data_3WAP
# 
_entry.id   3WAP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3WAP         
RCSB  RCSB096098   
WWPDB D_1000096098 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3VTU . unspecified 
PDB 3VTV . unspecified 
PDB 3VTW . unspecified 
PDB 3WAL . unspecified 
PDB 3WAM . unspecified 
PDB 3WAN . unspecified 
PDB 3WAO . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3WAP 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-06 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Suzuki, H.'     1 
'Tabata, K.'     2 
'Morita, E.'     3 
'Kawasaki, M.'   4 
'Kato, R.'       5 
'Dobson, R.C.J.' 6 
'Yoshimori, T.'  7 
'Wakatsuki, S.'  8 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            22 
_citation.page_first                47 
_citation.page_last                 58 
_citation.year                      2014 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24290141 
_citation.pdbx_database_id_DOI      10.1016/j.str.2013.09.023 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Suzuki, H.'    1 
primary 'Tabata, K.'    2 
primary 'Morita, E.'    3 
primary 'Kawasaki, M.'  4 
primary 'Kato, R.'      5 
primary 'Dobson, R.C.'  6 
primary 'Yoshimori, T.' 7 
primary 'Wakatsuki, S.' 8 
# 
_cell.entry_id           3WAP 
_cell.length_a           61.730 
_cell.length_b           61.730 
_cell.length_c           95.881 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3WAP 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3C' 
_entity.formula_weight             15401.719 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP RESIDUES 436-447, 8-125' 
_entity.details                    
;THE FUSION PROTEIN OF AUTOPHAGY-RELATED GENE 13 LIR (RESIDUES 436-447), LINKER (GLY SER) AND MICROTUBULE-ASSOCIATED PROTEINS 1A/1B LIGHT CHAIN 3C (RESIDUES 8-125)
;
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, MAP1 light chain 3-like protein 3, MAP1A/MAP1B light chain 3 C, MAP1A/MAP1B LC3 C, Microtubule-associated protein 1 light chain 3 gamma
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSSGNTHDDFVMIGSPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLS
IIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSSGNTHDDFVMIGSPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLS
IIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   SER n 
1 5   GLY n 
1 6   ASN n 
1 7   THR n 
1 8   HIS n 
1 9   ASP n 
1 10  ASP n 
1 11  PHE n 
1 12  VAL n 
1 13  MET n 
1 14  ILE n 
1 15  GLY n 
1 16  SER n 
1 17  PRO n 
1 18  SER n 
1 19  VAL n 
1 20  ARG n 
1 21  PRO n 
1 22  PHE n 
1 23  LYS n 
1 24  GLN n 
1 25  ARG n 
1 26  LYS n 
1 27  SER n 
1 28  LEU n 
1 29  ALA n 
1 30  ILE n 
1 31  ARG n 
1 32  GLN n 
1 33  GLU n 
1 34  GLU n 
1 35  VAL n 
1 36  ALA n 
1 37  GLY n 
1 38  ILE n 
1 39  ARG n 
1 40  ALA n 
1 41  LYS n 
1 42  PHE n 
1 43  PRO n 
1 44  ASN n 
1 45  LYS n 
1 46  ILE n 
1 47  PRO n 
1 48  VAL n 
1 49  VAL n 
1 50  VAL n 
1 51  GLU n 
1 52  ARG n 
1 53  TYR n 
1 54  PRO n 
1 55  ARG n 
1 56  GLU n 
1 57  THR n 
1 58  PHE n 
1 59  LEU n 
1 60  PRO n 
1 61  PRO n 
1 62  LEU n 
1 63  ASP n 
1 64  LYS n 
1 65  THR n 
1 66  LYS n 
1 67  PHE n 
1 68  LEU n 
1 69  VAL n 
1 70  PRO n 
1 71  GLN n 
1 72  GLU n 
1 73  LEU n 
1 74  THR n 
1 75  MET n 
1 76  THR n 
1 77  GLN n 
1 78  PHE n 
1 79  LEU n 
1 80  SER n 
1 81  ILE n 
1 82  ILE n 
1 83  ARG n 
1 84  SER n 
1 85  ARG n 
1 86  MET n 
1 87  VAL n 
1 88  LEU n 
1 89  ARG n 
1 90  ALA n 
1 91  THR n 
1 92  GLU n 
1 93  ALA n 
1 94  PHE n 
1 95  TYR n 
1 96  LEU n 
1 97  LEU n 
1 98  VAL n 
1 99  ASN n 
1 100 ASN n 
1 101 LYS n 
1 102 SER n 
1 103 LEU n 
1 104 VAL n 
1 105 SER n 
1 106 MET n 
1 107 SER n 
1 108 ALA n 
1 109 THR n 
1 110 MET n 
1 111 ALA n 
1 112 GLU n 
1 113 ILE n 
1 114 TYR n 
1 115 ARG n 
1 116 ASP n 
1 117 TYR n 
1 118 LYS n 
1 119 ASP n 
1 120 GLU n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 VAL n 
1 125 TYR n 
1 126 MET n 
1 127 THR n 
1 128 TYR n 
1 129 ALA n 
1 130 SER n 
1 131 GLN n 
1 132 GLU n 
1 133 THR n 
1 134 PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 3  14  human ? MAP1LC3C ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pET30 ? ? 
1 2 sample ? 17 134 human ? MAP1LC3C ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pET30 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ATG13_HUMAN O75143 1 SSGNTHDDFVMI 436 ? 
2 UNP MLP3C_HUMAN Q9BXW4 1 
;PSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYL
LVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETF
;
8   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3WAP A 3  ? 14  ? O75143 436 ? 447 ? 3  14  
2 2 3WAP A 17 ? 134 ? Q9BXW4 8   ? 125 ? 17 134 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3WAP GLY A 1  ? UNP O75143 ? ? 'EXPRESSION TAG' 1  1 
1 3WAP SER A 2  ? UNP O75143 ? ? 'EXPRESSION TAG' 2  2 
1 3WAP GLY A 15 ? UNP O75143 ? ? LINKER           15 3 
1 3WAP SER A 16 ? UNP O75143 ? ? LINKER           16 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3WAP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.42 
_exptl_crystal.density_percent_sol   64.08 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'0.1M Sodium acetate trihydrate, 8% PEG 4000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-01-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-17A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-17A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98000 
# 
_reflns.entry_id                     3WAP 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             53.46 
_reflns.d_resolution_high            3.10 
_reflns.number_obs                   4045 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            0.069 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  3.10 
_reflns_shell.d_res_low                   3.27 
_reflns_shell.percent_possible_all        100 
_reflns_shell.Rmerge_I_obs                0.785 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         2.8 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           588 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3WAP 
_refine.ls_number_reflns_obs                     3854 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             53.46 
_refine.ls_d_res_high                            3.10 
_refine.ls_percent_reflns_obs                    98.11 
_refine.ls_R_factor_obs                          0.21045 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20740 
_refine.ls_R_factor_R_free                       0.27321 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  185 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.B_iso_mean                               144.718 
_refine.aniso_B[1][1]                            6.01 
_refine.aniso_B[2][2]                            6.01 
_refine.aniso_B[3][3]                            -9.01 
_refine.aniso_B[1][2]                            3.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      3VTU 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.444 
_refine.overall_SU_ML                            0.376 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             54.548 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1014 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1014 
_refine_hist.d_res_high                       3.10 
_refine_hist.d_res_low                        53.46 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.014  0.020  ? 1036 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          2.445  1.982  ? 1398 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       9.812  5.000  ? 123  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       39.229 22.391 ? 46   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       25.979 15.000 ? 192  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       21.986 15.000 ? 10   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.119  0.200  ? 157  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.013  0.021  ? 769  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_scbond_it                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_scangle_it                 ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.100 
_refine_ls_shell.d_res_low                        3.181 
_refine_ls_shell.number_reflns_R_work             237 
_refine_ls_shell.R_factor_R_work                  0.350 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.530 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             8 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3WAP 
_struct.title                     'Crystal structure of Atg13 LIR-fused human LC3C_8-125' 
_struct.pdbx_descriptor           'Autophagy-related protein 13, Microtubule-associated proteins 1A/1B light chain 3C' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3WAP 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            'UBIQUITIN-LIKE FOLD, AUTOPHAGY, PROTEIN TRANSPORT' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 27  ? PHE A 42  ? SER A 27  PHE A 42  1 ? 16 
HELX_P HELX_P2 2 THR A 74  ? SER A 84  ? THR A 74  SER A 84  1 ? 11 
HELX_P HELX_P3 3 THR A 109 ? TYR A 117 ? THR A 109 TYR A 117 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 66  ? VAL A 69  ? LYS A 66  VAL A 69  
A 2 ILE A 46  ? ARG A 52  ? ILE A 46  ARG A 52  
A 3 VAL A 124 ? ALA A 129 ? VAL A 124 ALA A 129 
A 4 TYR A 95  ? VAL A 98  ? TYR A 95  VAL A 98  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 67  ? O PHE A 67  N VAL A 48  ? N VAL A 48  
A 2 3 N GLU A 51  ? N GLU A 51  O MET A 126 ? O MET A 126 
A 3 4 O THR A 127 ? O THR A 127 N LEU A 97  ? N LEU A 97  
# 
_database_PDB_matrix.entry_id          3WAP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3WAP 
_atom_sites.fract_transf_matrix[1][1]   0.016200 
_atom_sites.fract_transf_matrix[1][2]   0.009353 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018706 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010430 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . PHE A 1 11  ? 9.213   -33.135 -5.602  1.00 117.75 ? 11  PHE A N   1 
ATOM 2    C CA  . PHE A 1 11  ? 8.529   -33.484 -6.900  1.00 130.87 ? 11  PHE A CA  1 
ATOM 3    C C   . PHE A 1 11  ? 7.719   -32.403 -7.667  1.00 126.29 ? 11  PHE A C   1 
ATOM 4    O O   . PHE A 1 11  ? 6.497   -32.286 -7.505  1.00 133.18 ? 11  PHE A O   1 
ATOM 5    C CB  . PHE A 1 11  ? 7.645   -34.726 -6.727  1.00 141.90 ? 11  PHE A CB  1 
ATOM 6    C CG  . PHE A 1 11  ? 7.674   -35.626 -7.928  1.00 144.96 ? 11  PHE A CG  1 
ATOM 7    C CD1 . PHE A 1 11  ? 6.984   -35.287 -9.081  1.00 130.50 ? 11  PHE A CD1 1 
ATOM 8    C CD2 . PHE A 1 11  ? 8.459   -36.789 -7.924  1.00 156.87 ? 11  PHE A CD2 1 
ATOM 9    C CE1 . PHE A 1 11  ? 7.057   -36.104 -10.195 1.00 137.69 ? 11  PHE A CE1 1 
ATOM 10   C CE2 . PHE A 1 11  ? 8.541   -37.610 -9.039  1.00 146.29 ? 11  PHE A CE2 1 
ATOM 11   C CZ  . PHE A 1 11  ? 7.831   -37.264 -10.174 1.00 147.45 ? 11  PHE A CZ  1 
ATOM 12   N N   . VAL A 1 12  ? 8.391   -31.679 -8.558  1.00 120.93 ? 12  VAL A N   1 
ATOM 13   C CA  . VAL A 1 12  ? 7.801   -30.511 -9.232  1.00 114.29 ? 12  VAL A CA  1 
ATOM 14   C C   . VAL A 1 12  ? 6.442   -30.793 -9.788  1.00 119.41 ? 12  VAL A C   1 
ATOM 15   O O   . VAL A 1 12  ? 6.291   -31.613 -10.683 1.00 121.16 ? 12  VAL A O   1 
ATOM 16   C CB  . VAL A 1 12  ? 8.576   -30.090 -10.475 1.00 114.57 ? 12  VAL A CB  1 
ATOM 17   C CG1 . VAL A 1 12  ? 8.299   -28.638 -10.758 1.00 112.28 ? 12  VAL A CG1 1 
ATOM 18   C CG2 . VAL A 1 12  ? 10.064  -30.333 -10.310 1.00 130.73 ? 12  VAL A CG2 1 
ATOM 19   N N   . MET A 1 13  ? 5.438   -30.101 -9.288  1.00 126.42 ? 13  MET A N   1 
ATOM 20   C CA  . MET A 1 13  ? 4.166   -30.151 -9.966  1.00 132.01 ? 13  MET A CA  1 
ATOM 21   C C   . MET A 1 13  ? 4.404   -29.430 -11.237 1.00 132.75 ? 13  MET A C   1 
ATOM 22   O O   . MET A 1 13  ? 5.315   -28.619 -11.290 1.00 136.30 ? 13  MET A O   1 
ATOM 23   C CB  . MET A 1 13  ? 3.107   -29.366 -9.224  1.00 131.85 ? 13  MET A CB  1 
ATOM 24   C CG  . MET A 1 13  ? 2.378   -30.163 -8.166  1.00 137.97 ? 13  MET A CG  1 
ATOM 25   S SD  . MET A 1 13  ? 1.654   -31.652 -8.870  1.00 141.59 ? 13  MET A SD  1 
ATOM 26   C CE  . MET A 1 13  ? 0.178   -31.042 -9.691  1.00 117.05 ? 13  MET A CE  1 
ATOM 27   N N   . ILE A 1 14  ? 3.579   -29.687 -12.242 1.00 138.22 ? 14  ILE A N   1 
ATOM 28   C CA  . ILE A 1 14  ? 3.791   -29.046 -13.526 1.00 154.41 ? 14  ILE A CA  1 
ATOM 29   C C   . ILE A 1 14  ? 2.795   -27.943 -13.779 1.00 164.20 ? 14  ILE A C   1 
ATOM 30   O O   . ILE A 1 14  ? 2.013   -27.658 -12.935 1.00 180.49 ? 14  ILE A O   1 
ATOM 31   C CB  . ILE A 1 14  ? 3.399   -29.931 -14.673 1.00 160.14 ? 14  ILE A CB  1 
ATOM 32   C CG1 . ILE A 1 14  ? 4.390   -29.658 -15.820 1.00 160.42 ? 14  ILE A CG1 1 
ATOM 33   C CG2 . ILE A 1 14  ? 1.946   -29.631 -15.009 1.00 145.76 ? 14  ILE A CG2 1 
ATOM 34   C CD1 . ILE A 1 14  ? 5.494   -28.701 -15.426 1.00 126.95 ? 14  ILE A CD1 1 
ATOM 35   N N   . GLY A 1 15  ? 2.832   -27.318 -14.947 1.00 160.63 ? 15  GLY A N   1 
ATOM 36   C CA  . GLY A 1 15  ? 1.846   -26.289 -15.234 1.00 152.37 ? 15  GLY A CA  1 
ATOM 37   C C   . GLY A 1 15  ? 1.415   -26.538 -16.664 1.00 150.12 ? 15  GLY A C   1 
ATOM 38   O O   . GLY A 1 15  ? 2.160   -27.132 -17.456 1.00 137.31 ? 15  GLY A O   1 
ATOM 39   N N   . SER A 1 16  ? 0.195   -26.095 -16.971 1.00 147.77 ? 16  SER A N   1 
ATOM 40   C CA  . SER A 1 16  ? -0.687  -26.530 -18.053 1.00 150.23 ? 16  SER A CA  1 
ATOM 41   C C   . SER A 1 16  ? -0.860  -25.312 -18.994 1.00 158.90 ? 16  SER A C   1 
ATOM 42   O O   . SER A 1 16  ? -0.339  -24.232 -18.696 1.00 158.69 ? 16  SER A O   1 
ATOM 43   C CB  . SER A 1 16  ? -2.069  -26.899 -17.512 1.00 145.67 ? 16  SER A CB  1 
ATOM 44   O OG  . SER A 1 16  ? -2.852  -27.504 -18.517 1.00 146.49 ? 16  SER A OG  1 
ATOM 45   N N   . PRO A 1 17  ? -1.553  -25.476 -20.150 1.00 162.10 ? 17  PRO A N   1 
ATOM 46   C CA  . PRO A 1 17  ? -1.809  -24.350 -21.059 1.00 154.64 ? 17  PRO A CA  1 
ATOM 47   C C   . PRO A 1 17  ? -2.285  -23.059 -20.436 1.00 147.41 ? 17  PRO A C   1 
ATOM 48   O O   . PRO A 1 17  ? -1.633  -22.031 -20.582 1.00 141.74 ? 17  PRO A O   1 
ATOM 49   C CB  . PRO A 1 17  ? -2.993  -24.843 -21.917 1.00 167.77 ? 17  PRO A CB  1 
ATOM 50   C CG  . PRO A 1 17  ? -3.261  -26.265 -21.507 1.00 174.61 ? 17  PRO A CG  1 
ATOM 51   C CD  . PRO A 1 17  ? -2.055  -26.731 -20.740 1.00 173.96 ? 17  PRO A CD  1 
ATOM 52   N N   . SER A 1 18  ? -3.417  -23.141 -19.737 1.00 160.90 ? 18  SER A N   1 
ATOM 53   C CA  . SER A 1 18  ? -4.123  -21.984 -19.161 1.00 172.33 ? 18  SER A CA  1 
ATOM 54   C C   . SER A 1 18  ? -4.381  -20.845 -20.141 1.00 165.48 ? 18  SER A C   1 
ATOM 55   O O   . SER A 1 18  ? -3.968  -19.695 -19.912 1.00 163.96 ? 18  SER A O   1 
ATOM 56   C CB  . SER A 1 18  ? -3.516  -21.483 -17.824 1.00 172.50 ? 18  SER A CB  1 
ATOM 57   O OG  . SER A 1 18  ? -2.097  -21.507 -17.808 1.00 171.01 ? 18  SER A OG  1 
ATOM 58   N N   . VAL A 1 19  ? -5.064  -21.187 -21.234 1.00 149.18 ? 19  VAL A N   1 
ATOM 59   C CA  . VAL A 1 19  ? -5.431  -20.199 -22.257 1.00 141.44 ? 19  VAL A CA  1 
ATOM 60   C C   . VAL A 1 19  ? -6.058  -18.910 -21.718 1.00 132.21 ? 19  VAL A C   1 
ATOM 61   O O   . VAL A 1 19  ? -6.958  -18.958 -20.901 1.00 130.65 ? 19  VAL A O   1 
ATOM 62   C CB  . VAL A 1 19  ? -6.460  -20.754 -23.268 1.00 141.18 ? 19  VAL A CB  1 
ATOM 63   C CG1 . VAL A 1 19  ? -5.808  -21.767 -24.221 1.00 144.53 ? 19  VAL A CG1 1 
ATOM 64   C CG2 . VAL A 1 19  ? -7.648  -21.358 -22.538 1.00 138.94 ? 19  VAL A CG2 1 
ATOM 65   N N   . ARG A 1 20  ? -5.569  -17.775 -22.201 1.00 143.61 ? 20  ARG A N   1 
ATOM 66   C CA  . ARG A 1 20  ? -5.522  -16.445 -21.555 1.00 157.15 ? 20  ARG A CA  1 
ATOM 67   C C   . ARG A 1 20  ? -6.834  -15.813 -21.008 1.00 150.57 ? 20  ARG A C   1 
ATOM 68   O O   . ARG A 1 20  ? -7.859  -15.841 -21.686 1.00 148.30 ? 20  ARG A O   1 
ATOM 69   C CB  . ARG A 1 20  ? -4.837  -15.473 -22.527 1.00 178.98 ? 20  ARG A CB  1 
ATOM 70   C CG  . ARG A 1 20  ? -4.040  -14.352 -21.875 1.00 200.07 ? 20  ARG A CG  1 
ATOM 71   C CD  . ARG A 1 20  ? -2.693  -14.815 -21.308 1.00 212.76 ? 20  ARG A CD  1 
ATOM 72   N NE  . ARG A 1 20  ? -2.683  -14.910 -19.839 1.00 230.70 ? 20  ARG A NE  1 
ATOM 73   C CZ  . ARG A 1 20  ? -2.781  -16.040 -19.129 1.00 237.18 ? 20  ARG A CZ  1 
ATOM 74   N NH1 . ARG A 1 20  ? -2.901  -17.218 -19.737 1.00 234.63 ? 20  ARG A NH1 1 
ATOM 75   N NH2 . ARG A 1 20  ? -2.761  -15.991 -17.794 1.00 225.68 ? 20  ARG A NH2 1 
ATOM 76   N N   . PRO A 1 21  ? -6.794  -15.235 -19.776 1.00 153.30 ? 21  PRO A N   1 
ATOM 77   C CA  . PRO A 1 21  ? -7.954  -14.565 -19.194 1.00 152.25 ? 21  PRO A CA  1 
ATOM 78   C C   . PRO A 1 21  ? -8.804  -13.584 -19.930 1.00 147.36 ? 21  PRO A C   1 
ATOM 79   O O   . PRO A 1 21  ? -8.307  -12.662 -20.545 1.00 157.28 ? 21  PRO A O   1 
ATOM 80   C CB  . PRO A 1 21  ? -7.322  -13.619 -18.179 1.00 158.92 ? 21  PRO A CB  1 
ATOM 81   C CG  . PRO A 1 21  ? -6.163  -14.432 -17.652 1.00 173.92 ? 21  PRO A CG  1 
ATOM 82   C CD  . PRO A 1 21  ? -5.805  -15.475 -18.705 1.00 173.57 ? 21  PRO A CD  1 
ATOM 83   N N   . PHE A 1 22  ? -10.100 -13.812 -19.818 1.00 149.29 ? 22  PHE A N   1 
ATOM 84   C CA  . PHE A 1 22  ? -11.171 -13.442 -20.715 1.00 153.59 ? 22  PHE A CA  1 
ATOM 85   C C   . PHE A 1 22  ? -11.711 -12.086 -20.335 1.00 158.19 ? 22  PHE A C   1 
ATOM 86   O O   . PHE A 1 22  ? -12.644 -11.569 -20.973 1.00 152.14 ? 22  PHE A O   1 
ATOM 87   C CB  . PHE A 1 22  ? -12.287 -14.441 -20.565 1.00 158.50 ? 22  PHE A CB  1 
ATOM 88   C CG  . PHE A 1 22  ? -13.561 -14.011 -21.213 1.00 150.07 ? 22  PHE A CG  1 
ATOM 89   C CD1 . PHE A 1 22  ? -14.523 -13.234 -20.522 1.00 147.74 ? 22  PHE A CD1 1 
ATOM 90   C CD2 . PHE A 1 22  ? -13.812 -14.385 -22.511 1.00 144.74 ? 22  PHE A CD2 1 
ATOM 91   C CE1 . PHE A 1 22  ? -15.702 -12.843 -21.146 1.00 138.69 ? 22  PHE A CE1 1 
ATOM 92   C CE2 . PHE A 1 22  ? -14.998 -14.013 -23.122 1.00 148.40 ? 22  PHE A CE2 1 
ATOM 93   C CZ  . PHE A 1 22  ? -15.935 -13.232 -22.453 1.00 140.60 ? 22  PHE A CZ  1 
ATOM 94   N N   . LYS A 1 23  ? -11.191 -11.621 -19.200 1.00 169.77 ? 23  LYS A N   1 
ATOM 95   C CA  . LYS A 1 23  ? -11.009 -10.216 -18.860 1.00 174.58 ? 23  LYS A CA  1 
ATOM 96   C C   . LYS A 1 23  ? -10.203 -9.571  -20.003 1.00 174.76 ? 23  LYS A C   1 
ATOM 97   O O   . LYS A 1 23  ? -10.580 -8.527  -20.536 1.00 165.31 ? 23  LYS A O   1 
ATOM 98   C CB  . LYS A 1 23  ? -10.215 -10.124 -17.528 1.00 174.46 ? 23  LYS A CB  1 
ATOM 99   C CG  . LYS A 1 23  ? -11.012 -10.134 -16.220 1.00 163.59 ? 23  LYS A CG  1 
ATOM 100  C CD  . LYS A 1 23  ? -11.703 -8.788  -16.028 1.00 162.74 ? 23  LYS A CD  1 
ATOM 101  C CE  . LYS A 1 23  ? -12.628 -8.730  -14.820 1.00 164.32 ? 23  LYS A CE  1 
ATOM 102  N NZ  . LYS A 1 23  ? -13.699 -7.710  -15.065 1.00 156.47 ? 23  LYS A NZ  1 
ATOM 103  N N   . GLN A 1 24  ? -9.123  -10.263 -20.388 1.00 187.18 ? 24  GLN A N   1 
ATOM 104  C CA  . GLN A 1 24  ? -8.088  -9.834  -21.343 1.00 188.46 ? 24  GLN A CA  1 
ATOM 105  C C   . GLN A 1 24  ? -8.274  -10.176 -22.807 1.00 181.50 ? 24  GLN A C   1 
ATOM 106  O O   . GLN A 1 24  ? -7.477  -9.751  -23.634 1.00 189.21 ? 24  GLN A O   1 
ATOM 107  C CB  . GLN A 1 24  ? -6.804  -10.553 -20.981 1.00 195.09 ? 24  GLN A CB  1 
ATOM 108  C CG  . GLN A 1 24  ? -5.892  -9.792  -20.057 1.00 206.04 ? 24  GLN A CG  1 
ATOM 109  C CD  . GLN A 1 24  ? -4.455  -10.252 -20.199 1.00 206.85 ? 24  GLN A CD  1 
ATOM 110  O OE1 . GLN A 1 24  ? -4.188  -11.432 -20.445 1.00 207.41 ? 24  GLN A OE1 1 
ATOM 111  N NE2 . GLN A 1 24  ? -3.517  -9.319  -20.052 1.00 207.34 ? 24  GLN A NE2 1 
ATOM 112  N N   . ARG A 1 25  ? -9.260  -11.015 -23.093 1.00 182.12 ? 25  ARG A N   1 
ATOM 113  C CA  . ARG A 1 25  ? -9.544  -11.576 -24.411 1.00 183.86 ? 25  ARG A CA  1 
ATOM 114  C C   . ARG A 1 25  ? -10.517 -10.670 -25.104 1.00 176.64 ? 25  ARG A C   1 
ATOM 115  O O   . ARG A 1 25  ? -10.861 -10.840 -26.264 1.00 164.07 ? 25  ARG A O   1 
ATOM 116  C CB  . ARG A 1 25  ? -10.201 -12.952 -24.263 1.00 190.89 ? 25  ARG A CB  1 
ATOM 117  C CG  . ARG A 1 25  ? -9.374  -14.110 -24.767 1.00 189.87 ? 25  ARG A CG  1 
ATOM 118  C CD  . ARG A 1 25  ? -10.208 -15.364 -24.987 1.00 193.66 ? 25  ARG A CD  1 
ATOM 119  N NE  . ARG A 1 25  ? -9.598  -16.195 -26.041 1.00 225.51 ? 25  ARG A NE  1 
ATOM 120  C CZ  . ARG A 1 25  ? -9.743  -16.028 -27.369 1.00 223.31 ? 25  ARG A CZ  1 
ATOM 121  N NH1 . ARG A 1 25  ? -9.126  -16.850 -28.217 1.00 216.37 ? 25  ARG A NH1 1 
ATOM 122  N NH2 . ARG A 1 25  ? -10.497 -15.054 -27.871 1.00 217.80 ? 25  ARG A NH2 1 
ATOM 123  N N   . LYS A 1 26  ? -10.998 -9.722  -24.340 1.00 178.66 ? 26  LYS A N   1 
ATOM 124  C CA  . LYS A 1 26  ? -11.843 -8.727  -24.858 1.00 183.66 ? 26  LYS A CA  1 
ATOM 125  C C   . LYS A 1 26  ? -11.116 -7.506  -24.351 1.00 201.75 ? 26  LYS A C   1 
ATOM 126  O O   . LYS A 1 26  ? -10.281 -7.633  -23.436 1.00 208.45 ? 26  LYS A O   1 
ATOM 127  C CB  . LYS A 1 26  ? -13.217 -8.952  -24.236 1.00 167.76 ? 26  LYS A CB  1 
ATOM 128  C CG  . LYS A 1 26  ? -13.755 -10.349 -24.530 1.00 159.54 ? 26  LYS A CG  1 
ATOM 129  C CD  . LYS A 1 26  ? -14.040 -10.517 -26.014 1.00 161.82 ? 26  LYS A CD  1 
ATOM 130  C CE  . LYS A 1 26  ? -14.524 -11.905 -26.366 1.00 155.73 ? 26  LYS A CE  1 
ATOM 131  N NZ  . LYS A 1 26  ? -13.345 -12.776 -26.612 1.00 160.13 ? 26  LYS A NZ  1 
ATOM 132  N N   . SER A 1 27  ? -11.302 -6.380  -25.038 1.00 209.03 ? 27  SER A N   1 
ATOM 133  C CA  . SER A 1 27  ? -11.308 -5.090  -24.380 1.00 212.41 ? 27  SER A CA  1 
ATOM 134  C C   . SER A 1 27  ? -12.763 -5.137  -23.918 1.00 207.17 ? 27  SER A C   1 
ATOM 135  O O   . SER A 1 27  ? -13.478 -6.051  -24.328 1.00 199.60 ? 27  SER A O   1 
ATOM 136  C CB  . SER A 1 27  ? -11.032 -3.967  -25.381 1.00 212.02 ? 27  SER A CB  1 
ATOM 137  O OG  . SER A 1 27  ? -9.690  -4.020  -25.842 1.00 209.92 ? 27  SER A OG  1 
ATOM 138  N N   . LEU A 1 28  ? -13.200 -4.221  -23.053 1.00 198.96 ? 28  LEU A N   1 
ATOM 139  C CA  . LEU A 1 28  ? -14.591 -4.222  -22.528 1.00 185.30 ? 28  LEU A CA  1 
ATOM 140  C C   . LEU A 1 28  ? -15.656 -4.186  -23.623 1.00 184.98 ? 28  LEU A C   1 
ATOM 141  O O   . LEU A 1 28  ? -16.752 -4.753  -23.488 1.00 177.05 ? 28  LEU A O   1 
ATOM 142  C CB  . LEU A 1 28  ? -14.782 -3.067  -21.524 1.00 174.64 ? 28  LEU A CB  1 
ATOM 143  C CG  . LEU A 1 28  ? -15.978 -2.111  -21.324 1.00 165.55 ? 28  LEU A CG  1 
ATOM 144  C CD1 . LEU A 1 28  ? -17.375 -2.709  -21.455 1.00 155.26 ? 28  LEU A CD1 1 
ATOM 145  C CD2 . LEU A 1 28  ? -15.821 -1.437  -19.961 1.00 160.77 ? 28  LEU A CD2 1 
ATOM 146  N N   . ALA A 1 29  ? -15.292 -3.523  -24.713 1.00 198.23 ? 29  ALA A N   1 
ATOM 147  C CA  . ALA A 1 29  ? -16.195 -3.240  -25.812 1.00 213.26 ? 29  ALA A CA  1 
ATOM 148  C C   . ALA A 1 29  ? -16.278 -4.345  -26.849 1.00 217.78 ? 29  ALA A C   1 
ATOM 149  O O   . ALA A 1 29  ? -17.184 -4.309  -27.684 1.00 238.43 ? 29  ALA A O   1 
ATOM 150  C CB  . ALA A 1 29  ? -15.809 -1.930  -26.483 1.00 222.18 ? 29  ALA A CB  1 
ATOM 151  N N   . ILE A 1 30  ? -15.347 -5.301  -26.805 1.00 207.99 ? 30  ILE A N   1 
ATOM 152  C CA  . ILE A 1 30  ? -15.462 -6.486  -27.644 1.00 198.49 ? 30  ILE A CA  1 
ATOM 153  C C   . ILE A 1 30  ? -16.637 -7.326  -27.021 1.00 194.09 ? 30  ILE A C   1 
ATOM 154  O O   . ILE A 1 30  ? -17.508 -7.813  -27.754 1.00 190.44 ? 30  ILE A O   1 
ATOM 155  C CB  . ILE A 1 30  ? -14.070 -7.212  -27.890 1.00 188.51 ? 30  ILE A CB  1 
ATOM 156  C CG1 . ILE A 1 30  ? -12.863 -6.237  -27.833 1.00 181.08 ? 30  ILE A CG1 1 
ATOM 157  C CG2 . ILE A 1 30  ? -14.055 -7.984  -29.212 1.00 180.82 ? 30  ILE A CG2 1 
ATOM 158  C CD1 . ILE A 1 30  ? -12.118 -5.974  -29.134 1.00 171.67 ? 30  ILE A CD1 1 
ATOM 159  N N   . ARG A 1 31  ? -16.727 -7.358  -25.679 1.00 192.53 ? 31  ARG A N   1 
ATOM 160  C CA  . ARG A 1 31  ? -17.625 -8.267  -24.908 1.00 186.03 ? 31  ARG A CA  1 
ATOM 161  C C   . ARG A 1 31  ? -18.916 -7.643  -24.423 1.00 176.83 ? 31  ARG A C   1 
ATOM 162  O O   . ARG A 1 31  ? -19.898 -8.341  -24.154 1.00 165.63 ? 31  ARG A O   1 
ATOM 163  C CB  . ARG A 1 31  ? -16.896 -8.806  -23.669 1.00 182.17 ? 31  ARG A CB  1 
ATOM 164  C CG  . ARG A 1 31  ? -16.734 -7.806  -22.531 1.00 175.34 ? 31  ARG A CG  1 
ATOM 165  C CD  . ARG A 1 31  ? -15.272 -7.667  -22.137 1.00 179.22 ? 31  ARG A CD  1 
ATOM 166  N NE  . ARG A 1 31  ? -15.081 -7.406  -20.711 1.00 185.29 ? 31  ARG A NE  1 
ATOM 167  C CZ  . ARG A 1 31  ? -13.902 -7.456  -20.090 1.00 185.32 ? 31  ARG A CZ  1 
ATOM 168  N NH1 . ARG A 1 31  ? -12.803 -7.755  -20.776 1.00 179.15 ? 31  ARG A NH1 1 
ATOM 169  N NH2 . ARG A 1 31  ? -13.819 -7.215  -18.781 1.00 180.29 ? 31  ARG A NH2 1 
ATOM 170  N N   . GLN A 1 32  ? -18.869 -6.331  -24.256 1.00 176.02 ? 32  GLN A N   1 
ATOM 171  C CA  . GLN A 1 32  ? -19.979 -5.575  -23.763 1.00 177.21 ? 32  GLN A CA  1 
ATOM 172  C C   . GLN A 1 32  ? -21.203 -5.897  -24.610 1.00 172.47 ? 32  GLN A C   1 
ATOM 173  O O   . GLN A 1 32  ? -22.322 -6.037  -24.091 1.00 163.39 ? 32  GLN A O   1 
ATOM 174  C CB  . GLN A 1 32  ? -19.631 -4.090  -23.815 1.00 185.07 ? 32  GLN A CB  1 
ATOM 175  C CG  . GLN A 1 32  ? -20.589 -3.192  -23.060 1.00 195.73 ? 32  GLN A CG  1 
ATOM 176  C CD  . GLN A 1 32  ? -20.883 -3.685  -21.653 1.00 197.79 ? 32  GLN A CD  1 
ATOM 177  O OE1 . GLN A 1 32  ? -21.643 -4.641  -21.457 1.00 197.54 ? 32  GLN A OE1 1 
ATOM 178  N NE2 . GLN A 1 32  ? -20.303 -3.015  -20.662 1.00 191.79 ? 32  GLN A NE2 1 
ATOM 179  N N   . GLU A 1 33  ? -20.958 -6.030  -25.915 1.00 172.14 ? 33  GLU A N   1 
ATOM 180  C CA  . GLU A 1 33  ? -21.960 -6.495  -26.870 1.00 183.99 ? 33  GLU A CA  1 
ATOM 181  C C   . GLU A 1 33  ? -22.602 -7.794  -26.356 1.00 187.37 ? 33  GLU A C   1 
ATOM 182  O O   . GLU A 1 33  ? -23.801 -7.820  -26.059 1.00 185.11 ? 33  GLU A O   1 
ATOM 183  C CB  . GLU A 1 33  ? -21.335 -6.688  -28.273 1.00 184.80 ? 33  GLU A CB  1 
ATOM 184  C CG  . GLU A 1 33  ? -22.323 -6.753  -29.446 1.00 184.12 ? 33  GLU A CG  1 
ATOM 185  C CD  . GLU A 1 33  ? -22.653 -5.387  -30.057 1.00 195.51 ? 33  GLU A CD  1 
ATOM 186  O OE1 . GLU A 1 33  ? -22.818 -4.393  -29.308 1.00 192.92 ? 33  GLU A OE1 1 
ATOM 187  O OE2 . GLU A 1 33  ? -22.760 -5.305  -31.302 1.00 200.60 ? 33  GLU A OE2 1 
ATOM 188  N N   . GLU A 1 34  ? -21.778 -8.837  -26.204 1.00 185.79 ? 34  GLU A N   1 
ATOM 189  C CA  . GLU A 1 34  ? -22.208 -10.200 -25.832 1.00 163.34 ? 34  GLU A CA  1 
ATOM 190  C C   . GLU A 1 34  ? -23.070 -10.242 -24.588 1.00 154.38 ? 34  GLU A C   1 
ATOM 191  O O   . GLU A 1 34  ? -24.086 -10.941 -24.544 1.00 143.17 ? 34  GLU A O   1 
ATOM 192  C CB  . GLU A 1 34  ? -20.983 -11.073 -25.606 1.00 159.77 ? 34  GLU A CB  1 
ATOM 193  C CG  . GLU A 1 34  ? -21.253 -12.539 -25.818 1.00 177.76 ? 34  GLU A CG  1 
ATOM 194  C CD  . GLU A 1 34  ? -20.094 -13.232 -26.514 1.00 188.91 ? 34  GLU A CD  1 
ATOM 195  O OE1 . GLU A 1 34  ? -20.198 -13.453 -27.744 1.00 189.02 ? 34  GLU A OE1 1 
ATOM 196  O OE2 . GLU A 1 34  ? -19.078 -13.552 -25.849 1.00 184.16 ? 34  GLU A OE2 1 
ATOM 197  N N   . VAL A 1 35  ? -22.615 -9.500  -23.579 1.00 156.18 ? 35  VAL A N   1 
ATOM 198  C CA  . VAL A 1 35  ? -23.347 -9.267  -22.345 1.00 153.25 ? 35  VAL A CA  1 
ATOM 199  C C   . VAL A 1 35  ? -24.775 -8.895  -22.673 1.00 157.12 ? 35  VAL A C   1 
ATOM 200  O O   . VAL A 1 35  ? -25.722 -9.562  -22.264 1.00 148.00 ? 35  VAL A O   1 
ATOM 201  C CB  . VAL A 1 35  ? -22.778 -8.057  -21.590 1.00 157.67 ? 35  VAL A CB  1 
ATOM 202  C CG1 . VAL A 1 35  ? -23.517 -7.884  -20.278 1.00 150.96 ? 35  VAL A CG1 1 
ATOM 203  C CG2 . VAL A 1 35  ? -21.276 -8.179  -21.380 1.00 163.89 ? 35  VAL A CG2 1 
ATOM 204  N N   . ALA A 1 36  ? -24.900 -7.793  -23.408 1.00 169.63 ? 36  ALA A N   1 
ATOM 205  C CA  . ALA A 1 36  ? -26.181 -7.281  -23.860 1.00 172.05 ? 36  ALA A CA  1 
ATOM 206  C C   . ALA A 1 36  ? -26.838 -8.306  -24.778 1.00 172.45 ? 36  ALA A C   1 
ATOM 207  O O   . ALA A 1 36  ? -27.996 -8.677  -24.566 1.00 166.19 ? 36  ALA A O   1 
ATOM 208  C CB  . ALA A 1 36  ? -25.990 -5.951  -24.577 1.00 168.85 ? 36  ALA A CB  1 
ATOM 209  N N   . GLY A 1 37  ? -26.061 -8.785  -25.754 1.00 174.48 ? 37  GLY A N   1 
ATOM 210  C CA  . GLY A 1 37  ? -26.520 -9.717  -26.780 1.00 171.09 ? 37  GLY A CA  1 
ATOM 211  C C   . GLY A 1 37  ? -27.263 -10.947 -26.285 1.00 177.25 ? 37  GLY A C   1 
ATOM 212  O O   . GLY A 1 37  ? -28.344 -11.247 -26.790 1.00 171.99 ? 37  GLY A O   1 
ATOM 213  N N   . ILE A 1 38  ? -26.692 -11.664 -25.310 1.00 180.30 ? 38  ILE A N   1 
ATOM 214  C CA  . ILE A 1 38  ? -27.297 -12.924 -24.829 1.00 180.37 ? 38  ILE A CA  1 
ATOM 215  C C   . ILE A 1 38  ? -28.349 -12.654 -23.745 1.00 177.51 ? 38  ILE A C   1 
ATOM 216  O O   . ILE A 1 38  ? -29.316 -13.416 -23.574 1.00 172.25 ? 38  ILE A O   1 
ATOM 217  C CB  . ILE A 1 38  ? -26.237 -13.982 -24.390 1.00 175.64 ? 38  ILE A CB  1 
ATOM 218  C CG1 . ILE A 1 38  ? -26.533 -15.363 -25.001 1.00 177.71 ? 38  ILE A CG1 1 
ATOM 219  C CG2 . ILE A 1 38  ? -26.139 -14.093 -22.876 1.00 169.38 ? 38  ILE A CG2 1 
ATOM 220  C CD1 . ILE A 1 38  ? -26.024 -15.559 -26.419 1.00 183.49 ? 38  ILE A CD1 1 
ATOM 221  N N   . ARG A 1 39  ? -28.171 -11.548 -23.033 1.00 176.35 ? 39  ARG A N   1 
ATOM 222  C CA  . ARG A 1 39  ? -29.197 -11.111 -22.111 1.00 180.09 ? 39  ARG A CA  1 
ATOM 223  C C   . ARG A 1 39  ? -30.451 -10.801 -22.877 1.00 171.52 ? 39  ARG A C   1 
ATOM 224  O O   . ARG A 1 39  ? -31.528 -10.847 -22.327 1.00 177.92 ? 39  ARG A O   1 
ATOM 225  C CB  . ARG A 1 39  ? -28.770 -9.894  -21.301 1.00 186.13 ? 39  ARG A CB  1 
ATOM 226  C CG  . ARG A 1 39  ? -28.493 -10.217 -19.837 1.00 200.02 ? 39  ARG A CG  1 
ATOM 227  C CD  . ARG A 1 39  ? -29.700 -10.778 -19.069 1.00 213.78 ? 39  ARG A CD  1 
ATOM 228  N NE  . ARG A 1 39  ? -29.599 -10.453 -17.634 1.00 226.94 ? 39  ARG A NE  1 
ATOM 229  C CZ  . ARG A 1 39  ? -30.368 -10.931 -16.649 1.00 225.37 ? 39  ARG A CZ  1 
ATOM 230  N NH1 . ARG A 1 39  ? -31.335 -11.802 -16.893 1.00 220.06 ? 39  ARG A NH1 1 
ATOM 231  N NH2 . ARG A 1 39  ? -30.157 -10.534 -15.393 1.00 216.22 ? 39  ARG A NH2 1 
ATOM 232  N N   . ALA A 1 40  ? -30.305 -10.511 -24.159 1.00 164.87 ? 40  ALA A N   1 
ATOM 233  C CA  . ALA A 1 40  ? -31.450 -10.198 -24.995 1.00 170.70 ? 40  ALA A CA  1 
ATOM 234  C C   . ALA A 1 40  ? -32.246 -11.436 -25.457 1.00 173.82 ? 40  ALA A C   1 
ATOM 235  O O   . ALA A 1 40  ? -33.471 -11.419 -25.416 1.00 171.33 ? 40  ALA A O   1 
ATOM 236  C CB  . ALA A 1 40  ? -31.020 -9.344  -26.184 1.00 169.45 ? 40  ALA A CB  1 
ATOM 237  N N   . LYS A 1 41  ? -31.567 -12.492 -25.907 1.00 176.65 ? 41  LYS A N   1 
ATOM 238  C CA  . LYS A 1 41  ? -32.264 -13.668 -26.434 1.00 175.12 ? 41  LYS A CA  1 
ATOM 239  C C   . LYS A 1 41  ? -32.815 -14.654 -25.400 1.00 181.53 ? 41  LYS A C   1 
ATOM 240  O O   . LYS A 1 41  ? -33.903 -15.200 -25.593 1.00 184.55 ? 41  LYS A O   1 
ATOM 241  C CB  . LYS A 1 41  ? -31.360 -14.523 -27.339 1.00 164.27 ? 41  LYS A CB  1 
ATOM 242  C CG  . LYS A 1 41  ? -32.123 -15.302 -28.404 1.00 164.13 ? 41  LYS A CG  1 
ATOM 243  C CD  . LYS A 1 41  ? -31.321 -16.484 -28.917 1.00 170.86 ? 41  LYS A CD  1 
ATOM 244  C CE  . LYS A 1 41  ? -29.945 -16.038 -29.388 1.00 175.98 ? 41  LYS A CE  1 
ATOM 245  N NZ  . LYS A 1 41  ? -29.025 -17.197 -29.549 1.00 184.95 ? 41  LYS A NZ  1 
ATOM 246  N N   . PHE A 1 42  ? -32.101 -14.851 -24.289 1.00 179.18 ? 42  PHE A N   1 
ATOM 247  C CA  . PHE A 1 42  ? -32.605 -15.714 -23.202 1.00 165.69 ? 42  PHE A CA  1 
ATOM 248  C C   . PHE A 1 42  ? -32.256 -14.607 -22.168 1.00 158.00 ? 42  PHE A C   1 
ATOM 249  O O   . PHE A 1 42  ? -31.213 -14.685 -21.555 1.00 155.19 ? 42  PHE A O   1 
ATOM 250  C CB  . PHE A 1 42  ? -31.613 -16.866 -22.934 1.00 159.13 ? 42  PHE A CB  1 
ATOM 251  C CG  . PHE A 1 42  ? -31.350 -17.780 -24.125 1.00 154.57 ? 42  PHE A CG  1 
ATOM 252  C CD1 . PHE A 1 42  ? -32.150 -18.896 -24.369 1.00 150.32 ? 42  PHE A CD1 1 
ATOM 253  C CD2 . PHE A 1 42  ? -30.255 -17.568 -24.962 1.00 167.16 ? 42  PHE A CD2 1 
ATOM 254  C CE1 . PHE A 1 42  ? -31.897 -19.753 -25.444 1.00 161.34 ? 42  PHE A CE1 1 
ATOM 255  C CE2 . PHE A 1 42  ? -29.991 -18.428 -26.037 1.00 178.31 ? 42  PHE A CE2 1 
ATOM 256  C CZ  . PHE A 1 42  ? -30.818 -19.516 -26.286 1.00 170.84 ? 42  PHE A CZ  1 
ATOM 257  N N   . PRO A 1 43  ? -33.203 -13.714 -21.834 1.00 161.13 ? 43  PRO A N   1 
ATOM 258  C CA  . PRO A 1 43  ? -32.997 -12.553 -20.989 1.00 168.70 ? 43  PRO A CA  1 
ATOM 259  C C   . PRO A 1 43  ? -33.169 -12.610 -19.509 1.00 173.40 ? 43  PRO A C   1 
ATOM 260  O O   . PRO A 1 43  ? -32.973 -11.593 -18.864 1.00 186.81 ? 43  PRO A O   1 
ATOM 261  C CB  . PRO A 1 43  ? -33.854 -11.549 -21.697 1.00 169.95 ? 43  PRO A CB  1 
ATOM 262  C CG  . PRO A 1 43  ? -35.103 -12.349 -21.815 1.00 167.77 ? 43  PRO A CG  1 
ATOM 263  C CD  . PRO A 1 43  ? -34.617 -13.706 -22.252 1.00 165.07 ? 43  PRO A CD  1 
ATOM 264  N N   . ASN A 1 44  ? -33.635 -13.723 -18.988 1.00 177.44 ? 44  ASN A N   1 
ATOM 265  C CA  . ASN A 1 44  ? -34.207 -13.878 -17.648 1.00 183.99 ? 44  ASN A CA  1 
ATOM 266  C C   . ASN A 1 44  ? -33.324 -14.942 -17.000 1.00 186.66 ? 44  ASN A C   1 
ATOM 267  O O   . ASN A 1 44  ? -33.749 -15.747 -16.154 1.00 178.57 ? 44  ASN A O   1 
ATOM 268  C CB  . ASN A 1 44  ? -35.669 -14.307 -17.737 1.00 184.31 ? 44  ASN A CB  1 
ATOM 269  C CG  . ASN A 1 44  ? -35.840 -15.718 -18.278 1.00 192.95 ? 44  ASN A CG  1 
ATOM 270  O OD1 . ASN A 1 44  ? -35.058 -16.233 -19.085 1.00 188.01 ? 44  ASN A OD1 1 
ATOM 271  N ND2 . ASN A 1 44  ? -36.877 -16.354 -17.817 1.00 208.74 ? 44  ASN A ND2 1 
ATOM 272  N N   . LYS A 1 45  ? -32.069 -14.894 -17.467 1.00 180.26 ? 45  LYS A N   1 
ATOM 273  C CA  . LYS A 1 45  ? -30.958 -15.819 -17.175 1.00 163.40 ? 45  LYS A CA  1 
ATOM 274  C C   . LYS A 1 45  ? -29.640 -15.048 -16.922 1.00 167.45 ? 45  LYS A C   1 
ATOM 275  O O   . LYS A 1 45  ? -29.398 -13.978 -17.504 1.00 174.73 ? 45  LYS A O   1 
ATOM 276  C CB  . LYS A 1 45  ? -30.707 -16.734 -18.373 1.00 147.24 ? 45  LYS A CB  1 
ATOM 277  C CG  . LYS A 1 45  ? -31.922 -17.465 -18.932 1.00 149.81 ? 45  LYS A CG  1 
ATOM 278  C CD  . LYS A 1 45  ? -32.104 -18.860 -18.358 1.00 143.76 ? 45  LYS A CD  1 
ATOM 279  C CE  . LYS A 1 45  ? -31.160 -19.851 -19.047 1.00 143.91 ? 45  LYS A CE  1 
ATOM 280  N NZ  . LYS A 1 45  ? -31.706 -21.212 -19.312 1.00 144.33 ? 45  LYS A NZ  1 
ATOM 281  N N   . ILE A 1 46  ? -28.769 -15.626 -16.094 1.00 155.47 ? 46  ILE A N   1 
ATOM 282  C CA  . ILE A 1 46  ? -27.491 -15.012 -15.728 1.00 139.24 ? 46  ILE A CA  1 
ATOM 283  C C   . ILE A 1 46  ? -26.256 -15.644 -16.348 1.00 132.41 ? 46  ILE A C   1 
ATOM 284  O O   . ILE A 1 46  ? -26.052 -16.846 -16.256 1.00 137.11 ? 46  ILE A O   1 
ATOM 285  C CB  . ILE A 1 46  ? -27.237 -15.136 -14.223 1.00 141.61 ? 46  ILE A CB  1 
ATOM 286  C CG1 . ILE A 1 46  ? -28.429 -14.585 -13.447 1.00 147.24 ? 46  ILE A CG1 1 
ATOM 287  C CG2 . ILE A 1 46  ? -25.968 -14.395 -13.835 1.00 148.12 ? 46  ILE A CG2 1 
ATOM 288  C CD1 . ILE A 1 46  ? -28.405 -14.871 -11.964 1.00 141.42 ? 46  ILE A CD1 1 
ATOM 289  N N   . PRO A 1 47  ? -25.423 -14.835 -16.988 1.00 125.55 ? 47  PRO A N   1 
ATOM 290  C CA  . PRO A 1 47  ? -24.293 -15.360 -17.725 1.00 127.33 ? 47  PRO A CA  1 
ATOM 291  C C   . PRO A 1 47  ? -23.154 -15.471 -16.730 1.00 126.71 ? 47  PRO A C   1 
ATOM 292  O O   . PRO A 1 47  ? -22.841 -14.499 -16.041 1.00 144.54 ? 47  PRO A O   1 
ATOM 293  C CB  . PRO A 1 47  ? -24.069 -14.280 -18.772 1.00 131.50 ? 47  PRO A CB  1 
ATOM 294  C CG  . PRO A 1 47  ? -24.369 -13.019 -18.021 1.00 131.17 ? 47  PRO A CG  1 
ATOM 295  C CD  . PRO A 1 47  ? -25.507 -13.370 -17.085 1.00 127.51 ? 47  PRO A CD  1 
ATOM 296  N N   . VAL A 1 48  ? -22.524 -16.625 -16.648 1.00 116.00 ? 48  VAL A N   1 
ATOM 297  C CA  . VAL A 1 48  ? -21.326 -16.722 -15.859 1.00 112.41 ? 48  VAL A CA  1 
ATOM 298  C C   . VAL A 1 48  ? -20.132 -16.989 -16.721 1.00 112.62 ? 48  VAL A C   1 
ATOM 299  O O   . VAL A 1 48  ? -20.228 -17.725 -17.712 1.00 109.06 ? 48  VAL A O   1 
ATOM 300  C CB  . VAL A 1 48  ? -21.442 -17.852 -14.871 1.00 114.76 ? 48  VAL A CB  1 
ATOM 301  C CG1 . VAL A 1 48  ? -20.096 -18.120 -14.217 1.00 122.56 ? 48  VAL A CG1 1 
ATOM 302  C CG2 . VAL A 1 48  ? -22.484 -17.483 -13.848 1.00 119.85 ? 48  VAL A CG2 1 
ATOM 303  N N   . VAL A 1 49  ? -19.022 -16.373 -16.328 1.00 108.59 ? 49  VAL A N   1 
ATOM 304  C CA  . VAL A 1 49  ? -17.726 -16.683 -16.880 1.00 116.40 ? 49  VAL A CA  1 
ATOM 305  C C   . VAL A 1 49  ? -16.998 -17.495 -15.847 1.00 119.41 ? 49  VAL A C   1 
ATOM 306  O O   . VAL A 1 49  ? -16.859 -17.055 -14.701 1.00 128.38 ? 49  VAL A O   1 
ATOM 307  C CB  . VAL A 1 49  ? -16.891 -15.422 -17.081 1.00 126.07 ? 49  VAL A CB  1 
ATOM 308  C CG1 . VAL A 1 49  ? -15.414 -15.779 -17.212 1.00 133.01 ? 49  VAL A CG1 1 
ATOM 309  C CG2 . VAL A 1 49  ? -17.382 -14.633 -18.286 1.00 134.09 ? 49  VAL A CG2 1 
ATOM 310  N N   . VAL A 1 50  ? -16.504 -18.662 -16.234 1.00 111.05 ? 50  VAL A N   1 
ATOM 311  C CA  . VAL A 1 50  ? -15.800 -19.484 -15.260 1.00 105.69 ? 50  VAL A CA  1 
ATOM 312  C C   . VAL A 1 50  ? -14.374 -19.716 -15.710 1.00 115.21 ? 50  VAL A C   1 
ATOM 313  O O   . VAL A 1 50  ? -14.142 -20.613 -16.516 1.00 125.41 ? 50  VAL A O   1 
ATOM 314  C CB  . VAL A 1 50  ? -16.462 -20.851 -15.122 1.00 91.98  ? 50  VAL A CB  1 
ATOM 315  C CG1 . VAL A 1 50  ? -15.525 -21.769 -14.378 1.00 85.82  ? 50  VAL A CG1 1 
ATOM 316  C CG2 . VAL A 1 50  ? -17.821 -20.742 -14.450 1.00 86.64  ? 50  VAL A CG2 1 
ATOM 317  N N   . GLU A 1 51  ? -13.414 -18.932 -15.221 1.00 119.53 ? 51  GLU A N   1 
ATOM 318  C CA  . GLU A 1 51  ? -12.011 -19.188 -15.607 1.00 121.67 ? 51  GLU A CA  1 
ATOM 319  C C   . GLU A 1 51  ? -11.313 -20.040 -14.545 1.00 118.20 ? 51  GLU A C   1 
ATOM 320  O O   . GLU A 1 51  ? -11.523 -19.820 -13.345 1.00 117.53 ? 51  GLU A O   1 
ATOM 321  C CB  . GLU A 1 51  ? -11.190 -17.905 -15.841 1.00 127.75 ? 51  GLU A CB  1 
ATOM 322  C CG  . GLU A 1 51  ? -11.926 -16.571 -15.990 1.00 141.32 ? 51  GLU A CG  1 
ATOM 323  C CD  . GLU A 1 51  ? -11.113 -15.564 -16.814 1.00 156.13 ? 51  GLU A CD  1 
ATOM 324  O OE1 . GLU A 1 51  ? -10.682 -15.963 -17.921 1.00 155.84 ? 51  GLU A OE1 1 
ATOM 325  O OE2 . GLU A 1 51  ? -10.893 -14.397 -16.373 1.00 160.55 ? 51  GLU A OE2 1 
ATOM 326  N N   . ARG A 1 52  ? -10.483 -20.995 -14.976 1.00 110.42 ? 52  ARG A N   1 
ATOM 327  C CA  . ARG A 1 52  ? -9.564  -21.676 -14.055 1.00 106.68 ? 52  ARG A CA  1 
ATOM 328  C C   . ARG A 1 52  ? -8.734  -20.630 -13.396 1.00 113.36 ? 52  ARG A C   1 
ATOM 329  O O   . ARG A 1 52  ? -8.514  -19.561 -13.955 1.00 121.45 ? 52  ARG A O   1 
ATOM 330  C CB  . ARG A 1 52  ? -8.614  -22.597 -14.789 1.00 109.47 ? 52  ARG A CB  1 
ATOM 331  C CG  . ARG A 1 52  ? -7.799  -23.465 -13.855 1.00 114.98 ? 52  ARG A CG  1 
ATOM 332  C CD  . ARG A 1 52  ? -7.633  -24.910 -14.344 1.00 121.69 ? 52  ARG A CD  1 
ATOM 333  N NE  . ARG A 1 52  ? -6.738  -25.089 -15.491 1.00 135.28 ? 52  ARG A NE  1 
ATOM 334  C CZ  . ARG A 1 52  ? -5.525  -24.547 -15.624 1.00 154.44 ? 52  ARG A CZ  1 
ATOM 335  N NH1 . ARG A 1 52  ? -5.020  -23.745 -14.681 1.00 159.93 ? 52  ARG A NH1 1 
ATOM 336  N NH2 . ARG A 1 52  ? -4.818  -24.792 -16.727 1.00 158.19 ? 52  ARG A NH2 1 
ATOM 337  N N   . TYR A 1 53  ? -8.260  -20.915 -12.201 1.00 117.07 ? 53  TYR A N   1 
ATOM 338  C CA  . TYR A 1 53  ? -7.286  -20.024 -11.621 1.00 119.68 ? 53  TYR A CA  1 
ATOM 339  C C   . TYR A 1 53  ? -6.112  -20.079 -12.551 1.00 119.19 ? 53  TYR A C   1 
ATOM 340  O O   . TYR A 1 53  ? -5.749  -21.167 -13.035 1.00 111.22 ? 53  TYR A O   1 
ATOM 341  C CB  . TYR A 1 53  ? -6.899  -20.508 -10.255 1.00 127.64 ? 53  TYR A CB  1 
ATOM 342  C CG  . TYR A 1 53  ? -5.893  -19.682 -9.488  1.00 132.93 ? 53  TYR A CG  1 
ATOM 343  C CD1 . TYR A 1 53  ? -6.040  -18.308 -9.325  1.00 133.32 ? 53  TYR A CD1 1 
ATOM 344  C CD2 . TYR A 1 53  ? -4.835  -20.317 -8.844  1.00 130.85 ? 53  TYR A CD2 1 
ATOM 345  C CE1 . TYR A 1 53  ? -5.118  -17.593 -8.583  1.00 140.57 ? 53  TYR A CE1 1 
ATOM 346  C CE2 . TYR A 1 53  ? -3.922  -19.622 -8.097  1.00 129.49 ? 53  TYR A CE2 1 
ATOM 347  C CZ  . TYR A 1 53  ? -4.063  -18.271 -7.969  1.00 140.10 ? 53  TYR A CZ  1 
ATOM 348  O OH  . TYR A 1 53  ? -3.129  -17.636 -7.207  1.00 149.64 ? 53  TYR A OH  1 
ATOM 349  N N   . PRO A 1 54  ? -5.569  -18.896 -12.866 1.00 121.72 ? 54  PRO A N   1 
ATOM 350  C CA  . PRO A 1 54  ? -4.397  -18.740 -13.721 1.00 124.47 ? 54  PRO A CA  1 
ATOM 351  C C   . PRO A 1 54  ? -3.313  -19.669 -13.212 1.00 129.72 ? 54  PRO A C   1 
ATOM 352  O O   . PRO A 1 54  ? -2.874  -20.561 -13.941 1.00 132.14 ? 54  PRO A O   1 
ATOM 353  C CB  . PRO A 1 54  ? -4.002  -17.266 -13.524 1.00 122.67 ? 54  PRO A CB  1 
ATOM 354  C CG  . PRO A 1 54  ? -4.978  -16.689 -12.525 1.00 126.80 ? 54  PRO A CG  1 
ATOM 355  C CD  . PRO A 1 54  ? -6.166  -17.600 -12.506 1.00 122.25 ? 54  PRO A CD  1 
ATOM 356  N N   . ARG A 1 55  ? -2.975  -19.510 -11.932 1.00 130.55 ? 55  ARG A N   1 
ATOM 357  C CA  . ARG A 1 55  ? -1.852  -20.195 -11.301 1.00 133.45 ? 55  ARG A CA  1 
ATOM 358  C C   . ARG A 1 55  ? -2.016  -21.704 -11.011 1.00 124.03 ? 55  ARG A C   1 
ATOM 359  O O   . ARG A 1 55  ? -1.034  -22.408 -10.748 1.00 116.72 ? 55  ARG A O   1 
ATOM 360  C CB  . ARG A 1 55  ? -1.495  -19.446 -10.025 1.00 142.81 ? 55  ARG A CB  1 
ATOM 361  C CG  . ARG A 1 55  ? -0.238  -18.625 -10.135 1.00 161.06 ? 55  ARG A CG  1 
ATOM 362  C CD  . ARG A 1 55  ? 0.880   -19.307 -9.363  1.00 172.70 ? 55  ARG A CD  1 
ATOM 363  N NE  . ARG A 1 55  ? 1.845   -18.333 -8.851  1.00 183.89 ? 55  ARG A NE  1 
ATOM 364  C CZ  . ARG A 1 55  ? 1.534   -17.225 -8.171  1.00 188.99 ? 55  ARG A CZ  1 
ATOM 365  N NH1 . ARG A 1 55  ? 0.271   -16.909 -7.923  1.00 179.07 ? 55  ARG A NH1 1 
ATOM 366  N NH2 . ARG A 1 55  ? 2.493   -16.408 -7.756  1.00 207.15 ? 55  ARG A NH2 1 
ATOM 367  N N   . GLU A 1 56  ? -3.251  -22.190 -11.074 1.00 115.39 ? 56  GLU A N   1 
ATOM 368  C CA  . GLU A 1 56  ? -3.591  -23.563 -10.705 1.00 109.26 ? 56  GLU A CA  1 
ATOM 369  C C   . GLU A 1 56  ? -3.104  -24.731 -11.527 1.00 106.32 ? 56  GLU A C   1 
ATOM 370  O O   . GLU A 1 56  ? -3.253  -24.720 -12.716 1.00 115.58 ? 56  GLU A O   1 
ATOM 371  C CB  . GLU A 1 56  ? -5.044  -23.841 -11.093 1.00 117.69 ? 56  GLU A CB  1 
ATOM 372  C CG  . GLU A 1 56  ? -5.414  -25.322 -11.146 1.00 121.45 ? 56  GLU A CG  1 
ATOM 373  C CD  . GLU A 1 56  ? -5.396  -25.992 -9.769  1.00 125.34 ? 56  GLU A CD  1 
ATOM 374  O OE1 . GLU A 1 56  ? -5.153  -27.233 -9.693  1.00 114.18 ? 56  GLU A OE1 1 
ATOM 375  O OE2 . GLU A 1 56  ? -5.618  -25.264 -8.760  1.00 124.54 ? 56  GLU A OE2 1 
ATOM 376  N N   . THR A 1 57  ? -2.549  -25.752 -10.895 1.00 110.13 ? 57  THR A N   1 
ATOM 377  C CA  . THR A 1 57  ? -1.718  -26.771 -11.528 1.00 107.81 ? 57  THR A CA  1 
ATOM 378  C C   . THR A 1 57  ? -2.274  -28.207 -11.534 1.00 116.21 ? 57  THR A C   1 
ATOM 379  O O   . THR A 1 57  ? -2.046  -28.928 -12.486 1.00 126.02 ? 57  THR A O   1 
ATOM 380  C CB  . THR A 1 57  ? -0.307  -26.807 -10.898 1.00 108.52 ? 57  THR A CB  1 
ATOM 381  O OG1 . THR A 1 57  ? -0.233  -27.824 -9.867  1.00 107.93 ? 57  THR A OG1 1 
ATOM 382  C CG2 . THR A 1 57  ? 0.130   -25.390 -10.394 1.00 92.55  ? 57  THR A CG2 1 
ATOM 383  N N   . PHE A 1 58  ? -2.951  -28.655 -10.479 1.00 123.69 ? 58  PHE A N   1 
ATOM 384  C CA  . PHE A 1 58  ? -3.505  -30.024 -10.504 1.00 132.84 ? 58  PHE A CA  1 
ATOM 385  C C   . PHE A 1 58  ? -4.812  -30.080 -11.303 1.00 127.74 ? 58  PHE A C   1 
ATOM 386  O O   . PHE A 1 58  ? -5.254  -31.141 -11.719 1.00 135.81 ? 58  PHE A O   1 
ATOM 387  C CB  . PHE A 1 58  ? -3.648  -30.628 -9.073  1.00 154.76 ? 58  PHE A CB  1 
ATOM 388  C CG  . PHE A 1 58  ? -4.252  -32.040 -9.023  1.00 156.90 ? 58  PHE A CG  1 
ATOM 389  C CD1 . PHE A 1 58  ? -3.519  -33.172 -9.420  1.00 167.98 ? 58  PHE A CD1 1 
ATOM 390  C CD2 . PHE A 1 58  ? -5.550  -32.238 -8.542  1.00 147.39 ? 58  PHE A CD2 1 
ATOM 391  C CE1 . PHE A 1 58  ? -4.084  -34.451 -9.367  1.00 171.87 ? 58  PHE A CE1 1 
ATOM 392  C CE2 . PHE A 1 58  ? -6.111  -33.512 -8.475  1.00 152.99 ? 58  PHE A CE2 1 
ATOM 393  C CZ  . PHE A 1 58  ? -5.380  -34.618 -8.890  1.00 171.62 ? 58  PHE A CZ  1 
ATOM 394  N N   . LEU A 1 59  ? -5.433  -28.945 -11.554 1.00 116.16 ? 59  LEU A N   1 
ATOM 395  C CA  . LEU A 1 59  ? -6.727  -29.008 -12.189 1.00 110.32 ? 59  LEU A CA  1 
ATOM 396  C C   . LEU A 1 59  ? -6.664  -28.760 -13.691 1.00 112.44 ? 59  LEU A C   1 
ATOM 397  O O   . LEU A 1 59  ? -5.929  -27.870 -14.168 1.00 119.71 ? 59  LEU A O   1 
ATOM 398  C CB  . LEU A 1 59  ? -7.694  -28.033 -11.512 1.00 113.20 ? 59  LEU A CB  1 
ATOM 399  C CG  . LEU A 1 59  ? -8.483  -28.448 -10.268 1.00 108.87 ? 59  LEU A CG  1 
ATOM 400  C CD1 . LEU A 1 59  ? -8.694  -27.294 -9.299  1.00 109.63 ? 59  LEU A CD1 1 
ATOM 401  C CD2 . LEU A 1 59  ? -9.821  -28.954 -10.744 1.00 107.48 ? 59  LEU A CD2 1 
ATOM 402  N N   . PRO A 1 60  ? -7.447  -29.547 -14.443 1.00 106.73 ? 60  PRO A N   1 
ATOM 403  C CA  . PRO A 1 60  ? -7.833  -29.391 -15.877 1.00 107.61 ? 60  PRO A CA  1 
ATOM 404  C C   . PRO A 1 60  ? -8.846  -28.347 -16.261 1.00 104.18 ? 60  PRO A C   1 
ATOM 405  O O   . PRO A 1 60  ? -9.857  -28.250 -15.607 1.00 114.73 ? 60  PRO A O   1 
ATOM 406  C CB  . PRO A 1 60  ? -8.772  -30.573 -16.129 1.00 108.09 ? 60  PRO A CB  1 
ATOM 407  C CG  . PRO A 1 60  ? -9.034  -31.175 -14.775 1.00 113.64 ? 60  PRO A CG  1 
ATOM 408  C CD  . PRO A 1 60  ? -7.864  -30.842 -13.898 1.00 100.65 ? 60  PRO A CD  1 
ATOM 409  N N   . PRO A 1 61  ? -8.606  -27.573 -17.321 1.00 113.52 ? 61  PRO A N   1 
ATOM 410  C CA  . PRO A 1 61  ? -9.479  -26.407 -17.544 1.00 122.26 ? 61  PRO A CA  1 
ATOM 411  C C   . PRO A 1 61  ? -10.552 -26.718 -18.586 1.00 118.00 ? 61  PRO A C   1 
ATOM 412  O O   . PRO A 1 61  ? -10.407 -27.693 -19.331 1.00 121.96 ? 61  PRO A O   1 
ATOM 413  C CB  . PRO A 1 61  ? -8.615  -25.466 -18.409 1.00 120.68 ? 61  PRO A CB  1 
ATOM 414  C CG  . PRO A 1 61  ? -7.426  -26.304 -18.837 1.00 121.72 ? 61  PRO A CG  1 
ATOM 415  C CD  . PRO A 1 61  ? -7.687  -27.743 -18.446 1.00 116.04 ? 61  PRO A CD  1 
ATOM 416  N N   . LEU A 1 62  ? -11.613 -25.922 -18.643 1.00 104.64 ? 62  LEU A N   1 
ATOM 417  C CA  . LEU A 1 62  ? -12.920 -26.317 -19.130 1.00 110.70 ? 62  LEU A CA  1 
ATOM 418  C C   . LEU A 1 62  ? -12.978 -26.215 -20.628 1.00 123.96 ? 62  LEU A C   1 
ATOM 419  O O   . LEU A 1 62  ? -12.324 -25.373 -21.255 1.00 123.20 ? 62  LEU A O   1 
ATOM 420  C CB  . LEU A 1 62  ? -13.997 -25.587 -18.376 1.00 113.19 ? 62  LEU A CB  1 
ATOM 421  C CG  . LEU A 1 62  ? -14.311 -26.033 -16.976 1.00 115.62 ? 62  LEU A CG  1 
ATOM 422  C CD1 . LEU A 1 62  ? -14.434 -24.772 -16.140 1.00 123.40 ? 62  LEU A CD1 1 
ATOM 423  C CD2 . LEU A 1 62  ? -15.595 -26.844 -17.011 1.00 127.34 ? 62  LEU A CD2 1 
ATOM 424  N N   . ASP A 1 63  ? -13.865 -27.029 -21.190 1.00 137.72 ? 63  ASP A N   1 
ATOM 425  C CA  . ASP A 1 63  ? -14.257 -26.919 -22.582 1.00 152.21 ? 63  ASP A CA  1 
ATOM 426  C C   . ASP A 1 63  ? -14.849 -25.538 -22.860 1.00 149.65 ? 63  ASP A C   1 
ATOM 427  O O   . ASP A 1 63  ? -14.541 -24.934 -23.888 1.00 162.16 ? 63  ASP A O   1 
ATOM 428  C CB  . ASP A 1 63  ? -15.269 -28.008 -22.942 1.00 167.55 ? 63  ASP A CB  1 
ATOM 429  C CG  . ASP A 1 63  ? -15.021 -29.304 -22.196 1.00 179.36 ? 63  ASP A CG  1 
ATOM 430  O OD1 . ASP A 1 63  ? -15.501 -29.433 -21.050 1.00 172.63 ? 63  ASP A OD1 1 
ATOM 431  O OD2 . ASP A 1 63  ? -14.346 -30.193 -22.755 1.00 199.03 ? 63  ASP A OD2 1 
ATOM 432  N N   . LYS A 1 64  ? -15.691 -25.026 -21.960 1.00 131.05 ? 64  LYS A N   1 
ATOM 433  C CA  . LYS A 1 64  ? -16.237 -23.697 -22.190 1.00 128.58 ? 64  LYS A CA  1 
ATOM 434  C C   . LYS A 1 64  ? -16.593 -22.849 -20.978 1.00 119.14 ? 64  LYS A C   1 
ATOM 435  O O   . LYS A 1 64  ? -16.899 -23.367 -19.925 1.00 116.78 ? 64  LYS A O   1 
ATOM 436  C CB  . LYS A 1 64  ? -17.688 -23.776 -22.704 1.00 136.19 ? 64  LYS A CB  1 
ATOM 437  C CG  . LYS A 1 64  ? -18.077 -24.988 -23.543 1.00 131.02 ? 64  LYS A CG  1 
ATOM 438  C CD  . LYS A 1 64  ? -17.777 -24.835 -25.036 1.00 137.12 ? 64  LYS A CD  1 
ATOM 439  C CE  . LYS A 1 64  ? -18.252 -26.061 -25.800 1.00 140.86 ? 64  LYS A CE  1 
ATOM 440  N NZ  . LYS A 1 64  ? -18.046 -27.282 -24.958 1.00 158.75 ? 64  LYS A NZ  1 
ATOM 441  N N   . THR A 1 65  ? -16.604 -21.535 -21.174 1.00 122.84 ? 65  THR A N   1 
ATOM 442  C CA  . THR A 1 65  ? -16.329 -20.459 -20.242 1.00 123.46 ? 65  THR A CA  1 
ATOM 443  C C   . THR A 1 65  ? -17.553 -19.631 -19.943 1.00 123.15 ? 65  THR A C   1 
ATOM 444  O O   . THR A 1 65  ? -17.715 -19.113 -18.836 1.00 134.83 ? 65  THR A O   1 
ATOM 445  C CB  . THR A 1 65  ? -15.258 -19.540 -20.831 1.00 119.84 ? 65  THR A CB  1 
ATOM 446  O OG1 . THR A 1 65  ? -14.149 -20.353 -21.218 1.00 120.54 ? 65  THR A OG1 1 
ATOM 447  C CG2 . THR A 1 65  ? -14.799 -18.502 -19.808 1.00 125.50 ? 65  THR A CG2 1 
ATOM 448  N N   . LYS A 1 66  ? -18.410 -19.493 -20.934 1.00 111.15 ? 66  LYS A N   1 
ATOM 449  C CA  . LYS A 1 66  ? -19.564 -18.652 -20.764 1.00 118.45 ? 66  LYS A CA  1 
ATOM 450  C C   . LYS A 1 66  ? -20.766 -19.564 -20.593 1.00 119.27 ? 66  LYS A C   1 
ATOM 451  O O   . LYS A 1 66  ? -21.279 -20.125 -21.558 1.00 137.86 ? 66  LYS A O   1 
ATOM 452  C CB  . LYS A 1 66  ? -19.695 -17.669 -21.942 1.00 125.43 ? 66  LYS A CB  1 
ATOM 453  C CG  . LYS A 1 66  ? -19.116 -18.242 -23.225 1.00 153.83 ? 66  LYS A CG  1 
ATOM 454  C CD  . LYS A 1 66  ? -19.325 -17.368 -24.445 1.00 169.18 ? 66  LYS A CD  1 
ATOM 455  C CE  . LYS A 1 66  ? -19.360 -18.210 -25.725 1.00 177.51 ? 66  LYS A CE  1 
ATOM 456  N NZ  . LYS A 1 66  ? -20.019 -17.465 -26.836 1.00 178.47 ? 66  LYS A NZ  1 
ATOM 457  N N   . PHE A 1 67  ? -21.197 -19.745 -19.354 1.00 109.82 ? 67  PHE A N   1 
ATOM 458  C CA  . PHE A 1 67  ? -22.427 -20.492 -19.094 1.00 108.77 ? 67  PHE A CA  1 
ATOM 459  C C   . PHE A 1 67  ? -23.554 -19.538 -18.871 1.00 113.19 ? 67  PHE A C   1 
ATOM 460  O O   . PHE A 1 67  ? -23.358 -18.455 -18.320 1.00 120.26 ? 67  PHE A O   1 
ATOM 461  C CB  . PHE A 1 67  ? -22.284 -21.322 -17.851 1.00 107.00 ? 67  PHE A CB  1 
ATOM 462  C CG  . PHE A 1 67  ? -21.046 -22.092 -17.844 1.00 109.32 ? 67  PHE A CG  1 
ATOM 463  C CD1 . PHE A 1 67  ? -19.827 -21.432 -17.971 1.00 112.63 ? 67  PHE A CD1 1 
ATOM 464  C CD2 . PHE A 1 67  ? -21.079 -23.460 -17.781 1.00 105.82 ? 67  PHE A CD2 1 
ATOM 465  C CE1 . PHE A 1 67  ? -18.635 -22.128 -18.017 1.00 118.31 ? 67  PHE A CE1 1 
ATOM 466  C CE2 . PHE A 1 67  ? -19.893 -24.172 -17.815 1.00 110.37 ? 67  PHE A CE2 1 
ATOM 467  C CZ  . PHE A 1 67  ? -18.665 -23.509 -17.930 1.00 116.66 ? 67  PHE A CZ  1 
ATOM 468  N N   . LEU A 1 68  ? -24.739 -19.940 -19.300 1.00 108.23 ? 68  LEU A N   1 
ATOM 469  C CA  . LEU A 1 68  ? -25.948 -19.249 -18.904 1.00 110.52 ? 68  LEU A CA  1 
ATOM 470  C C   . LEU A 1 68  ? -26.392 -19.934 -17.652 1.00 116.86 ? 68  LEU A C   1 
ATOM 471  O O   . LEU A 1 68  ? -26.019 -21.072 -17.439 1.00 143.50 ? 68  LEU A O   1 
ATOM 472  C CB  . LEU A 1 68  ? -27.012 -19.410 -19.965 1.00 118.39 ? 68  LEU A CB  1 
ATOM 473  C CG  . LEU A 1 68  ? -26.744 -18.447 -21.115 1.00 128.58 ? 68  LEU A CG  1 
ATOM 474  C CD1 . LEU A 1 68  ? -27.357 -18.901 -22.448 1.00 137.51 ? 68  LEU A CD1 1 
ATOM 475  C CD2 . LEU A 1 68  ? -27.166 -17.043 -20.699 1.00 125.41 ? 68  LEU A CD2 1 
ATOM 476  N N   . VAL A 1 69  ? -27.150 -19.251 -16.803 1.00 114.74 ? 69  VAL A N   1 
ATOM 477  C CA  . VAL A 1 69  ? -27.633 -19.844 -15.552 1.00 114.88 ? 69  VAL A CA  1 
ATOM 478  C C   . VAL A 1 69  ? -29.060 -19.331 -15.372 1.00 121.52 ? 69  VAL A C   1 
ATOM 479  O O   . VAL A 1 69  ? -29.413 -18.263 -15.926 1.00 113.79 ? 69  VAL A O   1 
ATOM 480  C CB  . VAL A 1 69  ? -26.569 -19.876 -14.423 1.00 119.18 ? 69  VAL A CB  1 
ATOM 481  C CG1 . VAL A 1 69  ? -26.183 -21.301 -14.084 1.00 121.66 ? 69  VAL A CG1 1 
ATOM 482  C CG2 . VAL A 1 69  ? -25.333 -19.065 -14.777 1.00 118.78 ? 69  VAL A CG2 1 
ATOM 483  N N   . PRO A 1 70  ? -29.866 -20.086 -14.572 1.00 119.93 ? 70  PRO A N   1 
ATOM 484  C CA  . PRO A 1 70  ? -31.085 -19.839 -13.814 1.00 128.18 ? 70  PRO A CA  1 
ATOM 485  C C   . PRO A 1 70  ? -30.992 -18.771 -12.716 1.00 141.39 ? 70  PRO A C   1 
ATOM 486  O O   . PRO A 1 70  ? -30.005 -18.666 -11.979 1.00 130.68 ? 70  PRO A O   1 
ATOM 487  C CB  . PRO A 1 70  ? -31.373 -21.206 -13.170 1.00 121.83 ? 70  PRO A CB  1 
ATOM 488  C CG  . PRO A 1 70  ? -30.734 -22.218 -14.056 1.00 109.17 ? 70  PRO A CG  1 
ATOM 489  C CD  . PRO A 1 70  ? -29.833 -21.489 -15.023 1.00 110.58 ? 70  PRO A CD  1 
ATOM 490  N N   . GLN A 1 71  ? -32.069 -18.016 -12.588 1.00 158.25 ? 71  GLN A N   1 
ATOM 491  C CA  . GLN A 1 71  ? -32.080 -16.889 -11.699 1.00 161.34 ? 71  GLN A CA  1 
ATOM 492  C C   . GLN A 1 71  ? -31.619 -17.315 -10.291 1.00 168.38 ? 71  GLN A C   1 
ATOM 493  O O   . GLN A 1 71  ? -31.049 -16.509 -9.556  1.00 191.21 ? 71  GLN A O   1 
ATOM 494  C CB  . GLN A 1 71  ? -33.376 -16.079 -11.917 1.00 160.22 ? 71  GLN A CB  1 
ATOM 495  C CG  . GLN A 1 71  ? -33.281 -14.644 -11.453 1.00 174.17 ? 71  GLN A CG  1 
ATOM 496  C CD  . GLN A 1 71  ? -34.059 -13.706 -12.361 1.00 191.94 ? 71  GLN A CD  1 
ATOM 497  O OE1 . GLN A 1 71  ? -35.288 -13.668 -12.329 1.00 214.09 ? 71  GLN A OE1 1 
ATOM 498  N NE2 . GLN A 1 71  ? -33.342 -12.952 -13.185 1.00 190.51 ? 71  GLN A NE2 1 
ATOM 499  N N   . GLU A 1 72  ? -31.812 -18.600 -9.954  1.00 151.98 ? 72  GLU A N   1 
ATOM 500  C CA  . GLU A 1 72  ? -31.880 -19.157 -8.590  1.00 153.97 ? 72  GLU A CA  1 
ATOM 501  C C   . GLU A 1 72  ? -31.220 -20.480 -8.957  1.00 141.39 ? 72  GLU A C   1 
ATOM 502  O O   . GLU A 1 72  ? -31.796 -21.352 -9.624  1.00 126.44 ? 72  GLU A O   1 
ATOM 503  C CB  . GLU A 1 72  ? -33.322 -19.133 -8.039  1.00 166.62 ? 72  GLU A CB  1 
ATOM 504  C CG  . GLU A 1 72  ? -34.404 -19.266 -9.111  1.00 172.59 ? 72  GLU A CG  1 
ATOM 505  C CD  . GLU A 1 72  ? -34.028 -20.249 -10.216 1.00 163.23 ? 72  GLU A CD  1 
ATOM 506  O OE1 . GLU A 1 72  ? -33.167 -19.935 -11.061 1.00 151.09 ? 72  GLU A OE1 1 
ATOM 507  O OE2 . GLU A 1 72  ? -34.584 -21.360 -10.228 1.00 169.49 ? 72  GLU A OE2 1 
ATOM 508  N N   . LEU A 1 73  ? -29.989 -20.611 -8.501  1.00 143.74 ? 73  LEU A N   1 
ATOM 509  C CA  . LEU A 1 73  ? -29.259 -21.853 -8.517  1.00 139.24 ? 73  LEU A CA  1 
ATOM 510  C C   . LEU A 1 73  ? -28.226 -21.800 -7.392  1.00 136.13 ? 73  LEU A C   1 
ATOM 511  O O   . LEU A 1 73  ? -27.424 -20.870 -7.336  1.00 142.55 ? 73  LEU A O   1 
ATOM 512  C CB  . LEU A 1 73  ? -28.586 -22.021 -9.884  1.00 132.95 ? 73  LEU A CB  1 
ATOM 513  C CG  . LEU A 1 73  ? -28.404 -23.470 -10.314 1.00 131.03 ? 73  LEU A CG  1 
ATOM 514  C CD1 . LEU A 1 73  ? -29.774 -24.141 -10.311 1.00 132.84 ? 73  LEU A CD1 1 
ATOM 515  C CD2 . LEU A 1 73  ? -27.711 -23.549 -11.665 1.00 112.89 ? 73  LEU A CD2 1 
ATOM 516  N N   . THR A 1 74  ? -28.267 -22.766 -6.478  1.00 125.88 ? 74  THR A N   1 
ATOM 517  C CA  . THR A 1 74  ? -27.224 -22.877 -5.475  1.00 125.09 ? 74  THR A CA  1 
ATOM 518  C C   . THR A 1 74  ? -25.891 -22.999 -6.205  1.00 123.06 ? 74  THR A C   1 
ATOM 519  O O   . THR A 1 74  ? -25.771 -23.746 -7.193  1.00 116.05 ? 74  THR A O   1 
ATOM 520  C CB  . THR A 1 74  ? -27.372 -24.130 -4.574  1.00 138.24 ? 74  THR A CB  1 
ATOM 521  O OG1 . THR A 1 74  ? -26.514 -25.182 -5.046  1.00 140.89 ? 74  THR A OG1 1 
ATOM 522  C CG2 . THR A 1 74  ? -28.823 -24.626 -4.490  1.00 126.79 ? 74  THR A CG2 1 
ATOM 523  N N   . MET A 1 75  ? -24.902 -22.255 -5.727  1.00 114.57 ? 75  MET A N   1 
ATOM 524  C CA  . MET A 1 75  ? -23.536 -22.515 -6.100  1.00 113.28 ? 75  MET A CA  1 
ATOM 525  C C   . MET A 1 75  ? -23.201 -23.987 -5.984  1.00 119.23 ? 75  MET A C   1 
ATOM 526  O O   . MET A 1 75  ? -22.502 -24.517 -6.848  1.00 120.30 ? 75  MET A O   1 
ATOM 527  C CB  . MET A 1 75  ? -22.614 -21.779 -5.182  1.00 106.83 ? 75  MET A CB  1 
ATOM 528  C CG  . MET A 1 75  ? -22.615 -20.316 -5.475  1.00 105.75 ? 75  MET A CG  1 
ATOM 529  S SD  . MET A 1 75  ? -21.420 -19.968 -6.773  1.00 124.15 ? 75  MET A SD  1 
ATOM 530  C CE  . MET A 1 75  ? -19.961 -20.929 -6.314  1.00 122.10 ? 75  MET A CE  1 
ATOM 531  N N   . THR A 1 76  ? -23.691 -24.651 -4.935  1.00 112.63 ? 76  THR A N   1 
ATOM 532  C CA  . THR A 1 76  ? -23.398 -26.071 -4.812  1.00 123.01 ? 76  THR A CA  1 
ATOM 533  C C   . THR A 1 76  ? -23.784 -26.783 -6.083  1.00 118.82 ? 76  THR A C   1 
ATOM 534  O O   . THR A 1 76  ? -22.939 -27.431 -6.686  1.00 122.47 ? 76  THR A O   1 
ATOM 535  C CB  . THR A 1 76  ? -24.051 -26.753 -3.604  1.00 135.23 ? 76  THR A CB  1 
ATOM 536  O OG1 . THR A 1 76  ? -23.459 -26.230 -2.407  1.00 159.47 ? 76  THR A OG1 1 
ATOM 537  C CG2 . THR A 1 76  ? -23.816 -28.271 -3.663  1.00 126.10 ? 76  THR A CG2 1 
ATOM 538  N N   . GLN A 1 77  ? -25.033 -26.641 -6.516  1.00 115.58 ? 77  GLN A N   1 
ATOM 539  C CA  . GLN A 1 77  ? -25.450 -27.271 -7.769  1.00 116.94 ? 77  GLN A CA  1 
ATOM 540  C C   . GLN A 1 77  ? -24.497 -26.790 -8.853  1.00 109.56 ? 77  GLN A C   1 
ATOM 541  O O   . GLN A 1 77  ? -23.825 -27.619 -9.499  1.00 99.49  ? 77  GLN A O   1 
ATOM 542  C CB  . GLN A 1 77  ? -26.901 -26.941 -8.137  1.00 122.41 ? 77  GLN A CB  1 
ATOM 543  C CG  . GLN A 1 77  ? -27.957 -27.424 -7.141  1.00 130.03 ? 77  GLN A CG  1 
ATOM 544  C CD  . GLN A 1 77  ? -29.240 -26.590 -7.168  1.00 133.74 ? 77  GLN A CD  1 
ATOM 545  O OE1 . GLN A 1 77  ? -30.335 -27.125 -7.050  1.00 145.23 ? 77  GLN A OE1 1 
ATOM 546  N NE2 . GLN A 1 77  ? -29.106 -25.277 -7.320  1.00 126.81 ? 77  GLN A NE2 1 
ATOM 547  N N   . PHE A 1 78  ? -24.385 -25.464 -9.004  1.00 97.30  ? 78  PHE A N   1 
ATOM 548  C CA  . PHE A 1 78  ? -23.527 -24.948 -10.043 1.00 96.09  ? 78  PHE A CA  1 
ATOM 549  C C   . PHE A 1 78  ? -22.184 -25.601 -10.007 1.00 98.36  ? 78  PHE A C   1 
ATOM 550  O O   . PHE A 1 78  ? -21.697 -26.106 -11.041 1.00 98.29  ? 78  PHE A O   1 
ATOM 551  C CB  . PHE A 1 78  ? -23.273 -23.473 -9.963  1.00 93.44  ? 78  PHE A CB  1 
ATOM 552  C CG  . PHE A 1 78  ? -22.586 -22.944 -11.196 1.00 95.45  ? 78  PHE A CG  1 
ATOM 553  C CD1 . PHE A 1 78  ? -22.982 -23.351 -12.473 1.00 94.44  ? 78  PHE A CD1 1 
ATOM 554  C CD2 . PHE A 1 78  ? -21.547 -22.045 -11.101 1.00 100.39 ? 78  PHE A CD2 1 
ATOM 555  C CE1 . PHE A 1 78  ? -22.351 -22.857 -13.613 1.00 97.54  ? 78  PHE A CE1 1 
ATOM 556  C CE2 . PHE A 1 78  ? -20.925 -21.523 -12.251 1.00 98.59  ? 78  PHE A CE2 1 
ATOM 557  C CZ  . PHE A 1 78  ? -21.310 -21.945 -13.506 1.00 92.77  ? 78  PHE A CZ  1 
ATOM 558  N N   . LEU A 1 79  ? -21.575 -25.568 -8.825  1.00 95.86  ? 79  LEU A N   1 
ATOM 559  C CA  . LEU A 1 79  ? -20.306 -26.247 -8.644  1.00 97.77  ? 79  LEU A CA  1 
ATOM 560  C C   . LEU A 1 79  ? -20.418 -27.649 -9.250  1.00 101.44 ? 79  LEU A C   1 
ATOM 561  O O   . LEU A 1 79  ? -19.626 -27.998 -10.135 1.00 108.88 ? 79  LEU A O   1 
ATOM 562  C CB  . LEU A 1 79  ? -19.865 -26.301 -7.182  1.00 92.43  ? 79  LEU A CB  1 
ATOM 563  C CG  . LEU A 1 79  ? -18.370 -26.483 -6.833  1.00 97.50  ? 79  LEU A CG  1 
ATOM 564  C CD1 . LEU A 1 79  ? -18.172 -26.495 -5.311  1.00 99.68  ? 79  LEU A CD1 1 
ATOM 565  C CD2 . LEU A 1 79  ? -17.673 -27.710 -7.439  1.00 97.73  ? 79  LEU A CD2 1 
ATOM 566  N N   . SER A 1 80  ? -21.407 -28.438 -8.837  1.00 99.24  ? 80  SER A N   1 
ATOM 567  C CA  . SER A 1 80  ? -21.487 -29.795 -9.371  1.00 108.06 ? 80  SER A CA  1 
ATOM 568  C C   . SER A 1 80  ? -21.445 -29.812 -10.904 1.00 113.88 ? 80  SER A C   1 
ATOM 569  O O   . SER A 1 80  ? -20.574 -30.484 -11.504 1.00 109.94 ? 80  SER A O   1 
ATOM 570  C CB  . SER A 1 80  ? -22.717 -30.530 -8.884  1.00 115.32 ? 80  SER A CB  1 
ATOM 571  O OG  . SER A 1 80  ? -22.787 -31.768 -9.573  1.00 127.22 ? 80  SER A OG  1 
ATOM 572  N N   . ILE A 1 81  ? -22.361 -29.058 -11.530 1.00 111.20 ? 81  ILE A N   1 
ATOM 573  C CA  . ILE A 1 81  ? -22.410 -29.002 -12.994 1.00 107.10 ? 81  ILE A CA  1 
ATOM 574  C C   . ILE A 1 81  ? -21.106 -28.492 -13.567 1.00 106.42 ? 81  ILE A C   1 
ATOM 575  O O   . ILE A 1 81  ? -20.848 -28.671 -14.745 1.00 115.81 ? 81  ILE A O   1 
ATOM 576  C CB  . ILE A 1 81  ? -23.516 -28.115 -13.587 1.00 105.96 ? 81  ILE A CB  1 
ATOM 577  C CG1 . ILE A 1 81  ? -24.520 -27.665 -12.536 1.00 114.98 ? 81  ILE A CG1 1 
ATOM 578  C CG2 . ILE A 1 81  ? -24.195 -28.838 -14.743 1.00 106.86 ? 81  ILE A CG2 1 
ATOM 579  C CD1 . ILE A 1 81  ? -25.534 -26.679 -13.083 1.00 128.64 ? 81  ILE A CD1 1 
ATOM 580  N N   . ILE A 1 82  ? -20.275 -27.850 -12.769 1.00 95.69  ? 82  ILE A N   1 
ATOM 581  C CA  . ILE A 1 82  ? -18.935 -27.701 -13.247 1.00 93.27  ? 82  ILE A CA  1 
ATOM 582  C C   . ILE A 1 82  ? -18.016 -28.883 -13.033 1.00 97.13  ? 82  ILE A C   1 
ATOM 583  O O   . ILE A 1 82  ? -17.432 -29.344 -13.995 1.00 102.87 ? 82  ILE A O   1 
ATOM 584  C CB  . ILE A 1 82  ? -18.238 -26.519 -12.639 1.00 88.53  ? 82  ILE A CB  1 
ATOM 585  C CG1 . ILE A 1 82  ? -18.658 -25.291 -13.403 1.00 88.05  ? 82  ILE A CG1 1 
ATOM 586  C CG2 . ILE A 1 82  ? -16.755 -26.673 -12.752 1.00 88.01  ? 82  ILE A CG2 1 
ATOM 587  C CD1 . ILE A 1 82  ? -19.183 -24.228 -12.483 1.00 89.50  ? 82  ILE A CD1 1 
ATOM 588  N N   . ARG A 1 83  ? -17.908 -29.396 -11.811 1.00 99.33  ? 83  ARG A N   1 
ATOM 589  C CA  . ARG A 1 83  ? -17.156 -30.632 -11.571 1.00 110.13 ? 83  ARG A CA  1 
ATOM 590  C C   . ARG A 1 83  ? -17.574 -31.739 -12.541 1.00 118.14 ? 83  ARG A C   1 
ATOM 591  O O   . ARG A 1 83  ? -16.780 -32.598 -12.914 1.00 117.04 ? 83  ARG A O   1 
ATOM 592  C CB  . ARG A 1 83  ? -17.331 -31.141 -10.141 1.00 120.53 ? 83  ARG A CB  1 
ATOM 593  C CG  . ARG A 1 83  ? -16.611 -32.478 -9.881  1.00 133.48 ? 83  ARG A CG  1 
ATOM 594  C CD  . ARG A 1 83  ? -16.526 -32.870 -8.416  1.00 134.39 ? 83  ARG A CD  1 
ATOM 595  N NE  . ARG A 1 83  ? -16.247 -31.700 -7.592  1.00 145.33 ? 83  ARG A NE  1 
ATOM 596  C CZ  . ARG A 1 83  ? -15.947 -31.746 -6.302  1.00 152.67 ? 83  ARG A CZ  1 
ATOM 597  N NH1 . ARG A 1 83  ? -15.871 -32.939 -5.714  1.00 160.15 ? 83  ARG A NH1 1 
ATOM 598  N NH2 . ARG A 1 83  ? -15.722 -30.608 -5.620  1.00 143.93 ? 83  ARG A NH2 1 
ATOM 599  N N   . SER A 1 84  ? -18.835 -31.706 -12.944 1.00 121.03 ? 84  SER A N   1 
ATOM 600  C CA  . SER A 1 84  ? -19.365 -32.604 -13.949 1.00 122.31 ? 84  SER A CA  1 
ATOM 601  C C   . SER A 1 84  ? -18.663 -32.648 -15.319 1.00 124.56 ? 84  SER A C   1 
ATOM 602  O O   . SER A 1 84  ? -18.712 -33.690 -15.966 1.00 140.81 ? 84  SER A O   1 
ATOM 603  C CB  . SER A 1 84  ? -20.825 -32.272 -14.195 1.00 128.87 ? 84  SER A CB  1 
ATOM 604  O OG  . SER A 1 84  ? -21.039 -32.121 -15.594 1.00 155.24 ? 84  SER A OG  1 
ATOM 605  N N   . ARG A 1 85  ? -18.083 -31.540 -15.797 1.00 119.57 ? 85  ARG A N   1 
ATOM 606  C CA  . ARG A 1 85  ? -17.447 -31.517 -17.132 1.00 124.10 ? 85  ARG A CA  1 
ATOM 607  C C   . ARG A 1 85  ? -15.932 -31.702 -17.121 1.00 130.70 ? 85  ARG A C   1 
ATOM 608  O O   . ARG A 1 85  ? -15.281 -31.607 -18.175 1.00 146.60 ? 85  ARG A O   1 
ATOM 609  C CB  . ARG A 1 85  ? -17.802 -30.237 -17.869 1.00 121.65 ? 85  ARG A CB  1 
ATOM 610  C CG  . ARG A 1 85  ? -19.217 -29.801 -17.605 1.00 121.63 ? 85  ARG A CG  1 
ATOM 611  C CD  . ARG A 1 85  ? -19.341 -28.383 -18.089 1.00 132.11 ? 85  ARG A CD  1 
ATOM 612  N NE  . ARG A 1 85  ? -20.052 -28.231 -19.368 1.00 147.02 ? 85  ARG A NE  1 
ATOM 613  C CZ  . ARG A 1 85  ? -19.474 -28.174 -20.572 1.00 154.81 ? 85  ARG A CZ  1 
ATOM 614  N NH1 . ARG A 1 85  ? -18.164 -28.291 -20.698 1.00 151.64 ? 85  ARG A NH1 1 
ATOM 615  N NH2 . ARG A 1 85  ? -20.208 -28.003 -21.670 1.00 158.23 ? 85  ARG A NH2 1 
ATOM 616  N N   . MET A 1 86  ? -15.425 -31.980 -15.922 1.00 126.96 ? 86  MET A N   1 
ATOM 617  C CA  . MET A 1 86  ? -14.047 -32.172 -15.553 1.00 129.41 ? 86  MET A CA  1 
ATOM 618  C C   . MET A 1 86  ? -13.946 -33.699 -15.482 1.00 142.32 ? 86  MET A C   1 
ATOM 619  O O   . MET A 1 86  ? -14.925 -34.357 -15.775 1.00 151.63 ? 86  MET A O   1 
ATOM 620  C CB  . MET A 1 86  ? -13.894 -31.527 -14.188 1.00 137.58 ? 86  MET A CB  1 
ATOM 621  C CG  . MET A 1 86  ? -14.117 -30.012 -14.150 1.00 127.08 ? 86  MET A CG  1 
ATOM 622  S SD  . MET A 1 86  ? -12.572 -29.113 -13.873 1.00 132.32 ? 86  MET A SD  1 
ATOM 623  C CE  . MET A 1 86  ? -13.110 -27.901 -12.670 1.00 122.30 ? 86  MET A CE  1 
ATOM 624  N N   . VAL A 1 87  ? -12.819 -34.294 -15.119 1.00 150.21 ? 87  VAL A N   1 
ATOM 625  C CA  . VAL A 1 87  ? -12.618 -35.690 -15.550 1.00 175.92 ? 87  VAL A CA  1 
ATOM 626  C C   . VAL A 1 87  ? -12.279 -36.746 -14.530 1.00 204.18 ? 87  VAL A C   1 
ATOM 627  O O   . VAL A 1 87  ? -11.118 -36.863 -14.150 1.00 222.56 ? 87  VAL A O   1 
ATOM 628  C CB  . VAL A 1 87  ? -11.479 -35.824 -16.553 1.00 183.12 ? 87  VAL A CB  1 
ATOM 629  C CG1 . VAL A 1 87  ? -10.176 -35.632 -15.804 1.00 188.63 ? 87  VAL A CG1 1 
ATOM 630  C CG2 . VAL A 1 87  ? -11.509 -37.223 -17.173 1.00 178.51 ? 87  VAL A CG2 1 
ATOM 631  N N   . LEU A 1 88  ? -13.277 -37.595 -14.260 1.00 232.07 ? 88  LEU A N   1 
ATOM 632  C CA  . LEU A 1 88  ? -13.352 -38.651 -13.200 1.00 235.72 ? 88  LEU A CA  1 
ATOM 633  C C   . LEU A 1 88  ? -13.193 -38.186 -11.716 1.00 239.82 ? 88  LEU A C   1 
ATOM 634  O O   . LEU A 1 88  ? -12.646 -38.912 -10.872 1.00 245.15 ? 88  LEU A O   1 
ATOM 635  C CB  . LEU A 1 88  ? -12.609 -40.008 -13.555 1.00 218.54 ? 88  LEU A CB  1 
ATOM 636  C CG  . LEU A 1 88  ? -11.772 -40.583 -14.755 1.00 201.30 ? 88  LEU A CG  1 
ATOM 637  C CD1 . LEU A 1 88  ? -12.386 -40.436 -16.156 1.00 179.56 ? 88  LEU A CD1 1 
ATOM 638  C CD2 . LEU A 1 88  ? -10.290 -40.204 -14.765 1.00 180.86 ? 88  LEU A CD2 1 
ATOM 639  N N   . ARG A 1 89  ? -13.762 -37.005 -11.414 1.00 222.43 ? 89  ARG A N   1 
ATOM 640  C CA  . ARG A 1 89  ? -13.281 -36.139 -10.326 1.00 207.15 ? 89  ARG A CA  1 
ATOM 641  C C   . ARG A 1 89  ? -13.827 -35.691 -8.935  1.00 202.67 ? 89  ARG A C   1 
ATOM 642  O O   . ARG A 1 89  ? -13.504 -34.600 -8.451  1.00 204.90 ? 89  ARG A O   1 
ATOM 643  C CB  . ARG A 1 89  ? -12.578 -34.922 -10.964 1.00 187.62 ? 89  ARG A CB  1 
ATOM 644  C CG  . ARG A 1 89  ? -11.223 -34.538 -10.389 1.00 204.83 ? 89  ARG A CG  1 
ATOM 645  C CD  . ARG A 1 89  ? -10.032 -35.291 -10.974 1.00 221.28 ? 89  ARG A CD  1 
ATOM 646  N NE  . ARG A 1 89  ? -9.724  -36.523 -10.248 1.00 246.02 ? 89  ARG A NE  1 
ATOM 647  C CZ  . ARG A 1 89  ? -9.842  -37.748 -10.755 1.00 260.27 ? 89  ARG A CZ  1 
ATOM 648  N NH1 . ARG A 1 89  ? -10.241 -37.920 -12.007 1.00 277.09 ? 89  ARG A NH1 1 
ATOM 649  N NH2 . ARG A 1 89  ? -9.555  -38.809 -10.011 1.00 256.85 ? 89  ARG A NH2 1 
ATOM 650  N N   . ALA A 1 90  ? -14.623 -36.542 -8.280  1.00 190.81 ? 90  ALA A N   1 
ATOM 651  C CA  . ALA A 1 90  ? -15.466 -36.135 -7.134  1.00 184.68 ? 90  ALA A CA  1 
ATOM 652  C C   . ALA A 1 90  ? -15.093 -36.697 -5.747  1.00 181.91 ? 90  ALA A C   1 
ATOM 653  O O   . ALA A 1 90  ? -15.749 -36.375 -4.750  1.00 180.59 ? 90  ALA A O   1 
ATOM 654  C CB  . ALA A 1 90  ? -16.904 -36.615 -7.302  1.00 175.12 ? 90  ALA A CB  1 
ATOM 655  N N   . THR A 1 91  ? -14.048 -37.528 -5.691  1.00 173.06 ? 91  THR A N   1 
ATOM 656  C CA  . THR A 1 91  ? -13.210 -37.838 -4.501  1.00 169.15 ? 91  THR A CA  1 
ATOM 657  C C   . THR A 1 91  ? -12.289 -36.646 -4.091  1.00 166.05 ? 91  THR A C   1 
ATOM 658  O O   . THR A 1 91  ? -11.605 -36.658 -3.062  1.00 153.29 ? 91  THR A O   1 
ATOM 659  C CB  . THR A 1 91  ? -12.626 -39.282 -4.599  1.00 172.16 ? 91  THR A CB  1 
ATOM 660  O OG1 . THR A 1 91  ? -11.423 -39.394 -3.821  1.00 158.70 ? 91  THR A OG1 1 
ATOM 661  C CG2 . THR A 1 91  ? -12.342 -39.695 -6.081  1.00 167.70 ? 91  THR A CG2 1 
ATOM 662  N N   . GLU A 1 92  ? -12.300 -35.617 -4.933  1.00 175.88 ? 92  GLU A N   1 
ATOM 663  C CA  . GLU A 1 92  ? -11.315 -34.546 -5.069  1.00 165.81 ? 92  GLU A CA  1 
ATOM 664  C C   . GLU A 1 92  ? -12.132 -33.285 -5.340  1.00 146.99 ? 92  GLU A C   1 
ATOM 665  O O   . GLU A 1 92  ? -12.910 -33.219 -6.322  1.00 120.32 ? 92  GLU A O   1 
ATOM 666  C CB  . GLU A 1 92  ? -10.294 -34.847 -6.193  1.00 176.75 ? 92  GLU A CB  1 
ATOM 667  C CG  . GLU A 1 92  ? -10.862 -35.274 -7.569  1.00 205.90 ? 92  GLU A CG  1 
ATOM 668  C CD  . GLU A 1 92  ? -11.428 -36.711 -7.649  1.00 206.37 ? 92  GLU A CD  1 
ATOM 669  O OE1 . GLU A 1 92  ? -11.326 -37.395 -8.695  1.00 184.48 ? 92  GLU A OE1 1 
ATOM 670  O OE2 . GLU A 1 92  ? -12.013 -37.189 -6.675  1.00 210.85 ? 92  GLU A OE2 1 
ATOM 671  N N   . ALA A 1 93  ? -12.004 -32.338 -4.403  1.00 140.66 ? 93  ALA A N   1 
ATOM 672  C CA  . ALA A 1 93  ? -12.807 -31.103 -4.363  1.00 133.83 ? 93  ALA A CA  1 
ATOM 673  C C   . ALA A 1 93  ? -11.983 -29.927 -4.785  1.00 118.98 ? 93  ALA A C   1 
ATOM 674  O O   . ALA A 1 93  ? -10.760 -29.966 -4.771  1.00 118.66 ? 93  ALA A O   1 
ATOM 675  C CB  . ALA A 1 93  ? -13.406 -30.846 -2.976  1.00 128.83 ? 93  ALA A CB  1 
ATOM 676  N N   . PHE A 1 94  ? -12.662 -28.879 -5.182  1.00 103.24 ? 94  PHE A N   1 
ATOM 677  C CA  . PHE A 1 94  ? -11.965 -27.699 -5.573  1.00 103.92 ? 94  PHE A CA  1 
ATOM 678  C C   . PHE A 1 94  ? -12.917 -26.607 -5.223  1.00 108.47 ? 94  PHE A C   1 
ATOM 679  O O   . PHE A 1 94  ? -14.131 -26.785 -5.323  1.00 122.29 ? 94  PHE A O   1 
ATOM 680  C CB  . PHE A 1 94  ? -11.640 -27.715 -7.063  1.00 104.38 ? 94  PHE A CB  1 
ATOM 681  C CG  . PHE A 1 94  ? -12.850 -27.708 -7.962  1.00 111.97 ? 94  PHE A CG  1 
ATOM 682  C CD1 . PHE A 1 94  ? -13.656 -28.847 -8.100  1.00 115.79 ? 94  PHE A CD1 1 
ATOM 683  C CD2 . PHE A 1 94  ? -13.182 -26.567 -8.688  1.00 109.16 ? 94  PHE A CD2 1 
ATOM 684  C CE1 . PHE A 1 94  ? -14.771 -28.830 -8.934  1.00 122.19 ? 94  PHE A CE1 1 
ATOM 685  C CE2 . PHE A 1 94  ? -14.299 -26.550 -9.520  1.00 107.70 ? 94  PHE A CE2 1 
ATOM 686  C CZ  . PHE A 1 94  ? -15.090 -27.676 -9.649  1.00 115.04 ? 94  PHE A CZ  1 
ATOM 687  N N   . TYR A 1 95  ? -12.365 -25.500 -4.756  1.00 102.75 ? 95  TYR A N   1 
ATOM 688  C CA  . TYR A 1 95  ? -13.154 -24.379 -4.335  1.00 102.08 ? 95  TYR A CA  1 
ATOM 689  C C   . TYR A 1 95  ? -13.620 -23.668 -5.579  1.00 103.12 ? 95  TYR A C   1 
ATOM 690  O O   . TYR A 1 95  ? -13.005 -23.803 -6.638  1.00 97.16  ? 95  TYR A O   1 
ATOM 691  C CB  . TYR A 1 95  ? -12.274 -23.469 -3.514  1.00 104.54 ? 95  TYR A CB  1 
ATOM 692  C CG  . TYR A 1 95  ? -11.504 -24.180 -2.414  1.00 106.31 ? 95  TYR A CG  1 
ATOM 693  C CD1 . TYR A 1 95  ? -12.160 -24.679 -1.295  1.00 112.52 ? 95  TYR A CD1 1 
ATOM 694  C CD2 . TYR A 1 95  ? -10.121 -24.326 -2.478  1.00 107.63 ? 95  TYR A CD2 1 
ATOM 695  C CE1 . TYR A 1 95  ? -11.465 -25.313 -0.268  1.00 118.43 ? 95  TYR A CE1 1 
ATOM 696  C CE2 . TYR A 1 95  ? -9.413  -24.949 -1.457  1.00 117.89 ? 95  TYR A CE2 1 
ATOM 697  C CZ  . TYR A 1 95  ? -10.087 -25.447 -0.354  1.00 121.52 ? 95  TYR A CZ  1 
ATOM 698  O OH  . TYR A 1 95  ? -9.387  -26.069 0.662   1.00 127.11 ? 95  TYR A OH  1 
ATOM 699  N N   . LEU A 1 96  ? -14.728 -22.942 -5.470  1.00 107.55 ? 96  LEU A N   1 
ATOM 700  C CA  . LEU A 1 96  ? -15.179 -22.099 -6.574  1.00 101.33 ? 96  LEU A CA  1 
ATOM 701  C C   . LEU A 1 96  ? -15.376 -20.688 -6.041  1.00 107.20 ? 96  LEU A C   1 
ATOM 702  O O   . LEU A 1 96  ? -16.334 -20.418 -5.280  1.00 111.92 ? 96  LEU A O   1 
ATOM 703  C CB  . LEU A 1 96  ? -16.472 -22.627 -7.165  1.00 95.79  ? 96  LEU A CB  1 
ATOM 704  C CG  . LEU A 1 96  ? -16.891 -21.776 -8.347  1.00 104.31 ? 96  LEU A CG  1 
ATOM 705  C CD1 . LEU A 1 96  ? -15.720 -21.761 -9.307  1.00 107.79 ? 96  LEU A CD1 1 
ATOM 706  C CD2 . LEU A 1 96  ? -18.133 -22.326 -9.034  1.00 103.02 ? 96  LEU A CD2 1 
ATOM 707  N N   . LEU A 1 97  ? -14.442 -19.813 -6.423  1.00 102.75 ? 97  LEU A N   1 
ATOM 708  C CA  . LEU A 1 97  ? -14.363 -18.426 -5.919  1.00 102.77 ? 97  LEU A CA  1 
ATOM 709  C C   . LEU A 1 97  ? -14.883 -17.395 -6.879  1.00 104.02 ? 97  LEU A C   1 
ATOM 710  O O   . LEU A 1 97  ? -14.525 -17.389 -8.084  1.00 108.92 ? 97  LEU A O   1 
ATOM 711  C CB  . LEU A 1 97  ? -12.929 -18.031 -5.647  1.00 101.76 ? 97  LEU A CB  1 
ATOM 712  C CG  . LEU A 1 97  ? -12.251 -18.905 -4.626  1.00 112.96 ? 97  LEU A CG  1 
ATOM 713  C CD1 . LEU A 1 97  ? -10.758 -18.892 -4.884  1.00 117.15 ? 97  LEU A CD1 1 
ATOM 714  C CD2 . LEU A 1 97  ? -12.583 -18.331 -3.260  1.00 126.80 ? 97  LEU A CD2 1 
ATOM 715  N N   . VAL A 1 98  ? -15.679 -16.484 -6.339  1.00 95.67  ? 98  VAL A N   1 
ATOM 716  C CA  . VAL A 1 98  ? -16.120 -15.383 -7.141  1.00 98.91  ? 98  VAL A CA  1 
ATOM 717  C C   . VAL A 1 98  ? -14.989 -14.376 -7.244  1.00 108.73 ? 98  VAL A C   1 
ATOM 718  O O   . VAL A 1 98  ? -14.410 -13.949 -6.234  1.00 110.37 ? 98  VAL A O   1 
ATOM 719  C CB  . VAL A 1 98  ? -17.402 -14.764 -6.620  1.00 97.61  ? 98  VAL A CB  1 
ATOM 720  C CG1 . VAL A 1 98  ? -17.739 -13.555 -7.460  1.00 103.34 ? 98  VAL A CG1 1 
ATOM 721  C CG2 . VAL A 1 98  ? -18.529 -15.777 -6.731  1.00 98.85  ? 98  VAL A CG2 1 
ATOM 722  N N   . ASN A 1 99  ? -14.663 -14.042 -8.492  1.00 111.72 ? 99  ASN A N   1 
ATOM 723  C CA  . ASN A 1 99  ? -13.661 -13.044 -8.805  1.00 119.18 ? 99  ASN A CA  1 
ATOM 724  C C   . ASN A 1 99  ? -12.300 -13.514 -8.359  1.00 124.08 ? 99  ASN A C   1 
ATOM 725  O O   . ASN A 1 99  ? -11.390 -12.714 -8.224  1.00 133.61 ? 99  ASN A O   1 
ATOM 726  C CB  . ASN A 1 99  ? -13.993 -11.708 -8.120  1.00 123.42 ? 99  ASN A CB  1 
ATOM 727  C CG  . ASN A 1 99  ? -15.282 -11.086 -8.641  1.00 132.93 ? 99  ASN A CG  1 
ATOM 728  O OD1 . ASN A 1 99  ? -16.267 -10.960 -7.899  1.00 137.23 ? 99  ASN A OD1 1 
ATOM 729  N ND2 . ASN A 1 99  ? -15.288 -10.698 -9.927  1.00 124.01 ? 99  ASN A ND2 1 
ATOM 730  N N   . ASN A 1 100 ? -12.160 -14.818 -8.133  1.00 124.00 ? 100 ASN A N   1 
ATOM 731  C CA  . ASN A 1 100 ? -10.937 -15.376 -7.565  1.00 121.47 ? 100 ASN A CA  1 
ATOM 732  C C   . ASN A 1 100 ? -10.633 -14.875 -6.178  1.00 123.65 ? 100 ASN A C   1 
ATOM 733  O O   . ASN A 1 100 ? -9.613  -15.245 -5.596  1.00 123.62 ? 100 ASN A O   1 
ATOM 734  C CB  . ASN A 1 100 ? -9.778  -15.318 -8.564  1.00 129.64 ? 100 ASN A CB  1 
ATOM 735  C CG  . ASN A 1 100 ? -8.458  -15.807 -7.980  1.00 131.91 ? 100 ASN A CG  1 
ATOM 736  O OD1 . ASN A 1 100 ? -7.457  -15.088 -8.010  1.00 152.19 ? 100 ASN A OD1 1 
ATOM 737  N ND2 . ASN A 1 100 ? -8.445  -17.030 -7.462  1.00 120.07 ? 100 ASN A ND2 1 
ATOM 738  N N   . LYS A 1 101 ? -11.513 -14.030 -5.652  1.00 126.59 ? 101 LYS A N   1 
ATOM 739  C CA  . LYS A 1 101 ? -11.251 -13.343 -4.404  1.00 132.16 ? 101 LYS A CA  1 
ATOM 740  C C   . LYS A 1 101 ? -12.086 -13.826 -3.219  1.00 131.53 ? 101 LYS A C   1 
ATOM 741  O O   . LYS A 1 101 ? -11.627 -13.789 -2.086  1.00 147.05 ? 101 LYS A O   1 
ATOM 742  C CB  . LYS A 1 101 ? -10.633 -11.955 -4.679  1.00 137.40 ? 101 LYS A CB  1 
ATOM 743  C CG  . LYS A 1 101 ? -11.518 -10.948 -5.423  1.00 140.26 ? 101 LYS A CG  1 
ATOM 744  C CD  . LYS A 1 101 ? -10.994 -9.526  -5.261  1.00 145.06 ? 101 LYS A CD  1 
ATOM 745  C CE  . LYS A 1 101 ? -11.473 -8.930  -3.941  1.00 150.21 ? 101 LYS A CE  1 
ATOM 746  N NZ  . LYS A 1 101 ? -10.422 -8.222  -3.151  1.00 158.24 ? 101 LYS A NZ  1 
ATOM 747  N N   . SER A 1 102 ? -13.306 -14.283 -3.452  1.00 118.61 ? 102 SER A N   1 
ATOM 748  C CA  . SER A 1 102 ? -14.573 -14.134 -2.736  1.00 117.47 ? 102 SER A CA  1 
ATOM 749  C C   . SER A 1 102 ? -14.909 -15.623 -2.611  1.00 118.97 ? 102 SER A C   1 
ATOM 750  O O   . SER A 1 102 ? -15.179 -16.311 -3.600  1.00 116.50 ? 102 SER A O   1 
ATOM 751  C CB  . SER A 1 102 ? -15.488 -13.169 -3.499  1.00 118.92 ? 102 SER A CB  1 
ATOM 752  O OG  . SER A 1 102 ? -16.453 -12.584 -2.648  1.00 121.25 ? 102 SER A OG  1 
ATOM 753  N N   . LEU A 1 103 ? -14.881 -16.120 -1.382  1.00 115.13 ? 103 LEU A N   1 
ATOM 754  C CA  . LEU A 1 103 ? -15.527 -17.344 -0.952  1.00 109.30 ? 103 LEU A CA  1 
ATOM 755  C C   . LEU A 1 103 ? -16.898 -17.046 -0.454  1.00 111.37 ? 103 LEU A C   1 
ATOM 756  O O   . LEU A 1 103 ? -17.069 -16.159 0.395   1.00 114.30 ? 103 LEU A O   1 
ATOM 757  C CB  . LEU A 1 103 ? -14.767 -17.908 0.192   1.00 108.95 ? 103 LEU A CB  1 
ATOM 758  C CG  . LEU A 1 103 ? -13.737 -18.832 -0.367  1.00 114.41 ? 103 LEU A CG  1 
ATOM 759  C CD1 . LEU A 1 103 ? -12.761 -19.161 0.751   1.00 127.42 ? 103 LEU A CD1 1 
ATOM 760  C CD2 . LEU A 1 103 ? -14.509 -20.041 -0.856  1.00 113.12 ? 103 LEU A CD2 1 
ATOM 761  N N   . VAL A 1 104 ? -17.872 -17.797 -0.951  1.00 103.55 ? 104 VAL A N   1 
ATOM 762  C CA  . VAL A 1 104 ? -19.273 -17.404 -0.767  1.00 106.43 ? 104 VAL A CA  1 
ATOM 763  C C   . VAL A 1 104 ? -20.173 -18.460 -0.132  1.00 112.02 ? 104 VAL A C   1 
ATOM 764  O O   . VAL A 1 104 ? -19.729 -19.585 0.139   1.00 112.18 ? 104 VAL A O   1 
ATOM 765  C CB  . VAL A 1 104 ? -19.873 -16.959 -2.096  1.00 109.72 ? 104 VAL A CB  1 
ATOM 766  C CG1 . VAL A 1 104 ? -19.126 -15.744 -2.612  1.00 121.82 ? 104 VAL A CG1 1 
ATOM 767  C CG2 . VAL A 1 104 ? -19.771 -18.067 -3.117  1.00 114.56 ? 104 VAL A CG2 1 
ATOM 768  N N   . SER A 1 105 ? -21.434 -18.113 0.124   1.00 111.32 ? 105 SER A N   1 
ATOM 769  C CA  . SER A 1 105 ? -22.346 -19.127 0.626   1.00 116.51 ? 105 SER A CA  1 
ATOM 770  C C   . SER A 1 105 ? -22.383 -20.112 -0.501  1.00 120.99 ? 105 SER A C   1 
ATOM 771  O O   . SER A 1 105 ? -22.181 -19.692 -1.649  1.00 130.37 ? 105 SER A O   1 
ATOM 772  C CB  . SER A 1 105 ? -23.727 -18.562 0.852   1.00 126.14 ? 105 SER A CB  1 
ATOM 773  O OG  . SER A 1 105 ? -24.612 -19.589 1.253   1.00 146.16 ? 105 SER A OG  1 
ATOM 774  N N   . MET A 1 106 ? -22.530 -21.403 -0.170  1.00 124.82 ? 106 MET A N   1 
ATOM 775  C CA  . MET A 1 106 ? -22.756 -22.496 -1.150  1.00 126.55 ? 106 MET A CA  1 
ATOM 776  C C   . MET A 1 106 ? -24.237 -22.859 -1.239  1.00 131.63 ? 106 MET A C   1 
ATOM 777  O O   . MET A 1 106 ? -24.620 -23.917 -1.732  1.00 146.19 ? 106 MET A O   1 
ATOM 778  C CB  . MET A 1 106 ? -21.783 -23.693 -0.965  1.00 114.36 ? 106 MET A CB  1 
ATOM 779  C CG  . MET A 1 106 ? -20.304 -23.396 -1.259  1.00 122.92 ? 106 MET A CG  1 
ATOM 780  S SD  . MET A 1 106 ? -19.865 -22.838 -2.943  1.00 135.54 ? 106 MET A SD  1 
ATOM 781  C CE  . MET A 1 106 ? -18.085 -22.492 -2.917  1.00 112.10 ? 106 MET A CE  1 
ATOM 782  N N   . SER A 1 107 ? -25.056 -21.949 -0.728  1.00 124.15 ? 107 SER A N   1 
ATOM 783  C CA  . SER A 1 107 ? -26.480 -22.134 -0.590  1.00 128.96 ? 107 SER A CA  1 
ATOM 784  C C   . SER A 1 107 ? -27.311 -21.021 -1.217  1.00 122.00 ? 107 SER A C   1 
ATOM 785  O O   . SER A 1 107 ? -28.486 -20.825 -0.911  1.00 126.87 ? 107 SER A O   1 
ATOM 786  C CB  . SER A 1 107 ? -26.825 -22.585 0.843   1.00 141.11 ? 107 SER A CB  1 
ATOM 787  O OG  . SER A 1 107 ? -28.153 -22.229 1.226   1.00 158.59 ? 107 SER A OG  1 
ATOM 788  N N   . ALA A 1 108 ? -26.671 -20.282 -2.103  1.00 113.65 ? 108 ALA A N   1 
ATOM 789  C CA  . ALA A 1 108 ? -27.079 -18.971 -2.509  1.00 121.40 ? 108 ALA A CA  1 
ATOM 790  C C   . ALA A 1 108 ? -27.589 -19.000 -3.934  1.00 129.86 ? 108 ALA A C   1 
ATOM 791  O O   . ALA A 1 108 ? -26.872 -19.435 -4.818  1.00 147.08 ? 108 ALA A O   1 
ATOM 792  C CB  . ALA A 1 108 ? -25.897 -18.042 -2.400  1.00 121.13 ? 108 ALA A CB  1 
ATOM 793  N N   . THR A 1 109 ? -28.822 -18.539 -4.158  1.00 135.20 ? 109 THR A N   1 
ATOM 794  C CA  . THR A 1 109 ? -29.391 -18.444 -5.511  1.00 129.32 ? 109 THR A CA  1 
ATOM 795  C C   . THR A 1 109 ? -28.427 -17.634 -6.358  1.00 124.08 ? 109 THR A C   1 
ATOM 796  O O   . THR A 1 109 ? -27.771 -16.711 -5.863  1.00 116.70 ? 109 THR A O   1 
ATOM 797  C CB  . THR A 1 109 ? -30.785 -17.740 -5.553  1.00 145.67 ? 109 THR A CB  1 
ATOM 798  O OG1 . THR A 1 109 ? -30.634 -16.310 -5.644  1.00 148.28 ? 109 THR A OG1 1 
ATOM 799  C CG2 . THR A 1 109 ? -31.655 -18.083 -4.337  1.00 153.92 ? 109 THR A CG2 1 
ATOM 800  N N   . MET A 1 110 ? -28.344 -17.992 -7.633  1.00 122.96 ? 110 MET A N   1 
ATOM 801  C CA  . MET A 1 110 ? -27.451 -17.323 -8.565  1.00 126.48 ? 110 MET A CA  1 
ATOM 802  C C   . MET A 1 110 ? -27.846 -15.889 -8.708  1.00 131.59 ? 110 MET A C   1 
ATOM 803  O O   . MET A 1 110 ? -26.986 -15.028 -8.835  1.00 131.23 ? 110 MET A O   1 
ATOM 804  C CB  . MET A 1 110 ? -27.490 -17.983 -9.935  1.00 134.80 ? 110 MET A CB  1 
ATOM 805  C CG  . MET A 1 110 ? -26.570 -19.181 -10.066 1.00 145.51 ? 110 MET A CG  1 
ATOM 806  S SD  . MET A 1 110 ? -24.820 -18.738 -10.050 1.00 143.91 ? 110 MET A SD  1 
ATOM 807  C CE  . MET A 1 110 ? -24.114 -20.305 -9.554  1.00 147.60 ? 110 MET A CE  1 
ATOM 808  N N   . ALA A 1 111 ? -29.156 -15.651 -8.708  1.00 142.42 ? 111 ALA A N   1 
ATOM 809  C CA  . ALA A 1 111 ? -29.689 -14.299 -8.648  1.00 152.64 ? 111 ALA A CA  1 
ATOM 810  C C   . ALA A 1 111 ? -28.920 -13.550 -7.562  1.00 152.27 ? 111 ALA A C   1 
ATOM 811  O O   . ALA A 1 111 ? -28.307 -12.499 -7.811  1.00 146.04 ? 111 ALA A O   1 
ATOM 812  C CB  . ALA A 1 111 ? -31.189 -14.318 -8.343  1.00 160.15 ? 111 ALA A CB  1 
ATOM 813  N N   . GLU A 1 112 ? -28.920 -14.131 -6.369  1.00 140.16 ? 112 GLU A N   1 
ATOM 814  C CA  . GLU A 1 112 ? -28.257 -13.516 -5.261  1.00 142.03 ? 112 GLU A CA  1 
ATOM 815  C C   . GLU A 1 112 ? -26.854 -13.041 -5.690  1.00 137.69 ? 112 GLU A C   1 
ATOM 816  O O   . GLU A 1 112 ? -26.561 -11.851 -5.605  1.00 146.06 ? 112 GLU A O   1 
ATOM 817  C CB  . GLU A 1 112 ? -28.280 -14.451 -4.040  1.00 150.04 ? 112 GLU A CB  1 
ATOM 818  C CG  . GLU A 1 112 ? -29.567 -14.332 -3.217  1.00 157.48 ? 112 GLU A CG  1 
ATOM 819  C CD  . GLU A 1 112 ? -29.944 -15.576 -2.415  1.00 163.60 ? 112 GLU A CD  1 
ATOM 820  O OE1 . GLU A 1 112 ? -29.112 -16.492 -2.244  1.00 156.40 ? 112 GLU A OE1 1 
ATOM 821  O OE2 . GLU A 1 112 ? -31.100 -15.638 -1.942  1.00 177.54 ? 112 GLU A OE2 1 
ATOM 822  N N   . ILE A 1 113 ? -26.032 -13.930 -6.240  1.00 125.96 ? 113 ILE A N   1 
ATOM 823  C CA  . ILE A 1 113 ? -24.630 -13.597 -6.561  1.00 128.26 ? 113 ILE A CA  1 
ATOM 824  C C   . ILE A 1 113 ? -24.500 -12.520 -7.625  1.00 138.83 ? 113 ILE A C   1 
ATOM 825  O O   . ILE A 1 113 ? -23.497 -11.804 -7.701  1.00 134.18 ? 113 ILE A O   1 
ATOM 826  C CB  . ILE A 1 113 ? -23.856 -14.800 -7.128  1.00 120.73 ? 113 ILE A CB  1 
ATOM 827  C CG1 . ILE A 1 113 ? -24.625 -16.128 -6.958  1.00 121.15 ? 113 ILE A CG1 1 
ATOM 828  C CG2 . ILE A 1 113 ? -22.423 -14.816 -6.609  1.00 116.80 ? 113 ILE A CG2 1 
ATOM 829  C CD1 . ILE A 1 113 ? -25.259 -16.429 -5.609  1.00 116.09 ? 113 ILE A CD1 1 
ATOM 830  N N   . TYR A 1 114 ? -25.529 -12.442 -8.461  1.00 156.32 ? 114 TYR A N   1 
ATOM 831  C CA  . TYR A 1 114 ? -25.568 -11.525 -9.596  1.00 168.74 ? 114 TYR A CA  1 
ATOM 832  C C   . TYR A 1 114 ? -25.968 -10.083 -9.359  1.00 167.80 ? 114 TYR A C   1 
ATOM 833  O O   . TYR A 1 114 ? -25.698 -9.184  -10.173 1.00 165.54 ? 114 TYR A O   1 
ATOM 834  C CB  . TYR A 1 114 ? -26.700 -11.888 -10.555 1.00 177.56 ? 114 TYR A CB  1 
ATOM 835  C CG  . TYR A 1 114 ? -26.503 -11.177 -11.855 1.00 180.94 ? 114 TYR A CG  1 
ATOM 836  C CD1 . TYR A 1 114 ? -25.285 -11.300 -12.520 1.00 174.36 ? 114 TYR A CD1 1 
ATOM 837  C CD2 . TYR A 1 114 ? -27.492 -10.358 -12.410 1.00 174.76 ? 114 TYR A CD2 1 
ATOM 838  C CE1 . TYR A 1 114 ? -25.046 -10.655 -13.708 1.00 171.91 ? 114 TYR A CE1 1 
ATOM 839  C CE2 . TYR A 1 114 ? -27.263 -9.699  -13.610 1.00 175.35 ? 114 TYR A CE2 1 
ATOM 840  C CZ  . TYR A 1 114 ? -26.029 -9.850  -14.253 1.00 175.40 ? 114 TYR A CZ  1 
ATOM 841  O OH  . TYR A 1 114 ? -25.736 -9.216  -15.446 1.00 160.22 ? 114 TYR A OH  1 
ATOM 842  N N   . ARG A 1 115 ? -26.686 -9.920  -8.255  1.00 164.14 ? 115 ARG A N   1 
ATOM 843  C CA  . ARG A 1 115 ? -26.810 -8.757  -7.403  1.00 168.14 ? 115 ARG A CA  1 
ATOM 844  C C   . ARG A 1 115 ? -25.510 -8.234  -6.774  1.00 163.83 ? 115 ARG A C   1 
ATOM 845  O O   . ARG A 1 115 ? -25.184 -7.048  -6.900  1.00 170.21 ? 115 ARG A O   1 
ATOM 846  C CB  . ARG A 1 115 ? -27.706 -9.148  -6.218  1.00 165.04 ? 115 ARG A CB  1 
ATOM 847  C CG  . ARG A 1 115 ? -28.267 -8.027  -5.367  1.00 167.58 ? 115 ARG A CG  1 
ATOM 848  C CD  . ARG A 1 115 ? -29.784 -8.162  -5.227  1.00 182.28 ? 115 ARG A CD  1 
ATOM 849  N NE  . ARG A 1 115 ? -30.315 -9.248  -4.377  1.00 185.57 ? 115 ARG A NE  1 
ATOM 850  C CZ  . ARG A 1 115 ? -29.649 -9.989  -3.484  1.00 177.35 ? 115 ARG A CZ  1 
ATOM 851  N NH1 . ARG A 1 115 ? -30.310 -10.917 -2.798  1.00 170.17 ? 115 ARG A NH1 1 
ATOM 852  N NH2 . ARG A 1 115 ? -28.347 -9.825  -3.264  1.00 165.22 ? 115 ARG A NH2 1 
ATOM 853  N N   . ASP A 1 116 ? -24.732 -9.127  -6.177  1.00 152.60 ? 116 ASP A N   1 
ATOM 854  C CA  . ASP A 1 116 ? -23.598 -8.657  -5.401  1.00 148.55 ? 116 ASP A CA  1 
ATOM 855  C C   . ASP A 1 116 ? -22.458 -8.278  -6.339  1.00 146.46 ? 116 ASP A C   1 
ATOM 856  O O   . ASP A 1 116 ? -21.899 -7.185  -6.202  1.00 145.10 ? 116 ASP A O   1 
ATOM 857  C CB  . ASP A 1 116 ? -23.448 -9.519  -4.158  1.00 153.04 ? 116 ASP A CB  1 
ATOM 858  C CG  . ASP A 1 116 ? -24.706 -9.529  -3.303  1.00 168.04 ? 116 ASP A CG  1 
ATOM 859  O OD1 . ASP A 1 116 ? -25.806 -9.764  -3.849  1.00 157.40 ? 116 ASP A OD1 1 
ATOM 860  O OD2 . ASP A 1 116 ? -24.597 -9.282  -2.079  1.00 191.11 ? 116 ASP A OD2 1 
ATOM 861  N N   . TYR A 1 117 ? -22.112 -9.156  -7.283  1.00 141.91 ? 117 TYR A N   1 
ATOM 862  C CA  . TYR A 1 117 ? -20.796 -9.222  -7.925  1.00 138.02 ? 117 TYR A CA  1 
ATOM 863  C C   . TYR A 1 117 ? -20.833 -9.176  -9.439  1.00 142.85 ? 117 TYR A C   1 
ATOM 864  O O   . TYR A 1 117 ? -19.807 -9.408  -10.099 1.00 146.13 ? 117 TYR A O   1 
ATOM 865  C CB  . TYR A 1 117 ? -20.025 -10.469 -7.495  1.00 130.31 ? 117 TYR A CB  1 
ATOM 866  C CG  . TYR A 1 117 ? -20.232 -10.871 -6.058  1.00 133.69 ? 117 TYR A CG  1 
ATOM 867  C CD1 . TYR A 1 117 ? -21.417 -11.469 -5.656  1.00 132.94 ? 117 TYR A CD1 1 
ATOM 868  C CD2 . TYR A 1 117 ? -19.240 -10.669 -5.104  1.00 136.38 ? 117 TYR A CD2 1 
ATOM 869  C CE1 . TYR A 1 117 ? -21.624 -11.845 -4.353  1.00 135.59 ? 117 TYR A CE1 1 
ATOM 870  C CE2 . TYR A 1 117 ? -19.432 -11.053 -3.787  1.00 135.89 ? 117 TYR A CE2 1 
ATOM 871  C CZ  . TYR A 1 117 ? -20.635 -11.642 -3.425  1.00 139.05 ? 117 TYR A CZ  1 
ATOM 872  O OH  . TYR A 1 117 ? -20.886 -12.031 -2.133  1.00 141.09 ? 117 TYR A OH  1 
ATOM 873  N N   . LYS A 1 118 ? -22.000 -8.894  -10.005 1.00 142.14 ? 118 LYS A N   1 
ATOM 874  C CA  . LYS A 1 118 ? -22.065 -8.607  -11.442 1.00 141.35 ? 118 LYS A CA  1 
ATOM 875  C C   . LYS A 1 118 ? -20.943 -7.638  -11.764 1.00 136.90 ? 118 LYS A C   1 
ATOM 876  O O   . LYS A 1 118 ? -20.861 -6.574  -11.163 1.00 138.99 ? 118 LYS A O   1 
ATOM 877  C CB  . LYS A 1 118 ? -23.431 -8.024  -11.793 1.00 138.31 ? 118 LYS A CB  1 
ATOM 878  C CG  . LYS A 1 118 ? -23.445 -6.762  -12.629 1.00 140.76 ? 118 LYS A CG  1 
ATOM 879  C CD  . LYS A 1 118 ? -24.638 -5.943  -12.181 1.00 154.59 ? 118 LYS A CD  1 
ATOM 880  C CE  . LYS A 1 118 ? -24.625 -5.784  -10.659 1.00 165.31 ? 118 LYS A CE  1 
ATOM 881  N NZ  . LYS A 1 118 ? -25.922 -6.128  -10.008 1.00 169.27 ? 118 LYS A NZ  1 
ATOM 882  N N   . ASP A 1 119 ? -20.042 -8.019  -12.654 1.00 134.28 ? 119 ASP A N   1 
ATOM 883  C CA  . ASP A 1 119 ? -18.914 -7.147  -12.937 1.00 151.46 ? 119 ASP A CA  1 
ATOM 884  C C   . ASP A 1 119 ? -19.360 -5.961  -13.772 1.00 168.12 ? 119 ASP A C   1 
ATOM 885  O O   . ASP A 1 119 ? -20.548 -5.831  -14.126 1.00 163.16 ? 119 ASP A O   1 
ATOM 886  C CB  . ASP A 1 119 ? -17.847 -7.863  -13.765 1.00 161.42 ? 119 ASP A CB  1 
ATOM 887  C CG  . ASP A 1 119 ? -16.647 -6.965  -14.107 1.00 171.65 ? 119 ASP A CG  1 
ATOM 888  O OD1 . ASP A 1 119 ? -15.943 -6.512  -13.178 1.00 173.71 ? 119 ASP A OD1 1 
ATOM 889  O OD2 . ASP A 1 119 ? -16.407 -6.714  -15.310 1.00 177.90 ? 119 ASP A OD2 1 
ATOM 890  N N   . GLU A 1 120 ? -18.386 -5.109  -14.086 1.00 184.31 ? 120 GLU A N   1 
ATOM 891  C CA  . GLU A 1 120 ? -18.592 -3.901  -14.873 1.00 183.94 ? 120 GLU A CA  1 
ATOM 892  C C   . GLU A 1 120 ? -19.516 -4.241  -16.043 1.00 176.32 ? 120 GLU A C   1 
ATOM 893  O O   . GLU A 1 120 ? -20.585 -3.654  -16.160 1.00 176.39 ? 120 GLU A O   1 
ATOM 894  C CB  . GLU A 1 120 ? -17.255 -3.271  -15.332 1.00 192.92 ? 120 GLU A CB  1 
ATOM 895  C CG  . GLU A 1 120 ? -15.963 -3.636  -14.568 1.00 202.43 ? 120 GLU A CG  1 
ATOM 896  C CD  . GLU A 1 120 ? -16.011 -3.519  -13.034 1.00 198.97 ? 120 GLU A CD  1 
ATOM 897  O OE1 . GLU A 1 120 ? -17.094 -3.291  -12.437 1.00 206.05 ? 120 GLU A OE1 1 
ATOM 898  O OE2 . GLU A 1 120 ? -14.930 -3.682  -12.415 1.00 172.97 ? 120 GLU A OE2 1 
ATOM 899  N N   . ASP A 1 121 ? -19.135 -5.214  -16.873 1.00 172.42 ? 121 ASP A N   1 
ATOM 900  C CA  . ASP A 1 121 ? -20.109 -5.853  -17.765 1.00 166.85 ? 121 ASP A CA  1 
ATOM 901  C C   . ASP A 1 121 ? -20.934 -6.904  -17.018 1.00 167.94 ? 121 ASP A C   1 
ATOM 902  O O   . ASP A 1 121 ? -20.527 -7.383  -15.951 1.00 166.17 ? 121 ASP A O   1 
ATOM 903  C CB  . ASP A 1 121 ? -19.439 -6.615  -18.920 1.00 156.02 ? 121 ASP A CB  1 
ATOM 904  C CG  . ASP A 1 121 ? -18.228 -7.422  -18.488 1.00 159.27 ? 121 ASP A CG  1 
ATOM 905  O OD1 . ASP A 1 121 ? -18.181 -7.904  -17.334 1.00 157.69 ? 121 ASP A OD1 1 
ATOM 906  O OD2 . ASP A 1 121 ? -17.304 -7.571  -19.318 1.00 157.79 ? 121 ASP A OD2 1 
ATOM 907  N N   . GLY A 1 122 ? -22.088 -7.260  -17.574 1.00 159.35 ? 122 GLY A N   1 
ATOM 908  C CA  . GLY A 1 122 ? -23.055 -8.122  -16.887 1.00 156.88 ? 122 GLY A CA  1 
ATOM 909  C C   . GLY A 1 122 ? -22.503 -9.486  -16.506 1.00 156.73 ? 122 GLY A C   1 
ATOM 910  O O   . GLY A 1 122 ? -23.132 -10.253 -15.775 1.00 156.36 ? 122 GLY A O   1 
ATOM 911  N N   . PHE A 1 123 ? -21.312 -9.787  -16.999 1.00 151.49 ? 123 PHE A N   1 
ATOM 912  C CA  . PHE A 1 123 ? -20.649 -11.031 -16.655 1.00 151.78 ? 123 PHE A CA  1 
ATOM 913  C C   . PHE A 1 123 ? -20.230 -11.097 -15.194 1.00 144.27 ? 123 PHE A C   1 
ATOM 914  O O   . PHE A 1 123 ? -19.354 -10.346 -14.777 1.00 154.57 ? 123 PHE A O   1 
ATOM 915  C CB  . PHE A 1 123 ? -19.383 -11.198 -17.501 1.00 159.32 ? 123 PHE A CB  1 
ATOM 916  C CG  . PHE A 1 123 ? -19.620 -11.802 -18.851 1.00 158.54 ? 123 PHE A CG  1 
ATOM 917  C CD1 . PHE A 1 123 ? -20.699 -12.658 -19.069 1.00 164.49 ? 123 PHE A CD1 1 
ATOM 918  C CD2 . PHE A 1 123 ? -18.753 -11.524 -19.905 1.00 153.50 ? 123 PHE A CD2 1 
ATOM 919  C CE1 . PHE A 1 123 ? -20.914 -13.216 -20.320 1.00 174.54 ? 123 PHE A CE1 1 
ATOM 920  C CE2 . PHE A 1 123 ? -18.956 -12.081 -21.153 1.00 160.62 ? 123 PHE A CE2 1 
ATOM 921  C CZ  . PHE A 1 123 ? -20.035 -12.932 -21.363 1.00 176.54 ? 123 PHE A CZ  1 
ATOM 922  N N   . VAL A 1 124 ? -20.831 -11.998 -14.425 1.00 126.83 ? 124 VAL A N   1 
ATOM 923  C CA  . VAL A 1 124 ? -20.200 -12.437 -13.162 1.00 121.21 ? 124 VAL A CA  1 
ATOM 924  C C   . VAL A 1 124 ? -19.084 -13.492 -13.406 1.00 119.67 ? 124 VAL A C   1 
ATOM 925  O O   . VAL A 1 124 ? -19.347 -14.615 -13.899 1.00 115.47 ? 124 VAL A O   1 
ATOM 926  C CB  . VAL A 1 124 ? -21.242 -12.926 -12.141 1.00 112.95 ? 124 VAL A CB  1 
ATOM 927  C CG1 . VAL A 1 124 ? -22.412 -13.562 -12.859 1.00 112.39 ? 124 VAL A CG1 1 
ATOM 928  C CG2 . VAL A 1 124 ? -20.630 -13.904 -11.161 1.00 107.46 ? 124 VAL A CG2 1 
ATOM 929  N N   . TYR A 1 125 ? -17.848 -13.104 -13.068 1.00 112.69 ? 125 TYR A N   1 
ATOM 930  C CA  . TYR A 1 125 ? -16.637 -13.916 -13.275 1.00 119.81 ? 125 TYR A CA  1 
ATOM 931  C C   . TYR A 1 125 ? -16.311 -14.838 -12.081 1.00 123.43 ? 125 TYR A C   1 
ATOM 932  O O   . TYR A 1 125 ? -16.430 -14.438 -10.920 1.00 130.93 ? 125 TYR A O   1 
ATOM 933  C CB  . TYR A 1 125 ? -15.440 -12.990 -13.464 1.00 132.15 ? 125 TYR A CB  1 
ATOM 934  C CG  . TYR A 1 125 ? -15.260 -12.362 -14.833 1.00 147.61 ? 125 TYR A CG  1 
ATOM 935  C CD1 . TYR A 1 125 ? -16.215 -11.470 -15.366 1.00 148.15 ? 125 TYR A CD1 1 
ATOM 936  C CD2 . TYR A 1 125 ? -14.092 -12.607 -15.570 1.00 155.57 ? 125 TYR A CD2 1 
ATOM 937  C CE1 . TYR A 1 125 ? -16.022 -10.873 -16.608 1.00 150.17 ? 125 TYR A CE1 1 
ATOM 938  C CE2 . TYR A 1 125 ? -13.890 -12.029 -16.812 1.00 159.70 ? 125 TYR A CE2 1 
ATOM 939  C CZ  . TYR A 1 125 ? -14.855 -11.172 -17.333 1.00 166.94 ? 125 TYR A CZ  1 
ATOM 940  O OH  . TYR A 1 125 ? -14.614 -10.614 -18.571 1.00 187.58 ? 125 TYR A OH  1 
ATOM 941  N N   . MET A 1 126 ? -15.887 -16.067 -12.346 1.00 116.01 ? 126 MET A N   1 
ATOM 942  C CA  . MET A 1 126 ? -15.530 -16.962 -11.256 1.00 105.93 ? 126 MET A CA  1 
ATOM 943  C C   . MET A 1 126 ? -14.261 -17.595 -11.629 1.00 116.16 ? 126 MET A C   1 
ATOM 944  O O   . MET A 1 126 ? -13.950 -17.764 -12.813 1.00 128.94 ? 126 MET A O   1 
ATOM 945  C CB  . MET A 1 126 ? -16.531 -18.067 -11.078 1.00 93.81  ? 126 MET A CB  1 
ATOM 946  C CG  . MET A 1 126 ? -17.914 -17.537 -10.862 1.00 97.23  ? 126 MET A CG  1 
ATOM 947  S SD  . MET A 1 126 ? -18.931 -18.847 -10.187 1.00 109.47 ? 126 MET A SD  1 
ATOM 948  C CE  . MET A 1 126 ? -20.514 -17.991 -10.259 1.00 107.93 ? 126 MET A CE  1 
ATOM 949  N N   . THR A 1 127 ? -13.519 -17.957 -10.612 1.00 112.75 ? 127 THR A N   1 
ATOM 950  C CA  . THR A 1 127 ? -12.318 -18.688 -10.848 1.00 112.11 ? 127 THR A CA  1 
ATOM 951  C C   . THR A 1 127 ? -12.587 -19.927 -10.122 1.00 104.03 ? 127 THR A C   1 
ATOM 952  O O   . THR A 1 127 ? -13.432 -19.958 -9.245  1.00 110.73 ? 127 THR A O   1 
ATOM 953  C CB  . THR A 1 127 ? -11.143 -17.986 -10.205 1.00 113.59 ? 127 THR A CB  1 
ATOM 954  O OG1 . THR A 1 127 ? -11.322 -16.585 -10.402 1.00 124.18 ? 127 THR A OG1 1 
ATOM 955  C CG2 . THR A 1 127 ? -9.845  -18.400 -10.845 1.00 112.45 ? 127 THR A CG2 1 
ATOM 956  N N   . TYR A 1 128 ? -11.889 -20.971 -10.469 1.00 92.37  ? 128 TYR A N   1 
ATOM 957  C CA  . TYR A 1 128 ? -11.969 -22.082 -9.601  1.00 97.80  ? 128 TYR A CA  1 
ATOM 958  C C   . TYR A 1 128 ? -10.574 -22.582 -9.499  1.00 100.65 ? 128 TYR A C   1 
ATOM 959  O O   . TYR A 1 128 ? -9.882  -22.631 -10.521 1.00 107.73 ? 128 TYR A O   1 
ATOM 960  C CB  . TYR A 1 128 ? -12.856 -23.125 -10.210 1.00 97.70  ? 128 TYR A CB  1 
ATOM 961  C CG  . TYR A 1 128 ? -12.319 -23.664 -11.497 1.00 98.10  ? 128 TYR A CG  1 
ATOM 962  C CD1 . TYR A 1 128 ? -12.467 -22.945 -12.668 1.00 100.78 ? 128 TYR A CD1 1 
ATOM 963  C CD2 . TYR A 1 128 ? -11.651 -24.898 -11.538 1.00 98.66  ? 128 TYR A CD2 1 
ATOM 964  C CE1 . TYR A 1 128 ? -11.988 -23.436 -13.855 1.00 101.56 ? 128 TYR A CE1 1 
ATOM 965  C CE2 . TYR A 1 128 ? -11.158 -25.394 -12.717 1.00 95.86  ? 128 TYR A CE2 1 
ATOM 966  C CZ  . TYR A 1 128 ? -11.333 -24.653 -13.866 1.00 101.36 ? 128 TYR A CZ  1 
ATOM 967  O OH  . TYR A 1 128 ? -10.856 -25.115 -15.057 1.00 104.23 ? 128 TYR A OH  1 
ATOM 968  N N   . ALA A 1 129 ? -10.186 -22.956 -8.276  1.00 97.54  ? 129 ALA A N   1 
ATOM 969  C CA  . ALA A 1 129 ? -8.824  -23.379 -7.926  1.00 105.67 ? 129 ALA A CA  1 
ATOM 970  C C   . ALA A 1 129 ? -8.769  -24.580 -6.981  1.00 106.64 ? 129 ALA A C   1 
ATOM 971  O O   . ALA A 1 129 ? -9.713  -24.820 -6.235  1.00 114.19 ? 129 ALA A O   1 
ATOM 972  C CB  . ALA A 1 129 ? -8.094  -22.225 -7.280  1.00 115.70 ? 129 ALA A CB  1 
ATOM 973  N N   . SER A 1 130 ? -7.661  -25.322 -6.988  1.00 105.06 ? 130 SER A N   1 
ATOM 974  C CA  . SER A 1 130 ? -7.523  -26.428 -6.046  1.00 109.87 ? 130 SER A CA  1 
ATOM 975  C C   . SER A 1 130 ? -6.968  -25.921 -4.707  1.00 111.03 ? 130 SER A C   1 
ATOM 976  O O   . SER A 1 130 ? -7.074  -26.598 -3.686  1.00 107.76 ? 130 SER A O   1 
ATOM 977  C CB  . SER A 1 130 ? -6.699  -27.595 -6.615  1.00 107.01 ? 130 SER A CB  1 
ATOM 978  O OG  . SER A 1 130 ? -5.319  -27.434 -6.340  1.00 115.70 ? 130 SER A OG  1 
ATOM 979  N N   . GLN A 1 131 ? -6.401  -24.719 -4.690  1.00 104.21 ? 131 GLN A N   1 
ATOM 980  C CA  . GLN A 1 131 ? -5.930  -24.150 -3.423  1.00 110.57 ? 131 GLN A CA  1 
ATOM 981  C C   . GLN A 1 131 ? -5.475  -22.754 -3.698  1.00 109.01 ? 131 GLN A C   1 
ATOM 982  O O   . GLN A 1 131 ? -5.046  -22.493 -4.793  1.00 100.98 ? 131 GLN A O   1 
ATOM 983  C CB  . GLN A 1 131 ? -4.751  -24.948 -2.919  1.00 113.82 ? 131 GLN A CB  1 
ATOM 984  C CG  . GLN A 1 131 ? -4.044  -25.708 -4.023  1.00 127.11 ? 131 GLN A CG  1 
ATOM 985  C CD  . GLN A 1 131 ? -2.824  -26.437 -3.499  1.00 155.30 ? 131 GLN A CD  1 
ATOM 986  O OE1 . GLN A 1 131 ? -1.904  -25.807 -2.976  1.00 170.44 ? 131 GLN A OE1 1 
ATOM 987  N NE2 . GLN A 1 131 ? -2.807  -27.770 -3.624  1.00 164.15 ? 131 GLN A NE2 1 
ATOM 988  N N   . GLU A 1 132 ? -5.533  -21.835 -2.747  1.00 111.72 ? 132 GLU A N   1 
ATOM 989  C CA  . GLU A 1 132 ? -5.154  -20.491 -3.150  1.00 126.08 ? 132 GLU A CA  1 
ATOM 990  C C   . GLU A 1 132 ? -4.784  -20.178 -1.728  1.00 142.27 ? 132 GLU A C   1 
ATOM 991  O O   . GLU A 1 132 ? -5.392  -20.691 -0.788  1.00 158.40 ? 132 GLU A O   1 
ATOM 992  C CB  . GLU A 1 132 ? -6.109  -19.957 -4.215  1.00 121.00 ? 132 GLU A CB  1 
ATOM 993  C CG  . GLU A 1 132 ? -5.536  -18.797 -4.980  1.00 127.76 ? 132 GLU A CG  1 
ATOM 994  C CD  . GLU A 1 132 ? -6.611  -17.848 -5.428  1.00 133.56 ? 132 GLU A CD  1 
ATOM 995  O OE1 . GLU A 1 132 ? -7.794  -18.154 -5.190  1.00 126.92 ? 132 GLU A OE1 1 
ATOM 996  O OE2 . GLU A 1 132 ? -6.273  -16.793 -6.006  1.00 130.59 ? 132 GLU A OE2 1 
ATOM 997  N N   . THR A 1 133 ? -3.822  -19.280 -1.582  1.00 143.71 ? 133 THR A N   1 
ATOM 998  C CA  . THR A 1 133 ? -3.506  -18.287 -0.564  1.00 137.21 ? 133 THR A CA  1 
ATOM 999  C C   . THR A 1 133 ? -3.731  -16.860 -1.060  1.00 129.65 ? 133 THR A C   1 
ATOM 1000 O O   . THR A 1 133 ? -3.633  -16.603 -2.252  1.00 135.32 ? 133 THR A O   1 
ATOM 1001 C CB  . THR A 1 133 ? -2.058  -18.478 -0.138  1.00 138.22 ? 133 THR A CB  1 
ATOM 1002 O OG1 . THR A 1 133 ? -1.793  -19.888 -0.074  1.00 151.14 ? 133 THR A OG1 1 
ATOM 1003 C CG2 . THR A 1 133 ? -1.810  -17.853 1.218   1.00 151.11 ? 133 THR A CG2 1 
ATOM 1004 N N   . PHE A 1 134 ? -4.068  -15.957 -0.141  1.00 132.25 ? 134 PHE A N   1 
ATOM 1005 C CA  . PHE A 1 134 ? -4.376  -14.548 -0.446  1.00 144.77 ? 134 PHE A CA  1 
ATOM 1006 C C   . PHE A 1 134 ? -3.465  -13.617 0.383   1.00 152.42 ? 134 PHE A C   1 
ATOM 1007 O O   . PHE A 1 134 ? -3.780  -12.445 0.645   1.00 161.16 ? 134 PHE A O   1 
ATOM 1008 C CB  . PHE A 1 134 ? -5.873  -14.225 -0.199  1.00 146.24 ? 134 PHE A CB  1 
ATOM 1009 C CG  . PHE A 1 134 ? -6.833  -15.161 -0.889  1.00 143.24 ? 134 PHE A CG  1 
ATOM 1010 C CD1 . PHE A 1 134 ? -7.139  -14.999 -2.234  1.00 150.19 ? 134 PHE A CD1 1 
ATOM 1011 C CD2 . PHE A 1 134 ? -7.434  -16.208 -0.192  1.00 147.57 ? 134 PHE A CD2 1 
ATOM 1012 C CE1 . PHE A 1 134 ? -8.018  -15.868 -2.871  1.00 152.27 ? 134 PHE A CE1 1 
ATOM 1013 C CE2 . PHE A 1 134 ? -8.312  -17.083 -0.828  1.00 149.63 ? 134 PHE A CE2 1 
ATOM 1014 C CZ  . PHE A 1 134 ? -8.607  -16.910 -2.166  1.00 147.46 ? 134 PHE A CZ  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PHE A 11  ? 1.4543 1.5552 1.4641 0.0299  0.0715  0.0347  11  PHE A N   
2    C CA  . PHE A 11  ? 1.6247 1.7147 1.6329 0.0314  0.0709  0.0292  11  PHE A CA  
3    C C   . PHE A 11  ? 1.5773 1.6551 1.5659 0.0150  0.0805  0.0361  11  PHE A C   
4    O O   . PHE A 11  ? 1.6774 1.7233 1.6596 0.0124  0.0792  0.0484  11  PHE A O   
5    C CB  . PHE A 11  ? 1.7700 1.8297 1.7918 0.0454  0.0583  0.0339  11  PHE A CB  
6    C CG  . PHE A 11  ? 1.8034 1.8679 1.8364 0.0573  0.0511  0.0166  11  PHE A CG  
7    C CD1 . PHE A 11  ? 1.6252 1.6850 1.6483 0.0516  0.0558  0.0129  11  PHE A CD1 
8    C CD2 . PHE A 11  ? 1.9433 2.0202 1.9968 0.0760  0.0384  0.0015  11  PHE A CD2 
9    C CE1 . PHE A 11  ? 1.7093 1.7792 1.7431 0.0645  0.0485  -0.0059 11  PHE A CE1 
10   C CE2 . PHE A 11  ? 1.8025 1.8876 1.8680 0.0896  0.0297  -0.0187 11  PHE A CE2 
11   C CZ  . PHE A 11  ? 1.8214 1.9042 1.8769 0.0838  0.0352  -0.0228 11  PHE A CZ  
12   N N   . VAL A 12  ? 1.5033 1.6081 1.4832 0.0046  0.0892  0.0284  12  VAL A N   
13   C CA  . VAL A 12  ? 1.4293 1.5238 1.3891 -0.0125 0.0977  0.0371  12  VAL A CA  
14   C C   . VAL A 12  ? 1.5064 1.5698 1.4605 -0.0085 0.0943  0.0419  12  VAL A C   
15   O O   . VAL A 12  ? 1.5245 1.5937 1.4851 0.0021  0.0905  0.0311  12  VAL A O   
16   C CB  . VAL A 12  ? 1.4231 1.5534 1.3765 -0.0209 0.1055  0.0283  12  VAL A CB  
17   C CG1 . VAL A 12  ? 1.4039 1.5245 1.3374 -0.0428 0.1136  0.0419  12  VAL A CG1 
18   C CG2 . VAL A 12  ? 1.6086 1.7838 1.5747 -0.0184 0.1071  0.0153  12  VAL A CG2 
19   N N   . MET A 13  ? 1.6093 1.6417 1.5520 -0.0161 0.0950  0.0561  13  MET A N   
20   C CA  . MET A 13  ? 1.6912 1.6984 1.6261 -0.0149 0.0933  0.0598  13  MET A CA  
21   C C   . MET A 13  ? 1.7008 1.7226 1.6205 -0.0246 0.1003  0.0566  13  MET A C   
22   O O   . MET A 13  ? 1.7410 1.7833 1.6542 -0.0369 0.1067  0.0578  13  MET A O   
23   C CB  . MET A 13  ? 1.7029 1.6801 1.6265 -0.0217 0.0931  0.0740  13  MET A CB  
24   C CG  . MET A 13  ? 1.7818 1.7421 1.7180 -0.0118 0.0861  0.0807  13  MET A CG  
25   S SD  . MET A 13  ? 1.8258 1.7752 1.7786 0.0019  0.0777  0.0748  13  MET A SD  
26   C CE  . MET A 13  ? 1.5282 1.4541 1.4650 -0.0032 0.0792  0.0788  13  MET A CE  
27   N N   . ILE A 14  ? 1.7750 1.7875 1.6891 -0.0201 0.0988  0.0537  14  ILE A N   
28   C CA  . ILE A 14  ? 1.9795 2.0099 1.8774 -0.0284 0.1053  0.0520  14  ILE A CA  
29   C C   . ILE A 14  ? 2.1198 2.1236 1.9954 -0.0417 0.1080  0.0665  14  ILE A C   
30   O O   . ILE A 14  ? 2.3358 2.3129 2.2088 -0.0456 0.1056  0.0758  14  ILE A O   
31   C CB  . ILE A 14  ? 2.0476 2.0875 1.9495 -0.0148 0.1016  0.0388  14  ILE A CB  
32   C CG1 . ILE A 14  ? 2.0387 2.1240 1.9325 -0.0193 0.1090  0.0312  14  ILE A CG1 
33   C CG2 . ILE A 14  ? 1.8809 1.8867 1.7705 -0.0151 0.0990  0.0462  14  ILE A CG2 
34   C CD1 . ILE A 14  ? 1.6098 1.7158 1.4976 -0.0371 0.1175  0.0399  14  ILE A CD1 
35   N N   . GLY A 15  ? 2.0770 2.0901 1.9362 -0.0476 0.1121  0.0680  15  GLY A N   
36   C CA  . GLY A 15  ? 1.9895 1.9721 1.8276 -0.0564 0.1116  0.0808  15  GLY A CA  
37   C C   . GLY A 15  ? 1.9656 1.9373 1.8008 -0.0433 0.1073  0.0744  15  GLY A C   
38   O O   . GLY A 15  ? 1.7980 1.7676 1.6514 -0.0281 0.1016  0.0634  15  GLY A O   
39   N N   . SER A 16  ? 1.9459 1.9095 1.7590 -0.0497 0.1087  0.0820  16  SER A N   
40   C CA  . SER A 16  ? 1.9794 1.9425 1.7861 -0.0384 0.1057  0.0748  16  SER A CA  
41   C C   . SER A 16  ? 2.0982 2.0628 1.8763 -0.0507 0.1096  0.0878  16  SER A C   
42   O O   . SER A 16  ? 2.0983 2.0646 1.8663 -0.0683 0.1140  0.1017  16  SER A O   
43   C CB  . SER A 16  ? 1.9314 1.8586 1.7445 -0.0283 0.0976  0.0731  16  SER A CB  
44   O OG  . SER A 16  ? 1.9411 1.8712 1.7535 -0.0158 0.0937  0.0625  16  SER A OG  
45   N N   . PRO A 17  ? 2.1427 2.1077 1.9085 -0.0422 0.1074  0.0841  17  PRO A N   
46   C CA  . PRO A 17  ? 2.0595 2.0196 1.7962 -0.0527 0.1091  0.0993  17  PRO A CA  
47   C C   . PRO A 17  ? 1.9867 1.9041 1.7099 -0.0662 0.1052  0.1172  17  PRO A C   
48   O O   . PRO A 17  ? 1.9183 1.8372 1.6300 -0.0845 0.1084  0.1330  17  PRO A O   
49   C CB  . PRO A 17  ? 2.2298 2.1839 1.9607 -0.0359 0.1034  0.0890  17  PRO A CB  
50   C CG  . PRO A 17  ? 2.3054 2.2637 2.0650 -0.0183 0.0987  0.0680  17  PRO A CG  
51   C CD  . PRO A 17  ? 2.2840 2.2623 2.0633 -0.0221 0.1028  0.0643  17  PRO A CD  
52   N N   . SER A 18  ? 2.1684 2.0500 1.8950 -0.0569 0.0973  0.1137  18  SER A N   
53   C CA  . SER A 18  ? 2.3316 2.1714 2.0448 -0.0637 0.0903  0.1257  18  SER A CA  
54   C C   . SER A 18  ? 2.2581 2.0869 1.9424 -0.0729 0.0882  0.1411  18  SER A C   
55   O O   . SER A 18  ? 2.2468 2.0622 1.9204 -0.0901 0.0869  0.1571  18  SER A O   
56   C CB  . SER A 18  ? 2.3342 2.1619 2.0579 -0.0742 0.0896  0.1309  18  SER A CB  
57   O OG  . SER A 18  ? 2.3031 2.1605 2.0339 -0.0864 0.0975  0.1340  18  SER A OG  
58   N N   . VAL A 19  ? 2.0535 1.8879 1.7264 -0.0614 0.0866  0.1363  19  VAL A N   
59   C CA  . VAL A 19  ? 1.9693 1.7919 1.6127 -0.0669 0.0830  0.1513  19  VAL A CA  
60   C C   . VAL A 19  ? 1.8725 1.6468 1.5038 -0.0754 0.0726  0.1646  19  VAL A C   
61   O O   . VAL A 19  ? 1.8574 1.6068 1.4997 -0.0676 0.0661  0.1560  19  VAL A O   
62   C CB  . VAL A 19  ? 1.9668 1.7959 1.6012 -0.0487 0.0799  0.1405  19  VAL A CB  
63   C CG1 . VAL A 19  ? 1.9899 1.8710 1.6304 -0.0419 0.0885  0.1293  19  VAL A CG1 
64   C CG2 . VAL A 19  ? 1.9407 1.7471 1.5910 -0.0325 0.0728  0.1242  19  VAL A CG2 
65   N N   . ARG A 20  ? 2.0279 1.7913 1.6372 -0.0910 0.0701  0.1857  20  ARG A N   
66   C CA  . ARG A 20  ? 2.2158 1.9374 1.8177 -0.1052 0.0597  0.2008  20  ARG A CA  
67   C C   . ARG A 20  ? 2.1509 1.8238 1.7460 -0.0932 0.0437  0.1960  20  ARG A C   
68   O O   . ARG A 20  ? 2.1304 1.7934 1.7108 -0.0797 0.0381  0.1929  20  ARG A O   
69   C CB  . ARG A 20  ? 2.4988 2.2226 2.0789 -0.1258 0.0600  0.2270  20  ARG A CB  
70   C CG  . ARG A 20  ? 2.7729 2.4728 2.3560 -0.1490 0.0542  0.2438  20  ARG A CG  
71   C CD  . ARG A 20  ? 2.9136 2.6504 2.5196 -0.1618 0.0665  0.2405  20  ARG A CD  
72   N NE  . ARG A 20  ? 3.1391 2.8587 2.7675 -0.1570 0.0621  0.2255  20  ARG A NE  
73   C CZ  . ARG A 20  ? 3.2080 2.9472 2.8565 -0.1411 0.0683  0.2041  20  ARG A CZ  
74   N NH1 . ARG A 20  ? 3.1631 2.9368 2.8148 -0.1277 0.0780  0.1928  20  ARG A NH1 
75   N NH2 . ARG A 20  ? 3.0615 2.7859 2.7274 -0.1381 0.0635  0.1940  20  ARG A NH2 
76   N N   . PRO A 21  ? 2.1907 1.8367 1.7970 -0.0969 0.0355  0.1936  21  PRO A N   
77   C CA  . PRO A 21  ? 2.1930 1.7978 1.7939 -0.0849 0.0192  0.1871  21  PRO A CA  
78   C C   . PRO A 21  ? 2.1493 1.7261 1.7236 -0.0798 0.0075  0.1961  21  PRO A C   
79   O O   . PRO A 21  ? 2.2818 1.8563 1.8378 -0.0932 0.0076  0.2160  21  PRO A O   
80   C CB  . PRO A 21  ? 2.2824 1.8639 1.8916 -0.0980 0.0106  0.1920  21  PRO A CB  
81   C CG  . PRO A 21  ? 2.4524 2.0720 2.0835 -0.1066 0.0259  0.1881  21  PRO A CG  
82   C CD  . PRO A 21  ? 2.4349 2.0956 2.0643 -0.1059 0.0416  0.1892  21  PRO A CD  
83   N N   . PHE A 22  ? 2.1806 1.7384 1.7533 -0.0604 -0.0027 0.1816  22  PHE A N   
84   C CA  . PHE A 22  ? 2.2490 1.7877 1.7990 -0.0481 -0.0129 0.1831  22  PHE A CA  
85   C C   . PHE A 22  ? 2.3279 1.8166 1.8657 -0.0463 -0.0347 0.1872  22  PHE A C   
86   O O   . PHE A 22  ? 2.2660 1.7309 1.7836 -0.0351 -0.0475 0.1886  22  PHE A O   
87   C CB  . PHE A 22  ? 2.3020 1.8578 1.8623 -0.0262 -0.0103 0.1609  22  PHE A CB  
88   C CG  . PHE A 22  ? 2.2090 1.7433 1.7494 -0.0101 -0.0236 0.1571  22  PHE A CG  
89   C CD1 . PHE A 22  ? 2.1913 1.6931 1.7288 0.0021  -0.0413 0.1476  22  PHE A CD1 
90   C CD2 . PHE A 22  ? 2.1416 1.6913 1.6664 -0.0051 -0.0193 0.1608  22  PHE A CD2 
91   C CE1 . PHE A 22  ? 2.0888 1.5726 1.6080 0.0186  -0.0544 0.1427  22  PHE A CE1 
92   C CE2 . PHE A 22  ? 2.2000 1.7319 1.7064 0.0111  -0.0319 0.1562  22  PHE A CE2 
93   C CZ  . PHE A 22  ? 2.1137 1.6115 1.6169 0.0226  -0.0495 0.1477  22  PHE A CZ  
94   N N   . LYS A 23  ? 2.4738 1.9497 2.0268 -0.0540 -0.0398 0.1846  23  LYS A N   
95   C CA  . LYS A 23  ? 2.5523 1.9826 2.0981 -0.0628 -0.0595 0.1944  23  LYS A CA  
96   C C   . LYS A 23  ? 2.5646 1.9838 2.0915 -0.0850 -0.0594 0.2244  23  LYS A C   
97   O O   . LYS A 23  ? 2.4652 1.8436 1.9719 -0.0866 -0.0773 0.2380  23  LYS A O   
98   C CB  . LYS A 23  ? 2.5412 1.9759 2.1115 -0.0711 -0.0588 0.1867  23  LYS A CB  
99   C CG  . LYS A 23  ? 2.3997 1.8309 1.9849 -0.0512 -0.0685 0.1613  23  LYS A CG  
100  C CD  . LYS A 23  ? 2.4094 1.7905 1.9832 -0.0429 -0.0963 0.1580  23  LYS A CD  
101  C CE  . LYS A 23  ? 2.4249 1.8075 2.0107 -0.0197 -0.1077 0.1306  23  LYS A CE  
102  N NZ  . LYS A 23  ? 2.3451 1.6860 1.9141 -0.0036 -0.1335 0.1242  23  LYS A NZ  
103  N N   . GLN A 24  ? 2.7062 2.1657 2.2397 -0.1009 -0.0390 0.2342  24  GLN A N   
104  C CA  . GLN A 24  ? 2.7242 2.1909 2.2454 -0.1260 -0.0334 0.2631  24  GLN A CA  
105  C C   . GLN A 24  ? 2.6363 2.1255 2.1342 -0.1246 -0.0250 0.2763  24  GLN A C   
106  O O   . GLN A 24  ? 2.7351 2.2333 2.2204 -0.1455 -0.0210 0.3025  24  GLN A O   
107  C CB  . GLN A 24  ? 2.7863 2.2974 2.3287 -0.1411 -0.0140 0.2624  24  GLN A CB  
108  C CG  . GLN A 24  ? 2.9254 2.4188 2.4841 -0.1601 -0.0207 0.2681  24  GLN A CG  
109  C CD  . GLN A 24  ? 2.9162 2.4552 2.4877 -0.1815 -0.0020 0.2778  24  GLN A CD  
110  O OE1 . GLN A 24  ? 2.9050 2.4922 2.4832 -0.1747 0.0163  0.2679  24  GLN A OE1 
111  N NE2 . GLN A 24  ? 2.9257 2.4502 2.5019 -0.2073 -0.0081 0.2962  24  GLN A NE2 
112  N N   . ARG A 25  ? 2.6399 2.1449 2.1347 -0.1008 -0.0212 0.2576  25  ARG A N   
113  C CA  . ARG A 25  ? 2.6582 2.1929 2.1347 -0.0934 -0.0125 0.2621  25  ARG A CA  
114  C C   . ARG A 25  ? 2.5894 2.0844 2.0377 -0.0850 -0.0308 0.2729  25  ARG A C   
115  O O   . ARG A 25  ? 2.4320 1.9427 1.8591 -0.0785 -0.0284 0.2802  25  ARG A O   
116  C CB  . ARG A 25  ? 2.7311 2.2988 2.2229 -0.0708 -0.0023 0.2331  25  ARG A CB  
117  C CG  . ARG A 25  ? 2.6955 2.3206 2.1978 -0.0741 0.0179  0.2289  25  ARG A CG  
118  C CD  . ARG A 25  ? 2.7314 2.3827 2.2438 -0.0505 0.0233  0.2033  25  ARG A CD  
119  N NE  . ARG A 25  ? 3.1186 2.8212 2.6285 -0.0506 0.0371  0.2031  25  ARG A NE  
120  C CZ  . ARG A 25  ? 3.0936 2.8128 2.5783 -0.0478 0.0373  0.2134  25  ARG A CZ  
121  N NH1 . ARG A 25  ? 2.9874 2.7603 2.4734 -0.0461 0.0500  0.2091  25  ARG A NH1 
122  N NH2 . ARG A 25  ? 3.0441 2.7290 2.5020 -0.0452 0.0240  0.2272  25  ARG A NH2 
123  N N   . LYS A 26  ? 2.6318 2.0757 2.0806 -0.0824 -0.0506 0.2712  26  LYS A N   
124  C CA  . LYS A 26  ? 2.7185 2.1175 2.1422 -0.0749 -0.0716 0.2816  26  LYS A CA  
125  C C   . LYS A 26  ? 2.9610 2.3174 2.3869 -0.0970 -0.0861 0.3013  26  LYS A C   
126  O O   . LYS A 26  ? 3.0347 2.4006 2.4847 -0.1097 -0.0794 0.2963  26  LYS A O   
127  C CB  . LYS A 26  ? 2.5201 1.9040 1.9498 -0.0457 -0.0826 0.2513  26  LYS A CB  
128  C CG  . LYS A 26  ? 2.3973 1.8293 1.8351 -0.0281 -0.0658 0.2297  26  LYS A CG  
129  C CD  . LYS A 26  ? 2.4293 1.8781 1.8410 -0.0230 -0.0626 0.2412  26  LYS A CD  
130  C CE  . LYS A 26  ? 2.3329 1.8290 1.7551 -0.0059 -0.0479 0.2184  26  LYS A CE  
131  N NZ  . LYS A 26  ? 2.3684 1.9125 1.8031 -0.0202 -0.0263 0.2226  26  LYS A NZ  
132  N N   . SER A 27  ? 3.0756 2.3895 2.4771 -0.1039 -0.1048 0.3261  27  SER A N   
133  C CA  . SER A 27  ? 3.1382 2.3903 2.5421 -0.1110 -0.1309 0.3332  27  SER A CA  
134  C C   . SER A 27  ? 3.0792 2.3104 2.4818 -0.0770 -0.1461 0.3024  27  SER A C   
135  O O   . SER A 27  ? 2.9738 2.2385 2.3714 -0.0577 -0.1343 0.2867  27  SER A O   
136  C CB  . SER A 27  ? 3.1542 2.3695 2.5319 -0.1302 -0.1460 0.3727  27  SER A CB  
137  O OG  . SER A 27  ? 3.1165 2.3627 2.4965 -0.1626 -0.1291 0.4013  27  SER A OG  
138  N N   . LEU A 28  ? 2.9895 2.1709 2.3990 -0.0688 -0.1717 0.2911  28  LEU A N   
139  C CA  . LEU A 28  ? 2.8212 1.9880 2.2312 -0.0353 -0.1870 0.2592  28  LEU A CA  
140  C C   . LEU A 28  ? 2.8294 1.9884 2.2107 -0.0165 -0.1946 0.2622  28  LEU A C   
141  O O   . LEU A 28  ? 2.7227 1.8991 2.1051 0.0102  -0.1941 0.2353  28  LEU A O   
142  C CB  . LEU A 28  ? 2.7008 1.8136 2.1209 -0.0302 -0.2172 0.2484  28  LEU A CB  
143  C CG  . LEU A 28  ? 2.6063 1.6679 2.0158 -0.0041 -0.2514 0.2327  28  LEU A CG  
144  C CD1 . LEU A 28  ? 2.4713 1.5546 1.8730 0.0288  -0.2507 0.2059  28  LEU A CD1 
145  C CD2 . LEU A 28  ? 2.5464 1.5820 1.9799 -0.0006 -0.2707 0.2123  28  LEU A CD2 
146  N N   . ALA A 29  ? 3.0131 2.1489 2.3694 -0.0321 -0.2014 0.2966  29  ALA A N   
147  C CA  . ALA A 29  ? 3.2193 2.3391 2.5444 -0.0166 -0.2132 0.3055  29  ALA A CA  
148  C C   . ALA A 29  ? 3.2614 2.4386 2.5745 -0.0127 -0.1878 0.3080  29  ALA A C   
149  O O   . ALA A 29  ? 3.5320 2.7054 2.8217 0.0058  -0.1957 0.3075  29  ALA A O   
150  C CB  . ALA A 29  ? 3.3581 2.4227 2.6607 -0.0348 -0.2355 0.3439  29  ALA A CB  
151  N N   . ILE A 30  ? 3.1145 2.3443 2.4436 -0.0285 -0.1595 0.3093  30  ILE A N   
152  C CA  . ILE A 30  ? 2.9764 2.2648 2.3002 -0.0208 -0.1364 0.3032  30  ILE A CA  
153  C C   . ILE A 30  ? 2.9095 2.2149 2.2499 0.0093  -0.1352 0.2620  30  ILE A C   
154  O O   . ILE A 30  ? 2.8613 2.1853 2.1893 0.0290  -0.1340 0.2512  30  ILE A O   
155  C CB  . ILE A 30  ? 2.8290 2.1694 2.1639 -0.0460 -0.1089 0.3176  30  ILE A CB  
156  C CG1 . ILE A 30  ? 2.7437 2.0597 2.0767 -0.0790 -0.1134 0.3518  30  ILE A CG1 
157  C CG2 . ILE A 30  ? 2.7206 2.1119 2.0376 -0.0417 -0.0925 0.3242  30  ILE A CG2 
158  C CD1 . ILE A 30  ? 2.6260 1.9625 1.9340 -0.1000 -0.1057 0.3900  30  ILE A CD1 
159  N N   . ARG A 31  ? 2.8841 2.1799 2.2509 0.0131  -0.1386 0.2404  31  ARG A N   
160  C CA  . ARG A 31  ? 2.7858 2.1076 2.1746 0.0355  -0.1331 0.2042  31  ARG A CA  
161  C C   . ARG A 31  ? 2.6815 1.9705 2.0668 0.0603  -0.1571 0.1837  31  ARG A C   
162  O O   . ARG A 31  ? 2.5279 1.8413 1.9239 0.0811  -0.1543 0.1569  31  ARG A O   
163  C CB  . ARG A 31  ? 2.7193 2.0618 2.1404 0.0248  -0.1198 0.1929  31  ARG A CB  
164  C CG  . ARG A 31  ? 2.6429 1.9453 2.0738 0.0213  -0.1379 0.1899  31  ARG A CG  
165  C CD  . ARG A 31  ? 2.6870 1.9921 2.1305 -0.0066 -0.1282 0.2074  31  ARG A CD  
166  N NE  . ARG A 31  ? 2.7591 2.0546 2.2263 -0.0062 -0.1348 0.1914  31  ARG A NE  
167  C CZ  . ARG A 31  ? 2.7503 2.0557 2.2352 -0.0265 -0.1254 0.1983  31  ARG A CZ  
168  N NH1 . ARG A 31  ? 2.6662 1.9922 2.1482 -0.0494 -0.1086 0.2209  31  ARG A NH1 
169  N NH2 . ARG A 31  ? 2.6818 1.9808 2.1873 -0.0228 -0.1329 0.1813  31  ARG A NH2 
170  N N   . GLN A 32  ? 2.6932 1.9283 2.0664 0.0572  -0.1814 0.1957  32  GLN A N   
171  C CA  . GLN A 32  ? 2.7211 1.9211 2.0908 0.0810  -0.2080 0.1761  32  GLN A CA  
172  C C   . GLN A 32  ? 2.6628 1.8747 2.0153 0.1055  -0.2119 0.1644  32  GLN A C   
173  O O   . GLN A 32  ? 2.5427 1.7618 1.9034 0.1302  -0.2208 0.1348  32  GLN A O   
174  C CB  . GLN A 32  ? 2.8472 1.9824 2.2019 0.0718  -0.2356 0.1971  32  GLN A CB  
175  C CG  . GLN A 32  ? 2.9951 2.0901 2.3516 0.0959  -0.2669 0.1736  32  GLN A CG  
176  C CD  . GLN A 32  ? 3.0010 2.1255 2.3884 0.1081  -0.2618 0.1390  32  GLN A CD  
177  O OE1 . GLN A 32  ? 2.9794 2.1493 2.3767 0.1244  -0.2481 0.1157  32  GLN A OE1 
178  N NE2 . GLN A 32  ? 2.9280 2.0280 2.3312 0.1002  -0.2740 0.1358  32  GLN A NE2 
179  N N   . GLU A 33  ? 2.6641 1.8831 1.9932 0.0982  -0.2046 0.1874  33  GLU A N   
180  C CA  . GLU A 33  ? 2.8129 2.0523 2.1256 0.1192  -0.2042 0.1779  33  GLU A CA  
181  C C   . GLU A 33  ? 2.8292 2.1208 2.1689 0.1334  -0.1870 0.1446  33  GLU A C   
182  O O   . GLU A 33  ? 2.7987 2.0920 2.1423 0.1577  -0.1985 0.1185  33  GLU A O   
183  C CB  . GLU A 33  ? 2.8258 2.0816 2.1142 0.1057  -0.1921 0.2075  33  GLU A CB  
184  C CG  . GLU A 33  ? 2.8237 2.0863 2.0856 0.1275  -0.1996 0.2048  33  GLU A CG  
185  C CD  . GLU A 33  ? 2.9984 2.2037 2.2264 0.1326  -0.2284 0.2272  33  GLU A CD  
186  O OE1 . GLU A 33  ? 2.9819 2.1359 2.2120 0.1348  -0.2515 0.2260  33  GLU A OE1 
187  O OE2 . GLU A 33  ? 3.0704 2.2821 2.2692 0.1355  -0.2293 0.2458  33  GLU A OE2 
188  N N   . GLU A 34  ? 2.7887 2.1221 2.1483 0.1174  -0.1609 0.1459  34  GLU A N   
189  C CA  . GLU A 34  ? 2.4783 1.8623 1.8653 0.1259  -0.1429 0.1198  34  GLU A CA  
190  C C   . GLU A 34  ? 2.3570 1.7423 1.7664 0.1408  -0.1508 0.0921  34  GLU A C   
191  O O   . GLU A 34  ? 2.2018 1.6151 1.6226 0.1580  -0.1487 0.0688  34  GLU A O   
192  C CB  . GLU A 34  ? 2.4158 1.8321 1.8225 0.1039  -0.1185 0.1282  34  GLU A CB  
193  C CG  . GLU A 34  ? 2.6199 2.0872 2.0468 0.1102  -0.1002 0.1101  34  GLU A CG  
194  C CD  . GLU A 34  ? 2.7509 2.2482 2.1784 0.0934  -0.0808 0.1249  34  GLU A CD  
195  O OE1 . GLU A 34  ? 2.7528 2.2665 2.1623 0.0987  -0.0785 0.1298  34  GLU A OE1 
196  O OE2 . GLU A 34  ? 2.6812 2.1891 2.1270 0.0763  -0.0684 0.1304  34  GLU A OE2 
197  N N   . VAL A 35  ? 2.3863 1.7448 1.8029 0.1331  -0.1596 0.0949  35  VAL A N   
198  C CA  . VAL A 35  ? 2.3439 1.7010 1.7779 0.1477  -0.1709 0.0704  35  VAL A CA  
199  C C   . VAL A 35  ? 2.3997 1.7490 1.8210 0.1752  -0.1899 0.0517  35  VAL A C   
200  O O   . VAL A 35  ? 2.2670 1.6509 1.7052 0.1905  -0.1863 0.0270  35  VAL A O   
201  C CB  . VAL A 35  ? 2.4153 1.7285 1.8467 0.1408  -0.1886 0.0780  35  VAL A CB  
202  C CG1 . VAL A 35  ? 2.3212 1.6426 1.7718 0.1580  -0.1995 0.0494  35  VAL A CG1 
203  C CG2 . VAL A 35  ? 2.4910 1.8048 1.9310 0.1121  -0.1734 0.0998  35  VAL A CG2 
204  N N   . ALA A 36  ? 2.5832 1.8865 1.9751 0.1806  -0.2112 0.0649  36  ALA A N   
205  C CA  . ALA A 36  ? 2.6245 1.9132 1.9992 0.2076  -0.2329 0.0499  36  ALA A CA  
206  C C   . ALA A 36  ? 2.6166 1.9461 1.9895 0.2168  -0.2191 0.0418  36  ALA A C   
207  O O   . ALA A 36  ? 2.5255 1.8803 1.9085 0.2377  -0.2229 0.0147  36  ALA A O   
208  C CB  . ALA A 36  ? 2.6151 1.8432 1.9572 0.2076  -0.2576 0.0724  36  ALA A CB  
209  N N   . GLY A 37  ? 2.6423 1.9822 2.0048 0.2007  -0.2029 0.0640  37  GLY A N   
210  C CA  . GLY A 37  ? 2.5883 1.9652 1.9471 0.2085  -0.1910 0.0581  37  GLY A CA  
211  C C   . GLY A 37  ? 2.6388 2.0660 2.0296 0.2176  -0.1776 0.0288  37  GLY A C   
212  O O   . GLY A 37  ? 2.5670 2.0119 1.9557 0.2373  -0.1832 0.0106  37  GLY A O   
213  N N   . ILE A 38  ? 2.6596 2.1103 2.0807 0.2029  -0.1608 0.0251  38  ILE A N   
214  C CA  . ILE A 38  ? 2.6333 2.1322 2.0876 0.2073  -0.1470 0.0020  38  ILE A CA  
215  C C   . ILE A 38  ? 2.5899 2.0951 2.0594 0.2229  -0.1588 -0.0215 38  ILE A C   
216  O O   . ILE A 38  ? 2.5044 2.0462 1.9940 0.2336  -0.1553 -0.0430 38  ILE A O   
217  C CB  . ILE A 38  ? 2.5557 2.0815 2.0360 0.1853  -0.1232 0.0096  38  ILE A CB  
218  C CG1 . ILE A 38  ? 2.5617 2.1297 2.0606 0.1870  -0.1090 -0.0019 38  ILE A CG1 
219  C CG2 . ILE A 38  ? 2.4647 1.9992 1.9715 0.1794  -0.1195 0.0020  38  ILE A CG2 
220  C CD1 . ILE A 38  ? 2.6407 2.2117 2.1192 0.1849  -0.1043 0.0101  38  ILE A CD1 
221  N N   . ARG A 39  ? 2.5895 2.0611 2.0499 0.2246  -0.1738 -0.0183 39  ARG A N   
222  C CA  . ARG A 39  ? 2.6316 2.1094 2.1013 0.2435  -0.1888 -0.0424 39  ARG A CA  
223  C C   . ARG A 39  ? 2.5289 2.0053 1.9826 0.2684  -0.2055 -0.0583 39  ARG A C   
224  O O   . ARG A 39  ? 2.5975 2.0987 2.0640 0.2859  -0.2131 -0.0833 39  ARG A O   
225  C CB  . ARG A 39  ? 2.7239 2.1626 2.1855 0.2437  -0.2060 -0.0385 39  ARG A CB  
226  C CG  . ARG A 39  ? 2.8813 2.3467 2.3718 0.2367  -0.1970 -0.0478 39  ARG A CG  
227  C CD  . ARG A 39  ? 3.0311 2.5467 2.5449 0.2530  -0.1958 -0.0762 39  ARG A CD  
228  N NE  . ARG A 39  ? 3.1879 2.7165 2.7182 0.2549  -0.1996 -0.0872 39  ARG A NE  
229  C CZ  . ARG A 39  ? 3.1431 2.7224 2.6972 0.2638  -0.1955 -0.1077 39  ARG A CZ  
230  N NH1 . ARG A 39  ? 3.0571 2.6792 2.6249 0.2700  -0.1870 -0.1198 39  ARG A NH1 
231  N NH2 . ARG A 39  ? 3.0199 2.6101 2.5853 0.2661  -0.2000 -0.1162 39  ARG A NH2 
232  N N   . ALA A 40  ? 2.4621 1.9141 1.8879 0.2700  -0.2106 -0.0436 40  ALA A N   
233  C CA  . ALA A 40  ? 2.5430 1.9922 1.9504 0.2946  -0.2273 -0.0573 40  ALA A CA  
234  C C   . ALA A 40  ? 2.5590 2.0603 1.9850 0.3012  -0.2139 -0.0756 40  ALA A C   
235  O O   . ALA A 40  ? 2.5197 2.0397 1.9503 0.3227  -0.2251 -0.1003 40  ALA A O   
236  C CB  . ALA A 40  ? 2.5556 1.9588 1.9238 0.2947  -0.2399 -0.0327 40  ALA A CB  
237  N N   . LYS A 41  ? 2.5830 2.1080 2.0208 0.2838  -0.1919 -0.0653 41  LYS A N   
238  C CA  . LYS A 41  ? 2.5422 2.1124 1.9991 0.2895  -0.1816 -0.0827 41  LYS A CA  
239  C C   . LYS A 41  ? 2.5956 2.2080 2.0934 0.2879  -0.1729 -0.1036 41  LYS A C   
240  O O   . LYS A 41  ? 2.6206 2.2611 2.1302 0.3039  -0.1791 -0.1270 41  LYS A O   
241  C CB  . LYS A 41  ? 2.4006 1.9831 1.8575 0.2743  -0.1639 -0.0678 41  LYS A CB  
242  C CG  . LYS A 41  ? 2.3875 2.0010 1.8475 0.2876  -0.1632 -0.0842 41  LYS A CG  
243  C CD  . LYS A 41  ? 2.4584 2.0985 1.9348 0.2727  -0.1438 -0.0789 41  LYS A CD  
244  C CE  . LYS A 41  ? 2.5397 2.1558 1.9907 0.2576  -0.1376 -0.0493 41  LYS A CE  
245  N NZ  . LYS A 41  ? 2.6367 2.2808 2.1096 0.2415  -0.1180 -0.0458 41  LYS A NZ  
246  N N   . PHE A 42  ? 2.5567 2.1754 2.0756 0.2687  -0.1593 -0.0947 42  PHE A N   
247  C CA  . PHE A 42  ? 2.3585 2.0204 1.9164 0.2641  -0.1493 -0.1096 42  PHE A CA  
248  C C   . PHE A 42  ? 2.2574 1.9232 1.8226 0.2701  -0.1578 -0.1189 42  PHE A C   
249  O O   . PHE A 42  ? 2.1987 1.9029 1.7949 0.2635  -0.1478 -0.1265 42  PHE A O   
250  C CB  . PHE A 42  ? 2.2612 1.9403 1.8446 0.2398  -0.1270 -0.0964 42  PHE A CB  
251  C CG  . PHE A 42  ? 2.1993 1.8883 1.7853 0.2355  -0.1180 -0.0941 42  PHE A CG  
252  C CD1 . PHE A 42  ? 2.1234 1.8501 1.7380 0.2383  -0.1135 -0.1114 42  PHE A CD1 
253  C CD2 . PHE A 42  ? 2.3748 2.0389 1.9374 0.2275  -0.1140 -0.0749 42  PHE A CD2 
254  C CE1 . PHE A 42  ? 2.2579 1.9949 1.8772 0.2362  -0.1073 -0.1127 42  PHE A CE1 
255  C CE2 . PHE A 42  ? 2.5099 2.1896 2.0755 0.2257  -0.1063 -0.0754 42  PHE A CE2 
256  C CZ  . PHE A 42  ? 2.3940 2.1090 1.9879 0.2313  -0.1038 -0.0958 42  PHE A CZ  
257  N N   . PRO A 43  ? 2.3177 1.9490 1.8555 0.2861  -0.1787 -0.1218 43  PRO A N   
258  C CA  . PRO A 43  ? 2.4265 2.0303 1.9527 0.2923  -0.1938 -0.1220 43  PRO A CA  
259  C C   . PRO A 43  ? 2.4651 2.1077 2.0153 0.3000  -0.1956 -0.1424 43  PRO A C   
260  O O   . PRO A 43  ? 2.6415 2.2754 2.1809 0.3212  -0.2167 -0.1591 43  PRO A O   
261  C CB  . PRO A 43  ? 2.4605 2.0379 1.9588 0.3179  -0.2190 -0.1338 43  PRO A CB  
262  C CG  . PRO A 43  ? 2.4092 2.0378 1.9273 0.3301  -0.2156 -0.1575 43  PRO A CG  
263  C CD  . PRO A 43  ? 2.3600 2.0139 1.8979 0.3091  -0.1909 -0.1462 43  PRO A CD  
264  N N   . ASN A 44  ? 2.4902 2.1787 2.0729 0.2853  -0.1753 -0.1425 44  ASN A N   
265  C CA  . ASN A 44  ? 2.5494 2.2841 2.1569 0.2893  -0.1736 -0.1579 44  ASN A CA  
266  C C   . ASN A 44  ? 2.5673 2.3240 2.2007 0.2628  -0.1495 -0.1405 44  ASN A C   
267  O O   . ASN A 44  ? 2.4380 2.2457 2.1010 0.2567  -0.1381 -0.1457 44  ASN A O   
268  C CB  . ASN A 44  ? 2.5323 2.3152 2.1553 0.3045  -0.1771 -0.1818 44  ASN A CB  
269  C CG  . ASN A 44  ? 2.6235 2.4369 2.2708 0.2892  -0.1584 -0.1769 44  ASN A CG  
270  O OD1 . ASN A 44  ? 2.5702 2.3598 2.2133 0.2751  -0.1485 -0.1600 44  ASN A OD1 
271  N ND2 . ASN A 44  ? 2.7958 2.6648 2.4705 0.2921  -0.1546 -0.1927 44  ASN A ND2 
272  N N   . LYS A 45  ? 2.5041 2.2204 2.1243 0.2473  -0.1430 -0.1183 45  LYS A N   
273  C CA  . LYS A 45  ? 2.2828 2.0053 1.9203 0.2223  -0.1219 -0.0984 45  LYS A CA  
274  C C   . LYS A 45  ? 2.3536 2.0345 1.9741 0.2124  -0.1236 -0.0813 45  LYS A C   
275  O O   . LYS A 45  ? 2.4701 2.1065 2.0622 0.2196  -0.1387 -0.0775 45  LYS A O   
276  C CB  . LYS A 45  ? 2.0786 1.7975 1.7182 0.2126  -0.1111 -0.0896 45  LYS A CB  
277  C CG  . LYS A 45  ? 2.0954 1.8469 1.7497 0.2218  -0.1115 -0.1062 45  LYS A CG  
278  C CD  . LYS A 45  ? 1.9903 1.7870 1.6846 0.2071  -0.0952 -0.1060 45  LYS A CD  
279  C CE  . LYS A 45  ? 1.9923 1.7797 1.6956 0.1901  -0.0815 -0.0914 45  LYS A CE  
280  N NZ  . LYS A 45  ? 1.9755 1.7961 1.7122 0.1834  -0.0736 -0.0979 45  LYS A NZ  
281  N N   . ILE A 46  ? 2.1909 1.8861 1.8299 0.1948  -0.1085 -0.0695 46  ILE A N   
282  C CA  . ILE A 46  ? 1.9996 1.6629 1.6280 0.1836  -0.1084 -0.0544 46  ILE A CA  
283  C C   . ILE A 46  ? 1.9183 1.5668 1.5458 0.1637  -0.0933 -0.0335 46  ILE A C   
284  O O   . ILE A 46  ? 1.9618 1.6375 1.6102 0.1537  -0.0776 -0.0300 46  ILE A O   
285  C CB  . ILE A 46  ? 2.0133 1.7053 1.6617 0.1794  -0.1031 -0.0567 46  ILE A CB  
286  C CG1 . ILE A 46  ? 2.0748 1.7932 1.7264 0.2005  -0.1172 -0.0799 46  ILE A CG1 
287  C CG2 . ILE A 46  ? 2.1104 1.7691 1.7484 0.1697  -0.1058 -0.0444 46  ILE A CG2 
288  C CD1 . ILE A 46  ? 1.9791 1.7414 1.6525 0.1986  -0.1105 -0.0842 46  ILE A CD1 
289  N N   . PRO A 47  ? 1.8531 1.4596 1.4575 0.1578  -0.0990 -0.0198 47  PRO A N   
290  C CA  . PRO A 47  ? 1.8795 1.4769 1.4812 0.1399  -0.0852 -0.0009 47  PRO A CA  
291  C C   . PRO A 47  ? 1.8679 1.4655 1.4807 0.1231  -0.0755 0.0110  47  PRO A C   
292  O O   . PRO A 47  ? 2.1058 1.6776 1.7081 0.1217  -0.0857 0.0147  47  PRO A O   
293  C CB  . PRO A 47  ? 1.9579 1.5119 1.5266 0.1427  -0.0986 0.0088  47  PRO A CB  
294  C CG  . PRO A 47  ? 1.9653 1.4940 1.5243 0.1533  -0.1184 0.0015  47  PRO A CG  
295  C CD  . PRO A 47  ? 1.9003 1.4654 1.4791 0.1684  -0.1206 -0.0214 47  PRO A CD  
296  N N   . VAL A 48  ? 1.7160 1.3408 1.3507 0.1108  -0.0577 0.0164  48  VAL A N   
297  C CA  . VAL A 48  ? 1.6667 1.2930 1.3114 0.0959  -0.0488 0.0273  48  VAL A CA  
298  C C   . VAL A 48  ? 1.6753 1.2908 1.3130 0.0809  -0.0390 0.0433  48  VAL A C   
299  O O   . VAL A 48  ? 1.6269 1.2519 1.2648 0.0807  -0.0324 0.0439  48  VAL A O   
300  C CB  . VAL A 48  ? 1.6732 1.3386 1.3483 0.0923  -0.0367 0.0235  48  VAL A CB  
301  C CG1 . VAL A 48  ? 1.7677 1.4360 1.4528 0.0768  -0.0261 0.0359  48  VAL A CG1 
302  C CG2 . VAL A 48  ? 1.7295 1.4128 1.4113 0.1057  -0.0456 0.0091  48  VAL A CG2 
303  N N   . VAL A 49  ? 1.6315 1.2303 1.2639 0.0691  -0.0388 0.0547  49  VAL A N   
304  C CA  . VAL A 49  ? 1.7312 1.3293 1.3620 0.0526  -0.0273 0.0698  49  VAL A CA  
305  C C   . VAL A 49  ? 1.7525 1.3756 1.4087 0.0438  -0.0150 0.0706  49  VAL A C   
306  O O   . VAL A 49  ? 1.8641 1.4865 1.5271 0.0437  -0.0189 0.0681  49  VAL A O   
307  C CB  . VAL A 49  ? 1.8717 1.4360 1.4822 0.0427  -0.0357 0.0835  49  VAL A CB  
308  C CG1 . VAL A 49  ? 1.9546 1.5284 1.5707 0.0236  -0.0220 0.0978  49  VAL A CG1 
309  C CG2 . VAL A 49  ? 1.9919 1.5286 1.5742 0.0483  -0.0474 0.0890  49  VAL A CG2 
310  N N   . VAL A 50  ? 1.6346 1.2800 1.3046 0.0377  -0.0014 0.0733  50  VAL A N   
311  C CA  . VAL A 50  ? 1.5513 1.2190 1.2455 0.0302  0.0089  0.0749  50  VAL A CA  
312  C C   . VAL A 50  ? 1.6710 1.3417 1.3646 0.0164  0.0185  0.0857  50  VAL A C   
313  O O   . VAL A 50  ? 1.7933 1.4788 1.4928 0.0157  0.0258  0.0850  50  VAL A O   
314  C CB  . VAL A 50  ? 1.3606 1.0552 1.0789 0.0355  0.0152  0.0673  50  VAL A CB  
315  C CG1 . VAL A 50  ? 1.2686 0.9824 1.0095 0.0265  0.0256  0.0724  50  VAL A CG1 
316  C CG2 . VAL A 50  ? 1.2883 0.9906 1.0127 0.0470  0.0079  0.0571  50  VAL A CG2 
317  N N   . GLU A 51  ? 1.7312 1.3908 1.4193 0.0061  0.0176  0.0940  51  GLU A N   
318  C CA  . GLU A 51  ? 1.7546 1.4237 1.4444 -0.0077 0.0275  0.1036  51  GLU A CA  
319  C C   . GLU A 51  ? 1.6946 1.3868 1.4093 -0.0113 0.0361  0.1019  51  GLU A C   
320  O O   . GLU A 51  ? 1.6833 1.3758 1.4066 -0.0086 0.0325  0.0988  51  GLU A O   
321  C CB  . GLU A 51  ? 1.8452 1.4918 1.5166 -0.0204 0.0225  0.1160  51  GLU A CB  
322  C CG  . GLU A 51  ? 2.0360 1.6470 1.6863 -0.0163 0.0064  0.1178  51  GLU A CG  
323  C CD  . GLU A 51  ? 2.2372 1.8272 1.8675 -0.0314 0.0028  0.1349  51  GLU A CD  
324  O OE1 . GLU A 51  ? 2.2314 1.8359 1.8537 -0.0373 0.0116  0.1432  51  GLU A OE1 
325  O OE2 . GLU A 51  ? 2.3050 1.8663 1.9286 -0.0377 -0.0093 0.1403  51  GLU A OE2 
326  N N   . ARG A 52  ? 1.5855 1.2987 1.3111 -0.0161 0.0463  0.1033  52  ARG A N   
327  C CA  . ARG A 52  ? 1.5248 1.2572 1.2711 -0.0208 0.0534  0.1038  52  ARG A CA  
328  C C   . ARG A 52  ? 1.6147 1.3376 1.3546 -0.0310 0.0512  0.1102  52  ARG A C   
329  O O   . ARG A 52  ? 1.7297 1.4340 1.4508 -0.0384 0.0466  0.1168  52  ARG A O   
330  C CB  . ARG A 52  ? 1.5501 1.3042 1.3048 -0.0245 0.0623  0.1034  52  ARG A CB  
331  C CG  . ARG A 52  ? 1.6057 1.3794 1.3836 -0.0260 0.0678  0.1022  52  ARG A CG  
332  C CD  . ARG A 52  ? 1.6779 1.4713 1.4744 -0.0196 0.0716  0.0949  52  ARG A CD  
333  N NE  . ARG A 52  ? 1.8464 1.6560 1.6373 -0.0225 0.0764  0.0926  52  ARG A NE  
334  C CZ  . ARG A 52  ? 2.0879 1.9085 1.8714 -0.0333 0.0816  0.0981  52  ARG A CZ  
335  N NH1 . ARG A 52  ? 2.1607 1.9736 1.9420 -0.0426 0.0817  0.1057  52  ARG A NH1 
336  N NH2 . ARG A 52  ? 2.1296 1.9724 1.9085 -0.0347 0.0864  0.0953  52  ARG A NH2 
337  N N   . TYR A 53  ? 1.6523 1.3876 1.4083 -0.0319 0.0535  0.1090  53  TYR A N   
338  C CA  . TYR A 53  ? 1.6877 1.4182 1.4411 -0.0422 0.0517  0.1133  53  TYR A CA  
339  C C   . TYR A 53  ? 1.6797 1.4195 1.4294 -0.0547 0.0592  0.1199  53  TYR A C   
340  O O   . TYR A 53  ? 1.5681 1.3300 1.3276 -0.0526 0.0675  0.1176  53  TYR A O   
341  C CB  . TYR A 53  ? 1.7762 1.5252 1.5484 -0.0395 0.0541  0.1101  53  TYR A CB  
342  C CG  . TYR A 53  ? 1.8429 1.5912 1.6165 -0.0484 0.0515  0.1114  53  TYR A CG  
343  C CD1 . TYR A 53  ? 1.8602 1.5837 1.6214 -0.0519 0.0402  0.1111  53  TYR A CD1 
344  C CD2 . TYR A 53  ? 1.8033 1.5757 1.5928 -0.0518 0.0586  0.1115  53  TYR A CD2 
345  C CE1 . TYR A 53  ? 1.9504 1.6737 1.7167 -0.0600 0.0364  0.1104  53  TYR A CE1 
346  C CE2 . TYR A 53  ? 1.7838 1.5589 1.5771 -0.0591 0.0560  0.1108  53  TYR A CE2 
347  C CZ  . TYR A 53  ? 1.9299 1.6808 1.7123 -0.0637 0.0450  0.1100  53  TYR A CZ  
348  O OH  . TYR A 53  ? 2.0471 1.8018 1.8366 -0.0710 0.0413  0.1076  53  TYR A OH  
349  N N   . PRO A 54  ? 1.7217 1.4453 1.4575 -0.0674 0.0550  0.1280  54  PRO A N   
350  C CA  . PRO A 54  ? 1.7540 1.4903 1.4850 -0.0826 0.0620  0.1370  54  PRO A CA  
351  C C   . PRO A 54  ? 1.8025 1.5721 1.5539 -0.0845 0.0719  0.1325  54  PRO A C   
352  O O   . PRO A 54  ? 1.8232 1.6181 1.5792 -0.0832 0.0804  0.1305  54  PRO A O   
353  C CB  . PRO A 54  ? 1.7430 1.4538 1.4640 -0.0969 0.0528  0.1462  54  PRO A CB  
354  C CG  . PRO A 54  ? 1.8039 1.4889 1.5250 -0.0858 0.0398  0.1383  54  PRO A CG  
355  C CD  . PRO A 54  ? 1.7435 1.4346 1.4669 -0.0674 0.0413  0.1291  54  PRO A CD  
356  N N   . ARG A 55  ? 1.8085 1.5790 1.5725 -0.0845 0.0692  0.1289  55  ARG A N   
357  C CA  . ARG A 55  ? 1.8294 1.6291 1.6119 -0.0868 0.0765  0.1252  55  ARG A CA  
358  C C   . ARG A 55  ? 1.6975 1.5185 1.4966 -0.0727 0.0818  0.1175  55  ARG A C   
359  O O   . ARG A 55  ? 1.5916 1.4380 1.4050 -0.0732 0.0875  0.1143  55  ARG A O   
360  C CB  . ARG A 55  ? 1.9479 1.7412 1.7369 -0.0903 0.0701  0.1234  55  ARG A CB  
361  C CG  . ARG A 55  ? 2.1771 1.9756 1.9668 -0.1089 0.0708  0.1288  55  ARG A CG  
362  C CD  . ARG A 55  ? 2.3072 2.1382 2.1163 -0.1090 0.0773  0.1228  55  ARG A CD  
363  N NE  . ARG A 55  ? 2.4470 2.2786 2.2613 -0.1237 0.0733  0.1239  55  ARG A NE  
364  C CZ  . ARG A 55  ? 2.5210 2.3267 2.3328 -0.1263 0.0611  0.1226  55  ARG A CZ  
365  N NH1 . ARG A 55  ? 2.4074 2.1865 2.2099 -0.1143 0.0519  0.1198  55  ARG A NH1 
366  N NH2 . ARG A 55  ? 2.7477 2.5553 2.5678 -0.1405 0.0567  0.1225  55  ARG A NH2 
367  N N   . GLU A 56  ? 1.5920 1.4020 1.3902 -0.0605 0.0787  0.1147  56  GLU A N   
368  C CA  . GLU A 56  ? 1.5039 1.3276 1.3199 -0.0484 0.0808  0.1096  56  GLU A CA  
369  C C   . GLU A 56  ? 1.4554 1.3025 1.2816 -0.0479 0.0871  0.1055  56  GLU A C   
370  O O   . GLU A 56  ? 1.5736 1.4278 1.3898 -0.0547 0.0906  0.1060  56  GLU A O   
371  C CB  . GLU A 56  ? 1.6169 1.4259 1.4289 -0.0389 0.0766  0.1078  56  GLU A CB  
372  C CG  . GLU A 56  ? 1.6543 1.4749 1.4854 -0.0290 0.0778  0.1034  56  GLU A CG  
373  C CD  . GLU A 56  ? 1.6941 1.5243 1.5439 -0.0247 0.0770  0.1060  56  GLU A CD  
374  O OE1 . GLU A 56  ? 1.5425 1.3841 1.4115 -0.0197 0.0775  0.1045  56  GLU A OE1 
375  O OE2 . GLU A 56  ? 1.6864 1.5135 1.5318 -0.0256 0.0746  0.1093  56  GLU A OE2 
376  N N   . THR A 57  ? 1.4926 1.3530 1.3388 -0.0392 0.0874  0.1014  57  THR A N   
377  C CA  . THR A 57  ? 1.4515 1.3344 1.3102 -0.0352 0.0905  0.0939  57  THR A CA  
378  C C   . THR A 57  ? 1.5512 1.4346 1.4295 -0.0220 0.0861  0.0882  57  THR A C   
379  O O   . THR A 57  ? 1.6696 1.5644 1.5538 -0.0162 0.0856  0.0788  57  THR A O   
380  C CB  . THR A 57  ? 1.4501 1.3551 1.3179 -0.0396 0.0940  0.0928  57  THR A CB  
381  O OG1 . THR A 57  ? 1.4344 1.3441 1.3222 -0.0301 0.0906  0.0918  57  THR A OG1 
382  C CG2 . THR A 57  ? 1.2539 1.1536 1.1088 -0.0533 0.0954  0.0997  57  THR A CG2 
383  N N   . PHE A 58  ? 1.6454 1.5189 1.5352 -0.0174 0.0819  0.0935  58  PHE A N   
384  C CA  . PHE A 58  ? 1.7551 1.6260 1.6660 -0.0075 0.0761  0.0906  58  PHE A CA  
385  C C   . PHE A 58  ? 1.6968 1.5528 1.6037 -0.0045 0.0728  0.0880  58  PHE A C   
386  O O   . PHE A 58  ? 1.7942 1.6477 1.7180 0.0027  0.0671  0.0822  58  PHE A O   
387  C CB  . PHE A 58  ? 2.0273 1.8979 1.9547 -0.0050 0.0727  0.1005  58  PHE A CB  
388  C CG  . PHE A 58  ? 2.0484 1.9126 2.0001 0.0024  0.0648  0.1015  58  PHE A CG  
389  C CD1 . PHE A 58  ? 2.1807 2.0505 2.1514 0.0099  0.0592  0.0928  58  PHE A CD1 
390  C CD2 . PHE A 58  ? 1.9296 1.7832 1.8871 0.0017  0.0616  0.1109  58  PHE A CD2 
391  C CE1 . PHE A 58  ? 2.2252 2.0842 2.2207 0.0160  0.0491  0.0941  58  PHE A CE1 
392  C CE2 . PHE A 58  ? 1.9947 1.8411 1.9769 0.0055  0.0534  0.1142  58  PHE A CE2 
393  C CZ  . PHE A 58  ? 2.2242 2.0704 2.2260 0.0124  0.0463  0.1061  58  PHE A CZ  
394  N N   . LEU A 59  ? 1.5609 1.4062 1.4464 -0.0094 0.0748  0.0910  59  LEU A N   
395  C CA  . LEU A 59  ? 1.4922 1.3247 1.3745 -0.0053 0.0710  0.0882  59  LEU A CA  
396  C C   . LEU A 59  ? 1.5231 1.3576 1.3915 -0.0038 0.0720  0.0793  59  LEU A C   
397  O O   . LEU A 59  ? 1.6198 1.4593 1.4693 -0.0104 0.0768  0.0810  59  LEU A O   
398  C CB  . LEU A 59  ? 1.5373 1.3571 1.4065 -0.0080 0.0699  0.0955  59  LEU A CB  
399  C CG  . LEU A 59  ? 1.4771 1.2983 1.3608 -0.0060 0.0672  0.1028  59  LEU A CG  
400  C CD1 . LEU A 59  ? 1.4919 1.3119 1.3614 -0.0087 0.0675  0.1081  59  LEU A CD1 
401  C CD2 . LEU A 59  ? 1.4591 1.2741 1.3503 -0.0014 0.0626  0.0996  59  LEU A CD2 
402  N N   . PRO A 60  ? 1.4482 1.2806 1.3263 0.0043  0.0669  0.0705  60  PRO A N   
403  C CA  . PRO A 60  ? 1.4631 1.2974 1.3282 0.0092  0.0658  0.0610  60  PRO A CA  
404  C C   . PRO A 60  ? 1.4335 1.2524 1.2724 0.0054  0.0663  0.0672  60  PRO A C   
405  O O   . PRO A 60  ? 1.5720 1.3776 1.4094 0.0028  0.0648  0.0746  60  PRO A O   
406  C CB  . PRO A 60  ? 1.4625 1.2932 1.3510 0.0188  0.0575  0.0512  60  PRO A CB  
407  C CG  . PRO A 60  ? 1.5278 1.3514 1.4384 0.0162  0.0549  0.0602  60  PRO A CG  
408  C CD  . PRO A 60  ? 1.3620 1.1928 1.2695 0.0099  0.0606  0.0689  60  PRO A CD  
409  N N   . PRO A 61  ? 1.5577 1.3797 1.3757 0.0062  0.0674  0.0642  61  PRO A N   
410  C CA  . PRO A 61  ? 1.6830 1.4856 1.4765 0.0044  0.0650  0.0704  61  PRO A CA  
411  C C   . PRO A 61  ? 1.6296 1.4284 1.4255 0.0156  0.0587  0.0600  61  PRO A C   
412  O O   . PRO A 61  ? 1.6684 1.4779 1.4873 0.0232  0.0559  0.0488  61  PRO A O   
413  C CB  . PRO A 61  ? 1.6695 1.4780 1.4375 -0.0033 0.0696  0.0771  61  PRO A CB  
414  C CG  . PRO A 61  ? 1.6685 1.5073 1.4489 -0.0030 0.0750  0.0705  61  PRO A CG  
415  C CD  . PRO A 61  ? 1.5841 1.4291 1.3956 0.0074  0.0711  0.0579  61  PRO A CD  
416  N N   . LEU A 62  ? 1.4728 1.2558 1.2471 0.0173  0.0549  0.0627  62  LEU A N   
417  C CA  . LEU A 62  ? 1.5491 1.3287 1.3281 0.0282  0.0482  0.0523  62  LEU A CA  
418  C C   . LEU A 62  ? 1.7220 1.5065 1.4813 0.0354  0.0460  0.0461  62  LEU A C   
419  O O   . LEU A 62  ? 1.7239 1.5024 1.4546 0.0312  0.0472  0.0553  62  LEU A O   
420  C CB  . LEU A 62  ? 1.5888 1.3502 1.3614 0.0290  0.0432  0.0562  62  LEU A CB  
421  C CG  . LEU A 62  ? 1.6114 1.3743 1.4069 0.0264  0.0432  0.0589  62  LEU A CG  
422  C CD1 . LEU A 62  ? 1.7205 1.4693 1.4986 0.0228  0.0415  0.0673  62  LEU A CD1 
423  C CD2 . LEU A 62  ? 1.7517 1.5198 1.5668 0.0339  0.0379  0.0496  62  LEU A CD2 
424  N N   . ASP A 63  ? 1.8872 1.6825 1.6630 0.0462  0.0414  0.0308  63  ASP A N   
425  C CA  . ASP A 63  ? 2.0735 1.8764 1.8332 0.0565  0.0376  0.0215  63  ASP A CA  
426  C C   . ASP A 63  ? 2.0590 1.8426 1.7841 0.0550  0.0354  0.0329  63  ASP A C   
427  O O   . ASP A 63  ? 2.2249 2.0132 1.9232 0.0538  0.0373  0.0396  63  ASP A O   
428  C CB  . ASP A 63  ? 2.2581 2.0650 2.0429 0.0678  0.0296  0.0039  63  ASP A CB  
429  C CG  . ASP A 63  ? 2.3960 2.2011 2.2177 0.0633  0.0288  0.0028  63  ASP A CG  
430  O OD1 . ASP A 63  ? 2.3137 2.1057 2.1394 0.0573  0.0288  0.0121  63  ASP A OD1 
431  O OD2 . ASP A 63  ? 2.6325 2.4505 2.4791 0.0660  0.0273  -0.0067 63  ASP A OD2 
432  N N   . LYS A 64  ? 1.8302 1.5933 1.5557 0.0547  0.0307  0.0359  64  LYS A N   
433  C CA  . LYS A 64  ? 1.8162 1.5580 1.5109 0.0561  0.0251  0.0439  64  LYS A CA  
434  C C   . LYS A 64  ? 1.7055 1.4259 1.3951 0.0480  0.0237  0.0552  64  LYS A C   
435  O O   . LYS A 64  ? 1.6674 1.3921 1.3774 0.0417  0.0279  0.0569  64  LYS A O   
436  C CB  . LYS A 64  ? 1.9140 1.6535 1.6069 0.0705  0.0160  0.0307  64  LYS A CB  
437  C CG  . LYS A 64  ? 1.8346 1.5970 1.5463 0.0809  0.0148  0.0129  64  LYS A CG  
438  C CD  . LYS A 64  ? 1.9152 1.6905 1.6039 0.0881  0.0144  0.0101  64  LYS A CD  
439  C CE  . LYS A 64  ? 1.9474 1.7464 1.6583 0.1009  0.0106  -0.0119 64  LYS A CE  
440  N NZ  . LYS A 64  ? 2.1579 1.9640 1.9096 0.0964  0.0124  -0.0196 64  LYS A NZ  
441  N N   . THR A 65  ? 1.7690 1.4663 1.4317 0.0500  0.0159  0.0616  65  THR A N   
442  C CA  . THR A 65  ? 1.7875 1.4623 1.4409 0.0425  0.0123  0.0721  65  THR A CA  
443  C C   . THR A 65  ? 1.7941 1.4487 1.4364 0.0533  -0.0006 0.0667  65  THR A C   
444  O O   . THR A 65  ? 1.9438 1.5885 1.5906 0.0527  -0.0051 0.0664  65  THR A O   
445  C CB  . THR A 65  ? 1.7539 1.4162 1.3830 0.0307  0.0134  0.0891  65  THR A CB  
446  O OG1 . THR A 65  ? 1.7507 1.4392 1.3899 0.0226  0.0255  0.0916  65  THR A OG1 
447  C CG2 . THR A 65  ? 1.8348 1.4738 1.4597 0.0211  0.0087  0.0988  65  THR A CG2 
448  N N   . LYS A 66  ? 1.6482 1.2992 1.2758 0.0648  -0.0074 0.0607  66  LYS A N   
449  C CA  . LYS A 66  ? 1.7511 1.3832 1.3660 0.0771  -0.0213 0.0542  66  LYS A CA  
450  C C   . LYS A 66  ? 1.7469 1.4014 1.3834 0.0891  -0.0219 0.0359  66  LYS A C   
451  O O   . LYS A 66  ? 1.9783 1.6448 1.6148 0.0971  -0.0222 0.0275  66  LYS A O   
452  C CB  . LYS A 66  ? 1.8588 1.4675 1.4392 0.0817  -0.0310 0.0623  66  LYS A CB  
453  C CG  . LYS A 66  ? 2.2153 1.8416 1.7879 0.0786  -0.0224 0.0676  66  LYS A CG  
454  C CD  . LYS A 66  ? 2.4270 2.0363 1.9647 0.0839  -0.0315 0.0772  66  LYS A CD  
455  C CE  . LYS A 66  ? 2.5235 2.1626 2.0582 0.0908  -0.0253 0.0713  66  LYS A CE  
456  N NZ  . LYS A 66  ? 2.5508 2.1769 2.0532 0.1024  -0.0368 0.0754  66  LYS A NZ  
457  N N   . PHE A 67  ? 1.6173 1.2812 1.2739 0.0897  -0.0220 0.0298  67  PHE A N   
458  C CA  . PHE A 67  ? 1.5893 1.2763 1.2671 0.0992  -0.0236 0.0145  67  PHE A CA  
459  C C   . PHE A 67  ? 1.6529 1.3306 1.3171 0.1134  -0.0376 0.0048  67  PHE A C   
460  O O   . PHE A 67  ? 1.7542 1.4116 1.4032 0.1145  -0.0453 0.0087  67  PHE A O   
461  C CB  . PHE A 67  ? 1.5488 1.2587 1.2578 0.0910  -0.0152 0.0152  67  PHE A CB  
462  C CG  . PHE A 67  ? 1.5725 1.2874 1.2937 0.0777  -0.0037 0.0252  67  PHE A CG  
463  C CD1 . PHE A 67  ? 1.6263 1.3234 1.3296 0.0692  -0.0010 0.0376  67  PHE A CD1 
464  C CD2 . PHE A 67  ? 1.5108 1.2478 1.2619 0.0738  0.0029  0.0219  67  PHE A CD2 
465  C CE1 . PHE A 67  ? 1.6919 1.3972 1.4060 0.0581  0.0093  0.0452  67  PHE A CE1 
466  C CE2 . PHE A 67  ? 1.5634 1.3044 1.3256 0.0638  0.0117  0.0293  67  PHE A CE2 
467  C CZ  . PHE A 67  ? 1.6539 1.3812 1.3972 0.0566  0.0154  0.0401  67  PHE A CZ  
468  N N   . LEU A 68  ? 1.5825 1.2758 1.2537 0.1251  -0.0422 -0.0096 68  LEU A N   
469  C CA  . LEU A 68  ? 1.6126 1.3081 1.2784 0.1401  -0.0548 -0.0229 68  LEU A CA  
470  C C   . LEU A 68  ? 1.6712 1.4006 1.3683 0.1363  -0.0489 -0.0280 68  LEU A C   
471  O O   . LEU A 68  ? 1.9938 1.7422 1.7162 0.1243  -0.0370 -0.0229 68  LEU A O   
472  C CB  . LEU A 68  ? 1.7121 1.4137 1.3724 0.1542  -0.0622 -0.0366 68  LEU A CB  
473  C CG  . LEU A 68  ? 1.8649 1.5324 1.4880 0.1612  -0.0716 -0.0305 68  LEU A CG  
474  C CD1 . LEU A 68  ? 1.9771 1.6532 1.5944 0.1716  -0.0743 -0.0399 68  LEU A CD1 
475  C CD2 . LEU A 68  ? 1.8408 1.4826 1.4413 0.1729  -0.0883 -0.0331 68  LEU A CD2 
476  N N   . VAL A 69  ? 1.6418 1.3802 1.3375 0.1464  -0.0577 -0.0375 69  VAL A N   
477  C CA  . VAL A 69  ? 1.6207 1.3990 1.3449 0.1431  -0.0519 -0.0412 69  VAL A CA  
478  C C   . VAL A 69  ? 1.6977 1.4982 1.4210 0.1599  -0.0636 -0.0588 69  VAL A C   
479  O O   . VAL A 69  ? 1.6151 1.3936 1.3145 0.1731  -0.0776 -0.0657 69  VAL A O   
480  C CB  . VAL A 69  ? 1.6719 1.4526 1.4038 0.1303  -0.0435 -0.0277 69  VAL A CB  
481  C CG1 . VAL A 69  ? 1.6847 1.4900 1.4475 0.1141  -0.0283 -0.0171 69  VAL A CG1 
482  C CG2 . VAL A 69  ? 1.6889 1.4279 1.3963 0.1255  -0.0456 -0.0166 69  VAL A CG2 
483  N N   . PRO A 70  ? 1.6533 1.4989 1.4045 0.1591  -0.0588 -0.0662 70  PRO A N   
484  C CA  . PRO A 70  ? 1.7411 1.6272 1.5018 0.1712  -0.0653 -0.0820 70  PRO A CA  
485  C C   . PRO A 70  ? 1.9109 1.8017 1.6596 0.1814  -0.0735 -0.0876 70  PRO A C   
486  O O   . PRO A 70  ? 1.7777 1.6613 1.5262 0.1721  -0.0678 -0.0754 70  PRO A O   
487  C CB  . PRO A 70  ? 1.6324 1.5649 1.4314 0.1551  -0.0511 -0.0741 70  PRO A CB  
488  C CG  . PRO A 70  ? 1.4754 1.3874 1.2849 0.1406  -0.0423 -0.0625 70  PRO A CG  
489  C CD  . PRO A 70  ? 1.5213 1.3814 1.2989 0.1451  -0.0472 -0.0596 70  PRO A CD  
490  N N   . GLN A 71  ? 2.1217 2.0287 1.8624 0.2019  -0.0877 -0.1084 71  GLN A N   
491  C CA  . GLN A 71  ? 2.1646 2.0733 1.8922 0.2167  -0.1003 -0.1196 71  GLN A CA  
492  C C   . GLN A 71  ? 2.2308 2.1872 1.9795 0.2085  -0.0898 -0.1142 71  GLN A C   
493  O O   . GLN A 71  ? 2.5214 2.4821 2.2614 0.2197  -0.0992 -0.1231 71  GLN A O   
494  C CB  . GLN A 71  ? 2.1500 2.0709 1.8668 0.2429  -0.1194 -0.1463 71  GLN A CB  
495  C CG  . GLN A 71  ? 2.3417 2.2397 2.0363 0.2631  -0.1401 -0.1608 71  GLN A CG  
496  C CD  . GLN A 71  ? 2.5845 2.4525 2.2556 0.2867  -0.1626 -0.1793 71  GLN A CD  
497  O OE1 . GLN A 71  ? 2.8504 2.7564 2.5274 0.3038  -0.1704 -0.2007 71  GLN A OE1 
498  N NE2 . GLN A 71  ? 2.5975 2.3987 2.2420 0.2872  -0.1733 -0.1702 71  GLN A NE2 
499  N N   . GLU A 72  ? 2.0030 1.9924 1.7792 0.1889  -0.0715 -0.0988 72  GLU A N   
500  C CA  . GLU A 72  ? 2.0015 2.0478 1.8007 0.1808  -0.0608 -0.0919 72  GLU A CA  
501  C C   . GLU A 72  ? 1.8316 1.8849 1.6556 0.1548  -0.0421 -0.0670 72  GLU A C   
502  O O   . GLU A 72  ? 1.6218 1.7106 1.4716 0.1448  -0.0343 -0.0623 72  GLU A O   
503  C CB  . GLU A 72  ? 2.1356 2.2467 1.9481 0.1936  -0.0651 -0.1100 72  GLU A CB  
504  C CG  . GLU A 72  ? 2.2109 2.3220 2.0248 0.2015  -0.0716 -0.1240 72  GLU A CG  
505  C CD  . GLU A 72  ? 2.1005 2.1782 1.9233 0.1836  -0.0623 -0.1088 72  GLU A CD  
506  O OE1 . GLU A 72  ? 1.9730 1.9920 1.7754 0.1827  -0.0652 -0.1031 72  GLU A OE1 
507  O OE2 . GLU A 72  ? 2.1584 2.2713 2.0102 0.1700  -0.0526 -0.1023 72  GLU A OE2 
508  N N   . LEU A 73  ? 1.8754 1.8934 1.6925 0.1440  -0.0364 -0.0513 73  LEU A N   
509  C CA  . LEU A 73  ? 1.8124 1.8280 1.6500 0.1218  -0.0214 -0.0289 73  LEU A CA  
510  C C   . LEU A 73  ? 1.7705 1.7930 1.6088 0.1149  -0.0150 -0.0156 73  LEU A C   
511  O O   . LEU A 73  ? 1.8696 1.8602 1.6862 0.1213  -0.0211 -0.0190 73  LEU A O   
512  C CB  . LEU A 73  ? 1.7545 1.7156 1.5813 0.1168  -0.0215 -0.0249 73  LEU A CB  
513  C CG  . LEU A 73  ? 1.7204 1.6842 1.5737 0.0990  -0.0107 -0.0110 73  LEU A CG  
514  C CD1 . LEU A 73  ? 1.7213 1.7267 1.5990 0.0985  -0.0110 -0.0177 73  LEU A CD1 
515  C CD2 . LEU A 73  ? 1.5108 1.4270 1.3513 0.0974  -0.0118 -0.0105 73  LEU A CD2 
516  N N   . THR A 74  ? 1.6182 1.6830 1.4815 0.1018  -0.0038 -0.0001 74  THR A N   
517  C CA  . THR A 74  ? 1.6054 1.6766 1.4706 0.0943  0.0031  0.0145  74  THR A CA  
518  C C   . THR A 74  ? 1.6014 1.6166 1.4575 0.0854  0.0059  0.0241  74  THR A C   
519  O O   . THR A 74  ? 1.5180 1.5089 1.3821 0.0764  0.0092  0.0296  74  THR A O   
520  C CB  . THR A 74  ? 1.7464 1.8647 1.6415 0.0779  0.0153  0.0358  74  THR A CB  
521  O OG1 . THR A 74  ? 1.7855 1.8733 1.6941 0.0605  0.0230  0.0545  74  THR A OG1 
522  C CG2 . THR A 74  ? 1.5782 1.7456 1.4934 0.0768  0.0159  0.0326  74  THR A CG2 
523  N N   . MET A 75  ? 1.5049 1.5030 1.3452 0.0887  0.0038  0.0242  75  MET A N   
524  C CA  . MET A 75  ? 1.5023 1.4624 1.3392 0.0775  0.0092  0.0366  75  MET A CA  
525  C C   . MET A 75  ? 1.5651 1.5372 1.4278 0.0606  0.0211  0.0562  75  MET A C   
526  O O   . MET A 75  ? 1.5886 1.5287 1.4534 0.0524  0.0243  0.0623  75  MET A O   
527  C CB  . MET A 75  ? 1.4245 1.3838 1.2507 0.0805  0.0075  0.0369  75  MET A CB  
528  C CG  . MET A 75  ? 1.4286 1.3594 1.2296 0.0947  -0.0066 0.0192  75  MET A CG  
529  S SD  . MET A 75  ? 1.6889 1.5555 1.4725 0.0861  -0.0077 0.0247  75  MET A SD  
530  C CE  . MET A 75  ? 1.6570 1.5264 1.4555 0.0684  0.0068  0.0447  75  MET A CE  
531  N N   . THR A 76  ? 1.4591 1.4783 1.3419 0.0559  0.0266  0.0664  76  THR A N   
532  C CA  . THR A 76  ? 1.5794 1.6059 1.4885 0.0392  0.0353  0.0870  76  THR A CA  
533  C C   . THR A 76  ? 1.5306 1.5330 1.4508 0.0339  0.0340  0.0845  76  THR A C   
534  O O   . THR A 76  ? 1.5848 1.5574 1.5110 0.0262  0.0363  0.0912  76  THR A O   
535  C CB  . THR A 76  ? 1.7082 1.7908 1.6391 0.0326  0.0407  0.1017  76  THR A CB  
536  O OG1 . THR A 76  ? 2.0107 2.1162 1.9319 0.0374  0.0426  0.1055  76  THR A OG1 
537  C CG2 . THR A 76  ? 1.5835 1.6639 1.5436 0.0142  0.0465  0.1241  76  THR A CG2 
538  N N   . GLN A 77  ? 1.4839 1.5007 1.4068 0.0397  0.0293  0.0725  77  GLN A N   
539  C CA  . GLN A 77  ? 1.5047 1.5002 1.4381 0.0366  0.0266  0.0669  77  GLN A CA  
540  C C   . GLN A 77  ? 1.4351 1.3812 1.3461 0.0416  0.0239  0.0591  77  GLN A C   
541  O O   . GLN A 77  ? 1.3114 1.2355 1.2333 0.0337  0.0262  0.0648  77  GLN A O   
542  C CB  . GLN A 77  ? 1.5665 1.5835 1.5008 0.0455  0.0205  0.0509  77  GLN A CB  
543  C CG  . GLN A 77  ? 1.6360 1.7101 1.5941 0.0395  0.0236  0.0581  77  GLN A CG  
544  C CD  . GLN A 77  ? 1.6764 1.7798 1.6252 0.0544  0.0168  0.0379  77  GLN A CD  
545  O OE1 . GLN A 77  ? 1.8018 1.9435 1.7728 0.0495  0.0172  0.0377  77  GLN A OE1 
546  N NE2 . GLN A 77  ? 1.6051 1.6906 1.5222 0.0726  0.0093  0.0207  77  GLN A NE2 
547  N N   . PHE A 78  ? 1.2952 1.2257 1.1760 0.0543  0.0184  0.0470  78  PHE A N   
548  C CA  . PHE A 78  ? 1.3016 1.1887 1.1604 0.0572  0.0159  0.0425  78  PHE A CA  
549  C C   . PHE A 78  ? 1.3329 1.2053 1.1990 0.0458  0.0232  0.0560  78  PHE A C   
550  O O   . PHE A 78  ? 1.3388 1.1895 1.2064 0.0426  0.0242  0.0554  78  PHE A O   
551  C CB  . PHE A 78  ? 1.2843 1.1531 1.1126 0.0681  0.0087  0.0340  78  PHE A CB  
552  C CG  . PHE A 78  ? 1.3314 1.1580 1.1372 0.0695  0.0054  0.0314  78  PHE A CG  
553  C CD1 . PHE A 78  ? 1.3228 1.1373 1.1281 0.0714  0.0037  0.0258  78  PHE A CD1 
554  C CD2 . PHE A 78  ? 1.4088 1.2107 1.1947 0.0685  0.0037  0.0349  78  PHE A CD2 
555  C CE1 . PHE A 78  ? 1.3803 1.1622 1.1633 0.0728  0.0013  0.0252  78  PHE A CE1 
556  C CE2 . PHE A 78  ? 1.4047 1.1716 1.1695 0.0679  0.0009  0.0355  78  PHE A CE2 
557  C CZ  . PHE A 78  ? 1.3346 1.0932 1.0971 0.0700  0.0003  0.0316  78  PHE A CZ  
558  N N   . LEU A 79  ? 1.2951 1.1821 1.1650 0.0413  0.0277  0.0664  79  LEU A N   
559  C CA  . LEU A 79  ? 1.3193 1.1970 1.1982 0.0313  0.0343  0.0791  79  LEU A CA  
560  C C   . LEU A 79  ? 1.3576 1.2340 1.2626 0.0235  0.0362  0.0839  79  LEU A C   
561  O O   . LEU A 79  ? 1.4599 1.3132 1.3638 0.0216  0.0367  0.0822  79  LEU A O   
562  C CB  . LEU A 79  ? 1.2410 1.1437 1.1269 0.0276  0.0387  0.0909  79  LEU A CB  
563  C CG  . LEU A 79  ? 1.3092 1.2006 1.1945 0.0214  0.0436  0.1005  79  LEU A CG  
564  C CD1 . LEU A 79  ? 1.3241 1.2472 1.2158 0.0203  0.0468  0.1108  79  LEU A CD1 
565  C CD2 . LEU A 79  ? 1.3107 1.1884 1.2141 0.0129  0.0470  0.1081  79  LEU A CD2 
566  N N   . SER A 80  ? 1.3131 1.2151 1.2424 0.0192  0.0360  0.0888  80  SER A N   
567  C CA  . SER A 80  ? 1.4169 1.3141 1.3748 0.0111  0.0351  0.0932  80  SER A CA  
568  C C   . SER A 80  ? 1.5020 1.3723 1.4525 0.0171  0.0305  0.0774  80  SER A C   
569  O O   . SER A 80  ? 1.4554 1.3080 1.4136 0.0147  0.0303  0.0774  80  SER A O   
570  C CB  . SER A 80  ? 1.4896 1.4168 1.4749 0.0044  0.0338  0.0995  80  SER A CB  
571  O OG  . SER A 80  ? 1.6349 1.5502 1.6484 -0.0026 0.0298  0.1005  80  SER A OG  
572  N N   . ILE A 81  ? 1.4733 1.3433 1.4081 0.0265  0.0260  0.0632  81  ILE A N   
573  C CA  . ILE A 81  ? 1.4317 1.2806 1.3566 0.0338  0.0213  0.0484  81  ILE A CA  
574  C C   . ILE A 81  ? 1.4391 1.2637 1.3405 0.0360  0.0238  0.0481  81  ILE A C   
575  O O   . ILE A 81  ? 1.5642 1.3755 1.4602 0.0402  0.0215  0.0390  81  ILE A O   
576  C CB  . ILE A 81  ? 1.4231 1.2733 1.3294 0.0456  0.0153  0.0335  81  ILE A CB  
577  C CG1 . ILE A 81  ? 1.5272 1.4053 1.4362 0.0471  0.0146  0.0347  81  ILE A CG1 
578  C CG2 . ILE A 81  ? 1.4302 1.2789 1.3509 0.0490  0.0096  0.0206  81  ILE A CG2 
579  C CD1 . ILE A 81  ? 1.7071 1.5853 1.5952 0.0614  0.0069  0.0182  81  ILE A CD1 
580  N N   . ILE A 82  ? 1.3087 1.1306 1.1962 0.0331  0.0283  0.0574  82  ILE A N   
581  C CA  . ILE A 82  ? 1.2882 1.0927 1.1630 0.0312  0.0316  0.0595  82  ILE A CA  
582  C C   . ILE A 82  ? 1.3264 1.1355 1.2285 0.0239  0.0346  0.0661  82  ILE A C   
583  O O   . ILE A 82  ? 1.3988 1.2013 1.3084 0.0259  0.0325  0.0585  82  ILE A O   
584  C CB  . ILE A 82  ? 1.2384 1.0356 1.0894 0.0306  0.0338  0.0649  82  ILE A CB  
585  C CG1 . ILE A 82  ? 1.2479 1.0282 1.0692 0.0387  0.0279  0.0565  82  ILE A CG1 
586  C CG2 . ILE A 82  ? 1.2354 1.0245 1.0839 0.0244  0.0391  0.0710  82  ILE A CG2 
587  C CD1 . ILE A 82  ? 1.2694 1.0527 1.0784 0.0435  0.0235  0.0555  82  ILE A CD1 
588  N N   . ARG A 83  ? 1.3452 1.1666 1.2623 0.0170  0.0380  0.0791  83  ARG A N   
589  C CA  . ARG A 83  ? 1.4729 1.2954 1.4158 0.0109  0.0387  0.0866  83  ARG A CA  
590  C C   . ARG A 83  ? 1.5684 1.3857 1.5344 0.0124  0.0322  0.0773  83  ARG A C   
591  O O   . ARG A 83  ? 1.5518 1.3624 1.5326 0.0122  0.0299  0.0751  83  ARG A O   
592  C CB  . ARG A 83  ? 1.5922 1.4329 1.5544 0.0034  0.0406  0.1034  83  ARG A CB  
593  C CG  . ARG A 83  ? 1.7476 1.5857 1.7380 -0.0024 0.0388  0.1127  83  ARG A CG  
594  C CD  . ARG A 83  ? 1.7488 1.6046 1.7528 -0.0098 0.0413  0.1331  83  ARG A CD  
595  N NE  . ARG A 83  ? 1.8915 1.7596 1.8705 -0.0075 0.0476  0.1361  83  ARG A NE  
596  C CZ  . ARG A 83  ? 1.9770 1.8641 1.9593 -0.0110 0.0509  0.1513  83  ARG A CZ  
597  N NH1 . ARG A 83  ? 2.0607 1.9545 2.0697 -0.0182 0.0490  0.1678  83  ARG A NH1 
598  N NH2 . ARG A 83  ? 1.8701 1.7687 1.8298 -0.0068 0.0548  0.1497  83  ARG A NH2 
599  N N   . SER A 84  ? 1.6021 1.4241 1.5723 0.0152  0.0279  0.0697  84  SER A N   
600  C CA  . SER A 84  ? 1.6127 1.4306 1.6036 0.0182  0.0201  0.0571  84  SER A CA  
601  C C   . SER A 84  ? 1.6490 1.4547 1.6289 0.0272  0.0177  0.0411  84  SER A C   
602  O O   . SER A 84  ? 1.8475 1.6508 1.8517 0.0296  0.0101  0.0310  84  SER A O   
603  C CB  . SER A 84  ? 1.6928 1.5203 1.6832 0.0213  0.0166  0.0495  84  SER A CB  
604  O OG  . SER A 84  ? 2.0334 1.8521 2.0129 0.0318  0.0117  0.0306  84  SER A OG  
605  N N   . ARG A 85  ? 1.5994 1.3995 1.5443 0.0323  0.0226  0.0380  85  ARG A N   
606  C CA  . ARG A 85  ? 1.6624 1.4584 1.5942 0.0405  0.0213  0.0244  85  ARG A CA  
607  C C   . ARG A 85  ? 1.7468 1.5432 1.6759 0.0385  0.0259  0.0277  85  ARG A C   
608  O O   . ARG A 85  ? 1.9513 1.7512 1.8675 0.0447  0.0263  0.0177  85  ARG A O   
609  C CB  . ARG A 85  ? 1.6450 1.4365 1.5406 0.0468  0.0226  0.0199  85  ARG A CB  
610  C CG  . ARG A 85  ? 1.6450 1.4376 1.5387 0.0491  0.0188  0.0183  85  ARG A CG  
611  C CD  . ARG A 85  ? 1.7939 1.5768 1.6489 0.0548  0.0191  0.0178  85  ARG A CD  
612  N NE  . ARG A 85  ? 1.9868 1.7692 1.8300 0.0660  0.0130  0.0036  85  ARG A NE  
613  C CZ  . ARG A 85  ? 2.0907 1.8729 1.9183 0.0718  0.0129  -0.0027 85  ARG A CZ  
614  N NH1 . ARG A 85  ? 2.0513 1.8353 1.8749 0.0670  0.0188  0.0028  85  ARG A NH1 
615  N NH2 . ARG A 85  ? 2.1372 1.9217 1.9530 0.0832  0.0068  -0.0152 85  ARG A NH2 
616  N N   . MET A 86  ? 1.6950 1.4919 1.6367 0.0303  0.0291  0.0415  86  MET A N   
617  C CA  . MET A 86  ? 1.7249 1.5241 1.6678 0.0273  0.0333  0.0470  86  MET A CA  
618  C C   . MET A 86  ? 1.8758 1.6753 1.8564 0.0286  0.0250  0.0429  86  MET A C   
619  O O   . MET A 86  ? 1.9878 1.7847 1.9885 0.0304  0.0172  0.0366  86  MET A O   
620  C CB  . MET A 86  ? 1.8307 1.6305 1.7659 0.0191  0.0394  0.0640  86  MET A CB  
621  C CG  . MET A 86  ? 1.7103 1.5059 1.6122 0.0185  0.0438  0.0668  86  MET A CG  
622  S SD  . MET A 86  ? 1.7840 1.5792 1.6641 0.0132  0.0513  0.0735  86  MET A SD  
623  C CE  . MET A 86  ? 1.6634 1.4554 1.5280 0.0100  0.0523  0.0831  86  MET A CE  
624  N N   . VAL A 87  ? 1.9712 1.7725 1.9635 0.0280  0.0248  0.0455  87  VAL A N   
625  C CA  . VAL A 87  ? 2.2868 2.0856 2.3116 0.0341  0.0133  0.0341  87  VAL A CA  
626  C C   . VAL A 87  ? 2.6366 2.4291 2.6920 0.0295  0.0070  0.0457  87  VAL A C   
627  O O   . VAL A 87  ? 2.8686 2.6647 2.9228 0.0305  0.0091  0.0486  87  VAL A O   
628  C CB  . VAL A 87  ? 2.3768 2.1861 2.3947 0.0442  0.0126  0.0168  87  VAL A CB  
629  C CG1 . VAL A 87  ? 2.4467 2.2622 2.4582 0.0404  0.0193  0.0265  87  VAL A CG1 
630  C CG2 . VAL A 87  ? 2.3078 2.1145 2.3601 0.0542  -0.0027 -0.0011 87  VAL A CG2 
631  N N   . LEU A 88  ? 2.9830 2.7666 3.0677 0.0254  -0.0024 0.0501  88  LEU A N   
632  C CA  . LEU A 88  ? 3.0213 2.7960 3.1388 0.0174  -0.0104 0.0673  88  LEU A CA  
633  C C   . LEU A 88  ? 3.0741 2.8560 3.1818 0.0068  -0.0007 0.0939  88  LEU A C   
634  O O   . LEU A 88  ? 3.1371 2.9149 3.2626 0.0033  -0.0051 0.1079  88  LEU A O   
635  C CB  . LEU A 88  ? 2.7972 2.5596 2.9468 0.0253  -0.0264 0.0562  88  LEU A CB  
636  C CG  . LEU A 88  ? 2.5763 2.3385 2.7338 0.0418  -0.0367 0.0275  88  LEU A CG  
637  C CD1 . LEU A 88  ? 2.3004 2.0684 2.4534 0.0515  -0.0403 0.0022  88  LEU A CD1 
638  C CD2 . LEU A 88  ? 2.3196 2.0948 2.4572 0.0490  -0.0296 0.0224  88  LEU A CD2 
639  N N   . ARG A 89  ? 2.8590 2.6523 2.9399 0.0028  0.0107  0.0997  89  ARG A N   
640  C CA  . ARG A 89  ? 2.6688 2.4737 2.7280 -0.0014 0.0217  0.1149  89  ARG A CA  
641  C C   . ARG A 89  ? 2.6081 2.4278 2.6643 -0.0099 0.0268  0.1324  89  ARG A C   
642  O O   . ARG A 89  ? 2.6421 2.4698 2.6734 -0.0085 0.0335  0.1283  89  ARG A O   
643  C CB  . ARG A 89  ? 2.4323 2.2396 2.4566 0.0044  0.0302  0.1022  89  ARG A CB  
644  C CG  . ARG A 89  ? 2.6527 2.4655 2.6642 0.0045  0.0363  0.1070  89  ARG A CG  
645  C CD  . ARG A 89  ? 2.8583 2.6683 2.8807 0.0110  0.0316  0.0961  89  ARG A CD  
646  N NE  . ARG A 89  ? 3.1633 2.9689 3.2153 0.0104  0.0231  0.1058  89  ARG A NE  
647  C CZ  . ARG A 89  ? 3.3379 3.1321 3.4188 0.0150  0.0101  0.0983  89  ARG A CZ  
648  N NH1 . ARG A 89  ? 3.5514 3.3413 3.6354 0.0215  0.0049  0.0787  89  ARG A NH1 
649  N NH2 . ARG A 89  ? 3.2884 3.0751 3.3956 0.0137  0.0008  0.1100  89  ARG A NH2 
650  N N   . ALA A 90  ? 2.4478 2.2730 2.5290 -0.0183 0.0229  0.1521  90  ALA A N   
651  C CA  . ALA A 90  ? 2.3634 2.2122 2.4415 -0.0260 0.0288  0.1702  90  ALA A CA  
652  C C   . ALA A 90  ? 2.3215 2.1837 2.4065 -0.0316 0.0307  0.1940  90  ALA A C   
653  O O   . ALA A 90  ? 2.3003 2.1883 2.3729 -0.0341 0.0379  0.2057  90  ALA A O   
654  C CB  . ALA A 90  ? 2.2330 2.0883 2.3323 -0.0331 0.0239  0.1734  90  ALA A CB  
655  N N   . THR A 91  ? 2.2081 2.0546 2.3125 -0.0318 0.0232  0.1999  91  THR A N   
656  C CA  . THR A 91  ? 2.1549 2.0103 2.2615 -0.0336 0.0243  0.2197  91  THR A CA  
657  C C   . THR A 91  ? 2.1235 1.9863 2.1991 -0.0251 0.0333  0.2099  91  THR A C   
658  O O   . THR A 91  ? 1.9608 1.8275 2.0358 -0.0230 0.0335  0.2185  91  THR A O   
659  C CB  . THR A 91  ? 2.1904 2.0227 2.3283 -0.0345 0.0105  0.2268  91  THR A CB  
660  O OG1 . THR A 91  ? 2.0206 1.8560 2.1531 -0.0303 0.0111  0.2357  91  THR A OG1 
661  C CG2 . THR A 91  ? 2.1396 1.9452 2.2869 -0.0261 0.0014  0.1999  91  THR A CG2 
662  N N   . GLU A 92  ? 2.2559 2.1199 2.3068 -0.0207 0.0398  0.1920  92  GLU A N   
663  C CA  . GLU A 92  ? 2.1371 2.0020 2.1607 -0.0143 0.0465  0.1793  92  GLU A CA  
664  C C   . GLU A 92  ? 1.9045 1.7755 1.9049 -0.0131 0.0518  0.1695  92  GLU A C   
665  O O   . GLU A 92  ? 1.5702 1.4308 1.5704 -0.0121 0.0495  0.1585  92  GLU A O   
666  C CB  . GLU A 92  ? 2.2817 2.1274 2.3064 -0.0085 0.0432  0.1623  92  GLU A CB  
667  C CG  . GLU A 92  ? 2.6533 2.4827 2.6871 -0.0060 0.0373  0.1469  92  GLU A CG  
668  C CD  . GLU A 92  ? 2.6511 2.4699 2.7200 -0.0087 0.0256  0.1532  92  GLU A CD  
669  O OE1 . GLU A 92  ? 2.3740 2.1781 2.4572 -0.0034 0.0172  0.1381  92  GLU A OE1 
670  O OE2 . GLU A 92  ? 2.7004 2.5264 2.7845 -0.0163 0.0238  0.1735  92  GLU A OE2 
671  N N   . ALA A 93  ? 1.8243 1.7133 1.8068 -0.0119 0.0573  0.1734  93  ALA A N   
672  C CA  . ALA A 93  ? 1.7419 1.6395 1.7036 -0.0091 0.0598  0.1654  93  ALA A CA  
673  C C   . ALA A 93  ? 1.5660 1.4517 1.5029 -0.0051 0.0620  0.1515  93  ALA A C   
674  O O   . ALA A 93  ? 1.5642 1.4450 1.4992 -0.0054 0.0636  0.1506  93  ALA A O   
675  C CB  . ALA A 93  ? 1.6676 1.5980 1.6290 -0.0092 0.0619  0.1777  93  ALA A CB  
676  N N   . PHE A 94  ? 1.3741 1.2554 1.2929 -0.0018 0.0611  0.1409  94  PHE A N   
677  C CA  . PHE A 94  ? 1.3949 1.2623 1.2909 0.0000  0.0614  0.1302  94  PHE A CA  
678  C C   . PHE A 94  ? 1.4556 1.3291 1.3366 0.0054  0.0581  0.1239  94  PHE A C   
679  O O   . PHE A 94  ? 1.6266 1.5075 1.5121 0.0079  0.0559  0.1230  94  PHE A O   
680  C CB  . PHE A 94  ? 1.4109 1.2545 1.3006 -0.0010 0.0611  0.1211  94  PHE A CB  
681  C CG  . PHE A 94  ? 1.5107 1.3455 1.3980 0.0020  0.0576  0.1143  94  PHE A CG  
682  C CD1 . PHE A 94  ? 1.5498 1.3904 1.4592 0.0015  0.0557  0.1175  94  PHE A CD1 
683  C CD2 . PHE A 94  ? 1.4879 1.3076 1.3519 0.0051  0.0548  0.1049  94  PHE A CD2 
684  C CE1 . PHE A 94  ? 1.6331 1.4679 1.5415 0.0048  0.0520  0.1093  94  PHE A CE1 
685  C CE2 . PHE A 94  ? 1.4726 1.2856 1.3336 0.0095  0.0509  0.0977  94  PHE A CE2 
686  C CZ  . PHE A 94  ? 1.5552 1.3772 1.4384 0.0097  0.0499  0.0989  94  PHE A CZ  
687  N N   . TYR A 95  ? 1.3888 1.2611 1.2540 0.0076  0.0564  0.1187  95  TYR A N   
688  C CA  . TYR A 95  ? 1.3832 1.2607 1.2346 0.0152  0.0504  0.1098  95  TYR A CA  
689  C C   . TYR A 95  ? 1.4113 1.2600 1.2465 0.0170  0.0454  0.0997  95  TYR A C   
690  O O   . TYR A 95  ? 1.3446 1.1714 1.1757 0.0114  0.0475  0.1000  95  TYR A O   
691  C CB  . TYR A 95  ? 1.4162 1.2972 1.2586 0.0169  0.0479  0.1058  95  TYR A CB  
692  C CG  . TYR A 95  ? 1.4253 1.3322 1.2816 0.0149  0.0532  0.1161  95  TYR A CG  
693  C CD1 . TYR A 95  ? 1.4885 1.4314 1.3552 0.0194  0.0545  0.1235  95  TYR A CD1 
694  C CD2 . TYR A 95  ? 1.4441 1.3427 1.3024 0.0089  0.0565  0.1187  95  TYR A CD2 
695  C CE1 . TYR A 95  ? 1.5515 1.5189 1.4292 0.0184  0.0585  0.1348  95  TYR A CE1 
696  C CE2 . TYR A 95  ? 1.5622 1.4845 1.4322 0.0088  0.0601  0.1273  95  TYR A CE2 
697  C CZ  . TYR A 95  ? 1.5943 1.5495 1.4732 0.0138  0.0608  0.1361  95  TYR A CZ  
698  O OH  . TYR A 95  ? 1.6538 1.6329 1.5428 0.0143  0.0637  0.1467  95  TYR A OH  
699  N N   . LEU A 96  ? 1.4693 1.3213 1.2955 0.0257  0.0383  0.0908  96  LEU A N   
700  C CA  . LEU A 96  ? 1.4064 1.2293 1.2142 0.0293  0.0312  0.0812  96  LEU A CA  
701  C C   . LEU A 96  ? 1.4881 1.3050 1.2801 0.0380  0.0201  0.0701  96  LEU A C   
702  O O   . LEU A 96  ? 1.5395 1.3796 1.3331 0.0487  0.0147  0.0623  96  LEU A O   
703  C CB  . LEU A 96  ? 1.3326 1.1613 1.1457 0.0337  0.0303  0.0780  96  LEU A CB  
704  C CG  . LEU A 96  ? 1.4573 1.2559 1.2498 0.0386  0.0225  0.0688  96  LEU A CG  
705  C CD1 . LEU A 96  ? 1.5128 1.2856 1.2970 0.0293  0.0263  0.0745  96  LEU A CD1 
706  C CD2 . LEU A 96  ? 1.4370 1.2419 1.2353 0.0436  0.0213  0.0639  96  LEU A CD2 
707  N N   . LEU A 97  ? 1.4458 1.2339 1.2242 0.0333  0.0158  0.0691  97  LEU A N   
708  C CA  . LEU A 97  ? 1.4546 1.2297 1.2204 0.0397  0.0026  0.0586  97  LEU A CA  
709  C C   . LEU A 97  ? 1.4888 1.2281 1.2351 0.0441  -0.0098 0.0518  97  LEU A C   
710  O O   . LEU A 97  ? 1.5630 1.2758 1.2995 0.0355  -0.0075 0.0594  97  LEU A O   
711  C CB  . LEU A 97  ? 1.4453 1.2097 1.2112 0.0295  0.0036  0.0630  97  LEU A CB  
712  C CG  . LEU A 97  ? 1.5703 1.3680 1.3537 0.0264  0.0138  0.0691  97  LEU A CG  
713  C CD1 . LEU A 97  ? 1.6271 1.4123 1.4118 0.0128  0.0190  0.0763  97  LEU A CD1 
714  C CD2 . LEU A 97  ? 1.7365 1.5588 1.5225 0.0385  0.0056  0.0581  97  LEU A CD2 
715  N N   . VAL A 98  ? 1.3852 1.1247 1.1249 0.0584  -0.0242 0.0374  98  VAL A N   
716  C CA  . VAL A 98  ? 1.4453 1.1468 1.1660 0.0640  -0.0396 0.0306  98  VAL A CA  
717  C C   . VAL A 98  ? 1.5840 1.2506 1.2964 0.0545  -0.0482 0.0340  98  VAL A C   
718  O O   . VAL A 98  ? 1.5997 1.2742 1.3193 0.0555  -0.0533 0.0280  98  VAL A O   
719  C CB  . VAL A 98  ? 1.4262 1.1389 1.1434 0.0845  -0.0544 0.0118  98  VAL A CB  
720  C CG1 . VAL A 98  ? 1.5210 1.1876 1.2178 0.0907  -0.0732 0.0055  98  VAL A CG1 
721  C CG2 . VAL A 98  ? 1.4278 1.1741 1.1537 0.0905  -0.0452 0.0107  98  VAL A CG2 
722  N N   . ASN A 99  ? 1.6385 1.2694 1.3367 0.0444  -0.0495 0.0447  99  ASN A N   
723  C CA  . ASN A 99  ? 1.7479 1.3427 1.4374 0.0320  -0.0583 0.0518  99  ASN A CA  
724  C C   . ASN A 99  ? 1.8003 1.4108 1.5031 0.0160  -0.0450 0.0613  99  ASN A C   
725  O O   . ASN A 99  ? 1.9283 1.5180 1.6300 0.0050  -0.0519 0.0652  99  ASN A O   
726  C CB  . ASN A 99  ? 1.8104 1.3832 1.4956 0.0439  -0.0821 0.0364  99  ASN A CB  
727  C CG  . ASN A 99  ? 1.9430 1.4945 1.6130 0.0606  -0.0986 0.0264  99  ASN A CG  
728  O OD1 . ASN A 99  ? 1.9896 1.5608 1.6634 0.0805  -0.1076 0.0073  99  ASN A OD1 
729  N ND2 . ASN A 99  ? 1.8483 1.3629 1.5005 0.0533  -0.1028 0.0390  99  ASN A ND2 
730  N N   . ASN A 100 ? 1.7827 1.4294 1.4992 0.0145  -0.0273 0.0650  100 ASN A N   
731  C CA  . ASN A 100 ? 1.7390 1.4063 1.4700 0.0032  -0.0155 0.0712  100 ASN A CA  
732  C C   . ASN A 100 ? 1.7624 1.4347 1.5008 0.0071  -0.0255 0.0611  100 ASN A C   
733  O O   . ASN A 100 ? 1.7576 1.4349 1.5042 -0.0040 -0.0214 0.0652  100 ASN A O   
734  C CB  . ASN A 100 ? 1.8495 1.5006 1.5754 -0.0157 -0.0087 0.0857  100 ASN A CB  
735  C CG  . ASN A 100 ? 1.8657 1.5390 1.6069 -0.0267 0.0018  0.0900  100 ASN A CG  
736  O OD1 . ASN A 100 ? 2.1272 1.7876 1.8678 -0.0396 -0.0017 0.0942  100 ASN A OD1 
737  N ND2 . ASN A 100 ? 1.7000 1.4063 1.4557 -0.0221 0.0139  0.0897  100 ASN A ND2 
738  N N   . LYS A 101 ? 1.8000 1.4738 1.5359 0.0241  -0.0396 0.0457  101 LYS A N   
739  C CA  . LYS A 101 ? 1.8645 1.5485 1.6082 0.0318  -0.0511 0.0318  101 LYS A CA  
740  C C   . LYS A 101 ? 1.8474 1.5574 1.5925 0.0545  -0.0600 0.0141  101 LYS A C   
741  O O   . LYS A 101 ? 2.0473 1.7493 1.7906 0.0667  -0.0790 -0.0031 101 LYS A O   
742  C CB  . LYS A 101 ? 1.9479 1.5878 1.6848 0.0244  -0.0692 0.0291  101 LYS A CB  
743  C CG  . LYS A 101 ? 2.0034 1.6018 1.7237 0.0318  -0.0883 0.0240  101 LYS A CG  
744  C CD  . LYS A 101 ? 2.0779 1.6366 1.7971 0.0281  -0.1113 0.0174  101 LYS A CD  
745  C CE  . LYS A 101 ? 2.1346 1.7096 1.8627 0.0499  -0.1291 -0.0091 101 LYS A CE  
746  N NZ  . LYS A 101 ? 2.2340 1.8027 1.9754 0.0438  -0.1402 -0.0170 101 LYS A NZ  
747  N N   . SER A 102 ? 1.6711 1.4144 1.4208 0.0605  -0.0476 0.0173  102 SER A N   
748  C CA  . SER A 102 ? 1.6469 1.4191 1.3972 0.0811  -0.0559 0.0011  102 SER A CA  
749  C C   . SER A 102 ? 1.6472 1.4648 1.4080 0.0834  -0.0397 0.0085  102 SER A C   
750  O O   . SER A 102 ? 1.6177 1.4335 1.3752 0.0851  -0.0366 0.0110  102 SER A O   
751  C CB  . SER A 102 ? 1.6820 1.4195 1.4168 0.0913  -0.0735 -0.0100 102 SER A CB  
752  O OG  . SER A 102 ? 1.7034 1.4647 1.4386 0.1137  -0.0884 -0.0323 102 SER A OG  
753  N N   . LEU A 103 ? 1.5805 1.4389 1.3548 0.0827  -0.0301 0.0129  103 LEU A N   
754  C CA  . LEU A 103 ? 1.4878 1.3908 1.2742 0.0834  -0.0165 0.0225  103 LEU A CA  
755  C C   . LEU A 103 ? 1.5036 1.4390 1.2888 0.1010  -0.0245 0.0080  103 LEU A C   
756  O O   . LEU A 103 ? 1.5361 1.4885 1.3183 0.1162  -0.0375 -0.0102 103 LEU A O   
757  C CB  . LEU A 103 ? 1.4672 1.4064 1.2658 0.0810  -0.0081 0.0298  103 LEU A CB  
758  C CG  . LEU A 103 ? 1.5398 1.4620 1.3451 0.0632  0.0053  0.0490  103 LEU A CG  
759  C CD1 . LEU A 103 ? 1.6920 1.6424 1.5069 0.0617  0.0104  0.0541  103 LEU A CD1 
760  C CD2 . LEU A 103 ? 1.5167 1.4505 1.3307 0.0582  0.0161  0.0623  103 LEU A CD2 
761  N N   . VAL A 104 ? 1.3991 1.3468 1.1884 0.0998  -0.0175 0.0143  104 VAL A N   
762  C CA  . VAL A 104 ? 1.4279 1.4015 1.2144 0.1164  -0.0265 -0.0015 104 VAL A CA  
763  C C   . VAL A 104 ? 1.4737 1.5065 1.2758 0.1165  -0.0152 0.0070  104 VAL A C   
764  O O   . VAL A 104 ? 1.4655 1.5152 1.2814 0.1027  -0.0005 0.0278  104 VAL A O   
765  C CB  . VAL A 104 ? 1.4881 1.4186 1.2621 0.1183  -0.0346 -0.0079 104 VAL A CB  
766  C CG1 . VAL A 104 ? 1.6650 1.5408 1.4228 0.1193  -0.0490 -0.0160 104 VAL A CG1 
767  C CG2 . VAL A 104 ? 1.5529 1.4670 1.3329 0.1017  -0.0203 0.0109  104 VAL A CG2 
768  N N   . SER A 105 ? 1.4542 1.5200 1.2553 0.1317  -0.0226 -0.0083 105 SER A N   
769  C CA  . SER A 105 ? 1.4953 1.6189 1.3127 0.1288  -0.0114 0.0021  105 SER A CA  
770  C C   . SER A 105 ? 1.5596 1.6528 1.3846 0.1114  -0.0013 0.0195  105 SER A C   
771  O O   . SER A 105 ? 1.7002 1.7398 1.5134 0.1102  -0.0070 0.0142  105 SER A O   
772  C CB  . SER A 105 ? 1.6054 1.7670 1.4202 0.1475  -0.0215 -0.0190 105 SER A CB  
773  O OG  . SER A 105 ? 1.8340 2.0528 1.6665 0.1411  -0.0097 -0.0061 105 SER A OG  
774  N N   . MET A 106 ? 1.5908 1.7161 1.4357 0.0977  0.0125  0.0410  106 MET A N   
775  C CA  . MET A 106 ? 1.6150 1.7203 1.4731 0.0821  0.0207  0.0560  106 MET A CA  
776  C C   . MET A 106 ? 1.6594 1.8108 1.5310 0.0839  0.0219  0.0547  106 MET A C   
777  O O   . MET A 106 ? 1.8324 1.9971 1.7248 0.0694  0.0305  0.0721  106 MET A O   
778  C CB  . MET A 106 ? 1.4571 1.5567 1.3310 0.0640  0.0327  0.0815  106 MET A CB  
779  C CG  . MET A 106 ? 1.5843 1.6387 1.4474 0.0603  0.0326  0.0831  106 MET A CG  
780  S SD  . MET A 106 ? 1.7725 1.7585 1.6188 0.0593  0.0268  0.0724  106 MET A SD  
781  C CE  . MET A 106 ? 1.4897 1.4425 1.3269 0.0532  0.0283  0.0768  106 MET A CE  
782  N N   . SER A 107 ? 1.5600 1.7363 1.4207 0.1022  0.0118  0.0326  107 SER A N   
783  C CA  . SER A 107 ? 1.6010 1.8266 1.4721 0.1073  0.0112  0.0260  107 SER A CA  
784  C C   . SER A 107 ? 1.5237 1.7374 1.3744 0.1303  -0.0053 -0.0050 107 SER A C   
785  O O   . SER A 107 ? 1.5693 1.8329 1.4181 0.1468  -0.0121 -0.0220 107 SER A O   
786  C CB  . SER A 107 ? 1.7246 2.0268 1.6099 0.1057  0.0189  0.0374  107 SER A CB  
787  O OG  . SER A 107 ? 1.9256 2.2863 1.8138 0.1188  0.0142  0.0214  107 SER A OG  
788  N N   . ALA A 108 ? 1.4451 1.5928 1.2802 0.1320  -0.0127 -0.0122 108 ALA A N   
789  C CA  . ALA A 108 ? 1.5579 1.6824 1.3720 0.1529  -0.0307 -0.0388 108 ALA A CA  
790  C C   . ALA A 108 ? 1.6805 1.7647 1.4886 0.1525  -0.0349 -0.0432 108 ALA A C   
791  O O   . ALA A 108 ? 1.9145 1.9531 1.7208 0.1387  -0.0291 -0.0297 108 ALA A O   
792  C CB  . ALA A 108 ? 1.5752 1.6552 1.3720 0.1570  -0.0391 -0.0431 108 ALA A CB  
793  N N   . THR A 109 ? 1.7426 1.8469 1.5472 0.1688  -0.0453 -0.0634 109 THR A N   
794  C CA  . THR A 109 ? 1.6829 1.7512 1.4792 0.1723  -0.0518 -0.0709 109 THR A CA  
795  C C   . THR A 109 ? 1.6489 1.6443 1.4211 0.1735  -0.0609 -0.0708 109 THR A C   
796  O O   . THR A 109 ? 1.5660 1.5430 1.3250 0.1810  -0.0702 -0.0768 109 THR A O   
797  C CB  . THR A 109 ? 1.8822 1.9793 1.6733 0.1955  -0.0666 -0.0981 109 THR A CB  
798  O OG1 . THR A 109 ? 1.9357 1.9966 1.7016 0.2165  -0.0873 -0.1182 109 THR A OG1 
799  C CG2 . THR A 109 ? 1.9524 2.1332 1.7627 0.2001  -0.0616 -0.1035 109 THR A CG2 
800  N N   . MET A 110 ? 1.6492 1.6059 1.4167 0.1657  -0.0584 -0.0638 110 MET A N   
801  C CA  . MET A 110 ? 1.7230 1.6149 1.4677 0.1641  -0.0652 -0.0598 110 MET A CA  
802  C C   . MET A 110 ? 1.8038 1.6705 1.5255 0.1854  -0.0873 -0.0797 110 MET A C   
803  O O   . MET A 110 ? 1.8196 1.6421 1.5244 0.1855  -0.0963 -0.0773 110 MET A O   
804  C CB  . MET A 110 ? 1.8373 1.7034 1.5810 0.1553  -0.0595 -0.0517 110 MET A CB  
805  C CG  . MET A 110 ? 1.9679 1.8328 1.7281 0.1333  -0.0416 -0.0304 110 MET A CG  
806  S SD  . MET A 110 ? 1.9664 1.7885 1.7128 0.1217  -0.0387 -0.0156 110 MET A SD  
807  C CE  . MET A 110 ? 1.9946 1.8432 1.7701 0.1013  -0.0187 0.0038  110 MET A CE  
808  N N   . ALA A 111 ? 1.9314 1.8260 1.6538 0.2031  -0.0971 -0.0993 111 ALA A N   
809  C CA  . ALA A 111 ? 2.0723 1.9512 1.7759 0.2277  -0.1211 -0.1225 111 ALA A CA  
810  C C   . ALA A 111 ? 2.0693 1.9458 1.7704 0.2315  -0.1284 -0.1263 111 ALA A C   
811  O O   . ALA A 111 ? 2.0140 1.8382 1.6967 0.2366  -0.1443 -0.1290 111 ALA A O   
812  C CB  . ALA A 111 ? 2.1466 2.0792 1.8589 0.2466  -0.1277 -0.1450 111 ALA A CB  
813  N N   . GLU A 112 ? 1.8904 1.8240 1.6109 0.2277  -0.1167 -0.1249 112 GLU A N   
814  C CA  . GLU A 112 ? 1.9115 1.8530 1.6320 0.2329  -0.1229 -0.1308 112 GLU A CA  
815  C C   . GLU A 112 ? 1.8827 1.7582 1.5904 0.2199  -0.1254 -0.1164 112 GLU A C   
816  O O   . GLU A 112 ? 2.0051 1.8451 1.6992 0.2319  -0.1459 -0.1292 112 GLU A O   
817  C CB  . GLU A 112 ? 1.9817 1.9939 1.7250 0.2252  -0.1051 -0.1232 112 GLU A CB  
818  C CG  . GLU A 112 ? 2.0492 2.1327 1.8014 0.2453  -0.1110 -0.1454 112 GLU A CG  
819  C CD  . GLU A 112 ? 2.0939 2.2515 1.8704 0.2325  -0.0897 -0.1309 112 GLU A CD  
820  O OE1 . GLU A 112 ? 1.9998 2.1554 1.7872 0.2098  -0.0717 -0.1045 112 GLU A OE1 
821  O OE2 . GLU A 112 ? 2.2465 2.4669 2.0320 0.2452  -0.0917 -0.1456 112 GLU A OE2 
822  N N   . ILE A 113 ? 1.7386 1.5961 1.4509 0.1961  -0.1067 -0.0910 113 ILE A N   
823  C CA  . ILE A 113 ? 1.7879 1.5941 1.4911 0.1812  -0.1059 -0.0758 113 ILE A CA  
824  C C   . ILE A 113 ? 1.9510 1.6930 1.6309 0.1860  -0.1242 -0.0786 113 ILE A C   
825  O O   . ILE A 113 ? 1.9090 1.6091 1.5799 0.1790  -0.1317 -0.0723 113 ILE A O   
826  C CB  . ILE A 113 ? 1.6912 1.4924 1.4034 0.1568  -0.0833 -0.0502 113 ILE A CB  
827  C CG1 . ILE A 113 ? 1.6728 1.5248 1.4055 0.1522  -0.0670 -0.0451 113 ILE A CG1 
828  C CG2 . ILE A 113 ? 1.6442 1.4335 1.3599 0.1422  -0.0763 -0.0369 113 ILE A CG2 
829  C CD1 . ILE A 113 ? 1.5816 1.4978 1.3312 0.1600  -0.0638 -0.0531 113 ILE A CD1 
830  N N   . TYR A 114 ? 2.1776 1.9133 1.8485 0.1970  -0.1312 -0.0866 114 TYR A N   
831  C CA  . TYR A 114 ? 2.3623 2.0394 2.0096 0.2022  -0.1484 -0.0866 114 TYR A CA  
832  C C   . TYR A 114 ? 2.3635 2.0133 1.9988 0.2218  -0.1770 -0.1061 114 TYR A C   
833  O O   . TYR A 114 ? 2.3597 1.9512 1.9787 0.2184  -0.1918 -0.0991 114 TYR A O   
834  C CB  . TYR A 114 ? 2.4737 2.1573 2.1154 0.2111  -0.1487 -0.0919 114 TYR A CB  
835  C CG  . TYR A 114 ? 2.5449 2.1683 2.1614 0.2109  -0.1611 -0.0837 114 TYR A CG  
836  C CD1 . TYR A 114 ? 2.4757 2.0642 2.0847 0.1891  -0.1514 -0.0591 114 TYR A CD1 
837  C CD2 . TYR A 114 ? 2.4791 2.0823 2.0786 0.2326  -0.1831 -0.0995 114 TYR A CD2 
838  C CE1 . TYR A 114 ? 2.4696 2.0073 2.0546 0.1868  -0.1617 -0.0478 114 TYR A CE1 
839  C CE2 . TYR A 114 ? 2.5136 2.0606 2.0882 0.2313  -0.1948 -0.0881 114 TYR A CE2 
840  C CZ  . TYR A 114 ? 2.5272 2.0426 2.0945 0.2075  -0.1835 -0.0609 114 TYR A CZ  
841  O OH  . TYR A 114 ? 2.3602 1.8249 1.9023 0.2038  -0.1936 -0.0457 114 TYR A OH  
842  N N   . ARG A 115 ? 2.2990 1.9938 1.9436 0.2429  -0.1855 -0.1308 115 ARG A N   
843  C CA  . ARG A 115 ? 2.3520 2.0420 1.9944 0.2636  -0.2106 -0.1547 115 ARG A CA  
844  C C   . ARG A 115 ? 2.3075 1.9659 1.9513 0.2495  -0.2129 -0.1443 115 ARG A C   
845  O O   . ARG A 115 ? 2.4127 2.0112 2.0433 0.2507  -0.2339 -0.1441 115 ARG A O   
846  C CB  . ARG A 115 ? 2.2808 2.0491 1.9406 0.2802  -0.2071 -0.1765 115 ARG A CB  
847  C CG  . ARG A 115 ? 2.3091 2.0904 1.9678 0.3103  -0.2351 -0.2104 115 ARG A CG  
848  C CD  . ARG A 115 ? 2.4757 2.3118 2.1381 0.3339  -0.2402 -0.2345 115 ARG A CD  
849  N NE  . ARG A 115 ? 2.4815 2.4046 2.1646 0.3308  -0.2177 -0.2346 115 ARG A NE  
850  C CZ  . ARG A 115 ? 2.3590 2.3217 2.0576 0.3149  -0.1973 -0.2203 115 ARG A CZ  
851  N NH1 . ARG A 115 ? 2.2360 2.2774 1.9521 0.3133  -0.1798 -0.2196 115 ARG A NH1 
852  N NH2 . ARG A 115 ? 2.2177 2.1446 1.9150 0.3000  -0.1945 -0.2058 115 ARG A NH2 
853  N N   . ASP A 116 ? 2.1472 1.8434 1.8076 0.2344  -0.1912 -0.1331 116 ASP A N   
854  C CA  . ASP A 116 ? 2.0980 1.7818 1.7641 0.2274  -0.1955 -0.1318 116 ASP A CA  
855  C C   . ASP A 116 ? 2.0925 1.7203 1.7518 0.2020  -0.1906 -0.1064 116 ASP A C   
856  O O   . ASP A 116 ? 2.0819 1.6872 1.7440 0.1981  -0.2013 -0.1083 116 ASP A O   
857  C CB  . ASP A 116 ? 2.1255 1.8776 1.8114 0.2252  -0.1771 -0.1329 116 ASP A CB  
858  C CG  . ASP A 116 ? 2.2920 2.1072 1.9854 0.2505  -0.1834 -0.1588 116 ASP A CG  
859  O OD1 . ASP A 116 ? 2.1540 1.9826 1.8438 0.2595  -0.1837 -0.1646 116 ASP A OD1 
860  O OD2 . ASP A 116 ? 2.5676 2.4228 2.2708 0.2620  -0.1886 -0.1746 116 ASP A OD2 
861  N N   . TYR A 117 ? 2.0439 1.6526 1.6954 0.1853  -0.1753 -0.0839 117 TYR A N   
862  C CA  . TYR A 117 ? 2.0086 1.5792 1.6559 0.1594  -0.1657 -0.0582 117 TYR A CA  
863  C C   . TYR A 117 ? 2.0899 1.6191 1.7186 0.1503  -0.1651 -0.0411 117 TYR A C   
864  O O   . TYR A 117 ? 2.1397 1.6475 1.7648 0.1282  -0.1535 -0.0183 117 TYR A O   
865  C CB  . TYR A 117 ? 1.8924 1.5020 1.5565 0.1414  -0.1376 -0.0431 117 TYR A CB  
866  C CG  . TYR A 117 ? 1.9104 1.5763 1.5927 0.1511  -0.1326 -0.0568 117 TYR A CG  
867  C CD1 . TYR A 117 ? 1.8819 1.5973 1.5717 0.1654  -0.1278 -0.0684 117 TYR A CD1 
868  C CD2 . TYR A 117 ? 1.9385 1.6122 1.6309 0.1455  -0.1324 -0.0574 117 TYR A CD2 
869  C CE1 . TYR A 117 ? 1.8913 1.6637 1.5967 0.1735  -0.1225 -0.0783 117 TYR A CE1 
870  C CE2 . TYR A 117 ? 1.9086 1.6385 1.6161 0.1553  -0.1275 -0.0689 117 TYR A CE2 
871  C CZ  . TYR A 117 ? 1.9300 1.7099 1.6432 0.1690  -0.1223 -0.0782 117 TYR A CZ  
872  O OH  . TYR A 117 ? 1.9307 1.7723 1.6578 0.1784  -0.1170 -0.0873 117 TYR A OH  
873  N N   . LYS A 118 ? 2.0872 1.6092 1.7040 0.1679  -0.1774 -0.0523 118 LYS A N   
874  C CA  . LYS A 118 ? 2.0990 1.5770 1.6944 0.1626  -0.1823 -0.0375 118 LYS A CA  
875  C C   . LYS A 118 ? 2.0644 1.4875 1.6495 0.1473  -0.1941 -0.0214 118 LYS A C   
876  O O   . LYS A 118 ? 2.0993 1.4968 1.6846 0.1559  -0.2172 -0.0334 118 LYS A O   
877  C CB  . LYS A 118 ? 2.0678 1.5369 1.6505 0.1883  -0.2031 -0.0566 118 LYS A CB  
878  C CG  . LYS A 118 ? 2.1283 1.5323 1.6874 0.1931  -0.2294 -0.0518 118 LYS A CG  
879  C CD  . LYS A 118 ? 2.3051 1.7076 1.8609 0.2245  -0.2570 -0.0821 118 LYS A CD  
880  C CE  . LYS A 118 ? 2.4225 1.8597 1.9986 0.2354  -0.2621 -0.1053 118 LYS A CE  
881  N NZ  . LYS A 118 ? 2.4505 1.9445 2.0363 0.2607  -0.2636 -0.1338 118 LYS A NZ  
882  N N   . ASP A 119 ? 2.0382 1.4470 1.6168 0.1241  -0.1788 0.0048  119 ASP A N   
883  C CA  . ASP A 119 ? 2.2735 1.6362 1.8449 0.1057  -0.1881 0.0229  119 ASP A CA  
884  C C   . ASP A 119 ? 2.5108 1.8169 2.0601 0.1142  -0.2164 0.0253  119 ASP A C   
885  O O   . ASP A 119 ? 2.4519 1.7554 1.9917 0.1372  -0.2301 0.0093  119 ASP A O   
886  C CB  . ASP A 119 ? 2.3986 1.7667 1.9678 0.0792  -0.1643 0.0506  119 ASP A CB  
887  C CG  . ASP A 119 ? 2.5445 1.8700 2.1072 0.0569  -0.1726 0.0721  119 ASP A CG  
888  O OD1 . ASP A 119 ? 2.5676 1.8877 2.1446 0.0506  -0.1790 0.0675  119 ASP A OD1 
889  O OD2 . ASP A 119 ? 2.6385 1.9384 2.1822 0.0452  -0.1729 0.0941  119 ASP A OD2 
890  N N   . GLU A 120 ? 2.7332 1.9946 2.2751 0.0946  -0.2255 0.0464  120 GLU A N   
891  C CA  . GLU A 120 ? 2.7559 1.9562 2.2767 0.0964  -0.2528 0.0567  120 GLU A CA  
892  C C   . GLU A 120 ? 2.6662 1.8679 2.1652 0.1070  -0.2496 0.0621  120 GLU A C   
893  O O   . GLU A 120 ? 2.6775 1.8589 2.1654 0.1307  -0.2721 0.0465  120 GLU A O   
894  C CB  . GLU A 120 ? 2.8838 2.0453 2.4009 0.0658  -0.2552 0.0874  120 GLU A CB  
895  C CG  . GLU A 120 ? 2.9888 2.1738 2.5284 0.0437  -0.2383 0.0928  120 GLU A CG  
896  C CD  . GLU A 120 ? 2.9309 2.1344 2.4944 0.0575  -0.2463 0.0632  120 GLU A CD  
897  O OE1 . GLU A 120 ? 3.0182 2.2271 2.5833 0.0858  -0.2622 0.0351  120 GLU A OE1 
898  O OE2 . GLU A 120 ? 2.5910 1.8088 2.1719 0.0402  -0.2361 0.0675  120 GLU A OE2 
899  N N   . ASP A 121 ? 2.6092 1.8384 2.1034 0.0919  -0.2227 0.0808  121 ASP A N   
900  C CA  . ASP A 121 ? 2.5368 1.7854 2.0173 0.1057  -0.2153 0.0776  121 ASP A CA  
901  C C   . ASP A 121 ? 2.5271 1.8270 2.0266 0.1250  -0.2050 0.0486  121 ASP A C   
902  O O   . ASP A 121 ? 2.4891 1.8139 2.0106 0.1247  -0.1994 0.0356  121 ASP A O   
903  C CB  . ASP A 121 ? 2.3973 1.6625 1.8680 0.0859  -0.1916 0.1035  121 ASP A CB  
904  C CG  . ASP A 121 ? 2.4209 1.7191 1.9114 0.0634  -0.1664 0.1125  121 ASP A CG  
905  O OD1 . ASP A 121 ? 2.3837 1.7099 1.8978 0.0670  -0.1591 0.0951  121 ASP A OD1 
906  O OD2 . ASP A 121 ? 2.4049 1.7035 1.8869 0.0424  -0.1542 0.1374  121 ASP A OD2 
907  N N   . GLY A 122 ? 2.4151 1.7330 1.9065 0.1411  -0.2028 0.0393  122 GLY A N   
908  C CA  . GLY A 122 ? 2.3609 1.7289 1.8707 0.1580  -0.1940 0.0137  122 GLY A CA  
909  C C   . GLY A 122 ? 2.3351 1.7522 1.8677 0.1431  -0.1640 0.0175  122 GLY A C   
910  O O   . GLY A 122 ? 2.3094 1.7699 1.8614 0.1521  -0.1552 0.0004  122 GLY A O   
911  N N   . PHE A 123 ? 2.2712 1.6824 1.8020 0.1199  -0.1492 0.0407  123 PHE A N   
912  C CA  . PHE A 123 ? 2.2541 1.7065 1.8063 0.1057  -0.1233 0.0450  123 PHE A CA  
913  C C   . PHE A 123 ? 2.1455 1.6162 1.7198 0.1031  -0.1205 0.0361  123 PHE A C   
914  O O   . PHE A 123 ? 2.2842 1.7308 1.8577 0.0930  -0.1276 0.0434  123 PHE A O   
915  C CB  . PHE A 123 ? 2.3554 1.7980 1.8996 0.0827  -0.1106 0.0704  123 PHE A CB  
916  C CG  . PHE A 123 ? 2.3467 1.7987 1.8782 0.0828  -0.1017 0.0781  123 PHE A CG  
917  C CD1 . PHE A 123 ? 2.4100 1.8910 1.9487 0.0981  -0.0969 0.0620  123 PHE A CD1 
918  C CD2 . PHE A 123 ? 2.2944 1.7302 1.8076 0.0674  -0.0982 0.1013  123 PHE A CD2 
919  C CE1 . PHE A 123 ? 2.5374 2.0287 2.0655 0.0998  -0.0902 0.0664  123 PHE A CE1 
920  C CE2 . PHE A 123 ? 2.3839 1.8339 1.8847 0.0694  -0.0904 0.1068  123 PHE A CE2 
921  C CZ  . PHE A 123 ? 2.5741 2.0510 2.0825 0.0865  -0.0869 0.0881  123 PHE A CZ  
922  N N   . VAL A 124 ? 1.9030 1.4178 1.4978 0.1112  -0.1104 0.0216  124 VAL A N   
923  C CA  . VAL A 124 ? 1.8151 1.3579 1.4322 0.1040  -0.1001 0.0194  124 VAL A CA  
924  C C   . VAL A 124 ? 1.7863 1.3459 1.4147 0.0832  -0.0770 0.0366  124 VAL A C   
925  O O   . VAL A 124 ? 1.7221 1.3065 1.3587 0.0814  -0.0628 0.0385  124 VAL A O   
926  C CB  . VAL A 124 ? 1.6902 1.2764 1.3248 0.1198  -0.0992 -0.0001 124 VAL A CB  
927  C CG1 . VAL A 124 ? 1.6775 1.2813 1.3115 0.1300  -0.0963 -0.0070 124 VAL A CG1 
928  C CG2 . VAL A 124 ? 1.5997 1.2250 1.2582 0.1092  -0.0810 0.0040  124 VAL A CG2 
929  N N   . TYR A 125 ? 1.7019 1.2479 1.3317 0.0684  -0.0754 0.0474  125 TYR A N   
930  C CA  . TYR A 125 ? 1.7845 1.3441 1.4236 0.0492  -0.0563 0.0627  125 TYR A CA  
931  C C   . TYR A 125 ? 1.8089 1.4075 1.4733 0.0471  -0.0433 0.0583  125 TYR A C   
932  O O   . TYR A 125 ? 1.8983 1.5054 1.5708 0.0539  -0.0504 0.0483  125 TYR A O   
933  C CB  . TYR A 125 ? 1.9543 1.4828 1.5838 0.0333  -0.0617 0.0766  125 TYR A CB  
934  C CG  . TYR A 125 ? 2.1689 1.6645 1.7747 0.0258  -0.0675 0.0918  125 TYR A CG  
935  C CD1 . TYR A 125 ? 2.1929 1.6568 1.7790 0.0386  -0.0865 0.0881  125 TYR A CD1 
936  C CD2 . TYR A 125 ? 2.2701 1.7681 1.8726 0.0059  -0.0549 0.1107  125 TYR A CD2 
937  C CE1 . TYR A 125 ? 2.2363 1.6703 1.7991 0.0311  -0.0924 0.1053  125 TYR A CE1 
938  C CE2 . TYR A 125 ? 2.3379 1.8118 1.9180 -0.0022 -0.0594 0.1274  125 TYR A CE2 
939  C CZ  . TYR A 125 ? 2.4473 1.8883 2.0070 0.0099  -0.0779 0.1260  125 TYR A CZ  
940  O OH  . TYR A 125 ? 2.7240 2.1426 2.2603 0.0008  -0.0821 0.1459  125 TYR A OH  
941  N N   . MET A 126 ? 1.7025 1.3255 1.3795 0.0387  -0.0257 0.0654  126 MET A N   
942  C CA  . MET A 126 ? 1.5559 1.2126 1.2561 0.0360  -0.0146 0.0644  126 MET A CA  
943  C C   . MET A 126 ? 1.6819 1.3434 1.3882 0.0205  -0.0013 0.0768  126 MET A C   
944  O O   . MET A 126 ? 1.8501 1.5020 1.5470 0.0144  0.0028  0.0839  126 MET A O   
945  C CB  . MET A 126 ? 1.3872 1.0744 1.1028 0.0442  -0.0080 0.0584  126 MET A CB  
946  C CG  . MET A 126 ? 1.4315 1.1209 1.1415 0.0605  -0.0203 0.0447  126 MET A CG  
947  S SD  . MET A 126 ? 1.5626 1.2989 1.2980 0.0660  -0.0113 0.0399  126 MET A SD  
948  C CE  . MET A 126 ? 1.5471 1.2832 1.2706 0.0858  -0.0275 0.0219  126 MET A CE  
949  N N   . THR A 127 ? 1.6272 1.3075 1.3491 0.0155  0.0049  0.0784  127 THR A N   
950  C CA  . THR A 127 ? 1.6125 1.3034 1.3435 0.0028  0.0175  0.0879  127 THR A CA  
951  C C   . THR A 127 ? 1.4927 1.2144 1.2455 0.0068  0.0258  0.0862  127 THR A C   
952  O O   . THR A 127 ? 1.5706 1.3063 1.3302 0.0161  0.0220  0.0801  127 THR A O   
953  C CB  . THR A 127 ? 1.6330 1.3184 1.3644 -0.0068 0.0159  0.0915  127 THR A CB  
954  O OG1 . THR A 127 ? 1.7835 1.4371 1.4974 -0.0065 0.0014  0.0900  127 THR A OG1 
955  C CG2 . THR A 127 ? 1.6161 1.3064 1.3499 -0.0212 0.0266  0.1015  127 THR A CG2 
956  N N   . TYR A 128 ? 1.3367 1.0713 1.1014 0.0003  0.0364  0.0917  128 TYR A N   
957  C CA  . TYR A 128 ? 1.3895 1.1500 1.1764 0.0024  0.0424  0.0929  128 TYR A CA  
958  C C   . TYR A 128 ? 1.4197 1.1886 1.2156 -0.0064 0.0501  0.0988  128 TYR A C   
959  O O   . TYR A 128 ? 1.5138 1.2757 1.3036 -0.0125 0.0536  0.1005  128 TYR A O   
960  C CB  . TYR A 128 ? 1.3823 1.1501 1.1797 0.0070  0.0445  0.0910  128 TYR A CB  
961  C CG  . TYR A 128 ? 1.3898 1.1516 1.1860 0.0031  0.0487  0.0913  128 TYR A CG  
962  C CD1 . TYR A 128 ? 1.4367 1.1804 1.2119 0.0036  0.0453  0.0890  128 TYR A CD1 
963  C CD2 . TYR A 128 ? 1.3854 1.1615 1.2014 0.0003  0.0550  0.0934  128 TYR A CD2 
964  C CE1 . TYR A 128 ? 1.4467 1.1921 1.2198 0.0015  0.0494  0.0884  128 TYR A CE1 
965  C CE2 . TYR A 128 ? 1.3502 1.1260 1.1658 -0.0006 0.0577  0.0903  128 TYR A CE2 
966  C CZ  . TYR A 128 ? 1.4314 1.1945 1.2251 0.0000  0.0556  0.0876  128 TYR A CZ  
967  O OH  . TYR A 128 ? 1.4664 1.2357 1.2582 0.0002  0.0584  0.0838  128 TYR A OH  
968  N N   . ALA A 129 ? 1.3693 1.1571 1.1794 -0.0063 0.0526  0.1015  129 ALA A N   
969  C CA  . ALA A 129 ? 1.4654 1.2643 1.2852 -0.0130 0.0586  0.1059  129 ALA A CA  
970  C C   . ALA A 129 ? 1.4627 1.2849 1.3042 -0.0100 0.0625  0.1110  129 ALA A C   
971  O O   . ALA A 129 ? 1.5522 1.3859 1.4003 -0.0042 0.0604  0.1129  129 ALA A O   
972  C CB  . ALA A 129 ? 1.5967 1.3914 1.4076 -0.0171 0.0551  0.1045  129 ALA A CB  
973  N N   . SER A 130 ? 1.4359 1.2670 1.2888 -0.0138 0.0675  0.1140  130 SER A N   
974  C CA  . SER A 130 ? 1.4837 1.3338 1.3568 -0.0109 0.0692  0.1209  130 SER A CA  
975  C C   . SER A 130 ? 1.4933 1.3591 1.3659 -0.0102 0.0689  0.1233  130 SER A C   
976  O O   . SER A 130 ? 1.4415 1.3261 1.3267 -0.0067 0.0693  0.1311  130 SER A O   
977  C CB  . SER A 130 ? 1.4416 1.2944 1.3296 -0.0119 0.0719  0.1214  130 SER A CB  
978  O OG  . SER A 130 ? 1.5487 1.4104 1.4369 -0.0151 0.0747  0.1202  130 SER A OG  
979  N N   . GLN A 131 ? 1.4140 1.2729 1.2725 -0.0136 0.0672  0.1173  131 GLN A N   
980  C CA  . GLN A 131 ? 1.4894 1.3638 1.3480 -0.0115 0.0650  0.1161  131 GLN A CA  
981  C C   . GLN A 131 ? 1.4798 1.3381 1.3239 -0.0168 0.0605  0.1081  131 GLN A C   
982  O O   . GLN A 131 ? 1.3860 1.2274 1.2232 -0.0249 0.0621  0.1074  131 GLN A O   
983  C CB  . GLN A 131 ? 1.5201 1.4120 1.3923 -0.0127 0.0694  0.1204  131 GLN A CB  
984  C CG  . GLN A 131 ? 1.6888 1.5736 1.5669 -0.0176 0.0738  0.1206  131 GLN A CG  
985  C CD  . GLN A 131 ? 2.0353 1.9383 1.9268 -0.0169 0.0764  0.1223  131 GLN A CD  
986  O OE1 . GLN A 131 ? 2.2246 2.1372 2.1139 -0.0196 0.0765  0.1184  131 GLN A OE1 
987  N NE2 . GLN A 131 ? 2.1409 2.0480 2.0478 -0.0127 0.0768  0.1274  131 GLN A NE2 
988  N N   . GLU A 132 ? 1.5136 1.3775 1.3536 -0.0127 0.0538  0.1019  132 GLU A N   
989  C CA  . GLU A 132 ? 1.7070 1.5481 1.5350 -0.0193 0.0467  0.0948  132 GLU A CA  
990  C C   . GLU A 132 ? 1.9103 1.7576 1.7374 -0.0140 0.0368  0.0848  132 GLU A C   
991  O O   . GLU A 132 ? 2.1178 1.9623 1.9384 -0.0041 0.0278  0.0772  132 GLU A O   
992  C CB  . GLU A 132 ? 1.6570 1.4699 1.4706 -0.0198 0.0421  0.0938  132 GLU A CB  
993  C CG  . GLU A 132 ? 1.7559 1.5407 1.5576 -0.0311 0.0363  0.0927  132 GLU A CG  
994  C CD  . GLU A 132 ? 1.8436 1.6009 1.6300 -0.0263 0.0249  0.0882  132 GLU A CD  
995  O OE1 . GLU A 132 ? 1.7575 1.5215 1.5431 -0.0139 0.0230  0.0845  132 GLU A OE1 
996  O OE2 . GLU A 132 ? 1.8187 1.5484 1.5947 -0.0353 0.0171  0.0890  132 GLU A OE2 
997  N N   . THR A 133 ? 1.9232 1.7799 1.7573 -0.0198 0.0373  0.0826  133 THR A N   
998  C CA  . THR A 133 ? 1.8382 1.7010 1.6741 -0.0156 0.0266  0.0706  133 THR A CA  
999  C C   . THR A 133 ? 1.7575 1.5852 1.5830 -0.0203 0.0129  0.0627  133 THR A C   
1000 O O   . THR A 133 ? 1.8413 1.6412 1.6588 -0.0324 0.0141  0.0696  133 THR A O   
1001 C CB  . THR A 133 ? 1.8413 1.7215 1.6889 -0.0228 0.0308  0.0704  133 THR A CB  
1002 O OG1 . THR A 133 ? 1.9946 1.8975 1.8505 -0.0206 0.0431  0.0806  133 THR A OG1 
1003 C CG2 . THR A 133 ? 1.9959 1.8962 1.8493 -0.0132 0.0212  0.0573  133 THR A CG2 
1004 N N   . PHE A 134 ? 1.7897 1.6198 1.6153 -0.0096 -0.0011 0.0480  134 PHE A N   
1005 C CA  . PHE A 134 ? 1.9629 1.7571 1.7805 -0.0109 -0.0189 0.0381  134 PHE A CA  
1006 C C   . PHE A 134 ? 2.0559 1.8513 1.8838 -0.0127 -0.0316 0.0246  134 PHE A C   
1007 O O   . PHE A 134 ? 2.1742 1.9485 2.0006 -0.0071 -0.0510 0.0101  134 PHE A O   
1008 C CB  . PHE A 134 ? 1.9850 1.7776 1.7937 0.0075  -0.0290 0.0280  134 PHE A CB  
1009 C CG  . PHE A 134 ? 1.9482 1.7443 1.7498 0.0103  -0.0176 0.0392  134 PHE A CG  
1010 C CD1 . PHE A 134 ? 2.0517 1.8129 1.8416 0.0012  -0.0170 0.0477  134 PHE A CD1 
1011 C CD2 . PHE A 134 ? 1.9879 1.8235 1.7953 0.0214  -0.0080 0.0418  134 PHE A CD2 
1012 C CE1 . PHE A 134 ? 2.0780 1.8439 1.8634 0.0045  -0.0076 0.0556  134 PHE A CE1 
1013 C CE2 . PHE A 134 ? 2.0142 1.8523 1.8186 0.0225  0.0012  0.0517  134 PHE A CE2 
1014 C CZ  . PHE A 134 ? 2.0019 1.8051 1.7958 0.0147  0.0011  0.0570  134 PHE A CZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   ASN 6   6   ?   ?   ?   A . n 
A 1 7   THR 7   7   ?   ?   ?   A . n 
A 1 8   HIS 8   8   ?   ?   ?   A . n 
A 1 9   ASP 9   9   ?   ?   ?   A . n 
A 1 10  ASP 10  10  ?   ?   ?   A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  MET 13  13  13  MET MET A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  GLN 24  24  24  GLN GLN A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  PHE 58  58  58  PHE PHE A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  MET 75  75  75  MET MET A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  MET 86  86  86  MET MET A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 MET 106 106 106 MET MET A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 MET 110 110 110 MET MET A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 TYR 125 125 125 TYR TYR A . n 
A 1 126 MET 126 126 126 MET MET A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 THR 133 133 133 THR THR A . n 
A 1 134 PHE 134 134 134 PHE PHE A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A 
2 1,2 A 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 1280  ? 
2 MORE         -7    ? 
2 'SSA (A^2)'  14370 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-12-25 
2 'Structure model' 1 1 2014-03-12 
3 'Structure model' 1 2 2017-08-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
3 3 'Structure model' 'Source and taxonomy'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen 
2 3 'Structure model' software       
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -16.4349 
_pdbx_refine_tls.origin_y         -19.2057 
_pdbx_refine_tls.origin_z         -13.3695 
_pdbx_refine_tls.T[1][1]          0.6586 
_pdbx_refine_tls.T[2][2]          0.3383 
_pdbx_refine_tls.T[3][3]          0.3681 
_pdbx_refine_tls.T[1][2]          0.0373 
_pdbx_refine_tls.T[1][3]          0.0033 
_pdbx_refine_tls.T[2][3]          0.0668 
_pdbx_refine_tls.L[1][1]          3.5329 
_pdbx_refine_tls.L[2][2]          0.6603 
_pdbx_refine_tls.L[3][3]          2.3893 
_pdbx_refine_tls.L[1][2]          -0.6469 
_pdbx_refine_tls.L[1][3]          1.5909 
_pdbx_refine_tls.L[2][3]          0.6083 
_pdbx_refine_tls.S[1][1]          -0.1759 
_pdbx_refine_tls.S[1][2]          -0.0134 
_pdbx_refine_tls.S[1][3]          0.1124 
_pdbx_refine_tls.S[2][1]          -0.2899 
_pdbx_refine_tls.S[2][2]          -0.1330 
_pdbx_refine_tls.S[2][3]          -0.0020 
_pdbx_refine_tls.S[3][1]          -0.5503 
_pdbx_refine_tls.S[3][2]          -0.0958 
_pdbx_refine_tls.S[3][3]          0.3088 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     11 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     134 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOLREP phasing          .        ? 1 
REFMAC refinement       5.6.0117 ? 2 
MOSFLM 'data reduction' .        ? 3 
SCALA  'data scaling'   .        ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ILE 14  ? ? CA A ILE 14  ? ? C  A ILE 14  ? ? 97.51  111.60 -14.09 2.00 N 
2  1 CB A PRO 21  ? ? CA A PRO 21  ? ? C  A PRO 21  ? ? 99.01  111.70 -12.69 2.10 N 
3  1 CA A LEU 28  ? ? CB A LEU 28  ? ? CG A LEU 28  ? ? 130.08 115.30 14.78  2.30 N 
4  1 N  A PHE 42  ? ? CA A PHE 42  ? ? C  A PHE 42  ? ? 89.82  111.00 -21.18 2.70 N 
5  1 CB A GLU 56  ? ? CA A GLU 56  ? ? C  A GLU 56  ? ? 91.59  110.40 -18.81 2.00 N 
6  1 C  A LEU 59  ? ? N  A PRO 60  ? ? CA A PRO 60  ? ? 128.92 119.30 9.62   1.50 Y 
7  1 CB A PRO 60  ? ? CA A PRO 60  ? ? C  A PRO 60  ? ? 94.63  111.70 -17.07 2.10 N 
8  1 CB A PRO 61  ? ? CA A PRO 61  ? ? C  A PRO 61  ? ? 97.76  111.70 -13.94 2.10 N 
9  1 CB A LYS 64  ? ? CA A LYS 64  ? ? C  A LYS 64  ? ? 94.24  110.40 -16.16 2.00 N 
10 1 CB A VAL 69  ? ? CA A VAL 69  ? ? C  A VAL 69  ? ? 124.19 111.40 12.79  1.90 N 
11 1 C  A VAL 69  ? ? N  A PRO 70  ? ? CA A PRO 70  ? ? 134.91 119.30 15.61  1.50 Y 
12 1 C  A VAL 69  ? ? N  A PRO 70  ? ? CD A PRO 70  ? ? 109.53 128.40 -18.87 2.10 Y 
13 1 CA A LEU 88  ? ? CB A LEU 88  ? ? CG A LEU 88  ? ? 137.11 115.30 21.81  2.30 N 
14 1 N  A ARG 89  ? ? CA A ARG 89  ? ? C  A ARG 89  ? ? 135.55 111.00 24.55  2.70 N 
15 1 CB A LYS 101 ? ? CA A LYS 101 ? ? C  A LYS 101 ? ? 129.87 110.40 19.47  2.00 N 
16 1 CB A TYR 114 ? ? CA A TYR 114 ? ? C  A TYR 114 ? ? 97.40  110.40 -13.00 2.00 N 
17 1 CB A ASP 116 ? ? CA A ASP 116 ? ? C  A ASP 116 ? ? 124.78 110.40 14.38  2.00 N 
18 1 CB A GLU 132 ? ? CA A GLU 132 ? ? C  A GLU 132 ? ? 137.85 110.40 27.45  2.00 N 
19 1 N  A GLU 132 ? ? CA A GLU 132 ? ? C  A GLU 132 ? ? 89.68  111.00 -21.32 2.70 N 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LYS A 26  ? ? SER A 27  ? ? 146.85  
2 1 LYS A 101 ? ? SER A 102 ? ? -140.34 
3 1 GLU A 132 ? ? THR A 133 ? ? 149.77  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1  ? A GLY 1  
2  1 Y 1 A SER 2  ? A SER 2  
3  1 Y 1 A SER 3  ? A SER 3  
4  1 Y 1 A SER 4  ? A SER 4  
5  1 Y 1 A GLY 5  ? A GLY 5  
6  1 Y 1 A ASN 6  ? A ASN 6  
7  1 Y 1 A THR 7  ? A THR 7  
8  1 Y 1 A HIS 8  ? A HIS 8  
9  1 Y 1 A ASP 9  ? A ASP 9  
10 1 Y 1 A ASP 10 ? A ASP 10 
#