74.635  -15.995 1.00 42.94  ? 194  LEU D O   1 
ATOM   9441  C  CB  . LEU D 1 191 ? -4.911  -77.624  -17.071 1.00 41.59  ? 194  LEU D CB  1 
ATOM   9442  C  CG  . LEU D 1 191 ? -6.148  -77.729  -17.972 1.00 44.43  ? 194  LEU D CG  1 
ATOM   9443  C  CD1 . LEU D 1 191 ? -6.149  -76.714  -19.117 1.00 43.69  ? 194  LEU D CD1 1 
ATOM   9444  C  CD2 . LEU D 1 191 ? -6.266  -79.155  -18.497 1.00 45.22  ? 194  LEU D CD2 1 
ATOM   9445  N  N   . GLY D 1 192 ? -6.009  -76.336  -14.518 1.00 42.88  ? 195  GLY D N   1 
ATOM   9446  C  CA  . GLY D 1 192 ? -7.022  -75.838  -13.592 1.00 42.62  ? 195  GLY D CA  1 
ATOM   9447  C  C   . GLY D 1 192 ? -6.764  -74.392  -13.210 1.00 42.26  ? 195  GLY D C   1 
ATOM   9448  O  O   . GLY D 1 192 ? -7.677  -73.569  -13.176 1.00 42.33  ? 195  GLY D O   1 
ATOM   9449  N  N   . THR D 1 193 ? -5.504  -74.083  -12.941 1.00 41.40  ? 196  THR D N   1 
ATOM   9450  C  CA  . THR D 1 193 ? -5.104  -72.717  -12.659 1.00 43.59  ? 196  THR D CA  1 
ATOM   9451  C  C   . THR D 1 193 ? -5.375  -71.766  -13.833 1.00 45.46  ? 196  THR D C   1 
ATOM   9452  O  O   . THR D 1 193 ? -5.772  -70.624  -13.589 1.00 43.54  ? 196  THR D O   1 
ATOM   9453  C  CB  . THR D 1 193 ? -3.631  -72.641  -12.210 1.00 42.50  ? 196  THR D CB  1 
ATOM   9454  O  OG1 . THR D 1 193 ? -3.489  -73.307  -10.947 1.00 45.20  ? 196  THR D OG1 1 
ATOM   9455  C  CG2 . THR D 1 193 ? -3.159  -71.201  -12.076 1.00 40.17  ? 196  THR D CG2 1 
ATOM   9456  N  N   . PHE D 1 194 ? -5.180  -72.203  -15.087 1.00 49.20  ? 197  PHE D N   1 
ATOM   9457  C  CA  . PHE D 1 194 ? -5.510  -71.287  -16.195 1.00 53.49  ? 197  PHE D CA  1 
ATOM   9458  C  C   . PHE D 1 194 ? -7.004  -71.053  -16.382 1.00 50.13  ? 197  PHE D C   1 
ATOM   9459  O  O   . PHE D 1 194 ? -7.423  -69.894  -16.490 1.00 48.52  ? 197  PHE D O   1 
ATOM   9460  C  CB  . PHE D 1 194 ? -4.851  -71.573  -17.562 1.00 62.56  ? 197  PHE D CB  1 
ATOM   9461  C  CG  . PHE D 1 194 ? -5.478  -70.763  -18.698 1.00 73.23  ? 197  PHE D CG  1 
ATOM   9462  C  CD1 . PHE D 1 194 ? -5.591  -69.359  -18.607 1.00 76.29  ? 197  PHE D CD1 1 
ATOM   9463  C  CD2 . PHE D 1 194 ? -6.010  -71.387  -19.827 1.00 77.95  ? 197  PHE D CD2 1 
ATOM   9464  C  CE1 . PHE D 1 194 ? -6.200  -68.611  -19.612 1.00 73.54  ? 197  PHE D CE1 1 
ATOM   9465  C  CE2 . PHE D 1 194 ? -6.607  -70.635  -20.841 1.00 79.42  ? 197  PHE D CE2 1 
ATOM   9466  C  CZ  . PHE D 1 194 ? -6.701  -69.251  -20.733 1.00 76.53  ? 197  PHE D CZ  1 
ATOM   9467  N  N   . LEU D 1 195 ? -7.809  -72.115  -16.444 1.00 47.72  ? 198  LEU D N   1 
ATOM   9468  C  CA  . LEU D 1 195 ? -9.231  -71.866  -16.688 1.00 50.71  ? 198  LEU D CA  1 
ATOM   9469  C  C   . LEU D 1 195 ? -9.869  -71.020  -15.573 1.00 51.29  ? 198  LEU D C   1 
ATOM   9470  O  O   . LEU D 1 195 ? -10.535 -70.013  -15.857 1.00 50.87  ? 198  LEU D O   1 
ATOM   9471  C  CB  . LEU D 1 195 ? -10.054 -73.114  -17.095 1.00 51.92  ? 198  LEU D CB  1 
ATOM   9472  C  CG  . LEU D 1 195 ? -10.179 -74.530  -16.500 1.00 49.68  ? 198  LEU D CG  1 
ATOM   9473  C  CD1 . LEU D 1 195 ? -9.289  -75.531  -17.220 1.00 44.77  ? 198  LEU D CD1 1 
ATOM   9474  C  CD2 . LEU D 1 195 ? -9.997  -74.604  -14.993 1.00 50.59  ? 198  LEU D CD2 1 
ATOM   9475  N  N   . ARG D 1 196 ? -9.596  -71.380  -14.321 1.00 52.29  ? 199  ARG D N   1 
ATOM   9476  C  CA  . ARG D 1 196 ? -10.080 -70.613  -13.176 1.00 54.86  ? 199  ARG D CA  1 
ATOM   9477  C  C   . ARG D 1 196 ? -9.540  -69.184  -13.141 1.00 53.73  ? 199  ARG D C   1 
ATOM   9478  O  O   . ARG D 1 196 ? -10.140 -68.313  -12.521 1.00 54.28  ? 199  ARG D O   1 
ATOM   9479  C  CB  . ARG D 1 196 ? -9.773  -71.332  -11.856 1.00 58.77  ? 199  ARG D CB  1 
ATOM   9480  C  CG  . ARG D 1 196 ? -10.859 -72.308  -11.419 1.00 66.82  ? 199  ARG D CG  1 
ATOM   9481  C  CD  . ARG D 1 196 ? -12.051 -71.587  -10.782 1.00 68.56  ? 199  ARG D CD  1 
ATOM   9482  N  NE  . ARG D 1 196 ? -13.161 -72.441  -10.310 1.00 69.84  ? 199  ARG D NE  1 
ATOM   9483  C  CZ  . ARG D 1 196 ? -13.136 -73.767  -10.123 1.00 68.21  ? 199  ARG D CZ  1 
ATOM   9484  N  NH1 . ARG D 1 196 ? -12.047 -74.489  -10.363 1.00 63.36  ? 199  ARG D NH1 1 
ATOM   9485  N  NH2 . ARG D 1 196 ? -14.230 -74.384  -9.693  1.00 65.02  ? 199  ARG D NH2 1 
ATOM   9486  N  N   . LEU D 1 197 ? -8.415  -68.945  -13.805 1.00 53.21  ? 200  LEU D N   1 
ATOM   9487  C  CA  . LEU D 1 197 ? -7.816  -67.610  -13.852 1.00 55.37  ? 200  LEU D CA  1 
ATOM   9488  C  C   . LEU D 1 197 ? -8.568  -66.688  -14.816 1.00 55.34  ? 200  LEU D C   1 
ATOM   9489  O  O   . LEU D 1 197 ? -8.515  -65.463  -14.693 1.00 54.30  ? 200  LEU D O   1 
ATOM   9490  C  CB  . LEU D 1 197 ? -6.342  -67.717  -14.247 1.00 58.10  ? 200  LEU D CB  1 
ATOM   9491  C  CG  . LEU D 1 197 ? -5.315  -66.628  -13.935 1.00 60.96  ? 200  LEU D CG  1 
ATOM   9492  C  CD1 . LEU D 1 197 ? -5.372  -66.174  -12.484 1.00 59.32  ? 200  LEU D CD1 1 
ATOM   9493  C  CD2 . LEU D 1 197 ? -3.938  -67.191  -14.248 1.00 58.25  ? 200  LEU D CD2 1 
ATOM   9494  N  N   . ALA D 1 198 ? -9.261  -67.290  -15.778 1.00 57.03  ? 201  ALA D N   1 
ATOM   9495  C  CA  . ALA D 1 198 ? -10.130 -66.555  -16.694 1.00 55.79  ? 201  ALA D CA  1 
ATOM   9496  C  C   . ALA D 1 198 ? -11.530 -66.487  -16.108 1.00 55.35  ? 201  ALA D C   1 
ATOM   9497  O  O   . ALA D 1 198 ? -12.253 -65.524  -16.351 1.00 53.85  ? 201  ALA D O   1 
ATOM   9498  C  CB  . ALA D 1 198 ? -10.161 -67.223  -18.060 1.00 54.09  ? 201  ALA D CB  1 
ATOM   9499  N  N   . ALA D 1 199 ? -11.907 -67.520  -15.348 1.00 53.94  ? 202  ALA D N   1 
ATOM   9500  C  CA  . ALA D 1 199 ? -13.203 -67.561  -14.669 1.00 56.27  ? 202  ALA D CA  1 
ATOM   9501  C  C   . ALA D 1 199 ? -13.070 -67.135  -13.196 1.00 57.79  ? 202  ALA D C   1 
ATOM   9502  O  O   . ALA D 1 199 ? -13.757 -67.666  -12.314 1.00 56.74  ? 202  ALA D O   1 
ATOM   9503  C  CB  . ALA D 1 199 ? -13.819 -68.951  -14.793 1.00 54.47  ? 202  ALA D CB  1 
ATOM   9504  N  N   . LEU D 1 200 ? -12.193 -66.159  -12.949 1.00 59.32  ? 203  LEU D N   1 
ATOM   9505  C  CA  . LEU D 1 200 ? -11.794 -65.765  -11.592 1.00 62.78  ? 203  LEU D CA  1 
ATOM   9506  C  C   . LEU D 1 200 ? -12.965 -65.361  -10.720 1.00 64.41  ? 203  LEU D C   1 
ATOM   9507  O  O   . LEU D 1 200 ? -13.765 -64.504  -11.104 1.00 67.39  ? 203  LEU D O   1 
ATOM   9508  C  CB  . LEU D 1 200 ? -10.756 -64.632  -11.621 1.00 61.29  ? 203  LEU D CB  1 
ATOM   9509  C  CG  . LEU D 1 200 ? -10.170 -64.136  -10.287 1.00 61.02  ? 203  LEU D CG  1 
ATOM   9510  C  CD1 . LEU D 1 200 ? -8.763  -63.594  -10.476 1.00 59.09  ? 203  LEU D CD1 1 
ATOM   9511  C  CD2 . LEU D 1 200 ? -11.048 -63.065  -9.654  1.00 62.77  ? 203  LEU D CD2 1 
ATOM   9512  N  N   . ARG D 1 201 ? -13.046 -65.989  -9.549  1.00 62.67  ? 204  ARG D N   1 
ATOM   9513  C  CA  . ARG D 1 201 ? -13.967 -65.575  -8.494  1.00 59.74  ? 204  ARG D CA  1 
ATOM   9514  C  C   . ARG D 1 201 ? -13.173 -65.174  -7.262  1.00 59.35  ? 204  ARG D C   1 
ATOM   9515  O  O   . ARG D 1 201 ? -12.025 -65.602  -7.091  1.00 59.84  ? 204  ARG D O   1 
ATOM   9516  C  CB  . ARG D 1 201 ? -14.974 -66.682  -8.163  1.00 62.54  ? 204  ARG D CB  1 
ATOM   9517  C  CG  . ARG D 1 201 ? -14.364 -68.051  -7.904  1.00 67.61  ? 204  ARG D CG  1 
ATOM   9518  C  CD  . ARG D 1 201 ? -15.414 -69.152  -7.937  1.00 71.56  ? 204  ARG D CD  1 
ATOM   9519  N  NE  . ARG D 1 201 ? -16.280 -69.142  -6.757  1.00 75.51  ? 204  ARG D NE  1 
ATOM   9520  C  CZ  . ARG D 1 201 ? -17.229 -70.044  -6.505  1.00 77.12  ? 204  ARG D CZ  1 
ATOM   9521  N  NH1 . ARG D 1 201 ? -17.450 -71.048  -7.351  1.00 75.65  ? 204  ARG D NH1 1 
ATOM   9522  N  NH2 . ARG D 1 201 ? -17.960 -69.944  -5.400  1.00 74.72  ? 204  ARG D NH2 1 
ATOM   9523  N  N   . THR D 1 202 ? -13.766 -64.322  -6.427  1.00 55.96  ? 205  THR D N   1 
ATOM   9524  C  CA  . THR D 1 202 ? -13.184 -64.013  -5.131  1.00 50.29  ? 205  THR D CA  1 
ATOM   9525  C  C   . THR D 1 202 ? -14.046 -64.622  -4.046  1.00 49.20  ? 205  THR D C   1 
ATOM   9526  O  O   . THR D 1 202 ? -15.139 -65.133  -4.313  1.00 48.79  ? 205  THR D O   1 
ATOM   9527  C  CB  . THR D 1 202 ? -13.034 -62.507  -4.881  1.00 49.75  ? 205  THR D CB  1 
ATOM   9528  O  OG1 . THR D 1 202 ? -14.314 -61.885  -4.996  1.00 54.76  ? 205  THR D OG1 1 
ATOM   9529  C  CG2 . THR D 1 202 ? -12.080 -61.887  -5.871  1.00 48.13  ? 205  THR D CG2 1 
ATOM   9530  N  N   . TYR D 1 203 ? -13.539 -64.568  -2.819  1.00 47.17  ? 206  TYR D N   1 
ATOM   9531  C  CA  . TYR D 1 203 ? -14.168 -65.240  -1.687  1.00 44.57  ? 206  TYR D CA  1 
ATOM   9532  C  C   . TYR D 1 203 ? -14.192 -64.292  -0.499  1.00 42.93  ? 206  TYR D C   1 
ATOM   9533  O  O   . TYR D 1 203 ? -13.175 -63.668  -0.154  1.00 38.52  ? 206  TYR D O   1 
ATOM   9534  C  CB  . TYR D 1 203 ? -13.412 -66.532  -1.351  1.00 44.48  ? 206  TYR D CB  1 
ATOM   9535  C  CG  . TYR D 1 203 ? -13.075 -67.370  -2.577  1.00 44.58  ? 206  TYR D CG  1 
ATOM   9536  C  CD1 . TYR D 1 203 ? -11.944 -67.082  -3.358  1.00 44.48  ? 206  TYR D CD1 1 
ATOM   9537  C  CD2 . TYR D 1 203 ? -13.892 -68.425  -2.968  1.00 43.03  ? 206  TYR D CD2 1 
ATOM   9538  C  CE1 . TYR D 1 203 ? -11.640 -67.825  -4.487  1.00 45.52  ? 206  TYR D CE1 1 
ATOM   9539  C  CE2 . TYR D 1 203 ? -13.591 -69.187  -4.095  1.00 46.50  ? 206  TYR D CE2 1 
ATOM   9540  C  CZ  . TYR D 1 203 ? -12.470 -68.879  -4.855  1.00 46.87  ? 206  TYR D CZ  1 
ATOM   9541  O  OH  . TYR D 1 203 ? -12.164 -69.623  -5.977  1.00 49.79  ? 206  TYR D OH  1 
ATOM   9542  N  N   . ARG D 1 204 ? -15.374 -64.150  0.089   1.00 42.09  ? 207  ARG D N   1 
ATOM   9543  C  CA  . ARG D 1 204 ? -15.529 -63.320  1.264   1.00 46.20  ? 207  ARG D CA  1 
ATOM   9544  C  C   . ARG D 1 204 ? -15.171 -64.188  2.459   1.00 44.98  ? 207  ARG D C   1 
ATOM   9545  O  O   . ARG D 1 204 ? -15.517 -65.370  2.506   1.00 43.24  ? 207  ARG D O   1 
ATOM   9546  C  CB  . ARG D 1 204 ? -16.961 -62.761  1.357   1.00 52.26  ? 207  ARG D CB  1 
ATOM   9547  C  CG  . ARG D 1 204 ? -17.199 -61.538  0.463   1.00 57.21  ? 207  ARG D CG  1 
ATOM   9548  C  CD  . ARG D 1 204 ? -18.643 -61.379  -0.008  1.00 58.43  ? 207  ARG D CD  1 
ATOM   9549  N  NE  . ARG D 1 204 ? -19.527 -60.913  1.059   1.00 63.99  ? 207  ARG D NE  1 
ATOM   9550  C  CZ  . ARG D 1 204 ? -20.447 -61.662  1.668   1.00 65.65  ? 207  ARG D CZ  1 
ATOM   9551  N  NH1 . ARG D 1 204 ? -20.631 -62.934  1.319   1.00 67.85  ? 207  ARG D NH1 1 
ATOM   9552  N  NH2 . ARG D 1 204 ? -21.193 -61.135  2.629   1.00 64.76  ? 207  ARG D NH2 1 
ATOM   9553  N  N   . GLY D 1 205 ? -14.451 -63.607  3.407   1.00 44.42  ? 208  GLY D N   1 
ATOM   9554  C  CA  . GLY D 1 205 ? -14.011 -64.346  4.578   1.00 43.52  ? 208  GLY D CA  1 
ATOM   9555  C  C   . GLY D 1 205 ? -13.300 -63.493  5.600   1.00 41.07  ? 208  GLY D C   1 
ATOM   9556  O  O   . GLY D 1 205 ? -12.789 -62.420  5.282   1.00 39.06  ? 208  GLY D O   1 
ATOM   9557  N  N   . ARG D 1 206 ? -13.269 -63.981  6.835   1.00 40.94  ? 209  ARG D N   1 
ATOM   9558  C  CA  . ARG D 1 206 ? -12.545 -63.309  7.907   1.00 40.72  ? 209  ARG D CA  1 
ATOM   9559  C  C   . ARG D 1 206 ? -11.368 -64.170  8.307   1.00 37.48  ? 209  ARG D C   1 
ATOM   9560  O  O   . ARG D 1 206 ? -11.551 -65.303  8.723   1.00 37.72  ? 209  ARG D O   1 
ATOM   9561  C  CB  . ARG D 1 206 ? -13.459 -63.057  9.116   1.00 42.13  ? 209  ARG D CB  1 
ATOM   9562  C  CG  . ARG D 1 206 ? -14.733 -62.293  8.793   1.00 47.80  ? 209  ARG D CG  1 
ATOM   9563  C  CD  . ARG D 1 206 ? -15.352 -61.657  10.032  1.00 49.72  ? 209  ARG D CD  1 
ATOM   9564  N  NE  . ARG D 1 206 ? -16.306 -60.596  9.695   1.00 52.39  ? 209  ARG D NE  1 
ATOM   9565  C  CZ  . ARG D 1 206 ? -17.570 -60.801  9.323   1.00 54.89  ? 209  ARG D CZ  1 
ATOM   9566  N  NH1 . ARG D 1 206 ? -18.062 -62.031  9.230   1.00 58.69  ? 209  ARG D NH1 1 
ATOM   9567  N  NH2 . ARG D 1 206 ? -18.351 -59.769  9.046   1.00 55.56  ? 209  ARG D NH2 1 
ATOM   9568  N  N   . LEU D 1 207 ? -10.168 -63.619  8.167   1.00 36.32  ? 210  LEU D N   1 
ATOM   9569  C  CA  . LEU D 1 207 ? -8.929  -64.296  8.503   1.00 34.18  ? 210  LEU D CA  1 
ATOM   9570  C  C   . LEU D 1 207 ? -8.297  -63.634  9.724   1.00 34.01  ? 210  LEU D C   1 
ATOM   9571  O  O   . LEU D 1 207 ? -8.116  -62.412  9.757   1.00 32.76  ? 210  LEU D O   1 
ATOM   9572  C  CB  . LEU D 1 207 ? -7.951  -64.152  7.343   1.00 34.33  ? 210  LEU D CB  1 
ATOM   9573  C  CG  . LEU D 1 207 ? -6.846  -65.145  6.952   1.00 34.94  ? 210  LEU D CG  1 
ATOM   9574  C  CD1 . LEU D 1 207 ? -5.614  -64.335  6.556   1.00 33.78  ? 210  LEU D CD1 1 
ATOM   9575  C  CD2 . LEU D 1 207 ? -6.483  -66.193  7.996   1.00 31.86  ? 210  LEU D CD2 1 
ATOM   9576  N  N   . ALA D 1 208 ? -7.956  -64.448  10.717  1.00 30.59  ? 211  ALA D N   1 
ATOM   9577  C  CA  . ALA D 1 208 ? -7.107  -64.010  11.807  1.00 30.50  ? 211  ALA D CA  1 
ATOM   9578  C  C   . ALA D 1 208 ? -5.948  -64.999  11.952  1.00 29.28  ? 211  ALA D C   1 
ATOM   9579  O  O   . ALA D 1 208 ? -6.053  -66.145  11.523  1.00 29.41  ? 211  ALA D O   1 
ATOM   9580  C  CB  . ALA D 1 208 ? -7.909  -63.903  13.099  1.00 29.25  ? 211  ALA D CB  1 
ATOM   9581  N  N   . TYR D 1 209 ? -4.854  -64.549  12.545  1.00 28.51  ? 212  TYR D N   1 
ATOM   9582  C  CA  . TYR D 1 209 ? -3.716  -65.406  12.825  1.00 29.20  ? 212  TYR D CA  1 
ATOM   9583  C  C   . TYR D 1 209 ? -2.924  -64.904  14.025  1.00 31.22  ? 212  TYR D C   1 
ATOM   9584  O  O   . TYR D 1 209 ? -3.129  -63.776  14.488  1.00 30.36  ? 212  TYR D O   1 
ATOM   9585  C  CB  . TYR D 1 209 ? -2.793  -65.497  11.606  1.00 30.57  ? 212  TYR D CB  1 
ATOM   9586  C  CG  . TYR D 1 209 ? -2.305  -64.166  11.066  1.00 30.75  ? 212  TYR D CG  1 
ATOM   9587  C  CD1 . TYR D 1 209 ? -3.021  -63.484  10.082  1.00 29.15  ? 212  TYR D CD1 1 
ATOM   9588  C  CD2 . TYR D 1 209 ? -1.114  -63.600  11.520  1.00 31.26  ? 212  TYR D CD2 1 
ATOM   9589  C  CE1 . TYR D 1 209 ? -2.571  -62.268  9.579   1.00 30.32  ? 212  TYR D CE1 1 
ATOM   9590  C  CE2 . TYR D 1 209 ? -0.663  -62.383  11.021  1.00 31.49  ? 212  TYR D CE2 1 
ATOM   9591  C  CZ  . TYR D 1 209 ? -1.398  -61.725  10.053  1.00 30.97  ? 212  TYR D CZ  1 
ATOM   9592  O  OH  . TYR D 1 209 ? -0.950  -60.519  9.558   1.00 34.50  ? 212  TYR D OH  1 
ATOM   9593  N  N   . LEU D 1 210 ? -2.007  -65.748  14.507  1.00 31.68  ? 213  LEU D N   1 
ATOM   9594  C  CA  . LEU D 1 210 ? -1.081  -65.389  15.568  1.00 31.40  ? 213  LEU D CA  1 
ATOM   9595  C  C   . LEU D 1 210 ? 0.369   -65.515  15.100  1.00 31.96  ? 213  LEU D C   1 
ATOM   9596  O  O   . LEU D 1 210 ? 0.886   -66.619  14.951  1.00 31.77  ? 213  LEU D O   1 
ATOM   9597  C  CB  . LEU D 1 210 ? -1.334  -66.242  16.824  1.00 29.78  ? 213  LEU D CB  1 
ATOM   9598  C  CG  . LEU D 1 210 ? -0.401  -66.110  18.041  1.00 29.46  ? 213  LEU D CG  1 
ATOM   9599  C  CD1 . LEU D 1 210 ? -0.297  -64.672  18.558  1.00 27.49  ? 213  LEU D CD1 1 
ATOM   9600  C  CD2 . LEU D 1 210 ? -0.832  -67.057  19.161  1.00 28.28  ? 213  LEU D CD2 1 
ATOM   9601  N  N   . PRO D 1 211 ? 1.038   -64.373  14.877  1.00 34.29  ? 214  PRO D N   1 
ATOM   9602  C  CA  . PRO D 1 211 ? 2.409   -64.389  14.359  1.00 34.90  ? 214  PRO D CA  1 
ATOM   9603  C  C   . PRO D 1 211 ? 3.358   -64.958  15.392  1.00 36.17  ? 214  PRO D C   1 
ATOM   9604  O  O   . PRO D 1 211 ? 3.081   -64.876  16.592  1.00 39.75  ? 214  PRO D O   1 
ATOM   9605  C  CB  . PRO D 1 211 ? 2.729   -62.904  14.133  1.00 34.69  ? 214  PRO D CB  1 
ATOM   9606  C  CG  . PRO D 1 211 ? 1.438   -62.164  14.309  1.00 35.12  ? 214  PRO D CG  1 
ATOM   9607  C  CD  . PRO D 1 211 ? 0.595   -63.013  15.217  1.00 35.21  ? 214  PRO D CD  1 
ATOM   9608  N  N   . VAL D 1 212 ? 4.463   -65.528  14.930  1.00 36.40  ? 215  VAL D N   1 
ATOM   9609  C  CA  . VAL D 1 212 ? 5.502   -66.064  15.809  1.00 39.10  ? 215  VAL D CA  1 
ATOM   9610  C  C   . VAL D 1 212 ? 5.828   -65.095  16.961  1.00 43.97  ? 215  VAL D C   1 
ATOM   9611  O  O   . VAL D 1 212 ? 5.828   -65.491  18.138  1.00 43.63  ? 215  VAL D O   1 
ATOM   9612  C  CB  . VAL D 1 212 ? 6.787   -66.368  15.010  1.00 38.21  ? 215  VAL D CB  1 
ATOM   9613  C  CG1 . VAL D 1 212 ? 7.845   -67.007  15.887  1.00 39.82  ? 215  VAL D CG1 1 
ATOM   9614  C  CG2 . VAL D 1 212 ? 6.482   -67.287  13.850  1.00 37.65  ? 215  VAL D CG2 1 
ATOM   9615  N  N   . GLY D 1 213 ? 6.079   -63.830  16.608  1.00 44.86  ? 216  GLY D N   1 
ATOM   9616  C  CA  . GLY D 1 213 ? 6.590   -62.818  17.537  1.00 49.13  ? 216  GLY D CA  1 
ATOM   9617  C  C   . GLY D 1 213 ? 5.670   -62.398  18.670  1.00 52.03  ? 216  GLY D C   1 
ATOM   9618  O  O   . GLY D 1 213 ? 6.138   -62.061  19.759  1.00 52.07  ? 216  GLY D O   1 
ATOM   9619  N  N   . ARG D 1 214 ? 4.361   -62.428  18.419  1.00 55.73  ? 217  ARG D N   1 
ATOM   9620  C  CA  . ARG D 1 214 ? 3.369   -62.000  19.413  1.00 54.33  ? 217  ARG D CA  1 
ATOM   9621  C  C   . ARG D 1 214 ? 2.892   -63.131  20.328  1.00 52.58  ? 217  ARG D C   1 
ATOM   9622  O  O   . ARG D 1 214 ? 1.922   -62.966  21.067  1.00 52.84  ? 217  ARG D O   1 
ATOM   9623  C  CB  . ARG D 1 214 ? 2.180   -61.279  18.745  1.00 56.66  ? 217  ARG D CB  1 
ATOM   9624  C  CG  . ARG D 1 214 ? 2.539   -59.930  18.117  1.00 62.20  ? 217  ARG D CG  1 
ATOM   9625  C  CD  . ARG D 1 214 ? 1.513   -58.852  18.445  1.00 65.18  ? 217  ARG D CD  1 
ATOM   9626  N  NE  . ARG D 1 214 ? 1.604   -58.414  19.844  1.00 68.37  ? 217  ARG D NE  1 
ATOM   9627  C  CZ  . ARG D 1 214 ? 0.631   -57.797  20.519  1.00 68.01  ? 217  ARG D CZ  1 
ATOM   9628  N  NH1 . ARG D 1 214 ? 0.828   -57.449  21.781  1.00 64.52  ? 217  ARG D NH1 1 
ATOM   9629  N  NH2 . ARG D 1 214 ? -0.540  -57.528  19.945  1.00 67.11  ? 217  ARG D NH2 1 
ATOM   9630  N  N   . VAL D 1 215 ? 3.576   -64.273  20.278  1.00 50.66  ? 218  VAL D N   1 
ATOM   9631  C  CA  . VAL D 1 215 ? 3.307   -65.389  21.189  1.00 52.65  ? 218  VAL D CA  1 
ATOM   9632  C  C   . VAL D 1 215 ? 3.878   -65.056  22.572  1.00 54.44  ? 218  VAL D C   1 
ATOM   9633  O  O   . VAL D 1 215 ? 5.091   -64.878  22.733  1.00 54.87  ? 218  VAL D O   1 
ATOM   9634  C  CB  . VAL D 1 215 ? 3.895   -66.718  20.659  1.00 50.52  ? 218  VAL D CB  1 
ATOM   9635  C  CG1 . VAL D 1 215 ? 3.872   -67.804  21.734  1.00 49.14  ? 218  VAL D CG1 1 
ATOM   9636  C  CG2 . VAL D 1 215 ? 3.147   -67.162  19.418  1.00 49.97  ? 218  VAL D CG2 1 
ATOM   9637  N  N   . GLY D 1 216 ? 2.994   -64.985  23.563  1.00 56.48  ? 219  GLY D N   1 
ATOM   9638  C  CA  . GLY D 1 216 ? 3.339   -64.449  24.873  1.00 58.43  ? 219  GLY D CA  1 
ATOM   9639  C  C   . GLY D 1 216 ? 3.936   -65.439  25.848  1.00 61.11  ? 219  GLY D C   1 
ATOM   9640  O  O   . GLY D 1 216 ? 4.158   -66.612  25.514  1.00 58.98  ? 219  GLY D O   1 
ATOM   9641  N  N   . SER D 1 217 ? 4.189   -64.937  27.060  1.00 62.28  ? 220  SER D N   1 
ATOM   9642  C  CA  . SER D 1 217 ? 4.726   -65.701  28.190  1.00 62.66  ? 220  SER D CA  1 
ATOM   9643  C  C   . SER D 1 217 ? 3.697   -66.692  28.750  1.00 64.50  ? 220  SER D C   1 
ATOM   9644  O  O   . SER D 1 217 ? 4.001   -67.497  29.637  1.00 63.89  ? 220  SER D O   1 
ATOM   9645  C  CB  . SER D 1 217 ? 5.201   -64.744  29.281  1.00 61.52  ? 220  SER D CB  1 
ATOM   9646  N  N   . LYS D 1 218 ? 2.497   -66.624  28.191  1.00 66.51  ? 221  LYS D N   1 
ATOM   9647  C  CA  . LYS D 1 218 ? 1.394   -67.487  28.562  1.00 73.30  ? 221  LYS D CA  1 
ATOM   9648  C  C   . LYS D 1 218 ? 0.211   -67.099  27.694  1.00 72.47  ? 221  LYS D C   1 
ATOM   9649  O  O   . LYS D 1 218 ? 0.385   -66.504  26.635  1.00 72.87  ? 221  LYS D O   1 
ATOM   9650  C  CB  . LYS D 1 218 ? 1.047   -67.309  30.039  1.00 78.95  ? 221  LYS D CB  1 
ATOM   9651  C  CG  . LYS D 1 218 ? 1.534   -65.998  30.638  1.00 83.49  ? 221  LYS D CG  1 
ATOM   9652  C  CD  . LYS D 1 218 ? 1.776   -66.122  32.135  1.00 84.89  ? 221  LYS D CD  1 
ATOM   9653  C  CE  . LYS D 1 218 ? 3.217   -65.794  32.492  1.00 84.59  ? 221  LYS D CE  1 
ATOM   9654  N  NZ  . LYS D 1 218 ? 3.386   -64.362  32.859  1.00 78.76  ? 221  LYS D NZ  1 
ATOM   9655  N  N   . THR D 1 219 ? -0.992  -67.431  28.139  1.00 71.58  ? 222  THR D N   1 
ATOM   9656  C  CA  . THR D 1 219 ? -2.189  -67.053  27.405  1.00 73.03  ? 222  THR D CA  1 
ATOM   9657  C  C   . THR D 1 219 ? -3.009  -68.231  26.906  1.00 72.32  ? 222  THR D C   1 
ATOM   9658  O  O   . THR D 1 219 ? -2.476  -69.295  26.603  1.00 73.05  ? 222  THR D O   1 
ATOM   9659  C  CB  . THR D 1 219 ? -1.846  -66.145  26.211  1.00 73.97  ? 222  THR D CB  1 
ATOM   9660  N  N   . PRO D 1 220 ? -4.318  -68.017  26.830  1.00 83.84  ? 223  PRO D N   1 
ATOM   9661  C  CA  . PRO D 1 220 ? -5.248  -69.032  26.339  1.00 84.45  ? 223  PRO D CA  1 
ATOM   9662  C  C   . PRO D 1 220 ? -6.069  -68.463  25.197  1.00 72.46  ? 223  PRO D C   1 
ATOM   9663  O  O   . PRO D 1 220 ? -5.566  -67.555  24.544  1.00 62.76  ? 223  PRO D O   1 
ATOM   9664  C  CB  . PRO D 1 220 ? -6.140  -69.294  27.549  1.00 83.70  ? 223  PRO D CB  1 
ATOM   9665  C  CG  . PRO D 1 220 ? -6.165  -67.993  28.265  1.00 87.87  ? 223  PRO D CG  1 
ATOM   9666  C  CD  . PRO D 1 220 ? -4.800  -67.389  28.073  1.00 89.14  ? 223  PRO D CD  1 
ATOM   9667  N  N   . GLN D 1 228 ? -8.666  -87.959  21.852  1.00 54.70  ? 231  GLN D N   1 
ATOM   9668  C  CA  . GLN D 1 228 ? -8.396  -86.634  22.378  1.00 56.77  ? 231  GLN D CA  1 
ATOM   9669  C  C   . GLN D 1 228 ? -6.881  -86.460  22.555  1.00 56.69  ? 231  GLN D C   1 
ATOM   9670  O  O   . GLN D 1 228 ? -6.330  -86.779  23.612  1.00 60.36  ? 231  GLN D O   1 
ATOM   9671  C  CB  . GLN D 1 228 ? -9.147  -86.431  23.699  1.00 56.43  ? 231  GLN D CB  1 
ATOM   9672  C  CG  . GLN D 1 228 ? -9.284  -84.983  24.145  1.00 59.38  ? 231  GLN D CG  1 
ATOM   9673  C  CD  . GLN D 1 228 ? -10.564 -84.315  23.657  1.00 63.31  ? 231  GLN D CD  1 
ATOM   9674  O  OE1 . GLN D 1 228 ? -10.628 -83.092  23.536  1.00 62.02  ? 231  GLN D OE1 1 
ATOM   9675  N  NE2 . GLN D 1 228 ? -11.591 -85.115  23.388  1.00 65.70  ? 231  GLN D NE2 1 
ATOM   9676  N  N   . GLY D 1 229 ? -6.220  -85.964  21.506  1.00 52.87  ? 232  GLY D N   1 
ATOM   9677  C  CA  . GLY D 1 229 ? -4.757  -85.779  21.481  1.00 45.47  ? 232  GLY D CA  1 
ATOM   9678  C  C   . GLY D 1 229 ? -4.256  -84.626  22.332  1.00 41.54  ? 232  GLY D C   1 
ATOM   9679  O  O   . GLY D 1 229 ? -4.737  -84.432  23.444  1.00 44.11  ? 232  GLY D O   1 
ATOM   9680  N  N   . PRO D 1 230 ? -3.281  -83.848  21.820  1.00 37.10  ? 233  PRO D N   1 
ATOM   9681  C  CA  . PRO D 1 230 ? -2.705  -82.712  22.544  1.00 34.77  ? 233  PRO D CA  1 
ATOM   9682  C  C   . PRO D 1 230 ? -3.668  -81.538  22.640  1.00 34.27  ? 233  PRO D C   1 
ATOM   9683  O  O   . PRO D 1 230 ? -4.659  -81.499  21.908  1.00 34.48  ? 233  PRO D O   1 
ATOM   9684  C  CB  . PRO D 1 230 ? -1.499  -82.324  21.676  1.00 36.67  ? 233  PRO D CB  1 
ATOM   9685  C  CG  . PRO D 1 230 ? -1.878  -82.762  20.298  1.00 34.63  ? 233  PRO D CG  1 
ATOM   9686  C  CD  . PRO D 1 230 ? -2.626  -84.044  20.515  1.00 36.50  ? 233  PRO D CD  1 
ATOM   9687  N  N   . VAL D 1 231 ? -3.393  -80.588  23.533  1.00 32.83  ? 234  VAL D N   1 
ATOM   9688  C  CA  . VAL D 1 231 ? -4.283  -79.445  23.652  1.00 31.62  ? 234  VAL D CA  1 
ATOM   9689  C  C   . VAL D 1 231 ? -3.754  -78.276  22.823  1.00 30.18  ? 234  VAL D C   1 
ATOM   9690  O  O   . VAL D 1 231 ? -2.547  -78.086  22.672  1.00 28.73  ? 234  VAL D O   1 
ATOM   9691  C  CB  . VAL D 1 231 ? -4.623  -79.042  25.120  1.00 33.81  ? 234  VAL D CB  1 
ATOM   9692  C  CG1 . VAL D 1 231 ? -4.580  -80.253  26.061  1.00 33.67  ? 234  VAL D CG1 1 
ATOM   9693  C  CG2 . VAL D 1 231 ? -3.725  -77.924  25.632  1.00 33.66  ? 234  VAL D CG2 1 
ATOM   9694  N  N   . ASP D 1 232 ? -4.672  -77.517  22.257  1.00 28.23  ? 235  ASP D N   1 
ATOM   9695  C  CA  . ASP D 1 232 ? -4.288  -76.401  21.440  1.00 28.67  ? 235  ASP D CA  1 
ATOM   9696  C  C   . ASP D 1 232 ? -4.425  -75.139  22.286  1.00 28.65  ? 235  ASP D C   1 
ATOM   9697  O  O   . ASP D 1 232 ? -5.443  -74.460  22.230  1.00 27.59  ? 235  ASP D O   1 
ATOM   9698  C  CB  . ASP D 1 232 ? -5.155  -76.359  20.179  1.00 26.68  ? 235  ASP D CB  1 
ATOM   9699  C  CG  . ASP D 1 232 ? -4.917  -77.565  19.256  1.00 27.45  ? 235  ASP D CG  1 
ATOM   9700  O  OD1 . ASP D 1 232 ? -3.793  -78.128  19.243  1.00 26.34  ? 235  ASP D OD1 1 
ATOM   9701  O  OD2 . ASP D 1 232 ? -5.867  -77.949  18.539  1.00 27.59  ? 235  ASP D OD2 1 
ATOM   9702  N  N   . ALA D 1 233 ? -3.396  -74.842  23.075  1.00 29.08  ? 236  ALA D N   1 
ATOM   9703  C  CA  . ALA D 1 233 ? -3.465  -73.727  24.044  1.00 32.65  ? 236  ALA D CA  1 
ATOM   9704  C  C   . ALA D 1 233 ? -3.718  -72.368  23.383  1.00 33.74  ? 236  ALA D C   1 
ATOM   9705  O  O   . ALA D 1 233 ? -4.445  -71.536  23.941  1.00 37.08  ? 236  ALA D O   1 
ATOM   9706  C  CB  . ALA D 1 233 ? -2.217  -73.673  24.932  1.00 30.20  ? 236  ALA D CB  1 
ATOM   9707  N  N   . HIS D 1 234 ? -3.144  -72.157  22.194  1.00 32.15  ? 237  HIS D N   1 
ATOM   9708  C  CA  . HIS D 1 234 ? -3.283  -70.876  21.492  1.00 31.42  ? 237  HIS D CA  1 
ATOM   9709  C  C   . HIS D 1 234 ? -4.670  -70.643  20.969  1.00 30.33  ? 237  HIS D C   1 
ATOM   9710  O  O   . HIS D 1 234 ? -4.969  -69.548  20.509  1.00 30.75  ? 237  HIS D O   1 
ATOM   9711  C  CB  . HIS D 1 234 ? -2.277  -70.731  20.337  1.00 32.22  ? 237  HIS D CB  1 
ATOM   9712  C  CG  . HIS D 1 234 ? -0.814  -70.772  20.758  1.00 33.58  ? 237  HIS D CG  1 
ATOM   9713  N  ND1 . HIS D 1 234 ? 0.086   -71.599  20.174  1.00 33.36  ? 237  HIS D ND1 1 
ATOM   9714  C  CD2 . HIS D 1 234 ? -0.107  -70.035  21.707  1.00 33.40  ? 237  HIS D CD2 1 
ATOM   9715  C  CE1 . HIS D 1 234 ? 1.302   -71.411  20.724  1.00 33.25  ? 237  HIS D CE1 1 
ATOM   9716  N  NE2 . HIS D 1 234 ? 1.185   -70.458  21.667  1.00 35.00  ? 237  HIS D NE2 1 
ATOM   9717  N  N   . LEU D 1 235 ? -5.534  -71.655  21.014  1.00 29.78  ? 238  LEU D N   1 
ATOM   9718  C  CA  . LEU D 1 235 ? -6.875  -71.536  20.412  1.00 30.00  ? 238  LEU D CA  1 
ATOM   9719  C  C   . LEU D 1 235 ? -7.986  -71.381  21.426  1.00 29.84  ? 238  LEU D C   1 
ATOM   9720  O  O   . LEU D 1 235 ? -7.958  -72.029  22.455  1.00 34.12  ? 238  LEU D O   1 
ATOM   9721  C  CB  . LEU D 1 235 ? -7.181  -72.748  19.511  1.00 29.49  ? 238  LEU D CB  1 
ATOM   9722  C  CG  . LEU D 1 235 ? -6.178  -73.016  18.384  1.00 28.33  ? 238  LEU D CG  1 
ATOM   9723  C  CD1 . LEU D 1 235 ? -6.590  -74.240  17.587  1.00 26.18  ? 238  LEU D CD1 1 
ATOM   9724  C  CD2 . LEU D 1 235 ? -6.059  -71.789  17.487  1.00 25.74  ? 238  LEU D CD2 1 
ATOM   9725  N  N   . VAL D 1 236 ? -8.966  -70.535  21.113  1.00 29.90  ? 239  VAL D N   1 
ATOM   9726  C  CA  . VAL D 1 236 ? -10.203 -70.396  21.892  1.00 31.51  ? 239  VAL D CA  1 
ATOM   9727  C  C   . VAL D 1 236 ? -11.371 -70.853  21.021  1.00 32.30  ? 239  VAL D C   1 
ATOM   9728  O  O   . VAL D 1 236 ? -11.284 -70.755  19.804  1.00 32.06  ? 239  VAL D O   1 
ATOM   9729  C  CB  . VAL D 1 236 ? -10.451 -68.931  22.376  1.00 31.72  ? 239  VAL D CB  1 
ATOM   9730  C  CG1 . VAL D 1 236 ? -9.318  -68.451  23.277  1.00 31.46  ? 239  VAL D CG1 1 
ATOM   9731  C  CG2 . VAL D 1 236 ? -10.685 -67.967  21.206  1.00 29.47  ? 239  VAL D CG2 1 
ATOM   9732  N  N   . PRO D 1 237 ? -12.475 -71.340  21.632  1.00 34.87  ? 240  PRO D N   1 
ATOM   9733  C  CA  . PRO D 1 237 ? -13.570 -71.909  20.817  1.00 34.89  ? 240  PRO D CA  1 
ATOM   9734  C  C   . PRO D 1 237 ? -14.049 -71.005  19.675  1.00 36.17  ? 240  PRO D C   1 
ATOM   9735  O  O   . PRO D 1 237 ? -14.057 -69.775  19.810  1.00 36.41  ? 240  PRO D O   1 
ATOM   9736  C  CB  . PRO D 1 237 ? -14.688 -72.127  21.837  1.00 34.14  ? 240  PRO D CB  1 
ATOM   9737  C  CG  . PRO D 1 237 ? -13.984 -72.326  23.141  1.00 33.97  ? 240  PRO D CG  1 
ATOM   9738  C  CD  . PRO D 1 237 ? -12.709 -71.530  23.078  1.00 34.18  ? 240  PRO D CD  1 
ATOM   9739  N  N   . LEU D 1 238 ? -14.452 -71.625  18.567  1.00 38.34  ? 241  LEU D N   1 
ATOM   9740  C  CA  . LEU D 1 238 ? -14.878 -70.904  17.360  1.00 39.81  ? 241  LEU D CA  1 
ATOM   9741  C  C   . LEU D 1 238 ? -16.076 -69.978  17.566  1.00 42.15  ? 241  LEU D C   1 
ATOM   9742  O  O   . LEU D 1 238 ? -16.346 -69.115  16.725  1.00 42.95  ? 241  LEU D O   1 
ATOM   9743  C  CB  . LEU D 1 238 ? -15.163 -71.877  16.211  1.00 38.04  ? 241  LEU D CB  1 
ATOM   9744  C  CG  . LEU D 1 238 ? -13.944 -72.340  15.403  1.00 41.59  ? 241  LEU D CG  1 
ATOM   9745  C  CD1 . LEU D 1 238 ? -14.215 -73.664  14.693  1.00 41.91  ? 241  LEU D CD1 1 
ATOM   9746  C  CD2 . LEU D 1 238 ? -13.465 -71.275  14.412  1.00 38.66  ? 241  LEU D CD2 1 
ATOM   9747  N  N   . GLU D 1 239 ? -16.789 -70.155  18.676  1.00 42.30  ? 242  GLU D N   1 
ATOM   9748  C  CA  . GLU D 1 239 ? -17.886 -69.255  19.025  1.00 43.37  ? 242  GLU D CA  1 
ATOM   9749  C  C   . GLU D 1 239 ? -17.355 -67.959  19.648  1.00 40.81  ? 242  GLU D C   1 
ATOM   9750  O  O   . GLU D 1 239 ? -18.069 -66.953  19.691  1.00 41.06  ? 242  GLU D O   1 
ATOM   9751  C  CB  . GLU D 1 239 ? -18.884 -69.931  19.986  1.00 46.51  ? 242  GLU D CB  1 
ATOM   9752  C  CG  . GLU D 1 239 ? -19.285 -71.353  19.610  1.00 50.12  ? 242  GLU D CG  1 
ATOM   9753  C  CD  . GLU D 1 239 ? -18.287 -72.393  20.102  1.00 54.47  ? 242  GLU D CD  1 
ATOM   9754  O  OE1 . GLU D 1 239 ? -17.874 -72.323  21.284  1.00 59.42  ? 242  GLU D OE1 1 
ATOM   9755  O  OE2 . GLU D 1 239 ? -17.914 -73.286  19.316  1.00 52.80  ? 242  GLU D OE2 1 
ATOM   9756  N  N   . GLU D 1 240 ? -16.113 -67.989  20.138  1.00 38.79  ? 243  GLU D N   1 
ATOM   9757  C  CA  . GLU D 1 240 ? -15.490 -66.815  20.765  1.00 39.38  ? 243  GLU D CA  1 
ATOM   9758  C  C   . GLU D 1 240 ? -14.722 -65.987  19.737  1.00 36.64  ? 243  GLU D C   1 
ATOM   9759  O  O   . GLU D 1 240 ? -14.236 -66.528  18.747  1.00 36.74  ? 243  GLU D O   1 
ATOM   9760  C  CB  . GLU D 1 240 ? -14.521 -67.229  21.892  1.00 40.55  ? 243  GLU D CB  1 
ATOM   9761  C  CG  . GLU D 1 240 ? -15.183 -67.739  23.167  1.00 45.14  ? 243  GLU D CG  1 
ATOM   9762  C  CD  . GLU D 1 240 ? -16.076 -66.698  23.815  1.00 49.79  ? 243  GLU D CD  1 
ATOM   9763  O  OE1 . GLU D 1 240 ? -15.550 -65.657  24.297  1.00 50.93  ? 243  GLU D OE1 1 
ATOM   9764  O  OE2 . GLU D 1 240 ? -17.309 -66.924  23.835  1.00 49.20  ? 243  GLU D OE2 1 
ATOM   9765  N  N   . PRO D 1 241 ? -14.567 -64.679  19.985  1.00 34.42  ? 244  PRO D N   1 
ATOM   9766  C  CA  . PRO D 1 241 ? -13.646 -63.984  19.088  1.00 33.38  ? 244  PRO D CA  1 
ATOM   9767  C  C   . PRO D 1 241 ? -12.208 -64.399  19.414  1.00 32.66  ? 244  PRO D C   1 
ATOM   9768  O  O   . PRO D 1 241 ? -11.927 -64.834  20.526  1.00 31.11  ? 244  PRO D O   1 
ATOM   9769  C  CB  . PRO D 1 241 ? -13.888 -62.510  19.416  1.00 32.80  ? 244  PRO D CB  1 
ATOM   9770  C  CG  . PRO D 1 241 ? -14.360 -62.516  20.843  1.00 32.77  ? 244  PRO D CG  1 
ATOM   9771  C  CD  . PRO D 1 241 ? -15.088 -63.804  21.057  1.00 32.44  ? 244  PRO D CD  1 
ATOM   9772  N  N   . VAL D 1 242 ? -11.309 -64.298  18.445  1.00 32.51  ? 245  VAL D N   1 
ATOM   9773  C  CA  . VAL D 1 242 ? -9.902  -64.625  18.687  1.00 32.57  ? 245  VAL D CA  1 
ATOM   9774  C  C   . VAL D 1 242 ? -9.337  -63.757  19.826  1.00 33.23  ? 245  VAL D C   1 
ATOM   9775  O  O   . VAL D 1 242 ? -9.851  -62.672  20.078  1.00 34.00  ? 245  VAL D O   1 
ATOM   9776  C  CB  . VAL D 1 242 ? -9.068  -64.460  17.403  1.00 32.18  ? 245  VAL D CB  1 
ATOM   9777  C  CG1 . VAL D 1 242 ? -9.526  -65.457  16.347  1.00 31.06  ? 245  VAL D CG1 1 
ATOM   9778  C  CG2 . VAL D 1 242 ? -9.164  -63.037  16.867  1.00 31.80  ? 245  VAL D CG2 1 
ATOM   9779  N  N   . PRO D 1 243 ? -8.287  -64.228  20.527  1.00 33.58  ? 246  PRO D N   1 
ATOM   9780  C  CA  . PRO D 1 243 ? -7.705  -63.373  21.567  1.00 33.30  ? 246  PRO D CA  1 
ATOM   9781  C  C   . PRO D 1 243 ? -7.189  -62.038  21.021  1.00 34.70  ? 246  PRO D C   1 
ATOM   9782  O  O   . PRO D 1 243 ? -6.813  -61.944  19.845  1.00 33.44  ? 246  PRO D O   1 
ATOM   9783  C  CB  . PRO D 1 243 ? -6.545  -64.204  22.100  1.00 32.22  ? 246  PRO D CB  1 
ATOM   9784  C  CG  . PRO D 1 243 ? -6.898  -65.604  21.760  1.00 32.02  ? 246  PRO D CG  1 
ATOM   9785  C  CD  . PRO D 1 243 ? -7.573  -65.511  20.427  1.00 32.87  ? 246  PRO D CD  1 
ATOM   9786  N  N   . SER D 1 244 ? -7.177  -61.025  21.887  1.00 35.42  ? 247  SER D N   1 
ATOM   9787  C  CA  . SER D 1 244 ? -6.859  -59.638  21.517  1.00 37.68  ? 247  SER D CA  1 
ATOM   9788  C  C   . SER D 1 244 ? -5.462  -59.464  20.936  1.00 37.45  ? 247  SER D C   1 
ATOM   9789  O  O   . SER D 1 244 ? -5.214  -58.510  20.186  1.00 36.32  ? 247  SER D O   1 
ATOM   9790  C  CB  . SER D 1 244 ? -6.991  -58.734  22.740  1.00 38.84  ? 247  SER D CB  1 
ATOM   9791  O  OG  . SER D 1 244 ? -5.971  -59.058  23.671  1.00 41.60  ? 247  SER D OG  1 
ATOM   9792  N  N   . HIS D 1 245 ? -4.552  -60.367  21.294  1.00 34.33  ? 248  HIS D N   1 
ATOM   9793  C  CA  . HIS D 1 245 ? -3.182  -60.286  20.794  1.00 36.28  ? 248  HIS D CA  1 
ATOM   9794  C  C   . HIS D 1 245 ? -2.977  -60.871  19.407  1.00 36.74  ? 248  HIS D C   1 
ATOM   9795  O  O   . HIS D 1 245 ? -1.882  -60.782  18.848  1.00 37.47  ? 248  HIS D O   1 
ATOM   9796  C  CB  . HIS D 1 245 ? -2.180  -60.842  21.816  1.00 36.22  ? 248  HIS D CB  1 
ATOM   9797  C  CG  . HIS D 1 245 ? -2.256  -62.337  22.017  1.00 35.58  ? 248  HIS D CG  1 
ATOM   9798  N  ND1 . HIS D 1 245 ? -3.391  -62.967  22.365  1.00 34.86  ? 248  HIS D ND1 1 
ATOM   9799  C  CD2 . HIS D 1 245 ? -1.269  -63.320  21.935  1.00 34.63  ? 248  HIS D CD2 1 
ATOM   9800  C  CE1 . HIS D 1 245 ? -3.146  -64.286  22.495  1.00 35.67  ? 248  HIS D CE1 1 
ATOM   9801  N  NE2 . HIS D 1 245 ? -1.849  -64.499  22.225  1.00 33.36  ? 248  HIS D NE2 1 
ATOM   9802  N  N   . TRP D 1 246 ? -4.025  -61.453  18.827  1.00 34.98  ? 249  TRP D N   1 
ATOM   9803  C  CA  . TRP D 1 246 ? -3.961  -61.931  17.432  1.00 35.58  ? 249  TRP D CA  1 
ATOM   9804  C  C   . TRP D 1 246 ? -4.106  -60.774  16.488  1.00 36.05  ? 249  TRP D C   1 
ATOM   9805  O  O   . TRP D 1 246 ? -4.553  -59.702  16.883  1.00 37.88  ? 249  TRP D O   1 
ATOM   9806  C  CB  . TRP D 1 246 ? -5.085  -62.921  17.142  1.00 32.67  ? 249  TRP D CB  1 
ATOM   9807  C  CG  . TRP D 1 246 ? -4.911  -64.339  17.657  1.00 32.23  ? 249  TRP D CG  1 
ATOM   9808  C  CD1 . TRP D 1 246 ? -4.370  -64.759  18.876  1.00 32.19  ? 249  TRP D CD1 1 
ATOM   9809  C  CD2 . TRP D 1 246 ? -5.343  -65.583  16.983  1.00 31.15  ? 249  TRP D CD2 1 
ATOM   9810  N  NE1 . TRP D 1 246 ? -4.408  -66.134  18.981  1.00 31.93  ? 249  TRP D NE1 1 
ATOM   9811  C  CE2 . TRP D 1 246 ? -4.991  -66.687  17.887  1.00 30.63  ? 249  TRP D CE2 1 
ATOM   9812  C  CE3 . TRP D 1 246 ? -5.956  -65.877  15.762  1.00 30.61  ? 249  TRP D CE3 1 
ATOM   9813  C  CZ2 . TRP D 1 246 ? -5.251  -68.016  17.562  1.00 29.91  ? 249  TRP D CZ2 1 
ATOM   9814  C  CZ3 . TRP D 1 246 ? -6.211  -67.219  15.446  1.00 29.70  ? 249  TRP D CZ3 1 
ATOM   9815  C  CH2 . TRP D 1 246 ? -5.859  -68.261  16.324  1.00 29.24  ? 249  TRP D CH2 1 
ATOM   9816  N  N   . THR D 1 247 ? -3.754  -60.989  15.224  1.00 37.79  ? 250  THR D N   1 
ATOM   9817  C  CA  . THR D 1 247 ? -3.948  -60.000  14.157  1.00 34.64  ? 250  THR D CA  1 
ATOM   9818  C  C   . THR D 1 247 ? -5.178  -60.381  13.365  1.00 35.10  ? 250  THR D C   1 
ATOM   9819  O  O   . THR D 1 247 ? -5.242  -61.479  12.804  1.00 33.85  ? 250  THR D O   1 
ATOM   9820  C  CB  . THR D 1 247 ? -2.738  -59.970  13.194  1.00 34.81  ? 250  THR D CB  1 
ATOM   9821  O  OG1 . THR D 1 247 ? -1.560  -59.615  13.922  1.00 36.44  ? 250  THR D OG1 1 
ATOM   9822  C  CG2 . THR D 1 247 ? -2.947  -58.976  12.039  1.00 33.74  ? 250  THR D CG2 1 
ATOM   9823  N  N   . VAL D 1 248 ? -6.153  -59.477  13.319  1.00 35.34  ? 251  VAL D N   1 
ATOM   9824  C  CA  . VAL D 1 248 ? -7.345  -59.679  12.505  1.00 37.38  ? 251  VAL D CA  1 
ATOM   9825  C  C   . VAL D 1 248 ? -7.131  -58.928  11.194  1.00 42.01  ? 251  VAL D C   1 
ATOM   9826  O  O   . VAL D 1 248 ? -6.829  -57.733  11.206  1.00 44.28  ? 251  VAL D O   1 
ATOM   9827  C  CB  . VAL D 1 248 ? -8.621  -59.178  13.221  1.00 37.20  ? 251  VAL D CB  1 
ATOM   9828  C  CG1 . VAL D 1 248 ? -9.856  -59.386  12.351  1.00 35.79  ? 251  VAL D CG1 1 
ATOM   9829  C  CG2 . VAL D 1 248 ? -8.797  -59.869  14.574  1.00 35.46  ? 251  VAL D CG2 1 
ATOM   9830  N  N   . VAL D 1 249 ? -7.278  -59.633  10.074  1.00 42.95  ? 252  VAL D N   1 
ATOM   9831  C  CA  . VAL D 1 249 ? -7.018  -59.067  8.747   1.00 42.63  ? 252  VAL D CA  1 
ATOM   9832  C  C   . VAL D 1 249 ? -8.128  -58.087  8.350   1.00 46.02  ? 252  VAL D C   1 
ATOM   9833  O  O   . VAL D 1 249 ? -9.311  -58.451  8.358   1.00 44.62  ? 252  VAL D O   1 
ATOM   9834  C  CB  . VAL D 1 249 ? -6.815  -60.174  7.682   1.00 40.15  ? 252  VAL D CB  1 
ATOM   9835  C  CG1 . VAL D 1 249 ? -6.694  -59.584  6.291   1.00 41.69  ? 252  VAL D CG1 1 
ATOM   9836  C  CG2 . VAL D 1 249 ? -5.560  -60.969  7.998   1.00 40.51  ? 252  VAL D CG2 1 
ATOM   9837  N  N   . PRO D 1 250 ? -7.747  -56.835  8.011   1.00 49.84  ? 253  PRO D N   1 
ATOM   9838  C  CA  . PRO D 1 250 ? -8.739  -55.792  7.728   1.00 50.98  ? 253  PRO D CA  1 
ATOM   9839  C  C   . PRO D 1 250 ? -9.668  -56.185  6.583   1.00 51.46  ? 253  PRO D C   1 
ATOM   9840  O  O   . PRO D 1 250 ? -10.891 -56.264  6.774   1.00 49.91  ? 253  PRO D O   1 
ATOM   9841  C  CB  . PRO D 1 250 ? -7.876  -54.576  7.349   1.00 51.93  ? 253  PRO D CB  1 
ATOM   9842  C  CG  . PRO D 1 250 ? -6.546  -54.836  7.985   1.00 52.92  ? 253  PRO D CG  1 
ATOM   9843  C  CD  . PRO D 1 250 ? -6.364  -56.322  7.899   1.00 51.50  ? 253  PRO D CD  1 
ATOM   9844  N  N   . ASP D 1 251 ? -9.079  -56.459  5.419   1.00 53.43  ? 254  ASP D N   1 
ATOM   9845  C  CA  . ASP D 1 251 ? -9.842  -56.766  4.207   1.00 53.81  ? 254  ASP D CA  1 
ATOM   9846  C  C   . ASP D 1 251 ? -10.454 -58.159  4.252   1.00 51.12  ? 254  ASP D C   1 
ATOM   9847  O  O   . ASP D 1 251 ? -9.901  -59.075  4.860   1.00 48.03  ? 254  ASP D O   1 
ATOM   9848  C  CB  . ASP D 1 251 ? -8.980  -56.583  2.957   1.00 57.31  ? 254  ASP D CB  1 
ATOM   9849  C  CG  . ASP D 1 251 ? -7.561  -57.057  3.157   1.00 58.85  ? 254  ASP D CG  1 
ATOM   9850  O  OD1 . ASP D 1 251 ? -6.654  -56.203  3.242   1.00 61.16  ? 254  ASP D OD1 1 
ATOM   9851  O  OD2 . ASP D 1 251 ? -7.358  -58.283  3.243   1.00 62.18  ? 254  ASP D OD2 1 
ATOM   9852  N  N   . GLU D 1 252 ? -11.607 -58.297  3.608   1.00 50.21  ? 255  GLU D N   1 
ATOM   9853  C  CA  . GLU D 1 252 ? -12.406 -59.506  3.718   1.00 49.61  ? 255  GLU D CA  1 
ATOM   9854  C  C   . GLU D 1 252 ? -12.826 -60.082  2.355   1.00 48.28  ? 255  GLU D C   1 
ATOM   9855  O  O   . GLU D 1 252 ? -13.853 -60.763  2.235   1.00 46.40  ? 255  GLU D O   1 
ATOM   9856  C  CB  . GLU D 1 252 ? -13.594 -59.251  4.652   1.00 49.77  ? 255  GLU D CB  1 
ATOM   9857  C  CG  . GLU D 1 252 ? -13.176 -59.243  6.120   1.00 52.72  ? 255  GLU D CG  1 
ATOM   9858  C  CD  . GLU D 1 252 ? -14.175 -58.567  7.048   1.00 56.51  ? 255  GLU D CD  1 
ATOM   9859  O  OE1 . GLU D 1 252 ? -15.397 -58.831  6.931   1.00 57.73  ? 255  GLU D OE1 1 
ATOM   9860  O  OE2 . GLU D 1 252 ? -13.730 -57.778  7.912   1.00 56.28  ? 255  GLU D OE2 1 
ATOM   9861  N  N   . ASP D 1 253 ? -12.006 -59.803  1.341   1.00 48.09  ? 256  ASP D N   1 
ATOM   9862  C  CA  . ASP D 1 253 ? -12.177 -60.343  -0.011  1.00 50.27  ? 256  ASP D CA  1 
ATOM   9863  C  C   . ASP D 1 253 ? -10.838 -60.886  -0.448  1.00 47.48  ? 256  ASP D C   1 
ATOM   9864  O  O   . ASP D 1 253 ? -9.874  -60.131  -0.586  1.00 48.65  ? 256  ASP D O   1 
ATOM   9865  C  CB  . ASP D 1 253 ? -12.631 -59.257  -0.997  1.00 53.38  ? 256  ASP D CB  1 
ATOM   9866  C  CG  . ASP D 1 253 ? -14.128 -58.986  -0.935  1.00 58.21  ? 256  ASP D CG  1 
ATOM   9867  O  OD1 . ASP D 1 253 ? -14.525 -57.808  -1.086  1.00 61.49  ? 256  ASP D OD1 1 
ATOM   9868  O  OD2 . ASP D 1 253 ? -14.911 -59.943  -0.750  1.00 59.08  ? 256  ASP D OD2 1 
ATOM   9869  N  N   . PHE D 1 254 ? -10.774 -62.199  -0.648  1.00 45.42  ? 257  PHE D N   1 
ATOM   9870  C  CA  . PHE D 1 254 ? -9.514  -62.860  -0.995  1.00 42.67  ? 257  PHE D CA  1 
ATOM   9871  C  C   . PHE D 1 254 ? -9.614  -63.592  -2.322  1.00 38.27  ? 257  PHE D C   1 
ATOM   9872  O  O   . PHE D 1 254 ? -10.715 -63.922  -2.793  1.00 36.81  ? 257  PHE D O   1 
ATOM   9873  C  CB  . PHE D 1 254 ? -9.093  -63.851  0.106   1.00 44.11  ? 257  PHE D CB  1 
ATOM   9874  C  CG  . PHE D 1 254 ? -9.030  -63.247  1.489   1.00 43.40  ? 257  PHE D CG  1 
ATOM   9875  C  CD1 . PHE D 1 254 ? -7.838  -62.723  1.979   1.00 42.61  ? 257  PHE D CD1 1 
ATOM   9876  C  CD2 . PHE D 1 254 ? -10.161 -63.218  2.304   1.00 42.28  ? 257  PHE D CD2 1 
ATOM   9877  C  CE1 . PHE D 1 254 ? -7.780  -62.169  3.250   1.00 43.88  ? 257  PHE D CE1 1 
ATOM   9878  C  CE2 . PHE D 1 254 ? -10.110 -62.666  3.573   1.00 40.63  ? 257  PHE D CE2 1 
ATOM   9879  C  CZ  . PHE D 1 254 ? -8.919  -62.143  4.049   1.00 43.16  ? 257  PHE D CZ  1 
ATOM   9880  N  N   . VAL D 1 255 ? -8.467  -63.832  -2.940  1.00 37.41  ? 258  VAL D N   1 
ATOM   9881  C  CA  . VAL D 1 255 ? -8.431  -64.851  -3.992  1.00 39.03  ? 258  VAL D CA  1 
ATOM   9882  C  C   . VAL D 1 255 ? -8.017  -66.188  -3.353  1.00 36.67  ? 258  VAL D C   1 
ATOM   9883  O  O   . VAL D 1 255 ? -8.603  -67.228  -3.653  1.00 37.03  ? 258  VAL D O   1 
ATOM   9884  C  CB  . VAL D 1 255 ? -7.607  -64.442  -5.257  1.00 39.76  ? 258  VAL D CB  1 
ATOM   9885  C  CG1 . VAL D 1 255 ? -7.368  -62.941  -5.297  1.00 38.92  ? 258  VAL D CG1 1 
ATOM   9886  C  CG2 . VAL D 1 255 ? -6.288  -65.200  -5.369  1.00 42.14  ? 258  VAL D CG2 1 
ATOM   9887  N  N   . LEU D 1 256 ? -7.047  -66.145  -2.436  1.00 35.82  ? 259  LEU D N   1 
ATOM   9888  C  CA  . LEU D 1 256 ? -6.616  -67.362  -1.737  1.00 36.22  ? 259  LEU D CA  1 
ATOM   9889  C  C   . LEU D 1 256 ? -6.052  -67.139  -0.331  1.00 35.69  ? 259  LEU D C   1 
ATOM   9890  O  O   . LEU D 1 256 ? -5.471  -66.084  -0.032  1.00 34.29  ? 259  LEU D O   1 
ATOM   9891  C  CB  . LEU D 1 256 ? -5.624  -68.173  -2.588  1.00 34.81  ? 259  LEU D CB  1 
ATOM   9892  C  CG  . LEU D 1 256 ? -4.313  -67.514  -3.046  1.00 34.08  ? 259  LEU D CG  1 
ATOM   9893  C  CD1 . LEU D 1 256 ? -3.248  -67.522  -1.964  1.00 35.20  ? 259  LEU D CD1 1 
ATOM   9894  C  CD2 . LEU D 1 256 ? -3.775  -68.207  -4.292  1.00 35.28  ? 259  LEU D CD2 1 
ATOM   9895  N  N   . VAL D 1 257 ? -6.262  -68.151  0.517   1.00 35.58  ? 260  VAL D N   1 
ATOM   9896  C  CA  . VAL D 1 257 ? -5.588  -68.299  1.808   1.00 33.04  ? 260  VAL D CA  1 
ATOM   9897  C  C   . VAL D 1 257 ? -4.862  -69.642  1.836   1.00 30.71  ? 260  VAL D C   1 
ATOM   9898  O  O   . VAL D 1 257 ? -5.434  -70.689  1.529   1.00 29.97  ? 260  VAL D O   1 
ATOM   9899  C  CB  . VAL D 1 257 ? -6.570  -68.210  3.001   1.00 33.87  ? 260  VAL D CB  1 
ATOM   9900  C  CG1 . VAL D 1 257 ? -5.827  -68.395  4.318   1.00 33.50  ? 260  VAL D CG1 1 
ATOM   9901  C  CG2 . VAL D 1 257 ? -7.286  -66.863  2.994   1.00 34.85  ? 260  VAL D CG2 1 
ATOM   9902  N  N   . LEU D 1 258 ? -3.595  -69.611  2.209   1.00 27.81  ? 261  LEU D N   1 
ATOM   9903  C  CA  . LEU D 1 258 ? -2.853  -70.834  2.293   1.00 27.54  ? 261  LEU D CA  1 
ATOM   9904  C  C   . LEU D 1 258 ? -2.007  -70.881  3.559   1.00 27.79  ? 261  LEU D C   1 
ATOM   9905  O  O   . LEU D 1 258 ? -1.152  -70.015  3.812   1.00 26.88  ? 261  LEU D O   1 
ATOM   9906  C  CB  . LEU D 1 258 ? -2.003  -71.020  1.039   1.00 26.40  ? 261  LEU D CB  1 
ATOM   9907  C  CG  . LEU D 1 258 ? -0.897  -72.053  1.091   1.00 26.25  ? 261  LEU D CG  1 
ATOM   9908  C  CD1 . LEU D 1 258 ? -1.488  -73.440  0.894   1.00 25.89  ? 261  LEU D CD1 1 
ATOM   9909  C  CD2 . LEU D 1 258 ? 0.169   -71.738  0.049   1.00 26.42  ? 261  LEU D CD2 1 
ATOM   9910  N  N   . ALA D 1 259 ? -2.287  -71.897  4.362   1.00 28.00  ? 262  ALA D N   1 
ATOM   9911  C  CA  . ALA D 1 259 ? -1.461  -72.235  5.498   1.00 26.51  ? 262  ALA D CA  1 
ATOM   9912  C  C   . ALA D 1 259 ? -0.631  -73.393  4.977   1.00 26.69  ? 262  ALA D C   1 
ATOM   9913  O  O   . ALA D 1 259 ? -1.177  -74.368  4.452   1.00 25.45  ? 262  ALA D O   1 
ATOM   9914  C  CB  . ALA D 1 259 ? -2.331  -72.661  6.668   1.00 26.88  ? 262  ALA D CB  1 
ATOM   9915  N  N   . LEU D 1 260 ? 0.684   -73.266  5.095   1.00 25.84  ? 263  LEU D N   1 
ATOM   9916  C  CA  . LEU D 1 260 ? 1.607   -74.181  4.460   1.00 26.05  ? 263  LEU D CA  1 
ATOM   9917  C  C   . LEU D 1 260 ? 2.743   -74.477  5.414   1.00 25.93  ? 263  LEU D C   1 
ATOM   9918  O  O   . LEU D 1 260 ? 3.316   -73.551  5.993   1.00 26.74  ? 263  LEU D O   1 
ATOM   9919  C  CB  . LEU D 1 260 ? 2.153   -73.558  3.159   1.00 25.92  ? 263  LEU D CB  1 
ATOM   9920  C  CG  . LEU D 1 260 ? 3.277   -74.319  2.431   1.00 27.36  ? 263  LEU D CG  1 
ATOM   9921  C  CD1 . LEU D 1 260 ? 2.892   -75.772  2.095   1.00 26.35  ? 263  LEU D CD1 1 
ATOM   9922  C  CD2 . LEU D 1 260 ? 3.738   -73.576  1.182   1.00 26.16  ? 263  LEU D CD2 1 
ATOM   9923  N  N   . LEU D 1 261 ? 3.090   -75.755  5.565   1.00 24.90  ? 264  LEU D N   1 
ATOM   9924  C  CA  . LEU D 1 261 ? 4.088   -76.141  6.553   1.00 23.96  ? 264  LEU D CA  1 
ATOM   9925  C  C   . LEU D 1 261 ? 5.457   -76.372  5.955   1.00 24.48  ? 264  LEU D C   1 
ATOM   9926  O  O   . LEU D 1 261 ? 6.445   -76.510  6.674   1.00 26.28  ? 264  LEU D O   1 
ATOM   9927  C  CB  . LEU D 1 261 ? 3.642   -77.393  7.310   1.00 24.27  ? 264  LEU D CB  1 
ATOM   9928  C  CG  . LEU D 1 261 ? 2.718   -77.240  8.531   1.00 25.21  ? 264  LEU D CG  1 
ATOM   9929  C  CD1 . LEU D 1 261 ? 1.315   -76.827  8.124   1.00 25.35  ? 264  LEU D CD1 1 
ATOM   9930  C  CD2 . LEU D 1 261 ? 2.668   -78.547  9.315   1.00 24.62  ? 264  LEU D CD2 1 
ATOM   9931  N  N   . HIS D 1 262 ? 5.532   -76.420  4.635   1.00 25.55  ? 265  HIS D N   1 
ATOM   9932  C  CA  . HIS D 1 262 ? 6.754   -76.855  3.974   1.00 25.67  ? 265  HIS D CA  1 
ATOM   9933  C  C   . HIS D 1 262 ? 7.050   -75.965  2.827   1.00 25.88  ? 265  HIS D C   1 
ATOM   9934  O  O   . HIS D 1 262 ? 6.273   -75.066  2.557   1.00 27.00  ? 265  HIS D O   1 
ATOM   9935  C  CB  . HIS D 1 262 ? 6.599   -78.295  3.504   1.00 23.92  ? 265  HIS D CB  1 
ATOM   9936  C  CG  . HIS D 1 262 ? 6.628   -79.293  4.623   1.00 23.66  ? 265  HIS D CG  1 
ATOM   9937  N  ND1 . HIS D 1 262 ? 7.778   -79.743  5.156   1.00 23.61  ? 265  HIS D ND1 1 
ATOM   9938  C  CD2 . HIS D 1 262 ? 5.596   -79.900  5.330   1.00 22.30  ? 265  HIS D CD2 1 
ATOM   9939  C  CE1 . HIS D 1 262 ? 7.494   -80.609  6.145   1.00 23.36  ? 265  HIS D CE1 1 
ATOM   9940  N  NE2 . HIS D 1 262 ? 6.154   -80.691  6.254   1.00 23.05  ? 265  HIS D NE2 1 
ATOM   9941  N  N   . SER D 1 263 ? 8.156   -76.219  2.132   1.00 27.48  ? 266  SER D N   1 
ATOM   9942  C  CA  . SER D 1 263 ? 8.580   -75.374  1.003   1.00 30.05  ? 266  SER D CA  1 
ATOM   9943  C  C   . SER D 1 263 ? 7.700   -75.494  -0.241  1.00 29.68  ? 266  SER D C   1 
ATOM   9944  O  O   . SER D 1 263 ? 7.477   -74.504  -0.941  1.00 31.46  ? 266  SER D O   1 
ATOM   9945  C  CB  . SER D 1 263 ? 10.041  -75.633  0.646   1.00 29.82  ? 266  SER D CB  1 
ATOM   9946  O  OG  . SER D 1 263 ? 10.223  -76.977  0.238   1.00 32.78  ? 266  SER D OG  1 
ATOM   9947  N  N   . HIS D 1 264 ? 7.162   -76.683  -0.492  1.00 29.45  ? 267  HIS D N   1 
ATOM   9948  C  CA  . HIS D 1 264 ? 6.455   -76.942  -1.753  1.00 28.87  ? 267  HIS D CA  1 
ATOM   9949  C  C   . HIS D 1 264 ? 4.985   -77.213  -1.633  1.00 29.36  ? 267  HIS D C   1 
ATOM   9950  O  O   . HIS D 1 264 ? 4.553   -77.960  -0.736  1.00 28.84  ? 267  HIS D O   1 
ATOM   9951  C  CB  . HIS D 1 264 ? 7.127   -78.080  -2.493  1.00 28.21  ? 267  HIS D CB  1 
ATOM   9952  C  CG  . HIS D 1 264 ? 8.453   -77.709  -3.079  1.00 28.73  ? 267  HIS D CG  1 
ATOM   9953  N  ND1 . HIS D 1 264 ? 9.554   -77.525  -2.321  1.00 29.79  ? 267  HIS D ND1 1 
ATOM   9954  C  CD2 . HIS D 1 264 ? 8.840   -77.484  -4.407  1.00 28.62  ? 267  HIS D CD2 1 
ATOM   9955  C  CE1 . HIS D 1 264 ? 10.596  -77.198  -3.120  1.00 30.16  ? 267  HIS D CE1 1 
ATOM   9956  N  NE2 . HIS D 1 264 ? 10.153  -77.178  -4.397  1.00 29.60  ? 267  HIS D NE2 1 
ATOM   9957  N  N   . LEU D 1 265 ? 4.215   -76.611  -2.544  1.00 27.96  ? 268  LEU D N   1 
ATOM   9958  C  CA  . LEU D 1 265 ? 2.796   -76.927  -2.737  1.00 29.88  ? 268  LEU D CA  1 
ATOM   9959  C  C   . LEU D 1 265 ? 2.600   -78.060  -3.737  1.00 31.41  ? 268  LEU D C   1 
ATOM   9960  O  O   . LEU D 1 265 ? 1.517   -78.642  -3.819  1.00 33.68  ? 268  LEU D O   1 
ATOM   9961  C  CB  . LEU D 1 265 ? 2.051   -75.737  -3.315  1.00 28.88  ? 268  LEU D CB  1 
ATOM   9962  C  CG  . LEU D 1 265 ? 1.304   -74.731  -2.462  1.00 30.19  ? 268  LEU D CG  1 
ATOM   9963  C  CD1 . LEU D 1 265 ? 0.769   -73.656  -3.400  1.00 29.28  ? 268  LEU D CD1 1 
ATOM   9964  C  CD2 . LEU D 1 265 ? 0.183   -75.370  -1.650  1.00 28.44  ? 268  LEU D CD2 1 
ATOM   9965  N  N   . GLY D 1 266 ? 3.634   -78.324  -4.532  1.00 31.48  ? 269  GLY D N   1 
ATOM   9966  C  CA  . GLY D 1 266 ? 3.616   -79.357  -5.556  1.00 30.71  ? 269  GLY D CA  1 
ATOM   9967  C  C   . GLY D 1 266 ? 5.050   -79.599  -5.947  1.00 31.16  ? 269  GLY D C   1 
ATOM   9968  O  O   . GLY D 1 266 ? 5.915   -78.783  -5.618  1.00 31.83  ? 269  GLY D O   1 
ATOM   9969  N  N   . SER D 1 267 ? 5.316   -80.703  -6.647  1.00 31.87  ? 270  SER D N   1 
ATOM   9970  C  CA  . SER D 1 267 ? 6.689   -81.031  -7.060  1.00 32.90  ? 270  SER D CA  1 
ATOM   9971  C  C   . SER D 1 267 ? 7.335   -79.993  -7.989  1.00 32.26  ? 270  SER D C   1 
ATOM   9972  O  O   . SER D 1 267 ? 8.545   -79.996  -8.171  1.00 33.79  ? 270  SER D O   1 
ATOM   9973  C  CB  . SER D 1 267 ? 6.803   -82.460  -7.638  1.00 34.16  ? 270  SER D CB  1 
ATOM   9974  O  OG  . SER D 1 267 ? 6.183   -82.568  -8.903  1.00 35.88  ? 270  SER D OG  1 
ATOM   9975  N  N   . GLU D 1 268 ? 6.538   -79.095  -8.557  1.00 34.21  ? 271  GLU D N   1 
ATOM   9976  C  CA  . GLU D 1 268 ? 7.099   -77.996  -9.355  1.00 36.48  ? 271  GLU D CA  1 
ATOM   9977  C  C   . GLU D 1 268 ? 6.577   -76.636  -8.900  1.00 36.71  ? 271  GLU D C   1 
ATOM   9978  O  O   . GLU D 1 268 ? 6.523   -75.691  -9.686  1.00 37.92  ? 271  GLU D O   1 
ATOM   9979  C  CB  . GLU D 1 268 ? 6.856   -78.223  -10.847 1.00 37.88  ? 271  GLU D CB  1 
ATOM   9980  C  CG  . GLU D 1 268 ? 7.774   -79.289  -11.442 1.00 40.99  ? 271  GLU D CG  1 
ATOM   9981  C  CD  . GLU D 1 268 ? 7.522   -79.585  -12.925 1.00 41.11  ? 271  GLU D CD  1 
ATOM   9982  O  OE1 . GLU D 1 268 ? 8.511   -79.882  -13.623 1.00 41.88  ? 271  GLU D OE1 1 
ATOM   9983  O  OE2 . GLU D 1 268 ? 6.357   -79.546  -13.392 1.00 41.50  ? 271  GLU D OE2 1 
ATOM   9984  N  N   . MET D 1 269 ? 6.202   -76.552  -7.620  1.00 36.66  ? 272  MET D N   1 
ATOM   9985  C  CA  . MET D 1 269 ? 5.645   -75.330  -7.024  1.00 35.38  ? 272  MET D CA  1 
ATOM   9986  C  C   . MET D 1 269 ? 6.419   -74.940  -5.761  1.00 35.03  ? 272  MET D C   1 
ATOM   9987  O  O   . MET D 1 269 ? 6.045   -75.315  -4.641  1.00 37.21  ? 272  MET D O   1 
ATOM   9988  C  CB  . MET D 1 269 ? 4.142   -75.496  -6.735  1.00 34.73  ? 272  MET D CB  1 
ATOM   9989  C  CG  . MET D 1 269 ? 3.303   -75.619  -7.993  1.00 35.23  ? 272  MET D CG  1 
ATOM   9990  S  SD  . MET D 1 269 ? 1.518   -75.587  -7.731  1.00 37.09  ? 272  MET D SD  1 
ATOM   9991  C  CE  . MET D 1 269 ? 1.222   -77.338  -7.488  1.00 36.56  ? 272  MET D CE  1 
ATOM   9992  N  N   . PHE D 1 270 ? 7.511   -74.204  -5.952  1.00 31.89  ? 273  PHE D N   1 
ATOM   9993  C  CA  . PHE D 1 270 ? 8.374   -73.792  -4.858  1.00 33.07  ? 273  PHE D CA  1 
ATOM   9994  C  C   . PHE D 1 270 ? 7.668   -72.624  -4.173  1.00 33.80  ? 273  PHE D C   1 
ATOM   9995  O  O   . PHE D 1 270 ? 7.950   -71.462  -4.469  1.00 33.66  ? 273  PHE D O   1 
ATOM   9996  C  CB  . PHE D 1 270 ? 9.728   -73.365  -5.424  1.00 32.28  ? 273  PHE D CB  1 
ATOM   9997  C  CG  . PHE D 1 270 ? 10.807  -73.201  -4.397  1.00 32.56  ? 273  PHE D CG  1 
ATOM   9998  C  CD1 . PHE D 1 270 ? 10.541  -73.322  -3.036  1.00 32.93  ? 273  PHE D CD1 1 
ATOM   9999  C  CD2 . PHE D 1 270 ? 12.102  -72.886  -4.797  1.00 32.91  ? 273  PHE D CD2 1 
ATOM   10000 C  CE1 . PHE D 1 270 ? 11.548  -73.168  -2.096  1.00 32.60  ? 273  PHE D CE1 1 
ATOM   10001 C  CE2 . PHE D 1 270 ? 13.116  -72.730  -3.867  1.00 33.89  ? 273  PHE D CE2 1 
ATOM   10002 C  CZ  . PHE D 1 270 ? 12.840  -72.867  -2.510  1.00 33.92  ? 273  PHE D CZ  1 
ATOM   10003 N  N   . ALA D 1 271 ? 6.732   -72.932  -3.277  1.00 32.07  ? 274  ALA D N   1 
ATOM   10004 C  CA  . ALA D 1 271 ? 5.806   -71.905  -2.798  1.00 31.58  ? 274  ALA D CA  1 
ATOM   10005 C  C   . ALA D 1 271 ? 6.404   -71.020  -1.710  1.00 29.99  ? 274  ALA D C   1 
ATOM   10006 O  O   . ALA D 1 271 ? 6.012   -69.879  -1.548  1.00 31.77  ? 274  ALA D O   1 
ATOM   10007 C  CB  . ALA D 1 271 ? 4.496   -72.526  -2.337  1.00 31.86  ? 274  ALA D CB  1 
ATOM   10008 N  N   . ALA D 1 272 ? 7.381   -71.536  -0.987  1.00 29.83  ? 275  ALA D N   1 
ATOM   10009 C  CA  . ALA D 1 272 ? 7.926   -70.821  0.147   1.00 29.98  ? 275  ALA D CA  1 
ATOM   10010 C  C   . ALA D 1 272 ? 9.442   -70.858  0.087   1.00 32.46  ? 275  ALA D C   1 
ATOM   10011 O  O   . ALA D 1 272 ? 10.076  -71.709  0.727   1.00 33.13  ? 275  ALA D O   1 
ATOM   10012 C  CB  . ALA D 1 272 ? 7.410   -71.423  1.447   1.00 31.41  ? 275  ALA D CB  1 
ATOM   10013 N  N   . PRO D 1 273 ? 10.029  -69.936  -0.711  1.00 34.43  ? 276  PRO D N   1 
ATOM   10014 C  CA  . PRO D 1 273 ? 11.471  -69.850  -0.937  1.00 34.53  ? 276  PRO D CA  1 
ATOM   10015 C  C   . PRO D 1 273 ? 12.251  -69.208  0.201   1.00 36.47  ? 276  PRO D C   1 
ATOM   10016 O  O   . PRO D 1 273 ? 13.482  -69.308  0.230   1.00 39.09  ? 276  PRO D O   1 
ATOM   10017 C  CB  . PRO D 1 273 ? 11.572  -68.975  -2.187  1.00 34.83  ? 276  PRO D CB  1 
ATOM   10018 C  CG  . PRO D 1 273 ? 10.351  -68.121  -2.141  1.00 33.77  ? 276  PRO D CG  1 
ATOM   10019 C  CD  . PRO D 1 273 ? 9.283   -68.997  -1.577  1.00 32.89  ? 276  PRO D CD  1 
ATOM   10020 N  N   . MET D 1 274 ? 11.565  -68.525  1.113   1.00 37.22  ? 277  MET D N   1 
ATOM   10021 C  CA  . MET D 1 274 ? 12.215  -68.129  2.339   1.00 38.16  ? 277  MET D CA  1 
ATOM   10022 C  C   . MET D 1 274 ? 12.504  -69.468  3.023   1.00 40.19  ? 277  MET D C   1 
ATOM   10023 O  O   . MET D 1 274 ? 12.002  -70.504  2.580   1.00 44.94  ? 277  MET D O   1 
ATOM   10024 C  CB  . MET D 1 274 ? 11.335  -67.170  3.152   1.00 37.51  ? 277  MET D CB  1 
ATOM   10025 C  CG  . MET D 1 274 ? 10.064  -67.752  3.761   1.00 37.20  ? 277  MET D CG  1 
ATOM   10026 S  SD  . MET D 1 274 ? 8.854   -68.411  2.596   1.00 38.04  ? 277  MET D SD  1 
ATOM   10027 C  CE  . MET D 1 274 ? 8.145   -66.926  1.870   1.00 37.75  ? 277  MET D CE  1 
ATOM   10028 N  N   . GLY D 1 275 ? 13.341  -69.483  4.045   1.00 38.52  ? 278  GLY D N   1 
ATOM   10029 C  CA  . GLY D 1 275 ? 13.823  -70.766  4.567   1.00 36.45  ? 278  GLY D CA  1 
ATOM   10030 C  C   . GLY D 1 275 ? 12.798  -71.753  5.130   1.00 35.87  ? 278  GLY D C   1 
ATOM   10031 O  O   . GLY D 1 275 ? 11.610  -71.448  5.293   1.00 33.10  ? 278  GLY D O   1 
ATOM   10032 N  N   . ARG D 1 276 ? 13.286  -72.960  5.399   1.00 35.40  ? 279  ARG D N   1 
ATOM   10033 C  CA  . ARG D 1 276 ? 12.560  -73.972  6.130   1.00 35.94  ? 279  ARG D CA  1 
ATOM   10034 C  C   . ARG D 1 276 ? 11.976  -73.426  7.453   1.00 35.39  ? 279  ARG D C   1 
ATOM   10035 O  O   . ARG D 1 276 ? 12.658  -72.731  8.218   1.00 34.17  ? 279  ARG D O   1 
ATOM   10036 C  CB  . ARG D 1 276 ? 13.516  -75.124  6.405   1.00 37.98  ? 279  ARG D CB  1 
ATOM   10037 C  CG  . ARG D 1 276 ? 12.825  -76.454  6.576   1.00 41.07  ? 279  ARG D CG  1 
ATOM   10038 C  CD  . ARG D 1 276 ? 13.818  -77.595  6.681   1.00 43.12  ? 279  ARG D CD  1 
ATOM   10039 N  NE  . ARG D 1 276 ? 13.231  -78.675  7.470   1.00 46.87  ? 279  ARG D NE  1 
ATOM   10040 C  CZ  . ARG D 1 276 ? 13.874  -79.767  7.877   1.00 47.88  ? 279  ARG D CZ  1 
ATOM   10041 N  NH1 . ARG D 1 276 ? 15.152  -79.954  7.567   1.00 48.50  ? 279  ARG D NH1 1 
ATOM   10042 N  NH2 . ARG D 1 276 ? 13.228  -80.674  8.605   1.00 47.58  ? 279  ARG D NH2 1 
ATOM   10043 N  N   . CYS D 1 277 ? 10.714  -73.741  7.719   1.00 34.77  ? 280  CYS D N   1 
ATOM   10044 C  CA  . CYS D 1 277 ? 10.068  -73.328  8.974   1.00 35.19  ? 280  CYS D CA  1 
ATOM   10045 C  C   . CYS D 1 277 ? 10.806  -73.765  10.240  1.00 33.68  ? 280  CYS D C   1 
ATOM   10046 O  O   . CYS D 1 277 ? 11.349  -74.876  10.306  1.00 33.52  ? 280  CYS D O   1 
ATOM   10047 C  CB  . CYS D 1 277 ? 8.654   -73.890  9.052   1.00 34.77  ? 280  CYS D CB  1 
ATOM   10048 S  SG  . CYS D 1 277 ? 7.513   -73.221  7.842   1.00 38.35  ? 280  CYS D SG  1 
ATOM   10049 N  N   . ALA D 1 278 ? 10.784  -72.891  11.247  1.00 30.97  ? 281  ALA D N   1 
ATOM   10050 C  CA  . ALA D 1 278 ? 11.251  -73.214  12.591  1.00 29.66  ? 281  ALA D CA  1 
ATOM   10051 C  C   . ALA D 1 278 ? 10.256  -74.157  13.304  1.00 28.31  ? 281  ALA D C   1 
ATOM   10052 O  O   . ALA D 1 278 ? 9.112   -74.306  12.882  1.00 28.30  ? 281  ALA D O   1 
ATOM   10053 C  CB  . ALA D 1 278 ? 11.428  -71.927  13.401  1.00 28.22  ? 281  ALA D CB  1 
ATOM   10054 N  N   . ALA D 1 279 ? 10.686  -74.751  14.408  1.00 27.28  ? 282  ALA D N   1 
ATOM   10055 C  CA  . ALA D 1 279 ? 9.819   -75.614  15.205  1.00 27.12  ? 282  ALA D CA  1 
ATOM   10056 C  C   . ALA D 1 279 ? 8.595   -74.846  15.684  1.00 26.47  ? 282  ALA D C   1 
ATOM   10057 O  O   . ALA D 1 279 ? 8.729   -73.848  16.395  1.00 28.32  ? 282  ALA D O   1 
ATOM   10058 C  CB  . ALA D 1 279 ? 10.586  -76.172  16.393  1.00 25.51  ? 282  ALA D CB  1 
ATOM   10059 N  N   . GLY D 1 280 ? 7.414   -75.311  15.291  1.00 25.73  ? 283  GLY D N   1 
ATOM   10060 C  CA  . GLY D 1 280 ? 6.139   -74.747  15.770  1.00 25.49  ? 283  GLY D CA  1 
ATOM   10061 C  C   . GLY D 1 280 ? 5.671   -73.561  14.931  1.00 25.27  ? 283  GLY D C   1 
ATOM   10062 O  O   . GLY D 1 280 ? 4.748   -72.837  15.313  1.00 24.96  ? 283  GLY D O   1 
ATOM   10063 N  N   . VAL D 1 281 ? 6.330   -73.367  13.794  1.00 23.13  ? 284  VAL D N   1 
ATOM   10064 C  CA  . VAL D 1 281 ? 6.019   -72.296  12.871  1.00 23.97  ? 284  VAL D CA  1 
ATOM   10065 C  C   . VAL D 1 281 ? 5.580   -72.919  11.537  1.00 23.48  ? 284  VAL D C   1 
ATOM   10066 O  O   . VAL D 1 281 ? 6.071   -73.974  11.147  1.00 23.29  ? 284  VAL D O   1 
ATOM   10067 C  CB  . VAL D 1 281 ? 7.265   -71.400  12.644  1.00 24.68  ? 284  VAL D CB  1 
ATOM   10068 C  CG1 . VAL D 1 281 ? 6.965   -70.242  11.700  1.00 24.28  ? 284  VAL D CG1 1 
ATOM   10069 C  CG2 . VAL D 1 281 ? 7.798   -70.868  13.973  1.00 24.13  ? 284  VAL D CG2 1 
ATOM   10070 N  N   . MET D 1 282 ? 4.635   -72.267  10.871  1.00 23.51  ? 285  MET D N   1 
ATOM   10071 C  CA  . MET D 1 282 ? 4.254   -72.599  9.512   1.00 23.37  ? 285  MET D CA  1 
ATOM   10072 C  C   . MET D 1 282 ? 4.109   -71.281  8.719   1.00 24.15  ? 285  MET D C   1 
ATOM   10073 O  O   . MET D 1 282 ? 4.127   -70.188  9.318   1.00 23.01  ? 285  MET D O   1 
ATOM   10074 C  CB  . MET D 1 282 ? 2.948   -73.372  9.519   1.00 23.75  ? 285  MET D CB  1 
ATOM   10075 C  CG  . MET D 1 282 ? 1.787   -72.492  9.889   1.00 24.12  ? 285  MET D CG  1 
ATOM   10076 S  SD  . MET D 1 282 ? 0.220   -73.324  9.961   1.00 27.28  ? 285  MET D SD  1 
ATOM   10077 C  CE  . MET D 1 282 ? 0.041   -73.932  8.303   1.00 30.83  ? 285  MET D CE  1 
ATOM   10078 N  N   . HIS D 1 283 ? 3.982   -71.398  7.387   1.00 23.47  ? 286  HIS D N   1 
ATOM   10079 C  CA  . HIS D 1 283 ? 3.802   -70.259  6.489   1.00 24.10  ? 286  HIS D CA  1 
ATOM   10080 C  C   . HIS D 1 283 ? 2.355   -69.977  6.336   1.00 24.38  ? 286  HIS D C   1 
ATOM   10081 O  O   . HIS D 1 283 ? 1.568   -70.899  6.208   1.00 22.99  ? 286  HIS D O   1 
ATOM   10082 C  CB  . HIS D 1 283 ? 4.389   -70.554  5.107   1.00 24.58  ? 286  HIS D CB  1 
ATOM   10083 C  CG  . HIS D 1 283 ? 5.840   -70.967  5.139   1.00 25.14  ? 286  HIS D CG  1 
ATOM   10084 N  ND1 . HIS D 1 283 ? 6.249   -72.218  4.819   1.00 26.35  ? 286  HIS D ND1 1 
ATOM   10085 C  CD2 . HIS D 1 283 ? 6.978   -70.259  5.493   1.00 24.11  ? 286  HIS D CD2 1 
ATOM   10086 C  CE1 . HIS D 1 283 ? 7.589   -72.293  4.951   1.00 25.17  ? 286  HIS D CE1 1 
ATOM   10087 N  NE2 . HIS D 1 283 ? 8.031   -71.092  5.365   1.00 25.36  ? 286  HIS D NE2 1 
ATOM   10088 N  N   . LEU D 1 284 ? 1.991   -68.694  6.360   1.00 25.42  ? 287  LEU D N   1 
ATOM   10089 C  CA  . LEU D 1 284 ? 0.642   -68.273  5.997   1.00 27.72  ? 287  LEU D CA  1 
ATOM   10090 C  C   . LEU D 1 284 ? 0.685   -67.246  4.861   1.00 29.11  ? 287  LEU D C   1 
ATOM   10091 O  O   . LEU D 1 284 ? 1.315   -66.200  4.978   1.00 30.90  ? 287  LEU D O   1 
ATOM   10092 C  CB  . LEU D 1 284 ? -0.122  -67.709  7.198   1.00 26.72  ? 287  LEU D CB  1 
ATOM   10093 C  CG  . LEU D 1 284 ? -1.561  -67.262  6.917   1.00 27.78  ? 287  LEU D CG  1 
ATOM   10094 C  CD1 . LEU D 1 284 ? -2.499  -68.440  6.720   1.00 28.08  ? 287  LEU D CD1 1 
ATOM   10095 C  CD2 . LEU D 1 284 ? -2.096  -66.384  8.031   1.00 28.60  ? 287  LEU D CD2 1 
ATOM   10096 N  N   . PHE D 1 285 ? 0.022   -67.574  3.759   1.00 30.39  ? 288  PHE D N   1 
ATOM   10097 C  CA  . PHE D 1 285 ? -0.048  -66.709  2.590   1.00 30.08  ? 288  PHE D CA  1 
ATOM   10098 C  C   . PHE D 1 285 ? -1.503  -66.358  2.400   1.00 31.19  ? 288  PHE D C   1 
ATOM   10099 O  O   . PHE D 1 285 ? -2.387  -67.161  2.688   1.00 31.55  ? 288  PHE D O   1 
ATOM   10100 C  CB  . PHE D 1 285 ? 0.411   -67.445  1.325   1.00 28.69  ? 288  PHE D CB  1 
ATOM   10101 C  CG  . PHE D 1 285 ? 1.869   -67.824  1.305   1.00 28.16  ? 288  PHE D CG  1 
ATOM   10102 C  CD1 . PHE D 1 285 ? 2.829   -66.933  0.853   1.00 27.48  ? 288  PHE D CD1 1 
ATOM   10103 C  CD2 . PHE D 1 285 ? 2.276   -69.100  1.679   1.00 29.27  ? 288  PHE D CD2 1 
ATOM   10104 C  CE1 . PHE D 1 285 ? 4.171   -67.291  0.802   1.00 29.35  ? 288  PHE D CE1 1 
ATOM   10105 C  CE2 . PHE D 1 285 ? 3.623   -69.471  1.623   1.00 30.93  ? 288  PHE D CE2 1 
ATOM   10106 C  CZ  . PHE D 1 285 ? 4.574   -68.568  1.186   1.00 29.68  ? 288  PHE D CZ  1 
ATOM   10107 N  N   . TYR D 1 286 ? -1.755  -65.147  1.921   1.00 33.62  ? 289  TYR D N   1 
ATOM   10108 C  CA  . TYR D 1 286 ? -3.063  -64.816  1.375   1.00 35.19  ? 289  TYR D CA  1 
ATOM   10109 C  C   . TYR D 1 286 ? -2.924  -63.772  0.274   1.00 36.04  ? 289  TYR D C   1 
ATOM   10110 O  O   . TYR D 1 286 ? -1.978  -62.975  0.267   1.00 33.19  ? 289  TYR D O   1 
ATOM   10111 C  CB  . TYR D 1 286 ? -4.073  -64.399  2.462   1.00 34.73  ? 289  TYR D CB  1 
ATOM   10112 C  CG  . TYR D 1 286 ? -3.741  -63.129  3.212   1.00 37.32  ? 289  TYR D CG  1 
ATOM   10113 C  CD1 . TYR D 1 286 ? -4.250  -61.887  2.792   1.00 41.07  ? 289  TYR D CD1 1 
ATOM   10114 C  CD2 . TYR D 1 286 ? -2.938  -63.158  4.346   1.00 36.84  ? 289  TYR D CD2 1 
ATOM   10115 C  CE1 . TYR D 1 286 ? -3.957  -60.717  3.486   1.00 40.16  ? 289  TYR D CE1 1 
ATOM   10116 C  CE2 . TYR D 1 286 ? -2.646  -62.004  5.046   1.00 38.41  ? 289  TYR D CE2 1 
ATOM   10117 C  CZ  . TYR D 1 286 ? -3.155  -60.793  4.610   1.00 40.50  ? 289  TYR D CZ  1 
ATOM   10118 O  OH  . TYR D 1 286 ? -2.854  -59.661  5.304   1.00 40.58  ? 289  TYR D OH  1 
ATOM   10119 N  N   . VAL D 1 287 ? -3.846  -63.820  -0.683  1.00 38.51  ? 290  VAL D N   1 
ATOM   10120 C  CA  . VAL D 1 287 ? -3.882  -62.829  -1.736  1.00 39.67  ? 290  VAL D CA  1 
ATOM   10121 C  C   . VAL D 1 287 ? -5.188  -62.067  -1.619  1.00 40.99  ? 290  VAL D C   1 
ATOM   10122 O  O   . VAL D 1 287 ? -6.266  -62.648  -1.737  1.00 41.89  ? 290  VAL D O   1 
ATOM   10123 C  CB  . VAL D 1 287 ? -3.711  -63.453  -3.136  1.00 39.72  ? 290  VAL D CB  1 
ATOM   10124 C  CG1 . VAL D 1 287 ? -3.847  -62.381  -4.211  1.00 40.01  ? 290  VAL D CG1 1 
ATOM   10125 C  CG2 . VAL D 1 287 ? -2.350  -64.107  -3.254  1.00 38.53  ? 290  VAL D CG2 1 
ATOM   10126 N  N   . ARG D 1 288 ? -5.081  -60.769  -1.353  1.00 44.52  ? 291  ARG D N   1 
ATOM   10127 C  CA  . ARG D 1 288 ? -6.262  -59.917  -1.222  1.00 51.43  ? 291  ARG D CA  1 
ATOM   10128 C  C   . ARG D 1 288 ? -6.803  -59.518  -2.597  1.00 52.58  ? 291  ARG D C   1 
ATOM   10129 O  O   . ARG D 1 288 ? -6.032  -59.316  -3.548  1.00 50.52  ? 291  ARG D O   1 
ATOM   10130 C  CB  . ARG D 1 288 ? -5.985  -58.693  -0.320  1.00 56.16  ? 291  ARG D CB  1 
ATOM   10131 C  CG  . ARG D 1 288 ? -4.733  -57.901  -0.662  1.00 60.88  ? 291  ARG D CG  1 
ATOM   10132 C  CD  . ARG D 1 288 ? -4.001  -57.409  0.577   1.00 67.19  ? 291  ARG D CD  1 
ATOM   10133 N  NE  . ARG D 1 288 ? -4.460  -56.103  1.052   1.00 75.44  ? 291  ARG D NE  1 
ATOM   10134 C  CZ  . ARG D 1 288 ? -3.794  -55.336  1.921   1.00 80.53  ? 291  ARG D CZ  1 
ATOM   10135 N  NH1 . ARG D 1 288 ? -2.622  -55.727  2.420   1.00 80.64  ? 291  ARG D NH1 1 
ATOM   10136 N  NH2 . ARG D 1 288 ? -4.297  -54.164  2.295   1.00 82.26  ? 291  ARG D NH2 1 
ATOM   10137 N  N   . ALA D 1 289 ? -8.130  -59.437  -2.693  1.00 53.70  ? 292  ALA D N   1 
ATOM   10138 C  CA  . ALA D 1 289 ? -8.826  -59.048  -3.924  1.00 55.05  ? 292  ALA D CA  1 
ATOM   10139 C  C   . ALA D 1 289 ? -8.258  -57.784  -4.575  1.00 56.02  ? 292  ALA D C   1 
ATOM   10140 O  O   . ALA D 1 289 ? -7.752  -56.886  -3.893  1.00 54.28  ? 292  ALA D O   1 
ATOM   10141 C  CB  . ALA D 1 289 ? -10.310 -58.872  -3.658  1.00 55.33  ? 292  ALA D CB  1 
ATOM   10142 N  N   . GLY D 1 290 ? -8.340  -57.726  -5.900  1.00 55.89  ? 293  GLY D N   1 
ATOM   10143 C  CA  . GLY D 1 290 ? -7.890  -56.550  -6.626  1.00 57.79  ? 293  GLY D CA  1 
ATOM   10144 C  C   . GLY D 1 290 ? -6.546  -56.739  -7.296  1.00 59.45  ? 293  GLY D C   1 
ATOM   10145 O  O   . GLY D 1 290 ? -5.911  -55.763  -7.703  1.00 59.19  ? 293  GLY D O   1 
ATOM   10146 N  N   . VAL D 1 291 ? -6.101  -57.990  -7.393  1.00 57.18  ? 294  VAL D N   1 
ATOM   10147 C  CA  . VAL D 1 291 ? -4.994  -58.323  -8.275  1.00 53.15  ? 294  VAL D CA  1 
ATOM   10148 C  C   . VAL D 1 291 ? -5.546  -58.599  -9.647  1.00 53.61  ? 294  VAL D C   1 
ATOM   10149 O  O   . VAL D 1 291 ? -6.615  -59.215  -9.796  1.00 50.08  ? 294  VAL D O   1 
ATOM   10150 C  CB  . VAL D 1 291 ? -4.228  -59.592  -7.864  1.00 52.27  ? 294  VAL D CB  1 
ATOM   10151 C  CG1 . VAL D 1 291 ? -2.927  -59.233  -7.178  1.00 51.78  ? 294  VAL D CG1 1 
ATOM   10152 C  CG2 . VAL D 1 291 ? -5.106  -60.515  -7.038  1.00 49.78  ? 294  VAL D CG2 1 
ATOM   10153 N  N   . SER D 1 292 ? -4.798  -58.151  -10.648 1.00 55.57  ? 295  SER D N   1 
ATOM   10154 C  CA  . SER D 1 292 ? -5.099  -58.476  -12.030 1.00 55.05  ? 295  SER D CA  1 
ATOM   10155 C  C   . SER D 1 292 ? -4.789  -59.947  -12.264 1.00 55.07  ? 295  SER D C   1 
ATOM   10156 O  O   . SER D 1 292 ? -3.871  -60.504  -11.637 1.00 51.65  ? 295  SER D O   1 
ATOM   10157 C  CB  . SER D 1 292 ? -4.293  -57.589  -12.984 1.00 55.34  ? 295  SER D CB  1 
ATOM   10158 O  OG  . SER D 1 292 ? -2.898  -57.701  -12.754 1.00 52.76  ? 295  SER D OG  1 
ATOM   10159 N  N   . ARG D 1 293 ? -5.578  -60.564  -13.145 1.00 55.61  ? 296  ARG D N   1 
ATOM   10160 C  CA  . ARG D 1 293 ? -5.362  -61.937  -13.592 1.00 55.91  ? 296  ARG D CA  1 
ATOM   10161 C  C   . ARG D 1 293 ? -3.914  -62.131  -14.046 1.00 58.33  ? 296  ARG D C   1 
ATOM   10162 O  O   . ARG D 1 293 ? -3.280  -63.135  -13.714 1.00 60.12  ? 296  ARG D O   1 
ATOM   10163 C  CB  . ARG D 1 293 ? -6.290  -62.260  -14.755 1.00 55.14  ? 296  ARG D CB  1 
ATOM   10164 C  CG  . ARG D 1 293 ? -7.769  -62.247  -14.435 1.00 57.95  ? 296  ARG D CG  1 
ATOM   10165 C  CD  . ARG D 1 293 ? -8.569  -62.209  -15.732 1.00 62.15  ? 296  ARG D CD  1 
ATOM   10166 N  NE  . ARG D 1 293 ? -9.803  -63.000  -15.671 1.00 66.32  ? 296  ARG D NE  1 
ATOM   10167 C  CZ  . ARG D 1 293 ? -10.920 -62.622  -15.046 1.00 67.95  ? 296  ARG D CZ  1 
ATOM   10168 N  NH1 . ARG D 1 293 ? -11.992 -63.408  -15.052 1.00 60.37  ? 296  ARG D NH1 1 
ATOM   10169 N  NH2 . ARG D 1 293 ? -10.968 -61.461  -14.402 1.00 70.89  ? 296  ARG D NH2 1 
ATOM   10170 N  N   . ALA D 1 294 ? -3.405  -61.158  -14.801 1.00 56.30  ? 297  ALA D N   1 
ATOM   10171 C  CA  . ALA D 1 294 ? -2.036  -61.188  -15.305 1.00 57.64  ? 297  ALA D CA  1 
ATOM   10172 C  C   . ALA D 1 294 ? -1.014  -61.295  -14.174 1.00 57.56  ? 297  ALA D C   1 
ATOM   10173 O  O   . ALA D 1 294 ? -0.073  -62.094  -14.251 1.00 55.92  ? 297  ALA D O   1 
ATOM   10174 C  CB  . ALA D 1 294 ? -1.757  -59.954  -16.161 1.00 56.84  ? 297  ALA D CB  1 
ATOM   10175 N  N   . MET D 1 295 ? -1.203  -60.489  -13.129 1.00 57.82  ? 298  MET D N   1 
ATOM   10176 C  CA  . MET D 1 295 ? -0.295  -60.504  -11.983 1.00 60.50  ? 298  MET D CA  1 
ATOM   10177 C  C   . MET D 1 295 ? -0.359  -61.830  -11.234 1.00 57.08  ? 298  MET D C   1 
ATOM   10178 O  O   . MET D 1 295 ? 0.673   -62.356  -10.814 1.00 57.30  ? 298  MET D O   1 
ATOM   10179 C  CB  . MET D 1 295 ? -0.560  -59.331  -11.035 1.00 63.39  ? 298  MET D CB  1 
ATOM   10180 C  CG  . MET D 1 295 ? 0.612   -59.013  -10.117 1.00 68.25  ? 298  MET D CG  1 
ATOM   10181 S  SD  . MET D 1 295 ? 2.219   -59.306  -10.895 1.00 78.15  ? 298  MET D SD  1 
ATOM   10182 C  CE  . MET D 1 295 ? 3.280   -58.276  -9.876  1.00 76.75  ? 298  MET D CE  1 
ATOM   10183 N  N   . LEU D 1 296 ? -1.568  -62.369  -11.096 1.00 55.18  ? 299  LEU D N   1 
ATOM   10184 C  CA  . LEU D 1 296 ? -1.773  -63.676  -10.474 1.00 54.48  ? 299  LEU D CA  1 
ATOM   10185 C  C   . LEU D 1 296 ? -1.026  -64.773  -11.251 1.00 49.69  ? 299  LEU D C   1 
ATOM   10186 O  O   . LEU D 1 296 ? -0.325  -65.594  -10.653 1.00 46.66  ? 299  LEU D O   1 
ATOM   10187 C  CB  . LEU D 1 296 ? -3.273  -63.982  -10.363 1.00 53.94  ? 299  LEU D CB  1 
ATOM   10188 C  CG  . LEU D 1 296 ? -3.782  -64.510  -9.013  1.00 59.93  ? 299  LEU D CG  1 
ATOM   10189 C  CD1 . LEU D 1 296 ? -5.120  -63.879  -8.653  1.00 58.43  ? 299  LEU D CD1 1 
ATOM   10190 C  CD2 . LEU D 1 296 ? -3.878  -66.029  -8.979  1.00 58.39  ? 299  LEU D CD2 1 
ATOM   10191 N  N   . LEU D 1 297 ? -1.156  -64.751  -12.578 1.00 46.88  ? 300  LEU D N   1 
ATOM   10192 C  CA  . LEU D 1 297 ? -0.490  -65.721  -13.450 1.00 47.24  ? 300  LEU D CA  1 
ATOM   10193 C  C   . LEU D 1 297 ? 1.028   -65.622  -13.369 1.00 47.26  ? 300  LEU D C   1 
ATOM   10194 O  O   . LEU D 1 297 ? 1.721   -66.636  -13.209 1.00 44.68  ? 300  LEU D O   1 
ATOM   10195 C  CB  . LEU D 1 297 ? -0.934  -65.532  -14.895 1.00 49.96  ? 300  LEU D CB  1 
ATOM   10196 C  CG  . LEU D 1 297 ? -0.200  -66.375  -15.946 1.00 52.22  ? 300  LEU D CG  1 
ATOM   10197 C  CD1 . LEU D 1 297 ? -0.525  -67.863  -15.812 1.00 48.45  ? 300  LEU D CD1 1 
ATOM   10198 C  CD2 . LEU D 1 297 ? -0.516  -65.846  -17.345 1.00 53.82  ? 300  LEU D CD2 1 
ATOM   10199 N  N   . ARG D 1 298 ? 1.536   -64.397  -13.501 1.00 48.55  ? 301  ARG D N   1 
ATOM   10200 C  CA  . ARG D 1 298 ? 2.946   -64.110  -13.267 1.00 49.83  ? 301  ARG D CA  1 
ATOM   10201 C  C   . ARG D 1 298 ? 3.416   -64.705  -11.939 1.00 47.26  ? 301  ARG D C   1 
ATOM   10202 O  O   . ARG D 1 298 ? 4.481   -65.328  -11.886 1.00 42.78  ? 301  ARG D O   1 
ATOM   10203 C  CB  . ARG D 1 298 ? 3.219   -62.600  -13.308 1.00 55.20  ? 301  ARG D CB  1 
ATOM   10204 C  CG  . ARG D 1 298 ? 3.354   -62.005  -14.711 1.00 63.57  ? 301  ARG D CG  1 
ATOM   10205 C  CD  . ARG D 1 298 ? 4.510   -62.628  -15.493 1.00 71.06  ? 301  ARG D CD  1 
ATOM   10206 N  NE  . ARG D 1 298 ? 5.032   -61.744  -16.543 1.00 77.03  ? 301  ARG D NE  1 
ATOM   10207 C  CZ  . ARG D 1 298 ? 6.228   -61.150  -16.526 1.00 76.78  ? 301  ARG D CZ  1 
ATOM   10208 N  NH1 . ARG D 1 298 ? 7.071   -61.330  -15.514 1.00 73.86  ? 301  ARG D NH1 1 
ATOM   10209 N  NH2 . ARG D 1 298 ? 6.587   -60.368  -17.536 1.00 79.67  ? 301  ARG D NH2 1 
ATOM   10210 N  N   . LEU D 1 299 ? 2.616   -64.518  -10.882 1.00 45.72  ? 302  LEU D N   1 
ATOM   10211 C  CA  . LEU D 1 299 ? 2.926   -65.083  -9.553  1.00 43.47  ? 302  LEU D CA  1 
ATOM   10212 C  C   . LEU D 1 299 ? 2.970   -66.615  -9.613  1.00 40.54  ? 302  LEU D C   1 
ATOM   10213 O  O   . LEU D 1 299 ? 3.955   -67.230  -9.190  1.00 37.69  ? 302  LEU D O   1 
ATOM   10214 C  CB  . LEU D 1 299 ? 1.939   -64.602  -8.472  1.00 42.74  ? 302  LEU D CB  1 
ATOM   10215 C  CG  . LEU D 1 299 ? 2.074   -63.186  -7.895  1.00 44.99  ? 302  LEU D CG  1 
ATOM   10216 C  CD1 . LEU D 1 299 ? 0.993   -62.928  -6.859  1.00 45.80  ? 302  LEU D CD1 1 
ATOM   10217 C  CD2 . LEU D 1 299 ? 3.449   -62.903  -7.296  1.00 44.96  ? 302  LEU D CD2 1 
ATOM   10218 N  N   . PHE D 1 300 ? 1.918   -67.216  -10.163 1.00 37.76  ? 303  PHE D N   1 
ATOM   10219 C  CA  . PHE D 1 300 ? 1.874   -68.663  -10.344 1.00 39.34  ? 303  PHE D CA  1 
ATOM   10220 C  C   . PHE D 1 300 ? 3.105   -69.242  -11.050 1.00 40.22  ? 303  PHE D C   1 
ATOM   10221 O  O   . PHE D 1 300 ? 3.593   -70.305  -10.668 1.00 42.75  ? 303  PHE D O   1 
ATOM   10222 C  CB  . PHE D 1 300 ? 0.607   -69.079  -11.096 1.00 39.38  ? 303  PHE D CB  1 
ATOM   10223 C  CG  . PHE D 1 300 ? 0.503   -70.557  -11.324 1.00 41.78  ? 303  PHE D CG  1 
ATOM   10224 C  CD1 . PHE D 1 300 ? 0.228   -71.422  -10.266 1.00 43.27  ? 303  PHE D CD1 1 
ATOM   10225 C  CD2 . PHE D 1 300 ? 0.691   -71.095  -12.592 1.00 42.54  ? 303  PHE D CD2 1 
ATOM   10226 C  CE1 . PHE D 1 300 ? 0.135   -72.794  -10.468 1.00 42.14  ? 303  PHE D CE1 1 
ATOM   10227 C  CE2 . PHE D 1 300 ? 0.595   -72.464  -12.800 1.00 41.93  ? 303  PHE D CE2 1 
ATOM   10228 C  CZ  . PHE D 1 300 ? 0.319   -73.314  -11.738 1.00 41.74  ? 303  PHE D CZ  1 
ATOM   10229 N  N   . LEU D 1 301 ? 3.593   -68.549  -12.079 1.00 40.71  ? 304  LEU D N   1 
ATOM   10230 C  CA  . LEU D 1 301 ? 4.667   -69.067  -12.923 1.00 40.11  ? 304  LEU D CA  1 
ATOM   10231 C  C   . LEU D 1 301 ? 6.036   -68.817  -12.320 1.00 38.90  ? 304  LEU D C   1 
ATOM   10232 O  O   . LEU D 1 301 ? 6.942   -69.646  -12.455 1.00 34.30  ? 304  LEU D O   1 
ATOM   10233 C  CB  . LEU D 1 301 ? 4.595   -68.457  -14.324 1.00 43.04  ? 304  LEU D CB  1 
ATOM   10234 C  CG  . LEU D 1 301 ? 3.383   -68.823  -15.186 1.00 46.42  ? 304  LEU D CG  1 
ATOM   10235 C  CD1 . LEU D 1 301 ? 3.299   -67.872  -16.373 1.00 49.07  ? 304  LEU D CD1 1 
ATOM   10236 C  CD2 . LEU D 1 301 ? 3.407   -70.281  -15.643 1.00 45.70  ? 304  LEU D CD2 1 
ATOM   10237 N  N   . ALA D 1 302 ? 6.195   -67.665  -11.662 1.00 39.26  ? 305  ALA D N   1 
ATOM   10238 C  CA  . ALA D 1 302 ? 7.443   -67.368  -10.969 1.00 38.46  ? 305  ALA D CA  1 
ATOM   10239 C  C   . ALA D 1 302 ? 7.629   -68.394  -9.855  1.00 40.43  ? 305  ALA D C   1 
ATOM   10240 O  O   . ALA D 1 302 ? 8.759   -68.795  -9.547  1.00 39.56  ? 305  ALA D O   1 
ATOM   10241 C  CB  . ALA D 1 302 ? 7.442   -65.949  -10.427 1.00 38.40  ? 305  ALA D CB  1 
ATOM   10242 N  N   . MET D 1 303 ? 6.499   -68.842  -9.297  1.00 42.62  ? 306  MET D N   1 
ATOM   10243 C  CA  . MET D 1 303 ? 6.451   -69.861  -8.234  1.00 46.06  ? 306  MET D CA  1 
ATOM   10244 C  C   . MET D 1 303 ? 7.280   -71.116  -8.512  1.00 46.31  ? 306  MET D C   1 
ATOM   10245 O  O   . MET D 1 303 ? 7.919   -71.649  -7.606  1.00 46.22  ? 306  MET D O   1 
ATOM   10246 C  CB  . MET D 1 303 ? 5.001   -70.242  -7.920  1.00 45.15  ? 306  MET D CB  1 
ATOM   10247 C  CG  . MET D 1 303 ? 4.866   -71.414  -6.963  1.00 44.92  ? 306  MET D CG  1 
ATOM   10248 S  SD  . MET D 1 303 ? 3.351   -71.351  -6.007  1.00 44.11  ? 306  MET D SD  1 
ATOM   10249 C  CE  . MET D 1 303 ? 2.157   -71.941  -7.194  1.00 44.65  ? 306  MET D CE  1 
ATOM   10250 N  N   . GLU D 1 304 ? 7.277   -71.571  -9.762  1.00 47.67  ? 307  GLU D N   1 
ATOM   10251 C  CA  . GLU D 1 304 ? 8.013   -72.769  -10.145 1.00 48.60  ? 307  GLU D CA  1 
ATOM   10252 C  C   . GLU D 1 304 ? 9.511   -72.721  -9.818  1.00 47.19  ? 307  GLU D C   1 
ATOM   10253 O  O   . GLU D 1 304 ? 10.142  -73.761  -9.614  1.00 48.02  ? 307  GLU D O   1 
ATOM   10254 C  CB  . GLU D 1 304 ? 7.822   -73.062  -11.630 1.00 52.00  ? 307  GLU D CB  1 
ATOM   10255 C  CG  . GLU D 1 304 ? 8.316   -74.444  -12.019 1.00 53.88  ? 307  GLU D CG  1 
ATOM   10256 C  CD  . GLU D 1 304 ? 8.747   -74.532  -13.461 1.00 57.81  ? 307  GLU D CD  1 
ATOM   10257 O  OE1 . GLU D 1 304 ? 7.961   -74.131  -14.346 1.00 56.69  ? 307  GLU D OE1 1 
ATOM   10258 O  OE2 . GLU D 1 304 ? 9.873   -75.019  -13.703 1.00 61.84  ? 307  GLU D OE2 1 
ATOM   10259 N  N   . LYS D 1 305 ? 10.079  -71.524  -9.783  1.00 46.00  ? 308  LYS D N   1 
ATOM   10260 C  CA  . LYS D 1 305 ? 11.482  -71.372  -9.404  1.00 48.56  ? 308  LYS D CA  1 
ATOM   10261 C  C   . LYS D 1 305 ? 11.652  -70.610  -8.093  1.00 46.41  ? 308  LYS D C   1 
ATOM   10262 O  O   . LYS D 1 305 ? 12.772  -70.220  -7.738  1.00 46.00  ? 308  LYS D O   1 
ATOM   10263 C  CB  . LYS D 1 305 ? 12.290  -70.730  -10.539 1.00 54.71  ? 308  LYS D CB  1 
ATOM   10264 C  CG  . LYS D 1 305 ? 12.527  -71.689  -11.703 1.00 58.72  ? 308  LYS D CG  1 
ATOM   10265 C  CD  . LYS D 1 305 ? 13.625  -71.210  -12.641 1.00 66.80  ? 308  LYS D CD  1 
ATOM   10266 C  CE  . LYS D 1 305 ? 13.078  -70.389  -13.804 1.00 68.97  ? 308  LYS D CE  1 
ATOM   10267 N  NZ  . LYS D 1 305 ? 14.167  -69.952  -14.728 1.00 66.62  ? 308  LYS D NZ  1 
ATOM   10268 N  N   . GLY D 1 306 ? 10.539  -70.418  -7.379  1.00 41.57  ? 309  GLY D N   1 
ATOM   10269 C  CA  . GLY D 1 306 ? 10.540  -69.741  -6.086  1.00 41.65  ? 309  GLY D CA  1 
ATOM   10270 C  C   . GLY D 1 306 ? 10.904  -68.272  -6.181  1.00 44.21  ? 309  GLY D C   1 
ATOM   10271 O  O   . GLY D 1 306 ? 11.602  -67.744  -5.310  1.00 41.64  ? 309  GLY D O   1 
ATOM   10272 N  N   . ARG D 1 307 ? 10.417  -67.618  -7.237  1.00 42.79  ? 310  ARG D N   1 
ATOM   10273 C  CA  . ARG D 1 307 ? 10.755  -66.232  -7.529  1.00 44.56  ? 310  ARG D CA  1 
ATOM   10274 C  C   . ARG D 1 307 ? 9.564   -65.298  -7.347  1.00 45.81  ? 310  ARG D C   1 
ATOM   10275 O  O   . ARG D 1 307 ? 9.707   -64.081  -7.458  1.00 44.36  ? 310  ARG D O   1 
ATOM   10276 C  CB  . ARG D 1 307 ? 11.306  -66.094  -8.953  1.00 46.97  ? 310  ARG D CB  1 
ATOM   10277 C  CG  . ARG D 1 307 ? 12.676  -66.719  -9.160  1.00 50.66  ? 310  ARG D CG  1 
ATOM   10278 C  CD  . ARG D 1 307 ? 13.435  -66.018  -10.274 1.00 55.50  ? 310  ARG D CD  1 
ATOM   10279 N  NE  . ARG D 1 307 ? 14.789  -66.546  -10.422 1.00 59.85  ? 310  ARG D NE  1 
ATOM   10280 C  CZ  . ARG D 1 307 ? 15.195  -67.305  -11.439 1.00 66.39  ? 310  ARG D CZ  1 
ATOM   10281 N  NH1 . ARG D 1 307 ? 14.356  -67.625  -12.420 1.00 66.98  ? 310  ARG D NH1 1 
ATOM   10282 N  NH2 . ARG D 1 307 ? 16.450  -67.743  -11.484 1.00 66.85  ? 310  ARG D NH2 1 
ATOM   10283 N  N   . HIS D 1 308 ? 8.396   -65.865  -7.048  1.00 44.64  ? 311  HIS D N   1 
ATOM   10284 C  CA  . HIS D 1 308 ? 7.169   -65.075  -6.913  1.00 45.30  ? 311  HIS D CA  1 
ATOM   10285 C  C   . HIS D 1 308 ? 7.228   -63.984  -5.883  1.00 46.88  ? 311  HIS D C   1 
ATOM   10286 O  O   . HIS D 1 308 ? 6.545   -62.969  -6.016  1.00 49.54  ? 311  HIS D O   1 
ATOM   10287 C  CB  . HIS D 1 308 ? 5.954   -65.970  -6.683  1.00 44.74  ? 311  HIS D CB  1 
ATOM   10288 C  CG  . HIS D 1 308 ? 6.079   -66.912  -5.498  1.00 43.79  ? 311  HIS D CG  1 
ATOM   10289 N  ND1 . HIS D 1 308 ? 7.121   -67.751  -5.338  1.00 42.80  ? 311  HIS D ND1 1 
ATOM   10290 C  CD2 . HIS D 1 308 ? 5.213   -67.150  -4.427  1.00 42.19  ? 311  HIS D CD2 1 
ATOM   10291 C  CE1 . HIS D 1 308 ? 6.944   -68.470  -4.214  1.00 42.10  ? 311  HIS D CE1 1 
ATOM   10292 N  NE2 . HIS D 1 308 ? 5.773   -68.104  -3.661  1.00 41.44  ? 311  HIS D NE2 1 
ATOM   10293 N  N   . MET D 1 309 ? 8.054   -64.172  -4.860  1.00 48.25  ? 312  MET D N   1 
ATOM   10294 C  CA  . MET D 1 309 ? 8.202   -63.182  -3.795  1.00 49.78  ? 312  MET D CA  1 
ATOM   10295 C  C   . MET D 1 309 ? 9.004   -61.962  -4.268  1.00 51.92  ? 312  MET D C   1 
ATOM   10296 O  O   . MET D 1 309 ? 8.877   -60.877  -3.699  1.00 52.46  ? 312  MET D O   1 
ATOM   10297 C  CB  . MET D 1 309 ? 8.829   -63.805  -2.531  1.00 48.02  ? 312  MET D CB  1 
ATOM   10298 C  CG  . MET D 1 309 ? 8.009   -64.921  -1.858  1.00 46.76  ? 312  MET D CG  1 
ATOM   10299 S  SD  . MET D 1 309 ? 6.272   -64.565  -1.464  1.00 46.21  ? 312  MET D SD  1 
ATOM   10300 C  CE  . MET D 1 309 ? 6.436   -63.391  -0.121  1.00 44.06  ? 312  MET D CE  1 
ATOM   10301 N  N   . GLU D 1 310 ? 9.794   -62.142  -5.326  1.00 53.99  ? 313  GLU D N   1 
ATOM   10302 C  CA  . GLU D 1 310 ? 10.678  -61.094  -5.840  1.00 56.68  ? 313  GLU D CA  1 
ATOM   10303 C  C   . GLU D 1 310 ? 9.924   -59.940  -6.505  1.00 56.46  ? 313  GLU D C   1 
ATOM   10304 O  O   . GLU D 1 310 ? 10.527  -58.911  -6.805  1.00 56.58  ? 313  GLU D O   1 
ATOM   10305 C  CB  . GLU D 1 310 ? 11.710  -61.674  -6.814  1.00 57.34  ? 313  GLU D CB  1 
ATOM   10306 C  CG  . GLU D 1 310 ? 12.585  -62.770  -6.226  1.00 61.53  ? 313  GLU D CG  1 
ATOM   10307 C  CD  . GLU D 1 310 ? 13.547  -63.371  -7.237  1.00 65.28  ? 313  GLU D CD  1 
ATOM   10308 O  OE1 . GLU D 1 310 ? 13.264  -63.314  -8.455  1.00 67.06  ? 313  GLU D OE1 1 
ATOM   10309 O  OE2 . GLU D 1 310 ? 14.592  -63.910  -6.809  1.00 65.57  ? 313  GLU D OE2 1 
ATOM   10310 N  N   . TYR D 1 311 ? 8.617   -60.113  -6.714  1.00 59.06  ? 314  TYR D N   1 
ATOM   10311 C  CA  . TYR D 1 311 ? 7.771   -59.098  -7.359  1.00 61.41  ? 314  TYR D CA  1 
ATOM   10312 C  C   . TYR D 1 311 ? 7.308   -57.953  -6.461  1.00 62.75  ? 314  TYR D C   1 
ATOM   10313 O  O   . TYR D 1 311 ? 6.718   -56.977  -6.947  1.00 63.67  ? 314  TYR D O   1 
ATOM   10314 C  CB  . TYR D 1 311 ? 6.545   -59.741  -7.998  1.00 60.58  ? 314  TYR D CB  1 
ATOM   10315 C  CG  . TYR D 1 311 ? 6.809   -60.375  -9.343  1.00 64.22  ? 314  TYR D CG  1 
ATOM   10316 C  CD1 . TYR D 1 311 ? 6.784   -61.758  -9.487  1.00 63.68  ? 314  TYR D CD1 1 
ATOM   10317 C  CD2 . TYR D 1 311 ? 7.066   -59.595  -10.477 1.00 63.54  ? 314  TYR D CD2 1 
ATOM   10318 C  CE1 . TYR D 1 311 ? 7.010   -62.354  -10.712 1.00 63.98  ? 314  TYR D CE1 1 
ATOM   10319 C  CE2 . TYR D 1 311 ? 7.299   -60.187  -11.709 1.00 64.75  ? 314  TYR D CE2 1 
ATOM   10320 C  CZ  . TYR D 1 311 ? 7.270   -61.570  -11.814 1.00 65.83  ? 314  TYR D CZ  1 
ATOM   10321 O  OH  . TYR D 1 311 ? 7.494   -62.196  -13.013 1.00 67.84  ? 314  TYR D OH  1 
ATOM   10322 N  N   . GLU D 1 312 ? 7.552   -58.081  -5.158  1.00 64.82  ? 315  GLU D N   1 
ATOM   10323 C  CA  . GLU D 1 312 ? 7.156   -57.064  -4.170  1.00 67.66  ? 315  GLU D CA  1 
ATOM   10324 C  C   . GLU D 1 312 ? 5.650   -56.748  -4.208  1.00 64.65  ? 315  GLU D C   1 
ATOM   10325 O  O   . GLU D 1 312 ? 5.202   -55.762  -3.615  1.00 69.84  ? 315  GLU D O   1 
ATOM   10326 C  CB  . GLU D 1 312 ? 7.987   -55.779  -4.347  1.00 71.81  ? 315  GLU D CB  1 
ATOM   10327 C  CG  . GLU D 1 312 ? 9.488   -55.953  -4.140  1.00 76.69  ? 315  GLU D CG  1 
ATOM   10328 C  CD  . GLU D 1 312 ? 9.917   -55.757  -2.694  1.00 82.05  ? 315  GLU D CD  1 
ATOM   10329 O  OE1 . GLU D 1 312 ? 10.830  -56.481  -2.238  1.00 85.41  ? 315  GLU D OE1 1 
ATOM   10330 O  OE2 . GLU D 1 312 ? 9.345   -54.877  -2.012  1.00 83.59  ? 315  GLU D OE2 1 
ATOM   10331 N  N   . CYS D 1 313 ? 4.889   -57.595  -4.904  1.00 58.74  ? 316  CYS D N   1 
ATOM   10332 C  CA  . CYS D 1 313 ? 3.438   -57.455  -5.064  1.00 55.84  ? 316  CYS D CA  1 
ATOM   10333 C  C   . CYS D 1 313 ? 2.722   -57.177  -3.736  1.00 55.37  ? 316  CYS D C   1 
ATOM   10334 O  O   . CYS D 1 313 ? 2.906   -57.917  -2.761  1.00 55.41  ? 316  CYS D O   1 
ATOM   10335 C  CB  . CYS D 1 313 ? 2.863   -58.711  -5.733  1.00 51.41  ? 316  CYS D CB  1 
ATOM   10336 S  SG  . CYS D 1 313 ? 1.072   -58.690  -5.958  1.00 48.29  ? 316  CYS D SG  1 
ATOM   10337 N  N   . PRO D 1 314 ? 1.916   -56.097  -3.686  1.00 56.15  ? 317  PRO D N   1 
ATOM   10338 C  CA  . PRO D 1 314 ? 1.270   -55.694  -2.435  1.00 54.73  ? 317  PRO D CA  1 
ATOM   10339 C  C   . PRO D 1 314 ? -0.096  -56.350  -2.187  1.00 52.43  ? 317  PRO D C   1 
ATOM   10340 O  O   . PRO D 1 314 ? -0.766  -56.006  -1.216  1.00 52.86  ? 317  PRO D O   1 
ATOM   10341 C  CB  . PRO D 1 314 ? 1.124   -54.163  -2.584  1.00 55.39  ? 317  PRO D CB  1 
ATOM   10342 C  CG  . PRO D 1 314 ? 1.655   -53.815  -3.943  1.00 56.73  ? 317  PRO D CG  1 
ATOM   10343 C  CD  . PRO D 1 314 ? 1.692   -55.093  -4.736  1.00 57.12  ? 317  PRO D CD  1 
ATOM   10344 N  N   . TYR D 1 315 ? -0.490  -57.297  -3.038  1.00 49.04  ? 318  TYR D N   1 
ATOM   10345 C  CA  . TYR D 1 315 ? -1.740  -58.042  -2.841  1.00 48.14  ? 318  TYR D CA  1 
ATOM   10346 C  C   . TYR D 1 315 ? -1.491  -59.429  -2.266  1.00 47.65  ? 318  TYR D C   1 
ATOM   10347 O  O   . TYR D 1 315 ? -2.405  -60.086  -1.763  1.00 48.91  ? 318  TYR D O   1 
ATOM   10348 C  CB  . TYR D 1 315 ? -2.521  -58.149  -4.144  1.00 49.77  ? 318  TYR D CB  1 
ATOM   10349 C  CG  . TYR D 1 315 ? -2.933  -56.810  -4.689  1.00 50.48  ? 318  TYR D CG  1 
ATOM   10350 C  CD1 . TYR D 1 315 ? -4.139  -56.229  -4.305  1.00 52.55  ? 318  TYR D CD1 1 
ATOM   10351 C  CD2 . TYR D 1 315 ? -2.111  -56.115  -5.573  1.00 50.73  ? 318  TYR D CD2 1 
ATOM   10352 C  CE1 . TYR D 1 315 ? -4.525  -54.993  -4.797  1.00 55.23  ? 318  TYR D CE1 1 
ATOM   10353 C  CE2 . TYR D 1 315 ? -2.483  -54.880  -6.072  1.00 53.95  ? 318  TYR D CE2 1 
ATOM   10354 C  CZ  . TYR D 1 315 ? -3.689  -54.321  -5.680  1.00 54.36  ? 318  TYR D CZ  1 
ATOM   10355 O  OH  . TYR D 1 315 ? -4.066  -53.089  -6.160  1.00 54.88  ? 318  TYR D OH  1 
ATOM   10356 N  N   . LEU D 1 316 ? -0.247  -59.871  -2.360  1.00 45.48  ? 319  LEU D N   1 
ATOM   10357 C  CA  . LEU D 1 316 ? 0.174   -61.092  -1.728  1.00 44.49  ? 319  LEU D CA  1 
ATOM   10358 C  C   . LEU D 1 316 ? 0.841   -60.731  -0.410  1.00 43.99  ? 319  LEU D C   1 
ATOM   10359 O  O   . LEU D 1 316 ? 1.788   -59.935  -0.388  1.00 46.12  ? 319  LEU D O   1 
ATOM   10360 C  CB  . LEU D 1 316 ? 1.149   -61.837  -2.632  1.00 42.61  ? 319  LEU D CB  1 
ATOM   10361 C  CG  . LEU D 1 316 ? 1.937   -62.998  -2.031  1.00 41.48  ? 319  LEU D CG  1 
ATOM   10362 C  CD1 . LEU D 1 316 ? 1.046   -64.221  -1.860  1.00 40.33  ? 319  LEU D CD1 1 
ATOM   10363 C  CD2 . LEU D 1 316 ? 3.138   -63.315  -2.909  1.00 40.94  ? 319  LEU D CD2 1 
ATOM   10364 N  N   . VAL D 1 317 ? 0.331   -61.304  0.680   1.00 41.45  ? 320  VAL D N   1 
ATOM   10365 C  CA  . VAL D 1 317 ? 0.949   -61.155  2.007   1.00 41.07  ? 320  VAL D CA  1 
ATOM   10366 C  C   . VAL D 1 317 ? 1.438   -62.511  2.539   1.00 38.08  ? 320  VAL D C   1 
ATOM   10367 O  O   . VAL D 1 317 ? 0.771   -63.538  2.385   1.00 36.75  ? 320  VAL D O   1 
ATOM   10368 C  CB  . VAL D 1 317 ? -0.001  -60.504  3.042   1.00 42.17  ? 320  VAL D CB  1 
ATOM   10369 C  CG1 . VAL D 1 317 ? 0.743   -60.209  4.340   1.00 43.26  ? 320  VAL D CG1 1 
ATOM   10370 C  CG2 . VAL D 1 317 ? -0.627  -59.219  2.496   1.00 42.17  ? 320  VAL D CG2 1 
ATOM   10371 N  N   . TYR D 1 318 ? 2.621   -62.495  3.142   1.00 37.08  ? 321  TYR D N   1 
ATOM   10372 C  CA  . TYR D 1 318 ? 3.197   -63.664  3.790   1.00 36.21  ? 321  TYR D CA  1 
ATOM   10373 C  C   . TYR D 1 318 ? 3.502   -63.310  5.230   1.00 34.03  ? 321  TYR D C   1 
ATOM   10374 O  O   . TYR D 1 318 ? 4.107   -62.274  5.493   1.00 34.00  ? 321  TYR D O   1 
ATOM   10375 C  CB  . TYR D 1 318 ? 4.493   -64.098  3.098   1.00 36.18  ? 321  TYR D CB  1 
ATOM   10376 C  CG  . TYR D 1 318 ? 5.344   -65.023  3.953   1.00 35.56  ? 321  TYR D CG  1 
ATOM   10377 C  CD1 . TYR D 1 318 ? 4.988   -66.361  4.120   1.00 34.27  ? 321  TYR D CD1 1 
ATOM   10378 C  CD2 . TYR D 1 318 ? 6.482   -64.555  4.611   1.00 33.83  ? 321  TYR D CD2 1 
ATOM   10379 C  CE1 . TYR D 1 318 ? 5.739   -67.210  4.907   1.00 32.99  ? 321  TYR D CE1 1 
ATOM   10380 C  CE2 . TYR D 1 318 ? 7.248   -65.402  5.398   1.00 33.60  ? 321  TYR D CE2 1 
ATOM   10381 C  CZ  . TYR D 1 318 ? 6.866   -66.734  5.539   1.00 34.50  ? 321  TYR D CZ  1 
ATOM   10382 O  OH  . TYR D 1 318 ? 7.602   -67.605  6.314   1.00 34.82  ? 321  TYR D OH  1 
ATOM   10383 N  N   . VAL D 1 319 ? 3.084   -64.180  6.146   1.00 32.71  ? 322  VAL D N   1 
ATOM   10384 C  CA  . VAL D 1 319 ? 3.379   -64.042  7.570   1.00 32.49  ? 322  VAL D CA  1 
ATOM   10385 C  C   . VAL D 1 319 ? 3.651   -65.429  8.181   1.00 31.93  ? 322  VAL D C   1 
ATOM   10386 O  O   . VAL D 1 319 ? 2.880   -66.361  7.961   1.00 32.13  ? 322  VAL D O   1 
ATOM   10387 C  CB  . VAL D 1 319 ? 2.221   -63.347  8.345   1.00 32.23  ? 322  VAL D CB  1 
ATOM   10388 C  CG1 . VAL D 1 319 ? 2.676   -62.942  9.736   1.00 33.71  ? 322  VAL D CG1 1 
ATOM   10389 C  CG2 . VAL D 1 319 ? 1.734   -62.106  7.623   1.00 33.65  ? 322  VAL D CG2 1 
ATOM   10390 N  N   . PRO D 1 320 ? 4.751   -65.571  8.943   1.00 31.31  ? 323  PRO D N   1 
ATOM   10391 C  CA  . PRO D 1 320 ? 4.989   -66.812  9.684   1.00 30.04  ? 323  PRO D CA  1 
ATOM   10392 C  C   . PRO D 1 320 ? 4.098   -66.866  10.920  1.00 29.14  ? 323  PRO D C   1 
ATOM   10393 O  O   . PRO D 1 320 ? 4.113   -65.937  11.712  1.00 29.16  ? 323  PRO D O   1 
ATOM   10394 C  CB  . PRO D 1 320 ? 6.463   -66.720  10.093  1.00 30.61  ? 323  PRO D CB  1 
ATOM   10395 C  CG  . PRO D 1 320 ? 7.035   -65.548  9.354   1.00 33.11  ? 323  PRO D CG  1 
ATOM   10396 C  CD  . PRO D 1 320 ? 5.888   -64.637  9.042   1.00 31.69  ? 323  PRO D CD  1 
ATOM   10397 N  N   . VAL D 1 321 ? 3.310   -67.934  11.064  1.00 27.12  ? 324  VAL D N   1 
ATOM   10398 C  CA  . VAL D 1 321 ? 2.308   -68.016  12.133  1.00 26.24  ? 324  VAL D CA  1 
ATOM   10399 C  C   . VAL D 1 321 ? 2.412   -69.299  12.957  1.00 26.31  ? 324  VAL D C   1 
ATOM   10400 O  O   . VAL D 1 321 ? 3.067   -70.268  12.547  1.00 24.81  ? 324  VAL D O   1 
ATOM   10401 C  CB  . VAL D 1 321 ? 0.854   -67.838  11.605  1.00 25.24  ? 324  VAL D CB  1 
ATOM   10402 C  CG1 . VAL D 1 321 ? 0.732   -66.577  10.767  1.00 26.01  ? 324  VAL D CG1 1 
ATOM   10403 C  CG2 . VAL D 1 321 ? 0.397   -69.044  10.796  1.00 25.06  ? 324  VAL D CG2 1 
ATOM   10404 N  N   . VAL D 1 322 ? 1.778   -69.297  14.133  1.00 26.93  ? 325  VAL D N   1 
ATOM   10405 C  CA  . VAL D 1 322 ? 1.663   -70.528  14.916  1.00 26.45  ? 325  VAL D CA  1 
ATOM   10406 C  C   . VAL D 1 322 ? 0.215   -70.971  14.951  1.00 25.49  ? 325  VAL D C   1 
ATOM   10407 O  O   . VAL D 1 322 ? -0.071  -72.118  15.261  1.00 26.21  ? 325  VAL D O   1 
ATOM   10408 C  CB  . VAL D 1 322 ? 2.249   -70.422  16.346  1.00 27.44  ? 325  VAL D CB  1 
ATOM   10409 C  CG1 . VAL D 1 322 ? 3.674   -69.874  16.317  1.00 28.10  ? 325  VAL D CG1 1 
ATOM   10410 C  CG2 . VAL D 1 322 ? 1.353   -69.579  17.248  1.00 28.63  ? 325  VAL D CG2 1 
ATOM   10411 N  N   . ALA D 1 323 ? -0.698  -70.068  14.615  1.00 24.54  ? 326  ALA D N   1 
ATOM   10412 C  CA  . ALA D 1 323 ? -2.117  -70.380  14.660  1.00 24.78  ? 326  ALA D CA  1 
ATOM   10413 C  C   . ALA D 1 323 ? -2.881  -69.422  13.770  1.00 26.10  ? 326  ALA D C   1 
ATOM   10414 O  O   . ALA D 1 323 ? -2.391  -68.333  13.482  1.00 25.67  ? 326  ALA D O   1 
ATOM   10415 C  CB  . ALA D 1 323 ? -2.640  -70.298  16.090  1.00 23.71  ? 326  ALA D CB  1 
ATOM   10416 N  N   . PHE D 1 324 ? -4.077  -69.840  13.337  1.00 27.32  ? 327  PHE D N   1 
ATOM   10417 C  CA  . PHE D 1 324 ? -4.952  -69.030  12.478  1.00 26.63  ? 327  PHE D CA  1 
ATOM   10418 C  C   . PHE D 1 324 ? -6.407  -69.413  12.672  1.00 27.18  ? 327  PHE D C   1 
ATOM   10419 O  O   . PHE D 1 324 ? -6.707  -70.454  13.231  1.00 29.99  ? 327  PHE D O   1 
ATOM   10420 C  CB  . PHE D 1 324 ? -4.579  -69.197  10.993  1.00 26.72  ? 327  PHE D CB  1 
ATOM   10421 C  CG  . PHE D 1 324 ? -5.015  -70.514  10.401  1.00 25.67  ? 327  PHE D CG  1 
ATOM   10422 C  CD1 . PHE D 1 324 ? -6.162  -70.593  9.617   1.00 25.60  ? 327  PHE D CD1 1 
ATOM   10423 C  CD2 . PHE D 1 324 ? -4.287  -71.675  10.644  1.00 25.07  ? 327  PHE D CD2 1 
ATOM   10424 C  CE1 . PHE D 1 324 ? -6.583  -71.804  9.082   1.00 25.17  ? 327  PHE D CE1 1 
ATOM   10425 C  CE2 . PHE D 1 324 ? -4.699  -72.885  10.114  1.00 24.78  ? 327  PHE D CE2 1 
ATOM   10426 C  CZ  . PHE D 1 324 ? -5.846  -72.950  9.334   1.00 25.08  ? 327  PHE D CZ  1 
ATOM   10427 N  N   . ARG D 1 325 ? -7.309  -68.543  12.235  1.00 29.22  ? 328  ARG D N   1 
ATOM   10428 C  CA  . ARG D 1 325 ? -8.726  -68.862  12.109  1.00 29.10  ? 328  ARG D CA  1 
ATOM   10429 C  C   . ARG D 1 325 ? -9.169  -68.305  10.778  1.00 30.82  ? 328  ARG D C   1 
ATOM   10430 O  O   . ARG D 1 325 ? -8.690  -67.250  10.350  1.00 32.53  ? 328  ARG D O   1 
ATOM   10431 C  CB  . ARG D 1 325 ? -9.554  -68.228  13.223  1.00 28.25  ? 328  ARG D CB  1 
ATOM   10432 C  CG  . ARG D 1 325 ? -11.064 -68.354  12.997  1.00 29.15  ? 328  ARG D CG  1 
ATOM   10433 C  CD  . ARG D 1 325 ? -11.888 -67.726  14.105  1.00 27.90  ? 328  ARG D CD  1 
ATOM   10434 N  NE  . ARG D 1 325 ? -11.534 -68.265  15.418  1.00 28.83  ? 328  ARG D NE  1 
ATOM   10435 C  CZ  . ARG D 1 325 ? -12.137 -67.932  16.556  1.00 27.93  ? 328  ARG D CZ  1 
ATOM   10436 N  NH1 . ARG D 1 325 ? -13.135 -67.052  16.549  1.00 26.53  ? 328  ARG D NH1 1 
ATOM   10437 N  NH2 . ARG D 1 325 ? -11.732 -68.482  17.697  1.00 27.19  ? 328  ARG D NH2 1 
ATOM   10438 N  N   . LEU D 1 326 ? -10.085 -69.004  10.126  1.00 32.75  ? 329  LEU D N   1 
ATOM   10439 C  CA  . LEU D 1 326 ? -10.604 -68.551  8.849   1.00 34.21  ? 329  LEU D CA  1 
ATOM   10440 C  C   . LEU D 1 326 ? -12.090 -68.801  8.752   1.00 34.98  ? 329  LEU D C   1 
ATOM   10441 O  O   . LEU D 1 326 ? -12.561 -69.929  8.890   1.00 35.09  ? 329  LEU D O   1 
ATOM   10442 C  CB  . LEU D 1 326 ? -9.859  -69.220  7.688   1.00 33.87  ? 329  LEU D CB  1 
ATOM   10443 C  CG  . LEU D 1 326 ? -10.301 -68.783  6.296   1.00 35.65  ? 329  LEU D CG  1 
ATOM   10444 C  CD1 . LEU D 1 326 ? -10.154 -67.280  6.128   1.00 35.56  ? 329  LEU D CD1 1 
ATOM   10445 C  CD2 . LEU D 1 326 ? -9.499  -69.527  5.244   1.00 37.28  ? 329  LEU D CD2 1 
ATOM   10446 N  N   . GLU D 1 327 ? -12.816 -67.732  8.467   1.00 40.01  ? 330  GLU D N   1 
ATOM   10447 C  CA  . GLU D 1 327 ? -14.260 -67.732  8.567   1.00 46.25  ? 330  GLU D CA  1 
ATOM   10448 C  C   . GLU D 1 327 ? -14.927 -67.292  7.261   1.00 47.06  ? 330  GLU D C   1 
ATOM   10449 O  O   . GLU D 1 327 ? -15.116 -66.094  7.052   1.00 49.66  ? 330  GLU D O   1 
ATOM   10450 C  CB  . GLU D 1 327 ? -14.648 -66.773  9.701   1.00 49.33  ? 330  GLU D CB  1 
ATOM   10451 C  CG  . GLU D 1 327 ? -15.901 -67.132  10.478  1.00 54.04  ? 330  GLU D CG  1 
ATOM   10452 C  CD  . GLU D 1 327 ? -16.080 -66.272  11.726  1.00 55.90  ? 330  GLU D CD  1 
ATOM   10453 O  OE1 . GLU D 1 327 ? -17.220 -65.804  11.939  1.00 55.98  ? 330  GLU D OE1 1 
ATOM   10454 O  OE2 . GLU D 1 327 ? -15.095 -66.064  12.485  1.00 51.94  ? 330  GLU D OE2 1 
ATOM   10455 N  N   . PRO D 1 328 ? -15.259 -68.246  6.363   1.00 48.86  ? 331  PRO D N   1 
ATOM   10456 C  CA  . PRO D 1 328 ? -16.233 -67.930  5.303   1.00 52.65  ? 331  PRO D CA  1 
ATOM   10457 C  C   . PRO D 1 328 ? -17.638 -68.222  5.856   1.00 57.79  ? 331  PRO D C   1 
ATOM   10458 O  O   . PRO D 1 328 ? -17.916 -69.379  6.167   1.00 63.69  ? 331  PRO D O   1 
ATOM   10459 C  CB  . PRO D 1 328 ? -15.869 -68.914  4.187   1.00 48.99  ? 331  PRO D CB  1 
ATOM   10460 C  CG  . PRO D 1 328 ? -15.139 -70.041  4.851   1.00 48.21  ? 331  PRO D CG  1 
ATOM   10461 C  CD  . PRO D 1 328 ? -14.728 -69.618  6.239   1.00 48.30  ? 331  PRO D CD  1 
ATOM   10462 N  N   . LYS D 1 329 ? -18.559 -67.260  5.963   1.00 64.07  ? 332  LYS D N   1 
ATOM   10463 C  CA  . LYS D 1 329 ? -18.736 -66.056  5.147   1.00 65.85  ? 332  LYS D CA  1 
ATOM   10464 C  C   . LYS D 1 329 ? -19.583 -66.469  3.959   1.00 70.00  ? 332  LYS D C   1 
ATOM   10465 O  O   . LYS D 1 329 ? -19.074 -66.743  2.868   1.00 73.39  ? 332  LYS D O   1 
ATOM   10466 C  CB  . LYS D 1 329 ? -17.441 -65.355  4.755   1.00 63.98  ? 332  LYS D CB  1 
ATOM   10467 C  CG  . LYS D 1 329 ? -17.237 -64.034  5.482   1.00 66.37  ? 332  LYS D CG  1 
ATOM   10468 C  CD  . LYS D 1 329 ? -18.287 -63.007  5.077   1.00 66.10  ? 332  LYS D CD  1 
ATOM   10469 C  CE  . LYS D 1 329 ? -18.075 -61.666  5.761   1.00 66.67  ? 332  LYS D CE  1 
ATOM   10470 N  NZ  . LYS D 1 329 ? -16.897 -60.929  5.222   1.00 66.93  ? 332  LYS D NZ  1 
ATOM   10471 N  N   . ASP D 1 330 ? -20.890 -66.524  4.215   1.00 72.83  ? 333  ASP D N   1 
ATOM   10472 C  CA  . ASP D 1 330 ? -21.871 -67.183  3.349   1.00 74.90  ? 333  ASP D CA  1 
ATOM   10473 C  C   . ASP D 1 330 ? -21.655 -68.694  3.282   1.00 72.64  ? 333  ASP D C   1 
ATOM   10474 O  O   . ASP D 1 330 ? -20.890 -69.201  2.455   1.00 69.27  ? 333  ASP D O   1 
ATOM   10475 C  CB  . ASP D 1 330 ? -21.923 -66.561  1.946   1.00 81.98  ? 333  ASP D CB  1 
ATOM   10476 C  CG  . ASP D 1 330 ? -22.886 -65.390  1.860   1.00 87.37  ? 333  ASP D CG  1 
ATOM   10477 O  OD1 . ASP D 1 330 ? -23.457 -65.184  0.765   1.00 86.28  ? 333  ASP D OD1 1 
ATOM   10478 O  OD2 . ASP D 1 330 ? -23.078 -64.685  2.880   1.00 88.93  ? 333  ASP D OD2 1 
ATOM   10479 N  N   . GLY D 1 331 ? -22.334 -69.395  4.187   1.00 71.53  ? 334  GLY D N   1 
ATOM   10480 C  CA  . GLY D 1 331 ? -22.368 -70.855  4.208   1.00 71.05  ? 334  GLY D CA  1 
ATOM   10481 C  C   . GLY D 1 331 ? -21.034 -71.573  4.316   1.00 68.31  ? 334  GLY D C   1 
ATOM   10482 O  O   . GLY D 1 331 ? -19.981 -70.959  4.523   1.00 64.49  ? 334  GLY D O   1 
ATOM   10483 N  N   . LYS D 1 332 ? -21.103 -72.893  4.175   1.00 65.21  ? 335  LYS D N   1 
ATOM   10484 C  CA  . LYS D 1 332 ? -19.930 -73.756  4.164   1.00 63.99  ? 335  LYS D CA  1 
ATOM   10485 C  C   . LYS D 1 332 ? -18.963 -73.377  3.037   1.00 62.89  ? 335  LYS D C   1 
ATOM   10486 O  O   . LYS D 1 332 ? -19.374 -73.142  1.893   1.00 65.52  ? 335  LYS D O   1 
ATOM   10487 C  CB  . LYS D 1 332 ? -20.362 -75.222  4.041   1.00 61.69  ? 335  LYS D CB  1 
ATOM   10488 C  CG  . LYS D 1 332 ? -21.035 -75.773  5.292   1.00 64.85  ? 335  LYS D CG  1 
ATOM   10489 C  CD  . LYS D 1 332 ? -21.420 -77.236  5.145   1.00 65.49  ? 335  LYS D CD  1 
ATOM   10490 C  CE  . LYS D 1 332 ? -21.309 -77.970  6.474   1.00 66.65  ? 335  LYS D CE  1 
ATOM   10491 N  NZ  . LYS D 1 332 ? -20.918 -79.398  6.284   1.00 66.59  ? 335  LYS D NZ  1 
ATOM   10492 N  N   . GLY D 1 333 ? -17.683 -73.296  3.383   1.00 57.47  ? 336  GLY D N   1 
ATOM   10493 C  CA  . GLY D 1 333 ? -16.629 -73.028  2.415   1.00 50.38  ? 336  GLY D CA  1 
ATOM   10494 C  C   . GLY D 1 333 ? -15.955 -74.322  2.017   1.00 47.13  ? 336  GLY D C   1 
ATOM   10495 O  O   . GLY D 1 333 ? -15.999 -75.304  2.759   1.00 44.21  ? 336  GLY D O   1 
ATOM   10496 N  N   . VAL D 1 334 ? -15.352 -74.324  0.828   1.00 47.03  ? 337  VAL D N   1 
ATOM   10497 C  CA  . VAL D 1 334 ? -14.617 -75.476  0.319   1.00 43.23  ? 337  VAL D CA  1 
ATOM   10498 C  C   . VAL D 1 334 ? -13.125 -75.269  0.548   1.00 40.92  ? 337  VAL D C   1 
ATOM   10499 O  O   . VAL D 1 334 ? -12.545 -74.279  0.099   1.00 40.56  ? 337  VAL D O   1 
ATOM   10500 C  CB  . VAL D 1 334 ? -14.934 -75.770  -1.176  1.00 46.47  ? 337  VAL D CB  1 
ATOM   10501 C  CG1 . VAL D 1 334 ? -15.024 -74.488  -1.994  1.00 47.61  ? 337  VAL D CG1 1 
ATOM   10502 C  CG2 . VAL D 1 334 ? -13.898 -76.719  -1.780  1.00 46.34  ? 337  VAL D CG2 1 
ATOM   10503 N  N   . PHE D 1 335 ? -12.523 -76.197  1.283   1.00 38.80  ? 338  PHE D N   1 
ATOM   10504 C  CA  . PHE D 1 335 ? -11.093 -76.157  1.579   1.00 37.27  ? 338  PHE D CA  1 
ATOM   10505 C  C   . PHE D 1 335 ? -10.462 -77.423  1.029   1.00 35.56  ? 338  PHE D C   1 
ATOM   10506 O  O   . PHE D 1 335 ? -11.153 -78.416  0.774   1.00 33.25  ? 338  PHE D O   1 
ATOM   10507 C  CB  . PHE D 1 335 ? -10.818 -76.170  3.086   1.00 37.40  ? 338  PHE D CB  1 
ATOM   10508 C  CG  . PHE D 1 335 ? -11.460 -75.063  3.844   1.00 37.78  ? 338  PHE D CG  1 
ATOM   10509 C  CD1 . PHE D 1 335 ? -12.785 -75.159  4.247   1.00 40.68  ? 338  PHE D CD1 1 
ATOM   10510 C  CD2 . PHE D 1 335 ? -10.728 -73.944  4.206   1.00 38.37  ? 338  PHE D CD2 1 
ATOM   10511 C  CE1 . PHE D 1 335 ? -13.383 -74.131  4.964   1.00 41.90  ? 338  PHE D CE1 1 
ATOM   10512 C  CE2 . PHE D 1 335 ? -11.315 -72.913  4.922   1.00 39.45  ? 338  PHE D CE2 1 
ATOM   10513 C  CZ  . PHE D 1 335 ? -12.645 -73.008  5.301   1.00 40.22  ? 338  PHE D CZ  1 
ATOM   10514 N  N   . ALA D 1 336 ? -9.143  -77.374  0.879   1.00 32.08  ? 339  ALA D N   1 
ATOM   10515 C  CA  . ALA D 1 336 ? -8.345  -78.554  0.671   1.00 32.82  ? 339  ALA D CA  1 
ATOM   10516 C  C   . ALA D 1 336 ? -7.397  -78.696  1.856   1.00 31.64  ? 339  ALA D C   1 
ATOM   10517 O  O   . ALA D 1 336 ? -6.661  -77.760  2.181   1.00 30.89  ? 339  ALA D O   1 
ATOM   10518 C  CB  . ALA D 1 336 ? -7.563  -78.439  -0.637  1.00 31.71  ? 339  ALA D CB  1 
ATOM   10519 N  N   . VAL D 1 337 ? -7.423  -79.867  2.492   1.00 30.89  ? 340  VAL D N   1 
ATOM   10520 C  CA  . VAL D 1 337 ? -6.524  -80.179  3.599   1.00 30.33  ? 340  VAL D CA  1 
ATOM   10521 C  C   . VAL D 1 337 ? -5.563  -81.246  3.116   1.00 30.12  ? 340  VAL D C   1 
ATOM   10522 O  O   . VAL D 1 337 ? -5.980  -82.377  2.873   1.00 31.28  ? 340  VAL D O   1 
ATOM   10523 C  CB  . VAL D 1 337 ? -7.281  -80.755  4.832   1.00 30.61  ? 340  VAL D CB  1 
ATOM   10524 C  CG1 . VAL D 1 337 ? -6.322  -80.975  6.004   1.00 28.95  ? 340  VAL D CG1 1 
ATOM   10525 C  CG2 . VAL D 1 337 ? -8.411  -79.836  5.251   1.00 31.33  ? 340  VAL D CG2 1 
ATOM   10526 N  N   . ASP D 1 338 ? -4.282  -80.902  3.010   1.00 28.63  ? 341  ASP D N   1 
ATOM   10527 C  CA  . ASP D 1 338 ? -3.286  -81.819  2.478   1.00 29.87  ? 341  ASP D CA  1 
ATOM   10528 C  C   . ASP D 1 338 ? -3.716  -82.409  1.108   1.00 31.68  ? 341  ASP D C   1 
ATOM   10529 O  O   . ASP D 1 338 ? -3.458  -83.575  0.810   1.00 30.20  ? 341  ASP D O   1 
ATOM   10530 C  CB  . ASP D 1 338 ? -3.018  -82.940  3.484   1.00 28.47  ? 341  ASP D CB  1 
ATOM   10531 C  CG  . ASP D 1 338 ? -2.319  -82.455  4.739   1.00 29.00  ? 341  ASP D CG  1 
ATOM   10532 O  OD1 . ASP D 1 338 ? -1.820  -81.297  4.758   1.00 27.74  ? 341  ASP D OD1 1 
ATOM   10533 O  OD2 . ASP D 1 338 ? -2.258  -83.255  5.707   1.00 26.68  ? 341  ASP D OD2 1 
ATOM   10534 N  N   . GLY D 1 339 ? -4.374  -81.589  0.292   1.00 33.79  ? 342  GLY D N   1 
ATOM   10535 C  CA  . GLY D 1 339 ? -4.915  -82.016  -0.987  1.00 33.43  ? 342  GLY D CA  1 
ATOM   10536 C  C   . GLY D 1 339 ? -6.383  -82.409  -0.924  1.00 37.34  ? 342  GLY D C   1 
ATOM   10537 O  O   . GLY D 1 339 ? -7.123  -82.125  -1.856  1.00 40.31  ? 342  GLY D O   1 
ATOM   10538 N  N   . GLU D 1 340 ? -6.813  -83.064  0.156   1.00 37.75  ? 343  GLU D N   1 
ATOM   10539 C  CA  . GLU D 1 340 ? -8.160  -83.636  0.216   0.50 40.03  ? 343  GLU D CA  1 
ATOM   10540 C  C   . GLU D 1 340 ? -9.226  -82.598  0.488   1.00 43.07  ? 343  GLU D C   1 
ATOM   10541 O  O   . GLU D 1 340 ? -9.033  -81.700  1.312   1.00 47.87  ? 343  GLU D O   1 
ATOM   10542 C  CB  . GLU D 1 340 ? -8.247  -84.764  1.252   0.50 40.52  ? 343  GLU D CB  1 
ATOM   10543 C  CG  . GLU D 1 340 ? -9.670  -85.241  1.551   0.50 42.18  ? 343  GLU D CG  1 
ATOM   10544 C  CD  . GLU D 1 340 ? -9.820  -86.755  1.570   0.50 42.16  ? 343  GLU D CD  1 
ATOM   10545 O  OE1 . GLU D 1 340 ? -9.678  -87.378  0.498   0.50 42.64  ? 343  GLU D OE1 1 
ATOM   10546 O  OE2 . GLU D 1 340 ? -10.099 -87.322  2.650   0.50 40.93  ? 343  GLU D OE2 1 
ATOM   10547 N  N   . LEU D 1 341 ? -10.356 -82.737  -0.205  1.00 45.73  ? 344  LEU D N   1 
ATOM   10548 C  CA  . LEU D 1 341 ? -11.539 -81.896  0.000   1.00 44.80  ? 344  LEU D CA  1 
ATOM   10549 C  C   . LEU D 1 341 ? -12.091 -81.982  1.421   1.00 45.87  ? 344  LEU D C   1 
ATOM   10550 O  O   . LEU D 1 341 ? -12.256 -83.068  1.979   1.00 46.34  ? 344  LEU D O   1 
ATOM   10551 C  CB  . LEU D 1 341 ? -12.645 -82.264  -0.999  1.00 45.44  ? 344  LEU D CB  1 
ATOM   10552 C  CG  . LEU D 1 341 ? -14.107 -81.851  -0.715  1.00 47.08  ? 344  LEU D CG  1 
ATOM   10553 C  CD1 . LEU D 1 341 ? -14.367 -80.380  -1.007  1.00 46.73  ? 344  LEU D CD1 1 
ATOM   10554 C  CD2 . LEU D 1 341 ? -15.109 -82.727  -1.458  1.00 43.41  ? 344  LEU D CD2 1 
ATOM   10555 N  N   . MET D 1 342 ? -12.371 -80.815  1.985   1.00 45.76  ? 345  MET D N   1 
ATOM   10556 C  CA  . MET D 1 342 ? -13.086 -80.685  3.241   1.00 46.75  ? 345  MET D CA  1 
ATOM   10557 C  C   . MET D 1 342 ? -14.005 -79.466  3.123   1.00 48.13  ? 345  MET D C   1 
ATOM   10558 O  O   . MET D 1 342 ? -13.659 -78.476  2.474   1.00 45.38  ? 345  MET D O   1 
ATOM   10559 C  CB  . MET D 1 342 ? -12.092 -80.502  4.381   1.00 46.42  ? 345  MET D CB  1 
ATOM   10560 C  CG  . MET D 1 342 ? -12.630 -80.803  5.766   1.00 47.00  ? 345  MET D CG  1 
ATOM   10561 S  SD  . MET D 1 342 ? -11.633 -79.961  7.007   1.00 48.94  ? 345  MET D SD  1 
ATOM   10562 C  CE  . MET D 1 342 ? -12.088 -78.252  6.707   1.00 45.86  ? 345  MET D CE  1 
ATOM   10563 N  N   . VAL D 1 343 ? -15.183 -79.552  3.731   1.00 50.86  ? 346  VAL D N   1 
ATOM   10564 C  CA  . VAL D 1 343 ? -16.161 -78.471  3.679   1.00 51.96  ? 346  VAL D CA  1 
ATOM   10565 C  C   . VAL D 1 343 ? -16.660 -78.139  5.086   1.00 52.63  ? 346  VAL D C   1 
ATOM   10566 O  O   . VAL D 1 343 ? -17.157 -79.019  5.795   1.00 52.44  ? 346  VAL D O   1 
ATOM   10567 C  CB  . VAL D 1 343 ? -17.323 -78.822  2.713   1.00 54.72  ? 346  VAL D CB  1 
ATOM   10568 C  CG1 . VAL D 1 343 ? -18.552 -77.967  2.968   1.00 53.76  ? 346  VAL D CG1 1 
ATOM   10569 C  CG2 . VAL D 1 343 ? -16.876 -78.647  1.266   1.00 57.36  ? 346  VAL D CG2 1 
ATOM   10570 N  N   . SER D 1 344 ? -16.498 -76.877  5.492   1.00 52.85  ? 347  SER D N   1 
ATOM   10571 C  CA  . SER D 1 344 ? -17.006 -76.402  6.789   1.00 54.98  ? 347  SER D CA  1 
ATOM   10572 C  C   . SER D 1 344 ? -17.213 -74.885  6.826   1.00 54.61  ? 347  SER D C   1 
ATOM   10573 O  O   . SER D 1 344 ? -16.673 -74.140  5.992   1.00 51.69  ? 347  SER D O   1 
ATOM   10574 C  CB  . SER D 1 344 ? -16.104 -76.849  7.955   1.00 55.23  ? 347  SER D CB  1 
ATOM   10575 O  OG  . SER D 1 344 ? -16.881 -77.224  9.092   1.00 54.54  ? 347  SER D OG  1 
ATOM   10576 N  N   . GLU D 1 345 ? -18.010 -74.452  7.806   1.00 55.52  ? 348  GLU D N   1 
ATOM   10577 C  CA  . GLU D 1 345 ? -18.354 -73.044  8.036   1.00 51.99  ? 348  GLU D CA  1 
ATOM   10578 C  C   . GLU D 1 345 ? -17.145 -72.241  8.499   1.00 47.24  ? 348  GLU D C   1 
ATOM   10579 O  O   . GLU D 1 345 ? -17.028 -71.056  8.192   1.00 47.59  ? 348  GLU D O   1 
ATOM   10580 C  CB  . GLU D 1 345 ? -19.456 -72.925  9.095   1.00 54.73  ? 348  GLU D CB  1 
ATOM   10581 C  CG  . GLU D 1 345 ? -20.699 -73.762  8.830   1.00 64.32  ? 348  GLU D CG  1 
ATOM   10582 C  CD  . GLU D 1 345 ? -21.788 -72.978  8.123   1.00 70.26  ? 348  GLU D CD  1 
ATOM   10583 O  OE1 . GLU D 1 345 ? -22.213 -71.934  8.661   1.00 73.80  ? 348  GLU D OE1 1 
ATOM   10584 O  OE2 . GLU D 1 345 ? -22.228 -73.405  7.035   1.00 72.44  ? 348  GLU D OE2 1 
ATOM   10585 N  N   . ALA D 1 346 ? -16.256 -72.887  9.246   1.00 40.44  ? 349  ALA D N   1 
ATOM   10586 C  CA  . ALA D 1 346 ? -15.122 -72.202  9.841   1.00 37.92  ? 349  ALA D CA  1 
ATOM   10587 C  C   . ALA D 1 346 ? -14.097 -73.207  10.342  1.00 35.50  ? 349  ALA D C   1 
ATOM   10588 O  O   . ALA D 1 346 ? -14.439 -74.308  10.753  1.00 33.99  ? 349  ALA D O   1 
ATOM   10589 C  CB  . ALA D 1 346 ? -15.576 -71.279  10.967  1.00 37.69  ? 349  ALA D CB  1 
ATOM   10590 N  N   . VAL D 1 347 ? -12.832 -72.812  10.289  1.00 35.01  ? 350  VAL D N   1 
ATOM   10591 C  CA  . VAL D 1 347 ? -11.730 -73.699  10.588  1.00 34.16  ? 350  VAL D CA  1 
ATOM   10592 C  C   . VAL D 1 347 ? -10.697 -72.873  11.319  1.00 33.25  ? 350  VAL D C   1 
ATOM   10593 O  O   . VAL D 1 347 ? -10.432 -71.734  10.947  1.00 34.92  ? 350  VAL D O   1 
ATOM   10594 C  CB  . VAL D 1 347 ? -11.068 -74.234  9.295   1.00 34.90  ? 350  VAL D CB  1 
ATOM   10595 C  CG1 . VAL D 1 347 ? -9.887  -75.146  9.624   1.00 35.41  ? 350  VAL D CG1 1 
ATOM   10596 C  CG2 . VAL D 1 347 ? -12.078 -74.975  8.426   1.00 37.08  ? 350  VAL D CG2 1 
ATOM   10597 N  N   . GLN D 1 348 ? -10.092 -73.446  12.346  1.00 30.84  ? 351  GLN D N   1 
ATOM   10598 C  CA  . GLN D 1 348 ? -8.948  -72.802  12.946  1.00 31.93  ? 351  GLN D CA  1 
ATOM   10599 C  C   . GLN D 1 348 ? -7.941  -73.872  13.276  1.00 31.12  ? 351  GLN D C   1 
ATOM   10600 O  O   . GLN D 1 348 ? -8.280  -75.057  13.299  1.00 32.75  ? 351  GLN D O   1 
ATOM   10601 C  CB  . GLN D 1 348 ? -9.345  -71.987  14.183  1.00 32.46  ? 351  GLN D CB  1 
ATOM   10602 C  CG  . GLN D 1 348 ? -9.858  -72.791  15.363  1.00 32.83  ? 351  GLN D CG  1 
ATOM   10603 C  CD  . GLN D 1 348 ? -10.381 -71.900  16.463  1.00 35.23  ? 351  GLN D CD  1 
ATOM   10604 O  OE1 . GLN D 1 348 ? -10.938 -72.379  17.459  1.00 33.70  ? 351  GLN D OE1 1 
ATOM   10605 N  NE2 . GLN D 1 348 ? -10.217 -70.586  16.288  1.00 33.75  ? 351  GLN D NE2 1 
ATOM   10606 N  N   . GLY D 1 349 ? -6.703  -73.460  13.510  1.00 28.24  ? 352  GLY D N   1 
ATOM   10607 C  CA  . GLY D 1 349 ? -5.654  -74.404  13.810  1.00 26.77  ? 352  GLY D CA  1 
ATOM   10608 C  C   . GLY D 1 349 ? -4.429  -73.788  14.437  1.00 26.86  ? 352  GLY D C   1 
ATOM   10609 O  O   . GLY D 1 349 ? -4.238  -72.563  14.410  1.00 26.59  ? 352  GLY D O   1 
ATOM   10610 N  N   . GLN D 1 350 ? -3.604  -74.657  15.011  1.00 26.25  ? 353  GLN D N   1 
ATOM   10611 C  CA  . GLN D 1 350 ? -2.334  -74.268  15.582  1.00 25.28  ? 353  GLN D CA  1 
ATOM   10612 C  C   . GLN D 1 350 ? -1.306  -75.341  15.260  1.00 24.28  ? 353  GLN D C   1 
ATOM   10613 O  O   . GLN D 1 350 ? -1.652  -76.493  15.041  1.00 24.39  ? 353  GLN D O   1 
ATOM   10614 C  CB  . GLN D 1 350 ? -2.470  -74.021  17.089  1.00 25.85  ? 353  GLN D CB  1 
ATOM   10615 C  CG  . GLN D 1 350 ? -2.031  -75.133  18.031  1.00 26.80  ? 353  GLN D CG  1 
ATOM   10616 C  CD  . GLN D 1 350 ? -1.840  -74.634  19.471  1.00 28.09  ? 353  GLN D CD  1 
ATOM   10617 O  OE1 . GLN D 1 350 ? -2.739  -74.012  20.052  1.00 26.91  ? 353  GLN D OE1 1 
ATOM   10618 N  NE2 . GLN D 1 350 ? -0.664  -74.907  20.051  1.00 28.83  ? 353  GLN D NE2 1 
ATOM   10619 N  N   . VAL D 1 351 ? -0.048  -74.943  15.226  1.00 23.34  ? 354  VAL D N   1 
ATOM   10620 C  CA  . VAL D 1 351 ? 1.032   -75.823  14.868  1.00 24.26  ? 354  VAL D CA  1 
ATOM   10621 C  C   . VAL D 1 351 ? 1.573   -76.452  16.139  1.00 24.60  ? 354  VAL D C   1 
ATOM   10622 O  O   . VAL D 1 351 ? 1.621   -75.803  17.172  1.00 23.74  ? 354  VAL D O   1 
ATOM   1062