data_3X1T
# 
_entry.id   3X1T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3X1T         
RCSB  RCSB097071   
NDB   NA3318       
WWPDB D_1000097071 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3X1S . unspecified 
PDB 3X1U . unspecified 
PDB 3X1V . unspecified 
# 
_pdbx_database_status.entry_id                        3X1T 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2014-11-27 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sivaraman, P.'   1 
'Kumarevel, T.S.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming' 
_citation.journal_abbrev            Biochem.Biophys.Res.Commun. 
_citation.journal_volume            464 
_citation.page_first                929 
_citation.page_last                 935 
_citation.year                      2015 
_citation.journal_id_ASTM           BBRCA9 
_citation.country                   US 
_citation.journal_id_ISSN           0006-291X 
_citation.journal_id_CSD            0146 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26188507 
_citation.pdbx_database_id_DOI      10.1016/j.bbrc.2015.07.070 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Padavattan, S.' 1 
primary 'Shinagawa, T.'  2 
primary 'Hasegawa, K.'   3 
primary 'Kumasaka, T.'   4 
primary 'Ishii, S.'      5 
primary 'Kumarevel, T.'  6 
# 
_cell.length_a           105.771 
_cell.length_b           109.597 
_cell.length_c           181.597 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3X1T 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3X1T 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'DNA (146-MER)'        45053.855 2   ? ? ? ? 
2 polymer     man 'Histone H3.1'         15305.969 2   ? ? ? ? 
3 polymer     man 'Histone H4'           11263.231 2   ? ? ? ? 
4 polymer     man 'Histone H2A'          13952.184 2   ? ? ? ? 
5 polymer     man 'Histone H2B type 1-A' 14136.502 2   ? ? ? ? 
6 non-polymer syn 'MANGANESE (II) ION'   54.938    22  ? ? ? ? 
7 non-polymer syn 'CHLORIDE ION'         35.453    8   ? ? ? ? 
8 water       nat water                  18.015    113 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 
;Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l
;
5 'Histone H2B, testis, Testis-specific histone H2B' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)
(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)
(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)
(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATTCAGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTGAT
;
I,J ? 
2 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;SGPTKRGGKARAKVKSRSSRAGLQFPVGRVHRLLRQGNYAQRIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKTRITP
RHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHKSQTK
;
;SGPTKRGGKARAKVKSRSSRAGLQFPVGRVHRLLRQGNYAQRIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKTRITP
RHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHKSQTK
;
C,G ? 
5 'polypeptide(L)'        no no 
;PEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
;PEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DT  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DT  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DT  n 
1 76  DC  n 
1 77  DA  n 
1 78  DG  n 
1 79  DC  n 
1 80  DT  n 
1 81  DG  n 
1 82  DA  n 
1 83  DA  n 
1 84  DC  n 
1 85  DA  n 
1 86  DT  n 
1 87  DG  n 
1 88  DC  n 
1 89  DC  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DG  n 
1 95  DA  n 
1 96  DT  n 
1 97  DG  n 
1 98  DG  n 
1 99  DA  n 
1 100 DG  n 
1 101 DC  n 
1 102 DA  n 
1 103 DG  n 
1 104 DT  n 
1 105 DT  n 
1 106 DT  n 
1 107 DC  n 
1 108 DC  n 
1 109 DA  n 
1 110 DA  n 
1 111 DA  n 
1 112 DT  n 
1 113 DA  n 
1 114 DC  n 
1 115 DA  n 
1 116 DC  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DT  n 
1 121 DG  n 
1 122 DG  n 
1 123 DT  n 
1 124 DA  n 
1 125 DG  n 
1 126 DA  n 
1 127 DA  n 
1 128 DT  n 
1 129 DC  n 
1 130 DT  n 
1 131 DG  n 
1 132 DC  n 
1 133 DA  n 
1 134 DG  n 
1 135 DG  n 
1 136 DT  n 
1 137 DG  n 
1 138 DG  n 
1 139 DA  n 
1 140 DT  n 
1 141 DA  n 
1 142 DT  n 
1 143 DT  n 
1 144 DG  n 
1 145 DA  n 
1 146 DT  n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   LYS n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   LYS n 
2 10  SER n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  LYS n 
2 15  ALA n 
2 16  PRO n 
2 17  ARG n 
2 18  LYS n 
2 19  GLN n 
2 20  LEU n 
2 21  ALA n 
2 22  THR n 
2 23  LYS n 
2 24  ALA n 
2 25  ALA n 
2 26  ARG n 
2 27  LYS n 
2 28  SER n 
2 29  ALA n 
2 30  PRO n 
2 31  ALA n 
2 32  THR n 
2 33  GLY n 
2 34  GLY n 
2 35  VAL n 
2 36  LYS n 
2 37  LYS n 
2 38  PRO n 
2 39  HIS n 
2 40  ARG n 
2 41  TYR n 
2 42  ARG n 
2 43  PRO n 
2 44  GLY n 
2 45  THR n 
2 46  VAL n 
2 47  ALA n 
2 48  LEU n 
2 49  ARG n 
2 50  GLU n 
2 51  ILE n 
2 52  ARG n 
2 53  ARG n 
2 54  TYR n 
2 55  GLN n 
2 56  LYS n 
2 57  SER n 
2 58  THR n 
2 59  GLU n 
2 60  LEU n 
2 61  LEU n 
2 62  ILE n 
2 63  ARG n 
2 64  LYS n 
2 65  LEU n 
2 66  PRO n 
2 67  PHE n 
2 68  GLN n 
2 69  ARG n 
2 70  LEU n 
2 71  VAL n 
2 72  ARG n 
2 73  GLU n 
2 74  ILE n 
2 75  ALA n 
2 76  GLN n 
2 77  ASP n 
2 78  PHE n 
2 79  LYS n 
2 80  THR n 
2 81  ASP n 
2 82  LEU n 
2 83  ARG n 
2 84  PHE n 
2 85  GLN n 
2 86  SER n 
2 87  SER n 
2 88  ALA n 
2 89  VAL n 
2 90  MET n 
2 91  ALA n 
2 92  LEU n 
2 93  GLN n 
2 94  GLU n 
2 95  ALA n 
2 96  CYS n 
2 97  GLU n 
2 98  ALA n 
2 99  TYR n 
2 100 LEU n 
2 101 VAL n 
2 102 GLY n 
2 103 LEU n 
2 104 PHE n 
2 105 GLU n 
2 106 ASP n 
2 107 THR n 
2 108 ASN n 
2 109 LEU n 
2 110 CYS n 
2 111 ALA n 
2 112 ILE n 
2 113 HIS n 
2 114 ALA n 
2 115 LYS n 
2 116 ARG n 
2 117 VAL n 
2 118 THR n 
2 119 ILE n 
2 120 MET n 
2 121 PRO n 
2 122 LYS n 
2 123 ASP n 
2 124 ILE n 
2 125 GLN n 
2 126 LEU n 
2 127 ALA n 
2 128 ARG n 
2 129 ARG n 
2 130 ILE n 
2 131 ARG n 
2 132 GLY n 
2 133 GLU n 
2 134 ARG n 
2 135 ALA n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLY n 
3 7   GLY n 
3 8   LYS n 
3 9   GLY n 
3 10  LEU n 
3 11  GLY n 
3 12  LYS n 
3 13  GLY n 
3 14  GLY n 
3 15  ALA n 
3 16  LYS n 
3 17  ARG n 
3 18  HIS n 
3 19  ARG n 
3 20  LYS n 
3 21  VAL n 
3 22  LEU n 
3 23  ARG n 
3 24  ASP n 
3 25  ASN n 
3 26  ILE n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  THR n 
3 31  LYS n 
3 32  PRO n 
3 33  ALA n 
3 34  ILE n 
3 35  ARG n 
3 36  ARG n 
3 37  LEU n 
3 38  ALA n 
3 39  ARG n 
3 40  ARG n 
3 41  GLY n 
3 42  GLY n 
3 43  VAL n 
3 44  LYS n 
3 45  ARG n 
3 46  ILE n 
3 47  SER n 
3 48  GLY n 
3 49  LEU n 
3 50  ILE n 
3 51  TYR n 
3 52  GLU n 
3 53  GLU n 
3 54  THR n 
3 55  ARG n 
3 56  GLY n 
3 57  VAL n 
3 58  LEU n 
3 59  LYS n 
3 60  VAL n 
3 61  PHE n 
3 62  LEU n 
3 63  GLU n 
3 64  ASN n 
3 65  VAL n 
3 66  ILE n 
3 67  ARG n 
3 68  ASP n 
3 69  ALA n 
3 70  VAL n 
3 71  THR n 
3 72  TYR n 
3 73  THR n 
3 74  GLU n 
3 75  HIS n 
3 76  ALA n 
3 77  LYS n 
3 78  ARG n 
3 79  LYS n 
3 80  THR n 
3 81  VAL n 
3 82  THR n 
3 83  ALA n 
3 84  MET n 
3 85  ASP n 
3 86  VAL n 
3 87  VAL n 
3 88  TYR n 
3 89  ALA n 
3 90  LEU n 
3 91  LYS n 
3 92  ARG n 
3 93  GLN n 
3 94  GLY n 
3 95  ARG n 
3 96  THR n 
3 97  LEU n 
3 98  TYR n 
3 99  GLY n 
3 100 PHE n 
3 101 GLY n 
3 102 GLY n 
4 1   SER n 
4 2   GLY n 
4 3   PRO n 
4 4   THR n 
4 5   LYS n 
4 6   ARG n 
4 7   GLY n 
4 8   GLY n 
4 9   LYS n 
4 10  ALA n 
4 11  ARG n 
4 12  ALA n 
4 13  LYS n 
4 14  VAL n 
4 15  LYS n 
4 16  SER n 
4 17  ARG n 
4 18  SER n 
4 19  SER n 
4 20  ARG n 
4 21  ALA n 
4 22  GLY n 
4 23  LEU n 
4 24  GLN n 
4 25  PHE n 
4 26  PRO n 
4 27  VAL n 
4 28  GLY n 
4 29  ARG n 
4 30  VAL n 
4 31  HIS n 
4 32  ARG n 
4 33  LEU n 
4 34  LEU n 
4 35  ARG n 
4 36  GLN n 
4 37  GLY n 
4 38  ASN n 
4 39  TYR n 
4 40  ALA n 
4 41  GLN n 
4 42  ARG n 
4 43  ILE n 
4 44  GLY n 
4 45  ALA n 
4 46  GLY n 
4 47  ALA n 
4 48  PRO n 
4 49  VAL n 
4 50  TYR n 
4 51  LEU n 
4 52  ALA n 
4 53  ALA n 
4 54  VAL n 
4 55  LEU n 
4 56  GLU n 
4 57  TYR n 
4 58  LEU n 
4 59  THR n 
4 60  ALA n 
4 61  GLU n 
4 62  VAL n 
4 63  LEU n 
4 64  GLU n 
4 65  LEU n 
4 66  ALA n 
4 67  GLY n 
4 68  ASN n 
4 69  ALA n 
4 70  ALA n 
4 71  ARG n 
4 72  ASP n 
4 73  ASN n 
4 74  LYS n 
4 75  LYS n 
4 76  THR n 
4 77  ARG n 
4 78  ILE n 
4 79  THR n 
4 80  PRO n 
4 81  ARG n 
4 82  HIS n 
4 83  LEU n 
4 84  GLN n 
4 85  LEU n 
4 86  ALA n 
4 87  ILE n 
4 88  ARG n 
4 89  ASN n 
4 90  ASP n 
4 91  GLU n 
4 92  GLU n 
4 93  LEU n 
4 94  ASN n 
4 95  LYS n 
4 96  LEU n 
4 97  LEU n 
4 98  GLY n 
4 99  ARG n 
4 100 VAL n 
4 101 THR n 
4 102 ILE n 
4 103 ALA n 
4 104 GLN n 
4 105 GLY n 
4 106 GLY n 
4 107 VAL n 
4 108 LEU n 
4 109 PRO n 
4 110 ASN n 
4 111 ILE n 
4 112 GLN n 
4 113 ALA n 
4 114 VAL n 
4 115 LEU n 
4 116 LEU n 
4 117 PRO n 
4 118 LYS n 
4 119 LYS n 
4 120 THR n 
4 121 GLU n 
4 122 SER n 
4 123 HIS n 
4 124 LYS n 
4 125 SER n 
4 126 GLN n 
4 127 THR n 
4 128 LYS n 
5 1   PRO n 
5 2   GLU n 
5 3   VAL n 
5 4   ALA n 
5 5   VAL n 
5 6   LYS n 
5 7   GLY n 
5 8   ALA n 
5 9   THR n 
5 10  ILE n 
5 11  SER n 
5 12  LYS n 
5 13  LYS n 
5 14  GLY n 
5 15  PHE n 
5 16  LYS n 
5 17  LYS n 
5 18  ALA n 
5 19  VAL n 
5 20  THR n 
5 21  LYS n 
5 22  THR n 
5 23  GLN n 
5 24  LYS n 
5 25  LYS n 
5 26  GLU n 
5 27  GLY n 
5 28  ARG n 
5 29  LYS n 
5 30  ARG n 
5 31  LYS n 
5 32  ARG n 
5 33  CYS n 
5 34  ARG n 
5 35  LYS n 
5 36  GLU n 
5 37  SER n 
5 38  TYR n 
5 39  SER n 
5 40  ILE n 
5 41  TYR n 
5 42  ILE n 
5 43  TYR n 
5 44  LYS n 
5 45  VAL n 
5 46  LEU n 
5 47  LYS n 
5 48  GLN n 
5 49  VAL n 
5 50  HIS n 
5 51  PRO n 
5 52  ASP n 
5 53  THR n 
5 54  GLY n 
5 55  ILE n 
5 56  SER n 
5 57  SER n 
5 58  LYS n 
5 59  ALA n 
5 60  MET n 
5 61  SER n 
5 62  ILE n 
5 63  MET n 
5 64  ASN n 
5 65  SER n 
5 66  PHE n 
5 67  VAL n 
5 68  THR n 
5 69  ASP n 
5 70  ILE n 
5 71  PHE n 
5 72  GLU n 
5 73  ARG n 
5 74  ILE n 
5 75  ALA n 
5 76  SER n 
5 77  GLU n 
5 78  ALA n 
5 79  SER n 
5 80  ARG n 
5 81  LEU n 
5 82  ALA n 
5 83  HIS n 
5 84  TYR n 
5 85  ASN n 
5 86  LYS n 
5 87  ARG n 
5 88  SER n 
5 89  THR n 
5 90  ILE n 
5 91  THR n 
5 92  SER n 
5 93  ARG n 
5 94  GLU n 
5 95  ILE n 
5 96  GLN n 
5 97  THR n 
5 98  ALA n 
5 99  VAL n 
5 100 ARG n 
5 101 LEU n 
5 102 LEU n 
5 103 LEU n 
5 104 PRO n 
5 105 GLY n 
5 106 GLU n 
5 107 LEU n 
5 108 ALA n 
5 109 LYS n 
5 110 HIS n 
5 111 ALA n 
5 112 VAL n 
5 113 SER n 
5 114 GLU n 
5 115 GLY n 
5 116 THR n 
5 117 LYS n 
5 118 ALA n 
5 119 VAL n 
5 120 THR n 
5 121 LYS n 
5 122 TYR n 
5 123 THR n 
5 124 SER n 
5 125 SER n 
5 126 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
2 1 sample ? ? ? human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
plasmid ? ? ? ? ? ? 
3 1 sample ? ? ? human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
plasmid ? ? ? ? ? ? 
4 1 sample ? ? ? mouse ? ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
plasmid ? ? ? ? ? ? 
5 1 sample ? ? ? mouse ? ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
plasmid ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    synthetic 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 PDB 3X1T         3X1T   1 ? ? ? 
2 UNP H31_HUMAN    P68431 2 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 ? 
3 UNP H4_HUMAN     P62805 3 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 ? 
4 UNP Q8CGP4_MOUSE Q8CGP4 4 
;SGPTKRGGKARAKVKSRSSRAGLQFPVGRVHRLLRQGNYAQRIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKTRITP
RHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHKSQTK
;
2 ? 
5 UNP H2B1A_MOUSE  P70696 5 
;PEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
2 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3X1T I 1 ? 146 ? 3X1T   1   ? 146 ? 1   146 
2  1 3X1T J 1 ? 146 ? 3X1T   147 ? 292 ? 147 292 
3  2 3X1T A 1 ? 135 ? P68431 2   ? 136 ? 1   135 
4  3 3X1T B 1 ? 102 ? P62805 2   ? 103 ? 1   102 
5  4 3X1T C 1 ? 128 ? Q8CGP4 2   ? 129 ? 1   128 
6  5 3X1T D 1 ? 126 ? P70696 2   ? 127 ? 0   125 
7  2 3X1T E 1 ? 135 ? P68431 2   ? 136 ? 1   135 
8  3 3X1T F 1 ? 102 ? P62805 2   ? 103 ? 1   102 
9  4 3X1T G 1 ? 128 ? Q8CGP4 2   ? 129 ? 1   128 
10 5 3X1T H 1 ? 126 ? P70696 2   ? 127 ? 0   125 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                       ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3X1T 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.64 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   53.39 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '60-70mM Kcl, 70-90mM MnCl2, 24% MPD, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2012-01-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'S II' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
# 
_reflns.entry_id                     3X1T 
_reflns.observed_criterion_sigma_F   2 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            2.80 
_reflns.d_resolution_low             40 
_reflns.number_all                   51865 
_reflns.number_obs                   51865 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.128 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.80 
_reflns_shell.d_res_low                   2.90 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.percent_possible_all        99.1 
_reflns_shell.Rmerge_I_obs                0.72 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_redundancy             7.1 
_reflns_shell.number_unique_all           5066 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3X1T 
_refine.ls_d_res_high                            2.8080 
_refine.ls_d_res_low                             34.9600 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.1600 
_refine.ls_number_reflns_obs                     51778 
_refine.ls_number_reflns_all                     51865 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2124 
_refine.ls_R_factor_R_work                       0.2095 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2657 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0800 
_refine.ls_number_reflns_R_free                  2628 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               73.1979 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.3400 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      1AOI 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                176.690 
_refine.B_iso_min                                14.250 
_refine.pdbx_overall_phase_error                 26.3300 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6058 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             113 
_refine_hist.number_atoms_total               12181 
_refine_hist.d_res_high                       2.8080 
_refine_hist.d_res_low                        34.9600 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           12849 0.005  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          18606 0.744  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     2116  0.029  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      1346  0.003  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 5306  29.198 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
2.8084 2.8595  19 91.0000  2322 . 0.2753 0.3476 . 134 . 2456 . 'X-RAY DIFFRACTION' . 
2.8595 2.9144  19 99.0000  2561 . 0.2564 0.3225 . 127 . 2688 . 'X-RAY DIFFRACTION' . 
2.9144 2.9739  19 99.0000  2569 . 0.2537 0.2774 . 135 . 2704 . 'X-RAY DIFFRACTION' . 
2.9739 3.0385  19 99.0000  2564 . 0.2555 0.3329 . 130 . 2694 . 'X-RAY DIFFRACTION' . 
3.0385 3.1092  19 99.0000  2566 . 0.2544 0.2914 . 138 . 2704 . 'X-RAY DIFFRACTION' . 
3.1092 3.1869  19 100.0000 2567 . 0.2404 0.2851 . 130 . 2697 . 'X-RAY DIFFRACTION' . 
3.1869 3.2730  19 100.0000 2549 . 0.2370 0.2993 . 143 . 2692 . 'X-RAY DIFFRACTION' . 
3.2730 3.3692  19 100.0000 2589 . 0.2279 0.2908 . 144 . 2733 . 'X-RAY DIFFRACTION' . 
3.3692 3.4779  19 100.0000 2588 . 0.2201 0.2616 . 133 . 2721 . 'X-RAY DIFFRACTION' . 
3.4779 3.6020  19 100.0000 2585 . 0.2087 0.2565 . 134 . 2719 . 'X-RAY DIFFRACTION' . 
3.6020 3.7461  19 100.0000 2587 . 0.2027 0.2316 . 156 . 2743 . 'X-RAY DIFFRACTION' . 
3.7461 3.9164  19 100.0000 2573 . 0.2094 0.2736 . 152 . 2725 . 'X-RAY DIFFRACTION' . 
3.9164 4.1226  19 100.0000 2592 . 0.1959 0.2787 . 140 . 2732 . 'X-RAY DIFFRACTION' . 
4.1226 4.3804  19 100.0000 2619 . 0.1894 0.2443 . 134 . 2753 . 'X-RAY DIFFRACTION' . 
4.3804 4.7179  19 100.0000 2596 . 0.2009 0.2355 . 148 . 2744 . 'X-RAY DIFFRACTION' . 
4.7179 5.1913  19 100.0000 2648 . 0.1981 0.3106 . 124 . 2772 . 'X-RAY DIFFRACTION' . 
5.1913 5.9393  19 100.0000 2675 . 0.2176 0.2790 . 121 . 2796 . 'X-RAY DIFFRACTION' . 
5.9393 7.4708  19 100.0000 2652 . 0.2175 0.3071 . 163 . 2815 . 'X-RAY DIFFRACTION' . 
7.4708 34.9627 19 98.0000  2748 . 0.1704 0.2029 . 142 . 2890 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  3X1T 
_struct.title                     
'Crystal structure of nucleosome core particle consisting of mouse testis specific histone variants H2aa and H2ba' 
_struct.pdbx_descriptor           'Histone H3.1, Histone H4, Histone H2A, Histone H2B type 1-A/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3X1T 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            'Histone variants of h2a and h2b, reprogramming, chromatin, STRUCTURAL PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 4 ? 
F  N N 5 ? 
G  N N 2 ? 
H  N N 3 ? 
I  N N 4 ? 
J  N N 5 ? 
K  N N 6 ? 
L  N N 6 ? 
M  N N 6 ? 
N  N N 6 ? 
O  N N 6 ? 
P  N N 6 ? 
Q  N N 6 ? 
R  N N 6 ? 
S  N N 6 ? 
T  N N 6 ? 
U  N N 6 ? 
V  N N 6 ? 
W  N N 6 ? 
X  N N 6 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
BA N N 6 ? 
CA N N 7 ? 
DA N N 7 ? 
EA N N 7 ? 
FA N N 7 ? 
GA N N 7 ? 
HA N N 6 ? 
IA N N 7 ? 
JA N N 6 ? 
KA N N 6 ? 
LA N N 7 ? 
MA N N 7 ? 
NA N N 6 ? 
OA N N 8 ? 
PA N N 8 ? 
QA N N 8 ? 
RA N N 8 ? 
SA N N 8 ? 
TA N N 8 ? 
UA N N 8 ? 
VA N N 8 ? 
WA N N 8 ? 
XA N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 44  ? SER C 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG C 63  ? ASP C 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN C 85  ? ALA C 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET C 120 ? ARG C 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASN D 25  ? ILE D 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  6  THR D 30  ? GLY D 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU D 49  ? ALA D 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR D 82  ? GLN D 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  SER E 16  ? GLY E 22  ? SER C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 10 PRO E 26  ? GLY E 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 ALA E 45  ? ASN E 73  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 12 THR E 79  ? ASN E 89  ? THR C 79  ASN C 89  1 ? 11 
HELX_P HELX_P13 13 ASP E 90  ? LEU E 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN E 112 ? LEU E 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR F 38  ? HIS F 50  ? TYR D 37  HIS D 49  1 ? 13 
HELX_P HELX_P16 16 SER F 56  ? ASN F 85  ? SER D 55  ASN D 84  1 ? 30 
HELX_P HELX_P17 17 THR F 91  ? LEU F 103 ? THR D 90  LEU D 102 1 ? 13 
HELX_P HELX_P18 18 PRO F 104 ? SER F 124 ? PRO D 103 SER D 123 1 ? 21 
HELX_P HELX_P19 19 GLY G 44  ? SER G 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG G 63  ? LYS G 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 21 GLN G 85  ? ALA G 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET G 120 ? GLY G 132 ? MET E 120 GLY E 132 1 ? 13 
HELX_P HELX_P23 23 ASP H 24  ? ILE H 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 24 THR H 30  ? GLY H 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU H 49  ? ALA H 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 26 THR H 82  ? GLN H 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 SER I 16  ? GLY I 22  ? SER G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO I 26  ? GLY I 37  ? PRO G 26  GLY G 37  1 ? 12 
HELX_P HELX_P29 29 ALA I 45  ? ASN I 73  ? ALA G 45  ASN G 73  1 ? 29 
HELX_P HELX_P30 30 THR I 79  ? ASN I 89  ? THR G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 31 ASP I 90  ? LEU I 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN I 112 ? LEU I 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR J 38  ? HIS J 50  ? TYR H 37  HIS H 49  1 ? 13 
HELX_P HELX_P34 34 SER J 56  ? ASN J 85  ? SER H 55  ASN H 84  1 ? 30 
HELX_P HELX_P35 35 THR J 91  ? LEU J 103 ? THR H 90  LEU H 102 1 ? 13 
HELX_P HELX_P36 36 PRO J 104 ? SER J 124 ? PRO H 103 SER H 123 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? B DG  71  N7  ? ? ? 1_555 AA MN  .   MN ? ? J DG  217 J MN  306 1_555 ? ? ? ? ? ? ?               1.948 ? 
metalc2   metalc ? ? A DA  133 N7  ? ? ? 1_555 M  MN  .   MN ? ? I DA  133 I MN  203 1_555 ? ? ? ? ? ? ?               2.137 ? 
metalc3   metalc ? ? A DG  100 N7  ? ? ? 1_555 Q  MN  .   MN ? ? I DG  100 I MN  207 1_555 ? ? ? ? ? ? ?               2.383 ? 
metalc4   metalc ? ? F VAL 49  O   ? ? ? 1_555 JA MN  .   MN ? ? D VAL 48  D MN  201 1_555 ? ? ? ? ? ? ?               2.412 ? 
metalc5   metalc ? ? F VAL 49  O   ? ? ? 1_555 KA MN  .   MN ? ? D VAL 48  D MN  202 1_555 ? ? ? ? ? ? ?               2.490 ? 
metalc6   metalc ? ? B DC  101 N4  ? ? ? 1_555 W  MN  .   MN ? ? J DC  247 J MN  302 1_555 ? ? ? ? ? ? ?               2.526 ? 
metalc7   metalc ? ? B DT  86  OP2 ? ? ? 1_555 BA MN  .   MN ? ? J DT  232 J MN  307 1_555 ? ? ? ? ? ? ?               2.584 ? 
metalc8   metalc ? ? A DG  121 N7  ? ? ? 1_555 L  MN  .   MN ? ? I DG  121 I MN  202 1_555 ? ? ? ? ? ? ?               2.590 ? 
metalc9   metalc ? ? B DG  40  O6  ? ? ? 1_555 Y  MN  .   MN ? ? J DG  186 J MN  304 1_555 ? ? ? ? ? ? ?               2.593 ? 
metalc10  metalc ? ? C ASP 81  OD1 ? ? ? 1_555 HA MN  .   MN ? ? A ASP 81  A MN  201 1_555 ? ? ? ? ? ? ?               2.660 ? 
metalc11  metalc ? ? B DG  39  N7  ? ? ? 1_555 Y  MN  .   MN ? ? J DG  185 J MN  304 1_555 ? ? ? ? ? ? ?               2.704 ? 
metalc12  metalc ? ? A DG  122 O6  ? ? ? 1_555 L  MN  .   MN ? ? I DG  122 I MN  202 1_555 ? ? ? ? ? ? ?               2.739 ? 
metalc13  metalc ? ? B DG  134 N7  ? ? ? 1_555 Z  MN  .   MN ? ? J DG  280 J MN  305 1_555 ? ? ? ? ? ? ?               2.760 ? 
metalc14  metalc ? ? A DG  78  O6  ? ? ? 1_555 N  MN  .   MN ? ? I DG  78  I MN  204 1_555 ? ? ? ? ? ? ?               2.779 ? 
metalc15  metalc ? ? N MN  .   MN  ? ? ? 1_555 PA HOH .   O  ? ? I MN  204 J HOH 401 1_555 ? ? ? ? ? ? ?               2.520 ? 
hydrog1   hydrog ? ? A DT  2   N3  ? ? ? 1_555 B  DA  145 N1 ? ? I DT  2   J DA  291 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? A DT  2   O4  ? ? ? 1_555 B  DA  145 N6 ? ? I DT  2   J DA  291 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? A DC  3   O2  ? ? ? 1_555 B  DG  144 N2 ? ? I DC  3   J DG  290 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog4   hydrog ? ? A DA  4   N1  ? ? ? 1_555 B  DT  143 N3 ? ? I DA  4   J DT  289 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog5   hydrog ? ? A DA  5   N1  ? ? ? 1_555 B  DT  142 N3 ? ? I DA  5   J DT  288 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog6   hydrog ? ? A DT  6   N3  ? ? ? 1_555 B  DA  141 N1 ? ? I DT  6   J DA  287 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? A DT  6   O4  ? ? ? 1_555 B  DA  141 N6 ? ? I DT  6   J DA  287 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? A DA  7   N1  ? ? ? 1_555 B  DT  140 N3 ? ? I DA  7   J DT  286 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? A DA  7   N6  ? ? ? 1_555 B  DT  140 O4 ? ? I DA  7   J DT  286 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? A DT  8   N3  ? ? ? 1_555 B  DA  139 N1 ? ? I DT  8   J DA  285 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? A DT  8   O4  ? ? ? 1_555 B  DA  139 N6 ? ? I DT  8   J DA  285 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? A DC  9   O2  ? ? ? 1_555 B  DG  138 N2 ? ? I DC  9   J DG  284 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog13  hydrog ? ? A DC  10  N4  ? ? ? 1_555 B  DG  137 O6 ? ? I DC  10  J DG  283 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog14  hydrog ? ? A DC  10  N3  ? ? ? 1_555 B  DG  138 N2 ? ? I DC  10  J DG  284 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog15  hydrog ? ? A DA  11  N1  ? ? ? 1_555 B  DT  136 N3 ? ? I DA  11  J DT  282 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? A DA  11  N6  ? ? ? 1_555 B  DT  136 O4 ? ? I DA  11  J DT  282 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? A DC  12  N4  ? ? ? 1_555 B  DG  135 O6 ? ? I DC  12  J DG  281 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog18  hydrog ? ? A DC  13  N3  ? ? ? 1_555 B  DG  134 N1 ? ? I DC  13  J DG  280 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? A DC  13  N4  ? ? ? 1_555 B  DG  134 O6 ? ? I DC  13  J DG  280 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? A DC  13  O2  ? ? ? 1_555 B  DG  134 N2 ? ? I DC  13  J DG  280 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? A DT  14  N3  ? ? ? 1_555 B  DA  133 N1 ? ? I DT  14  J DA  279 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? A DT  14  O4  ? ? ? 1_555 B  DA  133 N6 ? ? I DT  14  J DA  279 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? A DG  15  N1  ? ? ? 1_555 B  DC  132 N3 ? ? I DG  15  J DC  278 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? A DG  15  N2  ? ? ? 1_555 B  DC  132 O2 ? ? I DG  15  J DC  278 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? A DG  15  O6  ? ? ? 1_555 B  DC  132 N4 ? ? I DG  15  J DC  278 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? A DC  16  N3  ? ? ? 1_555 B  DG  131 N1 ? ? I DC  16  J DG  277 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? A DC  16  N4  ? ? ? 1_555 B  DG  131 O6 ? ? I DC  16  J DG  277 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? A DC  16  O2  ? ? ? 1_555 B  DG  131 N2 ? ? I DC  16  J DG  277 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? A DA  17  N1  ? ? ? 1_555 B  DT  130 N3 ? ? I DA  17  J DT  276 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? A DA  17  N6  ? ? ? 1_555 B  DT  130 O4 ? ? I DA  17  J DT  276 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? A DG  18  N2  ? ? ? 1_555 B  DC  129 O2 ? ? I DG  18  J DC  275 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog32  hydrog ? ? A DA  19  N1  ? ? ? 1_555 B  DT  128 N3 ? ? I DA  19  J DT  274 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog33  hydrog ? ? A DC  22  N4  ? ? ? 1_555 B  DG  125 O6 ? ? I DC  22  J DG  271 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog34  hydrog ? ? A DT  23  N3  ? ? ? 1_555 B  DA  124 N1 ? ? I DT  23  J DA  270 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog35  hydrog ? ? A DA  24  N1  ? ? ? 1_555 B  DT  123 N3 ? ? I DA  24  J DT  269 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? A DA  24  N6  ? ? ? 1_555 B  DT  123 O4 ? ? I DA  24  J DT  269 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? A DC  25  N4  ? ? ? 1_555 B  DG  121 O6 ? ? I DC  25  J DG  267 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog38  hydrog ? ? A DC  25  O2  ? ? ? 1_555 B  DG  122 N2 ? ? I DC  25  J DG  268 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog39  hydrog ? ? A DC  26  O2  ? ? ? 1_555 B  DG  121 N2 ? ? I DC  26  J DG  267 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog40  hydrog ? ? A DA  27  N1  ? ? ? 1_555 B  DT  120 N3 ? ? I DA  27  J DT  266 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog41  hydrog ? ? A DA  28  N1  ? ? ? 1_555 B  DT  119 N3 ? ? I DA  28  J DT  265 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? A DA  28  N6  ? ? ? 1_555 B  DT  119 O4 ? ? I DA  28  J DT  265 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? A DA  29  N1  ? ? ? 1_555 B  DT  118 N3 ? ? I DA  29  J DT  264 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? A DA  29  N6  ? ? ? 1_555 B  DT  118 O4 ? ? I DA  29  J DT  264 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? A DA  30  N1  ? ? ? 1_555 B  DT  117 N3 ? ? I DA  30  J DT  263 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog46  hydrog ? ? A DG  31  N1  ? ? ? 1_555 B  DC  116 N3 ? ? I DG  31  J DC  262 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? A DG  31  N2  ? ? ? 1_555 B  DC  116 O2 ? ? I DG  31  J DC  262 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? A DG  31  O6  ? ? ? 1_555 B  DC  116 N4 ? ? I DG  31  J DC  262 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? A DT  32  N3  ? ? ? 1_555 B  DA  115 N1 ? ? I DT  32  J DA  261 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? A DT  32  O4  ? ? ? 1_555 B  DA  115 N6 ? ? I DT  32  J DA  261 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? A DG  33  N1  ? ? ? 1_555 B  DC  114 N3 ? ? I DG  33  J DC  260 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog52  hydrog ? ? A DT  34  N3  ? ? ? 1_555 B  DA  113 N1 ? ? I DT  34  J DA  259 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog53  hydrog ? ? A DA  35  N1  ? ? ? 1_555 B  DT  112 N3 ? ? I DA  35  J DT  258 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? A DA  35  N6  ? ? ? 1_555 B  DT  112 O4 ? ? I DA  35  J DT  258 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? A DT  36  N3  ? ? ? 1_555 B  DA  111 N1 ? ? I DT  36  J DA  257 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? A DT  36  O4  ? ? ? 1_555 B  DA  111 N6 ? ? I DT  36  J DA  257 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? A DT  37  N3  ? ? ? 1_555 B  DA  110 N1 ? ? I DT  37  J DA  256 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? A DT  37  O4  ? ? ? 1_555 B  DA  110 N6 ? ? I DT  37  J DA  256 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? A DT  38  N3  ? ? ? 1_555 B  DA  109 N1 ? ? I DT  38  J DA  255 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? A DT  38  O4  ? ? ? 1_555 B  DA  109 N6 ? ? I DT  38  J DA  255 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? A DG  39  N2  ? ? ? 1_555 B  DC  108 O2 ? ? I DG  39  J DC  254 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog62  hydrog ? ? A DG  40  N1  ? ? ? 1_555 B  DC  107 N3 ? ? I DG  40  J DC  253 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? A DG  40  N2  ? ? ? 1_555 B  DC  107 O2 ? ? I DG  40  J DC  253 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? A DG  40  O6  ? ? ? 1_555 B  DC  107 N4 ? ? I DG  40  J DC  253 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? A DA  41  N1  ? ? ? 1_555 B  DT  106 N3 ? ? I DA  41  J DT  252 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? A DA  41  N6  ? ? ? 1_555 B  DT  106 O4 ? ? I DA  41  J DT  252 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? A DA  42  N6  ? ? ? 1_555 B  DT  105 O4 ? ? I DA  42  J DT  251 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog68  hydrog ? ? A DC  44  O2  ? ? ? 1_555 B  DG  103 N2 ? ? I DC  44  J DG  249 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog69  hydrog ? ? A DT  45  N3  ? ? ? 1_555 B  DA  102 N1 ? ? I DT  45  J DA  248 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? A DT  45  O4  ? ? ? 1_555 B  DA  102 N6 ? ? I DT  45  J DA  248 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? A DG  46  N1  ? ? ? 1_555 B  DC  101 N3 ? ? I DG  46  J DC  247 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog72  hydrog ? ? A DC  47  N3  ? ? ? 1_555 B  DG  100 N1 ? ? I DC  47  J DG  246 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? A DC  47  N4  ? ? ? 1_555 B  DG  100 O6 ? ? I DC  47  J DG  246 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? A DC  47  O2  ? ? ? 1_555 B  DG  100 N2 ? ? I DC  47  J DG  246 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? A DT  48  N3  ? ? ? 1_555 B  DA  99  N1 ? ? I DT  48  J DA  245 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog76  hydrog ? ? A DC  49  O2  ? ? ? 1_555 B  DG  98  N2 ? ? I DC  49  J DG  244 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog77  hydrog ? ? A DC  50  N3  ? ? ? 1_555 B  DG  97  N1 ? ? I DC  50  J DG  243 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? A DC  50  N4  ? ? ? 1_555 B  DG  97  O6 ? ? I DC  50  J DG  243 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? A DC  50  O2  ? ? ? 1_555 B  DG  97  N2 ? ? I DC  50  J DG  243 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? A DA  51  N1  ? ? ? 1_555 B  DT  96  N3 ? ? I DA  51  J DT  242 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog81  hydrog ? ? A DT  52  N3  ? ? ? 1_555 B  DA  95  N1 ? ? I DT  52  J DA  241 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? A DT  52  O4  ? ? ? 1_555 B  DA  95  N6 ? ? I DT  52  J DA  241 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? A DC  53  N3  ? ? ? 1_555 B  DG  94  N1 ? ? I DC  53  J DG  240 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? A DC  53  N4  ? ? ? 1_555 B  DG  94  O6 ? ? I DC  53  J DG  240 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? A DC  53  O2  ? ? ? 1_555 B  DG  94  N2 ? ? I DC  53  J DG  240 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? A DA  54  N1  ? ? ? 1_555 B  DT  93  N3 ? ? I DA  54  J DT  239 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? A DA  54  N6  ? ? ? 1_555 B  DT  93  O4 ? ? I DA  54  J DT  239 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? A DA  55  N1  ? ? ? 1_555 B  DT  92  N3 ? ? I DA  55  J DT  238 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog89  hydrog ? ? A DA  56  N1  ? ? ? 1_555 B  DT  91  N3 ? ? I DA  56  J DT  237 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog90  hydrog ? ? A DA  57  N1  ? ? ? 1_555 B  DT  90  N3 ? ? I DA  57  J DT  236 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog91  hydrog ? ? A DG  58  N1  ? ? ? 1_555 B  DC  89  N3 ? ? I DG  58  J DC  235 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? A DG  58  N2  ? ? ? 1_555 B  DC  89  O2 ? ? I DG  58  J DC  235 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? A DG  58  O6  ? ? ? 1_555 B  DC  89  N4 ? ? I DG  58  J DC  235 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? A DG  59  N1  ? ? ? 1_555 B  DC  88  N3 ? ? I DG  59  J DC  234 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? A DG  59  N2  ? ? ? 1_555 B  DC  88  O2 ? ? I DG  59  J DC  234 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? A DG  59  O6  ? ? ? 1_555 B  DC  88  N4 ? ? I DG  59  J DC  234 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? A DC  60  N3  ? ? ? 1_555 B  DG  87  N1 ? ? I DC  60  J DG  233 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? A DC  60  N4  ? ? ? 1_555 B  DG  87  O6 ? ? I DC  60  J DG  233 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? A DC  60  O2  ? ? ? 1_555 B  DG  87  N2 ? ? I DC  60  J DG  233 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? A DA  61  N1  ? ? ? 1_555 B  DT  86  N3 ? ? I DA  61  J DT  232 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? A DA  61  N6  ? ? ? 1_555 B  DT  86  O4 ? ? I DA  61  J DT  232 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? A DT  62  N3  ? ? ? 1_555 B  DA  85  N1 ? ? I DT  62  J DA  231 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? A DT  62  O4  ? ? ? 1_555 B  DA  85  N6 ? ? I DT  62  J DA  231 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? A DG  63  N1  ? ? ? 1_555 B  DC  84  N3 ? ? I DG  63  J DC  230 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? A DG  63  N2  ? ? ? 1_555 B  DC  84  O2 ? ? I DG  63  J DC  230 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? A DG  63  O6  ? ? ? 1_555 B  DC  84  N4 ? ? I DG  63  J DC  230 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? A DT  64  N3  ? ? ? 1_555 B  DA  83  N1 ? ? I DT  64  J DA  229 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? A DT  64  O4  ? ? ? 1_555 B  DA  83  N6 ? ? I DT  64  J DA  229 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? A DT  65  N3  ? ? ? 1_555 B  DA  82  N1 ? ? I DT  65  J DA  228 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog110 hydrog ? ? A DC  66  O2  ? ? ? 1_555 B  DG  81  N2 ? ? I DC  66  J DG  227 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog111 hydrog ? ? A DA  67  N1  ? ? ? 1_555 B  DT  80  N3 ? ? I DA  67  J DT  226 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? A DA  67  N6  ? ? ? 1_555 B  DT  80  O4 ? ? I DA  67  J DT  226 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? A DG  68  N1  ? ? ? 1_555 B  DC  79  N3 ? ? I DG  68  J DC  225 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? A DG  68  N2  ? ? ? 1_555 B  DC  79  O2 ? ? I DG  68  J DC  225 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? A DG  68  O6  ? ? ? 1_555 B  DC  79  N4 ? ? I DG  68  J DC  225 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? A DC  69  N3  ? ? ? 1_555 B  DG  78  N1 ? ? I DC  69  J DG  224 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? A DC  69  N4  ? ? ? 1_555 B  DG  78  O6 ? ? I DC  69  J DG  224 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? A DC  69  O2  ? ? ? 1_555 B  DG  78  N2 ? ? I DC  69  J DG  224 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? A DT  70  N3  ? ? ? 1_555 B  DA  77  N1 ? ? I DT  70  J DA  223 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? A DT  70  O4  ? ? ? 1_555 B  DA  77  N6 ? ? I DT  70  J DA  223 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? A DG  71  N1  ? ? ? 1_555 B  DC  76  N3 ? ? I DG  71  J DC  222 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog122 hydrog ? ? A DA  72  N1  ? ? ? 1_555 B  DT  75  N3 ? ? I DA  72  J DT  221 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog123 hydrog ? ? A DA  73  N1  ? ? ? 1_555 B  DT  74  N3 ? ? I DA  73  J DT  220 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? A DA  73  N6  ? ? ? 1_555 B  DT  74  O4 ? ? I DA  73  J DT  220 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? A DT  74  N3  ? ? ? 1_555 B  DA  73  N1 ? ? I DT  74  J DA  219 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? A DT  74  O4  ? ? ? 1_555 B  DA  73  N6 ? ? I DT  74  J DA  219 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? A DT  75  N3  ? ? ? 1_555 B  DA  72  N1 ? ? I DT  75  J DA  218 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? A DT  75  O4  ? ? ? 1_555 B  DA  72  N6 ? ? I DT  75  J DA  218 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? A DC  76  N3  ? ? ? 1_555 B  DG  71  N1 ? ? I DC  76  J DG  217 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? A DC  76  N4  ? ? ? 1_555 B  DG  71  O6 ? ? I DC  76  J DG  217 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? A DC  76  O2  ? ? ? 1_555 B  DG  71  N2 ? ? I DC  76  J DG  217 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? A DA  77  N1  ? ? ? 1_555 B  DT  70  N3 ? ? I DA  77  J DT  216 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? A DA  77  N6  ? ? ? 1_555 B  DT  70  O4 ? ? I DA  77  J DT  216 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? A DG  78  N1  ? ? ? 1_555 B  DC  69  N3 ? ? I DG  78  J DC  215 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? A DG  78  N2  ? ? ? 1_555 B  DC  69  O2 ? ? I DG  78  J DC  215 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? A DG  78  O6  ? ? ? 1_555 B  DC  69  N4 ? ? I DG  78  J DC  215 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? A DC  79  N3  ? ? ? 1_555 B  DG  68  N1 ? ? I DC  79  J DG  214 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? A DC  79  N4  ? ? ? 1_555 B  DG  68  O6 ? ? I DC  79  J DG  214 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? A DC  79  O2  ? ? ? 1_555 B  DG  68  N2 ? ? I DC  79  J DG  214 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? A DT  80  N3  ? ? ? 1_555 B  DA  67  N1 ? ? I DT  80  J DA  213 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? A DT  80  O4  ? ? ? 1_555 B  DA  67  N6 ? ? I DT  80  J DA  213 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? A DG  81  N1  ? ? ? 1_555 B  DC  66  N3 ? ? I DG  81  J DC  212 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? A DG  81  N2  ? ? ? 1_555 B  DC  66  O2 ? ? I DG  81  J DC  212 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? A DG  81  O6  ? ? ? 1_555 B  DC  66  N4 ? ? I DG  81  J DC  212 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? A DA  82  N1  ? ? ? 1_555 B  DT  65  N3 ? ? I DA  82  J DT  211 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog146 hydrog ? ? A DA  83  N1  ? ? ? 1_555 B  DT  64  N3 ? ? I DA  83  J DT  210 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? A DA  83  N6  ? ? ? 1_555 B  DT  64  O4 ? ? I DA  83  J DT  210 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? A DC  84  N3  ? ? ? 1_555 B  DG  63  N1 ? ? I DC  84  J DG  209 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? A DC  84  N4  ? ? ? 1_555 B  DG  63  O6 ? ? I DC  84  J DG  209 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? A DC  84  O2  ? ? ? 1_555 B  DG  63  N2 ? ? I DC  84  J DG  209 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? A DA  85  N1  ? ? ? 1_555 B  DT  62  N3 ? ? I DA  85  J DT  208 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog152 hydrog ? ? A DT  86  N3  ? ? ? 1_555 B  DA  61  N1 ? ? I DT  86  J DA  207 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? A DT  86  O4  ? ? ? 1_555 B  DA  61  N6 ? ? I DT  86  J DA  207 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? A DG  87  N1  ? ? ? 1_555 B  DC  60  N3 ? ? I DG  87  J DC  206 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? A DG  87  N2  ? ? ? 1_555 B  DC  60  O2 ? ? I DG  87  J DC  206 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? A DG  87  O6  ? ? ? 1_555 B  DC  60  N4 ? ? I DG  87  J DC  206 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? A DC  88  O2  ? ? ? 1_555 B  DG  59  N2 ? ? I DC  88  J DG  205 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog158 hydrog ? ? A DC  89  N3  ? ? ? 1_555 B  DG  58  N1 ? ? I DC  89  J DG  204 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? A DC  89  N4  ? ? ? 1_555 B  DG  58  O6 ? ? I DC  89  J DG  204 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? A DC  89  O2  ? ? ? 1_555 B  DG  58  N2 ? ? I DC  89  J DG  204 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? A DT  90  N3  ? ? ? 1_555 B  DA  57  N1 ? ? I DT  90  J DA  203 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? A DT  90  O4  ? ? ? 1_555 B  DA  57  N6 ? ? I DT  90  J DA  203 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? A DT  91  N3  ? ? ? 1_555 B  DA  56  N1 ? ? I DT  91  J DA  202 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog164 hydrog ? ? A DT  92  N3  ? ? ? 1_555 B  DA  55  N1 ? ? I DT  92  J DA  201 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog165 hydrog ? ? A DT  93  N3  ? ? ? 1_555 B  DA  54  N1 ? ? I DT  93  J DA  200 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? A DT  93  O4  ? ? ? 1_555 B  DA  54  N6 ? ? I DT  93  J DA  200 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? A DG  94  N1  ? ? ? 1_555 B  DC  53  N3 ? ? I DG  94  J DC  199 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? A DG  94  N2  ? ? ? 1_555 B  DC  53  O2 ? ? I DG  94  J DC  199 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? A DG  94  O6  ? ? ? 1_555 B  DC  53  N4 ? ? I DG  94  J DC  199 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? A DA  95  N1  ? ? ? 1_555 B  DT  52  N3 ? ? I DA  95  J DT  198 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? A DA  95  N6  ? ? ? 1_555 B  DT  52  O4 ? ? I DA  95  J DT  198 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? A DT  96  N3  ? ? ? 1_555 B  DA  51  N1 ? ? I DT  96  J DA  197 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? A DT  96  O4  ? ? ? 1_555 B  DA  51  N6 ? ? I DT  96  J DA  197 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? A DG  97  N1  ? ? ? 1_555 B  DC  50  N3 ? ? I DG  97  J DC  196 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog175 hydrog ? ? A DG  98  N1  ? ? ? 1_555 B  DC  49  N3 ? ? I DG  98  J DC  195 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog176 hydrog ? ? A DA  99  N6  ? ? ? 1_555 B  DC  47  N3 ? ? I DA  99  J DC  193 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog177 hydrog ? ? A DA  99  N1  ? ? ? 1_555 B  DT  48  N3 ? ? I DA  99  J DT  194 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? A DA  99  N6  ? ? ? 1_555 B  DT  48  O4 ? ? I DA  99  J DT  194 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? A DG  100 N1  ? ? ? 1_555 B  DC  47  N3 ? ? I DG  100 J DC  193 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog180 hydrog ? ? A DC  101 O2  ? ? ? 1_555 B  DG  46  N2 ? ? I DC  101 J DG  192 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog181 hydrog ? ? A DA  102 N1  ? ? ? 1_555 B  DT  45  N3 ? ? I DA  102 J DT  191 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog182 hydrog ? ? A DG  103 N1  ? ? ? 1_555 B  DC  44  N3 ? ? I DG  103 J DC  190 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? A DG  103 N2  ? ? ? 1_555 B  DC  44  O2 ? ? I DG  103 J DC  190 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? A DG  103 O6  ? ? ? 1_555 B  DC  44  N4 ? ? I DG  103 J DC  190 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? A DT  104 N3  ? ? ? 1_555 B  DA  43  N1 ? ? I DT  104 J DA  189 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? A DT  104 O4  ? ? ? 1_555 B  DA  43  N6 ? ? I DT  104 J DA  189 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? A DT  105 N3  ? ? ? 1_555 B  DA  42  N1 ? ? I DT  105 J DA  188 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? A DT  105 O4  ? ? ? 1_555 B  DA  42  N6 ? ? I DT  105 J DA  188 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? A DT  106 N3  ? ? ? 1_555 B  DA  41  N1 ? ? I DT  106 J DA  187 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog190 hydrog ? ? A DC  107 N4  ? ? ? 1_555 B  DG  39  O6 ? ? I DC  107 J DG  185 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog191 hydrog ? ? A DC  107 O2  ? ? ? 1_555 B  DG  40  N2 ? ? I DC  107 J DG  186 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog192 hydrog ? ? A DC  108 N3  ? ? ? 1_555 B  DG  39  N1 ? ? I DC  108 J DG  185 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? A DC  108 N4  ? ? ? 1_555 B  DG  39  O6 ? ? I DC  108 J DG  185 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? A DC  108 O2  ? ? ? 1_555 B  DG  39  N2 ? ? I DC  108 J DG  185 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? A DA  109 N1  ? ? ? 1_555 B  DT  38  N3 ? ? I DA  109 J DT  184 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? A DA  109 N6  ? ? ? 1_555 B  DT  38  O4 ? ? I DA  109 J DT  184 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? A DA  110 N1  ? ? ? 1_555 B  DT  37  N3 ? ? I DA  110 J DT  183 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? A DA  110 N6  ? ? ? 1_555 B  DT  37  O4 ? ? I DA  110 J DT  183 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? A DA  111 N1  ? ? ? 1_555 B  DT  36  N3 ? ? I DA  111 J DT  182 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? A DA  111 N6  ? ? ? 1_555 B  DT  36  O4 ? ? I DA  111 J DT  182 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? A DT  112 N3  ? ? ? 1_555 B  DA  35  N1 ? ? I DT  112 J DA  181 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? A DT  112 O4  ? ? ? 1_555 B  DA  35  N6 ? ? I DT  112 J DA  181 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? A DA  113 N1  ? ? ? 1_555 B  DT  34  N3 ? ? I DA  113 J DT  180 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? A DA  113 N6  ? ? ? 1_555 B  DT  34  O4 ? ? I DA  113 J DT  180 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? A DC  114 N3  ? ? ? 1_555 B  DG  33  N1 ? ? I DC  114 J DG  179 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? A DC  114 N4  ? ? ? 1_555 B  DG  33  O6 ? ? I DC  114 J DG  179 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? A DC  114 O2  ? ? ? 1_555 B  DG  33  N2 ? ? I DC  114 J DG  179 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? A DA  115 N1  ? ? ? 1_555 B  DT  32  N3 ? ? I DA  115 J DT  178 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog209 hydrog ? ? A DC  116 N3  ? ? ? 1_555 B  DG  31  N1 ? ? I DC  116 J DG  177 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? A DC  116 N4  ? ? ? 1_555 B  DG  31  O6 ? ? I DC  116 J DG  177 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? A DC  116 O2  ? ? ? 1_555 B  DG  31  N2 ? ? I DC  116 J DG  177 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? A DT  117 N3  ? ? ? 1_555 B  DA  30  N1 ? ? I DT  117 J DA  176 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? A DT  117 O4  ? ? ? 1_555 B  DA  30  N6 ? ? I DT  117 J DA  176 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? A DT  118 N3  ? ? ? 1_555 B  DA  29  N1 ? ? I DT  118 J DA  175 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? A DT  118 O4  ? ? ? 1_555 B  DA  29  N6 ? ? I DT  118 J DA  175 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? A DT  119 N3  ? ? ? 1_555 B  DA  28  N1 ? ? I DT  119 J DA  174 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? A DT  119 O4  ? ? ? 1_555 B  DA  28  N6 ? ? I DT  119 J DA  174 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? A DT  120 N3  ? ? ? 1_555 B  DA  27  N1 ? ? I DT  120 J DA  173 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? A DT  120 O4  ? ? ? 1_555 B  DA  27  N6 ? ? I DT  120 J DA  173 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? A DG  121 O6  ? ? ? 1_555 B  DC  26  N4 ? ? I DG  121 J DC  172 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog221 hydrog ? ? A DG  122 N1  ? ? ? 1_555 B  DC  25  N3 ? ? I DG  122 J DC  171 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? A DG  122 N2  ? ? ? 1_555 B  DC  25  O2 ? ? I DG  122 J DC  171 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? A DG  122 O6  ? ? ? 1_555 B  DC  25  N4 ? ? I DG  122 J DC  171 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? A DG  122 N2  ? ? ? 1_555 B  DC  26  O2 ? ? I DG  122 J DC  172 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog225 hydrog ? ? A DT  123 N3  ? ? ? 1_555 B  DA  24  N1 ? ? I DT  123 J DA  170 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? A DT  123 O4  ? ? ? 1_555 B  DA  24  N6 ? ? I DT  123 J DA  170 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? A DG  125 O6  ? ? ? 1_555 B  DC  22  N4 ? ? I DG  125 J DC  168 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog228 hydrog ? ? A DG  125 N2  ? ? ? 1_555 B  DT  23  O2 ? ? I DG  125 J DT  169 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog229 hydrog ? ? A DA  126 N1  ? ? ? 1_555 B  DT  21  N3 ? ? I DA  126 J DT  167 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? A DA  126 N6  ? ? ? 1_555 B  DT  21  O4 ? ? I DA  126 J DT  167 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? A DA  127 N1  ? ? ? 1_555 B  DT  20  N3 ? ? I DA  127 J DT  166 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? A DA  127 N6  ? ? ? 1_555 B  DT  20  O4 ? ? I DA  127 J DT  166 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? A DT  128 N3  ? ? ? 1_555 B  DA  19  N1 ? ? I DT  128 J DA  165 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog234 hydrog ? ? A DC  129 O2  ? ? ? 1_555 B  DA  17  N6 ? ? I DC  129 J DA  163 1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
hydrog235 hydrog ? ? A DC  129 O2  ? ? ? 1_555 B  DG  18  N2 ? ? I DC  129 J DG  164 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog236 hydrog ? ? A DT  130 N3  ? ? ? 1_555 B  DA  17  N1 ? ? I DT  130 J DA  163 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? A DT  130 O4  ? ? ? 1_555 B  DA  17  N6 ? ? I DT  130 J DA  163 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? A DG  131 N1  ? ? ? 1_555 B  DC  16  N3 ? ? I DG  131 J DC  162 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? A DG  131 N2  ? ? ? 1_555 B  DC  16  O2 ? ? I DG  131 J DC  162 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? A DG  131 O6  ? ? ? 1_555 B  DC  16  N4 ? ? I DG  131 J DC  162 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? A DC  132 N3  ? ? ? 1_555 B  DG  15  N1 ? ? I DC  132 J DG  161 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? A DC  132 N4  ? ? ? 1_555 B  DG  15  O6 ? ? I DC  132 J DG  161 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? A DC  132 O2  ? ? ? 1_555 B  DG  15  N2 ? ? I DC  132 J DG  161 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? A DA  133 N1  ? ? ? 1_555 B  DT  14  N3 ? ? I DA  133 J DT  160 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? A DA  133 N6  ? ? ? 1_555 B  DT  14  O4 ? ? I DA  133 J DT  160 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? A DG  134 N1  ? ? ? 1_555 B  DC  13  N3 ? ? I DG  134 J DC  159 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? A DG  134 N2  ? ? ? 1_555 B  DC  13  O2 ? ? I DG  134 J DC  159 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? A DG  134 O6  ? ? ? 1_555 B  DC  13  N4 ? ? I DG  134 J DC  159 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? A DG  135 N1  ? ? ? 1_555 B  DC  12  N3 ? ? I DG  135 J DC  158 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? A DG  135 N2  ? ? ? 1_555 B  DC  12  O2 ? ? I DG  135 J DC  158 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? A DG  135 O6  ? ? ? 1_555 B  DC  12  N4 ? ? I DG  135 J DC  158 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? A DT  136 N3  ? ? ? 1_555 B  DA  11  N1 ? ? I DT  136 J DA  157 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog253 hydrog ? ? A DG  137 N1  ? ? ? 1_555 B  DC  10  N3 ? ? I DG  137 J DC  156 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog254 hydrog ? ? A DG  138 N1  ? ? ? 1_555 B  DC  9   N3 ? ? I DG  138 J DC  155 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog255 hydrog ? ? A DG  138 N2  ? ? ? 1_555 B  DC  10  O2 ? ? I DG  138 J DC  156 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog256 hydrog ? ? A DA  139 N1  ? ? ? 1_555 B  DT  8   N3 ? ? I DA  139 J DT  154 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog257 hydrog ? ? A DT  140 N3  ? ? ? 1_555 B  DA  7   N1 ? ? I DT  140 J DA  153 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? A DT  140 O4  ? ? ? 1_555 B  DA  7   N6 ? ? I DT  140 J DA  153 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? A DA  141 N1  ? ? ? 1_555 B  DT  6   N3 ? ? I DA  141 J DT  152 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog260 hydrog ? ? A DT  142 N3  ? ? ? 1_555 B  DA  5   N1 ? ? I DT  142 J DA  151 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? A DT  142 O4  ? ? ? 1_555 B  DA  5   N6 ? ? I DT  142 J DA  151 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? A DT  143 N3  ? ? ? 1_555 B  DA  4   N1 ? ? I DT  143 J DA  150 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog263 hydrog ? ? A DG  144 N1  ? ? ? 1_555 B  DC  3   N3 ? ? I DG  144 J DC  149 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? A DG  144 N2  ? ? ? 1_555 B  DC  3   O2 ? ? I DG  144 J DC  149 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? A DG  144 O6  ? ? ? 1_555 B  DC  3   N4 ? ? I DG  144 J DC  149 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? A DA  145 N1  ? ? ? 1_555 B  DA  1   N6 ? ? I DA  145 J DA  147 1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
hydrog267 hydrog ? ? A DT  146 O4  ? ? ? 1_555 B  DA  1   N6 ? ? I DT  146 J DA  147 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 83  ? PHE C 84  ? ARG A 83  PHE A 84  
A 2 THR D 80  ? VAL D 81  ? THR B 80  VAL B 81  
B 1 THR C 118 ? ILE C 119 ? THR A 118 ILE A 119 
B 2 ARG D 45  ? ILE D 46  ? ARG B 45  ILE B 46  
C 1 THR D 96  ? TYR D 98  ? THR B 96  TYR B 98  
C 2 VAL I 100 ? ILE I 102 ? VAL G 100 ILE G 102 
D 1 ARG E 42  ? ILE E 43  ? ARG C 42  ILE C 43  
D 2 THR F 89  ? ILE F 90  ? THR D 88  ILE D 89  
E 1 ARG E 77  ? ILE E 78  ? ARG C 77  ILE C 78  
E 2 GLY F 54  ? ILE F 55  ? GLY D 53  ILE D 54  
F 1 VAL E 100 ? ILE E 102 ? VAL C 100 ILE C 102 
F 2 THR H 96  ? TYR H 98  ? THR F 96  TYR F 98  
G 1 ARG G 83  ? PHE G 84  ? ARG E 83  PHE E 84  
G 2 THR H 80  ? VAL H 81  ? THR F 80  VAL F 81  
H 1 THR G 118 ? ILE G 119 ? THR E 118 ILE E 119 
H 2 ARG H 45  ? ILE H 46  ? ARG F 45  ILE F 46  
I 1 ARG I 42  ? ILE I 43  ? ARG G 42  ILE G 43  
I 2 THR J 89  ? ILE J 90  ? THR H 88  ILE H 89  
J 1 ARG I 77  ? ILE I 78  ? ARG G 77  ILE G 78  
J 2 GLY J 54  ? ILE J 55  ? GLY H 53  ILE H 54  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 83  ? N ARG A 83  O VAL D 81  ? O VAL B 81  
B 1 2 N ILE C 119 ? N ILE A 119 O ARG D 45  ? O ARG B 45  
C 1 2 N THR D 96  ? N THR B 96  O THR I 101 ? O THR G 101 
D 1 2 N ARG E 42  ? N ARG C 42  O ILE F 90  ? O ILE D 89  
E 1 2 N ILE E 78  ? N ILE C 78  O GLY F 54  ? O GLY D 53  
F 1 2 N THR E 101 ? N THR C 101 O THR H 96  ? O THR F 96  
G 1 2 N ARG G 83  ? N ARG E 83  O VAL H 81  ? O VAL F 81  
H 1 2 N ILE G 119 ? N ILE E 119 O ARG H 45  ? O ARG F 45  
I 1 2 N ARG I 42  ? N ARG G 42  O ILE J 90  ? O ILE H 89  
J 1 2 N ILE I 78  ? N ILE G 78  O GLY J 54  ? O GLY H 53  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 201' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN I 202' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 203' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 204' 
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 206' 
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 207' 
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN I 209' 
AC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 210' 
AC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 301' 
BC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 302' 
BC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 304' 
BC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 305' 
BC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 306' 
BC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 307' 
BC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL J 308' 
BC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL J 312' 
BC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN A 201' 
BC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL B 201' 
CC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN D 201' 
CC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN D 202' 
CC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL D 203' 
CC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN G 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1 DG  A  68  ? DG  I 68  . ? 1_555 ? 
2  AC2 4 DG  A  121 ? DG  I 121 . ? 1_555 ? 
3  AC2 4 DG  A  122 ? DG  I 122 . ? 1_555 ? 
4  AC2 4 MN  S  .   ? MN  I 209 . ? 1_555 ? 
5  AC2 4 DC  B  25  ? DC  J 171 . ? 1_555 ? 
6  AC3 2 DA  A  133 ? DA  I 133 . ? 1_555 ? 
7  AC3 2 MN  P  .   ? MN  I 206 . ? 1_555 ? 
8  AC4 2 DG  A  78  ? DG  I 78  . ? 1_555 ? 
9  AC4 2 HOH PA .   ? HOH J 401 . ? 1_555 ? 
10 AC5 1 MN  M  .   ? MN  I 203 . ? 1_555 ? 
11 AC6 2 DG  A  100 ? DG  I 100 . ? 1_555 ? 
12 AC6 2 HOH OA .   ? HOH I 301 . ? 1_555 ? 
13 AC7 3 DG  A  121 ? DG  I 121 . ? 1_555 ? 
14 AC7 3 MN  L  .   ? MN  I 202 . ? 1_555 ? 
15 AC7 3 MN  T  .   ? MN  I 210 . ? 1_555 ? 
16 AC8 2 DT  A  120 ? DT  I 120 . ? 1_555 ? 
17 AC8 2 MN  S  .   ? MN  I 209 . ? 1_555 ? 
18 AC9 2 DG  B  18  ? DG  J 164 . ? 1_555 ? 
19 AC9 2 DA  B  19  ? DA  J 165 . ? 1_555 ? 
20 BC1 1 DC  B  101 ? DC  J 247 . ? 1_555 ? 
21 BC2 2 DG  B  39  ? DG  J 185 . ? 1_555 ? 
22 BC2 2 DG  B  40  ? DG  J 186 . ? 1_555 ? 
23 BC3 1 DG  B  134 ? DG  J 280 . ? 1_555 ? 
24 BC4 1 DG  B  71  ? DG  J 217 . ? 1_555 ? 
25 BC5 2 DA  B  85  ? DA  J 231 . ? 1_555 ? 
26 BC5 2 DT  B  86  ? DT  J 232 . ? 1_555 ? 
27 BC6 2 DG  B  121 ? DG  J 267 . ? 1_555 ? 
28 BC6 2 DG  B  122 ? DG  J 268 . ? 1_555 ? 
29 BC7 1 DG  B  122 ? DG  J 268 . ? 1_555 ? 
30 BC8 1 ASP C  81  ? ASP A 81  . ? 1_555 ? 
31 BC9 1 HOH QA .   ? HOH A 305 . ? 1_555 ? 
32 CC1 4 GLU E  64  ? GLU C 64  . ? 1_555 ? 
33 CC1 4 VAL F  49  ? VAL D 48  . ? 1_555 ? 
34 CC1 4 MN  KA .   ? MN  D 202 . ? 1_555 ? 
35 CC1 4 ASP G  77  ? ASP E 77  . ? 3_544 ? 
36 CC2 4 GLN F  48  ? GLN D 47  . ? 1_555 ? 
37 CC2 4 VAL F  49  ? VAL D 48  . ? 1_555 ? 
38 CC2 4 MN  JA .   ? MN  D 201 . ? 1_555 ? 
39 CC2 4 ASP G  77  ? ASP E 77  . ? 3_544 ? 
40 CC3 4 GLY E  44  ? GLY C 44  . ? 1_555 ? 
41 CC3 4 GLY E  46  ? GLY C 46  . ? 1_555 ? 
42 CC3 4 THR F  91  ? THR D 90  . ? 1_555 ? 
43 CC3 4 SER F  92  ? SER D 91  . ? 1_555 ? 
44 CC4 6 GLY I  44  ? GLY G 44  . ? 1_555 ? 
45 CC4 6 ALA I  45  ? ALA G 45  . ? 1_555 ? 
46 CC4 6 GLY I  46  ? GLY G 46  . ? 1_555 ? 
47 CC4 6 ALA I  47  ? ALA G 47  . ? 1_555 ? 
48 CC4 6 THR J  91  ? THR H 90  . ? 1_555 ? 
49 CC4 6 SER J  92  ? SER H 91  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3X1T 
_atom_sites.fract_transf_matrix[1][1]   0.009454 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009124 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005507 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DA  A  1 1   ? 0.238   0.273   -94.921 1.00 142.87 ? 1   DA  I "O5'" 1 
ATOM   2     C  "C5'" . DA  A  1 1   ? 1.245   -0.044  -93.963 1.00 142.29 ? 1   DA  I "C5'" 1 
ATOM   3     C  "C4'" . DA  A  1 1   ? 2.587   0.531   -94.381 1.00 138.90 ? 1   DA  I "C4'" 1 
ATOM   4     O  "O4'" . DA  A  1 1   ? 2.462   1.970   -94.553 1.00 139.80 ? 1   DA  I "O4'" 1 
ATOM   5     C  "C3'" . DA  A  1 1   ? 3.718   0.334   -93.370 1.00 130.12 ? 1   DA  I "C3'" 1 
ATOM   6     O  "O3'" . DA  A  1 1   ? 4.958   0.187   -94.052 1.00 133.13 ? 1   DA  I "O3'" 1 
ATOM   7     C  "C2'" . DA  A  1 1   ? 3.673   1.634   -92.588 1.00 128.88 ? 1   DA  I "C2'" 1 
ATOM   8     C  "C1'" . DA  A  1 1   ? 3.378   2.621   -93.701 1.00 131.77 ? 1   DA  I "C1'" 1 
ATOM   9     N  N9    . DA  A  1 1   ? 2.783   3.859   -93.218 1.00 129.98 ? 1   DA  I N9    1 
ATOM   10    C  C8    . DA  A  1 1   ? 1.539   4.021   -92.675 1.00 134.25 ? 1   DA  I C8    1 
ATOM   11    N  N7    . DA  A  1 1   ? 1.278   5.254   -92.312 1.00 127.86 ? 1   DA  I N7    1 
ATOM   12    C  C5    . DA  A  1 1   ? 2.434   5.945   -92.635 1.00 125.29 ? 1   DA  I C5    1 
ATOM   13    C  C6    . DA  A  1 1   ? 2.802   7.297   -92.497 1.00 119.66 ? 1   DA  I C6    1 
ATOM   14    N  N6    . DA  A  1 1   ? 1.996   8.229   -91.981 1.00 119.45 ? 1   DA  I N6    1 
ATOM   15    N  N1    . DA  A  1 1   ? 4.033   7.656   -92.921 1.00 117.45 ? 1   DA  I N1    1 
ATOM   16    C  C2    . DA  A  1 1   ? 4.832   6.721   -93.447 1.00 120.01 ? 1   DA  I C2    1 
ATOM   17    N  N3    . DA  A  1 1   ? 4.601   5.422   -93.620 1.00 125.06 ? 1   DA  I N3    1 
ATOM   18    C  C4    . DA  A  1 1   ? 3.372   5.097   -93.191 1.00 125.39 ? 1   DA  I C4    1 
ATOM   19    P  P     . DT  A  1 2   ? 6.328   -0.015  -93.231 1.00 137.88 ? 2   DT  I P     1 
ATOM   20    O  OP1   . DT  A  1 2   ? 7.076   -1.110  -93.886 1.00 138.67 ? 2   DT  I OP1   1 
ATOM   21    O  OP2   . DT  A  1 2   ? 6.034   -0.097  -91.783 1.00 133.11 ? 2   DT  I OP2   1 
ATOM   22    O  "O5'" . DT  A  1 2   ? 7.125   1.345   -93.475 1.00 122.66 ? 2   DT  I "O5'" 1 
ATOM   23    C  "C5'" . DT  A  1 2   ? 8.405   1.520   -92.894 1.00 121.45 ? 2   DT  I "C5'" 1 
ATOM   24    C  "C4'" . DT  A  1 2   ? 9.150   2.658   -93.562 1.00 123.34 ? 2   DT  I "C4'" 1 
ATOM   25    O  "O4'" . DT  A  1 2   ? 8.308   3.839   -93.580 1.00 122.72 ? 2   DT  I "O4'" 1 
ATOM   26    C  "C3'" . DT  A  1 2   ? 10.418  3.086   -92.847 1.00 118.44 ? 2   DT  I "C3'" 1 
ATOM   27    O  "O3'" . DT  A  1 2   ? 11.314  3.697   -93.764 1.00 120.62 ? 2   DT  I "O3'" 1 
ATOM   28    C  "C2'" . DT  A  1 2   ? 9.883   4.091   -91.839 1.00 116.06 ? 2   DT  I "C2'" 1 
ATOM   29    C  "C1'" . DT  A  1 2   ? 8.795   4.790   -92.649 1.00 114.56 ? 2   DT  I "C1'" 1 
ATOM   30    N  N1    . DT  A  1 2   ? 7.657   5.260   -91.814 1.00 111.94 ? 2   DT  I N1    1 
ATOM   31    C  C2    . DT  A  1 2   ? 7.480   6.609   -91.617 1.00 109.57 ? 2   DT  I C2    1 
ATOM   32    O  O2    . DT  A  1 2   ? 8.204   7.457   -92.109 1.00 103.02 ? 2   DT  I O2    1 
ATOM   33    N  N3    . DT  A  1 2   ? 6.409   6.936   -90.826 1.00 110.94 ? 2   DT  I N3    1 
ATOM   34    C  C4    . DT  A  1 2   ? 5.518   6.064   -90.223 1.00 114.96 ? 2   DT  I C4    1 
ATOM   35    O  O4    . DT  A  1 2   ? 4.583   6.453   -89.529 1.00 112.41 ? 2   DT  I O4    1 
ATOM   36    C  C5    . DT  A  1 2   ? 5.767   4.663   -90.466 1.00 115.74 ? 2   DT  I C5    1 
ATOM   37    C  C7    . DT  A  1 2   ? 4.871   3.624   -89.861 1.00 121.64 ? 2   DT  I C7    1 
ATOM   38    C  C6    . DT  A  1 2   ? 6.813   4.333   -91.238 1.00 115.35 ? 2   DT  I C6    1 
ATOM   39    P  P     . DC  A  1 3   ? 12.854  3.240   -93.807 1.00 130.18 ? 3   DC  I P     1 
ATOM   40    O  OP1   . DC  A  1 3   ? 13.217  3.018   -95.224 1.00 136.62 ? 3   DC  I OP1   1 
ATOM   41    O  OP2   . DC  A  1 3   ? 13.017  2.150   -92.819 1.00 134.10 ? 3   DC  I OP2   1 
ATOM   42    O  "O5'" . DC  A  1 3   ? 13.658  4.518   -93.282 1.00 115.74 ? 3   DC  I "O5'" 1 
ATOM   43    C  "C5'" . DC  A  1 3   ? 13.209  5.214   -92.133 1.00 115.41 ? 3   DC  I "C5'" 1 
ATOM   44    C  "C4'" . DC  A  1 3   ? 13.511  6.693   -92.254 1.00 112.46 ? 3   DC  I "C4'" 1 
ATOM   45    O  "O4'" . DC  A  1 3   ? 12.340  7.457   -91.885 1.00 112.30 ? 3   DC  I "O4'" 1 
ATOM   46    C  "C3'" . DC  A  1 3   ? 14.600  7.192   -91.331 1.00 106.35 ? 3   DC  I "C3'" 1 
ATOM   47    O  "O3'" . DC  A  1 3   ? 15.143  8.396   -91.843 1.00 109.97 ? 3   DC  I "O3'" 1 
ATOM   48    C  "C2'" . DC  A  1 3   ? 13.827  7.429   -90.036 1.00 105.95 ? 3   DC  I "C2'" 1 
ATOM   49    C  "C1'" . DC  A  1 3   ? 12.475  7.930   -90.555 1.00 106.83 ? 3   DC  I "C1'" 1 
ATOM   50    N  N1    . DC  A  1 3   ? 11.308  7.433   -89.763 1.00 105.05 ? 3   DC  I N1    1 
ATOM   51    C  C2    . DC  A  1 3   ? 10.251  8.301   -89.468 1.00 97.56  ? 3   DC  I C2    1 
ATOM   52    O  O2    . DC  A  1 3   ? 10.303  9.472   -89.865 1.00 90.80  ? 3   DC  I O2    1 
ATOM   53    N  N3    . DC  A  1 3   ? 9.196   7.831   -88.754 1.00 96.14  ? 3   DC  I N3    1 
ATOM   54    C  C4    . DC  A  1 3   ? 9.178   6.560   -88.344 1.00 101.50 ? 3   DC  I C4    1 
ATOM   55    N  N4    . DC  A  1 3   ? 8.118   6.142   -87.642 1.00 103.76 ? 3   DC  I N4    1 
ATOM   56    C  C5    . DC  A  1 3   ? 10.247  5.661   -88.636 1.00 104.29 ? 3   DC  I C5    1 
ATOM   57    C  C6    . DC  A  1 3   ? 11.280  6.135   -89.340 1.00 106.95 ? 3   DC  I C6    1 
ATOM   58    P  P     . DA  A  1 4   ? 16.602  8.883   -91.383 1.00 115.36 ? 4   DA  I P     1 
ATOM   59    O  OP1   . DA  A  1 4   ? 17.480  8.934   -92.573 1.00 114.45 ? 4   DA  I OP1   1 
ATOM   60    O  OP2   . DA  A  1 4   ? 16.987  8.092   -90.192 1.00 103.31 ? 4   DA  I OP2   1 
ATOM   61    O  "O5'" . DA  A  1 4   ? 16.356  10.373  -90.891 1.00 107.45 ? 4   DA  I "O5'" 1 
ATOM   62    C  "C5'" . DA  A  1 4   ? 16.777  10.754  -89.609 1.00 103.94 ? 4   DA  I "C5'" 1 
ATOM   63    C  "C4'" . DA  A  1 4   ? 16.042  11.995  -89.168 1.00 97.02  ? 4   DA  I "C4'" 1 
ATOM   64    O  "O4'" . DA  A  1 4   ? 14.665  11.657  -88.863 1.00 90.56  ? 4   DA  I "O4'" 1 
ATOM   65    C  "C3'" . DA  A  1 4   ? 16.591  12.631  -87.912 1.00 90.68  ? 4   DA  I "C3'" 1 
ATOM   66    O  "O3'" . DA  A  1 4   ? 16.319  14.012  -87.925 1.00 91.27  ? 4   DA  I "O3'" 1 
ATOM   67    C  "C2'" . DA  A  1 4   ? 15.817  11.909  -86.816 1.00 93.62  ? 4   DA  I "C2'" 1 
ATOM   68    C  "C1'" . DA  A  1 4   ? 14.449  11.717  -87.466 1.00 93.92  ? 4   DA  I "C1'" 1 
ATOM   69    N  N9    . DA  A  1 4   ? 13.771  10.488  -87.052 1.00 91.52  ? 4   DA  I N9    1 
ATOM   70    C  C8    . DA  A  1 4   ? 14.259  9.213   -87.129 1.00 93.99  ? 4   DA  I C8    1 
ATOM   71    N  N7    . DA  A  1 4   ? 13.425  8.300   -86.686 1.00 89.74  ? 4   DA  I N7    1 
ATOM   72    C  C5    . DA  A  1 4   ? 12.313  9.027   -86.293 1.00 90.01  ? 4   DA  I C5    1 
ATOM   73    C  C6    . DA  A  1 4   ? 11.074  8.646   -85.735 1.00 85.16  ? 4   DA  I C6    1 
ATOM   74    N  N6    . DA  A  1 4   ? 10.745  7.378   -85.468 1.00 85.33  ? 4   DA  I N6    1 
ATOM   75    N  N1    . DA  A  1 4   ? 10.185  9.622   -85.460 1.00 81.34  ? 4   DA  I N1    1 
ATOM   76    C  C2    . DA  A  1 4   ? 10.516  10.890  -85.726 1.00 83.10  ? 4   DA  I C2    1 
ATOM   77    N  N3    . DA  A  1 4   ? 11.643  11.370  -86.249 1.00 89.30  ? 4   DA  I N3    1 
ATOM   78    C  C4    . DA  A  1 4   ? 12.509  10.377  -86.512 1.00 90.35  ? 4   DA  I C4    1 
ATOM   79    P  P     . DA  A  1 5   ? 17.265  15.016  -87.109 1.00 106.92 ? 5   DA  I P     1 
ATOM   80    O  OP1   . DA  A  1 5   ? 17.582  16.170  -87.981 1.00 102.18 ? 5   DA  I OP1   1 
ATOM   81    O  OP2   . DA  A  1 5   ? 18.351  14.196  -86.522 1.00 99.88  ? 5   DA  I OP2   1 
ATOM   82    O  "O5'" . DA  A  1 5   ? 16.336  15.511  -85.910 1.00 103.48 ? 5   DA  I "O5'" 1 
ATOM   83    C  "C5'" . DA  A  1 5   ? 14.973  15.840  -86.156 1.00 100.17 ? 5   DA  I "C5'" 1 
ATOM   84    C  "C4'" . DA  A  1 5   ? 14.215  15.948  -84.851 1.00 93.79  ? 5   DA  I "C4'" 1 
ATOM   85    O  "O4'" . DA  A  1 5   ? 13.562  14.682  -84.561 1.00 92.51  ? 5   DA  I "O4'" 1 
ATOM   86    C  "C3'" . DA  A  1 5   ? 15.088  16.262  -83.638 1.00 90.45  ? 5   DA  I "C3'" 1 
ATOM   87    O  "O3'" . DA  A  1 5   ? 14.410  17.167  -82.779 1.00 93.83  ? 5   DA  I "O3'" 1 
ATOM   88    C  "C2'" . DA  A  1 5   ? 15.272  14.893  -82.987 1.00 85.73  ? 5   DA  I "C2'" 1 
ATOM   89    C  "C1'" . DA  A  1 5   ? 13.923  14.253  -83.268 1.00 87.68  ? 5   DA  I "C1'" 1 
ATOM   90    N  N9    . DA  A  1 5   ? 13.948  12.793  -83.253 1.00 85.57  ? 5   DA  I N9    1 
ATOM   91    C  C8    . DA  A  1 5   ? 14.976  11.983  -83.640 1.00 86.03  ? 5   DA  I C8    1 
ATOM   92    N  N7    . DA  A  1 5   ? 14.718  10.702  -83.519 1.00 82.87  ? 5   DA  I N7    1 
ATOM   93    C  C5    . DA  A  1 5   ? 13.430  10.668  -83.014 1.00 82.86  ? 5   DA  I C5    1 
ATOM   94    C  C6    . DA  A  1 5   ? 12.574  9.604   -82.659 1.00 83.24  ? 5   DA  I C6    1 
ATOM   95    N  N6    . DA  A  1 5   ? 12.912  8.315   -82.769 1.00 77.84  ? 5   DA  I N6    1 
ATOM   96    N  N1    . DA  A  1 5   ? 11.351  9.919   -82.185 1.00 84.37  ? 5   DA  I N1    1 
ATOM   97    C  C2    . DA  A  1 5   ? 11.014  11.210  -82.075 1.00 81.76  ? 5   DA  I C2    1 
ATOM   98    N  N3    . DA  A  1 5   ? 11.730  12.293  -82.375 1.00 77.60  ? 5   DA  I N3    1 
ATOM   99    C  C4    . DA  A  1 5   ? 12.939  11.950  -82.843 1.00 84.05  ? 5   DA  I C4    1 
ATOM   100   P  P     . DT  A  1 6   ? 15.232  18.286  -81.972 1.00 98.83  ? 6   DT  I P     1 
ATOM   101   O  OP1   . DT  A  1 6   ? 14.690  19.614  -82.342 1.00 97.05  ? 6   DT  I OP1   1 
ATOM   102   O  OP2   . DT  A  1 6   ? 16.673  17.995  -82.147 1.00 106.69 ? 6   DT  I OP2   1 
ATOM   103   O  "O5'" . DT  A  1 6   ? 14.877  17.976  -80.451 1.00 89.90  ? 6   DT  I "O5'" 1 
ATOM   104   C  "C5'" . DT  A  1 6   ? 14.879  16.635  -80.001 1.00 88.75  ? 6   DT  I "C5'" 1 
ATOM   105   C  "C4'" . DT  A  1 6   ? 13.585  16.309  -79.290 1.00 82.67  ? 6   DT  I "C4'" 1 
ATOM   106   O  "O4'" . DT  A  1 6   ? 13.091  15.017  -79.738 1.00 87.96  ? 6   DT  I "O4'" 1 
ATOM   107   C  "C3'" . DT  A  1 6   ? 13.712  16.217  -77.777 1.00 79.18  ? 6   DT  I "C3'" 1 
ATOM   108   O  "O3'" . DT  A  1 6   ? 12.571  16.769  -77.160 1.00 75.61  ? 6   DT  I "O3'" 1 
ATOM   109   C  "C2'" . DT  A  1 6   ? 13.822  14.718  -77.528 1.00 80.93  ? 6   DT  I "C2'" 1 
ATOM   110   C  "C1'" . DT  A  1 6   ? 12.946  14.148  -78.634 1.00 83.85  ? 6   DT  I "C1'" 1 
ATOM   111   N  N1    . DT  A  1 6   ? 13.347  12.767  -79.050 1.00 77.12  ? 6   DT  I N1    1 
ATOM   112   C  C2    . DT  A  1 6   ? 12.458  11.728  -78.888 1.00 82.73  ? 6   DT  I C2    1 
ATOM   113   O  O2    . DT  A  1 6   ? 11.337  11.871  -78.431 1.00 82.41  ? 6   DT  I O2    1 
ATOM   114   N  N3    . DT  A  1 6   ? 12.927  10.504  -79.291 1.00 82.39  ? 6   DT  I N3    1 
ATOM   115   C  C4    . DT  A  1 6   ? 14.170  10.220  -79.822 1.00 80.92  ? 6   DT  I C4    1 
ATOM   116   O  O4    . DT  A  1 6   ? 14.497  9.086   -80.154 1.00 78.87  ? 6   DT  I O4    1 
ATOM   117   C  C5    . DT  A  1 6   ? 15.056  11.353  -79.961 1.00 82.54  ? 6   DT  I C5    1 
ATOM   118   C  C7    . DT  A  1 6   ? 16.433  11.169  -80.526 1.00 78.52  ? 6   DT  I C7    1 
ATOM   119   C  C6    . DT  A  1 6   ? 14.607  12.557  -79.570 1.00 79.46  ? 6   DT  I C6    1 
ATOM   120   P  P     . DA  A  1 7   ? 12.574  17.044  -75.579 1.00 81.14  ? 7   DA  I P     1 
ATOM   121   O  OP1   . DA  A  1 7   ? 11.849  18.316  -75.353 1.00 80.13  ? 7   DA  I OP1   1 
ATOM   122   O  OP2   . DA  A  1 7   ? 13.963  16.889  -75.089 1.00 82.77  ? 7   DA  I OP2   1 
ATOM   123   O  "O5'" . DA  A  1 7   ? 11.702  15.842  -74.997 1.00 71.83  ? 7   DA  I "O5'" 1 
ATOM   124   C  "C5'" . DA  A  1 7   ? 10.387  15.648  -75.483 1.00 74.50  ? 7   DA  I "C5'" 1 
ATOM   125   C  "C4'" . DA  A  1 7   ? 9.782   14.370  -74.940 1.00 69.46  ? 7   DA  I "C4'" 1 
ATOM   126   O  "O4'" . DA  A  1 7   ? 10.454  13.224  -75.515 1.00 72.32  ? 7   DA  I "O4'" 1 
ATOM   127   C  "C3'" . DA  A  1 7   ? 9.867   14.205  -73.431 1.00 71.24  ? 7   DA  I "C3'" 1 
ATOM   128   O  "O3'" . DA  A  1 7   ? 8.650   13.653  -72.957 1.00 76.02  ? 7   DA  I "O3'" 1 
ATOM   129   C  "C2'" . DA  A  1 7   ? 11.043  13.244  -73.249 1.00 79.58  ? 7   DA  I "C2'" 1 
ATOM   130   C  "C1'" . DA  A  1 7   ? 10.934  12.379  -74.493 1.00 81.07  ? 7   DA  I "C1'" 1 
ATOM   131   N  N9    . DA  A  1 7   ? 12.211  11.830  -74.936 1.00 83.10  ? 7   DA  I N9    1 
ATOM   132   C  C8    . DA  A  1 7   ? 13.374  12.517  -75.131 1.00 80.59  ? 7   DA  I C8    1 
ATOM   133   N  N7    . DA  A  1 7   ? 14.366  11.771  -75.550 1.00 80.58  ? 7   DA  I N7    1 
ATOM   134   C  C5    . DA  A  1 7   ? 13.815  10.505  -75.641 1.00 82.45  ? 7   DA  I C5    1 
ATOM   135   C  C6    . DA  A  1 7   ? 14.353  9.263   -76.028 1.00 87.41  ? 7   DA  I C6    1 
ATOM   136   N  N6    . DA  A  1 7   ? 15.623  9.099   -76.411 1.00 89.97  ? 7   DA  I N6    1 
ATOM   137   N  N1    . DA  A  1 7   ? 13.533  8.194   -76.006 1.00 86.41  ? 7   DA  I N1    1 
ATOM   138   C  C2    . DA  A  1 7   ? 12.266  8.362   -75.617 1.00 84.17  ? 7   DA  I C2    1 
ATOM   139   N  N3    . DA  A  1 7   ? 11.645  9.478   -75.237 1.00 81.20  ? 7   DA  I N3    1 
ATOM   140   C  C4    . DA  A  1 7   ? 12.485  10.523  -75.269 1.00 81.24  ? 7   DA  I C4    1 
ATOM   141   P  P     . DT  A  1 8   ? 8.484   13.241  -71.416 1.00 83.23  ? 8   DT  I P     1 
ATOM   142   O  OP1   . DT  A  1 8   ? 7.061   13.400  -71.049 1.00 79.30  ? 8   DT  I OP1   1 
ATOM   143   O  OP2   . DT  A  1 8   ? 9.534   13.924  -70.624 1.00 76.56  ? 8   DT  I OP2   1 
ATOM   144   O  "O5'" . DT  A  1 8   ? 8.784   11.684  -71.435 1.00 83.10  ? 8   DT  I "O5'" 1 
ATOM   145   C  "C5'" . DT  A  1 8   ? 8.176   10.867  -72.424 1.00 87.04  ? 8   DT  I "C5'" 1 
ATOM   146   C  "C4'" . DT  A  1 8   ? 8.273   9.413   -72.026 1.00 95.07  ? 8   DT  I "C4'" 1 
ATOM   147   O  "O4'" . DT  A  1 8   ? 9.479   8.832   -72.598 1.00 89.44  ? 8   DT  I "O4'" 1 
ATOM   148   C  "C3'" . DT  A  1 8   ? 8.376   9.186   -70.522 1.00 101.46 ? 8   DT  I "C3'" 1 
ATOM   149   O  "O3'" . DT  A  1 8   ? 7.710   7.973   -70.167 1.00 107.99 ? 8   DT  I "O3'" 1 
ATOM   150   C  "C2'" . DT  A  1 8   ? 9.885   9.091   -70.313 1.00 92.63  ? 8   DT  I "C2'" 1 
ATOM   151   C  "C1'" . DT  A  1 8   ? 10.293  8.327   -71.561 1.00 91.51  ? 8   DT  I "C1'" 1 
ATOM   152   N  N1    . DT  A  1 8   ? 11.716  8.515   -71.933 1.00 86.07  ? 8   DT  I N1    1 
ATOM   153   C  C2    . DT  A  1 8   ? 12.430  7.446   -72.421 1.00 87.79  ? 8   DT  I C2    1 
ATOM   154   O  O2    . DT  A  1 8   ? 11.950  6.335   -72.578 1.00 84.38  ? 8   DT  I O2    1 
ATOM   155   N  N3    . DT  A  1 8   ? 13.734  7.725   -72.732 1.00 85.80  ? 8   DT  I N3    1 
ATOM   156   C  C4    . DT  A  1 8   ? 14.383  8.940   -72.600 1.00 86.54  ? 8   DT  I C4    1 
ATOM   157   O  O4    . DT  A  1 8   ? 15.561  9.092   -72.905 1.00 89.10  ? 8   DT  I O4    1 
ATOM   158   C  C5    . DT  A  1 8   ? 13.577  10.018  -72.077 1.00 89.17  ? 8   DT  I C5    1 
ATOM   159   C  C7    . DT  A  1 8   ? 14.172  11.384  -71.889 1.00 85.79  ? 8   DT  I C7    1 
ATOM   160   C  C6    . DT  A  1 8   ? 12.297  9.755   -71.771 1.00 86.59  ? 8   DT  I C6    1 
ATOM   161   P  P     . DC  A  1 9   ? 7.280   7.691   -68.642 1.00 111.39 ? 9   DC  I P     1 
ATOM   162   O  OP1   . DC  A  1 9   ? 5.830   7.396   -68.628 1.00 110.87 ? 9   DC  I OP1   1 
ATOM   163   O  OP2   . DC  A  1 9   ? 7.827   8.774   -67.792 1.00 103.33 ? 9   DC  I OP2   1 
ATOM   164   O  "O5'" . DC  A  1 9   ? 8.067   6.356   -68.288 1.00 91.00  ? 9   DC  I "O5'" 1 
ATOM   165   C  "C5'" . DC  A  1 9   ? 9.341   6.153   -68.844 1.00 96.19  ? 9   DC  I "C5'" 1 
ATOM   166   C  "C4'" . DC  A  1 9   ? 9.668   4.690   -68.926 1.00 102.17 ? 9   DC  I "C4'" 1 
ATOM   167   O  "O4'" . DC  A  1 9   ? 10.870  4.513   -69.710 1.00 93.78  ? 9   DC  I "O4'" 1 
ATOM   168   C  "C3'" . DC  A  1 9   ? 9.956   4.057   -67.586 1.00 108.23 ? 9   DC  I "C3'" 1 
ATOM   169   O  "O3'" . DC  A  1 9   ? 9.600   2.698   -67.608 1.00 104.87 ? 9   DC  I "O3'" 1 
ATOM   170   C  "C2'" . DC  A  1 9   ? 11.463  4.257   -67.420 1.00 102.86 ? 9   DC  I "C2'" 1 
ATOM   171   C  "C1'" . DC  A  1 9   ? 11.980  4.310   -68.860 1.00 94.44  ? 9   DC  I "C1'" 1 
ATOM   172   N  N1    . DC  A  1 9   ? 12.968  5.407   -69.089 1.00 91.02  ? 9   DC  I N1    1 
ATOM   173   C  C2    . DC  A  1 9   ? 14.123  5.152   -69.831 1.00 97.53  ? 9   DC  I C2    1 
ATOM   174   O  O2    . DC  A  1 9   ? 14.297  4.021   -70.299 1.00 100.37 ? 9   DC  I O2    1 
ATOM   175   N  N3    . DC  A  1 9   ? 15.018  6.154   -70.021 1.00 97.34  ? 9   DC  I N3    1 
ATOM   176   C  C4    . DC  A  1 9   ? 14.791  7.360   -69.499 1.00 89.92  ? 9   DC  I C4    1 
ATOM   177   N  N4    . DC  A  1 9   ? 15.700  8.315   -69.713 1.00 91.06  ? 9   DC  I N4    1 
ATOM   178   C  C5    . DC  A  1 9   ? 13.622  7.638   -68.735 1.00 88.64  ? 9   DC  I C5    1 
ATOM   179   C  C6    . DC  A  1 9   ? 12.749  6.642   -68.554 1.00 92.52  ? 9   DC  I C6    1 
ATOM   180   P  P     . DC  A  1 10  ? 9.302   1.933   -66.232 1.00 106.78 ? 10  DC  I P     1 
ATOM   181   O  OP1   . DC  A  1 10  ? 7.950   1.340   -66.339 1.00 106.24 ? 10  DC  I OP1   1 
ATOM   182   O  OP2   . DC  A  1 10  ? 9.606   2.862   -65.118 1.00 103.12 ? 10  DC  I OP2   1 
ATOM   183   O  "O5'" . DC  A  1 10  ? 10.405  0.780   -66.221 1.00 109.81 ? 10  DC  I "O5'" 1 
ATOM   184   C  "C5'" . DC  A  1 10  ? 11.238  0.603   -67.358 1.00 106.49 ? 10  DC  I "C5'" 1 
ATOM   185   C  "C4'" . DC  A  1 10  ? 12.571  0.011   -66.959 1.00 107.49 ? 10  DC  I "C4'" 1 
ATOM   186   O  "O4'" . DC  A  1 10  ? 13.644  0.905   -67.357 1.00 102.85 ? 10  DC  I "O4'" 1 
ATOM   187   C  "C3'" . DC  A  1 10  ? 12.743  -0.235  -65.462 1.00 111.68 ? 10  DC  I "C3'" 1 
ATOM   188   O  "O3'" . DC  A  1 10  ? 13.386  -1.499  -65.266 1.00 122.25 ? 10  DC  I "O3'" 1 
ATOM   189   C  "C2'" . DC  A  1 10  ? 13.613  0.943   -65.014 1.00 106.58 ? 10  DC  I "C2'" 1 
ATOM   190   C  "C1'" . DC  A  1 10  ? 14.464  1.201   -66.248 1.00 103.72 ? 10  DC  I "C1'" 1 
ATOM   191   N  N1    . DC  A  1 10  ? 14.925  2.616   -66.373 1.00 105.88 ? 10  DC  I N1    1 
ATOM   192   C  C2    . DC  A  1 10  ? 15.985  2.926   -67.234 1.00 107.76 ? 10  DC  I C2    1 
ATOM   193   O  O2    . DC  A  1 10  ? 16.527  2.017   -67.876 1.00 107.70 ? 10  DC  I O2    1 
ATOM   194   N  N3    . DC  A  1 10  ? 16.389  4.219   -67.340 1.00 106.60 ? 10  DC  I N3    1 
ATOM   195   C  C4    . DC  A  1 10  ? 15.777  5.172   -66.631 1.00 102.69 ? 10  DC  I C4    1 
ATOM   196   N  N4    . DC  A  1 10  ? 16.212  6.429   -66.769 1.00 98.49  ? 10  DC  I N4    1 
ATOM   197   C  C5    . DC  A  1 10  ? 14.695  4.875   -65.749 1.00 97.37  ? 10  DC  I C5    1 
ATOM   198   C  C6    . DC  A  1 10  ? 14.307  3.598   -65.651 1.00 103.75 ? 10  DC  I C6    1 
ATOM   199   P  P     . DA  A  1 11  ? 13.667  -2.092  -63.796 1.00 123.53 ? 11  DA  I P     1 
ATOM   200   O  OP1   . DA  A  1 11  ? 12.979  -3.400  -63.722 1.00 110.13 ? 11  DA  I OP1   1 
ATOM   201   O  OP2   . DA  A  1 11  ? 13.377  -1.072  -62.762 1.00 117.37 ? 11  DA  I OP2   1 
ATOM   202   O  "O5'" . DA  A  1 11  ? 15.243  -2.340  -63.824 1.00 107.06 ? 11  DA  I "O5'" 1 
ATOM   203   C  "C5'" . DA  A  1 11  ? 16.004  -1.786  -64.885 1.00 102.60 ? 11  DA  I "C5'" 1 
ATOM   204   C  "C4'" . DA  A  1 11  ? 17.439  -2.246  -64.825 1.00 103.43 ? 11  DA  I "C4'" 1 
ATOM   205   O  "O4'" . DA  A  1 11  ? 18.300  -1.167  -65.250 1.00 107.46 ? 11  DA  I "O4'" 1 
ATOM   206   C  "C3'" . DA  A  1 11  ? 17.933  -2.612  -63.442 1.00 107.68 ? 11  DA  I "C3'" 1 
ATOM   207   O  "O3'" . DA  A  1 11  ? 19.039  -3.492  -63.554 1.00 117.22 ? 11  DA  I "O3'" 1 
ATOM   208   C  "C2'" . DA  A  1 11  ? 18.342  -1.255  -62.873 1.00 109.88 ? 11  DA  I "C2'" 1 
ATOM   209   C  "C1'" . DA  A  1 11  ? 18.833  -0.503  -64.115 1.00 112.15 ? 11  DA  I "C1'" 1 
ATOM   210   N  N9    . DA  A  1 11  ? 18.408  0.898   -64.149 1.00 111.20 ? 11  DA  I N9    1 
ATOM   211   C  C8    . DA  A  1 11  ? 17.153  1.385   -63.902 1.00 105.68 ? 11  DA  I C8    1 
ATOM   212   N  N7    . DA  A  1 11  ? 17.062  2.690   -63.999 1.00 100.52 ? 11  DA  I N7    1 
ATOM   213   C  C5    . DA  A  1 11  ? 18.346  3.089   -64.331 1.00 103.94 ? 11  DA  I C5    1 
ATOM   214   C  C6    . DA  A  1 11  ? 18.913  4.355   -64.576 1.00 108.17 ? 11  DA  I C6    1 
ATOM   215   N  N6    . DA  A  1 11  ? 18.218  5.496   -64.521 1.00 106.30 ? 11  DA  I N6    1 
ATOM   216   N  N1    . DA  A  1 11  ? 20.227  4.404   -64.883 1.00 110.75 ? 11  DA  I N1    1 
ATOM   217   C  C2    . DA  A  1 11  ? 20.919  3.260   -64.939 1.00 104.16 ? 11  DA  I C2    1 
ATOM   218   N  N3    . DA  A  1 11  ? 20.497  2.014   -64.728 1.00 102.06 ? 11  DA  I N3    1 
ATOM   219   C  C4    . DA  A  1 11  ? 19.189  1.998   -64.426 1.00 103.74 ? 11  DA  I C4    1 
ATOM   220   P  P     . DC  A  1 12  ? 19.779  -4.054  -62.243 1.00 107.52 ? 12  DC  I P     1 
ATOM   221   O  OP1   . DC  A  1 12  ? 20.211  -5.433  -62.566 1.00 94.45  ? 12  DC  I OP1   1 
ATOM   222   O  OP2   . DC  A  1 12  ? 18.905  -3.823  -61.071 1.00 87.36  ? 12  DC  I OP2   1 
ATOM   223   O  "O5'" . DC  A  1 12  ? 21.069  -3.109  -62.110 1.00 109.38 ? 12  DC  I "O5'" 1 
ATOM   224   C  "C5'" . DC  A  1 12  ? 21.843  -2.790  -63.271 1.00 102.27 ? 12  DC  I "C5'" 1 
ATOM   225   C  "C4'" . DC  A  1 12  ? 22.934  -1.781  -62.944 1.00 112.19 ? 12  DC  I "C4'" 1 
ATOM   226   O  "O4'" . DC  A  1 12  ? 22.415  -0.425  -63.069 1.00 120.25 ? 12  DC  I "O4'" 1 
ATOM   227   C  "C3'" . DC  A  1 12  ? 23.514  -1.879  -61.527 1.00 118.87 ? 12  DC  I "C3'" 1 
ATOM   228   O  "O3'" . DC  A  1 12  ? 24.934  -1.696  -61.572 1.00 124.77 ? 12  DC  I "O3'" 1 
ATOM   229   C  "C2'" . DC  A  1 12  ? 22.826  -0.720  -60.810 1.00 119.81 ? 12  DC  I "C2'" 1 
ATOM   230   C  "C1'" . DC  A  1 12  ? 22.795  0.306   -61.925 1.00 120.76 ? 12  DC  I "C1'" 1 
ATOM   231   N  N1    . DC  A  1 12  ? 21.828  1.423   -61.695 1.00 115.62 ? 12  DC  I N1    1 
ATOM   232   C  C2    . DC  A  1 12  ? 22.229  2.744   -61.934 1.00 114.54 ? 12  DC  I C2    1 
ATOM   233   O  O2    . DC  A  1 12  ? 23.375  2.963   -62.348 1.00 114.68 ? 12  DC  I O2    1 
ATOM   234   N  N3    . DC  A  1 12  ? 21.344  3.747   -61.714 1.00 111.03 ? 12  DC  I N3    1 
ATOM   235   C  C4    . DC  A  1 12  ? 20.117  3.470   -61.269 1.00 106.83 ? 12  DC  I C4    1 
ATOM   236   N  N4    . DC  A  1 12  ? 19.280  4.492   -61.066 1.00 106.76 ? 12  DC  I N4    1 
ATOM   237   C  C5    . DC  A  1 12  ? 19.694  2.133   -61.012 1.00 104.73 ? 12  DC  I C5    1 
ATOM   238   C  C6    . DC  A  1 12  ? 20.574  1.151   -61.233 1.00 108.29 ? 12  DC  I C6    1 
ATOM   239   P  P     . DC  A  1 13  ? 25.844  -1.945  -60.267 1.00 133.46 ? 13  DC  I P     1 
ATOM   240   O  OP1   . DC  A  1 13  ? 26.811  -3.011  -60.608 1.00 137.08 ? 13  DC  I OP1   1 
ATOM   241   O  OP2   . DC  A  1 13  ? 24.966  -2.119  -59.088 1.00 123.51 ? 13  DC  I OP2   1 
ATOM   242   O  "O5'" . DC  A  1 13  ? 26.639  -0.565  -60.090 1.00 114.18 ? 13  DC  I "O5'" 1 
ATOM   243   C  "C5'" . DC  A  1 13  ? 25.940  0.669   -60.180 1.00 115.80 ? 13  DC  I "C5'" 1 
ATOM   244   C  "C4'" . DC  A  1 13  ? 26.815  1.826   -59.745 1.00 127.48 ? 13  DC  I "C4'" 1 
ATOM   245   O  "O4'" . DC  A  1 13  ? 26.031  3.047   -59.759 1.00 128.19 ? 13  DC  I "O4'" 1 
ATOM   246   C  "C3'" . DC  A  1 13  ? 27.354  1.722   -58.329 1.00 128.42 ? 13  DC  I "C3'" 1 
ATOM   247   O  "O3'" . DC  A  1 13  ? 28.545  2.487   -58.208 1.00 136.25 ? 13  DC  I "O3'" 1 
ATOM   248   C  "C2'" . DC  A  1 13  ? 26.219  2.325   -57.514 1.00 126.01 ? 13  DC  I "C2'" 1 
ATOM   249   C  "C1'" . DC  A  1 13  ? 25.746  3.452   -58.430 1.00 127.41 ? 13  DC  I "C1'" 1 
ATOM   250   N  N1    . DC  A  1 13  ? 24.284  3.725   -58.321 1.00 123.56 ? 13  DC  I N1    1 
ATOM   251   C  C2    . DC  A  1 13  ? 23.831  5.039   -58.160 1.00 121.07 ? 13  DC  I C2    1 
ATOM   252   O  O2    . DC  A  1 13  ? 24.656  5.961   -58.115 1.00 121.85 ? 13  DC  I O2    1 
ATOM   253   N  N3    . DC  A  1 13  ? 22.497  5.265   -58.061 1.00 115.30 ? 13  DC  I N3    1 
ATOM   254   C  C4    . DC  A  1 13  ? 21.641  4.243   -58.114 1.00 111.02 ? 13  DC  I C4    1 
ATOM   255   N  N4    . DC  A  1 13  ? 20.337  4.513   -58.012 1.00 109.44 ? 13  DC  I N4    1 
ATOM   256   C  C5    . DC  A  1 13  ? 22.084  2.898   -58.274 1.00 110.18 ? 13  DC  I C5    1 
ATOM   257   C  C6    . DC  A  1 13  ? 23.399  2.688   -58.372 1.00 116.73 ? 13  DC  I C6    1 
ATOM   258   P  P     . DT  A  1 14  ? 29.365  2.488   -56.827 1.00 143.83 ? 14  DT  I P     1 
ATOM   259   O  OP1   . DT  A  1 14  ? 30.777  2.801   -57.143 1.00 143.00 ? 14  DT  I OP1   1 
ATOM   260   O  OP2   . DT  A  1 14  ? 29.024  1.241   -56.104 1.00 122.98 ? 14  DT  I OP2   1 
ATOM   261   O  "O5'" . DT  A  1 14  ? 28.743  3.714   -56.010 1.00 135.34 ? 14  DT  I "O5'" 1 
ATOM   262   C  "C5'" . DT  A  1 14  ? 28.941  5.049   -56.462 1.00 128.24 ? 14  DT  I "C5'" 1 
ATOM   263   C  "C4'" . DT  A  1 14  ? 28.650  6.041   -55.350 1.00 133.58 ? 14  DT  I "C4'" 1 
ATOM   264   O  "O4'" . DT  A  1 14  ? 27.219  6.295   -55.282 1.00 134.62 ? 14  DT  I "O4'" 1 
ATOM   265   C  "C3'" . DT  A  1 14  ? 29.067  5.584   -53.950 1.00 137.99 ? 14  DT  I "C3'" 1 
ATOM   266   O  "O3'" . DT  A  1 14  ? 29.588  6.685   -53.214 1.00 141.64 ? 14  DT  I "O3'" 1 
ATOM   267   C  "C2'" . DT  A  1 14  ? 27.756  5.081   -53.351 1.00 131.84 ? 14  DT  I "C2'" 1 
ATOM   268   C  "C1'" . DT  A  1 14  ? 26.750  6.036   -53.974 1.00 132.27 ? 14  DT  I "C1'" 1 
ATOM   269   N  N1    . DT  A  1 14  ? 25.379  5.461   -54.068 1.00 128.17 ? 14  DT  I N1    1 
ATOM   270   C  C2    . DT  A  1 14  ? 24.286  6.295   -53.991 1.00 123.21 ? 14  DT  I C2    1 
ATOM   271   O  O2    . DT  A  1 14  ? 24.373  7.504   -53.853 1.00 120.99 ? 14  DT  I O2    1 
ATOM   272   N  N3    . DT  A  1 14  ? 23.076  5.659   -54.086 1.00 115.50 ? 14  DT  I N3    1 
ATOM   273   C  C4    . DT  A  1 14  ? 22.856  4.300   -54.244 1.00 116.41 ? 14  DT  I C4    1 
ATOM   274   O  O4    . DT  A  1 14  ? 21.729  3.822   -54.320 1.00 113.20 ? 14  DT  I O4    1 
ATOM   275   C  C5    . DT  A  1 14  ? 24.045  3.485   -54.313 1.00 117.87 ? 14  DT  I C5    1 
ATOM   276   C  C7    . DT  A  1 14  ? 23.932  1.999   -54.484 1.00 114.23 ? 14  DT  I C7    1 
ATOM   277   C  C6    . DT  A  1 14  ? 25.234  4.097   -54.221 1.00 121.82 ? 14  DT  I C6    1 
ATOM   278   P  P     . DG  A  1 15  ? 30.474  6.445   -51.893 1.00 136.28 ? 15  DG  I P     1 
ATOM   279   O  OP1   . DG  A  1 15  ? 31.893  6.512   -52.302 1.00 141.48 ? 15  DG  I OP1   1 
ATOM   280   O  OP2   . DG  A  1 15  ? 29.980  5.241   -51.186 1.00 118.70 ? 15  DG  I OP2   1 
ATOM   281   O  "O5'" . DG  A  1 15  ? 30.135  7.718   -50.985 1.00 134.10 ? 15  DG  I "O5'" 1 
ATOM   282   C  "C5'" . DG  A  1 15  ? 30.248  9.030   -51.532 1.00 131.69 ? 15  DG  I "C5'" 1 
ATOM   283   C  "C4'" . DG  A  1 15  ? 29.065  9.895   -51.130 1.00 133.21 ? 15  DG  I "C4'" 1 
ATOM   284   O  "O4'" . DG  A  1 15  ? 27.825  9.185   -51.401 1.00 135.96 ? 15  DG  I "O4'" 1 
ATOM   285   C  "C3'" . DG  A  1 15  ? 29.006  10.282  -49.654 1.00 134.11 ? 15  DG  I "C3'" 1 
ATOM   286   O  "O3'" . DG  A  1 15  ? 28.432  11.583  -49.530 1.00 139.81 ? 15  DG  I "O3'" 1 
ATOM   287   C  "C2'" . DG  A  1 15  ? 28.091  9.207   -49.072 1.00 127.91 ? 15  DG  I "C2'" 1 
ATOM   288   C  "C1'" . DG  A  1 15  ? 27.087  9.041   -50.202 1.00 131.92 ? 15  DG  I "C1'" 1 
ATOM   289   N  N9    . DG  A  1 15  ? 26.422  7.739   -50.223 1.00 129.75 ? 15  DG  I N9    1 
ATOM   290   C  C8    . DG  A  1 15  ? 26.991  6.509   -49.987 1.00 128.82 ? 15  DG  I C8    1 
ATOM   291   N  N7    . DG  A  1 15  ? 26.147  5.518   -50.086 1.00 124.56 ? 15  DG  I N7    1 
ATOM   292   C  C5    . DG  A  1 15  ? 24.942  6.129   -50.411 1.00 123.17 ? 15  DG  I C5    1 
ATOM   293   C  C6    . DG  A  1 15  ? 23.665  5.563   -50.648 1.00 115.66 ? 15  DG  I C6    1 
ATOM   294   O  O6    . DG  A  1 15  ? 23.335  4.368   -50.615 1.00 108.88 ? 15  DG  I O6    1 
ATOM   295   N  N1    . DG  A  1 15  ? 22.717  6.539   -50.948 1.00 111.78 ? 15  DG  I N1    1 
ATOM   296   C  C2    . DG  A  1 15  ? 22.972  7.889   -51.014 1.00 113.50 ? 15  DG  I C2    1 
ATOM   297   N  N2    . DG  A  1 15  ? 21.933  8.676   -51.314 1.00 110.26 ? 15  DG  I N2    1 
ATOM   298   N  N3    . DG  A  1 15  ? 24.162  8.431   -50.795 1.00 123.05 ? 15  DG  I N3    1 
ATOM   299   C  C4    . DG  A  1 15  ? 25.096  7.495   -50.501 1.00 125.46 ? 15  DG  I C4    1 
ATOM   300   P  P     . DC  A  1 16  ? 28.517  12.399  -48.147 1.00 128.67 ? 16  DC  I P     1 
ATOM   301   O  OP1   . DC  A  1 16  ? 29.293  13.632  -48.409 1.00 134.94 ? 16  DC  I OP1   1 
ATOM   302   O  OP2   . DC  A  1 16  ? 28.950  11.470  -47.078 1.00 121.41 ? 16  DC  I OP2   1 
ATOM   303   O  "O5'" . DC  A  1 16  ? 26.996  12.811  -47.864 1.00 133.24 ? 16  DC  I "O5'" 1 
ATOM   304   C  "C5'" . DC  A  1 16  ? 26.028  12.708  -48.912 1.00 131.49 ? 16  DC  I "C5'" 1 
ATOM   305   C  "C4'" . DC  A  1 16  ? 24.656  13.186  -48.455 1.00 123.01 ? 16  DC  I "C4'" 1 
ATOM   306   O  "O4'" . DC  A  1 16  ? 23.743  12.065  -48.403 1.00 123.79 ? 16  DC  I "O4'" 1 
ATOM   307   C  "C3'" . DC  A  1 16  ? 24.604  13.806  -47.070 1.00 117.55 ? 16  DC  I "C3'" 1 
ATOM   308   O  "O3'" . DC  A  1 16  ? 23.519  14.713  -46.995 1.00 113.80 ? 16  DC  I "O3'" 1 
ATOM   309   C  "C2'" . DC  A  1 16  ? 24.374  12.592  -46.174 1.00 118.24 ? 16  DC  I "C2'" 1 
ATOM   310   C  "C1'" . DC  A  1 16  ? 23.508  11.688  -47.056 1.00 118.29 ? 16  DC  I "C1'" 1 
ATOM   311   N  N1    . DC  A  1 16  ? 23.833  10.239  -46.913 1.00 116.45 ? 16  DC  I N1    1 
ATOM   312   C  C2    . DC  A  1 16  ? 23.246  9.305   -47.776 1.00 117.20 ? 16  DC  I C2    1 
ATOM   313   O  O2    . DC  A  1 16  ? 22.460  9.697   -48.647 1.00 119.63 ? 16  DC  I O2    1 
ATOM   314   N  N3    . DC  A  1 16  ? 23.556  7.993   -47.629 1.00 116.56 ? 16  DC  I N3    1 
ATOM   315   C  C4    . DC  A  1 16  ? 24.408  7.609   -46.675 1.00 118.03 ? 16  DC  I C4    1 
ATOM   316   N  N4    . DC  A  1 16  ? 24.683  6.305   -46.569 1.00 116.59 ? 16  DC  I N4    1 
ATOM   317   C  C5    . DC  A  1 16  ? 25.015  8.546   -45.789 1.00 116.81 ? 16  DC  I C5    1 
ATOM   318   C  C6    . DC  A  1 16  ? 24.703  9.837   -45.942 1.00 115.45 ? 16  DC  I C6    1 
ATOM   319   P  P     . DA  A  1 17  ? 23.564  15.951  -45.973 1.00 115.54 ? 17  DA  I P     1 
ATOM   320   O  OP1   . DA  A  1 17  ? 24.339  17.035  -46.618 1.00 115.47 ? 17  DA  I OP1   1 
ATOM   321   O  OP2   . DA  A  1 17  ? 23.961  15.429  -44.645 1.00 103.75 ? 17  DA  I OP2   1 
ATOM   322   O  "O5'" . DA  A  1 17  ? 22.041  16.417  -45.885 1.00 112.78 ? 17  DA  I "O5'" 1 
ATOM   323   C  "C5'" . DA  A  1 17  ? 21.160  16.141  -46.962 1.00 112.13 ? 17  DA  I "C5'" 1 
ATOM   324   C  "C4'" . DA  A  1 17  ? 20.102  15.139  -46.542 1.00 106.95 ? 17  DA  I "C4'" 1 
ATOM   325   O  "O4'" . DA  A  1 17  ? 20.736  13.883  -46.185 1.00 104.09 ? 17  DA  I "O4'" 1 
ATOM   326   C  "C3'" . DA  A  1 17  ? 19.264  15.562  -45.333 1.00 102.94 ? 17  DA  I "C3'" 1 
ATOM   327   O  "O3'" . DA  A  1 17  ? 17.883  15.442  -45.640 1.00 98.01  ? 17  DA  I "O3'" 1 
ATOM   328   C  "C2'" . DA  A  1 17  ? 19.692  14.595  -44.224 1.00 98.99  ? 17  DA  I "C2'" 1 
ATOM   329   C  "C1'" . DA  A  1 17  ? 20.152  13.380  -45.009 1.00 99.99  ? 17  DA  I "C1'" 1 
ATOM   330   N  N9    . DA  A  1 17  ? 21.153  12.587  -44.304 1.00 106.52 ? 17  DA  I N9    1 
ATOM   331   C  C8    . DA  A  1 17  ? 22.180  13.055  -43.533 1.00 109.64 ? 17  DA  I C8    1 
ATOM   332   N  N7    . DA  A  1 17  ? 22.929  12.109  -43.018 1.00 110.98 ? 17  DA  I N7    1 
ATOM   333   C  C5    . DA  A  1 17  ? 22.354  10.939  -43.486 1.00 109.52 ? 17  DA  I C5    1 
ATOM   334   C  C6    . DA  A  1 17  ? 22.679  9.580   -43.299 1.00 111.21 ? 17  DA  I C6    1 
ATOM   335   N  N6    . DA  A  1 17  ? 23.710  9.164   -42.557 1.00 109.47 ? 17  DA  I N6    1 
ATOM   336   N  N1    . DA  A  1 17  ? 21.897  8.661   -43.905 1.00 109.73 ? 17  DA  I N1    1 
ATOM   337   C  C2    . DA  A  1 17  ? 20.865  9.080   -44.647 1.00 106.57 ? 17  DA  I C2    1 
ATOM   338   N  N3    . DA  A  1 17  ? 20.463  10.326  -44.896 1.00 106.99 ? 17  DA  I N3    1 
ATOM   339   C  C4    . DA  A  1 17  ? 21.257  11.216  -44.279 1.00 108.62 ? 17  DA  I C4    1 
ATOM   340   P  P     . DG  A  1 18  ? 16.764  15.902  -44.582 1.00 104.01 ? 18  DG  I P     1 
ATOM   341   O  OP1   . DG  A  1 18  ? 15.768  16.709  -45.320 1.00 104.95 ? 18  DG  I OP1   1 
ATOM   342   O  OP2   . DG  A  1 18  ? 17.417  16.459  -43.378 1.00 105.25 ? 18  DG  I OP2   1 
ATOM   343   O  "O5'" . DG  A  1 18  ? 16.081  14.530  -44.154 1.00 97.77  ? 18  DG  I "O5'" 1 
ATOM   344   C  "C5'" . DG  A  1 18  ? 15.784  13.565  -45.140 1.00 86.08  ? 18  DG  I "C5'" 1 
ATOM   345   C  "C4'" . DG  A  1 18  ? 15.584  12.210  -44.504 1.00 85.35  ? 18  DG  I "C4'" 1 
ATOM   346   O  "O4'" . DG  A  1 18  ? 16.863  11.680  -44.074 1.00 92.31  ? 18  DG  I "O4'" 1 
ATOM   347   C  "C3'" . DG  A  1 18  ? 14.676  12.211  -43.274 1.00 82.05  ? 18  DG  I "C3'" 1 
ATOM   348   O  "O3'" . DG  A  1 18  ? 13.707  11.190  -43.408 1.00 80.14  ? 18  DG  I "O3'" 1 
ATOM   349   C  "C2'" . DG  A  1 18  ? 15.635  11.943  -42.110 1.00 84.04  ? 18  DG  I "C2'" 1 
ATOM   350   C  "C1'" . DG  A  1 18  ? 16.739  11.145  -42.780 1.00 89.98  ? 18  DG  I "C1'" 1 
ATOM   351   N  N9    . DG  A  1 18  ? 18.026  11.270  -42.106 1.00 94.79  ? 18  DG  I N9    1 
ATOM   352   C  C8    . DG  A  1 18  ? 18.644  12.434  -41.723 1.00 99.88  ? 18  DG  I C8    1 
ATOM   353   N  N7    . DG  A  1 18  ? 19.792  12.245  -41.139 1.00 103.21 ? 18  DG  I N7    1 
ATOM   354   C  C5    . DG  A  1 18  ? 19.947  10.866  -41.133 1.00 106.19 ? 18  DG  I C5    1 
ATOM   355   C  C6    . DG  A  1 18  ? 21.003  10.070  -40.627 1.00 112.61 ? 18  DG  I C6    1 
ATOM   356   O  O6    . DG  A  1 18  ? 22.046  10.441  -40.070 1.00 116.78 ? 18  DG  I O6    1 
ATOM   357   N  N1    . DG  A  1 18  ? 20.765  8.711   -40.826 1.00 105.83 ? 18  DG  I N1    1 
ATOM   358   C  C2    . DG  A  1 18  ? 19.648  8.191   -41.434 1.00 103.61 ? 18  DG  I C2    1 
ATOM   359   N  N2    . DG  A  1 18  ? 19.594  6.856   -41.535 1.00 104.48 ? 18  DG  I N2    1 
ATOM   360   N  N3    . DG  A  1 18  ? 18.651  8.926   -41.911 1.00 104.35 ? 18  DG  I N3    1 
ATOM   361   C  C4    . DG  A  1 18  ? 18.868  10.251  -41.726 1.00 101.41 ? 18  DG  I C4    1 
ATOM   362   P  P     . DA  A  1 19  ? 12.528  11.020  -42.333 1.00 69.87  ? 19  DA  I P     1 
ATOM   363   O  OP1   . DA  A  1 19  ? 11.268  11.047  -43.114 1.00 53.12  ? 19  DA  I OP1   1 
ATOM   364   O  OP2   . DA  A  1 19  ? 12.719  11.980  -41.219 1.00 57.63  ? 19  DA  I OP2   1 
ATOM   365   O  "O5'" . DA  A  1 19  ? 12.768  9.541   -41.769 1.00 64.95  ? 19  DA  I "O5'" 1 
ATOM   366   C  "C5'" . DA  A  1 19  ? 12.841  8.455   -42.685 1.00 64.58  ? 19  DA  I "C5'" 1 
ATOM   367   C  "C4'" . DA  A  1 19  ? 13.510  7.236   -42.065 1.00 78.30  ? 19  DA  I "C4'" 1 
ATOM   368   O  "O4'" . DA  A  1 19  ? 14.836  7.588   -41.597 1.00 82.26  ? 19  DA  I "O4'" 1 
ATOM   369   C  "C3'" . DA  A  1 19  ? 12.780  6.615   -40.872 1.00 78.66  ? 19  DA  I "C3'" 1 
ATOM   370   O  "O3'" . DA  A  1 19  ? 12.748  5.201   -41.017 1.00 78.62  ? 19  DA  I "O3'" 1 
ATOM   371   C  "C2'" . DA  A  1 19  ? 13.631  7.037   -39.675 1.00 85.10  ? 19  DA  I "C2'" 1 
ATOM   372   C  "C1'" . DA  A  1 19  ? 15.018  7.106   -40.289 1.00 86.94  ? 19  DA  I "C1'" 1 
ATOM   373   N  N9    . DA  A  1 19  ? 15.913  8.021   -39.591 1.00 96.46  ? 19  DA  I N9    1 
ATOM   374   C  C8    . DA  A  1 19  ? 15.711  9.354   -39.361 1.00 96.50  ? 19  DA  I C8    1 
ATOM   375   N  N7    . DA  A  1 19  ? 16.690  9.932   -38.707 1.00 99.63  ? 19  DA  I N7    1 
ATOM   376   C  C5    . DA  A  1 19  ? 17.599  8.908   -38.496 1.00 105.07 ? 19  DA  I C5    1 
ATOM   377   C  C6    . DA  A  1 19  ? 18.855  8.869   -37.857 1.00 111.42 ? 19  DA  I C6    1 
ATOM   378   N  N6    . DA  A  1 19  ? 19.426  9.939   -37.291 1.00 112.11 ? 19  DA  I N6    1 
ATOM   379   N  N1    . DA  A  1 19  ? 19.502  7.685   -37.822 1.00 113.80 ? 19  DA  I N1    1 
ATOM   380   C  C2    . DA  A  1 19  ? 18.928  6.617   -38.390 1.00 109.29 ? 19  DA  I C2    1 
ATOM   381   N  N3    . DA  A  1 19  ? 17.755  6.531   -39.016 1.00 105.57 ? 19  DA  I N3    1 
ATOM   382   C  C4    . DA  A  1 19  ? 17.136  7.723   -39.036 1.00 103.20 ? 19  DA  I C4    1 
ATOM   383   P  P     . DT  A  1 20  ? 11.730  4.306   -40.150 1.00 91.07  ? 20  DT  I P     1 
ATOM   384   O  OP1   . DT  A  1 20  ? 10.805  3.640   -41.097 1.00 72.33  ? 20  DT  I OP1   1 
ATOM   385   O  OP2   . DT  A  1 20  ? 11.178  5.150   -39.064 1.00 74.55  ? 20  DT  I OP2   1 
ATOM   386   O  "O5'" . DT  A  1 20  ? 12.693  3.205   -39.498 1.00 89.62  ? 20  DT  I "O5'" 1 
ATOM   387   C  "C5'" . DT  A  1 20  ? 14.061  3.517   -39.344 1.00 91.58  ? 20  DT  I "C5'" 1 
ATOM   388   C  "C4'" . DT  A  1 20  ? 14.824  2.421   -38.634 1.00 101.16 ? 20  DT  I "C4'" 1 
ATOM   389   O  "O4'" . DT  A  1 20  ? 15.973  3.024   -37.994 1.00 111.73 ? 20  DT  I "O4'" 1 
ATOM   390   C  "C3'" . DT  A  1 20  ? 14.091  1.735   -37.494 1.00 102.10 ? 20  DT  I "C3'" 1 
ATOM   391   O  "O3'" . DT  A  1 20  ? 14.785  0.512   -37.163 1.00 119.82 ? 20  DT  I "O3'" 1 
ATOM   392   C  "C2'" . DT  A  1 20  ? 14.237  2.782   -36.397 1.00 105.55 ? 20  DT  I "C2'" 1 
ATOM   393   C  "C1'" . DT  A  1 20  ? 15.675  3.257   -36.627 1.00 110.50 ? 20  DT  I "C1'" 1 
ATOM   394   N  N1    . DT  A  1 20  ? 15.893  4.699   -36.311 1.00 109.01 ? 20  DT  I N1    1 
ATOM   395   C  C2    . DT  A  1 20  ? 17.162  5.134   -36.007 1.00 112.64 ? 20  DT  I C2    1 
ATOM   396   O  O2    . DT  A  1 20  ? 18.137  4.401   -35.998 1.00 117.01 ? 20  DT  I O2    1 
ATOM   397   N  N3    . DT  A  1 20  ? 17.256  6.471   -35.719 1.00 111.79 ? 20  DT  I N3    1 
ATOM   398   C  C4    . DT  A  1 20  ? 16.227  7.395   -35.699 1.00 109.81 ? 20  DT  I C4    1 
ATOM   399   O  O4    . DT  A  1 20  ? 16.412  8.577   -35.427 1.00 105.16 ? 20  DT  I O4    1 
ATOM   400   C  C5    . DT  A  1 20  ? 14.918  6.871   -36.018 1.00 106.43 ? 20  DT  I C5    1 
ATOM   401   C  C7    . DT  A  1 20  ? 13.725  7.779   -36.027 1.00 99.03  ? 20  DT  I C7    1 
ATOM   402   C  C6    . DT  A  1 20  ? 14.815  5.563   -36.302 1.00 102.88 ? 20  DT  I C6    1 
ATOM   403   P  P     . DT  A  1 21  ? 14.294  -0.467  -35.979 1.00 122.90 ? 21  DT  I P     1 
ATOM   404   O  OP1   . DT  A  1 21  ? 14.011  -1.775  -36.610 1.00 110.54 ? 21  DT  I OP1   1 
ATOM   405   O  OP2   . DT  A  1 21  ? 13.245  0.188   -35.163 1.00 103.60 ? 21  DT  I OP2   1 
ATOM   406   O  "O5'" . DT  A  1 21  ? 15.602  -0.623  -35.067 1.00 114.37 ? 21  DT  I "O5'" 1 
ATOM   407   C  "C5'" . DT  A  1 21  ? 16.388  0.523   -34.792 1.00 110.13 ? 21  DT  I "C5'" 1 
ATOM   408   C  "C4'" . DT  A  1 21  ? 17.612  0.198   -33.969 1.00 115.57 ? 21  DT  I "C4'" 1 
ATOM   409   O  "O4'" . DT  A  1 21  ? 18.237  1.442   -33.579 1.00 120.22 ? 21  DT  I "O4'" 1 
ATOM   410   C  "C3'" . DT  A  1 21  ? 17.332  -0.500  -32.655 1.00 119.83 ? 21  DT  I "C3'" 1 
ATOM   411   O  "O3'" . DT  A  1 21  ? 18.532  -1.099  -32.165 1.00 123.46 ? 21  DT  I "O3'" 1 
ATOM   412   C  "C2'" . DT  A  1 21  ? 16.891  0.670   -31.783 1.00 119.78 ? 21  DT  I "C2'" 1 
ATOM   413   C  "C1'" . DT  A  1 21  ? 17.811  1.792   -32.269 1.00 125.30 ? 21  DT  I "C1'" 1 
ATOM   414   N  N1    . DT  A  1 21  ? 17.139  3.130   -32.316 1.00 121.48 ? 21  DT  I N1    1 
ATOM   415   C  C2    . DT  A  1 21  ? 17.887  4.268   -32.118 1.00 120.97 ? 21  DT  I C2    1 
ATOM   416   O  O2    . DT  A  1 21  ? 19.089  4.251   -31.915 1.00 120.68 ? 21  DT  I O2    1 
ATOM   417   N  N3    . DT  A  1 21  ? 17.175  5.438   -32.173 1.00 120.80 ? 21  DT  I N3    1 
ATOM   418   C  C4    . DT  A  1 21  ? 15.815  5.582   -32.396 1.00 118.01 ? 21  DT  I C4    1 
ATOM   419   O  O4    . DT  A  1 21  ? 15.267  6.680   -32.427 1.00 113.07 ? 21  DT  I O4    1 
ATOM   420   C  C5    . DT  A  1 21  ? 15.088  4.348   -32.590 1.00 114.66 ? 21  DT  I C5    1 
ATOM   421   C  C7    . DT  A  1 21  ? 13.608  4.374   -32.841 1.00 103.81 ? 21  DT  I C7    1 
ATOM   422   C  C6    . DT  A  1 21  ? 15.776  3.196   -32.538 1.00 117.85 ? 21  DT  I C6    1 
ATOM   423   P  P     . DC  A  1 22  ? 18.625  -1.646  -30.655 1.00 123.51 ? 22  DC  I P     1 
ATOM   424   O  OP1   . DC  A  1 22  ? 19.619  -2.743  -30.656 1.00 119.60 ? 22  DC  I OP1   1 
ATOM   425   O  OP2   . DC  A  1 22  ? 17.258  -1.901  -30.146 1.00 109.07 ? 22  DC  I OP2   1 
ATOM   426   O  "O5'" . DC  A  1 22  ? 19.240  -0.414  -29.841 1.00 125.64 ? 22  DC  I "O5'" 1 
ATOM   427   C  "C5'" . DC  A  1 22  ? 20.591  -0.013  -30.067 1.00 124.53 ? 22  DC  I "C5'" 1 
ATOM   428   C  "C4'" . DC  A  1 22  ? 21.072  0.922   -28.970 1.00 127.94 ? 22  DC  I "C4'" 1 
ATOM   429   O  "O4'" . DC  A  1 22  ? 20.395  2.206   -29.087 1.00 125.82 ? 22  DC  I "O4'" 1 
ATOM   430   C  "C3'" . DC  A  1 22  ? 20.803  0.439   -27.541 1.00 130.65 ? 22  DC  I "C3'" 1 
ATOM   431   O  "O3'" . DC  A  1 22  ? 21.900  0.790   -26.696 1.00 134.79 ? 22  DC  I "O3'" 1 
ATOM   432   C  "C2'" . DC  A  1 22  ? 19.544  1.213   -27.169 1.00 124.68 ? 22  DC  I "C2'" 1 
ATOM   433   C  "C1'" . DC  A  1 22  ? 19.837  2.542   -27.837 1.00 127.11 ? 22  DC  I "C1'" 1 
ATOM   434   N  N1    . DC  A  1 22  ? 18.628  3.379   -28.047 1.00 127.54 ? 22  DC  I N1    1 
ATOM   435   C  C2    . DC  A  1 22  ? 18.694  4.761   -27.822 1.00 129.50 ? 22  DC  I C2    1 
ATOM   436   O  O2    . DC  A  1 22  ? 19.768  5.265   -27.465 1.00 129.34 ? 22  DC  I O2    1 
ATOM   437   N  N3    . DC  A  1 22  ? 17.578  5.508   -28.010 1.00 124.07 ? 22  DC  I N3    1 
ATOM   438   C  C4    . DC  A  1 22  ? 16.441  4.925   -28.396 1.00 120.96 ? 22  DC  I C4    1 
ATOM   439   N  N4    . DC  A  1 22  ? 15.367  5.701   -28.569 1.00 121.96 ? 22  DC  I N4    1 
ATOM   440   C  C5    . DC  A  1 22  ? 16.354  3.520   -28.623 1.00 124.36 ? 22  DC  I C5    1 
ATOM   441   C  C6    . DC  A  1 22  ? 17.460  2.793   -28.435 1.00 125.57 ? 22  DC  I C6    1 
ATOM   442   P  P     . DT  A  1 23  ? 22.001  0.217   -25.195 1.00 138.29 ? 23  DT  I P     1 
ATOM   443   O  OP1   . DT  A  1 23  ? 23.270  -0.536  -25.097 1.00 141.29 ? 23  DT  I OP1   1 
ATOM   444   O  OP2   . DT  A  1 23  ? 20.727  -0.450  -24.846 1.00 130.00 ? 23  DT  I OP2   1 
ATOM   445   O  "O5'" . DT  A  1 23  ? 22.121  1.533   -24.297 1.00 120.64 ? 23  DT  I "O5'" 1 
ATOM   446   C  "C5'" . DT  A  1 23  ? 21.221  2.601   -24.506 1.00 123.49 ? 23  DT  I "C5'" 1 
ATOM   447   C  "C4'" . DT  A  1 23  ? 21.474  3.723   -23.527 1.00 126.47 ? 23  DT  I "C4'" 1 
ATOM   448   O  "O4'" . DT  A  1 23  ? 20.517  4.783   -23.768 1.00 123.02 ? 23  DT  I "O4'" 1 
ATOM   449   C  "C3'" . DT  A  1 23  ? 21.302  3.342   -22.068 1.00 129.57 ? 23  DT  I "C3'" 1 
ATOM   450   O  "O3'" . DT  A  1 23  ? 22.127  4.170   -21.252 1.00 130.36 ? 23  DT  I "O3'" 1 
ATOM   451   C  "C2'" . DT  A  1 23  ? 19.816  3.603   -21.833 1.00 129.09 ? 23  DT  I "C2'" 1 
ATOM   452   C  "C1'" . DT  A  1 23  ? 19.541  4.801   -22.741 1.00 125.72 ? 23  DT  I "C1'" 1 
ATOM   453   N  N1    . DT  A  1 23  ? 18.186  4.767   -23.372 1.00 126.98 ? 23  DT  I N1    1 
ATOM   454   C  C2    . DT  A  1 23  ? 17.511  5.948   -23.587 1.00 125.32 ? 23  DT  I C2    1 
ATOM   455   O  O2    . DT  A  1 23  ? 17.966  7.041   -23.296 1.00 123.56 ? 23  DT  I O2    1 
ATOM   456   N  N3    . DT  A  1 23  ? 16.276  5.804   -24.165 1.00 121.50 ? 23  DT  I N3    1 
ATOM   457   C  C4    . DT  A  1 23  ? 15.658  4.623   -24.538 1.00 120.44 ? 23  DT  I C4    1 
ATOM   458   O  O4    . DT  A  1 23  ? 14.542  4.599   -25.052 1.00 114.46 ? 23  DT  I O4    1 
ATOM   459   C  C5    . DT  A  1 23  ? 16.418  3.421   -24.281 1.00 124.16 ? 23  DT  I C5    1 
ATOM   460   C  C7    . DT  A  1 23  ? 15.851  2.079   -24.643 1.00 122.16 ? 23  DT  I C7    1 
ATOM   461   C  C6    . DT  A  1 23  ? 17.629  3.549   -23.715 1.00 124.93 ? 23  DT  I C6    1 
ATOM   462   P  P     . DA  A  1 24  ? 22.015  4.120   -19.648 1.00 126.54 ? 24  DA  I P     1 
ATOM   463   O  OP1   . DA  A  1 24  ? 23.354  4.458   -19.115 1.00 121.41 ? 24  DA  I OP1   1 
ATOM   464   O  OP2   . DA  A  1 24  ? 21.377  2.844   -19.250 1.00 115.19 ? 24  DA  I OP2   1 
ATOM   465   O  "O5'" . DA  A  1 24  ? 21.010  5.319   -19.309 1.00 128.84 ? 24  DA  I "O5'" 1 
ATOM   466   C  "C5'" . DA  A  1 24  ? 21.187  6.592   -19.939 1.00 129.65 ? 24  DA  I "C5'" 1 
ATOM   467   C  "C4'" . DA  A  1 24  ? 20.144  7.590   -19.462 1.00 130.25 ? 24  DA  I "C4'" 1 
ATOM   468   O  "O4'" . DA  A  1 24  ? 18.931  7.448   -20.250 1.00 131.56 ? 24  DA  I "O4'" 1 
ATOM   469   C  "C3'" . DA  A  1 24  ? 19.733  7.441   -17.995 1.00 135.26 ? 24  DA  I "C3'" 1 
ATOM   470   O  "O3'" . DA  A  1 24  ? 19.756  8.712   -17.348 1.00 132.26 ? 24  DA  I "O3'" 1 
ATOM   471   C  "C2'" . DA  A  1 24  ? 18.318  6.859   -18.065 1.00 133.30 ? 24  DA  I "C2'" 1 
ATOM   472   C  "C1'" . DA  A  1 24  ? 17.808  7.393   -19.397 1.00 130.88 ? 24  DA  I "C1'" 1 
ATOM   473   N  N9    . DA  A  1 24  ? 16.799  6.532   -20.016 1.00 129.05 ? 24  DA  I N9    1 
ATOM   474   C  C8    . DA  A  1 24  ? 16.910  5.193   -20.279 1.00 125.55 ? 24  DA  I C8    1 
ATOM   475   N  N7    . DA  A  1 24  ? 15.846  4.672   -20.844 1.00 121.15 ? 24  DA  I N7    1 
ATOM   476   C  C5    . DA  A  1 24  ? 14.974  5.742   -20.962 1.00 121.00 ? 24  DA  I C5    1 
ATOM   477   C  C6    . DA  A  1 24  ? 13.668  5.849   -21.484 1.00 112.80 ? 24  DA  I C6    1 
ATOM   478   N  N6    . DA  A  1 24  ? 12.997  4.814   -22.004 1.00 105.87 ? 24  DA  I N6    1 
ATOM   479   N  N1    . DA  A  1 24  ? 13.078  7.065   -21.450 1.00 111.92 ? 24  DA  I N1    1 
ATOM   480   C  C2    . DA  A  1 24  ? 13.756  8.098   -20.928 1.00 118.24 ? 24  DA  I C2    1 
ATOM   481   N  N3    . DA  A  1 24  ? 14.985  8.120   -20.408 1.00 122.52 ? 24  DA  I N3    1 
ATOM   482   C  C4    . DA  A  1 24  ? 15.545  6.899   -20.456 1.00 125.09 ? 24  DA  I C4    1 
ATOM   483   P  P     . DC  A  1 25  ? 19.325  8.848   -15.805 1.00 128.67 ? 25  DC  I P     1 
ATOM   484   O  OP1   . DC  A  1 25  ? 20.038  10.014  -15.237 1.00 130.14 ? 25  DC  I OP1   1 
ATOM   485   O  OP2   . DC  A  1 25  ? 19.460  7.522   -15.161 1.00 125.03 ? 25  DC  I OP2   1 
ATOM   486   O  "O5'" . DC  A  1 25  ? 17.769  9.182   -15.885 1.00 128.38 ? 25  DC  I "O5'" 1 
ATOM   487   C  "C5'" . DC  A  1 25  ? 17.138  9.889   -14.838 1.00 129.55 ? 25  DC  I "C5'" 1 
ATOM   488   C  "C4'" . DC  A  1 25  ? 16.108  10.844  -15.404 1.00 132.81 ? 25  DC  I "C4'" 1 
ATOM   489   O  "O4'" . DC  A  1 25  ? 15.440  10.216  -16.528 1.00 130.91 ? 25  DC  I "O4'" 1 
ATOM   490   C  "C3'" . DC  A  1 25  ? 15.001  11.239  -14.443 1.00 129.03 ? 25  DC  I "C3'" 1 
ATOM   491   O  "O3'" . DC  A  1 25  ? 14.512  12.522  -14.783 1.00 129.26 ? 25  DC  I "O3'" 1 
ATOM   492   C  "C2'" . DC  A  1 25  ? 13.957  10.160  -14.696 1.00 121.64 ? 25  DC  I "C2'" 1 
ATOM   493   C  "C1'" . DC  A  1 25  ? 14.087  9.961   -16.203 1.00 126.57 ? 25  DC  I "C1'" 1 
ATOM   494   N  N1    . DC  A  1 25  ? 13.751  8.582   -16.649 1.00 122.00 ? 25  DC  I N1    1 
ATOM   495   C  C2    . DC  A  1 25  ? 12.436  8.275   -17.007 1.00 116.33 ? 25  DC  I C2    1 
ATOM   496   O  O2    . DC  A  1 25  ? 11.575  9.160   -16.947 1.00 117.88 ? 25  DC  I O2    1 
ATOM   497   N  N3    . DC  A  1 25  ? 12.142  7.015   -17.410 1.00 111.17 ? 25  DC  I N3    1 
ATOM   498   C  C4    . DC  A  1 25  ? 13.102  6.091   -17.461 1.00 112.48 ? 25  DC  I C4    1 
ATOM   499   N  N4    . DC  A  1 25  ? 12.766  4.862   -17.865 1.00 110.88 ? 25  DC  I N4    1 
ATOM   500   C  C5    . DC  A  1 25  ? 14.449  6.386   -17.100 1.00 119.62 ? 25  DC  I C5    1 
ATOM   501   C  C6    . DC  A  1 25  ? 14.726  7.632   -16.704 1.00 122.87 ? 25  DC  I C6    1 
ATOM   502   P  P     . DC  A  1 26  ? 13.662  13.368  -13.717 1.00 134.54 ? 26  DC  I P     1 
ATOM   503   O  OP1   . DC  A  1 26  ? 13.965  14.800  -13.938 1.00 123.28 ? 26  DC  I OP1   1 
ATOM   504   O  OP2   . DC  A  1 26  ? 13.876  12.756  -12.386 1.00 128.13 ? 26  DC  I OP2   1 
ATOM   505   O  "O5'" . DC  A  1 26  ? 12.147  13.094  -14.136 1.00 129.81 ? 26  DC  I "O5'" 1 
ATOM   506   C  "C5'" . DC  A  1 26  ? 11.644  13.612  -15.359 1.00 123.69 ? 26  DC  I "C5'" 1 
ATOM   507   C  "C4'" . DC  A  1 26  ? 10.190  13.223  -15.543 1.00 120.25 ? 26  DC  I "C4'" 1 
ATOM   508   O  "O4'" . DC  A  1 26  ? 10.103  11.802  -15.837 1.00 117.39 ? 26  DC  I "O4'" 1 
ATOM   509   C  "C3'" . DC  A  1 26  ? 9.302   13.454  -14.318 1.00 114.50 ? 26  DC  I "C3'" 1 
ATOM   510   O  "O3'" . DC  A  1 26  ? 8.019   13.912  -14.729 1.00 105.55 ? 26  DC  I "O3'" 1 
ATOM   511   C  "C2'" . DC  A  1 26  ? 9.224   12.062  -13.695 1.00 114.27 ? 26  DC  I "C2'" 1 
ATOM   512   C  "C1'" . DC  A  1 26  ? 9.198   11.197  -14.942 1.00 115.30 ? 26  DC  I "C1'" 1 
ATOM   513   N  N1    . DC  A  1 26  ? 9.619   9.785   -14.717 1.00 112.85 ? 26  DC  I N1    1 
ATOM   514   C  C2    . DC  A  1 26  ? 9.004   8.765   -15.444 1.00 109.79 ? 26  DC  I C2    1 
ATOM   515   O  O2    . DC  A  1 26  ? 8.125   9.057   -16.262 1.00 111.05 ? 26  DC  I O2    1 
ATOM   516   N  N3    . DC  A  1 26  ? 9.392   7.483   -15.238 1.00 110.56 ? 26  DC  I N3    1 
ATOM   517   C  C4    . DC  A  1 26  ? 10.346  7.209   -14.350 1.00 113.39 ? 26  DC  I C4    1 
ATOM   518   N  N4    . DC  A  1 26  ? 10.692  5.928   -14.180 1.00 112.52 ? 26  DC  I N4    1 
ATOM   519   C  C5    . DC  A  1 26  ? 10.987  8.238   -13.594 1.00 114.86 ? 26  DC  I C5    1 
ATOM   520   C  C6    . DC  A  1 26  ? 10.595  9.500   -13.808 1.00 115.01 ? 26  DC  I C6    1 
ATOM   521   P  P     . DA  A  1 27  ? 7.416   15.279  -14.137 1.00 111.34 ? 27  DA  I P     1 
ATOM   522   O  OP1   . DA  A  1 27  ? 8.225   16.387  -14.692 1.00 115.47 ? 27  DA  I OP1   1 
ATOM   523   O  OP2   . DA  A  1 27  ? 7.272   15.121  -12.673 1.00 115.69 ? 27  DA  I OP2   1 
ATOM   524   O  "O5'" . DA  A  1 27  ? 5.939   15.351  -14.750 1.00 113.42 ? 27  DA  I "O5'" 1 
ATOM   525   C  "C5'" . DA  A  1 27  ? 5.757   15.420  -16.157 1.00 111.67 ? 27  DA  I "C5'" 1 
ATOM   526   C  "C4'" . DA  A  1 27  ? 5.062   14.173  -16.685 1.00 108.75 ? 27  DA  I "C4'" 1 
ATOM   527   O  "O4'" . DA  A  1 27  ? 5.719   12.983  -16.172 1.00 108.65 ? 27  DA  I "O4'" 1 
ATOM   528   C  "C3'" . DA  A  1 27  ? 3.584   14.044  -16.318 1.00 101.87 ? 27  DA  I "C3'" 1 
ATOM   529   O  "O3'" . DA  A  1 27  ? 2.844   13.668  -17.467 1.00 101.78 ? 27  DA  I "O3'" 1 
ATOM   530   C  "C2'" . DA  A  1 27  ? 3.567   12.946  -15.250 1.00 98.48  ? 27  DA  I "C2'" 1 
ATOM   531   C  "C1'" . DA  A  1 27  ? 4.761   12.090  -15.647 1.00 102.58 ? 27  DA  I "C1'" 1 
ATOM   532   N  N9    . DA  A  1 27  ? 5.368   11.382  -14.519 1.00 107.73 ? 27  DA  I N9    1 
ATOM   533   C  C8    . DA  A  1 27  ? 5.824   11.934  -13.356 1.00 110.74 ? 27  DA  I C8    1 
ATOM   534   N  N7    . DA  A  1 27  ? 6.330   11.062  -12.515 1.00 107.54 ? 27  DA  I N7    1 
ATOM   535   C  C5    . DA  A  1 27  ? 6.201   9.853   -13.172 1.00 104.88 ? 27  DA  I C5    1 
ATOM   536   C  C6    . DA  A  1 27  ? 6.551   8.538   -12.811 1.00 106.90 ? 27  DA  I C6    1 
ATOM   537   N  N6    . DA  A  1 27  ? 7.125   8.223   -11.646 1.00 109.31 ? 27  DA  I N6    1 
ATOM   538   N  N1    . DA  A  1 27  ? 6.284   7.557   -13.695 1.00 107.14 ? 27  DA  I N1    1 
ATOM   539   C  C2    . DA  A  1 27  ? 5.707   7.877   -14.859 1.00 104.98 ? 27  DA  I C2    1 
ATOM   540   N  N3    . DA  A  1 27  ? 5.334   9.074   -15.310 1.00 106.70 ? 27  DA  I N3    1 
ATOM   541   C  C4    . DA  A  1 27  ? 5.611   10.029  -14.410 1.00 106.29 ? 27  DA  I C4    1 
ATOM   542   P  P     . DA  A  1 28  ? 1.245   13.816  -17.499 1.00 103.74 ? 28  DA  I P     1 
ATOM   543   O  OP1   . DA  A  1 28  ? 0.910   14.684  -18.650 1.00 104.92 ? 28  DA  I OP1   1 
ATOM   544   O  OP2   . DA  A  1 28  ? 0.770   14.172  -16.142 1.00 92.15  ? 28  DA  I OP2   1 
ATOM   545   O  "O5'" . DA  A  1 28  ? 0.750   12.331  -17.806 1.00 93.97  ? 28  DA  I "O5'" 1 
ATOM   546   C  "C5'" . DA  A  1 28  ? 1.555   11.479  -18.614 1.00 92.65  ? 28  DA  I "C5'" 1 
ATOM   547   C  "C4'" . DA  A  1 28  ? 1.232   10.021  -18.354 1.00 88.05  ? 28  DA  I "C4'" 1 
ATOM   548   O  "O4'" . DA  A  1 28  ? 2.035   9.522   -17.250 1.00 95.39  ? 28  DA  I "O4'" 1 
ATOM   549   C  "C3'" . DA  A  1 28  ? -0.217  9.745   -17.966 1.00 84.43  ? 28  DA  I "C3'" 1 
ATOM   550   O  "O3'" . DA  A  1 28  ? -0.619  8.525   -18.525 1.00 81.92  ? 28  DA  I "O3'" 1 
ATOM   551   C  "C2'" . DA  A  1 28  ? -0.137  9.645   -16.451 1.00 91.23  ? 28  DA  I "C2'" 1 
ATOM   552   C  "C1'" . DA  A  1 28  ? 1.182   8.916   -16.306 1.00 94.84  ? 28  DA  I "C1'" 1 
ATOM   553   N  N9    . DA  A  1 28  ? 1.779   9.037   -14.983 1.00 99.13  ? 28  DA  I N9    1 
ATOM   554   C  C8    . DA  A  1 28  ? 1.857   10.162  -14.213 1.00 101.49 ? 28  DA  I C8    1 
ATOM   555   N  N7    . DA  A  1 28  ? 2.453   9.973   -13.061 1.00 105.61 ? 28  DA  I N7    1 
ATOM   556   C  C5    . DA  A  1 28  ? 2.786   8.628   -13.077 1.00 103.28 ? 28  DA  I C5    1 
ATOM   557   C  C6    . DA  A  1 28  ? 3.438   7.802   -12.144 1.00 106.77 ? 28  DA  I C6    1 
ATOM   558   N  N6    . DA  A  1 28  ? 3.888   8.241   -10.964 1.00 109.74 ? 28  DA  I N6    1 
ATOM   559   N  N1    . DA  A  1 28  ? 3.613   6.504   -12.472 1.00 107.72 ? 28  DA  I N1    1 
ATOM   560   C  C2    . DA  A  1 28  ? 3.162   6.071   -13.654 1.00 100.59 ? 28  DA  I C2    1 
ATOM   561   N  N3    . DA  A  1 28  ? 2.535   6.753   -14.611 1.00 98.56  ? 28  DA  I N3    1 
ATOM   562   C  C4    . DA  A  1 28  ? 2.377   8.037   -14.255 1.00 98.54  ? 28  DA  I C4    1 
ATOM   563   P  P     . DA  A  1 29  ? -1.823  8.487   -19.578 1.00 89.21  ? 29  DA  I P     1 
ATOM   564   O  OP1   . DA  A  1 29  ? -1.304  8.890   -20.907 1.00 75.78  ? 29  DA  I OP1   1 
ATOM   565   O  OP2   . DA  A  1 29  ? -2.955  9.200   -18.939 1.00 69.98  ? 29  DA  I OP2   1 
ATOM   566   O  "O5'" . DA  A  1 29  ? -2.210  6.948   -19.633 1.00 76.72  ? 29  DA  I "O5'" 1 
ATOM   567   C  "C5'" . DA  A  1 29  ? -2.698  6.340   -18.479 1.00 79.02  ? 29  DA  I "C5'" 1 
ATOM   568   C  "C4'" . DA  A  1 29  ? -1.880  5.123   -18.131 1.00 77.51  ? 29  DA  I "C4'" 1 
ATOM   569   O  "O4'" . DA  A  1 29  ? -0.864  5.483   -17.159 1.00 81.50  ? 29  DA  I "O4'" 1 
ATOM   570   C  "C3'" . DA  A  1 29  ? -2.696  4.014   -17.502 1.00 78.09  ? 29  DA  I "C3'" 1 
ATOM   571   O  "O3'" . DA  A  1 29  ? -2.246  2.768   -17.935 1.00 62.75  ? 29  DA  I "O3'" 1 
ATOM   572   C  "C2'" . DA  A  1 29  ? -2.486  4.206   -16.007 1.00 86.33  ? 29  DA  I "C2'" 1 
ATOM   573   C  "C1'" . DA  A  1 29  ? -1.092  4.811   -15.934 1.00 87.34  ? 29  DA  I "C1'" 1 
ATOM   574   N  N9    . DA  A  1 29  ? -0.949  5.772   -14.839 1.00 94.39  ? 29  DA  I N9    1 
ATOM   575   C  C8    . DA  A  1 29  ? -1.398  7.062   -14.813 1.00 93.57  ? 29  DA  I C8    1 
ATOM   576   N  N7    . DA  A  1 29  ? -1.134  7.695   -13.694 1.00 97.62  ? 29  DA  I N7    1 
ATOM   577   C  C5    . DA  A  1 29  ? -0.475  6.750   -12.925 1.00 100.61 ? 29  DA  I C5    1 
ATOM   578   C  C6    . DA  A  1 29  ? 0.068   6.793   -11.625 1.00 101.92 ? 29  DA  I C6    1 
ATOM   579   N  N6    . DA  A  1 29  ? 0.025   7.878   -10.845 1.00 102.17 ? 29  DA  I N6    1 
ATOM   580   N  N1    . DA  A  1 29  ? 0.658   5.675   -11.156 1.00 102.93 ? 29  DA  I N1    1 
ATOM   581   C  C2    . DA  A  1 29  ? 0.699   4.589   -11.939 1.00 102.10 ? 29  DA  I C2    1 
ATOM   582   N  N3    . DA  A  1 29  ? 0.226   4.428   -13.174 1.00 99.58  ? 29  DA  I N3    1 
ATOM   583   C  C4    . DA  A  1 29  ? -0.356  5.556   -13.613 1.00 100.17 ? 29  DA  I C4    1 
ATOM   584   P  P     . DA  A  1 30  ? -3.265  1.535   -17.897 1.00 63.07  ? 30  DA  I P     1 
ATOM   585   O  OP1   . DA  A  1 30  ? -2.881  0.602   -18.980 1.00 73.01  ? 30  DA  I OP1   1 
ATOM   586   O  OP2   . DA  A  1 30  ? -4.631  2.099   -17.849 1.00 66.68  ? 30  DA  I OP2   1 
ATOM   587   O  "O5'" . DA  A  1 30  ? -3.007  0.880   -16.464 1.00 76.47  ? 30  DA  I "O5'" 1 
ATOM   588   C  "C5'" . DA  A  1 30  ? -1.678  0.627   -16.029 1.00 85.53  ? 30  DA  I "C5'" 1 
ATOM   589   C  "C4'" . DA  A  1 30  ? -1.660  0.180   -14.578 1.00 86.48  ? 30  DA  I "C4'" 1 
ATOM   590   O  "O4'" . DA  A  1 30  ? -1.531  1.337   -13.713 1.00 85.30  ? 30  DA  I "O4'" 1 
ATOM   591   C  "C3'" . DA  A  1 30  ? -2.909  -0.572  -14.117 1.00 82.06  ? 30  DA  I "C3'" 1 
ATOM   592   O  "O3'" . DA  A  1 30  ? -2.527  -1.721  -13.377 1.00 83.98  ? 30  DA  I "O3'" 1 
ATOM   593   C  "C2'" . DA  A  1 30  ? -3.640  0.451   -13.245 1.00 82.27  ? 30  DA  I "C2'" 1 
ATOM   594   C  "C1'" . DA  A  1 30  ? -2.490  1.271   -12.687 1.00 83.93  ? 30  DA  I "C1'" 1 
ATOM   595   N  N9    . DA  A  1 30  ? -2.870  2.634   -12.338 1.00 92.74  ? 30  DA  I N9    1 
ATOM   596   C  C8    . DA  A  1 30  ? -3.688  3.466   -13.048 1.00 97.72  ? 30  DA  I C8    1 
ATOM   597   N  N7    . DA  A  1 30  ? -3.850  4.646   -12.501 1.00 101.52 ? 30  DA  I N7    1 
ATOM   598   C  C5    . DA  A  1 30  ? -3.086  4.585   -11.349 1.00 106.16 ? 30  DA  I C5    1 
ATOM   599   C  C6    . DA  A  1 30  ? -2.838  5.518   -10.324 1.00 107.12 ? 30  DA  I C6    1 
ATOM   600   N  N6    . DA  A  1 30  ? -3.366  6.748   -10.305 1.00 106.10 ? 30  DA  I N6    1 
ATOM   601   N  N1    . DA  A  1 30  ? -2.026  5.137   -9.315  1.00 109.83 ? 30  DA  I N1    1 
ATOM   602   C  C2    . DA  A  1 30  ? -1.501  3.905   -9.337  1.00 106.66 ? 30  DA  I C2    1 
ATOM   603   N  N3    . DA  A  1 30  ? -1.660  2.942   -10.244 1.00 105.33 ? 30  DA  I N3    1 
ATOM   604   C  C4    . DA  A  1 30  ? -2.472  3.350   -11.233 1.00 104.16 ? 30  DA  I C4    1 
ATOM   605   P  P     . DG  A  1 31  ? -3.632  -2.714  -12.762 1.00 88.28  ? 31  DG  I P     1 
ATOM   606   O  OP1   . DG  A  1 31  ? -3.172  -4.093  -13.042 1.00 88.51  ? 31  DG  I OP1   1 
ATOM   607   O  OP2   . DG  A  1 31  ? -4.985  -2.299  -13.195 1.00 77.43  ? 31  DG  I OP2   1 
ATOM   608   O  "O5'" . DG  A  1 31  ? -3.525  -2.452  -11.190 1.00 99.19  ? 31  DG  I "O5'" 1 
ATOM   609   C  "C5'" . DG  A  1 31  ? -2.248  -2.463  -10.549 1.00 92.18  ? 31  DG  I "C5'" 1 
ATOM   610   C  "C4'" . DG  A  1 31  ? -2.394  -2.264  -9.049  1.00 103.03 ? 31  DG  I "C4'" 1 
ATOM   611   O  "O4'" . DG  A  1 31  ? -2.495  -0.844  -8.751  1.00 104.80 ? 31  DG  I "O4'" 1 
ATOM   612   C  "C3'" . DG  A  1 31  ? -3.631  -2.915  -8.430  1.00 103.78 ? 31  DG  I "C3'" 1 
ATOM   613   O  "O3'" . DG  A  1 31  ? -3.316  -3.427  -7.136  1.00 110.60 ? 31  DG  I "O3'" 1 
ATOM   614   C  "C2'" . DG  A  1 31  ? -4.615  -1.753  -8.352  1.00 104.46 ? 31  DG  I "C2'" 1 
ATOM   615   C  "C1'" . DG  A  1 31  ? -3.683  -0.595  -8.030  1.00 109.10 ? 31  DG  I "C1'" 1 
ATOM   616   N  N9    . DG  A  1 31  ? -4.213  0.703   -8.433  1.00 107.91 ? 31  DG  I N9    1 
ATOM   617   C  C8    . DG  A  1 31  ? -4.857  1.004   -9.609  1.00 108.48 ? 31  DG  I C8    1 
ATOM   618   N  N7    . DG  A  1 31  ? -5.229  2.250   -9.695  1.00 107.58 ? 31  DG  I N7    1 
ATOM   619   C  C5    . DG  A  1 31  ? -4.806  2.814   -8.499  1.00 112.49 ? 31  DG  I C5    1 
ATOM   620   C  C6    . DG  A  1 31  ? -4.931  4.141   -8.024  1.00 116.33 ? 31  DG  I C6    1 
ATOM   621   O  O6    . DG  A  1 31  ? -5.457  5.112   -8.586  1.00 112.56 ? 31  DG  I O6    1 
ATOM   622   N  N1    . DG  A  1 31  ? -4.366  4.290   -6.759  1.00 120.37 ? 31  DG  I N1    1 
ATOM   623   C  C2    . DG  A  1 31  ? -3.758  3.283   -6.045  1.00 119.95 ? 31  DG  I C2    1 
ATOM   624   N  N2    . DG  A  1 31  ? -3.272  3.619   -4.841  1.00 119.95 ? 31  DG  I N2    1 
ATOM   625   N  N3    . DG  A  1 31  ? -3.635  2.034   -6.480  1.00 116.57 ? 31  DG  I N3    1 
ATOM   626   C  C4    . DG  A  1 31  ? -4.180  1.874   -7.710  1.00 111.37 ? 31  DG  I C4    1 
ATOM   627   P  P     . DT  A  1 32  ? -4.277  -4.503  -6.423  1.00 133.63 ? 32  DT  I P     1 
ATOM   628   O  OP1   . DT  A  1 32  ? -3.468  -5.715  -6.156  1.00 116.07 ? 32  DT  I OP1   1 
ATOM   629   O  OP2   . DT  A  1 32  ? -5.527  -4.613  -7.210  1.00 121.48 ? 32  DT  I OP2   1 
ATOM   630   O  "O5'" . DT  A  1 32  ? -4.645  -3.808  -5.030  1.00 122.40 ? 32  DT  I "O5'" 1 
ATOM   631   C  "C5'" . DT  A  1 32  ? -4.969  -2.428  -5.005  1.00 119.75 ? 32  DT  I "C5'" 1 
ATOM   632   C  "C4'" . DT  A  1 32  ? -5.163  -1.934  -3.589  1.00 127.04 ? 32  DT  I "C4'" 1 
ATOM   633   O  "O4'" . DT  A  1 32  ? -5.274  -0.489  -3.606  1.00 125.30 ? 32  DT  I "O4'" 1 
ATOM   634   C  "C3'" . DT  A  1 32  ? -6.433  -2.420  -2.916  1.00 129.51 ? 32  DT  I "C3'" 1 
ATOM   635   O  "O3'" . DT  A  1 32  ? -6.274  -2.392  -1.501  1.00 137.65 ? 32  DT  I "O3'" 1 
ATOM   636   C  "C2'" . DT  A  1 32  ? -7.457  -1.395  -3.389  1.00 130.51 ? 32  DT  I "C2'" 1 
ATOM   637   C  "C1'" . DT  A  1 32  ? -6.630  -0.107  -3.437  1.00 128.79 ? 32  DT  I "C1'" 1 
ATOM   638   N  N1    . DT  A  1 32  ? -7.013  0.811   -4.562  1.00 126.22 ? 32  DT  I N1    1 
ATOM   639   C  C2    . DT  A  1 32  ? -7.010  2.173   -4.354  1.00 125.40 ? 32  DT  I C2    1 
ATOM   640   O  O2    . DT  A  1 32  ? -6.704  2.687   -3.294  1.00 127.89 ? 32  DT  I O2    1 
ATOM   641   N  N3    . DT  A  1 32  ? -7.379  2.919   -5.442  1.00 123.97 ? 32  DT  I N3    1 
ATOM   642   C  C4    . DT  A  1 32  ? -7.746  2.452   -6.691  1.00 123.27 ? 32  DT  I C4    1 
ATOM   643   O  O4    . DT  A  1 32  ? -8.062  3.208   -7.607  1.00 119.99 ? 32  DT  I O4    1 
ATOM   644   C  C5    . DT  A  1 32  ? -7.731  1.015   -6.843  1.00 120.47 ? 32  DT  I C5    1 
ATOM   645   C  C7    . DT  A  1 32  ? -8.111  0.389   -8.153  1.00 118.44 ? 32  DT  I C7    1 
ATOM   646   C  C6    . DT  A  1 32  ? -7.371  0.273   -5.783  1.00 121.86 ? 32  DT  I C6    1 
ATOM   647   P  P     . DG  A  1 33  ? -7.405  -3.014  -0.543  1.00 134.52 ? 33  DG  I P     1 
ATOM   648   O  OP1   . DG  A  1 33  ? -6.730  -3.557  0.657   1.00 132.06 ? 33  DG  I OP1   1 
ATOM   649   O  OP2   . DG  A  1 33  ? -8.262  -3.898  -1.365  1.00 126.42 ? 33  DG  I OP2   1 
ATOM   650   O  "O5'" . DG  A  1 33  ? -8.283  -1.746  -0.121  1.00 133.45 ? 33  DG  I "O5'" 1 
ATOM   651   C  "C5'" . DG  A  1 33  ? -7.652  -0.583  0.413   1.00 131.31 ? 33  DG  I "C5'" 1 
ATOM   652   C  "C4'" . DG  A  1 33  ? -8.680  0.498   0.701   1.00 134.28 ? 33  DG  I "C4'" 1 
ATOM   653   O  "O4'" . DG  A  1 33  ? -8.907  1.285   -0.499  1.00 134.55 ? 33  DG  I "O4'" 1 
ATOM   654   C  "C3'" . DG  A  1 33  ? -10.050 -0.025  1.137   1.00 139.47 ? 33  DG  I "C3'" 1 
ATOM   655   O  "O3'" . DG  A  1 33  ? -10.585 0.782   2.184   1.00 138.42 ? 33  DG  I "O3'" 1 
ATOM   656   C  "C2'" . DG  A  1 33  ? -10.887 0.074   -0.136  1.00 137.41 ? 33  DG  I "C2'" 1 
ATOM   657   C  "C1'" . DG  A  1 33  ? -10.283 1.294   -0.818  1.00 137.17 ? 33  DG  I "C1'" 1 
ATOM   658   N  N9    . DG  A  1 33  ? -10.424 1.268   -2.273  1.00 131.15 ? 33  DG  I N9    1 
ATOM   659   C  C8    . DG  A  1 33  ? -10.418 0.159   -3.083  1.00 131.83 ? 33  DG  I C8    1 
ATOM   660   N  N7    . DG  A  1 33  ? -10.564 0.437   -4.349  1.00 132.28 ? 33  DG  I N7    1 
ATOM   661   C  C5    . DG  A  1 33  ? -10.679 1.821   -4.381  1.00 130.08 ? 33  DG  I C5    1 
ATOM   662   C  C6    . DG  A  1 33  ? -10.859 2.694   -5.480  1.00 128.87 ? 33  DG  I C6    1 
ATOM   663   O  O6    . DG  A  1 33  ? -10.955 2.407   -6.682  1.00 129.46 ? 33  DG  I O6    1 
ATOM   664   N  N1    . DG  A  1 33  ? -10.926 4.026   -5.074  1.00 130.07 ? 33  DG  I N1    1 
ATOM   665   C  C2    . DG  A  1 33  ? -10.832 4.457   -3.771  1.00 131.71 ? 33  DG  I C2    1 
ATOM   666   N  N2    . DG  A  1 33  ? -10.921 5.780   -3.574  1.00 125.99 ? 33  DG  I N2    1 
ATOM   667   N  N3    . DG  A  1 33  ? -10.663 3.647   -2.732  1.00 133.30 ? 33  DG  I N3    1 
ATOM   668   C  C4    . DG  A  1 33  ? -10.595 2.348   -3.111  1.00 129.88 ? 33  DG  I C4    1 
ATOM   669   P  P     . DT  A  1 34  ? -11.894 0.297   2.982   1.00 143.90 ? 34  DT  I P     1 
ATOM   670   O  OP1   . DT  A  1 34  ? -11.891 0.949   4.310   1.00 137.91 ? 34  DT  I OP1   1 
ATOM   671   O  OP2   . DT  A  1 34  ? -11.960 -1.179  2.883   1.00 134.97 ? 34  DT  I OP2   1 
ATOM   672   O  "O5'" . DT  A  1 34  ? -13.106 0.888   2.125   1.00 138.82 ? 34  DT  I "O5'" 1 
ATOM   673   C  "C5'" . DT  A  1 34  ? -14.094 1.690   2.752   1.00 136.00 ? 34  DT  I "C5'" 1 
ATOM   674   C  "C4'" . DT  A  1 34  ? -13.848 3.161   2.475   1.00 140.46 ? 34  DT  I "C4'" 1 
ATOM   675   O  "O4'" . DT  A  1 34  ? -13.275 3.313   1.147   1.00 138.67 ? 34  DT  I "O4'" 1 
ATOM   676   C  "C3'" . DT  A  1 34  ? -15.101 4.024   2.476   1.00 140.28 ? 34  DT  I "C3'" 1 
ATOM   677   O  "O3'" . DT  A  1 34  ? -14.781 5.361   2.851   1.00 148.81 ? 34  DT  I "O3'" 1 
ATOM   678   C  "C2'" . DT  A  1 34  ? -15.534 3.945   1.020   1.00 138.65 ? 34  DT  I "C2'" 1 
ATOM   679   C  "C1'" . DT  A  1 34  ? -14.187 4.001   0.310   1.00 137.50 ? 34  DT  I "C1'" 1 
ATOM   680   N  N1    . DT  A  1 34  ? -14.190 3.350   -1.039  1.00 132.47 ? 34  DT  I N1    1 
ATOM   681   C  C2    . DT  A  1 34  ? -14.183 4.138   -2.170  1.00 127.18 ? 34  DT  I C2    1 
ATOM   682   O  O2    . DT  A  1 34  ? -14.173 5.356   -2.137  1.00 125.32 ? 34  DT  I O2    1 
ATOM   683   N  N3    . DT  A  1 34  ? -14.188 3.444   -3.350  1.00 126.18 ? 34  DT  I N3    1 
ATOM   684   C  C4    . DT  A  1 34  ? -14.199 2.070   -3.513  1.00 129.94 ? 34  DT  I C4    1 
ATOM   685   O  O4    . DT  A  1 34  ? -14.201 1.539   -4.619  1.00 128.99 ? 34  DT  I O4    1 
ATOM   686   C  C5    . DT  A  1 34  ? -14.207 1.303   -2.289  1.00 130.34 ? 34  DT  I C5    1 
ATOM   687   C  C7    . DT  A  1 34  ? -14.220 -0.196  -2.339  1.00 131.96 ? 34  DT  I C7    1 
ATOM   688   C  C6    . DT  A  1 34  ? -14.203 1.972   -1.125  1.00 130.61 ? 34  DT  I C6    1 
ATOM   689   P  P     . DA  A  1 35  ? -15.951 6.385   3.257   1.00 147.76 ? 35  DA  I P     1 
ATOM   690   O  OP1   . DA  A  1 35  ? -15.327 7.568   3.893   1.00 136.05 ? 35  DA  I OP1   1 
ATOM   691   O  OP2   . DA  A  1 35  ? -16.981 5.605   3.979   1.00 139.93 ? 35  DA  I OP2   1 
ATOM   692   O  "O5'" . DA  A  1 35  ? -16.587 6.828   1.857   1.00 142.62 ? 35  DA  I "O5'" 1 
ATOM   693   C  "C5'" . DA  A  1 35  ? -15.964 7.840   1.068   1.00 139.98 ? 35  DA  I "C5'" 1 
ATOM   694   C  "C4'" . DA  A  1 35  ? -16.944 8.397   0.051   1.00 134.42 ? 35  DA  I "C4'" 1 
ATOM   695   O  "O4'" . DA  A  1 35  ? -16.846 7.638   -1.184  1.00 132.23 ? 35  DA  I "O4'" 1 
ATOM   696   C  "C3'" . DA  A  1 35  ? -18.409 8.329   0.481   1.00 135.35 ? 35  DA  I "C3'" 1 
ATOM   697   O  "O3'" . DA  A  1 35  ? -19.093 9.516   0.111   1.00 131.41 ? 35  DA  I "O3'" 1 
ATOM   698   C  "C2'" . DA  A  1 35  ? -18.945 7.113   -0.270  1.00 133.78 ? 35  DA  I "C2'" 1 
ATOM   699   C  "C1'" . DA  A  1 35  ? -18.115 7.132   -1.545  1.00 134.45 ? 35  DA  I "C1'" 1 
ATOM   700   N  N9    . DA  A  1 35  ? -17.938 5.803   -2.124  1.00 130.68 ? 35  DA  I N9    1 
ATOM   701   C  C8    . DA  A  1 35  ? -17.528 4.676   -1.472  1.00 130.12 ? 35  DA  I C8    1 
ATOM   702   N  N7    . DA  A  1 35  ? -17.463 3.612   -2.235  1.00 125.98 ? 35  DA  I N7    1 
ATOM   703   C  C5    . DA  A  1 35  ? -17.864 4.071   -3.476  1.00 124.98 ? 35  DA  I C5    1 
ATOM   704   C  C6    . DA  A  1 35  ? -18.012 3.429   -4.720  1.00 122.89 ? 35  DA  I C6    1 
ATOM   705   N  N6    . DA  A  1 35  ? -17.757 2.128   -4.910  1.00 116.59 ? 35  DA  I N6    1 
ATOM   706   N  N1    . DA  A  1 35  ? -18.433 4.177   -5.763  1.00 121.74 ? 35  DA  I N1    1 
ATOM   707   C  C2    . DA  A  1 35  ? -18.686 5.478   -5.565  1.00 120.64 ? 35  DA  I C2    1 
ATOM   708   N  N3    . DA  A  1 35  ? -18.584 6.192   -4.443  1.00 122.39 ? 35  DA  I N3    1 
ATOM   709   C  C4    . DA  A  1 35  ? -18.165 5.422   -3.427  1.00 124.84 ? 35  DA  I C4    1 
ATOM   710   P  P     . DT  A  1 36  ? -20.663 9.667   0.423   1.00 141.01 ? 36  DT  I P     1 
ATOM   711   O  OP1   . DT  A  1 36  ? -20.958 11.110  0.562   1.00 135.04 ? 36  DT  I OP1   1 
ATOM   712   O  OP2   . DT  A  1 36  ? -21.012 8.732   1.517   1.00 134.65 ? 36  DT  I OP2   1 
ATOM   713   O  "O5'" . DT  A  1 36  ? -21.367 9.123   -0.902  1.00 136.97 ? 36  DT  I "O5'" 1 
ATOM   714   C  "C5'" . DT  A  1 36  ? -22.258 9.957   -1.619  1.00 130.74 ? 36  DT  I "C5'" 1 
ATOM   715   C  "C4'" . DT  A  1 36  ? -21.786 10.143  -3.048  1.00 125.05 ? 36  DT  I "C4'" 1 
ATOM   716   O  "O4'" . DT  A  1 36  ? -21.091 8.946   -3.493  1.00 124.93 ? 36  DT  I "O4'" 1 
ATOM   717   C  "C3'" . DT  A  1 36  ? -22.903 10.377  -4.053  1.00 115.31 ? 36  DT  I "C3'" 1 
ATOM   718   O  "O3'" . DT  A  1 36  ? -22.469 11.262  -5.076  1.00 116.17 ? 36  DT  I "O3'" 1 
ATOM   719   C  "C2'" . DT  A  1 36  ? -23.164 8.979   -4.595  1.00 119.02 ? 36  DT  I "C2'" 1 
ATOM   720   C  "C1'" . DT  A  1 36  ? -21.763 8.385   -4.602  1.00 121.31 ? 36  DT  I "C1'" 1 
ATOM   721   N  N1    . DT  A  1 36  ? -21.757 6.903   -4.460  1.00 117.94 ? 36  DT  I N1    1 
ATOM   722   C  C2    . DT  A  1 36  ? -21.863 6.120   -5.586  1.00 116.20 ? 36  DT  I C2    1 
ATOM   723   O  O2    . DT  A  1 36  ? -21.951 6.576   -6.713  1.00 113.88 ? 36  DT  I O2    1 
ATOM   724   N  N3    . DT  A  1 36  ? -21.852 4.771   -5.347  1.00 117.22 ? 36  DT  I N3    1 
ATOM   725   C  C4    . DT  A  1 36  ? -21.756 4.141   -4.119  1.00 116.50 ? 36  DT  I C4    1 
ATOM   726   O  O4    . DT  A  1 36  ? -21.758 2.919   -4.007  1.00 111.23 ? 36  DT  I O4    1 
ATOM   727   C  C5    . DT  A  1 36  ? -21.653 5.022   -2.980  1.00 118.88 ? 36  DT  I C5    1 
ATOM   728   C  C7    . DT  A  1 36  ? -21.543 4.454   -1.596  1.00 119.56 ? 36  DT  I C7    1 
ATOM   729   C  C6    . DT  A  1 36  ? -21.661 6.344   -3.203  1.00 117.83 ? 36  DT  I C6    1 
ATOM   730   P  P     . DT  A  1 37  ? -23.261 12.636  -5.334  1.00 127.58 ? 37  DT  I P     1 
ATOM   731   O  OP1   . DT  A  1 37  ? -22.260 13.701  -5.571  1.00 106.71 ? 37  DT  I OP1   1 
ATOM   732   O  OP2   . DT  A  1 37  ? -24.258 12.774  -4.249  1.00 133.96 ? 37  DT  I OP2   1 
ATOM   733   O  "O5'" . DT  A  1 37  ? -24.068 12.379  -6.689  1.00 125.44 ? 37  DT  I "O5'" 1 
ATOM   734   C  "C5'" . DT  A  1 37  ? -24.780 11.166  -6.874  1.00 116.24 ? 37  DT  I "C5'" 1 
ATOM   735   C  "C4'" . DT  A  1 37  ? -24.328 10.478  -8.144  1.00 109.16 ? 37  DT  I "C4'" 1 
ATOM   736   O  "O4'" . DT  A  1 37  ? -23.873 9.132   -7.842  1.00 103.71 ? 37  DT  I "O4'" 1 
ATOM   737   C  "C3'" . DT  A  1 37  ? -25.410 10.341  -9.205  1.00 104.85 ? 37  DT  I "C3'" 1 
ATOM   738   O  "O3'" . DT  A  1 37  ? -24.868 10.604  -10.481 1.00 96.42  ? 37  DT  I "O3'" 1 
ATOM   739   C  "C2'" . DT  A  1 37  ? -25.858 8.888   -9.067  1.00 103.68 ? 37  DT  I "C2'" 1 
ATOM   740   C  "C1'" . DT  A  1 37  ? -24.577 8.197   -8.628  1.00 102.52 ? 37  DT  I "C1'" 1 
ATOM   741   N  N1    . DT  A  1 37  ? -24.823 6.990   -7.800  1.00 107.73 ? 37  DT  I N1    1 
ATOM   742   C  C2    . DT  A  1 37  ? -24.561 5.748   -8.324  1.00 112.36 ? 37  DT  I C2    1 
ATOM   743   O  O2    . DT  A  1 37  ? -24.124 5.575   -9.448  1.00 114.32 ? 37  DT  I O2    1 
ATOM   744   N  N3    . DT  A  1 37  ? -24.825 4.704   -7.477  1.00 112.85 ? 37  DT  I N3    1 
ATOM   745   C  C4    . DT  A  1 37  ? -25.318 4.779   -6.187  1.00 113.03 ? 37  DT  I C4    1 
ATOM   746   O  O4    . DT  A  1 37  ? -25.523 3.782   -5.503  1.00 112.83 ? 37  DT  I O4    1 
ATOM   747   C  C5    . DT  A  1 37  ? -25.574 6.113   -5.703  1.00 114.13 ? 37  DT  I C5    1 
ATOM   748   C  C7    . DT  A  1 37  ? -26.111 6.324   -4.318  1.00 114.16 ? 37  DT  I C7    1 
ATOM   749   C  C6    . DT  A  1 37  ? -25.320 7.140   -6.525  1.00 113.26 ? 37  DT  I C6    1 
ATOM   750   P  P     . DT  A  1 38  ? -25.826 11.090  -11.672 1.00 94.24  ? 38  DT  I P     1 
ATOM   751   O  OP1   . DT  A  1 38  ? -25.540 12.519  -11.926 1.00 102.76 ? 38  DT  I OP1   1 
ATOM   752   O  OP2   . DT  A  1 38  ? -27.204 10.658  -11.354 1.00 89.62  ? 38  DT  I OP2   1 
ATOM   753   O  "O5'" . DT  A  1 38  ? -25.318 10.239  -12.921 1.00 86.03  ? 38  DT  I "O5'" 1 
ATOM   754   C  "C5'" . DT  A  1 38  ? -24.488 9.116   -12.708 1.00 84.85  ? 38  DT  I "C5'" 1 
ATOM   755   C  "C4'" . DT  A  1 38  ? -24.984 7.935   -13.507 1.00 86.31  ? 38  DT  I "C4'" 1 
ATOM   756   O  "O4'" . DT  A  1 38  ? -25.387 6.871   -12.602 1.00 96.16  ? 38  DT  I "O4'" 1 
ATOM   757   C  "C3'" . DT  A  1 38  ? -26.197 8.230   -14.381 1.00 90.23  ? 38  DT  I "C3'" 1 
ATOM   758   O  "O3'" . DT  A  1 38  ? -26.101 7.499   -15.590 1.00 92.30  ? 38  DT  I "O3'" 1 
ATOM   759   C  "C2'" . DT  A  1 38  ? -27.356 7.737   -13.519 1.00 96.88  ? 38  DT  I "C2'" 1 
ATOM   760   C  "C1'" . DT  A  1 38  ? -26.732 6.522   -12.848 1.00 100.78 ? 38  DT  I "C1'" 1 
ATOM   761   N  N1    . DT  A  1 38  ? -27.378 6.154   -11.547 1.00 107.84 ? 38  DT  I N1    1 
ATOM   762   C  C2    . DT  A  1 38  ? -27.194 4.886   -11.031 1.00 109.28 ? 38  DT  I C2    1 
ATOM   763   O  O2    . DT  A  1 38  ? -26.520 4.028   -11.578 1.00 104.96 ? 38  DT  I O2    1 
ATOM   764   N  N3    . DT  A  1 38  ? -27.829 4.657   -9.840  1.00 109.46 ? 38  DT  I N3    1 
ATOM   765   C  C4    . DT  A  1 38  ? -28.615 5.544   -9.126  1.00 114.63 ? 38  DT  I C4    1 
ATOM   766   O  O4    . DT  A  1 38  ? -29.144 5.238   -8.062  1.00 118.44 ? 38  DT  I O4    1 
ATOM   767   C  C5    . DT  A  1 38  ? -28.770 6.855   -9.722  1.00 111.29 ? 38  DT  I C5    1 
ATOM   768   C  C7    . DT  A  1 38  ? -29.601 7.906   -9.041  1.00 100.42 ? 38  DT  I C7    1 
ATOM   769   C  C6    . DT  A  1 38  ? -28.154 7.090   -10.891 1.00 105.97 ? 38  DT  I C6    1 
ATOM   770   P  P     . DG  A  1 39  ? -26.597 8.133   -16.983 1.00 82.68  ? 39  DG  I P     1 
ATOM   771   O  OP1   . DG  A  1 39  ? -25.387 8.572   -17.710 1.00 64.41  ? 39  DG  I OP1   1 
ATOM   772   O  OP2   . DG  A  1 39  ? -27.680 9.111   -16.727 1.00 80.50  ? 39  DG  I OP2   1 
ATOM   773   O  "O5'" . DG  A  1 39  ? -27.252 6.876   -17.725 1.00 90.01  ? 39  DG  I "O5'" 1 
ATOM   774   C  "C5'" . DG  A  1 39  ? -26.604 5.609   -17.662 1.00 93.50  ? 39  DG  I "C5'" 1 
ATOM   775   C  "C4'" . DG  A  1 39  ? -27.549 4.523   -17.169 1.00 97.16  ? 39  DG  I "C4'" 1 
ATOM   776   O  "O4'" . DG  A  1 39  ? -27.972 4.801   -15.808 1.00 98.14  ? 39  DG  I "O4'" 1 
ATOM   777   C  "C3'" . DG  A  1 39  ? -28.842 4.352   -17.982 1.00 99.73  ? 39  DG  I "C3'" 1 
ATOM   778   O  "O3'" . DG  A  1 39  ? -29.039 2.986   -18.269 1.00 101.05 ? 39  DG  I "O3'" 1 
ATOM   779   C  "C2'" . DG  A  1 39  ? -29.921 4.862   -17.032 1.00 98.80  ? 39  DG  I "C2'" 1 
ATOM   780   C  "C1'" . DG  A  1 39  ? -29.325 4.442   -15.707 1.00 106.62 ? 39  DG  I "C1'" 1 
ATOM   781   N  N9    . DG  A  1 39  ? -29.924 5.095   -14.549 1.00 112.24 ? 39  DG  I N9    1 
ATOM   782   C  C8    . DG  A  1 39  ? -30.338 6.401   -14.447 1.00 108.69 ? 39  DG  I C8    1 
ATOM   783   N  N7    . DG  A  1 39  ? -30.847 6.695   -13.282 1.00 105.50 ? 39  DG  I N7    1 
ATOM   784   C  C5    . DG  A  1 39  ? -30.769 5.504   -12.568 1.00 112.11 ? 39  DG  I C5    1 
ATOM   785   C  C6    . DG  A  1 39  ? -31.166 5.205   -11.243 1.00 114.66 ? 39  DG  I C6    1 
ATOM   786   O  O6    . DG  A  1 39  ? -31.686 5.959   -10.408 1.00 114.65 ? 39  DG  I O6    1 
ATOM   787   N  N1    . DG  A  1 39  ? -30.908 3.876   -10.915 1.00 112.01 ? 39  DG  I N1    1 
ATOM   788   C  C2    . DG  A  1 39  ? -30.338 2.954   -11.761 1.00 112.25 ? 39  DG  I C2    1 
ATOM   789   N  N2    . DG  A  1 39  ? -30.168 1.720   -11.268 1.00 114.23 ? 39  DG  I N2    1 
ATOM   790   N  N3    . DG  A  1 39  ? -29.962 3.221   -13.002 1.00 110.70 ? 39  DG  I N3    1 
ATOM   791   C  C4    . DG  A  1 39  ? -30.206 4.511   -13.337 1.00 112.56 ? 39  DG  I C4    1 
ATOM   792   P  P     . DG  A  1 40  ? -29.124 2.488   -19.790 1.00 106.74 ? 40  DG  I P     1 
ATOM   793   O  OP1   . DG  A  1 40  ? -28.076 1.457   -19.975 1.00 120.93 ? 40  DG  I OP1   1 
ATOM   794   O  OP2   . DG  A  1 40  ? -29.151 3.697   -20.641 1.00 100.02 ? 40  DG  I OP2   1 
ATOM   795   O  "O5'" . DG  A  1 40  ? -30.561 1.796   -19.895 1.00 106.74 ? 40  DG  I "O5'" 1 
ATOM   796   C  "C5'" . DG  A  1 40  ? -31.312 1.547   -18.721 1.00 117.20 ? 40  DG  I "C5'" 1 
ATOM   797   C  "C4'" . DG  A  1 40  ? -30.819 0.301   -18.007 1.00 111.19 ? 40  DG  I "C4'" 1 
ATOM   798   O  "O4'" . DG  A  1 40  ? -30.579 0.615   -16.618 1.00 115.09 ? 40  DG  I "O4'" 1 
ATOM   799   C  "C3'" . DG  A  1 40  ? -31.820 -0.833  -17.964 1.00 113.83 ? 40  DG  I "C3'" 1 
ATOM   800   O  "O3'" . DG  A  1 40  ? -31.155 -2.066  -17.712 1.00 119.55 ? 40  DG  I "O3'" 1 
ATOM   801   C  "C2'" . DG  A  1 40  ? -32.708 -0.424  -16.792 1.00 117.09 ? 40  DG  I "C2'" 1 
ATOM   802   C  "C1'" . DG  A  1 40  ? -31.720 0.270   -15.849 1.00 116.89 ? 40  DG  I "C1'" 1 
ATOM   803   N  N9    . DG  A  1 40  ? -32.252 1.487   -15.232 1.00 117.32 ? 40  DG  I N9    1 
ATOM   804   C  C8    . DG  A  1 40  ? -32.406 2.719   -15.825 1.00 116.34 ? 40  DG  I C8    1 
ATOM   805   N  N7    . DG  A  1 40  ? -32.902 3.622   -15.028 1.00 119.96 ? 40  DG  I N7    1 
ATOM   806   C  C5    . DG  A  1 40  ? -33.091 2.950   -13.828 1.00 120.08 ? 40  DG  I C5    1 
ATOM   807   C  C6    . DG  A  1 40  ? -33.603 3.416   -12.595 1.00 124.39 ? 40  DG  I C6    1 
ATOM   808   O  O6    . DG  A  1 40  ? -34.001 4.554   -12.311 1.00 129.87 ? 40  DG  I O6    1 
ATOM   809   N  N1    . DG  A  1 40  ? -33.626 2.410   -11.633 1.00 124.76 ? 40  DG  I N1    1 
ATOM   810   C  C2    . DG  A  1 40  ? -33.207 1.117   -11.837 1.00 123.69 ? 40  DG  I C2    1 
ATOM   811   N  N2    . DG  A  1 40  ? -33.306 0.287   -10.788 1.00 125.37 ? 40  DG  I N2    1 
ATOM   812   N  N3    . DG  A  1 40  ? -32.725 0.666   -12.989 1.00 120.91 ? 40  DG  I N3    1 
ATOM   813   C  C4    . DG  A  1 40  ? -32.696 1.635   -13.936 1.00 119.21 ? 40  DG  I C4    1 
ATOM   814   P  P     . DA  A  1 41  ? -31.751 -3.440  -18.298 1.00 115.65 ? 41  DA  I P     1 
ATOM   815   O  OP1   . DA  A  1 41  ? -30.695 -4.468  -18.183 1.00 118.83 ? 41  DA  I OP1   1 
ATOM   816   O  OP2   . DA  A  1 41  ? -32.354 -3.150  -19.618 1.00 109.90 ? 41  DA  I OP2   1 
ATOM   817   O  "O5'" . DA  A  1 41  ? -32.941 -3.802  -17.292 1.00 116.30 ? 41  DA  I "O5'" 1 
ATOM   818   C  "C5'" . DA  A  1 41  ? -32.678 -3.942  -15.903 1.00 120.55 ? 41  DA  I "C5'" 1 
ATOM   819   C  "C4'" . DA  A  1 41  ? -33.966 -4.148  -15.123 1.00 122.43 ? 41  DA  I "C4'" 1 
ATOM   820   O  "O4'" . DA  A  1 41  ? -34.451 -2.873  -14.626 1.00 116.83 ? 41  DA  I "O4'" 1 
ATOM   821   C  "C3'" . DA  A  1 41  ? -35.121 -4.760  -15.917 1.00 123.20 ? 41  DA  I "C3'" 1 
ATOM   822   O  "O3'" . DA  A  1 41  ? -35.835 -5.670  -15.086 1.00 129.21 ? 41  DA  I "O3'" 1 
ATOM   823   C  "C2'" . DA  A  1 41  ? -35.965 -3.539  -16.274 1.00 121.01 ? 41  DA  I "C2'" 1 
ATOM   824   C  "C1'" . DA  A  1 41  ? -35.788 -2.683  -15.034 1.00 121.13 ? 41  DA  I "C1'" 1 
ATOM   825   N  N9    . DA  A  1 41  ? -35.997 -1.260  -15.271 1.00 125.30 ? 41  DA  I N9    1 
ATOM   826   C  C8    . DA  A  1 41  ? -35.993 -0.613  -16.476 1.00 125.18 ? 41  DA  I C8    1 
ATOM   827   N  N7    . DA  A  1 41  ? -36.201 0.680   -16.383 1.00 124.96 ? 41  DA  I N7    1 
ATOM   828   C  C5    . DA  A  1 41  ? -36.353 0.894   -15.023 1.00 125.05 ? 41  DA  I C5    1 
ATOM   829   C  C6    . DA  A  1 41  ? -36.602 2.055   -14.265 1.00 123.03 ? 41  DA  I C6    1 
ATOM   830   N  N6    . DA  A  1 41  ? -36.746 3.269   -14.805 1.00 122.84 ? 41  DA  I N6    1 
ATOM   831   N  N1    . DA  A  1 41  ? -36.700 1.918   -12.927 1.00 126.79 ? 41  DA  I N1    1 
ATOM   832   C  C2    . DA  A  1 41  ? -36.557 0.701   -12.390 1.00 130.13 ? 41  DA  I C2    1 
ATOM   833   N  N3    . DA  A  1 41  ? -36.321 -0.460  -12.997 1.00 127.53 ? 41  DA  I N3    1 
ATOM   834   C  C4    . DA  A  1 41  ? -36.230 -0.293  -14.324 1.00 125.93 ? 41  DA  I C4    1 
ATOM   835   P  P     . DA  A  1 42  ? -37.101 -6.491  -15.643 1.00 126.21 ? 42  DA  I P     1 
ATOM   836   O  OP1   . DA  A  1 42  ? -36.907 -7.907  -15.260 1.00 120.74 ? 42  DA  I OP1   1 
ATOM   837   O  OP2   . DA  A  1 42  ? -37.329 -6.148  -17.065 1.00 128.39 ? 42  DA  I OP2   1 
ATOM   838   O  "O5'" . DA  A  1 42  ? -38.323 -5.903  -14.800 1.00 126.94 ? 42  DA  I "O5'" 1 
ATOM   839   C  "C5'" . DA  A  1 42  ? -39.490 -6.684  -14.606 1.00 139.19 ? 42  DA  I "C5'" 1 
ATOM   840   C  "C4'" . DA  A  1 42  ? -40.455 -5.982  -13.671 1.00 138.86 ? 42  DA  I "C4'" 1 
ATOM   841   O  "O4'" . DA  A  1 42  ? -40.035 -4.604  -13.495 1.00 139.36 ? 42  DA  I "O4'" 1 
ATOM   842   C  "C3'" . DA  A  1 42  ? -41.898 -5.936  -14.165 1.00 138.24 ? 42  DA  I "C3'" 1 
ATOM   843   O  "O3'" . DA  A  1 42  ? -42.797 -6.165  -13.094 1.00 143.38 ? 42  DA  I "O3'" 1 
ATOM   844   C  "C2'" . DA  A  1 42  ? -42.040 -4.526  -14.732 1.00 135.34 ? 42  DA  I "C2'" 1 
ATOM   845   C  "C1'" . DA  A  1 42  ? -41.071 -3.723  -13.872 1.00 137.24 ? 42  DA  I "C1'" 1 
ATOM   846   N  N9    . DA  A  1 42  ? -40.480 -2.594  -14.586 1.00 131.04 ? 42  DA  I N9    1 
ATOM   847   C  C8    . DA  A  1 42  ? -39.723 -2.646  -15.723 1.00 127.05 ? 42  DA  I C8    1 
ATOM   848   N  N7    . DA  A  1 42  ? -39.331 -1.471  -16.154 1.00 125.80 ? 42  DA  I N7    1 
ATOM   849   C  C5    . DA  A  1 42  ? -39.870 -0.583  -15.238 1.00 129.61 ? 42  DA  I C5    1 
ATOM   850   C  C6    . DA  A  1 42  ? -39.819 0.822   -15.132 1.00 126.14 ? 42  DA  I C6    1 
ATOM   851   N  N6    . DA  A  1 42  ? -39.169 1.603   -16.001 1.00 120.76 ? 42  DA  I N6    1 
ATOM   852   N  N1    . DA  A  1 42  ? -40.466 1.395   -14.095 1.00 125.82 ? 42  DA  I N1    1 
ATOM   853   C  C2    . DA  A  1 42  ? -41.118 0.609   -13.228 1.00 127.55 ? 42  DA  I C2    1 
ATOM   854   N  N3    . DA  A  1 42  ? -41.237 -0.718  -13.223 1.00 128.28 ? 42  DA  I N3    1 
ATOM   855   C  C4    . DA  A  1 42  ? -40.584 -1.259  -14.264 1.00 130.62 ? 42  DA  I C4    1 
ATOM   856   P  P     . DA  A  1 43  ? -44.288 -6.681  -13.399 1.00 154.80 ? 43  DA  I P     1 
ATOM   857   O  OP1   . DA  A  1 43  ? -44.509 -7.928  -12.631 1.00 144.36 ? 43  DA  I OP1   1 
ATOM   858   O  OP2   . DA  A  1 43  ? -44.464 -6.685  -14.869 1.00 144.21 ? 43  DA  I OP2   1 
ATOM   859   O  "O5'" . DA  A  1 43  ? -45.216 -5.522  -12.807 1.00 146.17 ? 43  DA  I "O5'" 1 
ATOM   860   C  "C5'" . DA  A  1 43  ? -44.642 -4.483  -12.022 1.00 140.89 ? 43  DA  I "C5'" 1 
ATOM   861   C  "C4'" . DA  A  1 43  ? -45.573 -3.288  -11.951 1.00 145.28 ? 43  DA  I "C4'" 1 
ATOM   862   O  "O4'" . DA  A  1 43  ? -44.938 -2.139  -12.578 1.00 145.81 ? 43  DA  I "O4'" 1 
ATOM   863   C  "C3'" . DA  A  1 43  ? -46.904 -3.465  -12.678 1.00 149.81 ? 43  DA  I "C3'" 1 
ATOM   864   O  "O3'" . DA  A  1 43  ? -47.915 -2.710  -12.018 1.00 155.90 ? 43  DA  I "O3'" 1 
ATOM   865   C  "C2'" . DA  A  1 43  ? -46.589 -2.888  -14.051 1.00 141.95 ? 43  DA  I "C2'" 1 
ATOM   866   C  "C1'" . DA  A  1 43  ? -45.737 -1.694  -13.656 1.00 140.32 ? 43  DA  I "C1'" 1 
ATOM   867   N  N9    . DA  A  1 43  ? -44.865 -1.214  -14.725 1.00 133.90 ? 43  DA  I N9    1 
ATOM   868   C  C8    . DA  A  1 43  ? -44.307 -1.953  -15.731 1.00 133.19 ? 43  DA  I C8    1 
ATOM   869   N  N7    . DA  A  1 43  ? -43.566 -1.251  -16.556 1.00 130.17 ? 43  DA  I N7    1 
ATOM   870   C  C5    . DA  A  1 43  ? -43.644 0.040   -16.057 1.00 130.69 ? 43  DA  I C5    1 
ATOM   871   C  C6    . DA  A  1 43  ? -43.078 1.260   -16.481 1.00 127.89 ? 43  DA  I C6    1 
ATOM   872   N  N6    . DA  A  1 43  ? -42.287 1.370   -17.554 1.00 124.26 ? 43  DA  I N6    1 
ATOM   873   N  N1    . DA  A  1 43  ? -43.357 2.365   -15.757 1.00 128.22 ? 43  DA  I N1    1 
ATOM   874   C  C2    . DA  A  1 43  ? -44.149 2.250   -14.684 1.00 127.21 ? 43  DA  I C2    1 
ATOM   875   N  N3    . DA  A  1 43  ? -44.738 1.162   -14.189 1.00 125.59 ? 43  DA  I N3    1 
ATOM   876   C  C4    . DA  A  1 43  ? -44.442 0.081   -14.929 1.00 130.25 ? 43  DA  I C4    1 
ATOM   877   P  P     . DC  A  1 44  ? -49.471 -2.994  -12.311 1.00 164.67 ? 44  DC  I P     1 
ATOM   878   O  OP1   . DC  A  1 44  ? -50.105 -3.342  -11.019 1.00 155.58 ? 44  DC  I OP1   1 
ATOM   879   O  OP2   . DC  A  1 44  ? -49.557 -3.940  -13.446 1.00 155.63 ? 44  DC  I OP2   1 
ATOM   880   O  "O5'" . DC  A  1 44  ? -50.030 -1.576  -12.805 1.00 146.73 ? 44  DC  I "O5'" 1 
ATOM   881   C  "C5'" . DC  A  1 44  ? -49.465 -0.950  -13.953 1.00 135.64 ? 44  DC  I "C5'" 1 
ATOM   882   C  "C4'" . DC  A  1 44  ? -49.658 0.554   -13.904 1.00 135.25 ? 44  DC  I "C4'" 1 
ATOM   883   O  "O4'" . DC  A  1 44  ? -48.494 1.211   -14.476 1.00 133.79 ? 44  DC  I "O4'" 1 
ATOM   884   C  "C3'" . DC  A  1 44  ? -50.849 1.074   -14.700 1.00 139.34 ? 44  DC  I "C3'" 1 
ATOM   885   O  "O3'" . DC  A  1 44  ? -51.345 2.266   -14.101 1.00 142.67 ? 44  DC  I "O3'" 1 
ATOM   886   C  "C2'" . DC  A  1 44  ? -50.220 1.358   -16.056 1.00 134.80 ? 44  DC  I "C2'" 1 
ATOM   887   C  "C1'" . DC  A  1 44  ? -48.876 1.932   -15.633 1.00 130.50 ? 44  DC  I "C1'" 1 
ATOM   888   N  N1    . DC  A  1 44  ? -47.813 1.778   -16.663 1.00 128.79 ? 44  DC  I N1    1 
ATOM   889   C  C2    . DC  A  1 44  ? -47.081 2.897   -17.078 1.00 125.93 ? 44  DC  I C2    1 
ATOM   890   O  O2    . DC  A  1 44  ? -47.328 4.001   -16.576 1.00 120.24 ? 44  DC  I O2    1 
ATOM   891   N  N3    . DC  A  1 44  ? -46.116 2.737   -18.017 1.00 124.55 ? 44  DC  I N3    1 
ATOM   892   C  C4    . DC  A  1 44  ? -45.879 1.528   -18.533 1.00 126.11 ? 44  DC  I C4    1 
ATOM   893   N  N4    . DC  A  1 44  ? -44.917 1.420   -19.455 1.00 125.83 ? 44  DC  I N4    1 
ATOM   894   C  C5    . DC  A  1 44  ? -46.617 0.378   -18.125 1.00 126.84 ? 44  DC  I C5    1 
ATOM   895   C  C6    . DC  A  1 44  ? -47.565 0.547   -17.198 1.00 127.77 ? 44  DC  I C6    1 
ATOM   896   P  P     . DT  A  1 45  ? -52.837 2.776   -14.414 1.00 140.82 ? 45  DT  I P     1 
ATOM   897   O  OP1   . DT  A  1 45  ? -53.041 4.021   -13.640 1.00 125.93 ? 45  DT  I OP1   1 
ATOM   898   O  OP2   . DT  A  1 45  ? -53.751 1.627   -14.221 1.00 136.53 ? 45  DT  I OP2   1 
ATOM   899   O  "O5'" . DT  A  1 45  ? -52.811 3.113   -15.981 1.00 133.82 ? 45  DT  I "O5'" 1 
ATOM   900   C  "C5'" . DT  A  1 45  ? -53.319 4.354   -16.458 1.00 126.84 ? 45  DT  I "C5'" 1 
ATOM   901   C  "C4'" . DT  A  1 45  ? -52.245 5.428   -16.419 1.00 127.00 ? 45  DT  I "C4'" 1 
ATOM   902   O  "O4'" . DT  A  1 45  ? -51.005 4.894   -16.953 1.00 133.28 ? 45  DT  I "O4'" 1 
ATOM   903   C  "C3'" . DT  A  1 45  ? -52.562 6.681   -17.234 1.00 125.67 ? 45  DT  I "C3'" 1 
ATOM   904   O  "O3'" . DT  A  1 45  ? -52.172 7.850   -16.517 1.00 127.87 ? 45  DT  I "O3'" 1 
ATOM   905   C  "C2'" . DT  A  1 45  ? -51.736 6.495   -18.505 1.00 124.89 ? 45  DT  I "C2'" 1 
ATOM   906   C  "C1'" . DT  A  1 45  ? -50.534 5.714   -18.001 1.00 128.11 ? 45  DT  I "C1'" 1 
ATOM   907   N  N1    . DT  A  1 45  ? -49.910 4.841   -19.047 1.00 124.00 ? 45  DT  I N1    1 
ATOM   908   C  C2    . DT  A  1 45  ? -48.979 5.378   -19.908 1.00 119.81 ? 45  DT  I C2    1 
ATOM   909   O  O2    . DT  A  1 45  ? -48.625 6.543   -19.869 1.00 119.02 ? 45  DT  I O2    1 
ATOM   910   N  N3    . DT  A  1 45  ? -48.471 4.497   -20.824 1.00 115.89 ? 45  DT  I N3    1 
ATOM   911   C  C4    . DT  A  1 45  ? -48.793 3.161   -20.966 1.00 118.22 ? 45  DT  I C4    1 
ATOM   912   O  O4    . DT  A  1 45  ? -48.278 2.451   -21.821 1.00 115.21 ? 45  DT  I O4    1 
ATOM   913   C  C5    . DT  A  1 45  ? -49.776 2.658   -20.034 1.00 123.32 ? 45  DT  I C5    1 
ATOM   914   C  C7    . DT  A  1 45  ? -50.206 1.220   -20.092 1.00 120.53 ? 45  DT  I C7    1 
ATOM   915   C  C6    . DT  A  1 45  ? -50.282 3.513   -19.131 1.00 121.86 ? 45  DT  I C6    1 
ATOM   916   P  P     . DG  A  1 46  ? -53.253 8.997   -16.193 1.00 127.87 ? 46  DG  I P     1 
ATOM   917   O  OP1   . DG  A  1 46  ? -53.008 9.480   -14.816 1.00 136.70 ? 46  DG  I OP1   1 
ATOM   918   O  OP2   . DG  A  1 46  ? -54.584 8.481   -16.583 1.00 121.59 ? 46  DG  I OP2   1 
ATOM   919   O  "O5'" . DG  A  1 46  ? -52.899 10.168  -17.216 1.00 114.23 ? 46  DG  I "O5'" 1 
ATOM   920   C  "C5'" . DG  A  1 46  ? -53.481 10.173  -18.509 1.00 115.45 ? 46  DG  I "C5'" 1 
ATOM   921   C  "C4'" . DG  A  1 46  ? -52.507 10.726  -19.528 1.00 108.59 ? 46  DG  I "C4'" 1 
ATOM   922   O  "O4'" . DG  A  1 46  ? -51.761 9.636   -20.121 1.00 106.34 ? 46  DG  I "O4'" 1 
ATOM   923   C  "C3'" . DG  A  1 46  ? -53.144 11.444  -20.700 1.00 101.19 ? 46  DG  I "C3'" 1 
ATOM   924   O  "O3'" . DG  A  1 46  ? -52.200 12.346  -21.260 1.00 103.16 ? 46  DG  I "O3'" 1 
ATOM   925   C  "C2'" . DG  A  1 46  ? -53.451 10.286  -21.645 1.00 105.37 ? 46  DG  I "C2'" 1 
ATOM   926   C  "C1'" . DG  A  1 46  ? -52.237 9.381   -21.432 1.00 107.21 ? 46  DG  I "C1'" 1 
ATOM   927   N  N9    . DG  A  1 46  ? -52.537 7.955   -21.533 1.00 109.59 ? 46  DG  I N9    1 
ATOM   928   C  C8    . DG  A  1 46  ? -53.633 7.302   -21.022 1.00 114.54 ? 46  DG  I C8    1 
ATOM   929   N  N7    . DG  A  1 46  ? -53.626 6.018   -21.252 1.00 113.27 ? 46  DG  I N7    1 
ATOM   930   C  C5    . DG  A  1 46  ? -52.452 5.806   -21.963 1.00 112.90 ? 46  DG  I C5    1 
ATOM   931   C  C6    . DG  A  1 46  ? -51.910 4.610   -22.488 1.00 114.77 ? 46  DG  I C6    1 
ATOM   932   O  O6    . DG  A  1 46  ? -52.377 3.465   -22.425 1.00 113.87 ? 46  DG  I O6    1 
ATOM   933   N  N1    . DG  A  1 46  ? -50.699 4.836   -23.141 1.00 117.87 ? 46  DG  I N1    1 
ATOM   934   C  C2    . DG  A  1 46  ? -50.092 6.064   -23.267 1.00 116.82 ? 46  DG  I C2    1 
ATOM   935   N  N2    . DG  A  1 46  ? -48.928 6.086   -23.932 1.00 113.74 ? 46  DG  I N2    1 
ATOM   936   N  N3    . DG  A  1 46  ? -50.590 7.193   -22.778 1.00 112.10 ? 46  DG  I N3    1 
ATOM   937   C  C4    . DG  A  1 46  ? -51.768 6.989   -22.141 1.00 110.60 ? 46  DG  I C4    1 
ATOM   938   P  P     . DC  A  1 47  ? -52.669 13.531  -22.238 1.00 105.87 ? 47  DC  I P     1 
ATOM   939   O  OP1   . DC  A  1 47  ? -52.265 14.813  -21.613 1.00 87.71  ? 47  DC  I OP1   1 
ATOM   940   O  OP2   . DC  A  1 47  ? -54.086 13.293  -22.593 1.00 93.88  ? 47  DC  I OP2   1 
ATOM   941   O  "O5'" . DC  A  1 47  ? -51.776 13.292  -23.543 1.00 108.14 ? 47  DC  I "O5'" 1 
ATOM   942   C  "C5'" . DC  A  1 47  ? -51.175 12.019  -23.748 1.00 106.85 ? 47  DC  I "C5'" 1 
ATOM   943   C  "C4'" . DC  A  1 47  ? -50.405 11.969  -25.050 1.00 99.47  ? 47  DC  I "C4'" 1 
ATOM   944   O  "O4'" . DC  A  1 47  ? -50.312 10.591  -25.484 1.00 103.42 ? 47  DC  I "O4'" 1 
ATOM   945   C  "C3'" . DC  A  1 47  ? -51.066 12.687  -26.206 1.00 100.27 ? 47  DC  I "C3'" 1 
ATOM   946   O  "O3'" . DC  A  1 47  ? -50.099 12.969  -27.209 1.00 100.47 ? 47  DC  I "O3'" 1 
ATOM   947   C  "C2'" . DC  A  1 47  ? -52.068 11.641  -26.678 1.00 100.54 ? 47  DC  I "C2'" 1 
ATOM   948   C  "C1'" . DC  A  1 47  ? -51.269 10.348  -26.502 1.00 102.35 ? 47  DC  I "C1'" 1 
ATOM   949   N  N1    . DC  A  1 47  ? -52.103 9.174   -26.101 1.00 103.28 ? 47  DC  I N1    1 
ATOM   950   C  C2    . DC  A  1 47  ? -51.682 7.883   -26.432 1.00 106.35 ? 47  DC  I C2    1 
ATOM   951   O  O2    . DC  A  1 47  ? -50.620 7.736   -27.049 1.00 105.41 ? 47  DC  I O2    1 
ATOM   952   N  N3    . DC  A  1 47  ? -52.449 6.826   -26.065 1.00 108.80 ? 47  DC  I N3    1 
ATOM   953   C  C4    . DC  A  1 47  ? -53.586 7.026   -25.399 1.00 109.24 ? 47  DC  I C4    1 
ATOM   954   N  N4    . DC  A  1 47  ? -54.308 5.954   -25.058 1.00 109.86 ? 47  DC  I N4    1 
ATOM   955   C  C5    . DC  A  1 47  ? -54.034 8.336   -25.054 1.00 109.91 ? 47  DC  I C5    1 
ATOM   956   C  C6    . DC  A  1 47  ? -53.269 9.370   -25.421 1.00 107.12 ? 47  DC  I C6    1 
ATOM   957   P  P     . DT  A  1 48  ? -49.569 14.470  -27.432 1.00 103.65 ? 48  DT  I P     1 
ATOM   958   O  OP1   . DT  A  1 48  ? -48.586 14.774  -26.367 1.00 106.56 ? 48  DT  I OP1   1 
ATOM   959   O  OP2   . DT  A  1 48  ? -50.746 15.345  -27.636 1.00 91.88  ? 48  DT  I OP2   1 
ATOM   960   O  "O5'" . DT  A  1 48  ? -48.808 14.391  -28.827 1.00 86.37  ? 48  DT  I "O5'" 1 
ATOM   961   C  "C5'" . DT  A  1 48  ? -49.481 13.865  -29.952 1.00 91.52  ? 48  DT  I "C5'" 1 
ATOM   962   C  "C4'" . DT  A  1 48  ? -48.939 12.497  -30.316 1.00 83.27  ? 48  DT  I "C4'" 1 
ATOM   963   O  "O4'" . DT  A  1 48  ? -49.716 11.457  -29.656 1.00 88.49  ? 48  DT  I "O4'" 1 
ATOM   964   C  "C3'" . DT  A  1 48  ? -49.003 12.172  -31.803 1.00 85.38  ? 48  DT  I "C3'" 1 
ATOM   965   O  "O3'" . DT  A  1 48  ? -47.866 11.438  -32.171 1.00 74.15  ? 48  DT  I "O3'" 1 
ATOM   966   C  "C2'" . DT  A  1 48  ? -50.260 11.320  -31.906 1.00 84.52  ? 48  DT  I "C2'" 1 
ATOM   967   C  "C1'" . DT  A  1 48  ? -50.143 10.523  -30.627 1.00 89.73  ? 48  DT  I "C1'" 1 
ATOM   968   N  N1    . DT  A  1 48  ? -51.422 9.914   -30.187 1.00 98.84  ? 48  DT  I N1    1 
ATOM   969   C  C2    . DT  A  1 48  ? -51.496 8.549   -30.024 1.00 99.58  ? 48  DT  I C2    1 
ATOM   970   O  O2    . DT  A  1 48  ? -50.554 7.801   -30.221 1.00 99.53  ? 48  DT  I O2    1 
ATOM   971   N  N3    . DT  A  1 48  ? -52.718 8.089   -29.614 1.00 101.56 ? 48  DT  I N3    1 
ATOM   972   C  C4    . DT  A  1 48  ? -53.851 8.843   -29.358 1.00 106.61 ? 48  DT  I C4    1 
ATOM   973   O  O4    . DT  A  1 48  ? -54.907 8.339   -28.993 1.00 112.51 ? 48  DT  I O4    1 
ATOM   974   C  C5    . DT  A  1 48  ? -53.705 10.265  -29.554 1.00 102.97 ? 48  DT  I C5    1 
ATOM   975   C  C7    . DT  A  1 48  ? -54.865 11.183  -29.310 1.00 98.90  ? 48  DT  I C7    1 
ATOM   976   C  C6    . DT  A  1 48  ? -52.512 10.726  -29.958 1.00 101.05 ? 48  DT  I C6    1 
ATOM   977   P  P     . DC  A  1 49  ? -47.409 11.410  -33.703 1.00 61.39  ? 49  DC  I P     1 
ATOM   978   O  OP1   . DC  A  1 49  ? -46.160 12.197  -33.740 1.00 73.57  ? 49  DC  I OP1   1 
ATOM   979   O  OP2   . DC  A  1 49  ? -48.552 11.826  -34.546 1.00 69.65  ? 49  DC  I OP2   1 
ATOM   980   O  "O5'" . DC  A  1 49  ? -47.141 9.861   -33.992 1.00 66.72  ? 49  DC  I "O5'" 1 
ATOM   981   C  "C5'" . DC  A  1 49  ? -47.704 8.895   -33.133 1.00 71.17  ? 49  DC  I "C5'" 1 
ATOM   982   C  "C4'" . DC  A  1 49  ? -47.948 7.581   -33.848 1.00 64.77  ? 49  DC  I "C4'" 1 
ATOM   983   O  "O4'" . DC  A  1 49  ? -49.201 7.024   -33.375 1.00 81.85  ? 49  DC  I "O4'" 1 
ATOM   984   C  "C3'" . DC  A  1 49  ? -48.085 7.661   -35.365 1.00 65.22  ? 49  DC  I "C3'" 1 
ATOM   985   O  "O3'" . DC  A  1 49  ? -47.673 6.413   -35.957 1.00 69.77  ? 49  DC  I "O3'" 1 
ATOM   986   C  "C2'" . DC  A  1 49  ? -49.582 7.906   -35.538 1.00 77.48  ? 49  DC  I "C2'" 1 
ATOM   987   C  "C1'" . DC  A  1 49  ? -50.178 7.082   -34.398 1.00 86.40  ? 49  DC  I "C1'" 1 
ATOM   988   N  N1    . DC  A  1 49  ? -51.437 7.670   -33.828 1.00 91.46  ? 49  DC  I N1    1 
ATOM   989   C  C2    . DC  A  1 49  ? -52.284 6.877   -33.045 1.00 91.14  ? 49  DC  I C2    1 
ATOM   990   O  O2    . DC  A  1 49  ? -51.977 5.700   -32.827 1.00 88.32  ? 49  DC  I O2    1 
ATOM   991   N  N3    . DC  A  1 49  ? -53.417 7.425   -32.543 1.00 95.65  ? 49  DC  I N3    1 
ATOM   992   C  C4    . DC  A  1 49  ? -53.712 8.699   -32.799 1.00 97.83  ? 49  DC  I C4    1 
ATOM   993   N  N4    . DC  A  1 49  ? -54.842 9.196   -32.284 1.00 106.11 ? 49  DC  I N4    1 
ATOM   994   C  C5    . DC  A  1 49  ? -52.865 9.520   -33.596 1.00 95.51  ? 49  DC  I C5    1 
ATOM   995   C  C6    . DC  A  1 49  ? -51.750 8.971   -34.086 1.00 90.24  ? 49  DC  I C6    1 
ATOM   996   P  P     . DC  A  1 50  ? -47.673 6.189   -37.555 1.00 62.61  ? 50  DC  I P     1 
ATOM   997   O  OP1   . DC  A  1 50  ? -46.350 5.653   -37.927 1.00 61.97  ? 50  DC  I OP1   1 
ATOM   998   O  OP2   . DC  A  1 50  ? -48.179 7.397   -38.238 1.00 64.92  ? 50  DC  I OP2   1 
ATOM   999   O  "O5'" . DC  A  1 50  ? -48.721 5.002   -37.774 1.00 80.95  ? 50  DC  I "O5'" 1 
ATOM   1000  C  "C5'" . DC  A  1 50  ? -48.414 3.695   -37.293 1.00 82.93  ? 50  DC  I "C5'" 1 
ATOM   1001  C  "C4'" . DC  A  1 50  ? -49.622 2.774   -37.376 1.00 85.61  ? 50  DC  I "C4'" 1 
ATOM   1002  O  "O4'" . DC  A  1 50  ? -50.705 3.304   -36.568 1.00 86.29  ? 50  DC  I "O4'" 1 
ATOM   1003  C  "C3'" . DC  A  1 50  ? -50.195 2.565   -38.778 1.00 85.48  ? 50  DC  I "C3'" 1 
ATOM   1004  O  "O3'" . DC  A  1 50  ? -50.503 1.192   -38.960 1.00 91.24  ? 50  DC  I "O3'" 1 
ATOM   1005  C  "C2'" . DC  A  1 50  ? -51.456 3.426   -38.774 1.00 84.02  ? 50  DC  I "C2'" 1 
ATOM   1006  C  "C1'" . DC  A  1 50  ? -51.894 3.310   -37.324 1.00 93.28  ? 50  DC  I "C1'" 1 
ATOM   1007  N  N1    . DC  A  1 50  ? -52.738 4.449   -36.858 1.00 102.54 ? 50  DC  I N1    1 
ATOM   1008  C  C2    . DC  A  1 50  ? -53.937 4.193   -36.177 1.00 107.36 ? 50  DC  I C2    1 
ATOM   1009  O  O2    . DC  A  1 50  ? -54.280 3.020   -35.975 1.00 105.74 ? 50  DC  I O2    1 
ATOM   1010  N  N3    . DC  A  1 50  ? -54.689 5.242   -35.755 1.00 106.42 ? 50  DC  I N3    1 
ATOM   1011  C  C4    . DC  A  1 50  ? -54.285 6.492   -35.990 1.00 101.96 ? 50  DC  I C4    1 
ATOM   1012  N  N4    . DC  A  1 50  ? -55.060 7.491   -35.556 1.00 99.82  ? 50  DC  I N4    1 
ATOM   1013  C  C5    . DC  A  1 50  ? -53.069 6.772   -36.682 1.00 100.10 ? 50  DC  I C5    1 
ATOM   1014  C  C6    . DC  A  1 50  ? -52.334 5.732   -37.093 1.00 98.43  ? 50  DC  I C6    1 
ATOM   1015  P  P     . DA  A  1 51  ? -50.761 0.595   -40.429 1.00 99.72  ? 51  DA  I P     1 
ATOM   1016  O  OP1   . DA  A  1 51  ? -49.905 -0.603  -40.584 1.00 105.58 ? 51  DA  I OP1   1 
ATOM   1017  O  OP2   . DA  A  1 51  ? -50.661 1.703   -41.404 1.00 104.55 ? 51  DA  I OP2   1 
ATOM   1018  O  "O5'" . DA  A  1 51  ? -52.289 0.135   -40.378 1.00 107.29 ? 51  DA  I "O5'" 1 
ATOM   1019  C  "C5'" . DA  A  1 51  ? -52.859 -0.307  -39.147 1.00 107.04 ? 51  DA  I "C5'" 1 
ATOM   1020  C  "C4'" . DA  A  1 51  ? -54.372 -0.374  -39.248 1.00 108.22 ? 51  DA  I "C4'" 1 
ATOM   1021  O  "O4'" . DA  A  1 51  ? -54.957 0.843   -38.704 1.00 107.06 ? 51  DA  I "O4'" 1 
ATOM   1022  C  "C3'" . DA  A  1 51  ? -54.917 -0.487  -40.669 1.00 117.27 ? 51  DA  I "C3'" 1 
ATOM   1023  O  "O3'" . DA  A  1 51  ? -56.113 -1.264  -40.665 1.00 123.37 ? 51  DA  I "O3'" 1 
ATOM   1024  C  "C2'" . DA  A  1 51  ? -55.208 0.968   -41.011 1.00 113.89 ? 51  DA  I "C2'" 1 
ATOM   1025  C  "C1'" . DA  A  1 51  ? -55.776 1.439   -39.687 1.00 110.03 ? 51  DA  I "C1'" 1 
ATOM   1026  N  N9    . DA  A  1 51  ? -55.745 2.884   -39.513 1.00 110.32 ? 51  DA  I N9    1 
ATOM   1027  C  C8    . DA  A  1 51  ? -54.783 3.749   -39.954 1.00 113.54 ? 51  DA  I C8    1 
ATOM   1028  N  N7    . DA  A  1 51  ? -55.019 5.003   -39.649 1.00 112.62 ? 51  DA  I N7    1 
ATOM   1029  C  C5    . DA  A  1 51  ? -56.219 4.956   -38.960 1.00 117.02 ? 51  DA  I C5    1 
ATOM   1030  C  C6    . DA  A  1 51  ? -57.011 5.956   -38.366 1.00 119.23 ? 51  DA  I C6    1 
ATOM   1031  N  N6    . DA  A  1 51  ? -56.687 7.252   -38.377 1.00 118.44 ? 51  DA  I N6    1 
ATOM   1032  N  N1    . DA  A  1 51  ? -58.153 5.571   -37.756 1.00 123.15 ? 51  DA  I N1    1 
ATOM   1033  C  C2    . DA  A  1 51  ? -58.472 4.270   -37.748 1.00 124.12 ? 51  DA  I C2    1 
ATOM   1034  N  N3    . DA  A  1 51  ? -57.807 3.240   -38.271 1.00 119.06 ? 51  DA  I N3    1 
ATOM   1035  C  C4    . DA  A  1 51  ? -56.680 3.656   -38.868 1.00 116.36 ? 51  DA  I C4    1 
ATOM   1036  P  P     . DT  A  1 52  ? -56.387 -2.349  -41.819 1.00 135.59 ? 52  DT  I P     1 
ATOM   1037  O  OP1   . DT  A  1 52  ? -56.899 -3.575  -41.165 1.00 123.76 ? 52  DT  I OP1   1 
ATOM   1038  O  OP2   . DT  A  1 52  ? -55.179 -2.418  -42.671 1.00 131.15 ? 52  DT  I OP2   1 
ATOM   1039  O  "O5'" . DT  A  1 52  ? -57.561 -1.701  -42.691 1.00 122.78 ? 52  DT  I "O5'" 1 
ATOM   1040  C  "C5'" . DT  A  1 52  ? -57.983 -0.374  -42.432 1.00 118.79 ? 52  DT  I "C5'" 1 
ATOM   1041  C  "C4'" . DT  A  1 52  ? -59.438 -0.339  -42.022 1.00 126.09 ? 52  DT  I "C4'" 1 
ATOM   1042  O  "O4'" . DT  A  1 52  ? -59.672 0.827   -41.188 1.00 123.08 ? 52  DT  I "O4'" 1 
ATOM   1043  C  "C3'" . DT  A  1 52  ? -60.409 -0.208  -43.184 1.00 137.58 ? 52  DT  I "C3'" 1 
ATOM   1044  O  "O3'" . DT  A  1 52  ? -61.662 -0.799  -42.851 1.00 139.88 ? 52  DT  I "O3'" 1 
ATOM   1045  C  "C2'" . DT  A  1 52  ? -60.520 1.303   -43.331 1.00 134.17 ? 52  DT  I "C2'" 1 
ATOM   1046  C  "C1'" . DT  A  1 52  ? -60.499 1.748   -41.874 1.00 130.11 ? 52  DT  I "C1'" 1 
ATOM   1047  N  N1    . DT  A  1 52  ? -59.951 3.123   -41.683 1.00 131.72 ? 52  DT  I N1    1 
ATOM   1048  C  C2    . DT  A  1 52  ? -60.669 4.037   -40.947 1.00 130.01 ? 52  DT  I C2    1 
ATOM   1049  O  O2    . DT  A  1 52  ? -61.739 3.781   -40.425 1.00 129.02 ? 52  DT  I O2    1 
ATOM   1050  N  N3    . DT  A  1 52  ? -60.082 5.271   -40.838 1.00 127.88 ? 52  DT  I N3    1 
ATOM   1051  C  C4    . DT  A  1 52  ? -58.876 5.676   -41.384 1.00 125.21 ? 52  DT  I C4    1 
ATOM   1052  O  O4    . DT  A  1 52  ? -58.433 6.810   -41.228 1.00 117.90 ? 52  DT  I O4    1 
ATOM   1053  C  C5    . DT  A  1 52  ? -58.176 4.669   -42.148 1.00 129.86 ? 52  DT  I C5    1 
ATOM   1054  C  C7    . DT  A  1 52  ? -56.857 4.989   -42.789 1.00 132.43 ? 52  DT  I C7    1 
ATOM   1055  C  C6    . DT  A  1 52  ? -58.742 3.456   -42.262 1.00 129.05 ? 52  DT  I C6    1 
ATOM   1056  P  P     . DC  A  1 53  ? -62.742 -1.110  -44.002 1.00 136.61 ? 53  DC  I P     1 
ATOM   1057  O  OP1   . DC  A  1 53  ? -63.064 -2.552  -43.937 1.00 129.35 ? 53  DC  I OP1   1 
ATOM   1058  O  OP2   . DC  A  1 53  ? -62.238 -0.535  -45.270 1.00 139.24 ? 53  DC  I OP2   1 
ATOM   1059  O  "O5'" . DC  A  1 53  ? -64.024 -0.261  -43.560 1.00 135.08 ? 53  DC  I "O5'" 1 
ATOM   1060  C  "C5'" . DC  A  1 53  ? -63.909 0.715   -42.531 1.00 134.72 ? 53  DC  I "C5'" 1 
ATOM   1061  C  "C4'" . DC  A  1 53  ? -64.759 1.933   -42.840 1.00 138.11 ? 53  DC  I "C4'" 1 
ATOM   1062  O  "O4'" . DC  A  1 53  ? -63.942 3.132   -42.760 1.00 139.00 ? 53  DC  I "O4'" 1 
ATOM   1063  C  "C3'" . DC  A  1 53  ? -65.389 1.945   -44.231 1.00 145.24 ? 53  DC  I "C3'" 1 
ATOM   1064  O  "O3'" . DC  A  1 53  ? -66.691 2.505   -44.155 1.00 156.93 ? 53  DC  I "O3'" 1 
ATOM   1065  C  "C2'" . DC  A  1 53  ? -64.441 2.839   -45.025 1.00 140.30 ? 53  DC  I "C2'" 1 
ATOM   1066  C  "C1'" . DC  A  1 53  ? -64.038 3.855   -43.969 1.00 140.29 ? 53  DC  I "C1'" 1 
ATOM   1067  N  N1    . DC  A  1 53  ? -62.722 4.504   -44.234 1.00 137.93 ? 53  DC  I N1    1 
ATOM   1068  C  C2    . DC  A  1 53  ? -62.401 5.705   -43.591 1.00 134.14 ? 53  DC  I C2    1 
ATOM   1069  O  O2    . DC  A  1 53  ? -63.219 6.210   -42.812 1.00 133.07 ? 53  DC  I O2    1 
ATOM   1070  N  N3    . DC  A  1 53  ? -61.197 6.280   -43.841 1.00 135.86 ? 53  DC  I N3    1 
ATOM   1071  C  C4    . DC  A  1 53  ? -60.342 5.702   -44.689 1.00 136.41 ? 53  DC  I C4    1 
ATOM   1072  N  N4    . DC  A  1 53  ? -59.167 6.306   -44.903 1.00 131.85 ? 53  DC  I N4    1 
ATOM   1073  C  C5    . DC  A  1 53  ? -60.654 4.479   -45.353 1.00 136.31 ? 53  DC  I C5    1 
ATOM   1074  C  C6    . DC  A  1 53  ? -61.843 3.922   -45.100 1.00 137.69 ? 53  DC  I C6    1 
ATOM   1075  P  P     . DA  A  1 54  ? -67.792 2.173   -45.278 1.00 162.38 ? 54  DA  I P     1 
ATOM   1076  O  OP1   . DA  A  1 54  ? -68.821 1.309   -44.656 1.00 149.51 ? 54  DA  I OP1   1 
ATOM   1077  O  OP2   . DA  A  1 54  ? -67.087 1.714   -46.497 1.00 160.11 ? 54  DA  I OP2   1 
ATOM   1078  O  "O5'" . DA  A  1 54  ? -68.438 3.600   -45.591 1.00 153.68 ? 54  DA  I "O5'" 1 
ATOM   1079  C  "C5'" . DA  A  1 54  ? -67.882 4.771   -45.001 1.00 146.62 ? 54  DA  I "C5'" 1 
ATOM   1080  C  "C4'" . DA  A  1 54  ? -68.015 5.950   -45.940 1.00 146.94 ? 54  DA  I "C4'" 1 
ATOM   1081  O  "O4'" . DA  A  1 54  ? -66.777 6.709   -45.937 1.00 149.18 ? 54  DA  I "O4'" 1 
ATOM   1082  C  "C3'" . DA  A  1 54  ? -68.281 5.568   -47.396 1.00 149.51 ? 54  DA  I "C3'" 1 
ATOM   1083  O  "O3'" . DA  A  1 54  ? -69.270 6.417   -47.957 1.00 156.26 ? 54  DA  I "O3'" 1 
ATOM   1084  C  "C2'" . DA  A  1 54  ? -66.926 5.760   -48.069 1.00 148.13 ? 54  DA  I "C2'" 1 
ATOM   1085  C  "C1'" . DA  A  1 54  ? -66.338 6.904   -47.262 1.00 146.54 ? 54  DA  I "C1'" 1 
ATOM   1086  N  N9    . DA  A  1 54  ? -64.879 6.924   -47.277 1.00 141.15 ? 54  DA  I N9    1 
ATOM   1087  C  C8    . DA  A  1 54  ? -64.050 5.934   -47.728 1.00 139.69 ? 54  DA  I C8    1 
ATOM   1088  N  N7    . DA  A  1 54  ? -62.775 6.224   -47.630 1.00 135.51 ? 54  DA  I N7    1 
ATOM   1089  C  C5    . DA  A  1 54  ? -62.767 7.494   -47.077 1.00 134.16 ? 54  DA  I C5    1 
ATOM   1090  C  C6    . DA  A  1 54  ? -61.720 8.363   -46.720 1.00 130.17 ? 54  DA  I C6    1 
ATOM   1091  N  N6    . DA  A  1 54  ? -60.428 8.061   -46.880 1.00 128.20 ? 54  DA  I N6    1 
ATOM   1092  N  N1    . DA  A  1 54  ? -62.054 9.559   -46.191 1.00 131.29 ? 54  DA  I N1    1 
ATOM   1093  C  C2    . DA  A  1 54  ? -63.351 9.857   -46.034 1.00 129.20 ? 54  DA  I C2    1 
ATOM   1094  N  N3    . DA  A  1 54  ? -64.421 9.123   -46.331 1.00 129.71 ? 54  DA  I N3    1 
ATOM   1095  C  C4    . DA  A  1 54  ? -64.056 7.941   -46.854 1.00 135.77 ? 54  DA  I C4    1 
ATOM   1096  P  P     . DA  A  1 55  ? -70.158 5.899   -49.192 1.00 165.89 ? 55  DA  I P     1 
ATOM   1097  O  OP1   . DA  A  1 55  ? -71.337 6.788   -49.313 1.00 154.69 ? 55  DA  I OP1   1 
ATOM   1098  O  OP2   . DA  A  1 55  ? -70.371 4.448   -48.991 1.00 163.07 ? 55  DA  I OP2   1 
ATOM   1099  O  "O5'" . DA  A  1 55  ? -69.190 6.058   -50.463 1.00 159.38 ? 55  DA  I "O5'" 1 
ATOM   1100  C  "C5'" . DA  A  1 55  ? -69.171 7.273   -51.218 1.00 153.87 ? 55  DA  I "C5'" 1 
ATOM   1101  C  "C4'" . DA  A  1 55  ? -68.969 8.476   -50.314 1.00 155.15 ? 55  DA  I "C4'" 1 
ATOM   1102  O  "O4'" . DA  A  1 55  ? -67.640 8.433   -49.729 1.00 152.62 ? 55  DA  I "O4'" 1 
ATOM   1103  C  "C3'" . DA  A  1 55  ? -69.072 9.828   -51.006 1.00 152.58 ? 55  DA  I "C3'" 1 
ATOM   1104  O  "O3'" . DA  A  1 55  ? -69.628 10.782  -50.104 1.00 155.14 ? 55  DA  I "O3'" 1 
ATOM   1105  C  "C2'" . DA  A  1 55  ? -67.614 10.137  -51.328 1.00 148.83 ? 55  DA  I "C2'" 1 
ATOM   1106  C  "C1'" . DA  A  1 55  ? -66.925 9.598   -50.086 1.00 147.78 ? 55  DA  I "C1'" 1 
ATOM   1107  N  N9    . DA  A  1 55  ? -65.529 9.234   -50.299 1.00 139.16 ? 55  DA  I N9    1 
ATOM   1108  C  C8    . DA  A  1 55  ? -65.056 8.108   -50.914 1.00 135.11 ? 55  DA  I C8    1 
ATOM   1109  N  N7    . DA  A  1 55  ? -63.748 8.039   -50.959 1.00 132.77 ? 55  DA  I N7    1 
ATOM   1110  C  C5    . DA  A  1 55  ? -63.332 9.199   -50.327 1.00 133.50 ? 55  DA  I C5    1 
ATOM   1111  C  C6    . DA  A  1 55  ? -62.054 9.721   -50.048 1.00 127.57 ? 55  DA  I C6    1 
ATOM   1112  N  N6    . DA  A  1 55  ? -60.919 9.104   -50.391 1.00 123.63 ? 55  DA  I N6    1 
ATOM   1113  N  N1    . DA  A  1 55  ? -61.989 10.906  -49.401 1.00 125.48 ? 55  DA  I N1    1 
ATOM   1114  C  C2    . DA  A  1 55  ? -63.128 11.520  -49.061 1.00 124.63 ? 55  DA  I C2    1 
ATOM   1115  N  N3    . DA  A  1 55  ? -64.385 11.128  -49.268 1.00 132.08 ? 55  DA  I N3    1 
ATOM   1116  C  C4    . DA  A  1 55  ? -64.417 9.948   -49.912 1.00 136.81 ? 55  DA  I C4    1 
ATOM   1117  P  P     . DA  A  1 56  ? -70.211 12.174  -50.653 1.00 166.50 ? 56  DA  I P     1 
ATOM   1118  O  OP1   . DA  A  1 56  ? -70.598 12.990  -49.480 1.00 158.58 ? 56  DA  I OP1   1 
ATOM   1119  O  OP2   . DA  A  1 56  ? -71.194 11.886  -51.721 1.00 157.58 ? 56  DA  I OP2   1 
ATOM   1120  O  "O5'" . DA  A  1 56  ? -68.943 12.860  -51.330 1.00 154.24 ? 56  DA  I "O5'" 1 
ATOM   1121  C  "C5'" . DA  A  1 56  ? -69.075 13.582  -52.530 1.00 146.08 ? 56  DA  I "C5'" 1 
ATOM   1122  C  "C4'" . DA  A  1 56  ? -67.914 14.539  -52.664 1.00 146.47 ? 56  DA  I "C4'" 1 
ATOM   1123  O  "O4'" . DA  A  1 56  ? -66.679 13.839  -52.359 1.00 144.69 ? 56  DA  I "O4'" 1 
ATOM   1124  C  "C3'" . DA  A  1 56  ? -67.737 15.170  -54.038 1.00 142.85 ? 56  DA  I "C3'" 1 
ATOM   1125  O  "O3'" . DA  A  1 56  ? -67.430 16.553  -53.873 1.00 145.19 ? 56  DA  I "O3'" 1 
ATOM   1126  C  "C2'" . DA  A  1 56  ? -66.575 14.377  -54.649 1.00 138.14 ? 56  DA  I "C2'" 1 
ATOM   1127  C  "C1'" . DA  A  1 56  ? -65.765 13.969  -53.423 1.00 141.39 ? 56  DA  I "C1'" 1 
ATOM   1128  N  N9    . DA  A  1 56  ? -65.066 12.692  -53.582 1.00 138.26 ? 56  DA  I N9    1 
ATOM   1129  C  C8    . DA  A  1 56  ? -65.566 11.540  -54.126 1.00 135.85 ? 56  DA  I C8    1 
ATOM   1130  N  N7    . DA  A  1 56  ? -64.712 10.543  -54.139 1.00 134.46 ? 56  DA  I N7    1 
ATOM   1131  C  C5    . DA  A  1 56  ? -63.570 11.076  -53.561 1.00 135.47 ? 56  DA  I C5    1 
ATOM   1132  C  C6    . DA  A  1 56  ? -62.299 10.527  -53.282 1.00 128.91 ? 56  DA  I C6    1 
ATOM   1133  N  N6    . DA  A  1 56  ? -61.964 9.262   -53.565 1.00 121.15 ? 56  DA  I N6    1 
ATOM   1134  N  N1    . DA  A  1 56  ? -61.385 11.332  -52.698 1.00 127.77 ? 56  DA  I N1    1 
ATOM   1135  C  C2    . DA  A  1 56  ? -61.725 12.597  -52.414 1.00 125.58 ? 56  DA  I C2    1 
ATOM   1136  N  N3    . DA  A  1 56  ? -62.881 13.223  -52.629 1.00 128.71 ? 56  DA  I N3    1 
ATOM   1137  C  C4    . DA  A  1 56  ? -63.770 12.400  -53.210 1.00 134.87 ? 56  DA  I C4    1 
ATOM   1138  P  P     . DA  A  1 57  ? -67.099 17.499  -55.128 1.00 144.76 ? 57  DA  I P     1 
ATOM   1139  O  OP1   . DA  A  1 57  ? -67.734 18.811  -54.868 1.00 141.16 ? 57  DA  I OP1   1 
ATOM   1140  O  OP2   . DA  A  1 57  ? -67.399 16.785  -56.390 1.00 142.29 ? 57  DA  I OP2   1 
ATOM   1141  O  "O5'" . DA  A  1 57  ? -65.521 17.683  -55.021 1.00 143.33 ? 57  DA  I "O5'" 1 
ATOM   1142  C  "C5'" . DA  A  1 57  ? -64.883 17.603  -53.745 1.00 140.79 ? 57  DA  I "C5'" 1 
ATOM   1143  C  "C4'" . DA  A  1 57  ? -63.377 17.672  -53.897 1.00 137.29 ? 57  DA  I "C4'" 1 
ATOM   1144  O  "O4'" . DA  A  1 57  ? -62.864 16.358  -54.250 1.00 131.43 ? 57  DA  I "O4'" 1 
ATOM   1145  C  "C3'" . DA  A  1 57  ? -62.902 18.613  -54.996 1.00 138.58 ? 57  DA  I "C3'" 1 
ATOM   1146  O  "O3'" . DA  A  1 57  ? -61.678 19.237  -54.617 1.00 140.54 ? 57  DA  I "O3'" 1 
ATOM   1147  C  "C2'" . DA  A  1 57  ? -62.723 17.674  -56.185 1.00 132.42 ? 57  DA  I "C2'" 1 
ATOM   1148  C  "C1'" . DA  A  1 57  ? -62.201 16.424  -55.497 1.00 132.08 ? 57  DA  I "C1'" 1 
ATOM   1149  N  N9    . DA  A  1 57  ? -62.476 15.196  -56.236 1.00 127.24 ? 57  DA  I N9    1 
ATOM   1150  C  C8    . DA  A  1 57  ? -63.464 14.992  -57.159 1.00 124.51 ? 57  DA  I C8    1 
ATOM   1151  N  N7    . DA  A  1 57  ? -63.471 13.782  -57.666 1.00 121.91 ? 57  DA  I N7    1 
ATOM   1152  C  C5    . DA  A  1 57  ? -62.414 13.149  -57.032 1.00 122.60 ? 57  DA  I C5    1 
ATOM   1153  C  C6    . DA  A  1 57  ? -61.891 11.843  -57.128 1.00 124.60 ? 57  DA  I C6    1 
ATOM   1154  N  N6    . DA  A  1 57  ? -62.393 10.907  -57.940 1.00 124.69 ? 57  DA  I N6    1 
ATOM   1155  N  N1    . DA  A  1 57  ? -60.827 11.536  -56.355 1.00 125.25 ? 57  DA  I N1    1 
ATOM   1156  C  C2    . DA  A  1 57  ? -60.327 12.475  -55.543 1.00 122.88 ? 57  DA  I C2    1 
ATOM   1157  N  N3    . DA  A  1 57  ? -60.733 13.731  -55.366 1.00 128.09 ? 57  DA  I N3    1 
ATOM   1158  C  C4    . DA  A  1 57  ? -61.790 14.007  -56.148 1.00 127.13 ? 57  DA  I C4    1 
ATOM   1159  P  P     . DG  A  1 58  ? -61.503 20.820  -54.831 1.00 143.45 ? 58  DG  I P     1 
ATOM   1160  O  OP1   . DG  A  1 58  ? -60.157 21.245  -54.374 1.00 142.19 ? 58  DG  I OP1   1 
ATOM   1161  O  OP2   . DG  A  1 58  ? -62.667 21.438  -54.161 1.00 140.90 ? 58  DG  I OP2   1 
ATOM   1162  O  "O5'" . DG  A  1 58  ? -61.729 21.010  -56.414 1.00 130.83 ? 58  DG  I "O5'" 1 
ATOM   1163  C  "C5'" . DG  A  1 58  ? -60.657 20.838  -57.370 1.00 133.65 ? 58  DG  I "C5'" 1 
ATOM   1164  C  "C4'" . DG  A  1 58  ? -59.605 19.837  -56.903 1.00 134.13 ? 58  DG  I "C4'" 1 
ATOM   1165  O  "O4'" . DG  A  1 58  ? -60.052 18.479  -57.159 1.00 134.34 ? 58  DG  I "O4'" 1 
ATOM   1166  C  "C3'" . DG  A  1 58  ? -58.256 19.972  -57.594 1.00 125.63 ? 58  DG  I "C3'" 1 
ATOM   1167  O  "O3'" . DG  A  1 58  ? -57.207 19.720  -56.673 1.00 120.63 ? 58  DG  I "O3'" 1 
ATOM   1168  C  "C2'" . DG  A  1 58  ? -58.321 18.911  -58.686 1.00 120.18 ? 58  DG  I "C2'" 1 
ATOM   1169  C  "C1'" . DG  A  1 58  ? -59.161 17.821  -58.035 1.00 121.80 ? 58  DG  I "C1'" 1 
ATOM   1170  N  N9    . DG  A  1 58  ? -59.954 17.049  -58.993 1.00 122.56 ? 58  DG  I N9    1 
ATOM   1171  C  C8    . DG  A  1 58  ? -60.883 17.540  -59.881 1.00 122.15 ? 58  DG  I C8    1 
ATOM   1172  N  N7    . DG  A  1 58  ? -61.442 16.618  -60.614 1.00 119.00 ? 58  DG  I N7    1 
ATOM   1173  C  C5    . DG  A  1 58  ? -60.849 15.436  -60.187 1.00 121.56 ? 58  DG  I C5    1 
ATOM   1174  C  C6    . DG  A  1 58  ? -61.058 14.103  -60.619 1.00 122.62 ? 58  DG  I C6    1 
ATOM   1175  O  O6    . DG  A  1 58  ? -61.833 13.690  -61.495 1.00 119.82 ? 58  DG  I O6    1 
ATOM   1176  N  N1    . DG  A  1 58  ? -60.251 13.204  -59.923 1.00 122.56 ? 58  DG  I N1    1 
ATOM   1177  C  C2    . DG  A  1 58  ? -59.358 13.549  -58.934 1.00 118.21 ? 58  DG  I C2    1 
ATOM   1178  N  N2    . DG  A  1 58  ? -58.670 12.542  -58.378 1.00 113.64 ? 58  DG  I N2    1 
ATOM   1179  N  N3    . DG  A  1 58  ? -59.153 14.795  -58.519 1.00 118.89 ? 58  DG  I N3    1 
ATOM   1180  C  C4    . DG  A  1 58  ? -59.931 15.683  -59.187 1.00 121.24 ? 58  DG  I C4    1 
ATOM   1181  P  P     . DG  A  1 59  ? -55.795 20.463  -56.852 1.00 97.76  ? 59  DG  I P     1 
ATOM   1182  O  OP1   . DG  A  1 59  ? -55.269 20.752  -55.502 1.00 99.14  ? 59  DG  I OP1   1 
ATOM   1183  O  OP2   . DG  A  1 59  ? -55.990 21.566  -57.819 1.00 107.05 ? 59  DG  I OP2   1 
ATOM   1184  O  "O5'" . DG  A  1 59  ? -54.869 19.353  -57.533 1.00 90.24  ? 59  DG  I "O5'" 1 
ATOM   1185  C  "C5'" . DG  A  1 59  ? -54.495 18.210  -56.786 1.00 92.63  ? 59  DG  I "C5'" 1 
ATOM   1186  C  "C4'" . DG  A  1 59  ? -54.184 17.035  -57.691 1.00 87.41  ? 59  DG  I "C4'" 1 
ATOM   1187  O  "O4'" . DG  A  1 59  ? -55.357 16.682  -58.462 1.00 94.99  ? 59  DG  I "O4'" 1 
ATOM   1188  C  "C3'" . DG  A  1 59  ? -53.055 17.267  -58.703 1.00 82.47  ? 59  DG  I "C3'" 1 
ATOM   1189  O  "O3'" . DG  A  1 59  ? -52.077 16.248  -58.550 1.00 78.52  ? 59  DG  I "O3'" 1 
ATOM   1190  C  "C2'" . DG  A  1 59  ? -53.758 17.175  -60.064 1.00 90.15  ? 59  DG  I "C2'" 1 
ATOM   1191  C  "C1'" . DG  A  1 59  ? -54.943 16.284  -59.743 1.00 91.91  ? 59  DG  I "C1'" 1 
ATOM   1192  N  N9    . DG  A  1 59  ? -56.065 16.444  -60.661 1.00 103.19 ? 59  DG  I N9    1 
ATOM   1193  C  C8    . DG  A  1 59  ? -56.631 17.624  -61.076 1.00 104.23 ? 59  DG  I C8    1 
ATOM   1194  N  N7    . DG  A  1 59  ? -57.633 17.461  -61.895 1.00 110.75 ? 59  DG  I N7    1 
ATOM   1195  C  C5    . DG  A  1 59  ? -57.734 16.083  -62.039 1.00 111.69 ? 59  DG  I C5    1 
ATOM   1196  C  C6    . DG  A  1 59  ? -58.635 15.310  -62.811 1.00 116.87 ? 59  DG  I C6    1 
ATOM   1197  O  O6    . DG  A  1 59  ? -59.555 15.707  -63.544 1.00 120.24 ? 59  DG  I O6    1 
ATOM   1198  N  N1    . DG  A  1 59  ? -58.391 13.945  -62.675 1.00 117.02 ? 59  DG  I N1    1 
ATOM   1199  C  C2    . DG  A  1 59  ? -57.402 13.395  -61.893 1.00 110.56 ? 59  DG  I C2    1 
ATOM   1200  N  N2    . DG  A  1 59  ? -57.322 12.055  -61.890 1.00 108.83 ? 59  DG  I N2    1 
ATOM   1201  N  N3    . DG  A  1 59  ? -56.551 14.109  -61.165 1.00 104.52 ? 59  DG  I N3    1 
ATOM   1202  C  C4    . DG  A  1 59  ? -56.776 15.441  -61.285 1.00 105.68 ? 59  DG  I C4    1 
ATOM   1203  P  P     . DC  A  1 60  ? -50.743 16.225  -59.446 1.00 69.34  ? 60  DC  I P     1 
ATOM   1204  O  OP1   . DC  A  1 60  ? -49.631 16.003  -58.498 1.00 71.89  ? 60  DC  I OP1   1 
ATOM   1205  O  OP2   . DC  A  1 60  ? -50.712 17.394  -60.354 1.00 68.28  ? 60  DC  I OP2   1 
ATOM   1206  O  "O5'" . DC  A  1 60  ? -50.916 14.913  -60.345 1.00 66.27  ? 60  DC  I "O5'" 1 
ATOM   1207  C  "C5'" . DC  A  1 60  ? -51.019 13.636  -59.728 1.00 65.25  ? 60  DC  I "C5'" 1 
ATOM   1208  C  "C4'" . DC  A  1 60  ? -51.460 12.585  -60.729 1.00 70.18  ? 60  DC  I "C4'" 1 
ATOM   1209  O  "O4'" . DC  A  1 60  ? -52.755 12.950  -61.277 1.00 79.87  ? 60  DC  I "O4'" 1 
ATOM   1210  C  "C3'" . DC  A  1 60  ? -50.526 12.400  -61.927 1.00 68.55  ? 60  DC  I "C3'" 1 
ATOM   1211  O  "O3'" . DC  A  1 60  ? -50.385 11.023  -62.220 1.00 70.31  ? 60  DC  I "O3'" 1 
ATOM   1212  C  "C2'" . DC  A  1 60  ? -51.247 13.135  -63.051 1.00 69.36  ? 60  DC  I "C2'" 1 
ATOM   1213  C  "C1'" . DC  A  1 60  ? -52.704 12.904  -62.685 1.00 79.33  ? 60  DC  I "C1'" 1 
ATOM   1214  N  N1    . DC  A  1 60  ? -53.618 13.949  -63.224 1.00 88.91  ? 60  DC  I N1    1 
ATOM   1215  C  C2    . DC  A  1 60  ? -54.729 13.579  -63.996 1.00 97.22  ? 60  DC  I C2    1 
ATOM   1216  O  O2    . DC  A  1 60  ? -54.943 12.379  -64.215 1.00 94.24  ? 60  DC  I O2    1 
ATOM   1217  N  N3    . DC  A  1 60  ? -55.542 14.553  -64.481 1.00 100.19 ? 60  DC  I N3    1 
ATOM   1218  C  C4    . DC  A  1 60  ? -55.277 15.838  -64.223 1.00 98.29  ? 60  DC  I C4    1 
ATOM   1219  N  N4    . DC  A  1 60  ? -56.106 16.762  -64.720 1.00 101.19 ? 60  DC  I N4    1 
ATOM   1220  C  C5    . DC  A  1 60  ? -54.150 16.230  -63.443 1.00 91.22  ? 60  DC  I C5    1 
ATOM   1221  C  C6    . DC  A  1 60  ? -53.356 15.263  -62.970 1.00 87.15  ? 60  DC  I C6    1 
ATOM   1222  P  P     . DA  A  1 61  ? -49.146 10.500  -63.098 1.00 64.62  ? 61  DA  I P     1 
ATOM   1223  O  OP1   . DA  A  1 61  ? -48.390 9.530   -62.275 1.00 70.44  ? 61  DA  I OP1   1 
ATOM   1224  O  OP2   . DA  A  1 61  ? -48.474 11.667  -63.707 1.00 62.48  ? 61  DA  I OP2   1 
ATOM   1225  O  "O5'" . DA  A  1 61  ? -49.839 9.697   -64.287 1.00 74.34  ? 61  DA  I "O5'" 1 
ATOM   1226  C  "C5'" . DA  A  1 61  ? -50.796 8.697   -64.001 1.00 71.76  ? 61  DA  I "C5'" 1 
ATOM   1227  C  "C4'" . DA  A  1 61  ? -51.637 8.411   -65.225 1.00 72.41  ? 61  DA  I "C4'" 1 
ATOM   1228  O  "O4'" . DA  A  1 61  ? -52.511 9.541   -65.484 1.00 76.99  ? 61  DA  I "O4'" 1 
ATOM   1229  C  "C3'" . DA  A  1 61  ? -50.842 8.184   -66.508 1.00 74.21  ? 61  DA  I "C3'" 1 
ATOM   1230  O  "O3'" . DA  A  1 61  ? -51.420 7.119   -67.243 1.00 80.87  ? 61  DA  I "O3'" 1 
ATOM   1231  C  "C2'" . DA  A  1 61  ? -50.975 9.518   -67.243 1.00 76.22  ? 61  DA  I "C2'" 1 
ATOM   1232  C  "C1'" . DA  A  1 61  ? -52.363 9.963   -66.820 1.00 78.21  ? 61  DA  I "C1'" 1 
ATOM   1233  N  N9    . DA  A  1 61  ? -52.551 11.407  -66.865 1.00 83.06  ? 61  DA  I N9    1 
ATOM   1234  C  C8    . DA  A  1 61  ? -51.771 12.355  -66.267 1.00 82.77  ? 61  DA  I C8    1 
ATOM   1235  N  N7    . DA  A  1 61  ? -52.179 13.584  -66.471 1.00 83.26  ? 61  DA  I N7    1 
ATOM   1236  C  C5    . DA  A  1 61  ? -53.309 13.432  -67.256 1.00 94.21  ? 61  DA  I C5    1 
ATOM   1237  C  C6    . DA  A  1 61  ? -54.209 14.362  -67.814 1.00 101.22 ? 61  DA  I C6    1 
ATOM   1238  N  N6    . DA  A  1 61  ? -54.094 15.685  -67.653 1.00 96.88  ? 61  DA  I N6    1 
ATOM   1239  N  N1    . DA  A  1 61  ? -55.233 13.877  -68.548 1.00 103.17 ? 61  DA  I N1    1 
ATOM   1240  C  C2    . DA  A  1 61  ? -55.342 12.552  -68.708 1.00 99.54  ? 61  DA  I C2    1 
ATOM   1241  N  N3    . DA  A  1 61  ? -54.561 11.583  -68.232 1.00 95.80  ? 61  DA  I N3    1 
ATOM   1242  C  C4    . DA  A  1 61  ? -53.554 12.096  -67.507 1.00 91.91  ? 61  DA  I C4    1 
ATOM   1243  P  P     . DT  A  1 62  ? -50.634 6.453   -68.475 1.00 87.16  ? 62  DT  I P     1 
ATOM   1244  O  OP1   . DT  A  1 62  ? -50.489 5.011   -68.173 1.00 94.73  ? 62  DT  I OP1   1 
ATOM   1245  O  OP2   . DT  A  1 62  ? -49.429 7.262   -68.768 1.00 78.44  ? 62  DT  I OP2   1 
ATOM   1246  O  "O5'" . DT  A  1 62  ? -51.655 6.618   -69.693 1.00 89.03  ? 62  DT  I "O5'" 1 
ATOM   1247  C  "C5'" . DT  A  1 62  ? -52.733 7.537   -69.583 1.00 89.00  ? 62  DT  I "C5'" 1 
ATOM   1248  C  "C4'" . DT  A  1 62  ? -53.399 7.753   -70.924 1.00 93.93  ? 62  DT  I "C4'" 1 
ATOM   1249  O  "O4'" . DT  A  1 62  ? -53.908 9.111   -70.990 1.00 92.27  ? 62  DT  I "O4'" 1 
ATOM   1250  C  "C3'" . DT  A  1 62  ? -52.483 7.592   -72.130 1.00 91.06  ? 62  DT  I "C3'" 1 
ATOM   1251  O  "O3'" . DT  A  1 62  ? -53.227 7.089   -73.234 1.00 94.08  ? 62  DT  I "O3'" 1 
ATOM   1252  C  "C2'" . DT  A  1 62  ? -52.001 9.017   -72.375 1.00 92.27  ? 62  DT  I "C2'" 1 
ATOM   1253  C  "C1'" . DT  A  1 62  ? -53.232 9.834   -72.000 1.00 94.92  ? 62  DT  I "C1'" 1 
ATOM   1254  N  N1    . DT  A  1 62  ? -52.905 11.189  -71.470 1.00 96.16  ? 62  DT  I N1    1 
ATOM   1255  C  C2    . DT  A  1 62  ? -53.731 12.249  -71.768 1.00 98.44  ? 62  DT  I C2    1 
ATOM   1256  O  O2    . DT  A  1 62  ? -54.735 12.143  -72.448 1.00 102.58 ? 62  DT  I O2    1 
ATOM   1257  N  N3    . DT  A  1 62  ? -53.338 13.447  -71.236 1.00 95.99  ? 62  DT  I N3    1 
ATOM   1258  C  C4    . DT  A  1 62  ? -52.225 13.688  -70.454 1.00 92.47  ? 62  DT  I C4    1 
ATOM   1259  O  O4    . DT  A  1 62  ? -51.956 14.802  -70.022 1.00 91.68  ? 62  DT  I O4    1 
ATOM   1260  C  C5    . DT  A  1 62  ? -51.401 12.536  -70.180 1.00 92.18  ? 62  DT  I C5    1 
ATOM   1261  C  C7    . DT  A  1 62  ? -50.166 12.675  -69.343 1.00 91.29  ? 62  DT  I C7    1 
ATOM   1262  C  C6    . DT  A  1 62  ? -51.776 11.356  -70.696 1.00 92.76  ? 62  DT  I C6    1 
ATOM   1263  P  P     . DG  A  1 63  ? -52.478 6.570   -74.558 1.00 96.10  ? 63  DG  I P     1 
ATOM   1264  O  OP1   . DG  A  1 63  ? -53.110 5.288   -74.941 1.00 107.95 ? 63  DG  I OP1   1 
ATOM   1265  O  OP2   . DG  A  1 63  ? -51.018 6.627   -74.323 1.00 85.37  ? 63  DG  I OP2   1 
ATOM   1266  O  "O5'" . DG  A  1 63  ? -52.839 7.680   -75.651 1.00 95.23  ? 63  DG  I "O5'" 1 
ATOM   1267  C  "C5'" . DG  A  1 63  ? -54.136 8.265   -75.657 1.00 96.82  ? 63  DG  I "C5'" 1 
ATOM   1268  C  "C4'" . DG  A  1 63  ? -54.199 9.446   -76.609 1.00 97.03  ? 63  DG  I "C4'" 1 
ATOM   1269  O  "O4'" . DG  A  1 63  ? -53.838 10.666  -75.908 1.00 100.36 ? 63  DG  I "O4'" 1 
ATOM   1270  C  "C3'" . DG  A  1 63  ? -53.268 9.361   -77.820 1.00 103.06 ? 63  DG  I "C3'" 1 
ATOM   1271  O  "O3'" . DG  A  1 63  ? -53.941 9.867   -78.965 1.00 102.33 ? 63  DG  I "O3'" 1 
ATOM   1272  C  "C2'" . DG  A  1 63  ? -52.106 10.262  -77.411 1.00 100.83 ? 63  DG  I "C2'" 1 
ATOM   1273  C  "C1'" . DG  A  1 63  ? -52.836 11.343  -76.635 1.00 100.71 ? 63  DG  I "C1'" 1 
ATOM   1274  N  N9    . DG  A  1 63  ? -51.982 12.061  -75.695 1.00 97.88  ? 63  DG  I N9    1 
ATOM   1275  C  C8    . DG  A  1 63  ? -50.955 11.536  -74.949 1.00 96.62  ? 63  DG  I C8    1 
ATOM   1276  N  N7    . DG  A  1 63  ? -50.362 12.413  -74.190 1.00 94.08  ? 63  DG  I N7    1 
ATOM   1277  C  C5    . DG  A  1 63  ? -51.037 13.598  -74.448 1.00 96.95  ? 63  DG  I C5    1 
ATOM   1278  C  C6    . DG  A  1 63  ? -50.837 14.894  -73.916 1.00 95.18  ? 63  DG  I C6    1 
ATOM   1279  O  O6    . DG  A  1 63  ? -49.995 15.258  -73.083 1.00 92.69  ? 63  DG  I O6    1 
ATOM   1280  N  N1    . DG  A  1 63  ? -51.740 15.815  -74.445 1.00 94.90  ? 63  DG  I N1    1 
ATOM   1281  C  C2    . DG  A  1 63  ? -52.713 15.519  -75.373 1.00 94.70  ? 63  DG  I C2    1 
ATOM   1282  N  N2    . DG  A  1 63  ? -53.488 16.541  -75.764 1.00 87.98  ? 63  DG  I N2    1 
ATOM   1283  N  N3    . DG  A  1 63  ? -52.911 14.307  -75.881 1.00 95.98  ? 63  DG  I N3    1 
ATOM   1284  C  C4    . DG  A  1 63  ? -52.039 13.399  -75.374 1.00 97.10  ? 63  DG  I C4    1 
ATOM   1285  P  P     . DT  A  1 64  ? -53.300 9.744   -80.436 1.00 107.35 ? 64  DT  I P     1 
ATOM   1286  O  OP1   . DT  A  1 64  ? -54.136 8.780   -81.183 1.00 105.16 ? 64  DT  I OP1   1 
ATOM   1287  O  OP2   . DT  A  1 64  ? -51.839 9.519   -80.350 1.00 103.13 ? 64  DT  I OP2   1 
ATOM   1288  O  "O5'" . DT  A  1 64  ? -53.523 11.203  -81.042 1.00 96.61  ? 64  DT  I "O5'" 1 
ATOM   1289  C  "C5'" . DT  A  1 64  ? -54.461 12.079  -80.424 1.00 97.09  ? 64  DT  I "C5'" 1 
ATOM   1290  C  "C4'" . DT  A  1 64  ? -54.350 13.481  -80.992 1.00 94.79  ? 64  DT  I "C4'" 1 
ATOM   1291  O  "O4'" . DT  A  1 64  ? -53.695 14.348  -80.028 1.00 96.09  ? 64  DT  I "O4'" 1 
ATOM   1292  C  "C3'" . DT  A  1 64  ? -53.542 13.591  -82.280 1.00 99.32  ? 64  DT  I "C3'" 1 
ATOM   1293  O  "O3'" . DT  A  1 64  ? -54.124 14.574  -83.127 1.00 97.24  ? 64  DT  I "O3'" 1 
ATOM   1294  C  "C2'" . DT  A  1 64  ? -52.163 14.016  -81.778 1.00 98.81  ? 64  DT  I "C2'" 1 
ATOM   1295  C  "C1'" . DT  A  1 64  ? -52.522 14.899  -80.593 1.00 96.77  ? 64  DT  I "C1'" 1 
ATOM   1296  N  N1    . DT  A  1 64  ? -51.462 14.940  -79.543 1.00 96.54  ? 64  DT  I N1    1 
ATOM   1297  C  C2    . DT  A  1 64  ? -51.271 16.097  -78.822 1.00 92.24  ? 64  DT  I C2    1 
ATOM   1298  O  O2    . DT  A  1 64  ? -51.931 17.107  -78.991 1.00 86.43  ? 64  DT  I O2    1 
ATOM   1299  N  N3    . DT  A  1 64  ? -50.272 16.026  -77.884 1.00 91.94  ? 64  DT  I N3    1 
ATOM   1300  C  C4    . DT  A  1 64  ? -49.461 14.938  -77.603 1.00 91.18  ? 64  DT  I C4    1 
ATOM   1301  O  O4    . DT  A  1 64  ? -48.589 14.972  -76.740 1.00 89.11  ? 64  DT  I O4    1 
ATOM   1302  C  C5    . DT  A  1 64  ? -49.713 13.760  -78.397 1.00 94.86  ? 64  DT  I C5    1 
ATOM   1303  C  C7    . DT  A  1 64  ? -48.898 12.519  -78.182 1.00 92.33  ? 64  DT  I C7    1 
ATOM   1304  C  C6    . DT  A  1 64  ? -50.689 13.817  -79.318 1.00 96.33  ? 64  DT  I C6    1 
ATOM   1305  P  P     . DT  A  1 65  ? -53.530 14.858  -84.594 1.00 102.90 ? 65  DT  I P     1 
ATOM   1306  O  OP1   . DT  A  1 65  ? -54.665 14.783  -85.540 1.00 106.36 ? 65  DT  I OP1   1 
ATOM   1307  O  OP2   . DT  A  1 65  ? -52.341 14.005  -84.821 1.00 91.60  ? 65  DT  I OP2   1 
ATOM   1308  O  "O5'" . DT  A  1 65  ? -53.036 16.375  -84.501 1.00 95.24  ? 65  DT  I "O5'" 1 
ATOM   1309  C  "C5'" . DT  A  1 65  ? -53.276 17.116  -83.311 1.00 94.89  ? 65  DT  I "C5'" 1 
ATOM   1310  C  "C4'" . DT  A  1 65  ? -52.522 18.432  -83.324 1.00 95.88  ? 65  DT  I "C4'" 1 
ATOM   1311  O  "O4'" . DT  A  1 65  ? -51.597 18.477  -82.205 1.00 96.42  ? 65  DT  I "O4'" 1 
ATOM   1312  C  "C3'" . DT  A  1 65  ? -51.686 18.688  -84.569 1.00 95.94  ? 65  DT  I "C3'" 1 
ATOM   1313  O  "O3'" . DT  A  1 65  ? -51.692 20.076  -84.863 1.00 93.68  ? 65  DT  I "O3'" 1 
ATOM   1314  C  "C2'" . DT  A  1 65  ? -50.301 18.201  -84.150 1.00 92.00  ? 65  DT  I "C2'" 1 
ATOM   1315  C  "C1'" . DT  A  1 65  ? -50.270 18.594  -82.679 1.00 93.90  ? 65  DT  I "C1'" 1 
ATOM   1316  N  N1    . DT  A  1 65  ? -49.396 17.717  -81.842 1.00 92.60  ? 65  DT  I N1    1 
ATOM   1317  C  C2    . DT  A  1 65  ? -48.904 18.201  -80.651 1.00 88.46  ? 65  DT  I C2    1 
ATOM   1318  O  O2    . DT  A  1 65  ? -49.142 19.325  -80.235 1.00 84.10  ? 65  DT  I O2    1 
ATOM   1319  N  N3    . DT  A  1 65  ? -48.116 17.319  -79.957 1.00 84.11  ? 65  DT  I N3    1 
ATOM   1320  C  C4    . DT  A  1 65  ? -47.777 16.029  -80.327 1.00 87.93  ? 65  DT  I C4    1 
ATOM   1321  O  O4    . DT  A  1 65  ? -47.059 15.313  -79.632 1.00 85.41  ? 65  DT  I O4    1 
ATOM   1322  C  C5    . DT  A  1 65  ? -48.326 15.583  -81.587 1.00 92.81  ? 65  DT  I C5    1 
ATOM   1323  C  C7    . DT  A  1 65  ? -48.028 14.201  -82.093 1.00 88.42  ? 65  DT  I C7    1 
ATOM   1324  C  C6    . DT  A  1 65  ? -49.101 16.439  -82.275 1.00 90.64  ? 65  DT  I C6    1 
ATOM   1325  P  P     . DC  A  1 66  ? -50.930 20.638  -86.159 1.00 88.38  ? 66  DC  I P     1 
ATOM   1326  O  OP1   . DC  A  1 66  ? -51.774 21.714  -86.729 1.00 90.92  ? 66  DC  I OP1   1 
ATOM   1327  O  OP2   . DC  A  1 66  ? -50.530 19.484  -86.998 1.00 84.56  ? 66  DC  I OP2   1 
ATOM   1328  O  "O5'" . DC  A  1 66  ? -49.604 21.291  -85.551 1.00 91.81  ? 66  DC  I "O5'" 1 
ATOM   1329  C  "C5'" . DC  A  1 66  ? -49.694 22.147  -84.414 1.00 92.51  ? 66  DC  I "C5'" 1 
ATOM   1330  C  "C4'" . DC  A  1 66  ? -48.313 22.509  -83.894 1.00 88.11  ? 66  DC  I "C4'" 1 
ATOM   1331  O  "O4'" . DC  A  1 66  ? -47.746 21.377  -83.181 1.00 86.75  ? 66  DC  I "O4'" 1 
ATOM   1332  C  "C3'" . DC  A  1 66  ? -47.293 22.890  -84.972 1.00 78.90  ? 66  DC  I "C3'" 1 
ATOM   1333  O  "O3'" . DC  A  1 66  ? -46.562 24.027  -84.558 1.00 77.79  ? 66  DC  I "O3'" 1 
ATOM   1334  C  "C2'" . DC  A  1 66  ? -46.396 21.657  -85.052 1.00 77.59  ? 66  DC  I "C2'" 1 
ATOM   1335  C  "C1'" . DC  A  1 66  ? -46.422 21.180  -83.611 1.00 79.19  ? 66  DC  I "C1'" 1 
ATOM   1336  N  N1    . DC  A  1 66  ? -46.076 19.737  -83.448 1.00 80.72  ? 66  DC  I N1    1 
ATOM   1337  C  C2    . DC  A  1 66  ? -45.572 19.278  -82.224 1.00 80.43  ? 66  DC  I C2    1 
ATOM   1338  O  O2    . DC  A  1 66  ? -45.426 20.079  -81.293 1.00 81.25  ? 66  DC  I O2    1 
ATOM   1339  N  N3    . DC  A  1 66  ? -45.261 17.964  -82.094 1.00 82.16  ? 66  DC  I N3    1 
ATOM   1340  C  C4    . DC  A  1 66  ? -45.432 17.132  -83.123 1.00 85.97  ? 66  DC  I C4    1 
ATOM   1341  N  N4    . DC  A  1 66  ? -45.110 15.845  -82.949 1.00 87.14  ? 66  DC  I N4    1 
ATOM   1342  C  C5    . DC  A  1 66  ? -45.941 17.582  -84.377 1.00 85.96  ? 66  DC  I C5    1 
ATOM   1343  C  C6    . DC  A  1 66  ? -46.246 18.879  -84.494 1.00 83.05  ? 66  DC  I C6    1 
ATOM   1344  P  P     . DA  A  1 67  ? -46.701 25.418  -85.348 1.00 83.28  ? 67  DA  I P     1 
ATOM   1345  O  OP1   . DA  A  1 67  ? -48.140 25.767  -85.391 1.00 85.71  ? 67  DA  I OP1   1 
ATOM   1346  O  OP2   . DA  A  1 67  ? -45.931 25.288  -86.605 1.00 75.74  ? 67  DA  I OP2   1 
ATOM   1347  O  "O5'" . DA  A  1 67  ? -45.939 26.468  -84.404 1.00 76.56  ? 67  DA  I "O5'" 1 
ATOM   1348  C  "C5'" . DA  A  1 67  ? -46.433 26.735  -83.089 1.00 72.75  ? 67  DA  I "C5'" 1 
ATOM   1349  C  "C4'" . DA  A  1 67  ? -45.320 26.676  -82.048 1.00 65.72  ? 67  DA  I "C4'" 1 
ATOM   1350  O  "O4'" . DA  A  1 67  ? -44.828 25.314  -81.920 1.00 64.10  ? 67  DA  I "O4'" 1 
ATOM   1351  C  "C3'" . DA  A  1 67  ? -44.093 27.537  -82.336 1.00 64.15  ? 67  DA  I "C3'" 1 
ATOM   1352  O  "O3'" . DA  A  1 67  ? -43.603 28.060  -81.114 1.00 61.85  ? 67  DA  I "O3'" 1 
ATOM   1353  C  "C2'" . DA  A  1 67  ? -43.116 26.530  -82.938 1.00 64.73  ? 67  DA  I "C2'" 1 
ATOM   1354  C  "C1'" . DA  A  1 67  ? -43.429 25.299  -82.104 1.00 66.48  ? 67  DA  I "C1'" 1 
ATOM   1355  N  N9    . DA  A  1 67  ? -43.066 24.032  -82.735 1.00 70.26  ? 67  DA  I N9    1 
ATOM   1356  C  C8    . DA  A  1 67  ? -43.234 23.680  -84.045 1.00 70.57  ? 67  DA  I C8    1 
ATOM   1357  N  N7    . DA  A  1 67  ? -42.826 22.463  -84.322 1.00 73.65  ? 67  DA  I N7    1 
ATOM   1358  C  C5    . DA  A  1 67  ? -42.370 21.980  -83.106 1.00 72.27  ? 67  DA  I C5    1 
ATOM   1359  C  C6    . DA  A  1 67  ? -41.811 20.744  -82.722 1.00 74.10  ? 67  DA  I C6    1 
ATOM   1360  N  N6    . DA  A  1 67  ? -41.611 19.730  -83.570 1.00 77.45  ? 67  DA  I N6    1 
ATOM   1361  N  N1    . DA  A  1 67  ? -41.460 20.593  -81.428 1.00 76.67  ? 67  DA  I N1    1 
ATOM   1362  C  C2    . DA  A  1 67  ? -41.656 21.610  -80.582 1.00 71.51  ? 67  DA  I C2    1 
ATOM   1363  N  N3    . DA  A  1 67  ? -42.172 22.813  -80.825 1.00 74.36  ? 67  DA  I N3    1 
ATOM   1364  C  C4    . DA  A  1 67  ? -42.512 22.934  -82.118 1.00 73.50  ? 67  DA  I C4    1 
ATOM   1365  P  P     . DG  A  1 68  ? -42.716 29.401  -81.077 1.00 62.52  ? 68  DG  I P     1 
ATOM   1366  O  OP1   . DG  A  1 68  ? -43.350 30.297  -80.091 1.00 69.86  ? 68  DG  I OP1   1 
ATOM   1367  O  OP2   . DG  A  1 68  ? -42.468 29.880  -82.452 1.00 66.50  ? 68  DG  I OP2   1 
ATOM   1368  O  "O5'" . DG  A  1 68  ? -41.329 28.897  -80.479 1.00 66.51  ? 68  DG  I "O5'" 1 
ATOM   1369  C  "C5'" . DG  A  1 68  ? -41.327 27.892  -79.482 1.00 64.02  ? 68  DG  I "C5'" 1 
ATOM   1370  C  "C4'" . DG  A  1 68  ? -40.045 27.088  -79.521 1.00 64.37  ? 68  DG  I "C4'" 1 
ATOM   1371  O  "O4'" . DG  A  1 68  ? -40.197 25.932  -80.396 1.00 66.33  ? 68  DG  I "O4'" 1 
ATOM   1372  C  "C3'" . DG  A  1 68  ? -38.820 27.838  -80.054 1.00 63.39  ? 68  DG  I "C3'" 1 
ATOM   1373  O  "O3'" . DG  A  1 68  ? -37.692 27.367  -79.389 1.00 65.98  ? 68  DG  I "O3'" 1 
ATOM   1374  C  "C2'" . DG  A  1 68  ? -38.778 27.369  -81.498 1.00 60.91  ? 68  DG  I "C2'" 1 
ATOM   1375  C  "C1'" . DG  A  1 68  ? -39.079 25.910  -81.255 1.00 65.74  ? 68  DG  I "C1'" 1 
ATOM   1376  N  N9    . DG  A  1 68  ? -39.381 25.143  -82.452 1.00 65.76  ? 68  DG  I N9    1 
ATOM   1377  C  C8    . DG  A  1 68  ? -39.944 25.603  -83.615 1.00 68.90  ? 68  DG  I C8    1 
ATOM   1378  N  N7    . DG  A  1 68  ? -40.085 24.676  -84.522 1.00 74.86  ? 68  DG  I N7    1 
ATOM   1379  C  C5    . DG  A  1 68  ? -39.572 23.532  -83.921 1.00 73.19  ? 68  DG  I C5    1 
ATOM   1380  C  C6    . DG  A  1 68  ? -39.454 22.213  -84.421 1.00 77.22  ? 68  DG  I C6    1 
ATOM   1381  O  O6    . DG  A  1 68  ? -39.794 21.779  -85.530 1.00 78.18  ? 68  DG  I O6    1 
ATOM   1382  N  N1    . DG  A  1 68  ? -38.876 21.355  -83.484 1.00 77.89  ? 68  DG  I N1    1 
ATOM   1383  C  C2    . DG  A  1 68  ? -38.464 21.727  -82.225 1.00 73.07  ? 68  DG  I C2    1 
ATOM   1384  N  N2    . DG  A  1 68  ? -37.930 20.761  -81.463 1.00 72.39  ? 68  DG  I N2    1 
ATOM   1385  N  N3    . DG  A  1 68  ? -38.569 22.961  -81.747 1.00 67.25  ? 68  DG  I N3    1 
ATOM   1386  C  C4    . DG  A  1 68  ? -39.131 23.806  -82.649 1.00 68.67  ? 68  DG  I C4    1 
ATOM   1387  P  P     . DC  A  1 69  ? -36.962 28.240  -78.267 1.00 61.66  ? 69  DC  I P     1 
ATOM   1388  O  OP1   . DC  A  1 69  ? -38.006 28.826  -77.394 1.00 56.83  ? 69  DC  I OP1   1 
ATOM   1389  O  OP2   . DC  A  1 69  ? -35.993 29.120  -78.962 1.00 54.02  ? 69  DC  I OP2   1 
ATOM   1390  O  "O5'" . DC  A  1 69  ? -36.155 27.125  -77.458 1.00 58.93  ? 69  DC  I "O5'" 1 
ATOM   1391  C  "C5'" . DC  A  1 69  ? -36.789 25.878  -77.178 1.00 56.80  ? 69  DC  I "C5'" 1 
ATOM   1392  C  "C4'" . DC  A  1 69  ? -35.879 24.706  -77.506 1.00 57.84  ? 69  DC  I "C4'" 1 
ATOM   1393  O  "O4'" . DC  A  1 69  ? -36.146 24.221  -78.853 1.00 59.82  ? 69  DC  I "O4'" 1 
ATOM   1394  C  "C3'" . DC  A  1 69  ? -34.384 25.010  -77.466 1.00 58.23  ? 69  DC  I "C3'" 1 
ATOM   1395  O  "O3'" . DC  A  1 69  ? -33.698 23.885  -76.955 1.00 56.39  ? 69  DC  I "O3'" 1 
ATOM   1396  C  "C2'" . DC  A  1 69  ? -34.059 25.216  -78.938 1.00 60.87  ? 69  DC  I "C2'" 1 
ATOM   1397  C  "C1'" . DC  A  1 69  ? -34.921 24.129  -79.545 1.00 58.57  ? 69  DC  I "C1'" 1 
ATOM   1398  N  N1    . DC  A  1 69  ? -35.171 24.294  -80.997 1.00 59.58  ? 69  DC  I N1    1 
ATOM   1399  C  C2    . DC  A  1 69  ? -35.216 23.163  -81.818 1.00 60.51  ? 69  DC  I C2    1 
ATOM   1400  O  O2    . DC  A  1 69  ? -35.049 22.045  -81.315 1.00 58.78  ? 69  DC  I O2    1 
ATOM   1401  N  N3    . DC  A  1 69  ? -35.446 23.325  -83.141 1.00 64.69  ? 69  DC  I N3    1 
ATOM   1402  C  C4    . DC  A  1 69  ? -35.621 24.549  -83.642 1.00 65.63  ? 69  DC  I C4    1 
ATOM   1403  N  N4    . DC  A  1 69  ? -35.848 24.658  -84.952 1.00 68.95  ? 69  DC  I N4    1 
ATOM   1404  C  C5    . DC  A  1 69  ? -35.574 25.715  -82.822 1.00 60.86  ? 69  DC  I C5    1 
ATOM   1405  C  C6    . DC  A  1 69  ? -35.348 25.542  -81.517 1.00 57.02  ? 69  DC  I C6    1 
ATOM   1406  P  P     . DT  A  1 70  ? -32.370 24.070  -76.074 1.00 50.63  ? 70  DT  I P     1 
ATOM   1407  O  OP1   . DT  A  1 70  ? -32.783 24.105  -74.652 1.00 44.54  ? 70  DT  I OP1   1 
ATOM   1408  O  OP2   . DT  A  1 70  ? -31.579 25.183  -76.655 1.00 48.65  ? 70  DT  I OP2   1 
ATOM   1409  O  "O5'" . DT  A  1 70  ? -31.575 22.717  -76.333 1.00 44.66  ? 70  DT  I "O5'" 1 
ATOM   1410  C  "C5'" . DT  A  1 70  ? -32.280 21.502  -76.428 1.00 49.02  ? 70  DT  I "C5'" 1 
ATOM   1411  C  "C4'" . DT  A  1 70  ? -31.731 20.679  -77.565 1.00 53.62  ? 70  DT  I "C4'" 1 
ATOM   1412  O  "O4'" . DT  A  1 70  ? -32.143 21.271  -78.824 1.00 66.33  ? 70  DT  I "O4'" 1 
ATOM   1413  C  "C3'" . DT  A  1 70  ? -30.205 20.605  -77.606 1.00 55.10  ? 70  DT  I "C3'" 1 
ATOM   1414  O  "O3'" . DT  A  1 70  ? -29.799 19.264  -77.812 1.00 58.74  ? 70  DT  I "O3'" 1 
ATOM   1415  C  "C2'" . DT  A  1 70  ? -29.830 21.507  -78.790 1.00 56.22  ? 70  DT  I "C2'" 1 
ATOM   1416  C  "C1'" . DT  A  1 70  ? -31.039 21.336  -79.692 1.00 60.23  ? 70  DT  I "C1'" 1 
ATOM   1417  N  N1    . DT  A  1 70  ? -31.256 22.462  -80.677 1.00 58.83  ? 70  DT  I N1    1 
ATOM   1418  C  C2    . DT  A  1 70  ? -31.623 22.154  -81.970 1.00 63.85  ? 70  DT  I C2    1 
ATOM   1419  O  O2    . DT  A  1 70  ? -31.776 21.012  -82.366 1.00 66.17  ? 70  DT  I O2    1 
ATOM   1420  N  N3    . DT  A  1 70  ? -31.804 23.235  -82.789 1.00 60.42  ? 70  DT  I N3    1 
ATOM   1421  C  C4    . DT  A  1 70  ? -31.658 24.568  -82.460 1.00 60.73  ? 70  DT  I C4    1 
ATOM   1422  O  O4    . DT  A  1 70  ? -31.842 25.467  -83.271 1.00 63.14  ? 70  DT  I O4    1 
ATOM   1423  C  C5    . DT  A  1 70  ? -31.275 24.831  -81.094 1.00 55.79  ? 70  DT  I C5    1 
ATOM   1424  C  C7    . DT  A  1 70  ? -31.088 26.246  -80.628 1.00 44.14  ? 70  DT  I C7    1 
ATOM   1425  C  C6    . DT  A  1 70  ? -31.095 23.776  -80.273 1.00 56.05  ? 70  DT  I C6    1 
ATOM   1426  P  P     . DG  A  1 71  ? -28.372 18.750  -77.279 1.00 65.11  ? 71  DG  I P     1 
ATOM   1427  O  OP1   . DG  A  1 71  ? -28.634 17.719  -76.253 1.00 57.77  ? 71  DG  I OP1   1 
ATOM   1428  O  OP2   . DG  A  1 71  ? -27.524 19.926  -76.974 1.00 56.30  ? 71  DG  I OP2   1 
ATOM   1429  O  "O5'" . DG  A  1 71  ? -27.723 18.048  -78.554 1.00 65.34  ? 71  DG  I "O5'" 1 
ATOM   1430  C  "C5'" . DG  A  1 71  ? -28.541 17.310  -79.446 1.00 70.57  ? 71  DG  I "C5'" 1 
ATOM   1431  C  "C4'" . DG  A  1 71  ? -28.052 17.464  -80.873 1.00 67.71  ? 71  DG  I "C4'" 1 
ATOM   1432  O  "O4'" . DG  A  1 71  ? -28.428 18.771  -81.383 1.00 66.75  ? 71  DG  I "O4'" 1 
ATOM   1433  C  "C3'" . DG  A  1 71  ? -26.536 17.355  -81.047 1.00 71.30  ? 71  DG  I "C3'" 1 
ATOM   1434  O  "O3'" . DG  A  1 71  ? -26.243 16.493  -82.131 1.00 76.81  ? 71  DG  I "O3'" 1 
ATOM   1435  C  "C2'" . DG  A  1 71  ? -26.100 18.796  -81.332 1.00 68.47  ? 71  DG  I "C2'" 1 
ATOM   1436  C  "C1'" . DG  A  1 71  ? -27.326 19.359  -82.028 1.00 64.63  ? 71  DG  I "C1'" 1 
ATOM   1437  N  N9    . DG  A  1 71  ? -27.449 20.806  -81.910 1.00 63.29  ? 71  DG  I N9    1 
ATOM   1438  C  C8    . DG  A  1 71  ? -27.176 21.572  -80.804 1.00 73.63  ? 71  DG  I C8    1 
ATOM   1439  N  N7    . DG  A  1 71  ? -27.383 22.847  -80.990 1.00 68.53  ? 71  DG  I N7    1 
ATOM   1440  C  C5    . DG  A  1 71  ? -27.823 22.929  -82.303 1.00 65.12  ? 71  DG  I C5    1 
ATOM   1441  C  C6    . DG  A  1 71  ? -28.204 24.056  -83.066 1.00 67.82  ? 71  DG  I C6    1 
ATOM   1442  O  O6    . DG  A  1 71  ? -28.227 25.247  -82.720 1.00 68.85  ? 71  DG  I O6    1 
ATOM   1443  N  N1    . DG  A  1 71  ? -28.584 23.697  -84.358 1.00 65.97  ? 71  DG  I N1    1 
ATOM   1444  C  C2    . DG  A  1 71  ? -28.596 22.412  -84.845 1.00 62.92  ? 71  DG  I C2    1 
ATOM   1445  N  N2    . DG  A  1 71  ? -28.993 22.261  -86.115 1.00 61.11  ? 71  DG  I N2    1 
ATOM   1446  N  N3    . DG  A  1 71  ? -28.243 21.349  -84.139 1.00 69.00  ? 71  DG  I N3    1 
ATOM   1447  C  C4    . DG  A  1 71  ? -27.870 21.681  -82.882 1.00 63.61  ? 71  DG  I C4    1 
ATOM   1448  P  P     . DA  A  1 72  ? -24.769 15.885  -82.325 1.00 77.80  ? 72  DA  I P     1 
ATOM   1449  O  OP1   . DA  A  1 72  ? -24.823 14.465  -81.909 1.00 76.04  ? 72  DA  I OP1   1 
ATOM   1450  O  OP2   . DA  A  1 72  ? -23.773 16.809  -81.739 1.00 61.97  ? 72  DA  I OP2   1 
ATOM   1451  O  "O5'" . DA  A  1 72  ? -24.560 15.939  -83.902 1.00 79.56  ? 72  DA  I "O5'" 1 
ATOM   1452  C  "C5'" . DA  A  1 72  ? -25.675 15.791  -84.763 1.00 76.01  ? 72  DA  I "C5'" 1 
ATOM   1453  C  "C4'" . DA  A  1 72  ? -25.421 16.507  -86.070 1.00 76.52  ? 72  DA  I "C4'" 1 
ATOM   1454  O  "O4'" . DA  A  1 72  ? -25.820 17.897  -85.953 1.00 77.15  ? 72  DA  I "O4'" 1 
ATOM   1455  C  "C3'" . DA  A  1 72  ? -23.962 16.515  -86.511 1.00 80.06  ? 72  DA  I "C3'" 1 
ATOM   1456  O  "O3'" . DA  A  1 72  ? -23.886 16.207  -87.881 1.00 88.33  ? 72  DA  I "O3'" 1 
ATOM   1457  C  "C2'" . DA  A  1 72  ? -23.502 17.947  -86.223 1.00 69.61  ? 72  DA  I "C2'" 1 
ATOM   1458  C  "C1'" . DA  A  1 72  ? -24.784 18.734  -86.417 1.00 71.35  ? 72  DA  I "C1'" 1 
ATOM   1459  N  N9    . DA  A  1 72  ? -24.824 19.969  -85.644 1.00 68.86  ? 72  DA  I N9    1 
ATOM   1460  C  C8    . DA  A  1 72  ? -24.505 20.121  -84.325 1.00 70.63  ? 72  DA  I C8    1 
ATOM   1461  N  N7    . DA  A  1 72  ? -24.642 21.347  -83.885 1.00 68.82  ? 72  DA  I N7    1 
ATOM   1462  C  C5    . DA  A  1 72  ? -25.083 22.050  -84.991 1.00 66.02  ? 72  DA  I C5    1 
ATOM   1463  C  C6    . DA  A  1 72  ? -25.417 23.404  -85.182 1.00 66.46  ? 72  DA  I C6    1 
ATOM   1464  N  N6    . DA  A  1 72  ? -25.344 24.323  -84.215 1.00 69.15  ? 72  DA  I N6    1 
ATOM   1465  N  N1    . DA  A  1 72  ? -25.823 23.780  -86.410 1.00 65.68  ? 72  DA  I N1    1 
ATOM   1466  C  C2    . DA  A  1 72  ? -25.892 22.858  -87.377 1.00 68.98  ? 72  DA  I C2    1 
ATOM   1467  N  N3    . DA  A  1 72  ? -25.606 21.557  -87.317 1.00 74.61  ? 72  DA  I N3    1 
ATOM   1468  C  C4    . DA  A  1 72  ? -25.205 21.214  -86.085 1.00 69.71  ? 72  DA  I C4    1 
ATOM   1469  P  P     . DA  A  1 73  ? -22.469 15.898  -88.563 1.00 91.83  ? 73  DA  I P     1 
ATOM   1470  O  OP1   . DA  A  1 73  ? -22.602 14.595  -89.252 1.00 84.34  ? 73  DA  I OP1   1 
ATOM   1471  O  OP2   . DA  A  1 73  ? -21.404 16.084  -87.549 1.00 87.97  ? 73  DA  I OP2   1 
ATOM   1472  O  "O5'" . DA  A  1 73  ? -22.327 17.069  -89.637 1.00 76.29  ? 73  DA  I "O5'" 1 
ATOM   1473  C  "C5'" . DA  A  1 73  ? -23.473 17.814  -90.011 1.00 71.68  ? 73  DA  I "C5'" 1 
ATOM   1474  C  "C4'" . DA  A  1 73  ? -23.090 18.966  -90.915 1.00 74.14  ? 73  DA  I "C4'" 1 
ATOM   1475  O  "O4'" . DA  A  1 73  ? -23.362 20.222  -90.240 1.00 77.82  ? 73  DA  I "O4'" 1 
ATOM   1476  C  "C3'" . DA  A  1 73  ? -21.621 19.011  -91.317 1.00 77.28  ? 73  DA  I "C3'" 1 
ATOM   1477  O  "O3'" . DA  A  1 73  ? -21.509 19.517  -92.640 1.00 93.83  ? 73  DA  I "O3'" 1 
ATOM   1478  C  "C2'" . DA  A  1 73  ? -21.022 19.969  -90.292 1.00 77.39  ? 73  DA  I "C2'" 1 
ATOM   1479  C  "C1'" . DA  A  1 73  ? -22.164 20.952  -90.070 1.00 76.14  ? 73  DA  I "C1'" 1 
ATOM   1480  N  N9    . DA  A  1 73  ? -22.162 21.534  -88.730 1.00 71.58  ? 73  DA  I N9    1 
ATOM   1481  C  C8    . DA  A  1 73  ? -21.865 20.893  -87.559 1.00 73.15  ? 73  DA  I C8    1 
ATOM   1482  N  N7    . DA  A  1 73  ? -21.935 21.664  -86.500 1.00 69.88  ? 73  DA  I N7    1 
ATOM   1483  C  C5    . DA  A  1 73  ? -22.304 22.897  -87.012 1.00 67.94  ? 73  DA  I C5    1 
ATOM   1484  C  C6    . DA  A  1 73  ? -22.544 24.142  -86.401 1.00 67.97  ? 73  DA  I C6    1 
ATOM   1485  N  N6    . DA  A  1 73  ? -22.443 24.343  -85.085 1.00 66.86  ? 73  DA  I N6    1 
ATOM   1486  N  N1    . DA  A  1 73  ? -22.894 25.174  -87.198 1.00 73.56  ? 73  DA  I N1    1 
ATOM   1487  C  C2    . DA  A  1 73  ? -22.995 24.965  -88.518 1.00 72.13  ? 73  DA  I C2    1 
ATOM   1488  N  N3    . DA  A  1 73  ? -22.795 23.840  -89.206 1.00 70.86  ? 73  DA  I N3    1 
ATOM   1489  C  C4    . DA  A  1 73  ? -22.448 22.835  -88.386 1.00 66.33  ? 73  DA  I C4    1 
ATOM   1490  P  P     . DT  A  1 74  ? -20.101 19.528  -93.420 1.00 100.55 ? 74  DT  I P     1 
ATOM   1491  O  OP1   . DT  A  1 74  ? -20.245 18.607  -94.570 1.00 85.20  ? 74  DT  I OP1   1 
ATOM   1492  O  OP2   . DT  A  1 74  ? -18.977 19.351  -92.470 1.00 90.74  ? 74  DT  I OP2   1 
ATOM   1493  O  "O5'" . DT  A  1 74  ? -20.022 21.020  -93.968 1.00 78.67  ? 74  DT  I "O5'" 1 
ATOM   1494  C  "C5'" . DT  A  1 74  ? -20.858 22.004  -93.395 1.00 78.30  ? 74  DT  I "C5'" 1 
ATOM   1495  C  "C4'" . DT  A  1 74  ? -20.318 23.389  -93.659 1.00 86.30  ? 74  DT  I "C4'" 1 
ATOM   1496  O  "O4'" . DT  A  1 74  ? -20.467 24.195  -92.461 1.00 85.68  ? 74  DT  I "O4'" 1 
ATOM   1497  C  "C3'" . DT  A  1 74  ? -18.840 23.446  -94.019 1.00 89.81  ? 74  DT  I "C3'" 1 
ATOM   1498  O  "O3'" . DT  A  1 74  ? -18.614 24.537  -94.909 1.00 92.18  ? 74  DT  I "O3'" 1 
ATOM   1499  C  "C2'" . DT  A  1 74  ? -18.177 23.666  -92.661 1.00 84.68  ? 74  DT  I "C2'" 1 
ATOM   1500  C  "C1'" . DT  A  1 74  ? -19.195 24.555  -91.955 1.00 83.33  ? 74  DT  I "C1'" 1 
ATOM   1501  N  N1    . DT  A  1 74  ? -19.210 24.379  -90.473 1.00 75.52  ? 74  DT  I N1    1 
ATOM   1502  C  C2    . DT  A  1 74  ? -19.545 25.446  -89.672 1.00 70.62  ? 74  DT  I C2    1 
ATOM   1503  O  O2    . DT  A  1 74  ? -19.838 26.545  -90.108 1.00 70.05  ? 74  DT  I O2    1 
ATOM   1504  N  N3    . DT  A  1 74  ? -19.527 25.179  -88.330 1.00 67.08  ? 74  DT  I N3    1 
ATOM   1505  C  C4    . DT  A  1 74  ? -19.213 23.977  -87.720 1.00 69.56  ? 74  DT  I C4    1 
ATOM   1506  O  O4    . DT  A  1 74  ? -19.226 23.837  -86.499 1.00 68.37  ? 74  DT  I O4    1 
ATOM   1507  C  C5    . DT  A  1 74  ? -18.869 22.900  -88.619 1.00 68.62  ? 74  DT  I C5    1 
ATOM   1508  C  C7    . DT  A  1 74  ? -18.508 21.549  -88.076 1.00 71.47  ? 74  DT  I C7    1 
ATOM   1509  C  C6    . DT  A  1 74  ? -18.886 23.151  -89.936 1.00 71.58  ? 74  DT  I C6    1 
ATOM   1510  P  P     . DT  A  1 75  ? -17.147 24.853  -95.485 1.00 98.09  ? 75  DT  I P     1 
ATOM   1511  O  OP1   . DT  A  1 75  ? -17.287 25.037  -96.948 1.00 93.62  ? 75  DT  I OP1   1 
ATOM   1512  O  OP2   . DT  A  1 75  ? -16.200 23.832  -94.978 1.00 93.24  ? 75  DT  I OP2   1 
ATOM   1513  O  "O5'" . DT  A  1 75  ? -16.796 26.267  -94.820 1.00 88.78  ? 75  DT  I "O5'" 1 
ATOM   1514  C  "C5'" . DT  A  1 75  ? -17.854 27.076  -94.304 1.00 83.57  ? 75  DT  I "C5'" 1 
ATOM   1515  C  "C4'" . DT  A  1 75  ? -17.335 28.393  -93.753 1.00 81.96  ? 75  DT  I "C4'" 1 
ATOM   1516  O  "O4'" . DT  A  1 75  ? -17.470 28.409  -92.307 1.00 86.65  ? 75  DT  I "O4'" 1 
ATOM   1517  C  "C3'" . DT  A  1 75  ? -15.870 28.693  -94.041 1.00 82.89  ? 75  DT  I "C3'" 1 
ATOM   1518  O  "O3'" . DT  A  1 75  ? -15.704 30.088  -94.229 1.00 83.58  ? 75  DT  I "O3'" 1 
ATOM   1519  C  "C2'" . DT  A  1 75  ? -15.172 28.213  -92.772 1.00 81.02  ? 75  DT  I "C2'" 1 
ATOM   1520  C  "C1'" . DT  A  1 75  ? -16.200 28.561  -91.701 1.00 84.33  ? 75  DT  I "C1'" 1 
ATOM   1521  N  N1    . DT  A  1 75  ? -16.146 27.661  -90.516 1.00 74.60  ? 75  DT  I N1    1 
ATOM   1522  C  C2    . DT  A  1 75  ? -16.379 28.176  -89.257 1.00 72.97  ? 75  DT  I C2    1 
ATOM   1523  O  O2    . DT  A  1 75  ? -16.627 29.350  -89.046 1.00 70.53  ? 75  DT  I O2    1 
ATOM   1524  N  N3    . DT  A  1 75  ? -16.311 27.257  -88.245 1.00 71.78  ? 75  DT  I N3    1 
ATOM   1525  C  C4    . DT  A  1 75  ? -16.038 25.905  -88.361 1.00 71.09  ? 75  DT  I C4    1 
ATOM   1526  O  O4    . DT  A  1 75  ? -15.996 25.158  -87.391 1.00 71.76  ? 75  DT  I O4    1 
ATOM   1527  C  C5    . DT  A  1 75  ? -15.805 25.435  -89.704 1.00 74.31  ? 75  DT  I C5    1 
ATOM   1528  C  C7    . DT  A  1 75  ? -15.500 23.988  -89.952 1.00 74.16  ? 75  DT  I C7    1 
ATOM   1529  C  C6    . DT  A  1 75  ? -15.871 26.325  -90.703 1.00 72.88  ? 75  DT  I C6    1 
ATOM   1530  P  P     . DC  A  1 76  ? -14.366 30.663  -94.906 1.00 95.36  ? 76  DC  I P     1 
ATOM   1531  O  OP1   . DC  A  1 76  ? -14.781 31.633  -95.945 1.00 82.95  ? 76  DC  I OP1   1 
ATOM   1532  O  OP2   . DC  A  1 76  ? -13.495 29.517  -95.258 1.00 79.47  ? 76  DC  I OP2   1 
ATOM   1533  O  "O5'" . DC  A  1 76  ? -13.662 31.468  -93.719 1.00 88.83  ? 76  DC  I "O5'" 1 
ATOM   1534  C  "C5'" . DC  A  1 76  ? -14.369 32.505  -93.051 1.00 80.92  ? 76  DC  I "C5'" 1 
ATOM   1535  C  "C4'" . DC  A  1 76  ? -13.627 32.951  -91.805 1.00 79.63  ? 76  DC  I "C4'" 1 
ATOM   1536  O  "O4'" . DC  A  1 76  ? -13.846 31.997  -90.728 1.00 81.15  ? 76  DC  I "O4'" 1 
ATOM   1537  C  "C3'" . DC  A  1 76  ? -12.108 33.059  -91.954 1.00 72.97  ? 76  DC  I "C3'" 1 
ATOM   1538  O  "O3'" . DC  A  1 76  ? -11.648 34.152  -91.191 1.00 76.70  ? 76  DC  I "O3'" 1 
ATOM   1539  C  "C2'" . DC  A  1 76  ? -11.629 31.748  -91.345 1.00 67.42  ? 76  DC  I "C2'" 1 
ATOM   1540  C  "C1'" . DC  A  1 76  ? -12.596 31.642  -90.183 1.00 73.24  ? 76  DC  I "C1'" 1 
ATOM   1541  N  N1    . DC  A  1 76  ? -12.692 30.287  -89.590 1.00 74.20  ? 76  DC  I N1    1 
ATOM   1542  C  C2    . DC  A  1 76  ? -13.037 30.153  -88.241 1.00 71.49  ? 76  DC  I C2    1 
ATOM   1543  O  O2    . DC  A  1 76  ? -13.260 31.171  -87.573 1.00 66.03  ? 76  DC  I O2    1 
ATOM   1544  N  N3    . DC  A  1 76  ? -13.120 28.910  -87.704 1.00 67.93  ? 76  DC  I N3    1 
ATOM   1545  C  C4    . DC  A  1 76  ? -12.871 27.839  -88.461 1.00 72.85  ? 76  DC  I C4    1 
ATOM   1546  N  N4    . DC  A  1 76  ? -12.965 26.633  -87.890 1.00 67.38  ? 76  DC  I N4    1 
ATOM   1547  C  C5    . DC  A  1 76  ? -12.515 27.958  -89.839 1.00 71.07  ? 76  DC  I C5    1 
ATOM   1548  C  C6    . DC  A  1 76  ? -12.436 29.188  -90.356 1.00 69.51  ? 76  DC  I C6    1 
ATOM   1549  P  P     . DA  A  1 77  ? -11.127 35.488  -91.908 1.00 77.18  ? 77  DA  I P     1 
ATOM   1550  O  OP1   . DA  A  1 77  ? -12.143 35.865  -92.920 1.00 80.34  ? 77  DA  I OP1   1 
ATOM   1551  O  OP2   . DA  A  1 77  ? -9.713  35.263  -92.289 1.00 71.87  ? 77  DA  I OP2   1 
ATOM   1552  O  "O5'" . DA  A  1 77  ? -11.132 36.572  -90.734 1.00 72.55  ? 77  DA  I "O5'" 1 
ATOM   1553  C  "C5'" . DA  A  1 77  ? -12.276 36.708  -89.902 1.00 74.23  ? 77  DA  I "C5'" 1 
ATOM   1554  C  "C4'" . DA  A  1 77  ? -11.920 36.465  -88.444 1.00 74.01  ? 77  DA  I "C4'" 1 
ATOM   1555  O  "O4'" . DA  A  1 77  ? -11.714 35.044  -88.210 1.00 76.05  ? 77  DA  I "O4'" 1 
ATOM   1556  C  "C3'" . DA  A  1 77  ? -10.650 37.160  -87.956 1.00 69.14  ? 77  DA  I "C3'" 1 
ATOM   1557  O  "O3'" . DA  A  1 77  ? -10.870 37.651  -86.648 1.00 71.96  ? 77  DA  I "O3'" 1 
ATOM   1558  C  "C2'" . DA  A  1 77  ? -9.619  36.029  -87.961 1.00 68.76  ? 77  DA  I "C2'" 1 
ATOM   1559  C  "C1'" . DA  A  1 77  ? -10.486 34.854  -87.541 1.00 70.61  ? 77  DA  I "C1'" 1 
ATOM   1560  N  N9    . DA  A  1 77  ? -9.954  33.543  -87.913 1.00 69.25  ? 77  DA  I N9    1 
ATOM   1561  C  C8    . DA  A  1 77  ? -9.309  33.207  -89.070 1.00 68.80  ? 77  DA  I C8    1 
ATOM   1562  N  N7    . DA  A  1 77  ? -8.954  31.944  -89.132 1.00 72.90  ? 77  DA  I N7    1 
ATOM   1563  C  C5    . DA  A  1 77  ? -9.403  31.413  -87.933 1.00 73.44  ? 77  DA  I C5    1 
ATOM   1564  C  C6    . DA  A  1 77  ? -9.339  30.115  -87.381 1.00 67.26  ? 77  DA  I C6    1 
ATOM   1565  N  N6    . DA  A  1 77  ? -8.770  29.078  -88.000 1.00 63.55  ? 77  DA  I N6    1 
ATOM   1566  N  N1    . DA  A  1 77  ? -9.885  29.926  -86.163 1.00 65.05  ? 77  DA  I N1    1 
ATOM   1567  C  C2    . DA  A  1 77  ? -10.451 30.965  -85.543 1.00 63.42  ? 77  DA  I C2    1 
ATOM   1568  N  N3    . DA  A  1 77  ? -10.573 32.224  -85.958 1.00 69.46  ? 77  DA  I N3    1 
ATOM   1569  C  C4    . DA  A  1 77  ? -10.022 32.384  -87.171 1.00 72.43  ? 77  DA  I C4    1 
ATOM   1570  P  P     . DG  A  1 78  ? -10.088 38.946  -86.112 1.00 73.45  ? 78  DG  I P     1 
ATOM   1571  O  OP1   . DG  A  1 78  ? -11.102 39.998  -85.874 1.00 74.16  ? 78  DG  I OP1   1 
ATOM   1572  O  OP2   . DG  A  1 78  ? -8.940  39.205  -87.010 1.00 74.65  ? 78  DG  I OP2   1 
ATOM   1573  O  "O5'" . DG  A  1 78  ? -9.489  38.466  -84.710 1.00 74.70  ? 78  DG  I "O5'" 1 
ATOM   1574  C  "C5'" . DG  A  1 78  ? -10.243 37.594  -83.877 1.00 67.58  ? 78  DG  I "C5'" 1 
ATOM   1575  C  "C4'" . DG  A  1 78  ? -9.326  36.655  -83.113 1.00 69.42  ? 78  DG  I "C4'" 1 
ATOM   1576  O  "O4'" . DG  A  1 78  ? -8.990  35.503  -83.938 1.00 73.06  ? 78  DG  I "O4'" 1 
ATOM   1577  C  "C3'" . DG  A  1 78  ? -7.982  37.258  -82.680 1.00 66.82  ? 78  DG  I "C3'" 1 
ATOM   1578  O  "O3'" . DG  A  1 78  ? -7.664  36.791  -81.390 1.00 64.60  ? 78  DG  I "O3'" 1 
ATOM   1579  C  "C2'" . DG  A  1 78  ? -7.015  36.673  -83.705 1.00 66.67  ? 78  DG  I "C2'" 1 
ATOM   1580  C  "C1'" . DG  A  1 78  ? -7.603  35.285  -83.835 1.00 67.46  ? 78  DG  I "C1'" 1 
ATOM   1581  N  N9    . DG  A  1 78  ? -7.140  34.532  -84.996 1.00 69.10  ? 78  DG  I N9    1 
ATOM   1582  C  C8    . DG  A  1 78  ? -6.745  35.034  -86.211 1.00 72.75  ? 78  DG  I C8    1 
ATOM   1583  N  N7    . DG  A  1 78  ? -6.377  34.110  -87.058 1.00 78.91  ? 78  DG  I N7    1 
ATOM   1584  C  C5    . DG  A  1 78  ? -6.538  32.920  -86.356 1.00 72.41  ? 78  DG  I C5    1 
ATOM   1585  C  C6    . DG  A  1 78  ? -6.297  31.583  -86.757 1.00 74.76  ? 78  DG  I C6    1 
ATOM   1586  O  O6    . DG  A  1 78  ? -5.881  31.172  -87.850 1.00 81.04  ? 78  DG  I O6    1 
ATOM   1587  N  N1    . DG  A  1 78  ? -6.587  30.678  -85.737 1.00 71.11  ? 78  DG  I N1    1 
ATOM   1588  C  C2    . DG  A  1 78  ? -7.053  31.023  -84.489 1.00 68.64  ? 78  DG  I C2    1 
ATOM   1589  N  N2    . DG  A  1 78  ? -7.278  30.010  -83.637 1.00 65.09  ? 78  DG  I N2    1 
ATOM   1590  N  N3    . DG  A  1 78  ? -7.282  32.271  -84.103 1.00 67.56  ? 78  DG  I N3    1 
ATOM   1591  C  C4    . DG  A  1 78  ? -7.004  33.164  -85.085 1.00 70.07  ? 78  DG  I C4    1 
ATOM   1592  P  P     . DC  A  1 79  ? -7.475  37.807  -80.164 1.00 73.00  ? 79  DC  I P     1 
ATOM   1593  O  OP1   . DC  A  1 79  ? -8.530  38.841  -80.261 1.00 78.52  ? 79  DC  I OP1   1 
ATOM   1594  O  OP2   . DC  A  1 79  ? -6.047  38.199  -80.118 1.00 59.08  ? 79  DC  I OP2   1 
ATOM   1595  O  "O5'" . DC  A  1 79  ? -7.771  36.886  -78.892 1.00 67.91  ? 79  DC  I "O5'" 1 
ATOM   1596  C  "C5'" . DC  A  1 79  ? -8.808  35.912  -78.957 1.00 57.82  ? 79  DC  I "C5'" 1 
ATOM   1597  C  "C4'" . DC  A  1 79  ? -8.275  34.513  -78.668 1.00 55.06  ? 79  DC  I "C4'" 1 
ATOM   1598  O  "O4'" . DC  A  1 79  ? -7.604  33.966  -79.838 1.00 48.92  ? 79  DC  I "O4'" 1 
ATOM   1599  C  "C3'" . DC  A  1 79  ? -7.263  34.408  -77.530 1.00 45.04  ? 79  DC  I "C3'" 1 
ATOM   1600  O  "O3'" . DC  A  1 79  ? -7.496  33.202  -76.853 1.00 49.92  ? 79  DC  I "O3'" 1 
ATOM   1601  C  "C2'" . DC  A  1 79  ? -5.934  34.362  -78.280 1.00 45.56  ? 79  DC  I "C2'" 1 
ATOM   1602  C  "C1'" . DC  A  1 79  ? -6.332  33.493  -79.456 1.00 49.58  ? 79  DC  I "C1'" 1 
ATOM   1603  N  N1    . DC  A  1 79  ? -5.423  33.579  -80.628 1.00 58.68  ? 79  DC  I N1    1 
ATOM   1604  C  C2    . DC  A  1 79  ? -4.958  32.402  -81.229 1.00 61.20  ? 79  DC  I C2    1 
ATOM   1605  O  O2    . DC  A  1 79  ? -5.296  31.307  -80.758 1.00 56.28  ? 79  DC  I O2    1 
ATOM   1606  N  N3    . DC  A  1 79  ? -4.147  32.495  -82.309 1.00 62.26  ? 79  DC  I N3    1 
ATOM   1607  C  C4    . DC  A  1 79  ? -3.804  33.690  -82.785 1.00 62.40  ? 79  DC  I C4    1 
ATOM   1608  N  N4    . DC  A  1 79  ? -3.000  33.727  -83.851 1.00 66.99  ? 79  DC  I N4    1 
ATOM   1609  C  C5    . DC  A  1 79  ? -4.270  34.899  -82.192 1.00 62.87  ? 79  DC  I C5    1 
ATOM   1610  C  C6    . DC  A  1 79  ? -5.073  34.798  -81.128 1.00 62.31  ? 79  DC  I C6    1 
ATOM   1611  P  P     . DT  A  1 80  ? -7.279  33.080  -75.271 1.00 52.73  ? 80  DT  I P     1 
ATOM   1612  O  OP1   . DT  A  1 80  ? -8.574  32.601  -74.734 1.00 46.50  ? 80  DT  I OP1   1 
ATOM   1613  O  OP2   . DT  A  1 80  ? -6.640  34.318  -74.774 1.00 41.94  ? 80  DT  I OP2   1 
ATOM   1614  O  "O5'" . DT  A  1 80  ? -6.199  31.908  -75.132 1.00 48.14  ? 80  DT  I "O5'" 1 
ATOM   1615  C  "C5'" . DT  A  1 80  ? -6.438  30.662  -75.746 1.00 37.67  ? 80  DT  I "C5'" 1 
ATOM   1616  C  "C4'" . DT  A  1 80  ? -5.150  30.057  -76.259 1.00 42.07  ? 80  DT  I "C4'" 1 
ATOM   1617  O  "O4'" . DT  A  1 80  ? -4.631  30.842  -77.360 1.00 49.07  ? 80  DT  I "O4'" 1 
ATOM   1618  C  "C3'" . DT  A  1 80  ? -4.002  29.951  -75.239 1.00 44.84  ? 80  DT  I "C3'" 1 
ATOM   1619  O  "O3'" . DT  A  1 80  ? -3.501  28.624  -75.259 1.00 43.83  ? 80  DT  I "O3'" 1 
ATOM   1620  C  "C2'" . DT  A  1 80  ? -2.960  30.934  -75.784 1.00 42.59  ? 80  DT  I "C2'" 1 
ATOM   1621  C  "C1'" . DT  A  1 80  ? -3.232  30.815  -77.269 1.00 51.32  ? 80  DT  I "C1'" 1 
ATOM   1622  N  N1    . DT  A  1 80  ? -2.645  31.910  -78.115 1.00 55.79  ? 80  DT  I N1    1 
ATOM   1623  C  C2    . DT  A  1 80  ? -2.094  31.583  -79.334 1.00 60.21  ? 80  DT  I C2    1 
ATOM   1624  O  O2    . DT  A  1 80  ? -2.063  30.446  -79.772 1.00 60.28  ? 80  DT  I O2    1 
ATOM   1625  N  N3    . DT  A  1 80  ? -1.580  32.639  -80.035 1.00 65.20  ? 80  DT  I N3    1 
ATOM   1626  C  C4    . DT  A  1 80  ? -1.556  33.965  -79.651 1.00 63.92  ? 80  DT  I C4    1 
ATOM   1627  O  O4    . DT  A  1 80  ? -1.069  34.841  -80.358 1.00 63.30  ? 80  DT  I O4    1 
ATOM   1628  C  C5    . DT  A  1 80  ? -2.145  34.247  -78.360 1.00 63.09  ? 80  DT  I C5    1 
ATOM   1629  C  C7    . DT  A  1 80  ? -2.176  35.657  -77.839 1.00 58.98  ? 80  DT  I C7    1 
ATOM   1630  C  C6    . DT  A  1 80  ? -2.655  33.216  -77.659 1.00 54.85  ? 80  DT  I C6    1 
ATOM   1631  P  P     . DG  A  1 81  ? -2.772  27.973  -73.984 1.00 37.84  ? 81  DG  I P     1 
ATOM   1632  O  OP1   . DG  A  1 81  ? -3.820  27.351  -73.145 1.00 37.99  ? 81  DG  I OP1   1 
ATOM   1633  O  OP2   . DG  A  1 81  ? -1.835  28.941  -73.369 1.00 39.15  ? 81  DG  I OP2   1 
ATOM   1634  O  "O5'" . DG  A  1 81  ? -1.903  26.824  -74.651 1.00 38.28  ? 81  DG  I "O5'" 1 
ATOM   1635  C  "C5'" . DG  A  1 81  ? -2.439  26.103  -75.746 1.00 40.87  ? 81  DG  I "C5'" 1 
ATOM   1636  C  "C4'" . DG  A  1 81  ? -1.336  25.518  -76.609 1.00 45.70  ? 81  DG  I "C4'" 1 
ATOM   1637  O  "O4'" . DG  A  1 81  ? -0.869  26.507  -77.557 1.00 41.91  ? 81  DG  I "O4'" 1 
ATOM   1638  C  "C3'" . DG  A  1 81  ? -0.102  25.050  -75.858 1.00 43.30  ? 81  DG  I "C3'" 1 
ATOM   1639  O  "O3'" . DG  A  1 81  ? 0.448   23.946  -76.519 1.00 38.48  ? 81  DG  I "O3'" 1 
ATOM   1640  C  "C2'" . DG  A  1 81  ? 0.828   26.260  -75.927 1.00 40.86  ? 81  DG  I "C2'" 1 
ATOM   1641  C  "C1'" . DG  A  1 81  ? 0.471   26.868  -77.275 1.00 43.42  ? 81  DG  I "C1'" 1 
ATOM   1642  N  N9    . DG  A  1 81  ? 0.545   28.319  -77.284 1.00 50.18  ? 81  DG  I N9    1 
ATOM   1643  C  C8    . DG  A  1 81  ? 0.085   29.179  -76.317 1.00 48.03  ? 81  DG  I C8    1 
ATOM   1644  N  N7    . DG  A  1 81  ? 0.275   30.433  -76.608 1.00 47.43  ? 81  DG  I N7    1 
ATOM   1645  C  C5    . DG  A  1 81  ? 0.895   30.401  -77.848 1.00 50.64  ? 81  DG  I C5    1 
ATOM   1646  C  C6    . DG  A  1 81  ? 1.346   31.457  -78.665 1.00 56.45  ? 81  DG  I C6    1 
ATOM   1647  O  O6    . DG  A  1 81  ? 1.281   32.674  -78.448 1.00 65.86  ? 81  DG  I O6    1 
ATOM   1648  N  N1    . DG  A  1 81  ? 1.921   30.987  -79.841 1.00 56.84  ? 81  DG  I N1    1 
ATOM   1649  C  C2    . DG  A  1 81  ? 2.043   29.662  -80.182 1.00 59.43  ? 81  DG  I C2    1 
ATOM   1650  N  N2    . DG  A  1 81  ? 2.626   29.401  -81.360 1.00 64.18  ? 81  DG  I N2    1 
ATOM   1651  N  N3    . DG  A  1 81  ? 1.625   28.663  -79.423 1.00 56.04  ? 81  DG  I N3    1 
ATOM   1652  C  C4    . DG  A  1 81  ? 1.065   29.106  -78.276 1.00 50.56  ? 81  DG  I C4    1 
ATOM   1653  P  P     . DA  A  1 82  ? 1.695   23.179  -75.878 1.00 39.74  ? 82  DA  I P     1 
ATOM   1654  O  OP1   . DA  A  1 82  ? 1.451   21.731  -76.068 1.00 45.97  ? 82  DA  I OP1   1 
ATOM   1655  O  OP2   . DA  A  1 82  ? 1.914   23.735  -74.524 1.00 37.34  ? 82  DA  I OP2   1 
ATOM   1656  O  "O5'" . DA  A  1 82  ? 2.920   23.618  -76.798 1.00 41.73  ? 82  DA  I "O5'" 1 
ATOM   1657  C  "C5'" . DA  A  1 82  ? 2.924   23.276  -78.159 1.00 35.89  ? 82  DA  I "C5'" 1 
ATOM   1658  C  "C4'" . DA  A  1 82  ? 4.176   23.791  -78.832 1.00 44.62  ? 82  DA  I "C4'" 1 
ATOM   1659  O  "O4'" . DA  A  1 82  ? 4.126   25.233  -78.908 1.00 42.11  ? 82  DA  I "O4'" 1 
ATOM   1660  C  "C3'" . DA  A  1 82  ? 5.483   23.441  -78.127 1.00 41.06  ? 82  DA  I "C3'" 1 
ATOM   1661  O  "O3'" . DA  A  1 82  ? 6.408   22.989  -79.082 1.00 47.24  ? 82  DA  I "O3'" 1 
ATOM   1662  C  "C2'" . DA  A  1 82  ? 5.924   24.763  -77.497 1.00 39.71  ? 82  DA  I "C2'" 1 
ATOM   1663  C  "C1'" . DA  A  1 82  ? 5.337   25.781  -78.455 1.00 42.38  ? 82  DA  I "C1'" 1 
ATOM   1664  N  N9    . DA  A  1 82  ? 5.026   27.055  -77.828 1.00 47.14  ? 82  DA  I N9    1 
ATOM   1665  C  C8    . DA  A  1 82  ? 4.538   27.251  -76.569 1.00 51.64  ? 82  DA  I C8    1 
ATOM   1666  N  N7    . DA  A  1 82  ? 4.335   28.512  -76.273 1.00 54.61  ? 82  DA  I N7    1 
ATOM   1667  C  C5    . DA  A  1 82  ? 4.706   29.186  -77.422 1.00 52.64  ? 82  DA  I C5    1 
ATOM   1668  C  C6    . DA  A  1 82  ? 4.722   30.552  -77.753 1.00 54.00  ? 82  DA  I C6    1 
ATOM   1669  N  N6    . DA  A  1 82  ? 4.340   31.513  -76.912 1.00 55.42  ? 82  DA  I N6    1 
ATOM   1670  N  N1    . DA  A  1 82  ? 5.150   30.893  -78.983 1.00 56.36  ? 82  DA  I N1    1 
ATOM   1671  C  C2    . DA  A  1 82  ? 5.532   29.927  -79.822 1.00 56.58  ? 82  DA  I C2    1 
ATOM   1672  N  N3    . DA  A  1 82  ? 5.560   28.611  -79.625 1.00 58.15  ? 82  DA  I N3    1 
ATOM   1673  C  C4    . DA  A  1 82  ? 5.129   28.304  -78.392 1.00 50.75  ? 82  DA  I C4    1 
ATOM   1674  P  P     . DA  A  1 83  ? 7.847   22.438  -78.638 1.00 47.85  ? 83  DA  I P     1 
ATOM   1675  O  OP1   . DA  A  1 83  ? 8.157   21.325  -79.562 1.00 52.47  ? 83  DA  I OP1   1 
ATOM   1676  O  OP2   . DA  A  1 83  ? 7.856   22.216  -77.173 1.00 44.49  ? 83  DA  I OP2   1 
ATOM   1677  O  "O5'" . DA  A  1 83  ? 8.819   23.650  -78.979 1.00 43.75  ? 83  DA  I "O5'" 1 
ATOM   1678  C  "C5'" . DA  A  1 83  ? 8.759   24.237  -80.265 1.00 49.69  ? 83  DA  I "C5'" 1 
ATOM   1679  C  "C4'" . DA  A  1 83  ? 9.722   25.398  -80.373 1.00 54.95  ? 83  DA  I "C4'" 1 
ATOM   1680  O  "O4'" . DA  A  1 83  ? 9.107   26.588  -79.817 1.00 54.21  ? 83  DA  I "O4'" 1 
ATOM   1681  C  "C3'" . DA  A  1 83  ? 11.045  25.215  -79.631 1.00 57.01  ? 83  DA  I "C3'" 1 
ATOM   1682  O  "O3'" . DA  A  1 83  ? 12.103  25.743  -80.421 1.00 55.28  ? 83  DA  I "O3'" 1 
ATOM   1683  C  "C2'" . DA  A  1 83  ? 10.830  26.021  -78.350 1.00 51.00  ? 83  DA  I "C2'" 1 
ATOM   1684  C  "C1'" . DA  A  1 83  ? 9.960   27.156  -78.853 1.00 55.04  ? 83  DA  I "C1'" 1 
ATOM   1685  N  N9    . DA  A  1 83  ? 9.129   27.754  -77.818 1.00 59.78  ? 83  DA  I N9    1 
ATOM   1686  C  C8    . DA  A  1 83  ? 8.506   27.111  -76.785 1.00 60.23  ? 83  DA  I C8    1 
ATOM   1687  N  N7    . DA  A  1 83  ? 7.812   27.908  -76.008 1.00 55.69  ? 83  DA  I N7    1 
ATOM   1688  C  C5    . DA  A  1 83  ? 7.989   29.157  -76.575 1.00 56.55  ? 83  DA  I C5    1 
ATOM   1689  C  C6    . DA  A  1 83  ? 7.514   30.431  -76.223 1.00 58.47  ? 83  DA  I C6    1 
ATOM   1690  N  N6    . DA  A  1 83  ? 6.724   30.655  -75.172 1.00 59.85  ? 83  DA  I N6    1 
ATOM   1691  N  N1    . DA  A  1 83  ? 7.878   31.468  -77.000 1.00 62.78  ? 83  DA  I N1    1 
ATOM   1692  C  C2    . DA  A  1 83  ? 8.669   31.239  -78.053 1.00 61.99  ? 83  DA  I C2    1 
ATOM   1693  N  N3    . DA  A  1 83  ? 9.179   30.088  -78.482 1.00 59.27  ? 83  DA  I N3    1 
ATOM   1694  C  C4    . DA  A  1 83  ? 8.797   29.079  -77.692 1.00 56.65  ? 83  DA  I C4    1 
ATOM   1695  P  P     . DC  A  1 84  ? 13.640  25.601  -79.966 1.00 67.04  ? 84  DC  I P     1 
ATOM   1696  O  OP1   . DC  A  1 84  ? 14.293  24.674  -80.913 1.00 74.76  ? 84  DC  I OP1   1 
ATOM   1697  O  OP2   . DC  A  1 84  ? 13.737  25.329  -78.515 1.00 65.66  ? 84  DC  I OP2   1 
ATOM   1698  O  "O5'" . DC  A  1 84  ? 14.213  27.066  -80.215 1.00 61.51  ? 84  DC  I "O5'" 1 
ATOM   1699  C  "C5'" . DC  A  1 84  ? 13.310  28.140  -80.410 1.00 62.54  ? 84  DC  I "C5'" 1 
ATOM   1700  C  "C4'" . DC  A  1 84  ? 13.974  29.460  -80.090 1.00 63.50  ? 84  DC  I "C4'" 1 
ATOM   1701  O  "O4'" . DC  A  1 84  ? 13.090  30.255  -79.249 1.00 63.32  ? 84  DC  I "O4'" 1 
ATOM   1702  C  "C3'" . DC  A  1 84  ? 15.289  29.342  -79.328 1.00 63.68  ? 84  DC  I "C3'" 1 
ATOM   1703  O  "O3'" . DC  A  1 84  ? 16.171  30.380  -79.740 1.00 69.57  ? 84  DC  I "O3'" 1 
ATOM   1704  C  "C2'" . DC  A  1 84  ? 14.847  29.509  -77.877 1.00 70.14  ? 84  DC  I "C2'" 1 
ATOM   1705  C  "C1'" . DC  A  1 84  ? 13.717  30.523  -78.012 1.00 68.18  ? 84  DC  I "C1'" 1 
ATOM   1706  N  N1    . DC  A  1 84  ? 12.697  30.427  -76.917 1.00 66.11  ? 84  DC  I N1    1 
ATOM   1707  C  C2    . DC  A  1 84  ? 12.021  31.577  -76.497 1.00 70.13  ? 84  DC  I C2    1 
ATOM   1708  O  O2    . DC  A  1 84  ? 12.269  32.655  -77.047 1.00 76.57  ? 84  DC  I O2    1 
ATOM   1709  N  N3    . DC  A  1 84  ? 11.107  31.476  -75.500 1.00 67.39  ? 84  DC  I N3    1 
ATOM   1710  C  C4    . DC  A  1 84  ? 10.868  30.295  -74.929 1.00 68.45  ? 84  DC  I C4    1 
ATOM   1711  N  N4    . DC  A  1 84  ? 9.958   30.247  -73.948 1.00 65.10  ? 84  DC  I N4    1 
ATOM   1712  C  C5    . DC  A  1 84  ? 11.551  29.110  -75.338 1.00 64.41  ? 84  DC  I C5    1 
ATOM   1713  C  C6    . DC  A  1 84  ? 12.449  29.222  -76.324 1.00 64.51  ? 84  DC  I C6    1 
ATOM   1714  P  P     . DA  A  1 85  ? 17.716  30.400  -79.284 1.00 72.55  ? 85  DA  I P     1 
ATOM   1715  O  OP1   . DA  A  1 85  ? 18.530  30.265  -80.511 1.00 62.55  ? 85  DA  I OP1   1 
ATOM   1716  O  OP2   . DA  A  1 85  ? 17.935  29.468  -78.153 1.00 60.08  ? 85  DA  I OP2   1 
ATOM   1717  O  "O5'" . DA  A  1 85  ? 17.902  31.886  -78.740 1.00 62.08  ? 85  DA  I "O5'" 1 
ATOM   1718  C  "C5'" . DA  A  1 85  ? 17.306  32.963  -79.447 1.00 66.37  ? 85  DA  I "C5'" 1 
ATOM   1719  C  "C4'" . DA  A  1 85  ? 17.133  34.173  -78.550 1.00 74.02  ? 85  DA  I "C4'" 1 
ATOM   1720  O  "O4'" . DA  A  1 85  ? 16.042  33.941  -77.617 1.00 74.94  ? 85  DA  I "O4'" 1 
ATOM   1721  C  "C3'" . DA  A  1 85  ? 18.353  34.520  -77.703 1.00 77.87  ? 85  DA  I "C3'" 1 
ATOM   1722  O  "O3'" . DA  A  1 85  ? 18.506  35.939  -77.634 1.00 83.22  ? 85  DA  I "O3'" 1 
ATOM   1723  C  "C2'" . DA  A  1 85  ? 18.006  33.918  -76.343 1.00 71.71  ? 85  DA  I "C2'" 1 
ATOM   1724  C  "C1'" . DA  A  1 85  ? 16.498  34.121  -76.296 1.00 72.36  ? 85  DA  I "C1'" 1 
ATOM   1725  N  N9    . DA  A  1 85  ? 15.815  33.165  -75.425 1.00 79.08  ? 85  DA  I N9    1 
ATOM   1726  C  C8    . DA  A  1 85  ? 16.005  31.811  -75.379 1.00 75.27  ? 85  DA  I C8    1 
ATOM   1727  N  N7    . DA  A  1 85  ? 15.260  31.201  -74.489 1.00 72.06  ? 85  DA  I N7    1 
ATOM   1728  C  C5    . DA  A  1 85  ? 14.532  32.223  -73.907 1.00 73.03  ? 85  DA  I C5    1 
ATOM   1729  C  C6    . DA  A  1 85  ? 13.560  32.234  -72.889 1.00 75.72  ? 85  DA  I C6    1 
ATOM   1730  N  N6    . DA  A  1 85  ? 13.144  31.130  -72.257 1.00 69.35  ? 85  DA  I N6    1 
ATOM   1731  N  N1    . DA  A  1 85  ? 13.031  33.427  -72.544 1.00 78.16  ? 85  DA  I N1    1 
ATOM   1732  C  C2    . DA  A  1 85  ? 13.450  34.528  -73.179 1.00 72.35  ? 85  DA  I C2    1 
ATOM   1733  N  N3    . DA  A  1 85  ? 14.354  34.642  -74.150 1.00 73.02  ? 85  DA  I N3    1 
ATOM   1734  C  C4    . DA  A  1 85  ? 14.862  33.442  -74.470 1.00 76.45  ? 85  DA  I C4    1 
ATOM   1735  P  P     . DT  A  1 86  ? 19.880  36.596  -77.112 1.00 84.33  ? 86  DT  I P     1 
ATOM   1736  O  OP1   . DT  A  1 86  ? 20.376  37.481  -78.189 1.00 84.41  ? 86  DT  I OP1   1 
ATOM   1737  O  OP2   . DT  A  1 86  ? 20.755  35.530  -76.565 1.00 63.34  ? 86  DT  I OP2   1 
ATOM   1738  O  "O5'" . DT  A  1 86  ? 19.405  37.514  -75.896 1.00 80.96  ? 86  DT  I "O5'" 1 
ATOM   1739  C  "C5'" . DT  A  1 86  ? 18.149  37.263  -75.287 1.00 78.89  ? 86  DT  I "C5'" 1 
ATOM   1740  C  "C4'" . DT  A  1 86  ? 17.982  38.073  -74.023 1.00 76.36  ? 86  DT  I "C4'" 1 
ATOM   1741  O  "O4'" . DT  A  1 86  ? 17.083  37.368  -73.127 1.00 78.91  ? 86  DT  I "O4'" 1 
ATOM   1742  C  "C3'" . DT  A  1 86  ? 19.262  38.303  -73.229 1.00 72.58  ? 86  DT  I "C3'" 1 
ATOM   1743  O  "O3'" . DT  A  1 86  ? 19.175  39.555  -72.539 1.00 77.00  ? 86  DT  I "O3'" 1 
ATOM   1744  C  "C2'" . DT  A  1 86  ? 19.262  37.118  -72.268 1.00 71.79  ? 86  DT  I "C2'" 1 
ATOM   1745  C  "C1'" . DT  A  1 86  ? 17.775  36.977  -71.958 1.00 74.88  ? 86  DT  I "C1'" 1 
ATOM   1746  N  N1    . DT  A  1 86  ? 17.362  35.584  -71.605 1.00 78.25  ? 86  DT  I N1    1 
ATOM   1747  C  C2    . DT  A  1 86  ? 16.283  35.390  -70.768 1.00 78.55  ? 86  DT  I C2    1 
ATOM   1748  O  O2    . DT  A  1 86  ? 15.631  36.306  -70.292 1.00 78.03  ? 86  DT  I O2    1 
ATOM   1749  N  N3    . DT  A  1 86  ? 15.991  34.078  -70.505 1.00 72.24  ? 86  DT  I N3    1 
ATOM   1750  C  C4    . DT  A  1 86  ? 16.654  32.963  -70.983 1.00 73.86  ? 86  DT  I C4    1 
ATOM   1751  O  O4    . DT  A  1 86  ? 16.315  31.824  -70.690 1.00 76.23  ? 86  DT  I O4    1 
ATOM   1752  C  C5    . DT  A  1 86  ? 17.774  33.234  -71.852 1.00 75.44  ? 86  DT  I C5    1 
ATOM   1753  C  C7    . DT  A  1 86  ? 18.568  32.100  -72.430 1.00 66.60  ? 86  DT  I C7    1 
ATOM   1754  C  C6    . DT  A  1 86  ? 18.073  34.516  -72.118 1.00 76.36  ? 86  DT  I C6    1 
ATOM   1755  P  P     . DG  A  1 87  ? 20.461  40.207  -71.822 1.00 61.85  ? 87  DG  I P     1 
ATOM   1756  O  OP1   . DG  A  1 87  ? 20.522  41.621  -72.254 1.00 60.44  ? 87  DG  I OP1   1 
ATOM   1757  O  OP2   . DG  A  1 87  ? 21.618  39.293  -71.958 1.00 53.92  ? 87  DG  I OP2   1 
ATOM   1758  O  "O5'" . DG  A  1 87  ? 20.064  40.207  -70.284 1.00 59.36  ? 87  DG  I "O5'" 1 
ATOM   1759  C  "C5'" . DG  A  1 87  ? 18.801  40.697  -69.898 1.00 58.23  ? 87  DG  I "C5'" 1 
ATOM   1760  C  "C4'" . DG  A  1 87  ? 18.371  40.078  -68.591 1.00 62.70  ? 87  DG  I "C4'" 1 
ATOM   1761  O  "O4'" . DG  A  1 87  ? 18.098  38.660  -68.776 1.00 68.87  ? 87  DG  I "O4'" 1 
ATOM   1762  C  "C3'" . DG  A  1 87  ? 19.409  40.150  -67.464 1.00 58.95  ? 87  DG  I "C3'" 1 
ATOM   1763  O  "O3'" . DG  A  1 87  ? 18.741  40.399  -66.282 1.00 54.97  ? 87  DG  I "O3'" 1 
ATOM   1764  C  "C2'" . DG  A  1 87  ? 19.976  38.735  -67.447 1.00 59.38  ? 87  DG  I "C2'" 1 
ATOM   1765  C  "C1'" . DG  A  1 87  ? 18.698  37.970  -67.707 1.00 67.28  ? 87  DG  I "C1'" 1 
ATOM   1766  N  N9    . DG  A  1 87  ? 18.882  36.571  -68.064 1.00 70.65  ? 87  DG  I N9    1 
ATOM   1767  C  C8    . DG  A  1 87  ? 19.796  36.043  -68.942 1.00 72.24  ? 87  DG  I C8    1 
ATOM   1768  N  N7    . DG  A  1 87  ? 19.716  34.746  -69.056 1.00 69.29  ? 87  DG  I N7    1 
ATOM   1769  C  C5    . DG  A  1 87  ? 18.684  34.393  -68.197 1.00 72.26  ? 87  DG  I C5    1 
ATOM   1770  C  C6    . DG  A  1 87  ? 18.140  33.124  -67.898 1.00 74.54  ? 87  DG  I C6    1 
ATOM   1771  O  O6    . DG  A  1 87  ? 18.476  32.020  -68.350 1.00 73.36  ? 87  DG  I O6    1 
ATOM   1772  N  N1    . DG  A  1 87  ? 17.102  33.213  -66.972 1.00 80.20  ? 87  DG  I N1    1 
ATOM   1773  C  C2    . DG  A  1 87  ? 16.647  34.382  -66.409 1.00 75.36  ? 87  DG  I C2    1 
ATOM   1774  N  N2    . DG  A  1 87  ? 15.635  34.268  -65.536 1.00 69.68  ? 87  DG  I N2    1 
ATOM   1775  N  N3    . DG  A  1 87  ? 17.149  35.578  -66.681 1.00 76.29  ? 87  DG  I N3    1 
ATOM   1776  C  C4    . DG  A  1 87  ? 18.162  35.506  -67.580 1.00 74.80  ? 87  DG  I C4    1 
ATOM   1777  P  P     . DC  A  1 88  ? 19.240  41.526  -65.269 1.00 60.32  ? 88  DC  I P     1 
ATOM   1778  O  OP1   . DC  A  1 88  ? 19.313  42.798  -66.025 1.00 63.64  ? 88  DC  I OP1   1 
ATOM   1779  O  OP2   . DC  A  1 88  ? 20.435  41.005  -64.567 1.00 50.61  ? 88  DC  I OP2   1 
ATOM   1780  O  "O5'" . DC  A  1 88  ? 18.027  41.594  -64.228 1.00 64.03  ? 88  DC  I "O5'" 1 
ATOM   1781  C  "C5'" . DC  A  1 88  ? 16.682  41.520  -64.722 1.00 62.38  ? 88  DC  I "C5'" 1 
ATOM   1782  C  "C4'" . DC  A  1 88  ? 15.869  40.450  -63.999 1.00 64.19  ? 88  DC  I "C4'" 1 
ATOM   1783  O  "O4'" . DC  A  1 88  ? 16.388  39.126  -64.297 1.00 59.83  ? 88  DC  I "O4'" 1 
ATOM   1784  C  "C3'" . DC  A  1 88  ? 15.849  40.557  -62.476 1.00 63.89  ? 88  DC  I "C3'" 1 
ATOM   1785  O  "O3'" . DC  A  1 88  ? 14.552  40.249  -62.007 1.00 61.85  ? 88  DC  I "O3'" 1 
ATOM   1786  C  "C2'" . DC  A  1 88  ? 16.859  39.496  -62.050 1.00 61.92  ? 88  DC  I "C2'" 1 
ATOM   1787  C  "C1'" . DC  A  1 88  ? 16.591  38.425  -63.089 1.00 63.04  ? 88  DC  I "C1'" 1 
ATOM   1788  N  N1    . DC  A  1 88  ? 17.715  37.474  -63.286 1.00 67.29  ? 88  DC  I N1    1 
ATOM   1789  C  C2    . DC  A  1 88  ? 17.456  36.098  -63.342 1.00 74.84  ? 88  DC  I C2    1 
ATOM   1790  O  O2    . DC  A  1 88  ? 16.291  35.697  -63.210 1.00 74.42  ? 88  DC  I O2    1 
ATOM   1791  N  N3    . DC  A  1 88  ? 18.491  35.243  -63.539 1.00 73.27  ? 88  DC  I N3    1 
ATOM   1792  C  C4    . DC  A  1 88  ? 19.730  35.719  -63.678 1.00 72.30  ? 88  DC  I C4    1 
ATOM   1793  N  N4    . DC  A  1 88  ? 20.716  34.845  -63.875 1.00 71.28  ? 88  DC  I N4    1 
ATOM   1794  C  C5    . DC  A  1 88  ? 20.010  37.116  -63.626 1.00 71.95  ? 88  DC  I C5    1 
ATOM   1795  C  C6    . DC  A  1 88  ? 18.983  37.948  -63.432 1.00 67.45  ? 88  DC  I C6    1 
ATOM   1796  P  P     . DC  A  1 89  ? 14.004  40.917  -60.655 1.00 74.08  ? 89  DC  I P     1 
ATOM   1797  O  OP1   . DC  A  1 89  ? 12.757  41.652  -60.976 1.00 55.25  ? 89  DC  I OP1   1 
ATOM   1798  O  OP2   . DC  A  1 89  ? 15.145  41.622  -60.031 1.00 67.29  ? 89  DC  I OP2   1 
ATOM   1799  O  "O5'" . DC  A  1 89  ? 13.662  39.658  -59.727 1.00 68.62  ? 89  DC  I "O5'" 1 
ATOM   1800  C  "C5'" . DC  A  1 89  ? 13.279  38.423  -60.315 1.00 55.92  ? 89  DC  I "C5'" 1 
ATOM   1801  C  "C4'" . DC  A  1 89  ? 13.641  37.257  -59.409 1.00 56.45  ? 89  DC  I "C4'" 1 
ATOM   1802  O  "O4'" . DC  A  1 89  ? 14.940  36.717  -59.777 1.00 58.31  ? 89  DC  I "O4'" 1 
ATOM   1803  C  "C3'" . DC  A  1 89  ? 13.747  37.594  -57.922 1.00 52.82  ? 89  DC  I "C3'" 1 
ATOM   1804  O  "O3'" . DC  A  1 89  ? 13.269  36.507  -57.177 1.00 55.54  ? 89  DC  I "O3'" 1 
ATOM   1805  C  "C2'" . DC  A  1 89  ? 15.248  37.742  -57.732 1.00 56.17  ? 89  DC  I "C2'" 1 
ATOM   1806  C  "C1'" . DC  A  1 89  ? 15.722  36.607  -58.610 1.00 58.69  ? 89  DC  I "C1'" 1 
ATOM   1807  N  N1    . DC  A  1 89  ? 17.150  36.681  -58.980 1.00 66.37  ? 89  DC  I N1    1 
ATOM   1808  C  C2    . DC  A  1 89  ? 17.877  35.500  -59.143 1.00 70.00  ? 89  DC  I C2    1 
ATOM   1809  O  O2    . DC  A  1 89  ? 17.309  34.416  -58.973 1.00 67.28  ? 89  DC  I O2    1 
ATOM   1810  N  N3    . DC  A  1 89  ? 19.184  35.578  -59.487 1.00 77.40  ? 89  DC  I N3    1 
ATOM   1811  C  C4    . DC  A  1 89  ? 19.758  36.768  -59.665 1.00 73.03  ? 89  DC  I C4    1 
ATOM   1812  N  N4    . DC  A  1 89  ? 21.049  36.793  -60.003 1.00 74.51  ? 89  DC  I N4    1 
ATOM   1813  C  C5    . DC  A  1 89  ? 19.032  37.984  -59.500 1.00 71.51  ? 89  DC  I C5    1 
ATOM   1814  C  C6    . DC  A  1 89  ? 17.744  37.894  -59.159 1.00 71.24  ? 89  DC  I C6    1 
ATOM   1815  P  P     . DT  A  1 90  ? 11.943  36.652  -56.292 1.00 52.92  ? 90  DT  I P     1 
ATOM   1816  O  OP1   . DT  A  1 90  ? 10.870  37.179  -57.168 1.00 46.55  ? 90  DT  I OP1   1 
ATOM   1817  O  OP2   . DT  A  1 90  ? 12.342  37.366  -55.057 1.00 43.18  ? 90  DT  I OP2   1 
ATOM   1818  O  "O5'" . DT  A  1 90  ? 11.586  35.142  -55.903 1.00 49.26  ? 90  DT  I "O5'" 1 
ATOM   1819  C  "C5'" . DT  A  1 90  ? 11.365  34.174  -56.932 1.00 47.16  ? 90  DT  I "C5'" 1 
ATOM   1820  C  "C4'" . DT  A  1 90  ? 12.320  33.002  -56.787 1.00 46.87  ? 90  DT  I "C4'" 1 
ATOM   1821  O  "O4'" . DT  A  1 90  ? 13.680  33.458  -56.994 1.00 49.30  ? 90  DT  I "O4'" 1 
ATOM   1822  C  "C3'" . DT  A  1 90  ? 12.303  32.311  -55.416 1.00 42.98  ? 90  DT  I "C3'" 1 
ATOM   1823  O  "O3'" . DT  A  1 90  ? 11.998  30.924  -55.563 1.00 42.26  ? 90  DT  I "O3'" 1 
ATOM   1824  C  "C2'" . DT  A  1 90  ? 13.720  32.525  -54.870 1.00 53.04  ? 90  DT  I "C2'" 1 
ATOM   1825  C  "C1'" . DT  A  1 90  ? 14.527  32.745  -56.137 1.00 54.78  ? 90  DT  I "C1'" 1 
ATOM   1826  N  N1    . DT  A  1 90  ? 15.765  33.544  -55.922 1.00 63.50  ? 90  DT  I N1    1 
ATOM   1827  C  C2    . DT  A  1 90  ? 16.981  33.009  -56.279 1.00 68.31  ? 90  DT  I C2    1 
ATOM   1828  O  O2    . DT  A  1 90  ? 17.107  31.902  -56.774 1.00 66.31  ? 90  DT  I O2    1 
ATOM   1829  N  N3    . DT  A  1 90  ? 18.056  33.825  -56.039 1.00 70.09  ? 90  DT  I N3    1 
ATOM   1830  C  C4    . DT  A  1 90  ? 18.039  35.094  -55.486 1.00 67.76  ? 90  DT  I C4    1 
ATOM   1831  O  O4    . DT  A  1 90  ? 19.062  35.748  -55.310 1.00 72.99  ? 90  DT  I O4    1 
ATOM   1832  C  C5    . DT  A  1 90  ? 16.734  35.594  -55.129 1.00 65.62  ? 90  DT  I C5    1 
ATOM   1833  C  C7    . DT  A  1 90  ? 16.593  36.958  -54.519 1.00 58.74  ? 90  DT  I C7    1 
ATOM   1834  C  C6    . DT  A  1 90  ? 15.671  34.804  -55.361 1.00 65.19  ? 90  DT  I C6    1 
ATOM   1835  P  P     . DT  A  1 91  ? 11.864  29.974  -54.267 1.00 46.76  ? 91  DT  I P     1 
ATOM   1836  O  OP1   . DT  A  1 91  ? 10.792  28.994  -54.523 1.00 42.43  ? 91  DT  I OP1   1 
ATOM   1837  O  OP2   . DT  A  1 91  ? 11.821  30.808  -53.043 1.00 37.57  ? 91  DT  I OP2   1 
ATOM   1838  O  "O5'" . DT  A  1 91  ? 13.250  29.198  -54.230 1.00 54.42  ? 91  DT  I "O5'" 1 
ATOM   1839  C  "C5'" . DT  A  1 91  ? 13.812  28.685  -55.420 1.00 48.35  ? 91  DT  I "C5'" 1 
ATOM   1840  C  "C4'" . DT  A  1 91  ? 15.203  28.169  -55.144 1.00 51.73  ? 91  DT  I "C4'" 1 
ATOM   1841  O  "O4'" . DT  A  1 91  ? 16.137  29.283  -55.123 1.00 63.48  ? 91  DT  I "O4'" 1 
ATOM   1842  C  "C3'" . DT  A  1 91  ? 15.356  27.463  -53.796 1.00 54.33  ? 91  DT  I "C3'" 1 
ATOM   1843  O  "O3'" . DT  A  1 91  ? 16.156  26.307  -53.951 1.00 58.66  ? 91  DT  I "O3'" 1 
ATOM   1844  C  "C2'" . DT  A  1 91  ? 16.047  28.515  -52.929 1.00 58.01  ? 91  DT  I "C2'" 1 
ATOM   1845  C  "C1'" . DT  A  1 91  ? 16.923  29.208  -53.955 1.00 65.73  ? 91  DT  I "C1'" 1 
ATOM   1846  N  N1    . DT  A  1 91  ? 17.334  30.587  -53.559 1.00 69.99  ? 91  DT  I N1    1 
ATOM   1847  C  C2    . DT  A  1 91  ? 18.610  31.022  -53.849 1.00 72.89  ? 91  DT  I C2    1 
ATOM   1848  O  O2    . DT  A  1 91  ? 19.435  30.336  -54.426 1.00 75.74  ? 91  DT  I O2    1 
ATOM   1849  N  N3    . DT  A  1 91  ? 18.885  32.301  -53.441 1.00 71.12  ? 91  DT  I N3    1 
ATOM   1850  C  C4    . DT  A  1 91  ? 18.032  33.171  -52.783 1.00 70.11  ? 91  DT  I C4    1 
ATOM   1851  O  O4    . DT  A  1 91  ? 18.372  34.304  -52.455 1.00 67.11  ? 91  DT  I O4    1 
ATOM   1852  C  C5    . DT  A  1 91  ? 16.714  32.653  -52.506 1.00 69.59  ? 91  DT  I C5    1 
ATOM   1853  C  C7    . DT  A  1 91  ? 15.704  33.505  -51.796 1.00 61.59  ? 91  DT  I C7    1 
ATOM   1854  C  C6    . DT  A  1 91  ? 16.432  31.399  -52.901 1.00 68.82  ? 91  DT  I C6    1 
ATOM   1855  P  P     . DT  A  1 92  ? 16.198  25.179  -52.807 1.00 65.14  ? 92  DT  I P     1 
ATOM   1856  O  OP1   . DT  A  1 92  ? 15.747  23.923  -53.446 1.00 65.07  ? 92  DT  I OP1   1 
ATOM   1857  O  OP2   . DT  A  1 92  ? 15.494  25.673  -51.604 1.00 60.76  ? 92  DT  I OP2   1 
ATOM   1858  O  "O5'" . DT  A  1 92  ? 17.755  25.078  -52.452 1.00 64.50  ? 92  DT  I "O5'" 1 
ATOM   1859  C  "C5'" . DT  A  1 92  ? 18.611  26.151  -52.809 1.00 71.17  ? 92  DT  I "C5'" 1 
ATOM   1860  C  "C4'" . DT  A  1 92  ? 19.999  25.973  -52.239 1.00 73.43  ? 92  DT  I "C4'" 1 
ATOM   1861  O  "O4'" . DT  A  1 92  ? 20.603  27.278  -52.051 1.00 73.15  ? 92  DT  I "O4'" 1 
ATOM   1862  C  "C3'" . DT  A  1 92  ? 20.059  25.296  -50.881 1.00 77.31  ? 92  DT  I "C3'" 1 
ATOM   1863  O  "O3'" . DT  A  1 92  ? 21.301  24.610  -50.749 1.00 85.75  ? 92  DT  I "O3'" 1 
ATOM   1864  C  "C2'" . DT  A  1 92  ? 19.953  26.475  -49.917 1.00 79.12  ? 92  DT  I "C2'" 1 
ATOM   1865  C  "C1'" . DT  A  1 92  ? 20.680  27.588  -50.672 1.00 81.26  ? 92  DT  I "C1'" 1 
ATOM   1866  N  N1    . DT  A  1 92  ? 20.076  28.938  -50.453 1.00 81.45  ? 92  DT  I N1    1 
ATOM   1867  C  C2    . DT  A  1 92  ? 20.815  30.068  -50.726 1.00 84.66  ? 92  DT  I C2    1 
ATOM   1868  O  O2    . DT  A  1 92  ? 21.956  30.037  -51.152 1.00 87.49  ? 92  DT  I O2    1 
ATOM   1869  N  N3    . DT  A  1 92  ? 20.162  31.249  -50.485 1.00 79.46  ? 92  DT  I N3    1 
ATOM   1870  C  C4    . DT  A  1 92  ? 18.874  31.410  -50.006 1.00 77.42  ? 92  DT  I C4    1 
ATOM   1871  O  O4    . DT  A  1 92  ? 18.375  32.514  -49.821 1.00 81.47  ? 92  DT  I O4    1 
ATOM   1872  C  C5    . DT  A  1 92  ? 18.157  30.187  -49.738 1.00 78.03  ? 92  DT  I C5    1 
ATOM   1873  C  C7    . DT  A  1 92  ? 16.753  30.237  -49.215 1.00 73.75  ? 92  DT  I C7    1 
ATOM   1874  C  C6    . DT  A  1 92  ? 18.785  29.025  -49.970 1.00 82.18  ? 92  DT  I C6    1 
ATOM   1875  P  P     . DT  A  1 93  ? 21.571  23.600  -49.526 1.00 96.65  ? 93  DT  I P     1 
ATOM   1876  O  OP1   . DT  A  1 93  ? 21.803  22.262  -50.116 1.00 85.93  ? 93  DT  I OP1   1 
ATOM   1877  O  OP2   . DT  A  1 93  ? 20.521  23.765  -48.495 1.00 95.35  ? 93  DT  I OP2   1 
ATOM   1878  O  "O5'" . DT  A  1 93  ? 22.937  24.150  -48.906 1.00 92.82  ? 93  DT  I "O5'" 1 
ATOM   1879  C  "C5'" . DT  A  1 93  ? 23.529  25.321  -49.458 1.00 91.95  ? 93  DT  I "C5'" 1 
ATOM   1880  C  "C4'" . DT  A  1 93  ? 24.471  25.976  -48.468 1.00 97.66  ? 93  DT  I "C4'" 1 
ATOM   1881  O  "O4'" . DT  A  1 93  ? 24.185  27.401  -48.400 1.00 95.32  ? 93  DT  I "O4'" 1 
ATOM   1882  C  "C3'" . DT  A  1 93  ? 24.365  25.461  -47.033 1.00 103.50 ? 93  DT  I "C3'" 1 
ATOM   1883  O  "O3'" . DT  A  1 93  ? 25.652  25.494  -46.423 1.00 108.40 ? 93  DT  I "O3'" 1 
ATOM   1884  C  "C2'" . DT  A  1 93  ? 23.422  26.476  -46.396 1.00 100.78 ? 93  DT  I "C2'" 1 
ATOM   1885  C  "C1'" . DT  A  1 93  ? 23.899  27.754  -47.064 1.00 102.08 ? 93  DT  I "C1'" 1 
ATOM   1886  N  N1    . DT  A  1 93  ? 22.893  28.856  -47.058 1.00 96.71  ? 93  DT  I N1    1 
ATOM   1887  C  C2    . DT  A  1 93  ? 23.264  30.107  -47.499 1.00 100.68 ? 93  DT  I C2    1 
ATOM   1888  O  O2    . DT  A  1 93  ? 24.383  30.366  -47.912 1.00 101.74 ? 93  DT  I O2    1 
ATOM   1889  N  N3    . DT  A  1 93  ? 22.273  31.050  -47.445 1.00 97.85  ? 93  DT  I N3    1 
ATOM   1890  C  C4    . DT  A  1 93  ? 20.976  30.873  -47.001 1.00 95.03  ? 93  DT  I C4    1 
ATOM   1891  O  O4    . DT  A  1 93  ? 20.156  31.784  -46.992 1.00 92.75  ? 93  DT  I O4    1 
ATOM   1892  C  C5    . DT  A  1 93  ? 20.653  29.541  -46.548 1.00 93.14  ? 93  DT  I C5    1 
ATOM   1893  C  C7    . DT  A  1 93  ? 19.274  29.232  -46.044 1.00 95.80  ? 93  DT  I C7    1 
ATOM   1894  C  C6    . DT  A  1 93  ? 21.616  28.608  -46.596 1.00 93.23  ? 93  DT  I C6    1 
ATOM   1895  P  P     . DG  A  1 94  ? 25.940  24.707  -45.050 1.00 112.27 ? 94  DG  I P     1 
ATOM   1896  O  OP1   . DG  A  1 94  ? 26.891  23.622  -45.373 1.00 113.36 ? 94  DG  I OP1   1 
ATOM   1897  O  OP2   . DG  A  1 94  ? 24.657  24.387  -44.386 1.00 107.60 ? 94  DG  I OP2   1 
ATOM   1898  O  "O5'" . DG  A  1 94  ? 26.684  25.797  -44.147 1.00 106.39 ? 94  DG  I "O5'" 1 
ATOM   1899  C  "C5'" . DG  A  1 94  ? 26.995  27.072  -44.695 1.00 108.26 ? 94  DG  I "C5'" 1 
ATOM   1900  C  "C4'" . DG  A  1 94  ? 27.080  28.123  -43.604 1.00 111.16 ? 94  DG  I "C4'" 1 
ATOM   1901  O  "O4'" . DG  A  1 94  ? 26.091  29.156  -43.847 1.00 106.98 ? 94  DG  I "O4'" 1 
ATOM   1902  C  "C3'" . DG  A  1 94  ? 26.838  27.603  -42.183 1.00 118.62 ? 94  DG  I "C3'" 1 
ATOM   1903  O  "O3'" . DG  A  1 94  ? 27.926  28.001  -41.333 1.00 122.32 ? 94  DG  I "O3'" 1 
ATOM   1904  C  "C2'" . DG  A  1 94  ? 25.501  28.234  -41.774 1.00 113.36 ? 94  DG  I "C2'" 1 
ATOM   1905  C  "C1'" . DG  A  1 94  ? 25.426  29.476  -42.648 1.00 110.68 ? 94  DG  I "C1'" 1 
ATOM   1906  N  N9    . DG  A  1 94  ? 24.054  29.864  -42.974 1.00 107.27 ? 94  DG  I N9    1 
ATOM   1907  C  C8    . DG  A  1 94  ? 22.968  29.030  -43.104 1.00 106.22 ? 94  DG  I C8    1 
ATOM   1908  N  N7    . DG  A  1 94  ? 21.863  29.656  -43.402 1.00 98.29  ? 94  DG  I N7    1 
ATOM   1909  C  C5    . DG  A  1 94  ? 22.240  30.991  -43.476 1.00 103.44 ? 94  DG  I C5    1 
ATOM   1910  C  C6    . DG  A  1 94  ? 21.467  32.140  -43.766 1.00 102.02 ? 94  DG  I C6    1 
ATOM   1911  O  O6    . DG  A  1 94  ? 20.257  32.208  -44.024 1.00 102.25 ? 94  DG  I O6    1 
ATOM   1912  N  N1    . DG  A  1 94  ? 22.238  33.299  -43.736 1.00 101.40 ? 94  DG  I N1    1 
ATOM   1913  C  C2    . DG  A  1 94  ? 23.584  33.342  -43.462 1.00 101.92 ? 94  DG  I C2    1 
ATOM   1914  N  N2    . DG  A  1 94  ? 24.155  34.557  -43.481 1.00 100.34 ? 94  DG  I N2    1 
ATOM   1915  N  N3    . DG  A  1 94  ? 24.321  32.272  -43.190 1.00 100.74 ? 94  DG  I N3    1 
ATOM   1916  C  C4    . DG  A  1 94  ? 23.586  31.135  -43.215 1.00 103.26 ? 94  DG  I C4    1 
ATOM   1917  P  P     . DA  A  1 95  ? 27.810  27.977  -39.726 1.00 130.93 ? 95  DA  I P     1 
ATOM   1918  O  OP1   . DA  A  1 95  ? 29.160  27.633  -39.229 1.00 131.84 ? 95  DA  I OP1   1 
ATOM   1919  O  OP2   . DA  A  1 95  ? 26.665  27.152  -39.274 1.00 120.70 ? 95  DA  I OP2   1 
ATOM   1920  O  "O5'" . DA  A  1 95  ? 27.538  29.508  -39.364 1.00 110.00 ? 95  DA  I "O5'" 1 
ATOM   1921  C  "C5'" . DA  A  1 95  ? 28.364  30.510  -39.943 1.00 109.26 ? 95  DA  I "C5'" 1 
ATOM   1922  C  "C4'" . DA  A  1 95  ? 27.940  31.899  -39.508 1.00 108.46 ? 95  DA  I "C4'" 1 
ATOM   1923  O  "O4'" . DA  A  1 95  ? 26.692  32.258  -40.158 1.00 109.73 ? 95  DA  I "O4'" 1 
ATOM   1924  C  "C3'" . DA  A  1 95  ? 27.705  32.071  -38.004 1.00 107.63 ? 95  DA  I "C3'" 1 
ATOM   1925  O  "O3'" . DA  A  1 95  ? 28.270  33.305  -37.581 1.00 112.37 ? 95  DA  I "O3'" 1 
ATOM   1926  C  "C2'" . DA  A  1 95  ? 26.181  32.087  -37.897 1.00 106.23 ? 95  DA  I "C2'" 1 
ATOM   1927  C  "C1'" . DA  A  1 95  ? 25.807  32.780  -39.195 1.00 108.00 ? 95  DA  I "C1'" 1 
ATOM   1928  N  N9    . DA  A  1 95  ? 24.433  32.525  -39.624 1.00 107.50 ? 95  DA  I N9    1 
ATOM   1929  C  C8    . DA  A  1 95  ? 23.851  31.309  -39.858 1.00 106.06 ? 95  DA  I C8    1 
ATOM   1930  N  N7    . DA  A  1 95  ? 22.595  31.386  -40.234 1.00 103.82 ? 95  DA  I N7    1 
ATOM   1931  C  C5    . DA  A  1 95  ? 22.336  32.748  -40.249 1.00 102.11 ? 95  DA  I C5    1 
ATOM   1932  C  C6    . DA  A  1 95  ? 21.180  33.491  -40.565 1.00 99.58  ? 95  DA  I C6    1 
ATOM   1933  N  N6    . DA  A  1 95  ? 20.025  32.932  -40.942 1.00 96.70  ? 95  DA  I N6    1 
ATOM   1934  N  N1    . DA  A  1 95  ? 21.259  34.838  -40.478 1.00 99.46  ? 95  DA  I N1    1 
ATOM   1935  C  C2    . DA  A  1 95  ? 22.418  35.394  -40.100 1.00 100.15 ? 95  DA  I C2    1 
ATOM   1936  N  N3    . DA  A  1 95  ? 23.567  34.801  -39.779 1.00 102.91 ? 95  DA  I N3    1 
ATOM   1937  C  C4    . DA  A  1 95  ? 23.458  33.465  -39.875 1.00 104.90 ? 95  DA  I C4    1 
ATOM   1938  P  P     . DT  A  1 96  ? 28.406  33.669  -36.021 1.00 119.42 ? 96  DT  I P     1 
ATOM   1939  O  OP1   . DT  A  1 96  ? 29.847  33.615  -35.692 1.00 112.60 ? 96  DT  I OP1   1 
ATOM   1940  O  OP2   . DT  A  1 96  ? 27.440  32.872  -35.228 1.00 102.74 ? 96  DT  I OP2   1 
ATOM   1941  O  "O5'" . DT  A  1 96  ? 27.938  35.194  -35.967 1.00 108.13 ? 96  DT  I "O5'" 1 
ATOM   1942  C  "C5'" . DT  A  1 96  ? 26.909  35.643  -36.835 1.00 102.29 ? 96  DT  I "C5'" 1 
ATOM   1943  C  "C4'" . DT  A  1 96  ? 26.043  36.676  -36.147 1.00 106.82 ? 96  DT  I "C4'" 1 
ATOM   1944  O  "O4'" . DT  A  1 96  ? 24.654  36.472  -36.527 1.00 107.26 ? 96  DT  I "O4'" 1 
ATOM   1945  C  "C3'" . DT  A  1 96  ? 26.073  36.624  -34.623 1.00 109.51 ? 96  DT  I "C3'" 1 
ATOM   1946  O  "O3'" . DT  A  1 96  ? 25.948  37.942  -34.099 1.00 114.27 ? 96  DT  I "O3'" 1 
ATOM   1947  C  "C2'" . DT  A  1 96  ? 24.858  35.761  -34.295 1.00 104.95 ? 96  DT  I "C2'" 1 
ATOM   1948  C  "C1'" . DT  A  1 96  ? 23.877  36.173  -35.384 1.00 102.91 ? 96  DT  I "C1'" 1 
ATOM   1949  N  N1    . DT  A  1 96  ? 22.904  35.095  -35.737 1.00 101.53 ? 96  DT  I N1    1 
ATOM   1950  C  C2    . DT  A  1 96  ? 21.721  35.426  -36.359 1.00 98.19  ? 96  DT  I C2    1 
ATOM   1951  O  O2    . DT  A  1 96  ? 21.415  36.569  -36.652 1.00 99.06  ? 96  DT  I O2    1 
ATOM   1952  N  N3    . DT  A  1 96  ? 20.902  34.361  -36.633 1.00 95.05  ? 96  DT  I N3    1 
ATOM   1953  C  C4    . DT  A  1 96  ? 21.140  33.027  -36.349 1.00 96.14  ? 96  DT  I C4    1 
ATOM   1954  O  O4    . DT  A  1 96  ? 20.339  32.141  -36.635 1.00 90.47  ? 96  DT  I O4    1 
ATOM   1955  C  C5    . DT  A  1 96  ? 22.397  32.750  -35.692 1.00 98.34  ? 96  DT  I C5    1 
ATOM   1956  C  C7    . DT  A  1 96  ? 22.769  31.342  -35.332 1.00 97.07  ? 96  DT  I C7    1 
ATOM   1957  C  C6    . DT  A  1 96  ? 23.206  33.785  -35.421 1.00 101.70 ? 96  DT  I C6    1 
ATOM   1958  P  P     . DG  A  1 97  ? 26.097  38.236  -32.523 1.00 110.87 ? 97  DG  I P     1 
ATOM   1959  O  OP1   . DG  A  1 97  ? 27.279  39.109  -32.350 1.00 121.67 ? 97  DG  I OP1   1 
ATOM   1960  O  OP2   . DG  A  1 97  ? 25.992  36.976  -31.753 1.00 89.50  ? 97  DG  I OP2   1 
ATOM   1961  O  "O5'" . DG  A  1 97  ? 24.808  39.116  -32.207 1.00 107.21 ? 97  DG  I "O5'" 1 
ATOM   1962  C  "C5'" . DG  A  1 97  ? 24.352  40.054  -33.170 1.00 103.69 ? 97  DG  I "C5'" 1 
ATOM   1963  C  "C4'" . DG  A  1 97  ? 22.901  40.405  -32.926 1.00 102.94 ? 97  DG  I "C4'" 1 
ATOM   1964  O  "O4'" . DG  A  1 97  ? 22.053  39.315  -33.374 1.00 101.69 ? 97  DG  I "O4'" 1 
ATOM   1965  C  "C3'" . DG  A  1 97  ? 22.545  40.653  -31.465 1.00 99.95  ? 97  DG  I "C3'" 1 
ATOM   1966  O  "O3'" . DG  A  1 97  ? 21.638  41.738  -31.376 1.00 104.59 ? 97  DG  I "O3'" 1 
ATOM   1967  C  "C2'" . DG  A  1 97  ? 21.908  39.333  -31.028 1.00 95.50  ? 97  DG  I "C2'" 1 
ATOM   1968  C  "C1'" . DG  A  1 97  ? 21.236  38.866  -32.312 1.00 97.70  ? 97  DG  I "C1'" 1 
ATOM   1969  N  N9    . DG  A  1 97  ? 21.115  37.413  -32.413 1.00 95.05  ? 97  DG  I N9    1 
ATOM   1970  C  C8    . DG  A  1 97  ? 22.008  36.474  -31.956 1.00 100.66 ? 97  DG  I C8    1 
ATOM   1971  N  N7    . DG  A  1 97  ? 21.640  35.245  -32.195 1.00 96.14  ? 97  DG  I N7    1 
ATOM   1972  C  C5    . DG  A  1 97  ? 20.427  35.376  -32.857 1.00 98.31  ? 97  DG  I C5    1 
ATOM   1973  C  C6    . DG  A  1 97  ? 19.553  34.385  -33.368 1.00 97.10  ? 97  DG  I C6    1 
ATOM   1974  O  O6    . DG  A  1 97  ? 19.683  33.151  -33.331 1.00 97.01  ? 97  DG  I O6    1 
ATOM   1975  N  N1    . DG  A  1 97  ? 18.429  34.948  -33.966 1.00 86.59  ? 97  DG  I N1    1 
ATOM   1976  C  C2    . DG  A  1 97  ? 18.182  36.296  -34.060 1.00 87.88  ? 97  DG  I C2    1 
ATOM   1977  N  N2    . DG  A  1 97  ? 17.044  36.650  -34.672 1.00 85.71  ? 97  DG  I N2    1 
ATOM   1978  N  N3    . DG  A  1 97  ? 18.991  37.234  -33.588 1.00 95.92  ? 97  DG  I N3    1 
ATOM   1979  C  C4    . DG  A  1 97  ? 20.090  36.704  -33.000 1.00 96.14  ? 97  DG  I C4    1 
ATOM   1980  P  P     . DG  A  1 98  ? 21.117  42.250  -29.945 1.00 114.29 ? 98  DG  I P     1 
ATOM   1981  O  OP1   . DG  A  1 98  ? 21.043  43.727  -30.011 1.00 99.76  ? 98  DG  I OP1   1 
ATOM   1982  O  OP2   . DG  A  1 98  ? 21.911  41.586  -28.884 1.00 102.50 ? 98  DG  I OP2   1 
ATOM   1983  O  "O5'" . DG  A  1 98  ? 19.633  41.670  -29.858 1.00 107.27 ? 98  DG  I "O5'" 1 
ATOM   1984  C  "C5'" . DG  A  1 98  ? 18.690  41.971  -30.881 1.00 96.84  ? 98  DG  I "C5'" 1 
ATOM   1985  C  "C4'" . DG  A  1 98  ? 17.396  41.209  -30.658 1.00 90.34  ? 98  DG  I "C4'" 1 
ATOM   1986  O  "O4'" . DG  A  1 98  ? 17.618  39.793  -30.888 1.00 87.49  ? 98  DG  I "O4'" 1 
ATOM   1987  C  "C3'" . DG  A  1 98  ? 16.818  41.313  -29.248 1.00 86.73  ? 98  DG  I "C3'" 1 
ATOM   1988  O  "O3'" . DG  A  1 98  ? 15.422  41.330  -29.319 1.00 81.90  ? 98  DG  I "O3'" 1 
ATOM   1989  C  "C2'" . DG  A  1 98  ? 17.305  40.030  -28.590 1.00 86.71  ? 98  DG  I "C2'" 1 
ATOM   1990  C  "C1'" . DG  A  1 98  ? 17.200  39.065  -29.755 1.00 87.65  ? 98  DG  I "C1'" 1 
ATOM   1991  N  N9    . DG  A  1 98  ? 18.050  37.890  -29.620 1.00 94.46  ? 98  DG  I N9    1 
ATOM   1992  C  C8    . DG  A  1 98  ? 19.253  37.808  -28.961 1.00 96.76  ? 98  DG  I C8    1 
ATOM   1993  N  N7    . DG  A  1 98  ? 19.791  36.621  -29.010 1.00 95.18  ? 98  DG  I N7    1 
ATOM   1994  C  C5    . DG  A  1 98  ? 18.885  35.869  -29.749 1.00 96.64  ? 98  DG  I C5    1 
ATOM   1995  C  C6    . DG  A  1 98  ? 18.927  34.506  -30.130 1.00 99.12  ? 98  DG  I C6    1 
ATOM   1996  O  O6    . DG  A  1 98  ? 19.804  33.666  -29.884 1.00 105.89 ? 98  DG  I O6    1 
ATOM   1997  N  N1    . DG  A  1 98  ? 17.807  34.145  -30.875 1.00 95.05  ? 98  DG  I N1    1 
ATOM   1998  C  C2    . DG  A  1 98  ? 16.778  34.994  -31.210 1.00 94.24  ? 98  DG  I C2    1 
ATOM   1999  N  N2    . DG  A  1 98  ? 15.783  34.463  -31.936 1.00 89.24  ? 98  DG  I N2    1 
ATOM   2000  N  N3    . DG  A  1 98  ? 16.725  36.271  -30.857 1.00 94.58  ? 98  DG  I N3    1 
ATOM   2001  C  C4    . DG  A  1 98  ? 17.809  36.638  -30.131 1.00 94.47  ? 98  DG  I C4    1 
ATOM   2002  P  P     . DA  A  1 99  ? 14.609  42.628  -28.849 1.00 97.14  ? 99  DA  I P     1 
ATOM   2003  O  OP1   . DA  A  1 99  ? 15.272  43.824  -29.420 1.00 94.98  ? 99  DA  I OP1   1 
ATOM   2004  O  OP2   . DA  A  1 99  ? 14.405  42.501  -27.389 1.00 91.79  ? 99  DA  I OP2   1 
ATOM   2005  O  "O5'" . DA  A  1 99  ? 13.197  42.453  -29.566 1.00 93.86  ? 99  DA  I "O5'" 1 
ATOM   2006  C  "C5'" . DA  A  1 99  ? 13.147  42.032  -30.923 1.00 92.68  ? 99  DA  I "C5'" 1 
ATOM   2007  C  "C4'" . DA  A  1 99  ? 12.184  40.872  -31.086 1.00 82.83  ? 99  DA  I "C4'" 1 
ATOM   2008  O  "O4'" . DA  A  1 99  ? 12.843  39.631  -30.719 1.00 81.02  ? 99  DA  I "O4'" 1 
ATOM   2009  C  "C3'" . DA  A  1 99  ? 10.927  40.964  -30.228 1.00 74.27  ? 99  DA  I "C3'" 1 
ATOM   2010  O  "O3'" . DA  A  1 99  ? 9.807   40.551  -30.980 1.00 66.39  ? 99  DA  I "O3'" 1 
ATOM   2011  C  "C2'" . DA  A  1 99  ? 11.215  40.014  -29.066 1.00 79.44  ? 99  DA  I "C2'" 1 
ATOM   2012  C  "C1'" . DA  A  1 99  ? 12.104  38.964  -29.717 1.00 81.87  ? 99  DA  I "C1'" 1 
ATOM   2013  N  N9    . DA  A  1 99  ? 13.051  38.358  -28.784 1.00 85.35  ? 99  DA  I N9    1 
ATOM   2014  C  C8    . DA  A  1 99  ? 13.648  38.962  -27.713 1.00 92.88  ? 99  DA  I C8    1 
ATOM   2015  N  N7    . DA  A  1 99  ? 14.464  38.178  -27.049 1.00 92.17  ? 99  DA  I N7    1 
ATOM   2016  C  C5    . DA  A  1 99  ? 14.401  36.978  -27.734 1.00 91.37  ? 99  DA  I C5    1 
ATOM   2017  C  C6    . DA  A  1 99  ? 15.040  35.739  -27.534 1.00 93.98  ? 99  DA  I C6    1 
ATOM   2018  N  N6    . DA  A  1 99  ? 15.900  35.508  -26.537 1.00 98.75  ? 99  DA  I N6    1 
ATOM   2019  N  N1    . DA  A  1 99  ? 14.757  34.744  -28.400 1.00 91.45  ? 99  DA  I N1    1 
ATOM   2020  C  C2    . DA  A  1 99  ? 13.895  34.981  -29.395 1.00 89.76  ? 99  DA  I C2    1 
ATOM   2021  N  N3    . DA  A  1 99  ? 13.235  36.101  -29.685 1.00 88.44  ? 99  DA  I N3    1 
ATOM   2022  C  C4    . DA  A  1 99  ? 13.535  37.070  -28.807 1.00 88.37  ? 99  DA  I C4    1 
ATOM   2023  P  P     . DG  A  1 100 ? 8.337   40.612  -30.340 1.00 67.02  ? 100 DG  I P     1 
ATOM   2024  O  OP1   . DG  A  1 100 ? 7.402   40.901  -31.451 1.00 64.06  ? 100 DG  I OP1   1 
ATOM   2025  O  OP2   . DG  A  1 100 ? 8.371   41.485  -29.146 1.00 70.61  ? 100 DG  I OP2   1 
ATOM   2026  O  "O5'" . DG  A  1 100 ? 8.098   39.125  -29.813 1.00 72.68  ? 100 DG  I "O5'" 1 
ATOM   2027  C  "C5'" . DG  A  1 100 ? 8.465   38.026  -30.625 1.00 69.10  ? 100 DG  I "C5'" 1 
ATOM   2028  C  "C4'" . DG  A  1 100 ? 8.257   36.719  -29.889 1.00 66.83  ? 100 DG  I "C4'" 1 
ATOM   2029  O  "O4'" . DG  A  1 100 ? 9.395   36.448  -29.032 1.00 76.91  ? 100 DG  I "O4'" 1 
ATOM   2030  C  "C3'" . DG  A  1 100 ? 7.030   36.669  -28.982 1.00 62.21  ? 100 DG  I "C3'" 1 
ATOM   2031  O  "O3'" . DG  A  1 100 ? 6.467   35.381  -29.042 1.00 62.05  ? 100 DG  I "O3'" 1 
ATOM   2032  C  "C2'" . DG  A  1 100 ? 7.625   36.935  -27.605 1.00 65.93  ? 100 DG  I "C2'" 1 
ATOM   2033  C  "C1'" . DG  A  1 100 ? 8.937   36.184  -27.726 1.00 77.27  ? 100 DG  I "C1'" 1 
ATOM   2034  N  N9    . DG  A  1 100 ? 9.962   36.619  -26.786 1.00 86.77  ? 100 DG  I N9    1 
ATOM   2035  C  C8    . DG  A  1 100 ? 10.083  37.857  -26.201 1.00 88.68  ? 100 DG  I C8    1 
ATOM   2036  N  N7    . DG  A  1 100 ? 11.112  37.955  -25.404 1.00 93.36  ? 100 DG  I N7    1 
ATOM   2037  C  C5    . DG  A  1 100 ? 11.712  36.703  -25.471 1.00 89.57  ? 100 DG  I C5    1 
ATOM   2038  C  C6    . DG  A  1 100 ? 12.868  36.212  -24.821 1.00 94.46  ? 100 DG  I C6    1 
ATOM   2039  O  O6    . DG  A  1 100 ? 13.617  36.805  -24.031 1.00 99.89  ? 100 DG  I O6    1 
ATOM   2040  N  N1    . DG  A  1 100 ? 13.129  34.887  -25.167 1.00 99.05  ? 100 DG  I N1    1 
ATOM   2041  C  C2    . DG  A  1 100 ? 12.366  34.135  -26.033 1.00 96.08  ? 100 DG  I C2    1 
ATOM   2042  N  N2    . DG  A  1 100 ? 12.772  32.875  -26.247 1.00 92.38  ? 100 DG  I N2    1 
ATOM   2043  N  N3    . DG  A  1 100 ? 11.282  34.586  -26.646 1.00 90.60  ? 100 DG  I N3    1 
ATOM   2044  C  C4    . DG  A  1 100 ? 11.016  35.873  -26.319 1.00 87.39  ? 100 DG  I C4    1 
ATOM   2045  P  P     . DC  A  1 101 ? 4.885   35.188  -29.212 1.00 52.60  ? 101 DC  I P     1 
ATOM   2046  O  OP1   . DC  A  1 101 ? 4.492   35.642  -30.563 1.00 58.15  ? 101 DC  I OP1   1 
ATOM   2047  O  OP2   . DC  A  1 101 ? 4.217   35.705  -28.001 1.00 47.21  ? 101 DC  I OP2   1 
ATOM   2048  O  "O5'" . DC  A  1 101 ? 4.708   33.626  -29.130 1.00 61.53  ? 101 DC  I "O5'" 1 
ATOM   2049  C  "C5'" . DC  A  1 101 ? 4.978   32.999  -27.927 1.00 73.52  ? 101 DC  I "C5'" 1 
ATOM   2050  C  "C4'" . DC  A  1 101 ? 5.887   31.822  -28.136 1.00 73.56  ? 101 DC  I "C4'" 1 
ATOM   2051  O  "O4'" . DC  A  1 101 ? 7.224   32.172  -27.698 1.00 75.78  ? 101 DC  I "O4'" 1 
ATOM   2052  C  "C3'" . DC  A  1 101 ? 5.499   30.624  -27.307 1.00 76.94  ? 101 DC  I "C3'" 1 
ATOM   2053  O  "O3'" . DC  A  1 101 ? 5.985   29.436  -27.903 1.00 81.18  ? 101 DC  I "O3'" 1 
ATOM   2054  C  "C2'" . DC  A  1 101 ? 6.189   30.930  -25.986 1.00 83.82  ? 101 DC  I "C2'" 1 
ATOM   2055  C  "C1'" . DC  A  1 101 ? 7.498   31.545  -26.459 1.00 82.95  ? 101 DC  I "C1'" 1 
ATOM   2056  N  N1    . DC  A  1 101 ? 8.056   32.562  -25.517 1.00 84.97  ? 101 DC  I N1    1 
ATOM   2057  C  C2    . DC  A  1 101 ? 9.177   32.241  -24.744 1.00 89.82  ? 101 DC  I C2    1 
ATOM   2058  O  O2    . DC  A  1 101 ? 9.683   31.119  -24.856 1.00 88.13  ? 101 DC  I O2    1 
ATOM   2059  N  N3    . DC  A  1 101 ? 9.678   33.169  -23.894 1.00 95.89  ? 101 DC  I N3    1 
ATOM   2060  C  C4    . DC  A  1 101 ? 9.105   34.368  -23.801 1.00 88.88  ? 101 DC  I C4    1 
ATOM   2061  N  N4    . DC  A  1 101 ? 9.638   35.249  -22.948 1.00 85.65  ? 101 DC  I N4    1 
ATOM   2062  C  C5    . DC  A  1 101 ? 7.960   34.716  -24.579 1.00 81.55  ? 101 DC  I C5    1 
ATOM   2063  C  C6    . DC  A  1 101 ? 7.473   33.791  -25.415 1.00 78.06  ? 101 DC  I C6    1 
ATOM   2064  P  P     . DA  A  1 102 ? 5.016   28.162  -28.053 1.00 81.93  ? 102 DA  I P     1 
ATOM   2065  O  OP1   . DA  A  1 102 ? 5.384   27.460  -29.304 1.00 82.85  ? 102 DA  I OP1   1 
ATOM   2066  O  OP2   . DA  A  1 102 ? 3.624   28.622  -27.848 1.00 80.34  ? 102 DA  I OP2   1 
ATOM   2067  O  "O5'" . DA  A  1 102 ? 5.395   27.242  -26.803 1.00 88.07  ? 102 DA  I "O5'" 1 
ATOM   2068  C  "C5'" . DA  A  1 102 ? 5.091   27.676  -25.482 1.00 90.79  ? 102 DA  I "C5'" 1 
ATOM   2069  C  "C4'" . DA  A  1 102 ? 6.233   27.355  -24.535 1.00 97.54  ? 102 DA  I "C4'" 1 
ATOM   2070  O  "O4'" . DA  A  1 102 ? 6.931   28.578  -24.161 1.00 95.65  ? 102 DA  I "O4'" 1 
ATOM   2071  C  "C3'" . DA  A  1 102 ? 5.803   26.697  -23.229 1.00 102.62 ? 102 DA  I "C3'" 1 
ATOM   2072  O  "O3'" . DA  A  1 102 ? 6.722   25.679  -22.876 1.00 104.39 ? 102 DA  I "O3'" 1 
ATOM   2073  C  "C2'" . DA  A  1 102 ? 5.829   27.854  -22.234 1.00 104.71 ? 102 DA  I "C2'" 1 
ATOM   2074  C  "C1'" . DA  A  1 102 ? 6.996   28.677  -22.755 1.00 100.59 ? 102 DA  I "C1'" 1 
ATOM   2075  N  N9    . DA  A  1 102 ? 6.931   30.090  -22.377 1.00 94.75  ? 102 DA  I N9    1 
ATOM   2076  C  C8    . DA  A  1 102 ? 5.950   30.985  -22.700 1.00 90.69  ? 102 DA  I C8    1 
ATOM   2077  N  N7    . DA  A  1 102 ? 6.151   32.190  -22.222 1.00 96.05  ? 102 DA  I N7    1 
ATOM   2078  C  C5    . DA  A  1 102 ? 7.345   32.078  -21.530 1.00 97.06  ? 102 DA  I C5    1 
ATOM   2079  C  C6    . DA  A  1 102 ? 8.105   33.006  -20.791 1.00 96.38  ? 102 DA  I C6    1 
ATOM   2080  N  N6    . DA  A  1 102 ? 7.749   34.284  -20.626 1.00 95.34  ? 102 DA  I N6    1 
ATOM   2081  N  N1    . DA  A  1 102 ? 9.250   32.569  -20.227 1.00 102.96 ? 102 DA  I N1    1 
ATOM   2082  C  C2    . DA  A  1 102 ? 9.604   31.289  -20.395 1.00 101.62 ? 102 DA  I C2    1 
ATOM   2083  N  N3    . DA  A  1 102 ? 8.973   30.326  -21.065 1.00 101.58 ? 102 DA  I N3    1 
ATOM   2084  C  C4    . DA  A  1 102 ? 7.840   30.790  -21.615 1.00 98.53  ? 102 DA  I C4    1 
ATOM   2085  P  P     . DG  A  1 103 ? 6.227   24.407  -22.031 1.00 107.52 ? 103 DG  I P     1 
ATOM   2086  O  OP1   . DG  A  1 103 ? 6.373   23.206  -22.884 1.00 110.47 ? 103 DG  I OP1   1 
ATOM   2087  O  OP2   . DG  A  1 103 ? 4.905   24.751  -21.456 1.00 105.68 ? 103 DG  I OP2   1 
ATOM   2088  O  "O5'" . DG  A  1 103 ? 7.276   24.323  -20.829 1.00 116.19 ? 103 DG  I "O5'" 1 
ATOM   2089  C  "C5'" . DG  A  1 103 ? 8.495   25.045  -20.907 1.00 114.68 ? 103 DG  I "C5'" 1 
ATOM   2090  C  "C4'" . DG  A  1 103 ? 9.076   25.270  -19.523 1.00 116.28 ? 103 DG  I "C4'" 1 
ATOM   2091  O  "O4'" . DG  A  1 103 ? 9.060   26.692  -19.208 1.00 114.64 ? 103 DG  I "O4'" 1 
ATOM   2092  C  "C3'" . DG  A  1 103 ? 8.329   24.590  -18.382 1.00 118.47 ? 103 DG  I "C3'" 1 
ATOM   2093  O  "O3'" . DG  A  1 103 ? 9.260   24.246  -17.353 1.00 123.97 ? 103 DG  I "O3'" 1 
ATOM   2094  C  "C2'" . DG  A  1 103 ? 7.366   25.690  -17.936 1.00 115.59 ? 103 DG  I "C2'" 1 
ATOM   2095  C  "C1'" . DG  A  1 103 ? 8.253   26.921  -18.070 1.00 114.41 ? 103 DG  I "C1'" 1 
ATOM   2096  N  N9    . DG  A  1 103 ? 7.518   28.169  -18.272 1.00 110.21 ? 103 DG  I N9    1 
ATOM   2097  C  C8    . DG  A  1 103 ? 6.380   28.345  -19.018 1.00 107.68 ? 103 DG  I C8    1 
ATOM   2098  N  N7    . DG  A  1 103 ? 5.949   29.575  -19.030 1.00 107.02 ? 103 DG  I N7    1 
ATOM   2099  C  C5    . DG  A  1 103 ? 6.861   30.264  -18.241 1.00 108.14 ? 103 DG  I C5    1 
ATOM   2100  C  C6    . DG  A  1 103 ? 6.910   31.634  -17.887 1.00 107.84 ? 103 DG  I C6    1 
ATOM   2101  O  O6    . DG  A  1 103 ? 6.128   32.539  -18.213 1.00 106.93 ? 103 DG  I O6    1 
ATOM   2102  N  N1    . DG  A  1 103 ? 8.000   31.917  -17.068 1.00 111.27 ? 103 DG  I N1    1 
ATOM   2103  C  C2    . DG  A  1 103 ? 8.927   30.994  -16.645 1.00 111.21 ? 103 DG  I C2    1 
ATOM   2104  N  N2    . DG  A  1 103 ? 9.910   31.458  -15.859 1.00 114.57 ? 103 DG  I N2    1 
ATOM   2105  N  N3    . DG  A  1 103 ? 8.894   29.706  -16.969 1.00 111.66 ? 103 DG  I N3    1 
ATOM   2106  C  C4    . DG  A  1 103 ? 7.836   29.414  -17.767 1.00 110.85 ? 103 DG  I C4    1 
ATOM   2107  P  P     . DT  A  1 104 ? 8.849   23.257  -16.152 1.00 134.95 ? 104 DT  I P     1 
ATOM   2108  O  OP1   . DT  A  1 104 ? 9.781   22.108  -16.190 1.00 134.06 ? 104 DT  I OP1   1 
ATOM   2109  O  OP2   . DT  A  1 104 ? 7.392   23.011  -16.226 1.00 126.56 ? 104 DT  I OP2   1 
ATOM   2110  O  "O5'" . DT  A  1 104 ? 9.154   24.120  -14.837 1.00 124.64 ? 104 DT  I "O5'" 1 
ATOM   2111  C  "C5'" . DT  A  1 104 ? 8.909   25.521  -14.845 1.00 120.76 ? 104 DT  I "C5'" 1 
ATOM   2112  C  "C4'" . DT  A  1 104 ? 9.306   26.164  -13.533 1.00 125.31 ? 104 DT  I "C4'" 1 
ATOM   2113  O  "O4'" . DT  A  1 104 ? 9.070   27.595  -13.618 1.00 120.48 ? 104 DT  I "O4'" 1 
ATOM   2114  C  "C3'" . DT  A  1 104 ? 8.502   25.707  -12.331 1.00 126.85 ? 104 DT  I "C3'" 1 
ATOM   2115  O  "O3'" . DT  A  1 104 ? 9.253   25.940  -11.138 1.00 133.23 ? 104 DT  I "O3'" 1 
ATOM   2116  C  "C2'" . DT  A  1 104 ? 7.283   26.620  -12.418 1.00 124.83 ? 104 DT  I "C2'" 1 
ATOM   2117  C  "C1'" . DT  A  1 104 ? 7.918   27.937  -12.867 1.00 120.47 ? 104 DT  I "C1'" 1 
ATOM   2118  N  N1    . DT  A  1 104 ? 7.022   28.772  -13.723 1.00 118.05 ? 104 DT  I N1    1 
ATOM   2119  C  C2    . DT  A  1 104 ? 7.158   30.142  -13.712 1.00 117.46 ? 104 DT  I C2    1 
ATOM   2120  O  O2    . DT  A  1 104 ? 7.984   30.728  -13.033 1.00 118.03 ? 104 DT  I O2    1 
ATOM   2121  N  N3    . DT  A  1 104 ? 6.285   30.810  -14.532 1.00 117.06 ? 104 DT  I N3    1 
ATOM   2122  C  C4    . DT  A  1 104 ? 5.309   30.256  -15.344 1.00 113.66 ? 104 DT  I C4    1 
ATOM   2123  O  O4    . DT  A  1 104 ? 4.572   30.940  -16.047 1.00 112.67 ? 104 DT  I O4    1 
ATOM   2124  C  C5    . DT  A  1 104 ? 5.220   28.817  -15.308 1.00 111.50 ? 104 DT  I C5    1 
ATOM   2125  C  C7    . DT  A  1 104 ? 4.201   28.106  -16.147 1.00 109.01 ? 104 DT  I C7    1 
ATOM   2126  C  C6    . DT  A  1 104 ? 6.069   28.153  -14.509 1.00 117.92 ? 104 DT  I C6    1 
ATOM   2127  P  P     . DT  A  1 105 ? 8.867   25.205  -9.761  1.00 128.45 ? 105 DT  I P     1 
ATOM   2128  O  OP1   . DT  A  1 105 ? 10.051  24.428  -9.330  1.00 127.75 ? 105 DT  I OP1   1 
ATOM   2129  O  OP2   . DT  A  1 105 ? 7.567   24.521  -9.948  1.00 117.58 ? 105 DT  I OP2   1 
ATOM   2130  O  "O5'" . DT  A  1 105 ? 8.647   26.419  -8.740  1.00 130.28 ? 105 DT  I "O5'" 1 
ATOM   2131  C  "C5'" . DT  A  1 105 ? 7.750   27.468  -9.081  1.00 125.79 ? 105 DT  I "C5'" 1 
ATOM   2132  C  "C4'" . DT  A  1 105 ? 8.106   28.758  -8.368  1.00 125.47 ? 105 DT  I "C4'" 1 
ATOM   2133  O  "O4'" . DT  A  1 105 ? 7.709   29.872  -9.201  1.00 122.24 ? 105 DT  I "O4'" 1 
ATOM   2134  C  "C3'" . DT  A  1 105 ? 7.363   28.984  -7.065  1.00 126.81 ? 105 DT  I "C3'" 1 
ATOM   2135  O  "O3'" . DT  A  1 105 ? 8.032   29.973  -6.284  1.00 128.36 ? 105 DT  I "O3'" 1 
ATOM   2136  C  "C2'" . DT  A  1 105 ? 6.024   29.496  -7.575  1.00 127.34 ? 105 DT  I "C2'" 1 
ATOM   2137  C  "C1'" . DT  A  1 105 ? 6.458   30.373  -8.752  1.00 125.49 ? 105 DT  I "C1'" 1 
ATOM   2138  N  N1    . DT  A  1 105 ? 5.500   30.348  -9.889  1.00 122.63 ? 105 DT  I N1    1 
ATOM   2139  C  C2    . DT  A  1 105 ? 5.174   31.525  -10.520 1.00 122.47 ? 105 DT  I C2    1 
ATOM   2140  O  O2    . DT  A  1 105 ? 5.639   32.606  -10.202 1.00 123.01 ? 105 DT  I O2    1 
ATOM   2141  N  N3    . DT  A  1 105 ? 4.281   31.391  -11.550 1.00 119.25 ? 105 DT  I N3    1 
ATOM   2142  C  C4    . DT  A  1 105 ? 3.691   30.223  -11.998 1.00 113.89 ? 105 DT  I C4    1 
ATOM   2143  O  O4    . DT  A  1 105 ? 2.899   30.205  -12.933 1.00 114.67 ? 105 DT  I O4    1 
ATOM   2144  C  C5    . DT  A  1 105 ? 4.074   29.027  -11.289 1.00 116.43 ? 105 DT  I C5    1 
ATOM   2145  C  C7    . DT  A  1 105 ? 3.500   27.699  -11.685 1.00 119.93 ? 105 DT  I C7    1 
ATOM   2146  C  C6    . DT  A  1 105 ? 4.947   29.146  -10.279 1.00 120.44 ? 105 DT  I C6    1 
ATOM   2147  P  P     . DT  A  1 106 ? 7.621   30.210  -4.746  1.00 128.83 ? 106 DT  I P     1 
ATOM   2148  O  OP1   . DT  A  1 106 ? 8.840   30.013  -3.931  1.00 125.80 ? 106 DT  I OP1   1 
ATOM   2149  O  OP2   . DT  A  1 106 ? 6.408   29.414  -4.453  1.00 120.76 ? 106 DT  I OP2   1 
ATOM   2150  O  "O5'" . DT  A  1 106 ? 7.219   31.760  -4.686  1.00 134.50 ? 106 DT  I "O5'" 1 
ATOM   2151  C  "C5'" . DT  A  1 106 ? 7.022   32.498  -5.890  1.00 128.84 ? 106 DT  I "C5'" 1 
ATOM   2152  C  "C4'" . DT  A  1 106 ? 5.930   33.538  -5.713  1.00 133.99 ? 106 DT  I "C4'" 1 
ATOM   2153  O  "O4'" . DT  A  1 106 ? 4.954   33.404  -6.785  1.00 133.25 ? 106 DT  I "O4'" 1 
ATOM   2154  C  "C3'" . DT  A  1 106 ? 5.133   33.419  -4.416  1.00 136.58 ? 106 DT  I "C3'" 1 
ATOM   2155  O  "O3'" . DT  A  1 106 ? 4.707   34.712  -3.987  1.00 140.06 ? 106 DT  I "O3'" 1 
ATOM   2156  C  "C2'" . DT  A  1 106 ? 3.952   32.557  -4.846  1.00 131.77 ? 106 DT  I "C2'" 1 
ATOM   2157  C  "C1'" . DT  A  1 106 ? 3.682   33.122  -6.232  1.00 129.49 ? 106 DT  I "C1'" 1 
ATOM   2158  N  N1    . DT  A  1 106 ? 2.954   32.177  -7.139  1.00 127.56 ? 106 DT  I N1    1 
ATOM   2159  C  C2    . DT  A  1 106 ? 2.468   32.638  -8.342  1.00 124.12 ? 106 DT  I C2    1 
ATOM   2160  O  O2    . DT  A  1 106 ? 2.607   33.787  -8.723  1.00 122.95 ? 106 DT  I O2    1 
ATOM   2161  N  N3    . DT  A  1 106 ? 1.812   31.697  -9.093  1.00 120.67 ? 106 DT  I N3    1 
ATOM   2162  C  C4    . DT  A  1 106 ? 1.594   30.370  -8.767  1.00 121.19 ? 106 DT  I C4    1 
ATOM   2163  O  O4    . DT  A  1 106 ? 0.991   29.602  -9.511  1.00 118.87 ? 106 DT  I O4    1 
ATOM   2164  C  C5    . DT  A  1 106 ? 2.125   29.953  -7.488  1.00 123.47 ? 106 DT  I C5    1 
ATOM   2165  C  C7    . DT  A  1 106 ? 1.952   28.536  -7.025  1.00 120.63 ? 106 DT  I C7    1 
ATOM   2166  C  C6    . DT  A  1 106 ? 2.770   30.866  -6.745  1.00 125.05 ? 106 DT  I C6    1 
ATOM   2167  P  P     . DC  A  1 107 ? 4.239   34.954  -2.468  1.00 142.49 ? 107 DC  I P     1 
ATOM   2168  O  OP1   . DC  A  1 107 ? 5.088   36.032  -1.910  1.00 129.15 ? 107 DC  I OP1   1 
ATOM   2169  O  OP2   . DC  A  1 107 ? 4.168   33.633  -1.800  1.00 125.03 ? 107 DC  I OP2   1 
ATOM   2170  O  "O5'" . DC  A  1 107 ? 2.744   35.502  -2.609  1.00 127.11 ? 107 DC  I "O5'" 1 
ATOM   2171  C  "C5'" . DC  A  1 107 ? 1.728   34.652  -3.118  1.00 122.11 ? 107 DC  I "C5'" 1 
ATOM   2172  C  "C4'" . DC  A  1 107 ? 0.648   35.455  -3.814  1.00 116.59 ? 107 DC  I "C4'" 1 
ATOM   2173  O  "O4'" . DC  A  1 107 ? 0.230   34.756  -5.014  1.00 116.06 ? 107 DC  I "O4'" 1 
ATOM   2174  C  "C3'" . DC  A  1 107 ? -0.622  35.653  -3.001  1.00 111.06 ? 107 DC  I "C3'" 1 
ATOM   2175  O  "O3'" . DC  A  1 107 ? -1.277  36.844  -3.409  1.00 109.01 ? 107 DC  I "O3'" 1 
ATOM   2176  C  "C2'" . DC  A  1 107 ? -1.429  34.418  -3.373  1.00 109.73 ? 107 DC  I "C2'" 1 
ATOM   2177  C  "C1'" . DC  A  1 107 ? -1.091  34.272  -4.853  1.00 112.41 ? 107 DC  I "C1'" 1 
ATOM   2178  N  N1    . DC  A  1 107 ? -1.139  32.864  -5.342  1.00 112.85 ? 107 DC  I N1    1 
ATOM   2179  C  C2    . DC  A  1 107 ? -2.007  32.524  -6.383  1.00 108.90 ? 107 DC  I C2    1 
ATOM   2180  O  O2    . DC  A  1 107 ? -2.723  33.402  -6.882  1.00 106.10 ? 107 DC  I O2    1 
ATOM   2181  N  N3    . DC  A  1 107 ? -2.039  31.238  -6.819  1.00 111.67 ? 107 DC  I N3    1 
ATOM   2182  C  C4    . DC  A  1 107 ? -1.251  30.321  -6.256  1.00 112.03 ? 107 DC  I C4    1 
ATOM   2183  N  N4    . DC  A  1 107 ? -1.318  29.068  -6.719  1.00 109.55 ? 107 DC  I N4    1 
ATOM   2184  C  C5    . DC  A  1 107 ? -0.359  30.648  -5.191  1.00 119.36 ? 107 DC  I C5    1 
ATOM   2185  C  C6    . DC  A  1 107 ? -0.336  31.919  -4.771  1.00 119.68 ? 107 DC  I C6    1 
ATOM   2186  P  P     . DC  A  1 108 ? -1.585  38.001  -2.339  1.00 114.19 ? 108 DC  I P     1 
ATOM   2187  O  OP1   . DC  A  1 108 ? -0.383  38.859  -2.230  1.00 110.46 ? 108 DC  I OP1   1 
ATOM   2188  O  OP2   . DC  A  1 108 ? -2.140  37.346  -1.134  1.00 117.70 ? 108 DC  I OP2   1 
ATOM   2189  O  "O5'" . DC  A  1 108 ? -2.765  38.842  -3.010  1.00 109.13 ? 108 DC  I "O5'" 1 
ATOM   2190  C  "C5'" . DC  A  1 108 ? -4.113  38.480  -2.763  1.00 106.05 ? 108 DC  I "C5'" 1 
ATOM   2191  C  "C4'" . DC  A  1 108 ? -4.908  38.434  -4.054  1.00 104.25 ? 108 DC  I "C4'" 1 
ATOM   2192  O  "O4'" . DC  A  1 108 ? -4.610  37.197  -4.762  1.00 103.08 ? 108 DC  I "O4'" 1 
ATOM   2193  C  "C3'" . DC  A  1 108 ? -6.420  38.434  -3.866  1.00 102.27 ? 108 DC  I "C3'" 1 
ATOM   2194  O  "O3'" . DC  A  1 108 ? -7.039  39.025  -4.988  1.00 98.45  ? 108 DC  I "O3'" 1 
ATOM   2195  C  "C2'" . DC  A  1 108 ? -6.721  36.948  -3.802  1.00 100.13 ? 108 DC  I "C2'" 1 
ATOM   2196  C  "C1'" . DC  A  1 108 ? -5.799  36.444  -4.897  1.00 101.06 ? 108 DC  I "C1'" 1 
ATOM   2197  N  N1    . DC  A  1 108 ? -5.475  35.000  -4.784  1.00 102.42 ? 108 DC  I N1    1 
ATOM   2198  C  C2    . DC  A  1 108 ? -5.708  34.157  -5.873  1.00 101.75 ? 108 DC  I C2    1 
ATOM   2199  O  O2    . DC  A  1 108 ? -6.170  34.635  -6.917  1.00 96.78  ? 108 DC  I O2    1 
ATOM   2200  N  N3    . DC  A  1 108 ? -5.417  32.838  -5.756  1.00 102.95 ? 108 DC  I N3    1 
ATOM   2201  C  C4    . DC  A  1 108 ? -4.920  32.364  -4.613  1.00 100.23 ? 108 DC  I C4    1 
ATOM   2202  N  N4    . DC  A  1 108 ? -4.647  31.058  -4.545  1.00 99.59  ? 108 DC  I N4    1 
ATOM   2203  C  C5    . DC  A  1 108 ? -4.682  33.208  -3.490  1.00 99.80  ? 108 DC  I C5    1 
ATOM   2204  C  C6    . DC  A  1 108 ? -4.972  34.506  -3.618  1.00 101.73 ? 108 DC  I C6    1 
ATOM   2205  P  P     . DA  A  1 109 ? -7.762  40.450  -4.857  1.00 105.80 ? 109 DA  I P     1 
ATOM   2206  O  OP1   . DA  A  1 109 ? -6.710  41.487  -4.967  1.00 102.56 ? 109 DA  I OP1   1 
ATOM   2207  O  OP2   . DA  A  1 109 ? -8.636  40.405  -3.663  1.00 101.27 ? 109 DA  I OP2   1 
ATOM   2208  O  "O5'" . DA  A  1 109 ? -8.700  40.517  -6.153  1.00 104.69 ? 109 DA  I "O5'" 1 
ATOM   2209  C  "C5'" . DA  A  1 109 ? -8.123  40.433  -7.452  1.00 101.02 ? 109 DA  I "C5'" 1 
ATOM   2210  C  "C4'" . DA  A  1 109 ? -8.966  39.564  -8.370  1.00 100.07 ? 109 DA  I "C4'" 1 
ATOM   2211  O  "O4'" . DA  A  1 109 ? -8.774  38.164  -8.033  1.00 100.32 ? 109 DA  I "O4'" 1 
ATOM   2212  C  "C3'" . DA  A  1 109 ? -10.471 39.817  -8.309  1.00 98.89  ? 109 DA  I "C3'" 1 
ATOM   2213  O  "O3'" . DA  A  1 109 ? -11.020 39.743  -9.624  1.00 98.65  ? 109 DA  I "O3'" 1 
ATOM   2214  C  "C2'" . DA  A  1 109 ? -10.974 38.689  -7.407  1.00 97.76  ? 109 DA  I "C2'" 1 
ATOM   2215  C  "C1'" . DA  A  1 109 ? -10.019 37.557  -7.752  1.00 99.20  ? 109 DA  I "C1'" 1 
ATOM   2216  N  N9    . DA  A  1 109 ? -9.827  36.610  -6.657  1.00 95.08  ? 109 DA  I N9    1 
ATOM   2217  C  C8    . DA  A  1 109 ? -9.807  36.894  -5.322  1.00 99.54  ? 109 DA  I C8    1 
ATOM   2218  N  N7    . DA  A  1 109 ? -9.610  35.845  -4.560  1.00 99.69  ? 109 DA  I N7    1 
ATOM   2219  C  C5    . DA  A  1 109 ? -9.487  34.800  -5.458  1.00 99.92  ? 109 DA  I C5    1 
ATOM   2220  C  C6    . DA  A  1 109 ? -9.262  33.419  -5.284  1.00 100.19 ? 109 DA  I C6    1 
ATOM   2221  N  N6    . DA  A  1 109 ? -9.117  32.840  -4.088  1.00 97.37  ? 109 DA  I N6    1 
ATOM   2222  N  N1    . DA  A  1 109 ? -9.197  32.653  -6.391  1.00 99.20  ? 109 DA  I N1    1 
ATOM   2223  C  C2    . DA  A  1 109 ? -9.346  33.234  -7.587  1.00 98.96  ? 109 DA  I C2    1 
ATOM   2224  N  N3    . DA  A  1 109 ? -9.557  34.518  -7.876  1.00 100.13 ? 109 DA  I N3    1 
ATOM   2225  C  C4    . DA  A  1 109 ? -9.619  35.254  -6.757  1.00 97.45  ? 109 DA  I C4    1 
ATOM   2226  P  P     . DA  A  1 110 ? -12.602 39.573  -9.855  1.00 107.64 ? 110 DA  I P     1 
ATOM   2227  O  OP1   . DA  A  1 110 ? -12.912 40.135  -11.189 1.00 109.26 ? 110 DA  I OP1   1 
ATOM   2228  O  OP2   . DA  A  1 110 ? -13.335 40.077  -8.672  1.00 105.47 ? 110 DA  I OP2   1 
ATOM   2229  O  "O5'" . DA  A  1 110 ? -12.794 37.992  -9.940  1.00 95.39  ? 110 DA  I "O5'" 1 
ATOM   2230  C  "C5'" . DA  A  1 110 ? -12.069 37.249  -10.911 1.00 89.92  ? 110 DA  I "C5'" 1 
ATOM   2231  C  "C4'" . DA  A  1 110 ? -12.604 35.834  -11.022 1.00 82.39  ? 110 DA  I "C4'" 1 
ATOM   2232  O  "O4'" . DA  A  1 110 ? -12.217 35.075  -9.849  1.00 80.50  ? 110 DA  I "O4'" 1 
ATOM   2233  C  "C3'" . DA  A  1 110 ? -14.124 35.726  -11.108 1.00 83.82  ? 110 DA  I "C3'" 1 
ATOM   2234  O  "O3'" . DA  A  1 110 ? -14.478 34.672  -11.974 1.00 79.79  ? 110 DA  I "O3'" 1 
ATOM   2235  C  "C2'" . DA  A  1 110 ? -14.524 35.417  -9.673  1.00 86.13  ? 110 DA  I "C2'" 1 
ATOM   2236  C  "C1'" . DA  A  1 110 ? -13.368 34.547  -9.223  1.00 88.20  ? 110 DA  I "C1'" 1 
ATOM   2237  N  N9    . DA  A  1 110 ? -13.166 34.579  -7.784  1.00 92.56  ? 110 DA  I N9    1 
ATOM   2238  C  C8    . DA  A  1 110 ? -13.296 35.661  -6.963  1.00 97.00  ? 110 DA  I C8    1 
ATOM   2239  N  N7    . DA  A  1 110 ? -13.055 35.400  -5.702  1.00 99.12  ? 110 DA  I N7    1 
ATOM   2240  C  C5    . DA  A  1 110 ? -12.747 34.051  -5.697  1.00 101.86 ? 110 DA  I C5    1 
ATOM   2241  C  C6    . DA  A  1 110 ? -12.396 33.164  -4.663  1.00 103.58 ? 110 DA  I C6    1 
ATOM   2242  N  N6    . DA  A  1 110 ? -12.294 33.532  -3.381  1.00 100.03 ? 110 DA  I N6    1 
ATOM   2243  N  N1    . DA  A  1 110 ? -12.150 31.879  -4.998  1.00 103.60 ? 110 DA  I N1    1 
ATOM   2244  C  C2    . DA  A  1 110 ? -12.252 31.516  -6.283  1.00 98.79  ? 110 DA  I C2    1 
ATOM   2245  N  N3    . DA  A  1 110 ? -12.575 32.258  -7.340  1.00 98.24  ? 110 DA  I N3    1 
ATOM   2246  C  C4    . DA  A  1 110 ? -12.812 33.529  -6.974  1.00 99.06  ? 110 DA  I C4    1 
ATOM   2247  P  P     . DA  A  1 111 ? -16.015 34.421  -12.374 1.00 86.13  ? 111 DA  I P     1 
ATOM   2248  O  OP1   . DA  A  1 111 ? -16.075 34.532  -13.849 1.00 76.96  ? 111 DA  I OP1   1 
ATOM   2249  O  OP2   . DA  A  1 111 ? -16.919 35.246  -11.539 1.00 80.29  ? 111 DA  I OP2   1 
ATOM   2250  O  "O5'" . DA  A  1 111 ? -16.244 32.891  -11.981 1.00 77.52  ? 111 DA  I "O5'" 1 
ATOM   2251  C  "C5'" . DA  A  1 111 ? -15.357 31.901  -12.501 1.00 80.37  ? 111 DA  I "C5'" 1 
ATOM   2252  C  "C4'" . DA  A  1 111 ? -15.482 30.601  -11.740 1.00 81.65  ? 111 DA  I "C4'" 1 
ATOM   2253  O  "O4'" . DA  A  1 111 ? -15.006 30.787  -10.382 1.00 87.85  ? 111 DA  I "O4'" 1 
ATOM   2254  C  "C3'" . DA  A  1 111 ? -16.909 30.065  -11.634 1.00 84.17  ? 111 DA  I "C3'" 1 
ATOM   2255  O  "O3'" . DA  A  1 111 ? -16.923 28.674  -11.935 1.00 75.57  ? 111 DA  I "O3'" 1 
ATOM   2256  C  "C2'" . DA  A  1 111 ? -17.289 30.351  -10.181 1.00 97.44  ? 111 DA  I "C2'" 1 
ATOM   2257  C  "C1'" . DA  A  1 111 ? -15.947 30.262  -9.476  1.00 95.71  ? 111 DA  I "C1'" 1 
ATOM   2258  N  N9    . DA  A  1 111 ? -15.895 31.048  -8.240  1.00 101.97 ? 111 DA  I N9    1 
ATOM   2259  C  C8    . DA  A  1 111 ? -16.257 32.360  -8.082  1.00 100.64 ? 111 DA  I C8    1 
ATOM   2260  N  N7    . DA  A  1 111 ? -16.113 32.807  -6.859  1.00 99.93  ? 111 DA  I N7    1 
ATOM   2261  C  C5    . DA  A  1 111 ? -15.627 31.714  -6.161  1.00 101.89 ? 111 DA  I C5    1 
ATOM   2262  C  C6    . DA  A  1 111 ? -15.268 31.535  -4.811  1.00 104.79 ? 111 DA  I C6    1 
ATOM   2263  N  N6    . DA  A  1 111 ? -15.350 32.505  -3.895  1.00 106.54 ? 111 DA  I N6    1 
ATOM   2264  N  N1    . DA  A  1 111 ? -14.816 30.319  -4.439  1.00 105.22 ? 111 DA  I N1    1 
ATOM   2265  C  C2    . DA  A  1 111 ? -14.736 29.351  -5.360  1.00 105.95 ? 111 DA  I C2    1 
ATOM   2266  N  N3    . DA  A  1 111 ? -15.045 29.400  -6.656  1.00 105.93 ? 111 DA  I N3    1 
ATOM   2267  C  C4    . DA  A  1 111 ? -15.488 30.620  -6.995  1.00 103.98 ? 111 DA  I C4    1 
ATOM   2268  P  P     . DT  A  1 112 ? -18.297 27.838  -11.956 1.00 76.21  ? 112 DT  I P     1 
ATOM   2269  O  OP1   . DT  A  1 112 ? -18.384 27.143  -13.263 1.00 68.56  ? 112 DT  I OP1   1 
ATOM   2270  O  OP2   . DT  A  1 112 ? -19.417 28.712  -11.541 1.00 85.65  ? 112 DT  I OP2   1 
ATOM   2271  O  "O5'" . DT  A  1 112 ? -18.052 26.742  -10.822 1.00 88.99  ? 112 DT  I "O5'" 1 
ATOM   2272  C  "C5'" . DT  A  1 112 ? -16.795 26.708  -10.159 1.00 90.66  ? 112 DT  I "C5'" 1 
ATOM   2273  C  "C4'" . DT  A  1 112 ? -16.770 25.648  -9.074  1.00 100.46 ? 112 DT  I "C4'" 1 
ATOM   2274  O  "O4'" . DT  A  1 112 ? -16.634 26.281  -7.778  1.00 107.48 ? 112 DT  I "O4'" 1 
ATOM   2275  C  "C3'" . DT  A  1 112 ? -18.010 24.770  -8.969  1.00 102.50 ? 112 DT  I "C3'" 1 
ATOM   2276  O  "O3'" . DT  A  1 112 ? -17.631 23.498  -8.438  1.00 113.08 ? 112 DT  I "O3'" 1 
ATOM   2277  C  "C2'" . DT  A  1 112 ? -18.884 25.561  -7.993  1.00 108.81 ? 112 DT  I "C2'" 1 
ATOM   2278  C  "C1'" . DT  A  1 112 ? -17.847 26.186  -7.056  1.00 110.92 ? 112 DT  I "C1'" 1 
ATOM   2279  N  N1    . DT  A  1 112 ? -18.212 27.562  -6.568  1.00 110.25 ? 112 DT  I N1    1 
ATOM   2280  C  C2    . DT  A  1 112 ? -17.797 27.964  -5.317  1.00 110.66 ? 112 DT  I C2    1 
ATOM   2281  O  O2    . DT  A  1 112 ? -17.147 27.255  -4.569  1.00 109.21 ? 112 DT  I O2    1 
ATOM   2282  N  N3    . DT  A  1 112 ? -18.173 29.235  -4.968  1.00 112.15 ? 112 DT  I N3    1 
ATOM   2283  C  C4    . DT  A  1 112 ? -18.906 30.129  -5.727  1.00 110.83 ? 112 DT  I C4    1 
ATOM   2284  O  O4    . DT  A  1 112 ? -19.195 31.253  -5.323  1.00 107.67 ? 112 DT  I O4    1 
ATOM   2285  C  C5    . DT  A  1 112 ? -19.309 29.649  -7.029  1.00 110.14 ? 112 DT  I C5    1 
ATOM   2286  C  C7    . DT  A  1 112 ? -20.110 30.531  -7.942  1.00 108.36 ? 112 DT  I C7    1 
ATOM   2287  C  C6    . DT  A  1 112 ? -18.945 28.404  -7.383  1.00 109.17 ? 112 DT  I C6    1 
ATOM   2288  P  P     . DA  A  1 113 ? -18.681 22.287  -8.317  1.00 105.61 ? 113 DA  I P     1 
ATOM   2289  O  OP1   . DA  A  1 113 ? -17.949 21.042  -8.640  1.00 95.61  ? 113 DA  I OP1   1 
ATOM   2290  O  OP2   . DA  A  1 113 ? -19.903 22.633  -9.076  1.00 109.51 ? 113 DA  I OP2   1 
ATOM   2291  O  "O5'" . DA  A  1 113 ? -19.050 22.268  -6.761  1.00 115.08 ? 113 DA  I "O5'" 1 
ATOM   2292  C  "C5'" . DA  A  1 113 ? -18.022 22.435  -5.784  1.00 117.15 ? 113 DA  I "C5'" 1 
ATOM   2293  C  "C4'" . DA  A  1 113 ? -18.615 22.568  -4.392  1.00 121.76 ? 113 DA  I "C4'" 1 
ATOM   2294  O  "O4'" . DA  A  1 113 ? -18.870 23.971  -4.098  1.00 118.70 ? 113 DA  I "O4'" 1 
ATOM   2295  C  "C3'" . DA  A  1 113 ? -19.947 21.842  -4.192  1.00 125.76 ? 113 DA  I "C3'" 1 
ATOM   2296  O  "O3'" . DA  A  1 113 ? -19.984 21.216  -2.909  1.00 130.60 ? 113 DA  I "O3'" 1 
ATOM   2297  C  "C2'" . DA  A  1 113 ? -20.970 22.971  -4.296  1.00 124.02 ? 113 DA  I "C2'" 1 
ATOM   2298  C  "C1'" . DA  A  1 113 ? -20.206 24.123  -3.669  1.00 124.37 ? 113 DA  I "C1'" 1 
ATOM   2299  N  N9    . DA  A  1 113 ? -20.695 25.435  -4.086  1.00 122.48 ? 113 DA  I N9    1 
ATOM   2300  C  C8    . DA  A  1 113 ? -21.072 25.813  -5.345  1.00 120.70 ? 113 DA  I C8    1 
ATOM   2301  N  N7    . DA  A  1 113 ? -21.479 27.058  -5.426  1.00 117.64 ? 113 DA  I N7    1 
ATOM   2302  C  C5    . DA  A  1 113 ? -21.365 27.529  -4.128  1.00 119.20 ? 113 DA  I C5    1 
ATOM   2303  C  C6    . DA  A  1 113 ? -21.640 28.782  -3.545  1.00 119.73 ? 113 DA  I C6    1 
ATOM   2304  N  N6    . DA  A  1 113 ? -22.108 29.827  -4.234  1.00 121.65 ? 113 DA  I N6    1 
ATOM   2305  N  N1    . DA  A  1 113 ? -21.415 28.917  -2.222  1.00 124.51 ? 113 DA  I N1    1 
ATOM   2306  C  C2    . DA  A  1 113 ? -20.950 27.867  -1.534  1.00 124.09 ? 113 DA  I C2    1 
ATOM   2307  N  N3    . DA  A  1 113 ? -20.652 26.645  -1.971  1.00 123.24 ? 113 DA  I N3    1 
ATOM   2308  C  C4    . DA  A  1 113 ? -20.885 26.540  -3.289  1.00 122.55 ? 113 DA  I C4    1 
ATOM   2309  P  P     . DC  A  1 114 ? -21.022 20.021  -2.617  1.00 140.84 ? 114 DC  I P     1 
ATOM   2310  O  OP1   . DC  A  1 114 ? -20.875 19.641  -1.194  1.00 135.60 ? 114 DC  I OP1   1 
ATOM   2311  O  OP2   . DC  A  1 114 ? -20.838 18.996  -3.670  1.00 131.86 ? 114 DC  I OP2   1 
ATOM   2312  O  "O5'" . DC  A  1 114 ? -22.459 20.696  -2.845  1.00 138.24 ? 114 DC  I "O5'" 1 
ATOM   2313  C  "C5'" . DC  A  1 114 ? -23.543 20.396  -1.975  1.00 133.42 ? 114 DC  I "C5'" 1 
ATOM   2314  C  "C4'" . DC  A  1 114 ? -23.581 21.359  -0.798  1.00 136.97 ? 114 DC  I "C4'" 1 
ATOM   2315  O  "O4'" . DC  A  1 114 ? -23.253 22.700  -1.250  1.00 130.75 ? 114 DC  I "O4'" 1 
ATOM   2316  C  "C3'" . DC  A  1 114 ? -24.934 21.457  -0.096  1.00 139.46 ? 114 DC  I "C3'" 1 
ATOM   2317  O  "O3'" . DC  A  1 114 ? -24.764 21.399  1.312   1.00 145.60 ? 114 DC  I "O3'" 1 
ATOM   2318  C  "C2'" . DC  A  1 114 ? -25.483 22.809  -0.544  1.00 134.63 ? 114 DC  I "C2'" 1 
ATOM   2319  C  "C1'" . DC  A  1 114 ? -24.215 23.615  -0.777  1.00 131.75 ? 114 DC  I "C1'" 1 
ATOM   2320  N  N1    . DC  A  1 114 ? -24.383 24.684  -1.801  1.00 132.03 ? 114 DC  I N1    1 
ATOM   2321  C  C2    . DC  A  1 114 ? -24.304 26.033  -1.426  1.00 129.28 ? 114 DC  I C2    1 
ATOM   2322  O  O2    . DC  A  1 114 ? -24.089 26.322  -0.242  1.00 124.65 ? 114 DC  I O2    1 
ATOM   2323  N  N3    . DC  A  1 114 ? -24.463 26.987  -2.378  1.00 126.67 ? 114 DC  I N3    1 
ATOM   2324  C  C4    . DC  A  1 114 ? -24.693 26.636  -3.646  1.00 125.94 ? 114 DC  I C4    1 
ATOM   2325  N  N4    . DC  A  1 114 ? -24.843 27.611  -4.549  1.00 125.78 ? 114 DC  I N4    1 
ATOM   2326  C  C5    . DC  A  1 114 ? -24.780 25.269  -4.044  1.00 127.23 ? 114 DC  I C5    1 
ATOM   2327  C  C6    . DC  A  1 114 ? -24.621 24.337  -3.099  1.00 128.95 ? 114 DC  I C6    1 
ATOM   2328  P  P     . DA  A  1 115 ? -25.970 20.884  2.239   1.00 151.66 ? 115 DA  I P     1 
ATOM   2329  O  OP1   . DA  A  1 115 ? -25.392 20.352  3.494   1.00 148.84 ? 115 DA  I OP1   1 
ATOM   2330  O  OP2   . DA  A  1 115 ? -26.833 20.022  1.399   1.00 136.67 ? 115 DA  I OP2   1 
ATOM   2331  O  "O5'" . DA  A  1 115 ? -26.797 22.212  2.564   1.00 139.60 ? 115 DA  I "O5'" 1 
ATOM   2332  C  "C5'" . DA  A  1 115 ? -26.186 23.283  3.281   1.00 137.23 ? 115 DA  I "C5'" 1 
ATOM   2333  C  "C4'" . DA  A  1 115 ? -27.199 24.378  3.563   1.00 140.46 ? 115 DA  I "C4'" 1 
ATOM   2334  O  "O4'" . DA  A  1 115 ? -27.148 25.373  2.503   1.00 142.61 ? 115 DA  I "O4'" 1 
ATOM   2335  C  "C3'" . DA  A  1 115 ? -28.650 23.905  3.620   1.00 143.21 ? 115 DA  I "C3'" 1 
ATOM   2336  O  "O3'" . DA  A  1 115 ? -29.377 24.650  4.595   1.00 145.06 ? 115 DA  I "O3'" 1 
ATOM   2337  C  "C2'" . DA  A  1 115 ? -29.148 24.193  2.209   1.00 138.42 ? 115 DA  I "C2'" 1 
ATOM   2338  C  "C1'" . DA  A  1 115 ? -28.423 25.494  1.905   1.00 139.62 ? 115 DA  I "C1'" 1 
ATOM   2339  N  N9    . DA  A  1 115 ? -28.250 25.741  0.476   1.00 134.23 ? 115 DA  I N9    1 
ATOM   2340  C  C8    . DA  A  1 115 ? -28.147 24.805  -0.514  1.00 131.79 ? 115 DA  I C8    1 
ATOM   2341  N  N7    . DA  A  1 115 ? -28.000 25.315  -1.713  1.00 128.83 ? 115 DA  I N7    1 
ATOM   2342  C  C5    . DA  A  1 115 ? -28.012 26.681  -1.495  1.00 127.59 ? 115 DA  I C5    1 
ATOM   2343  C  C6    . DA  A  1 115 ? -27.900 27.781  -2.366  1.00 128.69 ? 115 DA  I C6    1 
ATOM   2344  N  N6    . DA  A  1 115 ? -27.747 27.658  -3.688  1.00 127.89 ? 115 DA  I N6    1 
ATOM   2345  N  N1    . DA  A  1 115 ? -27.951 29.016  -1.823  1.00 130.70 ? 115 DA  I N1    1 
ATOM   2346  C  C2    . DA  A  1 115 ? -28.107 29.133  -0.498  1.00 130.32 ? 115 DA  I C2    1 
ATOM   2347  N  N3    . DA  A  1 115 ? -28.222 28.175  0.419   1.00 131.12 ? 115 DA  I N3    1 
ATOM   2348  C  C4    . DA  A  1 115 ? -28.167 26.961  -0.150  1.00 129.78 ? 115 DA  I C4    1 
ATOM   2349  P  P     . DC  A  1 116 ? -30.608 23.970  5.375   1.00 147.47 ? 116 DC  I P     1 
ATOM   2350  O  OP1   . DC  A  1 116 ? -30.351 24.099  6.826   1.00 132.91 ? 116 DC  I OP1   1 
ATOM   2351  O  OP2   . DC  A  1 116 ? -30.836 22.636  4.773   1.00 145.89 ? 116 DC  I OP2   1 
ATOM   2352  O  "O5'" . DC  A  1 116 ? -31.862 24.885  4.999   1.00 136.83 ? 116 DC  I "O5'" 1 
ATOM   2353  C  "C5'" . DC  A  1 116 ? -32.046 25.314  3.664   1.00 134.57 ? 116 DC  I "C5'" 1 
ATOM   2354  C  "C4'" . DC  A  1 116 ? -32.155 26.822  3.605   1.00 136.26 ? 116 DC  I "C4'" 1 
ATOM   2355  O  "O4'" . DC  A  1 116 ? -31.487 27.314  2.414   1.00 137.99 ? 116 DC  I "O4'" 1 
ATOM   2356  C  "C3'" . DC  A  1 116 ? -33.579 27.345  3.540   1.00 135.98 ? 116 DC  I "C3'" 1 
ATOM   2357  O  "O3'" . DC  A  1 116 ? -33.687 28.556  4.260   1.00 131.62 ? 116 DC  I "O3'" 1 
ATOM   2358  C  "C2'" . DC  A  1 116 ? -33.805 27.548  2.044   1.00 138.76 ? 116 DC  I "C2'" 1 
ATOM   2359  C  "C1'" . DC  A  1 116 ? -32.416 27.941  1.553   1.00 137.65 ? 116 DC  I "C1'" 1 
ATOM   2360  N  N1    . DC  A  1 116 ? -32.135 27.493  0.154   1.00 135.32 ? 116 DC  I N1    1 
ATOM   2361  C  C2    . DC  A  1 116 ? -31.609 28.399  -0.776  1.00 129.20 ? 116 DC  I C2    1 
ATOM   2362  O  O2    . DC  A  1 116 ? -31.381 29.564  -0.423  1.00 123.44 ? 116 DC  I O2    1 
ATOM   2363  N  N3    . DC  A  1 116 ? -31.362 27.971  -2.040  1.00 126.70 ? 116 DC  I N3    1 
ATOM   2364  C  C4    . DC  A  1 116 ? -31.620 26.706  -2.380  1.00 124.68 ? 116 DC  I C4    1 
ATOM   2365  N  N4    . DC  A  1 116 ? -31.360 26.330  -3.637  1.00 122.59 ? 116 DC  I N4    1 
ATOM   2366  C  C5    . DC  A  1 116 ? -32.157 25.771  -1.448  1.00 127.97 ? 116 DC  I C5    1 
ATOM   2367  C  C6    . DC  A  1 116 ? -32.396 26.202  -0.205  1.00 132.26 ? 116 DC  I C6    1 
ATOM   2368  P  P     . DT  A  1 117 ? -35.137 29.128  4.642   1.00 136.80 ? 117 DT  I P     1 
ATOM   2369  O  OP1   . DT  A  1 117 ? -35.045 29.740  5.986   1.00 136.86 ? 117 DT  I OP1   1 
ATOM   2370  O  OP2   . DT  A  1 117 ? -36.118 28.049  4.387   1.00 129.91 ? 117 DT  I OP2   1 
ATOM   2371  O  "O5'" . DT  A  1 117 ? -35.387 30.271  3.553   1.00 136.87 ? 117 DT  I "O5'" 1 
ATOM   2372  C  "C5'" . DT  A  1 117 ? -34.328 31.153  3.192   1.00 132.35 ? 117 DT  I "C5'" 1 
ATOM   2373  C  "C4'" . DT  A  1 117 ? -34.734 32.037  2.026   1.00 131.35 ? 117 DT  I "C4'" 1 
ATOM   2374  O  "O4'" . DT  A  1 117 ? -34.347 31.409  0.770   1.00 135.42 ? 117 DT  I "O4'" 1 
ATOM   2375  C  "C3'" . DT  A  1 117 ? -36.236 32.316  1.914   1.00 132.62 ? 117 DT  I "C3'" 1 
ATOM   2376  O  "O3'" . DT  A  1 117 ? -36.441 33.682  1.525   1.00 133.76 ? 117 DT  I "O3'" 1 
ATOM   2377  C  "C2'" . DT  A  1 117 ? -36.672 31.337  0.823   1.00 129.14 ? 117 DT  I "C2'" 1 
ATOM   2378  C  "C1'" . DT  A  1 117 ? -35.462 31.379  -0.093  1.00 131.72 ? 117 DT  I "C1'" 1 
ATOM   2379  N  N1    . DT  A  1 117 ? -35.346 30.196  -1.002  1.00 129.69 ? 117 DT  I N1    1 
ATOM   2380  C  C2    . DT  A  1 117 ? -34.948 30.387  -2.307  1.00 123.67 ? 117 DT  I C2    1 
ATOM   2381  O  O2    . DT  A  1 117 ? -34.675 31.481  -2.769  1.00 119.96 ? 117 DT  I O2    1 
ATOM   2382  N  N3    . DT  A  1 117 ? -34.875 29.242  -3.056  1.00 123.06 ? 117 DT  I N3    1 
ATOM   2383  C  C4    . DT  A  1 117 ? -35.158 27.952  -2.642  1.00 125.00 ? 117 DT  I C4    1 
ATOM   2384  O  O4    . DT  A  1 117 ? -35.063 26.986  -3.392  1.00 123.83 ? 117 DT  I O4    1 
ATOM   2385  C  C5    . DT  A  1 117 ? -35.573 27.822  -1.265  1.00 128.42 ? 117 DT  I C5    1 
ATOM   2386  C  C7    . DT  A  1 117 ? -35.908 26.472  -0.704  1.00 125.45 ? 117 DT  I C7    1 
ATOM   2387  C  C6    . DT  A  1 117 ? -35.648 28.937  -0.521  1.00 128.65 ? 117 DT  I C6    1 
ATOM   2388  P  P     . DT  A  1 118 ? -37.913 34.335  1.488   1.00 127.07 ? 118 DT  I P     1 
ATOM   2389  O  OP1   . DT  A  1 118 ? -37.910 35.492  2.408   1.00 126.74 ? 118 DT  I OP1   1 
ATOM   2390  O  OP2   . DT  A  1 118 ? -38.932 33.271  1.639   1.00 127.09 ? 118 DT  I OP2   1 
ATOM   2391  O  "O5'" . DT  A  1 118 ? -38.027 34.884  -0.005  1.00 126.14 ? 118 DT  I "O5'" 1 
ATOM   2392  C  "C5'" . DT  A  1 118 ? -37.670 34.033  -1.072  1.00 124.84 ? 118 DT  I "C5'" 1 
ATOM   2393  C  "C4'" . DT  A  1 118 ? -37.464 34.802  -2.352  1.00 114.81 ? 118 DT  I "C4'" 1 
ATOM   2394  O  "O4'" . DT  A  1 118 ? -37.009 33.890  -3.377  1.00 112.81 ? 118 DT  I "O4'" 1 
ATOM   2395  C  "C3'" . DT  A  1 118 ? -38.721 35.424  -2.918  1.00 109.75 ? 118 DT  I "C3'" 1 
ATOM   2396  O  "O3'" . DT  A  1 118 ? -38.376 36.512  -3.761  1.00 102.80 ? 118 DT  I "O3'" 1 
ATOM   2397  C  "C2'" . DT  A  1 118 ? -39.333 34.260  -3.698  1.00 109.21 ? 118 DT  I "C2'" 1 
ATOM   2398  C  "C1'" . DT  A  1 118 ? -38.099 33.501  -4.194  1.00 110.23 ? 118 DT  I "C1'" 1 
ATOM   2399  N  N1    . DT  A  1 118 ? -38.242 32.008  -4.127  1.00 114.45 ? 118 DT  I N1    1 
ATOM   2400  C  C2    . DT  A  1 118 ? -38.071 31.266  -5.271  1.00 117.02 ? 118 DT  I C2    1 
ATOM   2401  O  O2    . DT  A  1 118 ? -37.804 31.760  -6.352  1.00 116.38 ? 118 DT  I O2    1 
ATOM   2402  N  N3    . DT  A  1 118 ? -38.221 29.913  -5.105  1.00 116.80 ? 118 DT  I N3    1 
ATOM   2403  C  C4    . DT  A  1 118 ? -38.521 29.242  -3.934  1.00 115.25 ? 118 DT  I C4    1 
ATOM   2404  O  O4    . DT  A  1 118 ? -38.636 28.021  -3.887  1.00 113.66 ? 118 DT  I O4    1 
ATOM   2405  C  C5    . DT  A  1 118 ? -38.689 30.079  -2.771  1.00 119.94 ? 118 DT  I C5    1 
ATOM   2406  C  C7    . DT  A  1 118 ? -39.018 29.466  -1.442  1.00 117.85 ? 118 DT  I C7    1 
ATOM   2407  C  C6    . DT  A  1 118 ? -38.545 31.405  -2.923  1.00 119.80 ? 118 DT  I C6    1 
ATOM   2408  P  P     . DT  A  1 119 ? -39.516 37.369  -4.500  1.00 97.20  ? 119 DT  I P     1 
ATOM   2409  O  OP1   . DT  A  1 119 ? -39.102 38.790  -4.463  1.00 90.58  ? 119 DT  I OP1   1 
ATOM   2410  O  OP2   . DT  A  1 119 ? -40.838 36.965  -3.971  1.00 95.18  ? 119 DT  I OP2   1 
ATOM   2411  O  "O5'" . DT  A  1 119 ? -39.439 36.854  -6.005  1.00 107.99 ? 119 DT  I "O5'" 1 
ATOM   2412  C  "C5'" . DT  A  1 119 ? -38.187 36.457  -6.552  1.00 106.55 ? 119 DT  I "C5'" 1 
ATOM   2413  C  "C4'" . DT  A  1 119 ? -38.371 35.869  -7.937  1.00 101.87 ? 119 DT  I "C4'" 1 
ATOM   2414  O  "O4'" . DT  A  1 119 ? -38.598 34.438  -7.839  1.00 100.76 ? 119 DT  I "O4'" 1 
ATOM   2415  C  "C3'" . DT  A  1 119 ? -39.551 36.429  -8.723  1.00 96.49  ? 119 DT  I "C3'" 1 
ATOM   2416  O  "O3'" . DT  A  1 119 ? -39.206 36.507  -10.078 1.00 97.94  ? 119 DT  I "O3'" 1 
ATOM   2417  C  "C2'" . DT  A  1 119 ? -40.637 35.384  -8.490  1.00 99.50  ? 119 DT  I "C2'" 1 
ATOM   2418  C  "C1'" . DT  A  1 119 ? -39.818 34.104  -8.461  1.00 100.23 ? 119 DT  I "C1'" 1 
ATOM   2419  N  N1    . DT  A  1 119 ? -40.450 33.017  -7.678  1.00 107.12 ? 119 DT  I N1    1 
ATOM   2420  C  C2    . DT  A  1 119 ? -40.291 31.713  -8.086  1.00 113.32 ? 119 DT  I C2    1 
ATOM   2421  O  O2    . DT  A  1 119 ? -39.650 31.396  -9.073  1.00 112.02 ? 119 DT  I O2    1 
ATOM   2422  N  N3    . DT  A  1 119 ? -40.912 30.786  -7.291  1.00 114.85 ? 119 DT  I N3    1 
ATOM   2423  C  C4    . DT  A  1 119 ? -41.659 31.028  -6.153  1.00 111.51 ? 119 DT  I C4    1 
ATOM   2424  O  O4    . DT  A  1 119 ? -42.178 30.126  -5.505  1.00 108.43 ? 119 DT  I O4    1 
ATOM   2425  C  C5    . DT  A  1 119 ? -41.785 32.418  -5.782  1.00 112.74 ? 119 DT  I C5    1 
ATOM   2426  C  C7    . DT  A  1 119 ? -42.574 32.807  -4.566  1.00 116.24 ? 119 DT  I C7    1 
ATOM   2427  C  C6    . DT  A  1 119 ? -41.182 33.334  -6.554  1.00 108.93 ? 119 DT  I C6    1 
ATOM   2428  P  P     . DT  A  1 120 ? -39.947 37.535  -11.060 1.00 94.16  ? 120 DT  I P     1 
ATOM   2429  O  OP1   . DT  A  1 120 ? -39.265 38.842  -10.929 1.00 92.98  ? 120 DT  I OP1   1 
ATOM   2430  O  OP2   . DT  A  1 120 ? -41.409 37.427  -10.852 1.00 92.75  ? 120 DT  I OP2   1 
ATOM   2431  O  "O5'" . DT  A  1 120 ? -39.612 36.932  -12.493 1.00 98.54  ? 120 DT  I "O5'" 1 
ATOM   2432  C  "C5'" . DT  A  1 120 ? -38.438 36.154  -12.649 1.00 95.26  ? 120 DT  I "C5'" 1 
ATOM   2433  C  "C4'" . DT  A  1 120 ? -38.757 34.800  -13.252 1.00 98.89  ? 120 DT  I "C4'" 1 
ATOM   2434  O  "O4'" . DT  A  1 120 ? -39.408 33.943  -12.275 1.00 97.45  ? 120 DT  I "O4'" 1 
ATOM   2435  C  "C3'" . DT  A  1 120 ? -39.688 34.835  -14.468 1.00 102.92 ? 120 DT  I "C3'" 1 
ATOM   2436  O  "O3'" . DT  A  1 120 ? -39.094 34.114  -15.518 1.00 105.37 ? 120 DT  I "O3'" 1 
ATOM   2437  C  "C2'" . DT  A  1 120 ? -40.956 34.137  -13.967 1.00 99.00  ? 120 DT  I "C2'" 1 
ATOM   2438  C  "C1'" . DT  A  1 120 ? -40.364 33.176  -12.958 1.00 100.15 ? 120 DT  I "C1'" 1 
ATOM   2439  N  N1    . DT  A  1 120 ? -41.353 32.616  -11.982 1.00 111.51 ? 120 DT  I N1    1 
ATOM   2440  C  C2    . DT  A  1 120 ? -41.489 31.248  -11.877 1.00 110.06 ? 120 DT  I C2    1 
ATOM   2441  O  O2    . DT  A  1 120 ? -40.839 30.460  -12.540 1.00 109.81 ? 120 DT  I O2    1 
ATOM   2442  N  N3    . DT  A  1 120 ? -42.416 30.832  -10.960 1.00 109.17 ? 120 DT  I N3    1 
ATOM   2443  C  C4    . DT  A  1 120 ? -43.208 31.627  -10.153 1.00 114.81 ? 120 DT  I C4    1 
ATOM   2444  O  O4    . DT  A  1 120 ? -44.015 31.157  -9.357  1.00 119.51 ? 120 DT  I O4    1 
ATOM   2445  C  C5    . DT  A  1 120 ? -43.021 33.051  -10.313 1.00 114.35 ? 120 DT  I C5    1 
ATOM   2446  C  C7    . DT  A  1 120 ? -43.828 34.013  -9.490  1.00 111.38 ? 120 DT  I C7    1 
ATOM   2447  C  C6    . DT  A  1 120 ? -42.114 33.473  -11.211 1.00 111.60 ? 120 DT  I C6    1 
ATOM   2448  P  P     . DG  A  1 121 ? -39.287 34.576  -17.041 1.00 99.22  ? 121 DG  I P     1 
ATOM   2449  O  OP1   . DG  A  1 121 ? -38.002 35.171  -17.481 1.00 72.55  ? 121 DG  I OP1   1 
ATOM   2450  O  OP2   . DG  A  1 121 ? -40.538 35.364  -17.127 1.00 97.41  ? 121 DG  I OP2   1 
ATOM   2451  O  "O5'" . DG  A  1 121 ? -39.522 33.191  -17.804 1.00 88.54  ? 121 DG  I "O5'" 1 
ATOM   2452  C  "C5'" . DG  A  1 121 ? -38.669 32.087  -17.523 1.00 85.84  ? 121 DG  I "C5'" 1 
ATOM   2453  C  "C4'" . DG  A  1 121 ? -39.385 30.759  -17.709 1.00 82.95  ? 121 DG  I "C4'" 1 
ATOM   2454  O  "O4'" . DG  A  1 121 ? -40.251 30.500  -16.576 1.00 92.15  ? 121 DG  I "O4'" 1 
ATOM   2455  C  "C3'" . DG  A  1 121 ? -40.271 30.644  -18.944 1.00 74.17  ? 121 DG  I "C3'" 1 
ATOM   2456  O  "O3'" . DG  A  1 121 ? -40.210 29.314  -19.415 1.00 74.18  ? 121 DG  I "O3'" 1 
ATOM   2457  C  "C2'" . DG  A  1 121 ? -41.652 30.970  -18.384 1.00 83.47  ? 121 DG  I "C2'" 1 
ATOM   2458  C  "C1'" . DG  A  1 121 ? -41.572 30.293  -17.030 1.00 95.64  ? 121 DG  I "C1'" 1 
ATOM   2459  N  N9    . DG  A  1 121 ? -42.479 30.844  -16.034 1.00 106.91 ? 121 DG  I N9    1 
ATOM   2460  C  C8    . DG  A  1 121 ? -42.812 32.163  -15.852 1.00 108.59 ? 121 DG  I C8    1 
ATOM   2461  N  N7    . DG  A  1 121 ? -43.636 32.356  -14.860 1.00 111.98 ? 121 DG  I N7    1 
ATOM   2462  C  C5    . DG  A  1 121 ? -43.858 31.083  -14.351 1.00 113.77 ? 121 DG  I C5    1 
ATOM   2463  C  C6    . DG  A  1 121 ? -44.663 30.661  -13.267 1.00 119.43 ? 121 DG  I C6    1 
ATOM   2464  O  O6    . DG  A  1 121 ? -45.370 31.352  -12.521 1.00 121.86 ? 121 DG  I O6    1 
ATOM   2465  N  N1    . DG  A  1 121 ? -44.606 29.279  -13.091 1.00 119.20 ? 121 DG  I N1    1 
ATOM   2466  C  C2    . DG  A  1 121 ? -43.859 28.419  -13.863 1.00 119.43 ? 121 DG  I C2    1 
ATOM   2467  N  N2    . DG  A  1 121 ? -43.926 27.118  -13.544 1.00 124.63 ? 121 DG  I N2    1 
ATOM   2468  N  N3    . DG  A  1 121 ? -43.099 28.804  -14.877 1.00 116.40 ? 121 DG  I N3    1 
ATOM   2469  C  C4    . DG  A  1 121 ? -43.148 30.144  -15.062 1.00 112.51 ? 121 DG  I C4    1 
ATOM   2470  P  P     . DG  A  1 122 ? -40.811 28.907  -20.845 1.00 74.44  ? 122 DG  I P     1 
ATOM   2471  O  OP1   . DG  A  1 122 ? -39.654 28.599  -21.714 1.00 72.79  ? 122 DG  I OP1   1 
ATOM   2472  O  OP2   . DG  A  1 122 ? -41.812 29.908  -21.272 1.00 80.38  ? 122 DG  I OP2   1 
ATOM   2473  O  "O5'" . DG  A  1 122 ? -41.595 27.553  -20.532 1.00 84.63  ? 122 DG  I "O5'" 1 
ATOM   2474  C  "C5'" . DG  A  1 122 ? -42.212 27.385  -19.265 1.00 94.11  ? 122 DG  I "C5'" 1 
ATOM   2475  C  "C4'" . DG  A  1 122 ? -42.905 26.042  -19.167 1.00 98.53  ? 122 DG  I "C4'" 1 
ATOM   2476  O  "O4'" . DG  A  1 122 ? -43.780 26.055  -18.023 1.00 100.73 ? 122 DG  I "O4'" 1 
ATOM   2477  C  "C3'" . DG  A  1 122 ? -43.820 25.712  -20.328 1.00 99.20  ? 122 DG  I "C3'" 1 
ATOM   2478  O  "O3'" . DG  A  1 122 ? -44.069 24.314  -20.362 1.00 99.39  ? 122 DG  I "O3'" 1 
ATOM   2479  C  "C2'" . DG  A  1 122 ? -45.075 26.495  -19.965 1.00 107.34 ? 122 DG  I "C2'" 1 
ATOM   2480  C  "C1'" . DG  A  1 122 ? -45.091 26.395  -18.439 1.00 108.83 ? 122 DG  I "C1'" 1 
ATOM   2481  N  N9    . DG  A  1 122 ? -45.472 27.640  -17.787 1.00 113.92 ? 122 DG  I N9    1 
ATOM   2482  C  C8    . DG  A  1 122 ? -45.252 28.917  -18.246 1.00 111.88 ? 122 DG  I C8    1 
ATOM   2483  N  N7    . DG  A  1 122 ? -45.711 29.840  -17.448 1.00 113.68 ? 122 DG  I N7    1 
ATOM   2484  C  C5    . DG  A  1 122 ? -46.271 29.128  -16.394 1.00 120.97 ? 122 DG  I C5    1 
ATOM   2485  C  C6    . DG  A  1 122 ? -46.923 29.590  -15.228 1.00 126.47 ? 122 DG  I C6    1 
ATOM   2486  O  O6    . DG  A  1 122 ? -47.138 30.760  -14.884 1.00 125.24 ? 122 DG  I O6    1 
ATOM   2487  N  N1    . DG  A  1 122 ? -47.339 28.534  -14.417 1.00 129.60 ? 122 DG  I N1    1 
ATOM   2488  C  C2    . DG  A  1 122 ? -47.151 27.201  -14.702 1.00 125.70 ? 122 DG  I C2    1 
ATOM   2489  N  N2    . DG  A  1 122 ? -47.623 26.325  -13.802 1.00 125.71 ? 122 DG  I N2    1 
ATOM   2490  N  N3    . DG  A  1 122 ? -46.544 26.757  -15.793 1.00 124.91 ? 122 DG  I N3    1 
ATOM   2491  C  C4    . DG  A  1 122 ? -46.132 27.773  -16.590 1.00 121.17 ? 122 DG  I C4    1 
ATOM   2492  P  P     . DT  A  1 123 ? -45.058 23.687  -21.463 1.00 102.55 ? 123 DT  I P     1 
ATOM   2493  O  OP1   . DT  A  1 123 ? -44.490 22.382  -21.867 1.00 97.45  ? 123 DT  I OP1   1 
ATOM   2494  O  OP2   . DT  A  1 123 ? -45.328 24.716  -22.493 1.00 100.57 ? 123 DT  I OP2   1 
ATOM   2495  O  "O5'" . DT  A  1 123 ? -46.416 23.438  -20.652 1.00 118.34 ? 123 DT  I "O5'" 1 
ATOM   2496  C  "C5'" . DT  A  1 123 ? -46.389 22.720  -19.416 1.00 118.41 ? 123 DT  I "C5'" 1 
ATOM   2497  C  "C4'" . DT  A  1 123 ? -47.788 22.579  -18.836 1.00 126.12 ? 123 DT  I "C4'" 1 
ATOM   2498  O  "O4'" . DT  A  1 123 ? -48.169 23.813  -18.175 1.00 126.29 ? 123 DT  I "O4'" 1 
ATOM   2499  C  "C3'" . DT  A  1 123 ? -48.885 22.279  -19.858 1.00 131.23 ? 123 DT  I "C3'" 1 
ATOM   2500  O  "O3'" . DT  A  1 123 ? -49.794 21.313  -19.337 1.00 141.61 ? 123 DT  I "O3'" 1 
ATOM   2501  C  "C2'" . DT  A  1 123 ? -49.558 23.634  -20.064 1.00 131.23 ? 123 DT  I "C2'" 1 
ATOM   2502  C  "C1'" . DT  A  1 123 ? -49.389 24.290  -18.700 1.00 134.18 ? 123 DT  I "C1'" 1 
ATOM   2503  N  N1    . DT  A  1 123 ? -49.318 25.779  -18.770 1.00 132.74 ? 123 DT  I N1    1 
ATOM   2504  C  C2    . DT  A  1 123 ? -49.739 26.530  -17.694 1.00 130.45 ? 123 DT  I C2    1 
ATOM   2505  O  O2    . DT  A  1 123 ? -50.173 26.043  -16.665 1.00 129.74 ? 123 DT  I O2    1 
ATOM   2506  N  N3    . DT  A  1 123 ? -49.632 27.885  -17.867 1.00 129.49 ? 123 DT  I N3    1 
ATOM   2507  C  C4    . DT  A  1 123 ? -49.157 28.551  -18.984 1.00 127.42 ? 123 DT  I C4    1 
ATOM   2508  O  O4    . DT  A  1 123 ? -49.100 29.775  -19.043 1.00 122.65 ? 123 DT  I O4    1 
ATOM   2509  C  C5    . DT  A  1 123 ? -48.735 27.704  -20.074 1.00 128.87 ? 123 DT  I C5    1 
ATOM   2510  C  C7    . DT  A  1 123 ? -48.202 28.311  -21.338 1.00 133.91 ? 123 DT  I C7    1 
ATOM   2511  C  C6    . DT  A  1 123 ? -48.835 26.376  -19.916 1.00 125.71 ? 123 DT  I C6    1 
ATOM   2512  P  P     . DA  A  1 124 ? -50.756 20.491  -20.330 1.00 146.47 ? 124 DA  I P     1 
ATOM   2513  O  OP1   . DA  A  1 124 ? -50.768 19.081  -19.878 1.00 131.95 ? 124 DA  I OP1   1 
ATOM   2514  O  OP2   . DA  A  1 124 ? -50.349 20.814  -21.716 1.00 136.21 ? 124 DA  I OP2   1 
ATOM   2515  O  "O5'" . DA  A  1 124 ? -52.202 21.136  -20.085 1.00 147.77 ? 124 DA  I "O5'" 1 
ATOM   2516  C  "C5'" . DA  A  1 124 ? -52.868 20.936  -18.843 1.00 147.52 ? 124 DA  I "C5'" 1 
ATOM   2517  C  "C4'" . DA  A  1 124 ? -54.090 21.832  -18.722 1.00 149.43 ? 124 DA  I "C4'" 1 
ATOM   2518  O  "O4'" . DA  A  1 124 ? -53.679 23.228  -18.724 1.00 146.07 ? 124 DA  I "O4'" 1 
ATOM   2519  C  "C3'" . DA  A  1 124 ? -55.120 21.700  -19.852 1.00 154.65 ? 124 DA  I "C3'" 1 
ATOM   2520  O  "O3'" . DA  A  1 124 ? -56.439 21.792  -19.309 1.00 162.00 ? 124 DA  I "O3'" 1 
ATOM   2521  C  "C2'" . DA  A  1 124 ? -54.802 22.909  -20.722 1.00 150.05 ? 124 DA  I "C2'" 1 
ATOM   2522  C  "C1'" . DA  A  1 124 ? -54.477 23.926  -19.649 1.00 149.77 ? 124 DA  I "C1'" 1 
ATOM   2523  N  N9    . DA  A  1 124 ? -53.747 25.089  -20.136 1.00 146.20 ? 124 DA  I N9    1 
ATOM   2524  C  C8    . DA  A  1 124 ? -53.010 25.181  -21.283 1.00 146.10 ? 124 DA  I C8    1 
ATOM   2525  N  N7    . DA  A  1 124 ? -52.470 26.362  -21.470 1.00 142.99 ? 124 DA  I N7    1 
ATOM   2526  C  C5    . DA  A  1 124 ? -52.885 27.095  -20.369 1.00 143.49 ? 124 DA  I C5    1 
ATOM   2527  C  C6    . DA  A  1 124 ? -52.650 28.426  -19.969 1.00 141.94 ? 124 DA  I C6    1 
ATOM   2528  N  N6    . DA  A  1 124 ? -51.905 29.285  -20.674 1.00 139.46 ? 124 DA  I N6    1 
ATOM   2529  N  N1    . DA  A  1 124 ? -53.214 28.841  -18.814 1.00 141.10 ? 124 DA  I N1    1 
ATOM   2530  C  C2    . DA  A  1 124 ? -53.959 27.978  -18.112 1.00 140.95 ? 124 DA  I C2    1 
ATOM   2531  N  N3    . DA  A  1 124 ? -54.249 26.707  -18.385 1.00 143.96 ? 124 DA  I N3    1 
ATOM   2532  C  C4    . DA  A  1 124 ? -53.676 26.325  -19.538 1.00 144.90 ? 124 DA  I C4    1 
ATOM   2533  P  P     . DG  A  1 125 ? -57.729 21.402  -20.190 1.00 163.80 ? 125 DG  I P     1 
ATOM   2534  O  OP1   . DG  A  1 125 ? -57.989 19.963  -19.970 1.00 160.32 ? 125 DG  I OP1   1 
ATOM   2535  O  OP2   . DG  A  1 125 ? -57.558 21.913  -21.567 1.00 160.25 ? 125 DG  I OP2   1 
ATOM   2536  O  "O5'" . DG  A  1 125 ? -58.913 22.243  -19.519 1.00 156.11 ? 125 DG  I "O5'" 1 
ATOM   2537  C  "C5'" . DG  A  1 125 ? -59.739 23.079  -20.324 1.00 159.82 ? 125 DG  I "C5'" 1 
ATOM   2538  C  "C4'" . DG  A  1 125 ? -59.692 24.517  -19.836 1.00 164.37 ? 125 DG  I "C4'" 1 
ATOM   2539  O  "O4'" . DG  A  1 125 ? -58.360 25.062  -20.046 1.00 159.11 ? 125 DG  I "O4'" 1 
ATOM   2540  C  "C3'" . DG  A  1 125 ? -60.659 25.475  -20.546 1.00 168.68 ? 125 DG  I "C3'" 1 
ATOM   2541  O  "O3'" . DG  A  1 125 ? -61.312 26.312  -19.592 1.00 174.46 ? 125 DG  I "O3'" 1 
ATOM   2542  C  "C2'" . DG  A  1 125 ? -59.741 26.285  -21.458 1.00 163.36 ? 125 DG  I "C2'" 1 
ATOM   2543  C  "C1'" . DG  A  1 125 ? -58.480 26.343  -20.617 1.00 159.10 ? 125 DG  I "C1'" 1 
ATOM   2544  N  N9    . DG  A  1 125 ? -57.277 26.640  -21.389 1.00 153.87 ? 125 DG  I N9    1 
ATOM   2545  C  C8    . DG  A  1 125 ? -56.559 25.773  -22.179 1.00 152.28 ? 125 DG  I C8    1 
ATOM   2546  N  N7    . DG  A  1 125 ? -55.528 26.329  -22.755 1.00 147.59 ? 125 DG  I N7    1 
ATOM   2547  C  C5    . DG  A  1 125 ? -55.566 27.649  -22.322 1.00 148.75 ? 125 DG  I C5    1 
ATOM   2548  C  C6    . DG  A  1 125 ? -54.703 28.732  -22.616 1.00 148.51 ? 125 DG  I C6    1 
ATOM   2549  O  O6    . DG  A  1 125 ? -53.698 28.738  -23.342 1.00 147.16 ? 125 DG  I O6    1 
ATOM   2550  N  N1    . DG  A  1 125 ? -55.101 29.901  -21.969 1.00 145.81 ? 125 DG  I N1    1 
ATOM   2551  C  C2    . DG  A  1 125 ? -56.196 30.008  -21.143 1.00 146.76 ? 125 DG  I C2    1 
ATOM   2552  N  N2    . DG  A  1 125 ? -56.422 31.217  -20.609 1.00 146.00 ? 125 DG  I N2    1 
ATOM   2553  N  N3    . DG  A  1 125 ? -57.013 29.001  -20.860 1.00 148.93 ? 125 DG  I N3    1 
ATOM   2554  C  C4    . DG  A  1 125 ? -56.638 27.856  -21.482 1.00 150.23 ? 125 DG  I C4    1 
ATOM   2555  P  P     . DA  A  1 126 ? -62.512 27.280  -20.050 1.00 176.69 ? 126 DA  I P     1 
ATOM   2556  O  OP1   . DA  A  1 126 ? -63.437 27.418  -18.904 1.00 174.45 ? 126 DA  I OP1   1 
ATOM   2557  O  OP2   . DA  A  1 126 ? -63.018 26.785  -21.350 1.00 173.16 ? 126 DA  I OP2   1 
ATOM   2558  O  "O5'" . DA  A  1 126 ? -61.801 28.693  -20.305 1.00 163.80 ? 126 DA  I "O5'" 1 
ATOM   2559  C  "C5'" . DA  A  1 126 ? -61.390 29.496  -19.201 1.00 159.21 ? 126 DA  I "C5'" 1 
ATOM   2560  C  "C4'" . DA  A  1 126 ? -60.985 30.889  -19.660 1.00 160.11 ? 126 DA  I "C4'" 1 
ATOM   2561  O  "O4'" . DA  A  1 126 ? -59.861 30.791  -20.575 1.00 156.94 ? 126 DA  I "O4'" 1 
ATOM   2562  C  "C3'" . DA  A  1 126 ? -62.069 31.671  -20.405 1.00 163.05 ? 126 DA  I "C3'" 1 
ATOM   2563  O  "O3'" . DA  A  1 126 ? -62.013 33.050  -20.046 1.00 165.27 ? 126 DA  I "O3'" 1 
ATOM   2564  C  "C2'" . DA  A  1 126 ? -61.694 31.463  -21.868 1.00 158.67 ? 126 DA  I "C2'" 1 
ATOM   2565  C  "C1'" . DA  A  1 126 ? -60.177 31.444  -21.786 1.00 154.66 ? 126 DA  I "C1'" 1 
ATOM   2566  N  N9    . DA  A  1 126 ? -59.546 30.719  -22.884 1.00 152.76 ? 126 DA  I N9    1 
ATOM   2567  C  C8    . DA  A  1 126 ? -59.711 29.399  -23.203 1.00 152.48 ? 126 DA  I C8    1 
ATOM   2568  N  N7    . DA  A  1 126 ? -59.017 29.016  -24.249 1.00 148.21 ? 126 DA  I N7    1 
ATOM   2569  C  C5    . DA  A  1 126 ? -58.351 30.165  -24.643 1.00 147.91 ? 126 DA  I C5    1 
ATOM   2570  C  C6    . DA  A  1 126 ? -57.450 30.427  -25.695 1.00 142.29 ? 126 DA  I C6    1 
ATOM   2571  N  N6    . DA  A  1 126 ? -57.056 29.500  -26.573 1.00 139.68 ? 126 DA  I N6    1 
ATOM   2572  N  N1    . DA  A  1 126 ? -56.970 31.683  -25.808 1.00 140.77 ? 126 DA  I N1    1 
ATOM   2573  C  C2    . DA  A  1 126 ? -57.369 32.609  -24.927 1.00 142.74 ? 126 DA  I C2    1 
ATOM   2574  N  N3    . DA  A  1 126 ? -58.207 32.483  -23.900 1.00 145.31 ? 126 DA  I N3    1 
ATOM   2575  C  C4    . DA  A  1 126 ? -58.667 31.224  -23.813 1.00 149.13 ? 126 DA  I C4    1 
ATOM   2576  P  P     . DA  A  1 127 ? -63.065 34.093  -20.671 1.00 160.44 ? 127 DA  I P     1 
ATOM   2577  O  OP1   . DA  A  1 127 ? -63.257 35.176  -19.681 1.00 160.41 ? 127 DA  I OP1   1 
ATOM   2578  O  OP2   . DA  A  1 127 ? -64.231 33.326  -21.164 1.00 151.89 ? 127 DA  I OP2   1 
ATOM   2579  O  "O5'" . DA  A  1 127 ? -62.304 34.698  -21.941 1.00 156.70 ? 127 DA  I "O5'" 1 
ATOM   2580  C  "C5'" . DA  A  1 127 ? -61.275 35.664  -21.760 1.00 152.61 ? 127 DA  I "C5'" 1 
ATOM   2581  C  "C4'" . DA  A  1 127 ? -61.037 36.447  -23.041 1.00 150.50 ? 127 DA  I "C4'" 1 
ATOM   2582  O  "O4'" . DA  A  1 127 ? -60.305 35.623  -23.986 1.00 149.85 ? 127 DA  I "O4'" 1 
ATOM   2583  C  "C3'" . DA  A  1 127 ? -62.304 36.909  -23.763 1.00 150.86 ? 127 DA  I "C3'" 1 
ATOM   2584  O  "O3'" . DA  A  1 127 ? -62.133 38.236  -24.255 1.00 153.38 ? 127 DA  I "O3'" 1 
ATOM   2585  C  "C2'" . DA  A  1 127 ? -62.448 35.899  -24.900 1.00 148.13 ? 127 DA  I "C2'" 1 
ATOM   2586  C  "C1'" . DA  A  1 127 ? -60.997 35.572  -25.216 1.00 147.27 ? 127 DA  I "C1'" 1 
ATOM   2587  N  N9    . DA  A  1 127 ? -60.822 34.242  -25.788 1.00 147.45 ? 127 DA  I N9    1 
ATOM   2588  C  C8    . DA  A  1 127 ? -61.496 33.103  -25.444 1.00 149.36 ? 127 DA  I C8    1 
ATOM   2589  N  N7    . DA  A  1 127 ? -61.133 32.044  -26.128 1.00 147.18 ? 127 DA  I N7    1 
ATOM   2590  C  C5    . DA  A  1 127 ? -60.152 32.521  -26.981 1.00 146.72 ? 127 DA  I C5    1 
ATOM   2591  C  C6    . DA  A  1 127 ? -59.366 31.892  -27.967 1.00 144.04 ? 127 DA  I C6    1 
ATOM   2592  N  N6    . DA  A  1 127 ? -59.457 30.589  -28.261 1.00 138.09 ? 127 DA  I N6    1 
ATOM   2593  N  N1    . DA  A  1 127 ? -58.477 32.657  -28.639 1.00 138.37 ? 127 DA  I N1    1 
ATOM   2594  C  C2    . DA  A  1 127 ? -58.390 33.961  -28.340 1.00 137.23 ? 127 DA  I C2    1 
ATOM   2595  N  N3    . DA  A  1 127 ? -59.076 34.662  -27.436 1.00 138.15 ? 127 DA  I N3    1 
ATOM   2596  C  C4    . DA  A  1 127 ? -59.948 33.876  -26.785 1.00 143.94 ? 127 DA  I C4    1 
ATOM   2597  P  P     . DT  A  1 128 ? -63.294 38.948  -25.110 1.00 157.71 ? 128 DT  I P     1 
ATOM   2598  O  OP1   . DT  A  1 128 ? -63.215 40.401  -24.840 1.00 151.36 ? 128 DT  I OP1   1 
ATOM   2599  O  OP2   . DT  A  1 128 ? -64.567 38.228  -24.874 1.00 154.69 ? 128 DT  I OP2   1 
ATOM   2600  O  "O5'" . DT  A  1 128 ? -62.859 38.692  -26.627 1.00 148.93 ? 128 DT  I "O5'" 1 
ATOM   2601  C  "C5'" . DT  A  1 128 ? -62.647 39.792  -27.502 1.00 144.47 ? 128 DT  I "C5'" 1 
ATOM   2602  C  "C4'" . DT  A  1 128 ? -61.234 39.776  -28.058 1.00 142.69 ? 128 DT  I "C4'" 1 
ATOM   2603  O  "O4'" . DT  A  1 128 ? -60.756 38.404  -28.132 1.00 139.20 ? 128 DT  I "O4'" 1 
ATOM   2604  C  "C3'" . DT  A  1 128 ? -61.097 40.334  -29.467 1.00 138.14 ? 128 DT  I "C3'" 1 
ATOM   2605  O  "O3'" . DT  A  1 128 ? -59.800 40.916  -29.640 1.00 129.23 ? 128 DT  I "O3'" 1 
ATOM   2606  C  "C2'" . DT  A  1 128 ? -61.281 39.083  -30.323 1.00 126.46 ? 128 DT  I "C2'" 1 
ATOM   2607  C  "C1'" . DT  A  1 128 ? -60.555 38.037  -29.484 1.00 132.87 ? 128 DT  I "C1'" 1 
ATOM   2608  N  N1    . DT  A  1 128 ? -61.068 36.644  -29.680 1.00 136.83 ? 128 DT  I N1    1 
ATOM   2609  C  C2    . DT  A  1 128 ? -60.481 35.837  -30.629 1.00 133.14 ? 128 DT  I C2    1 
ATOM   2610  O  O2    . DT  A  1 128 ? -59.555 36.197  -31.334 1.00 130.25 ? 128 DT  I O2    1 
ATOM   2611  N  N3    . DT  A  1 128 ? -61.023 34.582  -30.728 1.00 134.37 ? 128 DT  I N3    1 
ATOM   2612  C  C4    . DT  A  1 128 ? -62.068 34.061  -29.988 1.00 138.99 ? 128 DT  I C4    1 
ATOM   2613  O  O4    . DT  A  1 128 ? -62.482 32.916  -30.152 1.00 140.93 ? 128 DT  I O4    1 
ATOM   2614  C  C5    . DT  A  1 128 ? -62.638 34.956  -29.009 1.00 143.51 ? 128 DT  I C5    1 
ATOM   2615  C  C7    . DT  A  1 128 ? -63.780 34.502  -28.146 1.00 138.13 ? 128 DT  I C7    1 
ATOM   2616  C  C6    . DT  A  1 128 ? -62.116 36.190  -28.903 1.00 142.79 ? 128 DT  I C6    1 
ATOM   2617  P  P     . DC  A  1 129 ? -59.604 42.220  -30.565 1.00 124.33 ? 129 DC  I P     1 
ATOM   2618  O  OP1   . DC  A  1 129 ? -58.954 43.269  -29.749 1.00 126.26 ? 129 DC  I OP1   1 
ATOM   2619  O  OP2   . DC  A  1 129 ? -60.891 42.496  -31.241 1.00 122.34 ? 129 DC  I OP2   1 
ATOM   2620  O  "O5'" . DC  A  1 129 ? -58.573 41.729  -31.678 1.00 118.56 ? 129 DC  I "O5'" 1 
ATOM   2621  C  "C5'" . DC  A  1 129 ? -58.632 40.391  -32.111 1.00 113.65 ? 129 DC  I "C5'" 1 
ATOM   2622  C  "C4'" . DC  A  1 129 ? -57.573 40.088  -33.142 1.00 97.18  ? 129 DC  I "C4'" 1 
ATOM   2623  O  "O4'" . DC  A  1 129 ? -57.719 38.711  -33.556 1.00 99.54  ? 129 DC  I "O4'" 1 
ATOM   2624  C  "C3'" . DC  A  1 129 ? -57.700 40.867  -34.429 1.00 89.59  ? 129 DC  I "C3'" 1 
ATOM   2625  O  "O3'" . DC  A  1 129 ? -56.495 40.756  -35.152 1.00 88.38  ? 129 DC  I "O3'" 1 
ATOM   2626  C  "C2'" . DC  A  1 129 ? -58.820 40.103  -35.120 1.00 93.12  ? 129 DC  I "C2'" 1 
ATOM   2627  C  "C1'" . DC  A  1 129 ? -58.454 38.660  -34.768 1.00 100.03 ? 129 DC  I "C1'" 1 
ATOM   2628  N  N1    . DC  A  1 129 ? -59.632 37.772  -34.566 1.00 103.71 ? 129 DC  I N1    1 
ATOM   2629  C  C2    . DC  A  1 129 ? -59.741 36.588  -35.301 1.00 107.67 ? 129 DC  I C2    1 
ATOM   2630  O  O2    . DC  A  1 129 ? -58.856 36.299  -36.114 1.00 101.53 ? 129 DC  I O2    1 
ATOM   2631  N  N3    . DC  A  1 129 ? -60.818 35.789  -35.102 1.00 117.24 ? 129 DC  I N3    1 
ATOM   2632  C  C4    . DC  A  1 129 ? -61.752 36.136  -34.214 1.00 117.04 ? 129 DC  I C4    1 
ATOM   2633  N  N4    . DC  A  1 129 ? -62.796 35.317  -34.053 1.00 115.77 ? 129 DC  I N4    1 
ATOM   2634  C  C5    . DC  A  1 129 ? -61.658 37.338  -33.456 1.00 118.49 ? 129 DC  I C5    1 
ATOM   2635  C  C6    . DC  A  1 129 ? -60.593 38.118  -33.662 1.00 114.71 ? 129 DC  I C6    1 
ATOM   2636  P  P     . DT  A  1 130 ? -56.044 41.904  -36.177 1.00 77.63  ? 130 DT  I P     1 
ATOM   2637  O  OP1   . DT  A  1 130 ? -55.157 42.836  -35.442 1.00 70.26  ? 130 DT  I OP1   1 
ATOM   2638  O  OP2   . DT  A  1 130 ? -57.258 42.400  -36.858 1.00 79.85  ? 130 DT  I OP2   1 
ATOM   2639  O  "O5'" . DT  A  1 130 ? -55.183 41.112  -37.265 1.00 86.15  ? 130 DT  I "O5'" 1 
ATOM   2640  C  "C5'" . DT  A  1 130 ? -54.232 40.137  -36.850 1.00 72.46  ? 130 DT  I "C5'" 1 
ATOM   2641  C  "C4'" . DT  A  1 130 ? -54.133 39.015  -37.867 1.00 69.20  ? 130 DT  I "C4'" 1 
ATOM   2642  O  "O4'" . DT  A  1 130 ? -55.321 38.185  -37.791 1.00 75.30  ? 130 DT  I "O4'" 1 
ATOM   2643  C  "C3'" . DT  A  1 130 ? -54.029 39.465  -39.323 1.00 73.93  ? 130 DT  I "C3'" 1 
ATOM   2644  O  "O3'" . DT  A  1 130 ? -53.115 38.622  -40.027 1.00 74.29  ? 130 DT  I "O3'" 1 
ATOM   2645  C  "C2'" . DT  A  1 130 ? -55.458 39.297  -39.836 1.00 75.61  ? 130 DT  I "C2'" 1 
ATOM   2646  C  "C1'" . DT  A  1 130 ? -55.893 38.059  -39.073 1.00 80.78  ? 130 DT  I "C1'" 1 
ATOM   2647  N  N1    . DT  A  1 130 ? -57.367 37.931  -38.912 1.00 91.20  ? 130 DT  I N1    1 
ATOM   2648  C  C2    . DT  A  1 130 ? -57.936 36.678  -38.948 1.00 99.33  ? 130 DT  I C2    1 
ATOM   2649  O  O2    . DT  A  1 130 ? -57.294 35.657  -39.114 1.00 102.29 ? 130 DT  I O2    1 
ATOM   2650  N  N3    . DT  A  1 130 ? -59.291 36.660  -38.778 1.00 100.11 ? 130 DT  I N3    1 
ATOM   2651  C  C4    . DT  A  1 130 ? -60.121 37.745  -38.580 1.00 107.17 ? 130 DT  I C4    1 
ATOM   2652  O  O4    . DT  A  1 130 ? -61.331 37.621  -38.438 1.00 109.93 ? 130 DT  I O4    1 
ATOM   2653  C  C5    . DT  A  1 130 ? -59.461 39.034  -38.551 1.00 100.27 ? 130 DT  I C5    1 
ATOM   2654  C  C7    . DT  A  1 130 ? -60.261 40.288  -38.346 1.00 104.94 ? 130 DT  I C7    1 
ATOM   2655  C  C6    . DT  A  1 130 ? -58.131 39.063  -38.715 1.00 88.46  ? 130 DT  I C6    1 
ATOM   2656  P  P     . DG  A  1 131 ? -51.962 39.267  -40.942 1.00 70.02  ? 131 DG  I P     1 
ATOM   2657  O  OP1   . DG  A  1 131 ? -50.657 38.726  -40.516 1.00 65.89  ? 131 DG  I OP1   1 
ATOM   2658  O  OP2   . DG  A  1 131 ? -52.198 40.727  -40.994 1.00 79.38  ? 131 DG  I OP2   1 
ATOM   2659  O  "O5'" . DG  A  1 131 ? -52.270 38.708  -42.391 1.00 68.91  ? 131 DG  I "O5'" 1 
ATOM   2660  C  "C5'" . DG  A  1 131 ? -53.588 38.413  -42.740 1.00 83.06  ? 131 DG  I "C5'" 1 
ATOM   2661  C  "C4'" . DG  A  1 131 ? -53.759 36.926  -42.917 1.00 79.55  ? 131 DG  I "C4'" 1 
ATOM   2662  O  "O4'" . DG  A  1 131 ? -54.998 36.513  -42.305 1.00 84.12  ? 131 DG  I "O4'" 1 
ATOM   2663  C  "C3'" . DG  A  1 131 ? -53.888 36.499  -44.355 1.00 81.40  ? 131 DG  I "C3'" 1 
ATOM   2664  O  "O3'" . DG  A  1 131 ? -53.612 35.132  -44.469 1.00 83.53  ? 131 DG  I "O3'" 1 
ATOM   2665  C  "C2'" . DG  A  1 131 ? -55.355 36.797  -44.629 1.00 85.35  ? 131 DG  I "C2'" 1 
ATOM   2666  C  "C1'" . DG  A  1 131 ? -56.010 36.445  -43.294 1.00 88.01  ? 131 DG  I "C1'" 1 
ATOM   2667  N  N9    . DG  A  1 131 ? -57.078 37.362  -42.915 1.00 93.02  ? 131 DG  I N9    1 
ATOM   2668  C  C8    . DG  A  1 131 ? -57.007 38.733  -42.845 1.00 97.61  ? 131 DG  I C8    1 
ATOM   2669  N  N7    . DG  A  1 131 ? -58.124 39.292  -42.470 1.00 95.57  ? 131 DG  I N7    1 
ATOM   2670  C  C5    . DG  A  1 131 ? -58.988 38.223  -42.279 1.00 99.75  ? 131 DG  I C5    1 
ATOM   2671  C  C6    . DG  A  1 131 ? -60.341 38.209  -41.870 1.00 106.56 ? 131 DG  I C6    1 
ATOM   2672  O  O6    . DG  A  1 131 ? -61.065 39.172  -41.586 1.00 109.52 ? 131 DG  I O6    1 
ATOM   2673  N  N1    . DG  A  1 131 ? -60.845 36.911  -41.804 1.00 108.88 ? 131 DG  I N1    1 
ATOM   2674  C  C2    . DG  A  1 131 ? -60.128 35.774  -42.097 1.00 110.13 ? 131 DG  I C2    1 
ATOM   2675  N  N2    . DG  A  1 131 ? -60.781 34.609  -41.979 1.00 113.48 ? 131 DG  I N2    1 
ATOM   2676  N  N3    . DG  A  1 131 ? -58.860 35.776  -42.481 1.00 102.90 ? 131 DG  I N3    1 
ATOM   2677  C  C4    . DG  A  1 131 ? -58.358 37.029  -42.550 1.00 94.92  ? 131 DG  I C4    1 
ATOM   2678  P  P     . DC  A  1 132 ? -52.997 34.559  -45.832 1.00 85.62  ? 132 DC  I P     1 
ATOM   2679  O  OP1   . DC  A  1 132 ? -51.691 33.948  -45.499 1.00 94.24  ? 132 DC  I OP1   1 
ATOM   2680  O  OP2   . DC  A  1 132 ? -53.079 35.636  -46.846 1.00 72.92  ? 132 DC  I OP2   1 
ATOM   2681  O  "O5'" . DC  A  1 132 ? -54.023 33.408  -46.246 1.00 87.60  ? 132 DC  I "O5'" 1 
ATOM   2682  C  "C5'" . DC  A  1 132 ? -54.579 32.563  -45.248 1.00 85.46  ? 132 DC  I "C5'" 1 
ATOM   2683  C  "C4'" . DC  A  1 132 ? -55.882 31.959  -45.729 1.00 94.11  ? 132 DC  I "C4'" 1 
ATOM   2684  O  "O4'" . DC  A  1 132 ? -56.984 32.845  -45.397 1.00 94.86  ? 132 DC  I "O4'" 1 
ATOM   2685  C  "C3'" . DC  A  1 132 ? -55.958 31.729  -47.236 1.00 99.49  ? 132 DC  I "C3'" 1 
ATOM   2686  O  "O3'" . DC  A  1 132 ? -56.644 30.517  -47.503 1.00 107.66 ? 132 DC  I "O3'" 1 
ATOM   2687  C  "C2'" . DC  A  1 132 ? -56.742 32.942  -47.732 1.00 99.55  ? 132 DC  I "C2'" 1 
ATOM   2688  C  "C1'" . DC  A  1 132 ? -57.691 33.199  -46.569 1.00 99.45  ? 132 DC  I "C1'" 1 
ATOM   2689  N  N1    . DC  A  1 132 ? -58.116 34.629  -46.447 1.00 101.44 ? 132 DC  I N1    1 
ATOM   2690  C  C2    . DC  A  1 132 ? -59.257 34.953  -45.700 1.00 102.13 ? 132 DC  I C2    1 
ATOM   2691  O  O2    . DC  A  1 132 ? -59.899 34.047  -45.155 1.00 103.98 ? 132 DC  I O2    1 
ATOM   2692  N  N3    . DC  A  1 132 ? -59.625 36.254  -45.594 1.00 96.91  ? 132 DC  I N3    1 
ATOM   2693  C  C4    . DC  A  1 132 ? -58.906 37.202  -46.195 1.00 98.05  ? 132 DC  I C4    1 
ATOM   2694  N  N4    . DC  A  1 132 ? -59.309 38.470  -46.063 1.00 96.50  ? 132 DC  I N4    1 
ATOM   2695  C  C5    . DC  A  1 132 ? -57.742 36.893  -46.961 1.00 95.79  ? 132 DC  I C5    1 
ATOM   2696  C  C6    . DC  A  1 132 ? -57.388 35.607  -47.060 1.00 93.59  ? 132 DC  I C6    1 
ATOM   2697  P  P     . DA  A  1 133 ? -56.302 29.659  -48.817 1.00 99.59  ? 133 DA  I P     1 
ATOM   2698  O  OP1   . DA  A  1 133 ? -55.608 28.428  -48.380 1.00 106.08 ? 133 DA  I OP1   1 
ATOM   2699  O  OP2   . DA  A  1 133 ? -55.665 30.554  -49.809 1.00 101.76 ? 133 DA  I OP2   1 
ATOM   2700  O  "O5'" . DA  A  1 133 ? -57.742 29.267  -49.379 1.00 113.26 ? 133 DA  I "O5'" 1 
ATOM   2701  C  "C5'" . DA  A  1 133 ? -58.813 29.048  -48.471 1.00 114.23 ? 133 DA  I "C5'" 1 
ATOM   2702  C  "C4'" . DA  A  1 133 ? -60.088 29.698  -48.974 1.00 108.32 ? 133 DA  I "C4'" 1 
ATOM   2703  O  "O4'" . DA  A  1 133 ? -60.066 31.126  -48.687 1.00 109.16 ? 133 DA  I "O4'" 1 
ATOM   2704  C  "C3'" . DA  A  1 133 ? -60.328 29.576  -50.484 1.00 106.13 ? 133 DA  I "C3'" 1 
ATOM   2705  O  "O3'" . DA  A  1 133 ? -61.691 29.231  -50.720 1.00 113.12 ? 133 DA  I "O3'" 1 
ATOM   2706  C  "C2'" . DA  A  1 133 ? -60.011 30.983  -50.991 1.00 104.85 ? 133 DA  I "C2'" 1 
ATOM   2707  C  "C1'" . DA  A  1 133 ? -60.521 31.809  -49.829 1.00 109.04 ? 133 DA  I "C1'" 1 
ATOM   2708  N  N9    . DA  A  1 133 ? -60.030 33.187  -49.810 1.00 106.29 ? 133 DA  I N9    1 
ATOM   2709  C  C8    . DA  A  1 133 ? -58.840 33.648  -50.300 1.00 103.66 ? 133 DA  I C8    1 
ATOM   2710  N  N7    . DA  A  1 133 ? -58.672 34.943  -50.153 1.00 97.04  ? 133 DA  I N7    1 
ATOM   2711  C  C5    . DA  A  1 133 ? -59.838 35.361  -49.531 1.00 100.34 ? 133 DA  I C5    1 
ATOM   2712  C  C6    . DA  A  1 133 ? -60.285 36.626  -49.100 1.00 96.88  ? 133 DA  I C6    1 
ATOM   2713  N  N6    . DA  A  1 133 ? -59.574 37.749  -49.246 1.00 94.32  ? 133 DA  I N6    1 
ATOM   2714  N  N1    . DA  A  1 133 ? -61.498 36.695  -48.517 1.00 96.34  ? 133 DA  I N1    1 
ATOM   2715  C  C2    . DA  A  1 133 ? -62.211 35.572  -48.377 1.00 100.92 ? 133 DA  I C2    1 
ATOM   2716  N  N3    . DA  A  1 133 ? -61.897 34.330  -48.740 1.00 103.02 ? 133 DA  I N3    1 
ATOM   2717  C  C4    . DA  A  1 133 ? -60.687 34.292  -49.317 1.00 102.96 ? 133 DA  I C4    1 
ATOM   2718  P  P     . DG  A  1 134 ? -62.193 28.783  -52.181 1.00 123.41 ? 134 DG  I P     1 
ATOM   2719  O  OP1   . DG  A  1 134 ? -62.752 27.418  -52.054 1.00 114.08 ? 134 DG  I OP1   1 
ATOM   2720  O  OP2   . DG  A  1 134 ? -61.121 29.059  -53.165 1.00 116.36 ? 134 DG  I OP2   1 
ATOM   2721  O  "O5'" . DG  A  1 134 ? -63.396 29.787  -52.480 1.00 112.70 ? 134 DG  I "O5'" 1 
ATOM   2722  C  "C5'" . DG  A  1 134 ? -63.326 31.110  -51.997 1.00 108.41 ? 134 DG  I "C5'" 1 
ATOM   2723  C  "C4'" . DG  A  1 134 ? -64.601 31.869  -52.277 1.00 103.99 ? 134 DG  I "C4'" 1 
ATOM   2724  O  "O4'" . DG  A  1 134 ? -64.415 33.244  -51.861 1.00 102.64 ? 134 DG  I "O4'" 1 
ATOM   2725  C  "C3'" . DG  A  1 134 ? -64.974 31.965  -53.745 1.00 103.62 ? 134 DG  I "C3'" 1 
ATOM   2726  O  "O3'" . DG  A  1 134 ? -66.348 32.317  -53.860 1.00 111.82 ? 134 DG  I "O3'" 1 
ATOM   2727  C  "C2'" . DG  A  1 134 ? -64.073 33.103  -54.191 1.00 104.26 ? 134 DG  I "C2'" 1 
ATOM   2728  C  "C1'" . DG  A  1 134 ? -64.204 34.053  -53.006 1.00 108.06 ? 134 DG  I "C1'" 1 
ATOM   2729  N  N9    . DG  A  1 134 ? -63.021 34.882  -52.801 1.00 105.74 ? 134 DG  I N9    1 
ATOM   2730  C  C8    . DG  A  1 134 ? -61.720 34.558  -53.102 1.00 102.02 ? 134 DG  I C8    1 
ATOM   2731  N  N7    . DG  A  1 134 ? -60.871 35.508  -52.826 1.00 103.07 ? 134 DG  I N7    1 
ATOM   2732  C  C5    . DG  A  1 134 ? -61.662 36.530  -52.313 1.00 102.23 ? 134 DG  I C5    1 
ATOM   2733  C  C6    . DG  A  1 134 ? -61.300 37.812  -51.842 1.00 98.34  ? 134 DG  I C6    1 
ATOM   2734  O  O6    . DG  A  1 134 ? -60.169 38.315  -51.777 1.00 96.68  ? 134 DG  I O6    1 
ATOM   2735  N  N1    . DG  A  1 134 ? -62.409 38.534  -51.407 1.00 101.01 ? 134 DG  I N1    1 
ATOM   2736  C  C2    . DG  A  1 134 ? -63.705 38.073  -51.431 1.00 101.35 ? 134 DG  I C2    1 
ATOM   2737  N  N2    . DG  A  1 134 ? -64.643 38.913  -50.974 1.00 101.65 ? 134 DG  I N2    1 
ATOM   2738  N  N3    . DG  A  1 134 ? -64.057 36.875  -51.873 1.00 102.15 ? 134 DG  I N3    1 
ATOM   2739  C  C4    . DG  A  1 134 ? -62.988 36.160  -52.296 1.00 103.22 ? 134 DG  I C4    1 
ATOM   2740  P  P     . DG  A  1 135 ? -67.074 32.419  -55.294 1.00 114.64 ? 135 DG  I P     1 
ATOM   2741  O  OP1   . DG  A  1 135 ? -67.894 31.197  -55.443 1.00 111.26 ? 135 DG  I OP1   1 
ATOM   2742  O  OP2   . DG  A  1 135 ? -66.097 32.778  -56.348 1.00 99.20  ? 135 DG  I OP2   1 
ATOM   2743  O  "O5'" . DG  A  1 135 ? -68.053 33.671  -55.117 1.00 116.08 ? 135 DG  I "O5'" 1 
ATOM   2744  C  "C5'" . DG  A  1 135 ? -67.642 34.785  -54.322 1.00 114.46 ? 135 DG  I "C5'" 1 
ATOM   2745  C  "C4'" . DG  A  1 135 ? -67.972 36.096  -55.012 1.00 111.79 ? 135 DG  I "C4'" 1 
ATOM   2746  O  "O4'" . DG  A  1 135 ? -66.913 37.056  -54.748 1.00 110.04 ? 135 DG  I "O4'" 1 
ATOM   2747  C  "C3'" . DG  A  1 135 ? -68.086 36.008  -56.531 1.00 109.98 ? 135 DG  I "C3'" 1 
ATOM   2748  O  "O3'" . DG  A  1 135 ? -69.056 36.932  -57.008 1.00 118.04 ? 135 DG  I "O3'" 1 
ATOM   2749  C  "C2'" . DG  A  1 135 ? -66.685 36.381  -56.994 1.00 111.98 ? 135 DG  I "C2'" 1 
ATOM   2750  C  "C1'" . DG  A  1 135 ? -66.280 37.423  -55.959 1.00 110.24 ? 135 DG  I "C1'" 1 
ATOM   2751  N  N9    . DG  A  1 135 ? -64.839 37.471  -55.737 1.00 106.34 ? 135 DG  I N9    1 
ATOM   2752  C  C8    . DG  A  1 135 ? -63.963 36.414  -55.785 1.00 106.40 ? 135 DG  I C8    1 
ATOM   2753  N  N7    . DG  A  1 135 ? -62.726 36.752  -55.556 1.00 105.50 ? 135 DG  I N7    1 
ATOM   2754  C  C5    . DG  A  1 135 ? -62.782 38.124  -55.346 1.00 105.41 ? 135 DG  I C5    1 
ATOM   2755  C  C6    . DG  A  1 135 ? -61.746 39.044  -55.053 1.00 105.41 ? 135 DG  I C6    1 
ATOM   2756  O  O6    . DG  A  1 135 ? -60.534 38.820  -54.916 1.00 107.78 ? 135 DG  I O6    1 
ATOM   2757  N  N1    . DG  A  1 135 ? -62.234 40.341  -54.916 1.00 102.14 ? 135 DG  I N1    1 
ATOM   2758  C  C2    . DG  A  1 135 ? -63.552 40.704  -55.044 1.00 104.92 ? 135 DG  I C2    1 
ATOM   2759  N  N2    . DG  A  1 135 ? -63.826 42.006  -54.875 1.00 100.38 ? 135 DG  I N2    1 
ATOM   2760  N  N3    . DG  A  1 135 ? -64.535 39.851  -55.318 1.00 104.83 ? 135 DG  I N3    1 
ATOM   2761  C  C4    . DG  A  1 135 ? -64.076 38.583  -55.455 1.00 103.02 ? 135 DG  I C4    1 
ATOM   2762  P  P     . DT  A  1 136 ? -69.709 36.733  -58.464 1.00 127.56 ? 136 DT  I P     1 
ATOM   2763  O  OP1   . DT  A  1 136 ? -70.894 37.617  -58.550 1.00 117.61 ? 136 DT  I OP1   1 
ATOM   2764  O  OP2   . DT  A  1 136 ? -69.862 35.278  -58.691 1.00 123.62 ? 136 DT  I OP2   1 
ATOM   2765  O  "O5'" . DT  A  1 136 ? -68.573 37.239  -59.469 1.00 119.29 ? 136 DT  I "O5'" 1 
ATOM   2766  C  "C5'" . DT  A  1 136 ? -68.858 38.262  -60.409 1.00 117.89 ? 136 DT  I "C5'" 1 
ATOM   2767  C  "C4'" . DT  A  1 136 ? -68.835 39.628  -59.744 1.00 116.94 ? 136 DT  I "C4'" 1 
ATOM   2768  O  "O4'" . DT  A  1 136 ? -67.802 39.662  -58.732 1.00 114.99 ? 136 DT  I "O4'" 1 
ATOM   2769  C  "C3'" . DT  A  1 136 ? -68.575 40.791  -60.689 1.00 113.79 ? 136 DT  I "C3'" 1 
ATOM   2770  O  "O3'" . DT  A  1 136 ? -69.481 41.848  -60.434 1.00 115.51 ? 136 DT  I "O3'" 1 
ATOM   2771  C  "C2'" . DT  A  1 136 ? -67.126 41.209  -60.422 1.00 109.96 ? 136 DT  I "C2'" 1 
ATOM   2772  C  "C1'" . DT  A  1 136 ? -66.753 40.534  -59.104 1.00 111.76 ? 136 DT  I "C1'" 1 
ATOM   2773  N  N1    . DT  A  1 136 ? -65.468 39.746  -59.182 1.00 112.34 ? 136 DT  I N1    1 
ATOM   2774  C  C2    . DT  A  1 136 ? -64.318 40.271  -58.630 1.00 103.58 ? 136 DT  I C2    1 
ATOM   2775  O  O2    . DT  A  1 136 ? -64.278 41.354  -58.070 1.00 96.08  ? 136 DT  I O2    1 
ATOM   2776  N  N3    . DT  A  1 136 ? -63.207 39.476  -58.758 1.00 103.60 ? 136 DT  I N3    1 
ATOM   2777  C  C4    . DT  A  1 136 ? -63.129 38.235  -59.372 1.00 107.03 ? 136 DT  I C4    1 
ATOM   2778  O  O4    . DT  A  1 136 ? -62.082 37.596  -59.436 1.00 102.12 ? 136 DT  I O4    1 
ATOM   2779  C  C5    . DT  A  1 136 ? -64.367 37.744  -59.933 1.00 108.84 ? 136 DT  I C5    1 
ATOM   2780  C  C7    . DT  A  1 136 ? -64.407 36.412  -60.624 1.00 98.92  ? 136 DT  I C7    1 
ATOM   2781  C  C6    . DT  A  1 136 ? -65.462 38.514  -59.815 1.00 113.29 ? 136 DT  I C6    1 
ATOM   2782  P  P     . DG  A  1 137 ? -70.166 42.621  -61.664 1.00 122.02 ? 137 DG  I P     1 
ATOM   2783  O  OP1   . DG  A  1 137 ? -71.449 43.188  -61.193 1.00 125.15 ? 137 DG  I OP1   1 
ATOM   2784  O  OP2   . DG  A  1 137 ? -70.137 41.703  -62.825 1.00 100.31 ? 137 DG  I OP2   1 
ATOM   2785  O  "O5'" . DG  A  1 137 ? -69.149 43.812  -61.986 1.00 116.25 ? 137 DG  I "O5'" 1 
ATOM   2786  C  "C5'" . DG  A  1 137 ? -68.488 44.491  -60.930 1.00 107.23 ? 137 DG  I "C5'" 1 
ATOM   2787  C  "C4'" . DG  A  1 137 ? -67.198 45.110  -61.431 1.00 104.64 ? 137 DG  I "C4'" 1 
ATOM   2788  O  "O4'" . DG  A  1 137 ? -66.092 44.195  -61.210 1.00 105.60 ? 137 DG  I "O4'" 1 
ATOM   2789  C  "C3'" . DG  A  1 137 ? -67.188 45.454  -62.922 1.00 99.83  ? 137 DG  I "C3'" 1 
ATOM   2790  O  "O3'" . DG  A  1 137 ? -66.746 46.796  -63.090 1.00 96.65  ? 137 DG  I "O3'" 1 
ATOM   2791  C  "C2'" . DG  A  1 137 ? -66.214 44.434  -63.528 1.00 99.26  ? 137 DG  I "C2'" 1 
ATOM   2792  C  "C1'" . DG  A  1 137 ? -65.286 44.135  -62.365 1.00 100.00 ? 137 DG  I "C1'" 1 
ATOM   2793  N  N9    . DG  A  1 137 ? -64.676 42.804  -62.433 1.00 100.59 ? 137 DG  I N9    1 
ATOM   2794  C  C8    . DG  A  1 137 ? -65.227 41.666  -62.975 1.00 101.44 ? 137 DG  I C8    1 
ATOM   2795  N  N7    . DG  A  1 137 ? -64.457 40.616  -62.882 1.00 97.23  ? 137 DG  I N7    1 
ATOM   2796  C  C5    . DG  A  1 137 ? -63.317 41.088  -62.245 1.00 95.55  ? 137 DG  I C5    1 
ATOM   2797  C  C6    . DG  A  1 137 ? -62.131 40.408  -61.878 1.00 93.65  ? 137 DG  I C6    1 
ATOM   2798  O  O6    . DG  A  1 137 ? -61.846 39.214  -62.049 1.00 98.56  ? 137 DG  I O6    1 
ATOM   2799  N  N1    . DG  A  1 137 ? -61.224 41.256  -61.252 1.00 88.63  ? 137 DG  I N1    1 
ATOM   2800  C  C2    . DG  A  1 137 ? -61.433 42.592  -61.010 1.00 90.51  ? 137 DG  I C2    1 
ATOM   2801  N  N2    . DG  A  1 137 ? -60.437 43.246  -60.395 1.00 89.91  ? 137 DG  I N2    1 
ATOM   2802  N  N3    . DG  A  1 137 ? -62.538 43.245  -61.348 1.00 92.43  ? 137 DG  I N3    1 
ATOM   2803  C  C4    . DG  A  1 137 ? -63.434 42.432  -61.960 1.00 97.36  ? 137 DG  I C4    1 
ATOM   2804  P  P     . DG  A  1 138 ? -66.494 47.436  -64.545 1.00 108.11 ? 138 DG  I P     1 
ATOM   2805  O  OP1   . DG  A  1 138 ? -67.261 48.699  -64.589 1.00 105.37 ? 138 DG  I OP1   1 
ATOM   2806  O  OP2   . DG  A  1 138 ? -66.704 46.445  -65.625 1.00 104.30 ? 138 DG  I OP2   1 
ATOM   2807  O  "O5'" . DG  A  1 138 ? -64.943 47.798  -64.498 1.00 98.45  ? 138 DG  I "O5'" 1 
ATOM   2808  C  "C5'" . DG  A  1 138 ? -64.386 48.309  -63.295 1.00 92.36  ? 138 DG  I "C5'" 1 
ATOM   2809  C  "C4'" . DG  A  1 138 ? -62.873 48.346  -63.370 1.00 89.58  ? 138 DG  I "C4'" 1 
ATOM   2810  O  "O4'" . DG  A  1 138 ? -62.340 47.019  -63.134 1.00 93.95  ? 138 DG  I "O4'" 1 
ATOM   2811  C  "C3'" . DG  A  1 138 ? -62.306 48.805  -64.709 1.00 91.77  ? 138 DG  I "C3'" 1 
ATOM   2812  O  "O3'" . DG  A  1 138 ? -61.188 49.639  -64.490 1.00 92.84  ? 138 DG  I "O3'" 1 
ATOM   2813  C  "C2'" . DG  A  1 138 ? -61.909 47.498  -65.391 1.00 89.30  ? 138 DG  I "C2'" 1 
ATOM   2814  C  "C1'" . DG  A  1 138 ? -61.508 46.634  -64.208 1.00 92.01  ? 138 DG  I "C1'" 1 
ATOM   2815  N  N9    . DG  A  1 138 ? -61.701 45.207  -64.448 1.00 93.86  ? 138 DG  I N9    1 
ATOM   2816  C  C8    . DG  A  1 138 ? -62.861 44.582  -64.838 1.00 93.37  ? 138 DG  I C8    1 
ATOM   2817  N  N7    . DG  A  1 138 ? -62.736 43.292  -64.976 1.00 87.10  ? 138 DG  I N7    1 
ATOM   2818  C  C5    . DG  A  1 138 ? -61.408 43.044  -64.655 1.00 91.71  ? 138 DG  I C5    1 
ATOM   2819  C  C6    . DG  A  1 138 ? -60.690 41.825  -64.625 1.00 87.72  ? 138 DG  I C6    1 
ATOM   2820  O  O6    . DG  A  1 138 ? -61.101 40.684  -64.884 1.00 86.59  ? 138 DG  I O6    1 
ATOM   2821  N  N1    . DG  A  1 138 ? -59.364 42.021  -64.249 1.00 81.76  ? 138 DG  I N1    1 
ATOM   2822  C  C2    . DG  A  1 138 ? -58.806 43.239  -63.940 1.00 80.68  ? 138 DG  I C2    1 
ATOM   2823  N  N2    . DG  A  1 138 ? -57.511 43.230  -63.598 1.00 90.58  ? 138 DG  I N2    1 
ATOM   2824  N  N3    . DG  A  1 138 ? -59.468 44.385  -63.964 1.00 87.66  ? 138 DG  I N3    1 
ATOM   2825  C  C4    . DG  A  1 138 ? -60.758 44.213  -64.329 1.00 90.68  ? 138 DG  I C4    1 
ATOM   2826  P  P     . DA  A  1 139 ? -60.539 50.465  -65.704 1.00 98.54  ? 139 DA  I P     1 
ATOM   2827  O  OP1   . DA  A  1 139 ? -60.573 51.904  -65.354 1.00 112.98 ? 139 DA  I OP1   1 
ATOM   2828  O  OP2   . DA  A  1 139 ? -61.140 49.998  -66.976 1.00 88.16  ? 139 DA  I OP2   1 
ATOM   2829  O  "O5'" . DA  A  1 139 ? -59.023 49.993  -65.685 1.00 94.73  ? 139 DA  I "O5'" 1 
ATOM   2830  C  "C5'" . DA  A  1 139 ? -58.436 49.483  -66.855 1.00 98.73  ? 139 DA  I "C5'" 1 
ATOM   2831  C  "C4'" . DA  A  1 139 ? -57.128 48.804  -66.525 1.00 95.21  ? 139 DA  I "C4'" 1 
ATOM   2832  O  "O4'" . DA  A  1 139 ? -57.379 47.430  -66.142 1.00 82.10  ? 139 DA  I "O4'" 1 
ATOM   2833  C  "C3'" . DA  A  1 139 ? -56.142 48.736  -67.672 1.00 87.37  ? 139 DA  I "C3'" 1 
ATOM   2834  O  "O3'" . DA  A  1 139 ? -54.824 48.725  -67.162 1.00 85.75  ? 139 DA  I "O3'" 1 
ATOM   2835  C  "C2'" . DA  A  1 139 ? -56.507 47.417  -68.350 1.00 77.37  ? 139 DA  I "C2'" 1 
ATOM   2836  C  "C1'" . DA  A  1 139 ? -56.987 46.554  -67.183 1.00 80.61  ? 139 DA  I "C1'" 1 
ATOM   2837  N  N9    . DA  A  1 139 ? -58.125 45.700  -67.523 1.00 85.23  ? 139 DA  I N9    1 
ATOM   2838  C  C8    . DA  A  1 139 ? -59.337 46.096  -68.021 1.00 88.73  ? 139 DA  I C8    1 
ATOM   2839  N  N7    . DA  A  1 139 ? -60.173 45.106  -68.233 1.00 81.35  ? 139 DA  I N7    1 
ATOM   2840  C  C5    . DA  A  1 139 ? -59.461 43.983  -67.846 1.00 83.22  ? 139 DA  I C5    1 
ATOM   2841  C  C6    . DA  A  1 139 ? -59.787 42.611  -67.826 1.00 82.52  ? 139 DA  I C6    1 
ATOM   2842  N  N6    . DA  A  1 139 ? -60.970 42.128  -68.221 1.00 80.90  ? 139 DA  I N6    1 
ATOM   2843  N  N1    . DA  A  1 139 ? -58.846 41.753  -67.380 1.00 83.02  ? 139 DA  I N1    1 
ATOM   2844  C  C2    . DA  A  1 139 ? -57.663 42.239  -66.986 1.00 83.31  ? 139 DA  I C2    1 
ATOM   2845  N  N3    . DA  A  1 139 ? -57.242 43.504  -66.960 1.00 82.06  ? 139 DA  I N3    1 
ATOM   2846  C  C4    . DA  A  1 139 ? -58.197 44.332  -67.406 1.00 83.03  ? 139 DA  I C4    1 
ATOM   2847  P  P     . DT  A  1 140 ? -53.576 48.985  -68.136 1.00 87.77  ? 140 DT  I P     1 
ATOM   2848  O  OP1   . DT  A  1 140 ? -52.895 50.218  -67.675 1.00 95.91  ? 140 DT  I OP1   1 
ATOM   2849  O  OP2   . DT  A  1 140 ? -54.062 48.899  -69.531 1.00 78.17  ? 140 DT  I OP2   1 
ATOM   2850  O  "O5'" . DT  A  1 140 ? -52.637 47.722  -67.857 1.00 84.64  ? 140 DT  I "O5'" 1 
ATOM   2851  C  "C5'" . DT  A  1 140 ? -53.062 46.723  -66.930 1.00 83.78  ? 140 DT  I "C5'" 1 
ATOM   2852  C  "C4'" . DT  A  1 140 ? -52.339 45.412  -67.171 1.00 79.67  ? 140 DT  I "C4'" 1 
ATOM   2853  O  "O4'" . DT  A  1 140 ? -53.309 44.356  -67.429 1.00 74.02  ? 140 DT  I "O4'" 1 
ATOM   2854  C  "C3'" . DT  A  1 140 ? -51.382 45.414  -68.363 1.00 79.80  ? 140 DT  I "C3'" 1 
ATOM   2855  O  "O3'" . DT  A  1 140 ? -50.207 44.667  -68.036 1.00 80.76  ? 140 DT  I "O3'" 1 
ATOM   2856  C  "C2'" . DT  A  1 140 ? -52.207 44.738  -69.457 1.00 76.53  ? 140 DT  I "C2'" 1 
ATOM   2857  C  "C1'" . DT  A  1 140 ? -53.004 43.721  -68.651 1.00 74.43  ? 140 DT  I "C1'" 1 
ATOM   2858  N  N1    . DT  A  1 140 ? -54.285 43.290  -69.309 1.00 71.35  ? 140 DT  I N1    1 
ATOM   2859  C  C2    . DT  A  1 140 ? -54.542 41.943  -69.470 1.00 76.87  ? 140 DT  I C2    1 
ATOM   2860  O  O2    . DT  A  1 140 ? -53.779 41.067  -69.102 1.00 78.94  ? 140 DT  I O2    1 
ATOM   2861  N  N3    . DT  A  1 140 ? -55.734 41.655  -70.080 1.00 73.39  ? 140 DT  I N3    1 
ATOM   2862  C  C4    . DT  A  1 140 ? -56.677 42.555  -70.538 1.00 77.67  ? 140 DT  I C4    1 
ATOM   2863  O  O4    . DT  A  1 140 ? -57.722 42.197  -71.074 1.00 72.45  ? 140 DT  I O4    1 
ATOM   2864  C  C5    . DT  A  1 140 ? -56.348 43.948  -70.342 1.00 79.21  ? 140 DT  I C5    1 
ATOM   2865  C  C7    . DT  A  1 140 ? -57.298 45.015  -70.803 1.00 81.99  ? 140 DT  I C7    1 
ATOM   2866  C  C6    . DT  A  1 140 ? -55.181 44.244  -69.744 1.00 71.32  ? 140 DT  I C6    1 
ATOM   2867  P  P     . DA  A  1 141 ? -48.947 44.619  -69.034 1.00 73.93  ? 141 DA  I P     1 
ATOM   2868  O  OP1   . DA  A  1 141 ? -47.724 44.817  -68.225 1.00 75.53  ? 141 DA  I OP1   1 
ATOM   2869  O  OP2   . DA  A  1 141 ? -49.210 45.497  -70.195 1.00 86.43  ? 141 DA  I OP2   1 
ATOM   2870  O  "O5'" . DA  A  1 141 ? -48.949 43.112  -69.543 1.00 71.67  ? 141 DA  I "O5'" 1 
ATOM   2871  C  "C5'" . DA  A  1 141 ? -49.110 42.065  -68.603 1.00 72.53  ? 141 DA  I "C5'" 1 
ATOM   2872  C  "C4'" . DA  A  1 141 ? -49.386 40.755  -69.305 1.00 73.91  ? 141 DA  I "C4'" 1 
ATOM   2873  O  "O4'" . DA  A  1 141 ? -50.738 40.760  -69.827 1.00 68.40  ? 141 DA  I "O4'" 1 
ATOM   2874  C  "C3'" . DA  A  1 141 ? -48.465 40.458  -70.484 1.00 80.24  ? 141 DA  I "C3'" 1 
ATOM   2875  O  "O3'" . DA  A  1 141 ? -48.050 39.106  -70.436 1.00 75.72  ? 141 DA  I "O3'" 1 
ATOM   2876  C  "C2'" . DA  A  1 141 ? -49.332 40.751  -71.711 1.00 76.51  ? 141 DA  I "C2'" 1 
ATOM   2877  C  "C1'" . DA  A  1 141 ? -50.734 40.448  -71.202 1.00 70.18  ? 141 DA  I "C1'" 1 
ATOM   2878  N  N9    . DA  A  1 141 ? -51.770 41.248  -71.843 1.00 70.89  ? 141 DA  I N9    1 
ATOM   2879  C  C8    . DA  A  1 141 ? -51.793 42.611  -71.981 1.00 81.46  ? 141 DA  I C8    1 
ATOM   2880  N  N7    . DA  A  1 141 ? -52.862 43.065  -72.593 1.00 72.09  ? 141 DA  I N7    1 
ATOM   2881  C  C5    . DA  A  1 141 ? -53.589 41.922  -72.875 1.00 73.39  ? 141 DA  I C5    1 
ATOM   2882  C  C6    . DA  A  1 141 ? -54.822 41.721  -73.515 1.00 74.01  ? 141 DA  I C6    1 
ATOM   2883  N  N6    . DA  A  1 141 ? -55.564 42.718  -74.003 1.00 78.54  ? 141 DA  I N6    1 
ATOM   2884  N  N1    . DA  A  1 141 ? -55.266 40.451  -73.634 1.00 77.11  ? 141 DA  I N1    1 
ATOM   2885  C  C2    . DA  A  1 141 ? -54.518 39.455  -73.142 1.00 75.54  ? 141 DA  I C2    1 
ATOM   2886  N  N3    . DA  A  1 141 ? -53.343 39.520  -72.519 1.00 72.24  ? 141 DA  I N3    1 
ATOM   2887  C  C4    . DA  A  1 141 ? -52.930 40.793  -72.417 1.00 74.29  ? 141 DA  I C4    1 
ATOM   2888  P  P     . DT  A  1 142 ? -46.912 38.573  -71.433 1.00 79.86  ? 142 DT  I P     1 
ATOM   2889  O  OP1   . DT  A  1 142 ? -46.069 37.621  -70.675 1.00 83.49  ? 142 DT  I OP1   1 
ATOM   2890  O  OP2   . DT  A  1 142 ? -46.291 39.742  -72.100 1.00 73.91  ? 142 DT  I OP2   1 
ATOM   2891  O  "O5'" . DT  A  1 142 ? -47.748 37.751  -72.511 1.00 74.40  ? 142 DT  I "O5'" 1 
ATOM   2892  C  "C5'" . DT  A  1 142 ? -48.837 36.959  -72.073 1.00 74.07  ? 142 DT  I "C5'" 1 
ATOM   2893  C  "C4'" . DT  A  1 142 ? -49.519 36.284  -73.241 1.00 76.82  ? 142 DT  I "C4'" 1 
ATOM   2894  O  "O4'" . DT  A  1 142 ? -50.651 37.081  -73.668 1.00 72.97  ? 142 DT  I "O4'" 1 
ATOM   2895  C  "C3'" . DT  A  1 142 ? -48.638 36.081  -74.473 1.00 77.11  ? 142 DT  I "C3'" 1 
ATOM   2896  O  "O3'" . DT  A  1 142 ? -48.817 34.758  -74.964 1.00 74.59  ? 142 DT  I "O3'" 1 
ATOM   2897  C  "C2'" . DT  A  1 142 ? -49.152 37.136  -75.455 1.00 70.61  ? 142 DT  I "C2'" 1 
ATOM   2898  C  "C1'" . DT  A  1 142 ? -50.617 37.238  -75.062 1.00 69.83  ? 142 DT  I "C1'" 1 
ATOM   2899  N  N1    . DT  A  1 142 ? -51.235 38.547  -75.387 1.00 72.62  ? 142 DT  I N1    1 
ATOM   2900  C  C2    . DT  A  1 142 ? -52.502 38.574  -75.918 1.00 72.68  ? 142 DT  I C2    1 
ATOM   2901  O  O2    . DT  A  1 142 ? -53.150 37.568  -76.144 1.00 75.48  ? 142 DT  I O2    1 
ATOM   2902  N  N3    . DT  A  1 142 ? -52.988 39.827  -76.178 1.00 71.37  ? 142 DT  I N3    1 
ATOM   2903  C  C4    . DT  A  1 142 ? -52.345 41.034  -75.962 1.00 73.65  ? 142 DT  I C4    1 
ATOM   2904  O  O4    . DT  A  1 142 ? -52.865 42.113  -76.230 1.00 73.51  ? 142 DT  I O4    1 
ATOM   2905  C  C5    . DT  A  1 142 ? -51.018 40.933  -75.399 1.00 67.51  ? 142 DT  I C5    1 
ATOM   2906  C  C7    . DT  A  1 142 ? -50.223 42.173  -75.121 1.00 68.65  ? 142 DT  I C7    1 
ATOM   2907  C  C6    . DT  A  1 142 ? -50.534 39.709  -75.139 1.00 70.24  ? 142 DT  I C6    1 
ATOM   2908  P  P     . DT  A  1 143 ? -47.946 34.201  -76.194 1.00 64.95  ? 143 DT  I P     1 
ATOM   2909  O  OP1   . DT  A  1 143 ? -47.587 32.807  -75.851 1.00 70.82  ? 143 DT  I OP1   1 
ATOM   2910  O  OP2   . DT  A  1 143 ? -46.881 35.175  -76.525 1.00 79.40  ? 143 DT  I OP2   1 
ATOM   2911  O  "O5'" . DT  A  1 143 ? -48.998 34.173  -77.398 1.00 77.24  ? 143 DT  I "O5'" 1 
ATOM   2912  C  "C5'" . DT  A  1 143 ? -50.321 33.690  -77.154 1.00 82.74  ? 143 DT  I "C5'" 1 
ATOM   2913  C  "C4'" . DT  A  1 143 ? -51.188 33.793  -78.396 1.00 79.39  ? 143 DT  I "C4'" 1 
ATOM   2914  O  "O4'" . DT  A  1 143 ? -51.895 35.062  -78.404 1.00 81.40  ? 143 DT  I "O4'" 1 
ATOM   2915  C  "C3'" . DT  A  1 143 ? -50.439 33.717  -79.728 1.00 80.71  ? 143 DT  I "C3'" 1 
ATOM   2916  O  "O3'" . DT  A  1 143 ? -51.185 32.923  -80.639 1.00 86.83  ? 143 DT  I "O3'" 1 
ATOM   2917  C  "C2'" . DT  A  1 143 ? -50.396 35.177  -80.169 1.00 78.09  ? 143 DT  I "C2'" 1 
ATOM   2918  C  "C1'" . DT  A  1 143 ? -51.746 35.656  -79.670 1.00 83.84  ? 143 DT  I "C1'" 1 
ATOM   2919  N  N1    . DT  A  1 143 ? -51.847 37.134  -79.524 1.00 78.62  ? 143 DT  I N1    1 
ATOM   2920  C  C2    . DT  A  1 143 ? -53.052 37.757  -79.781 1.00 83.68  ? 143 DT  I C2    1 
ATOM   2921  O  O2    . DT  A  1 143 ? -54.061 37.157  -80.123 1.00 81.16  ? 143 DT  I O2    1 
ATOM   2922  N  N3    . DT  A  1 143 ? -53.037 39.117  -79.621 1.00 78.53  ? 143 DT  I N3    1 
ATOM   2923  C  C4    . DT  A  1 143 ? -51.963 39.902  -79.239 1.00 79.17  ? 143 DT  I C4    1 
ATOM   2924  O  O4    . DT  A  1 143 ? -52.053 41.121  -79.126 1.00 76.52  ? 143 DT  I O4    1 
ATOM   2925  C  C5    . DT  A  1 143 ? -50.729 39.184  -78.988 1.00 76.27  ? 143 DT  I C5    1 
ATOM   2926  C  C7    . DT  A  1 143 ? -49.492 39.926  -78.569 1.00 72.86  ? 143 DT  I C7    1 
ATOM   2927  C  C6    . DT  A  1 143 ? -50.733 37.851  -79.142 1.00 69.51  ? 143 DT  I C6    1 
ATOM   2928  P  P     . DG  A  1 144 ? -50.507 32.332  -81.971 1.00 94.36  ? 144 DG  I P     1 
ATOM   2929  O  OP1   . DG  A  1 144 ? -50.430 30.863  -81.804 1.00 101.11 ? 144 DG  I OP1   1 
ATOM   2930  O  OP2   . DG  A  1 144 ? -49.293 33.116  -82.294 1.00 74.85  ? 144 DG  I OP2   1 
ATOM   2931  O  "O5'" . DG  A  1 144 ? -51.580 32.653  -83.106 1.00 91.28  ? 144 DG  I "O5'" 1 
ATOM   2932  C  "C5'" . DG  A  1 144 ? -52.956 32.356  -82.891 1.00 96.41  ? 144 DG  I "C5'" 1 
ATOM   2933  C  "C4'" . DG  A  1 144 ? -53.824 33.237  -83.764 1.00 95.68  ? 144 DG  I "C4'" 1 
ATOM   2934  O  "O4'" . DG  A  1 144 ? -53.836 34.583  -83.219 1.00 89.91  ? 144 DG  I "O4'" 1 
ATOM   2935  C  "C3'" . DG  A  1 144 ? -53.340 33.364  -85.210 1.00 101.56 ? 144 DG  I "C3'" 1 
ATOM   2936  O  "O3'" . DG  A  1 144 ? -54.432 33.271  -86.113 1.00 112.01 ? 144 DG  I "O3'" 1 
ATOM   2937  C  "C2'" . DG  A  1 144 ? -52.698 34.746  -85.250 1.00 99.18  ? 144 DG  I "C2'" 1 
ATOM   2938  C  "C1'" . DG  A  1 144 ? -53.533 35.506  -84.235 1.00 92.64  ? 144 DG  I "C1'" 1 
ATOM   2939  N  N9    . DG  A  1 144 ? -52.820 36.632  -83.649 1.00 88.54  ? 144 DG  I N9    1 
ATOM   2940  C  C8    . DG  A  1 144 ? -51.526 36.639  -83.190 1.00 86.36  ? 144 DG  I C8    1 
ATOM   2941  N  N7    . DG  A  1 144 ? -51.143 37.797  -82.733 1.00 84.06  ? 144 DG  I N7    1 
ATOM   2942  C  C5    . DG  A  1 144 ? -52.252 38.613  -82.906 1.00 86.03  ? 144 DG  I C5    1 
ATOM   2943  C  C6    . DG  A  1 144 ? -52.432 39.978  -82.592 1.00 86.02  ? 144 DG  I C6    1 
ATOM   2944  O  O6    . DG  A  1 144 ? -51.617 40.762  -82.086 1.00 87.88  ? 144 DG  I O6    1 
ATOM   2945  N  N1    . DG  A  1 144 ? -53.709 40.419  -82.930 1.00 90.58  ? 144 DG  I N1    1 
ATOM   2946  C  C2    . DG  A  1 144 ? -54.687 39.637  -83.497 1.00 91.62  ? 144 DG  I C2    1 
ATOM   2947  N  N2    . DG  A  1 144 ? -55.858 40.240  -83.750 1.00 101.55 ? 144 DG  I N2    1 
ATOM   2948  N  N3    . DG  A  1 144 ? -54.531 38.354  -83.795 1.00 87.32  ? 144 DG  I N3    1 
ATOM   2949  C  C4    . DG  A  1 144 ? -53.292 37.911  -83.472 1.00 90.24  ? 144 DG  I C4    1 
ATOM   2950  P  P     . DA  A  1 145 ? -54.162 33.258  -87.698 1.00 114.36 ? 145 DA  I P     1 
ATOM   2951  O  OP1   . DA  A  1 145 ? -55.078 32.256  -88.287 1.00 104.25 ? 145 DA  I OP1   1 
ATOM   2952  O  OP2   . DA  A  1 145 ? -52.702 33.128  -87.913 1.00 106.18 ? 145 DA  I OP2   1 
ATOM   2953  O  "O5'" . DA  A  1 145 ? -54.583 34.730  -88.179 1.00 111.30 ? 145 DA  I "O5'" 1 
ATOM   2954  C  "C5'" . DA  A  1 145 ? -55.947 35.141  -88.125 1.00 104.05 ? 145 DA  I "C5'" 1 
ATOM   2955  C  "C4'" . DA  A  1 145 ? -56.078 36.642  -88.340 1.00 115.55 ? 145 DA  I "C4'" 1 
ATOM   2956  O  "O4'" . DA  A  1 145 ? -55.260 37.351  -87.366 1.00 107.28 ? 145 DA  I "O4'" 1 
ATOM   2957  C  "C3'" . DA  A  1 145 ? -55.629 37.155  -89.716 1.00 124.64 ? 145 DA  I "C3'" 1 
ATOM   2958  O  "O3'" . DA  A  1 145 ? -56.526 38.177  -90.177 1.00 136.48 ? 145 DA  I "O3'" 1 
ATOM   2959  C  "C2'" . DA  A  1 145 ? -54.248 37.732  -89.420 1.00 115.95 ? 145 DA  I "C2'" 1 
ATOM   2960  C  "C1'" . DA  A  1 145 ? -54.489 38.318  -88.042 1.00 110.15 ? 145 DA  I "C1'" 1 
ATOM   2961  N  N9    . DA  A  1 145 ? -53.266 38.573  -87.289 1.00 102.89 ? 145 DA  I N9    1 
ATOM   2962  C  C8    . DA  A  1 145 ? -52.257 37.688  -87.023 1.00 98.53  ? 145 DA  I C8    1 
ATOM   2963  N  N7    . DA  A  1 145 ? -51.272 38.203  -86.325 1.00 90.80  ? 145 DA  I N7    1 
ATOM   2964  C  C5    . DA  A  1 145 ? -51.662 39.518  -86.123 1.00 96.38  ? 145 DA  I C5    1 
ATOM   2965  C  C6    . DA  A  1 145 ? -51.053 40.597  -85.452 1.00 101.49 ? 145 DA  I C6    1 
ATOM   2966  N  N6    . DA  A  1 145 ? -49.869 40.505  -84.837 1.00 101.56 ? 145 DA  I N6    1 
ATOM   2967  N  N1    . DA  A  1 145 ? -51.710 41.779  -85.438 1.00 104.43 ? 145 DA  I N1    1 
ATOM   2968  C  C2    . DA  A  1 145 ? -52.896 41.864  -86.053 1.00 104.05 ? 145 DA  I C2    1 
ATOM   2969  N  N3    . DA  A  1 145 ? -53.565 40.922  -86.716 1.00 101.83 ? 145 DA  I N3    1 
ATOM   2970  C  C4    . DA  A  1 145 ? -52.887 39.762  -86.713 1.00 97.71  ? 145 DA  I C4    1 
ATOM   2971  P  P     . DT  A  1 146 ? -56.609 38.557  -91.740 1.00 147.85 ? 146 DT  I P     1 
ATOM   2972  O  OP1   . DT  A  1 146 ? -57.609 37.656  -92.358 1.00 141.79 ? 146 DT  I OP1   1 
ATOM   2973  O  OP2   . DT  A  1 146 ? -55.232 38.601  -92.284 1.00 131.72 ? 146 DT  I OP2   1 
ATOM   2974  O  "O5'" . DT  A  1 146 ? -57.195 40.054  -91.751 1.00 146.18 ? 146 DT  I "O5'" 1 
ATOM   2975  C  "C5'" . DT  A  1 146 ? -56.407 41.149  -91.263 1.00 139.43 ? 146 DT  I "C5'" 1 
ATOM   2976  C  "C4'" . DT  A  1 146 ? -57.067 42.484  -91.589 1.00 147.80 ? 146 DT  I "C4'" 1 
ATOM   2977  O  "O4'" . DT  A  1 146 ? -56.693 43.468  -90.598 1.00 148.67 ? 146 DT  I "O4'" 1 
ATOM   2978  C  "C3'" . DT  A  1 146 ? -56.670 43.100  -92.921 1.00 149.04 ? 146 DT  I "C3'" 1 
ATOM   2979  O  "O3'" . DT  A  1 146 ? -57.708 43.954  -93.395 1.00 149.35 ? 146 DT  I "O3'" 1 
ATOM   2980  C  "C2'" . DT  A  1 146 ? -55.414 43.894  -92.561 1.00 146.03 ? 146 DT  I "C2'" 1 
ATOM   2981  C  "C1'" . DT  A  1 146 ? -55.669 44.307  -91.106 1.00 146.03 ? 146 DT  I "C1'" 1 
ATOM   2982  N  N1    . DT  A  1 146 ? -54.473 44.143  -90.238 1.00 141.02 ? 146 DT  I N1    1 
ATOM   2983  C  C2    . DT  A  1 146 ? -54.251 45.027  -89.205 1.00 135.35 ? 146 DT  I C2    1 
ATOM   2984  O  O2    . DT  A  1 146 ? -54.989 45.964  -88.953 1.00 135.57 ? 146 DT  I O2    1 
ATOM   2985  N  N3    . DT  A  1 146 ? -53.122 44.772  -88.471 1.00 133.28 ? 146 DT  I N3    1 
ATOM   2986  C  C4    . DT  A  1 146 ? -52.214 43.745  -88.666 1.00 126.47 ? 146 DT  I C4    1 
ATOM   2987  O  O4    . DT  A  1 146 ? -51.231 43.596  -87.953 1.00 119.40 ? 146 DT  I O4    1 
ATOM   2988  C  C5    . DT  A  1 146 ? -52.512 42.857  -89.766 1.00 127.82 ? 146 DT  I C5    1 
ATOM   2989  C  C7    . DT  A  1 146 ? -51.608 41.706  -90.080 1.00 114.23 ? 146 DT  I C7    1 
ATOM   2990  C  C6    . DT  A  1 146 ? -53.611 43.098  -90.486 1.00 136.42 ? 146 DT  I C6    1 
ATOM   2991  O  "O5'" . DA  B  1 1   ? -43.005 49.908  -82.004 1.00 143.42 ? 147 DA  J "O5'" 1 
ATOM   2992  C  "C5'" . DA  B  1 1   ? -43.951 48.928  -82.422 1.00 145.49 ? 147 DA  J "C5'" 1 
ATOM   2993  C  "C4'" . DA  B  1 1   ? -45.124 49.574  -83.142 1.00 148.66 ? 147 DA  J "C4'" 1 
ATOM   2994  O  "O4'" . DA  B  1 1   ? -45.724 48.603  -84.048 1.00 146.52 ? 147 DA  J "O4'" 1 
ATOM   2995  C  "C3'" . DA  B  1 1   ? -46.268 50.043  -82.236 1.00 152.87 ? 147 DA  J "C3'" 1 
ATOM   2996  O  "O3'" . DA  B  1 1   ? -46.915 51.184  -82.816 1.00 163.64 ? 147 DA  J "O3'" 1 
ATOM   2997  C  "C2'" . DA  B  1 1   ? -47.184 48.832  -82.250 1.00 149.06 ? 147 DA  J "C2'" 1 
ATOM   2998  C  "C1'" . DA  B  1 1   ? -47.088 48.455  -83.715 1.00 146.39 ? 147 DA  J "C1'" 1 
ATOM   2999  N  N9    . DA  B  1 1   ? -47.521 47.091  -84.001 1.00 140.65 ? 147 DA  J N9    1 
ATOM   3000  C  C8    . DA  B  1 1   ? -46.945 45.925  -83.573 1.00 135.08 ? 147 DA  J C8    1 
ATOM   3001  N  N7    . DA  B  1 1   ? -47.569 44.845  -83.988 1.00 128.99 ? 147 DA  J N7    1 
ATOM   3002  C  C5    . DA  B  1 1   ? -48.629 45.340  -84.735 1.00 129.71 ? 147 DA  J C5    1 
ATOM   3003  C  C6    . DA  B  1 1   ? -49.671 44.710  -85.449 1.00 123.11 ? 147 DA  J C6    1 
ATOM   3004  N  N6    . DA  B  1 1   ? -49.815 43.386  -85.524 1.00 111.60 ? 147 DA  J N6    1 
ATOM   3005  N  N1    . DA  B  1 1   ? -50.562 45.501  -86.084 1.00 124.33 ? 147 DA  J N1    1 
ATOM   3006  C  C2    . DA  B  1 1   ? -50.416 46.828  -86.009 1.00 127.73 ? 147 DA  J C2    1 
ATOM   3007  N  N3    . DA  B  1 1   ? -49.485 47.532  -85.371 1.00 131.79 ? 147 DA  J N3    1 
ATOM   3008  C  C4    . DA  B  1 1   ? -48.613 46.721  -84.750 1.00 134.81 ? 147 DA  J C4    1 
ATOM   3009  P  P     . DT  B  1 2   ? -48.314 51.732  -82.229 1.00 174.44 ? 148 DT  J P     1 
ATOM   3010  O  OP1   . DT  B  1 2   ? -48.347 53.190  -82.479 1.00 166.87 ? 148 DT  J OP1   1 
ATOM   3011  O  OP2   . DT  B  1 2   ? -48.472 51.236  -80.843 1.00 163.15 ? 148 DT  J OP2   1 
ATOM   3012  O  "O5'" . DT  B  1 2   ? -49.437 51.037  -83.148 1.00 157.80 ? 148 DT  J "O5'" 1 
ATOM   3013  C  "C5'" . DT  B  1 2   ? -50.827 51.298  -82.893 1.00 152.02 ? 148 DT  J "C5'" 1 
ATOM   3014  C  "C4'" . DT  B  1 2   ? -51.718 50.773  -84.011 1.00 144.74 ? 148 DT  J "C4'" 1 
ATOM   3015  O  "O4'" . DT  B  1 2   ? -51.390 49.387  -84.280 1.00 139.30 ? 148 DT  J "O4'" 1 
ATOM   3016  C  "C3'" . DT  B  1 2   ? -53.201 50.750  -83.677 1.00 147.24 ? 148 DT  J "C3'" 1 
ATOM   3017  O  "O3'" . DT  B  1 2   ? -53.972 50.702  -84.873 1.00 145.65 ? 148 DT  J "O3'" 1 
ATOM   3018  C  "C2'" . DT  B  1 2   ? -53.307 49.444  -82.909 1.00 144.82 ? 148 DT  J "C2'" 1 
ATOM   3019  C  "C1'" . DT  B  1 2   ? -52.411 48.549  -83.758 1.00 142.21 ? 148 DT  J "C1'" 1 
ATOM   3020  N  N1    . DT  B  1 2   ? -51.770 47.445  -82.994 1.00 141.14 ? 148 DT  J N1    1 
ATOM   3021  C  C2    . DT  B  1 2   ? -52.009 46.144  -83.366 1.00 132.71 ? 148 DT  J C2    1 
ATOM   3022  O  O2    . DT  B  1 2   ? -52.732 45.837  -84.301 1.00 128.28 ? 148 DT  J O2    1 
ATOM   3023  N  N3    . DT  B  1 2   ? -51.368 45.204  -82.602 1.00 129.31 ? 148 DT  J N3    1 
ATOM   3024  C  C4    . DT  B  1 2   ? -50.533 45.430  -81.522 1.00 134.05 ? 148 DT  J C4    1 
ATOM   3025  O  O4    . DT  B  1 2   ? -50.005 44.515  -80.896 1.00 127.97 ? 148 DT  J O4    1 
ATOM   3026  C  C5    . DT  B  1 2   ? -50.324 46.818  -81.184 1.00 139.87 ? 148 DT  J C5    1 
ATOM   3027  C  C7    . DT  B  1 2   ? -49.437 47.188  -80.031 1.00 139.74 ? 148 DT  J C7    1 
ATOM   3028  C  C6    . DT  B  1 2   ? -50.946 47.748  -81.927 1.00 141.53 ? 148 DT  J C6    1 
ATOM   3029  P  P     . DC  B  1 3   ? -55.391 51.453  -84.948 1.00 155.87 ? 149 DC  J P     1 
ATOM   3030  O  OP1   . DC  B  1 3   ? -55.341 52.359  -86.119 1.00 151.51 ? 149 DC  J OP1   1 
ATOM   3031  O  OP2   . DC  B  1 3   ? -55.685 51.997  -83.603 1.00 146.80 ? 149 DC  J OP2   1 
ATOM   3032  O  "O5'" . DC  B  1 3   ? -56.442 50.284  -85.255 1.00 137.12 ? 149 DC  J "O5'" 1 
ATOM   3033  C  "C5'" . DC  B  1 3   ? -56.203 48.969  -84.784 1.00 124.91 ? 149 DC  J "C5'" 1 
ATOM   3034  C  "C4'" . DC  B  1 3   ? -57.208 48.000  -85.372 1.00 126.40 ? 149 DC  J "C4'" 1 
ATOM   3035  O  "O4'" . DC  B  1 3   ? -56.614 46.682  -85.457 1.00 124.14 ? 149 DC  J "O4'" 1 
ATOM   3036  C  "C3'" . DC  B  1 3   ? -58.470 47.816  -84.550 1.00 131.71 ? 149 DC  J "C3'" 1 
ATOM   3037  O  "O3'" . DC  B  1 3   ? -59.539 47.411  -85.387 1.00 135.33 ? 149 DC  J "O3'" 1 
ATOM   3038  C  "C2'" . DC  B  1 3   ? -58.067 46.702  -83.596 1.00 125.82 ? 149 DC  J "C2'" 1 
ATOM   3039  C  "C1'" . DC  B  1 3   ? -57.209 45.823  -84.500 1.00 123.21 ? 149 DC  J "C1'" 1 
ATOM   3040  N  N1    . DC  B  1 3   ? -56.128 45.124  -83.769 1.00 119.06 ? 149 DC  J N1    1 
ATOM   3041  C  C2    . DC  B  1 3   ? -55.675 43.881  -84.219 1.00 110.54 ? 149 DC  J C2    1 
ATOM   3042  O  O2    . DC  B  1 3   ? -56.185 43.382  -85.227 1.00 113.08 ? 149 DC  J O2    1 
ATOM   3043  N  N3    . DC  B  1 3   ? -54.686 43.259  -83.535 1.00 103.89 ? 149 DC  J N3    1 
ATOM   3044  C  C4    . DC  B  1 3   ? -54.162 43.832  -82.452 1.00 109.14 ? 149 DC  J C4    1 
ATOM   3045  N  N4    . DC  B  1 3   ? -53.191 43.180  -81.808 1.00 108.97 ? 149 DC  J N4    1 
ATOM   3046  C  C5    . DC  B  1 3   ? -54.617 45.097  -81.975 1.00 119.24 ? 149 DC  J C5    1 
ATOM   3047  C  C6    . DC  B  1 3   ? -55.589 45.702  -82.660 1.00 120.83 ? 149 DC  J C6    1 
ATOM   3048  P  P     . DA  B  1 4   ? -60.980 47.100  -84.749 1.00 136.95 ? 150 DA  J P     1 
ATOM   3049  O  OP1   . DA  B  1 4   ? -61.996 47.325  -85.801 1.00 138.33 ? 150 DA  J OP1   1 
ATOM   3050  O  OP2   . DA  B  1 4   ? -61.071 47.835  -83.467 1.00 130.77 ? 150 DA  J OP2   1 
ATOM   3051  O  "O5'" . DA  B  1 4   ? -60.916 45.542  -84.403 1.00 123.59 ? 150 DA  J "O5'" 1 
ATOM   3052  C  "C5'" . DA  B  1 4   ? -61.723 45.022  -83.364 1.00 120.05 ? 150 DA  J "C5'" 1 
ATOM   3053  C  "C4'" . DA  B  1 4   ? -61.559 43.520  -83.250 1.00 121.01 ? 150 DA  J "C4'" 1 
ATOM   3054  O  "O4'" . DA  B  1 4   ? -60.156 43.201  -83.054 1.00 119.25 ? 150 DA  J "O4'" 1 
ATOM   3055  C  "C3'" . DA  B  1 4   ? -62.306 42.892  -82.081 1.00 116.54 ? 150 DA  J "C3'" 1 
ATOM   3056  O  "O3'" . DA  B  1 4   ? -62.823 41.629  -82.444 1.00 110.13 ? 150 DA  J "O3'" 1 
ATOM   3057  C  "C2'" . DA  B  1 4   ? -61.237 42.770  -81.004 1.00 115.30 ? 150 DA  J "C2'" 1 
ATOM   3058  C  "C1'" . DA  B  1 4   ? -59.977 42.531  -81.824 1.00 113.00 ? 150 DA  J "C1'" 1 
ATOM   3059  N  N9    . DA  B  1 4   ? -58.785 43.063  -81.179 1.00 110.13 ? 150 DA  J N9    1 
ATOM   3060  C  C8    . DA  B  1 4   ? -58.578 44.352  -80.771 1.00 111.05 ? 150 DA  J C8    1 
ATOM   3061  N  N7    . DA  B  1 4   ? -57.413 44.547  -80.203 1.00 105.88 ? 150 DA  J N7    1 
ATOM   3062  C  C5    . DA  B  1 4   ? -56.817 43.298  -80.235 1.00 101.06 ? 150 DA  J C5    1 
ATOM   3063  C  C6    . DA  B  1 4   ? -55.568 42.835  -79.785 1.00 96.78  ? 150 DA  J C6    1 
ATOM   3064  N  N6    . DA  B  1 4   ? -54.663 43.624  -79.194 1.00 96.10  ? 150 DA  J N6    1 
ATOM   3065  N  N1    . DA  B  1 4   ? -55.281 41.529  -79.974 1.00 97.29  ? 150 DA  J N1    1 
ATOM   3066  C  C2    . DA  B  1 4   ? -56.193 40.746  -80.567 1.00 94.48  ? 150 DA  J C2    1 
ATOM   3067  N  N3    . DA  B  1 4   ? -57.400 41.068  -81.030 1.00 93.96  ? 150 DA  J N3    1 
ATOM   3068  C  C4    . DA  B  1 4   ? -57.652 42.370  -80.831 1.00 101.32 ? 150 DA  J C4    1 
ATOM   3069  P  P     . DA  B  1 5   ? -63.870 40.897  -81.472 1.00 121.75 ? 151 DA  J P     1 
ATOM   3070  O  OP1   . DA  B  1 5   ? -64.865 40.195  -82.312 1.00 117.55 ? 151 DA  J OP1   1 
ATOM   3071  O  OP2   . DA  B  1 5   ? -64.308 41.891  -80.464 1.00 121.78 ? 151 DA  J OP2   1 
ATOM   3072  O  "O5'" . DA  B  1 5   ? -62.985 39.811  -80.713 1.00 108.17 ? 151 DA  J "O5'" 1 
ATOM   3073  C  "C5'" . DA  B  1 5   ? -62.190 38.907  -81.458 1.00 105.69 ? 151 DA  J "C5'" 1 
ATOM   3074  C  "C4'" . DA  B  1 5   ? -61.611 37.834  -80.555 1.00 102.29 ? 151 DA  J "C4'" 1 
ATOM   3075  O  "O4'" . DA  B  1 5   ? -60.315 38.261  -80.063 1.00 101.77 ? 151 DA  J "O4'" 1 
ATOM   3076  C  "C3'" . DA  B  1 5   ? -62.449 37.514  -79.322 1.00 97.73  ? 151 DA  J "C3'" 1 
ATOM   3077  O  "O3'" . DA  B  1 5   ? -62.397 36.127  -79.051 1.00 87.79  ? 151 DA  J "O3'" 1 
ATOM   3078  C  "C2'" . DA  B  1 5   ? -61.774 38.329  -78.222 1.00 95.76  ? 151 DA  J "C2'" 1 
ATOM   3079  C  "C1'" . DA  B  1 5   ? -60.315 38.275  -78.651 1.00 97.64  ? 151 DA  J "C1'" 1 
ATOM   3080  N  N9    . DA  B  1 5   ? -59.533 39.425  -78.212 1.00 90.94  ? 151 DA  J N9    1 
ATOM   3081  C  C8    . DA  B  1 5   ? -59.961 40.717  -78.090 1.00 90.60  ? 151 DA  J C8    1 
ATOM   3082  N  N7    . DA  B  1 5   ? -59.030 41.544  -77.677 1.00 92.14  ? 151 DA  J N7    1 
ATOM   3083  C  C5    . DA  B  1 5   ? -57.915 40.737  -77.521 1.00 86.36  ? 151 DA  J C5    1 
ATOM   3084  C  C6    . DA  B  1 5   ? -56.598 41.008  -77.107 1.00 80.78  ? 151 DA  J C6    1 
ATOM   3085  N  N6    . DA  B  1 5   ? -56.174 42.226  -76.763 1.00 84.28  ? 151 DA  J N6    1 
ATOM   3086  N  N1    . DA  B  1 5   ? -55.730 39.977  -77.063 1.00 78.76  ? 151 DA  J N1    1 
ATOM   3087  C  C2    . DA  B  1 5   ? -56.157 38.760  -77.412 1.00 77.82  ? 151 DA  J C2    1 
ATOM   3088  N  N3    . DA  B  1 5   ? -57.367 38.382  -77.816 1.00 83.83  ? 151 DA  J N3    1 
ATOM   3089  C  C4    . DA  B  1 5   ? -58.207 39.429  -77.849 1.00 86.89  ? 151 DA  J C4    1 
ATOM   3090  P  P     . DT  B  1 6   ? -63.589 35.427  -78.234 1.00 106.07 ? 152 DT  J P     1 
ATOM   3091  O  OP1   . DT  B  1 6   ? -63.624 33.994  -78.604 1.00 97.77  ? 152 DT  J OP1   1 
ATOM   3092  O  OP2   . DT  B  1 6   ? -64.799 36.263  -78.406 1.00 110.07 ? 152 DT  J OP2   1 
ATOM   3093  O  "O5'" . DT  B  1 6   ? -63.135 35.568  -76.709 1.00 97.82  ? 152 DT  J "O5'" 1 
ATOM   3094  C  "C5'" . DT  B  1 6   ? -62.927 34.406  -75.919 1.00 103.91 ? 152 DT  J "C5'" 1 
ATOM   3095  C  "C4'" . DT  B  1 6   ? -61.494 33.914  -76.042 1.00 104.72 ? 152 DT  J "C4'" 1 
ATOM   3096  O  "O4'" . DT  B  1 6   ? -60.605 35.044  -76.271 1.00 101.26 ? 152 DT  J "O4'" 1 
ATOM   3097  C  "C3'" . DT  B  1 6   ? -60.962 33.196  -74.802 1.00 94.52  ? 152 DT  J "C3'" 1 
ATOM   3098  O  "O3'" . DT  B  1 6   ? -60.239 32.038  -75.173 1.00 87.74  ? 152 DT  J "O3'" 1 
ATOM   3099  C  "C2'" . DT  B  1 6   ? -60.059 34.238  -74.150 1.00 90.56  ? 152 DT  J "C2'" 1 
ATOM   3100  C  "C1'" . DT  B  1 6   ? -59.534 34.994  -75.356 1.00 91.17  ? 152 DT  J "C1'" 1 
ATOM   3101  N  N1    . DT  B  1 6   ? -59.115 36.388  -75.035 1.00 85.41  ? 152 DT  J N1    1 
ATOM   3102  C  C2    . DT  B  1 6   ? -57.797 36.639  -74.726 1.00 87.63  ? 152 DT  J C2    1 
ATOM   3103  O  O2    . DT  B  1 6   ? -56.937 35.775  -74.709 1.00 92.90  ? 152 DT  J O2    1 
ATOM   3104  N  N3    . DT  B  1 6   ? -57.515 37.947  -74.437 1.00 79.82  ? 152 DT  J N3    1 
ATOM   3105  C  C4    . DT  B  1 6   ? -58.400 39.008  -74.424 1.00 80.00  ? 152 DT  J C4    1 
ATOM   3106  O  O4    . DT  B  1 6   ? -58.049 40.150  -74.152 1.00 74.39  ? 152 DT  J O4    1 
ATOM   3107  C  C5    . DT  B  1 6   ? -59.769 38.677  -74.751 1.00 86.68  ? 152 DT  J C5    1 
ATOM   3108  C  C7    . DT  B  1 6   ? -60.822 39.748  -74.769 1.00 84.39  ? 152 DT  J C7    1 
ATOM   3109  C  C6    . DT  B  1 6   ? -60.056 37.396  -75.035 1.00 85.35  ? 152 DT  J C6    1 
ATOM   3110  P  P     . DA  B  1 7   ? -60.195 30.783  -74.175 1.00 91.21  ? 153 DA  J P     1 
ATOM   3111  O  OP1   . DA  B  1 7   ? -59.899 29.556  -74.949 1.00 93.98  ? 153 DA  J OP1   1 
ATOM   3112  O  OP2   . DA  B  1 7   ? -61.408 30.875  -73.332 1.00 75.81  ? 153 DA  J OP2   1 
ATOM   3113  O  "O5'" . DA  B  1 7   ? -58.947 31.091  -73.237 1.00 92.53  ? 153 DA  J "O5'" 1 
ATOM   3114  C  "C5'" . DA  B  1 7   ? -59.148 31.708  -71.987 1.00 89.93  ? 153 DA  J "C5'" 1 
ATOM   3115  C  "C4'" . DA  B  1 7   ? -57.825 32.115  -71.386 1.00 82.85  ? 153 DA  J "C4'" 1 
ATOM   3116  O  "O4'" . DA  B  1 7   ? -57.544 33.496  -71.720 1.00 73.63  ? 153 DA  J "O4'" 1 
ATOM   3117  C  "C3'" . DA  B  1 7   ? -57.760 32.008  -69.873 1.00 79.39  ? 153 DA  J "C3'" 1 
ATOM   3118  O  "O3'" . DA  B  1 7   ? -56.504 31.507  -69.488 1.00 74.39  ? 153 DA  J "O3'" 1 
ATOM   3119  C  "C2'" . DA  B  1 7   ? -57.981 33.441  -69.389 1.00 75.90  ? 153 DA  J "C2'" 1 
ATOM   3120  C  "C1'" . DA  B  1 7   ? -57.488 34.293  -70.555 1.00 75.07  ? 153 DA  J "C1'" 1 
ATOM   3121  N  N9    . DA  B  1 7   ? -58.312 35.479  -70.774 1.00 79.48  ? 153 DA  J N9    1 
ATOM   3122  C  C8    . DA  B  1 7   ? -59.645 35.507  -71.077 1.00 84.69  ? 153 DA  J C8    1 
ATOM   3123  N  N7    . DA  B  1 7   ? -60.135 36.717  -71.216 1.00 81.46  ? 153 DA  J N7    1 
ATOM   3124  C  C5    . DA  B  1 7   ? -59.050 37.541  -70.982 1.00 79.07  ? 153 DA  J C5    1 
ATOM   3125  C  C6    . DA  B  1 7   ? -58.909 38.942  -70.977 1.00 77.12  ? 153 DA  J C6    1 
ATOM   3126  N  N6    . DA  B  1 7   ? -59.917 39.785  -71.226 1.00 75.64  ? 153 DA  J N6    1 
ATOM   3127  N  N1    . DA  B  1 7   ? -57.686 39.443  -70.705 1.00 79.61  ? 153 DA  J N1    1 
ATOM   3128  C  C2    . DA  B  1 7   ? -56.678 38.595  -70.458 1.00 79.44  ? 153 DA  J C2    1 
ATOM   3129  N  N3    . DA  B  1 7   ? -56.689 37.262  -70.435 1.00 75.08  ? 153 DA  J N3    1 
ATOM   3130  C  C4    . DA  B  1 7   ? -57.916 36.794  -70.707 1.00 78.48  ? 153 DA  J C4    1 
ATOM   3131  P  P     . DT  B  1 8   ? -56.159 31.323  -67.936 1.00 77.12  ? 154 DT  J P     1 
ATOM   3132  O  OP1   . DT  B  1 8   ? -55.242 30.165  -67.830 1.00 77.58  ? 154 DT  J OP1   1 
ATOM   3133  O  OP2   . DT  B  1 8   ? -57.435 31.322  -67.184 1.00 69.88  ? 154 DT  J OP2   1 
ATOM   3134  O  "O5'" . DT  B  1 8   ? -55.356 32.658  -67.582 1.00 72.98  ? 154 DT  J "O5'" 1 
ATOM   3135  C  "C5'" . DT  B  1 8   ? -54.346 33.125  -68.475 1.00 71.39  ? 154 DT  J "C5'" 1 
ATOM   3136  C  "C4'" . DT  B  1 8   ? -53.647 34.358  -67.927 1.00 70.52  ? 154 DT  J "C4'" 1 
ATOM   3137  O  "O4'" . DT  B  1 8   ? -54.443 35.549  -68.205 1.00 76.35  ? 154 DT  J "O4'" 1 
ATOM   3138  C  "C3'" . DT  B  1 8   ? -53.422 34.360  -66.418 1.00 67.72  ? 154 DT  J "C3'" 1 
ATOM   3139  O  "O3'" . DT  B  1 8   ? -52.197 35.047  -66.126 1.00 73.45  ? 154 DT  J "O3'" 1 
ATOM   3140  C  "C2'" . DT  B  1 8   ? -54.632 35.152  -65.929 1.00 72.18  ? 154 DT  J "C2'" 1 
ATOM   3141  C  "C1'" . DT  B  1 8   ? -54.672 36.234  -66.991 1.00 73.33  ? 154 DT  J "C1'" 1 
ATOM   3142  N  N1    . DT  B  1 8   ? -55.974 36.979  -67.079 1.00 72.00  ? 154 DT  J N1    1 
ATOM   3143  C  C2    . DT  B  1 8   ? -55.962 38.361  -67.081 1.00 77.35  ? 154 DT  J C2    1 
ATOM   3144  O  O2    . DT  B  1 8   ? -54.940 39.024  -67.013 1.00 80.18  ? 154 DT  J O2    1 
ATOM   3145  N  N3    . DT  B  1 8   ? -57.196 38.946  -67.170 1.00 72.95  ? 154 DT  J N3    1 
ATOM   3146  C  C4    . DT  B  1 8   ? -58.418 38.305  -67.253 1.00 79.13  ? 154 DT  J C4    1 
ATOM   3147  O  O4    . DT  B  1 8   ? -59.477 38.921  -67.329 1.00 76.88  ? 154 DT  J O4    1 
ATOM   3148  C  C5    . DT  B  1 8   ? -58.361 36.858  -67.245 1.00 75.91  ? 154 DT  J C5    1 
ATOM   3149  C  C7    . DT  B  1 8   ? -59.625 36.053  -67.330 1.00 76.45  ? 154 DT  J C7    1 
ATOM   3150  C  C6    . DT  B  1 8   ? -57.156 36.273  -67.160 1.00 70.08  ? 154 DT  J C6    1 
ATOM   3151  P  P     . DC  B  1 9   ? -51.265 34.596  -64.895 1.00 69.56  ? 155 DC  J P     1 
ATOM   3152  O  OP1   . DC  B  1 9   ? -49.875 34.547  -65.392 1.00 73.44  ? 155 DC  J OP1   1 
ATOM   3153  O  OP2   . DC  B  1 9   ? -51.892 33.434  -64.225 1.00 61.99  ? 155 DC  J OP2   1 
ATOM   3154  O  "O5'" . DC  B  1 9   ? -51.320 35.833  -63.895 1.00 64.35  ? 155 DC  J "O5'" 1 
ATOM   3155  C  "C5'" . DC  B  1 9   ? -52.483 36.606  -63.818 1.00 72.84  ? 155 DC  J "C5'" 1 
ATOM   3156  C  "C4'" . DC  B  1 9   ? -52.148 38.058  -63.619 1.00 69.35  ? 155 DC  J "C4'" 1 
ATOM   3157  O  "O4'" . DC  B  1 9   ? -53.236 38.865  -64.121 1.00 73.43  ? 155 DC  J "O4'" 1 
ATOM   3158  C  "C3'" . DC  B  1 9   ? -52.002 38.455  -62.171 1.00 74.71  ? 155 DC  J "C3'" 1 
ATOM   3159  O  "O3'" . DC  B  1 9   ? -51.207 39.620  -62.069 1.00 77.88  ? 155 DC  J "O3'" 1 
ATOM   3160  C  "C2'" . DC  B  1 9   ? -53.454 38.707  -61.761 1.00 77.38  ? 155 DC  J "C2'" 1 
ATOM   3161  C  "C1'" . DC  B  1 9   ? -54.073 39.261  -63.049 1.00 75.97  ? 155 DC  J "C1'" 1 
ATOM   3162  N  N1    . DC  B  1 9   ? -55.470 38.767  -63.314 1.00 75.75  ? 155 DC  J N1    1 
ATOM   3163  C  C2    . DC  B  1 9   ? -56.417 39.641  -63.858 1.00 72.94  ? 155 DC  J C2    1 
ATOM   3164  O  O2    . DC  B  1 9   ? -56.083 40.801  -64.116 1.00 73.21  ? 155 DC  J O2    1 
ATOM   3165  N  N3    . DC  B  1 9   ? -57.673 39.189  -64.092 1.00 74.95  ? 155 DC  J N3    1 
ATOM   3166  C  C4    . DC  B  1 9   ? -57.996 37.926  -63.803 1.00 78.36  ? 155 DC  J C4    1 
ATOM   3167  N  N4    . DC  B  1 9   ? -59.250 37.529  -64.054 1.00 75.83  ? 155 DC  J N4    1 
ATOM   3168  C  C5    . DC  B  1 9   ? -57.046 37.016  -63.245 1.00 69.91  ? 155 DC  J C5    1 
ATOM   3169  C  C6    . DC  B  1 9   ? -55.807 37.475  -63.017 1.00 73.33  ? 155 DC  J C6    1 
ATOM   3170  P  P     . DC  B  1 10  ? -50.574 40.044  -60.656 1.00 83.34  ? 156 DC  J P     1 
ATOM   3171  O  OP1   . DC  B  1 10  ? -49.102 40.063  -60.808 1.00 83.06  ? 156 DC  J OP1   1 
ATOM   3172  O  OP2   . DC  B  1 10  ? -51.205 39.212  -59.603 1.00 74.64  ? 156 DC  J OP2   1 
ATOM   3173  O  "O5'" . DC  B  1 10  ? -51.075 41.546  -60.468 1.00 76.37  ? 156 DC  J "O5'" 1 
ATOM   3174  C  "C5'" . DC  B  1 10  ? -51.890 42.143  -61.464 1.00 78.97  ? 156 DC  J "C5'" 1 
ATOM   3175  C  "C4'" . DC  B  1 10  ? -52.751 43.228  -60.857 1.00 84.27  ? 156 DC  J "C4'" 1 
ATOM   3176  O  "O4'" . DC  B  1 10  ? -54.151 42.956  -61.141 1.00 80.24  ? 156 DC  J "O4'" 1 
ATOM   3177  C  "C3'" . DC  B  1 10  ? -52.640 43.348  -59.342 1.00 82.95  ? 156 DC  J "C3'" 1 
ATOM   3178  O  "O3'" . DC  B  1 10  ? -52.725 44.716  -58.967 1.00 82.46  ? 156 DC  J "O3'" 1 
ATOM   3179  C  "C2'" . DC  B  1 10  ? -53.834 42.532  -58.847 1.00 83.63  ? 156 DC  J "C2'" 1 
ATOM   3180  C  "C1'" . DC  B  1 10  ? -54.868 42.787  -59.936 1.00 85.08  ? 156 DC  J "C1'" 1 
ATOM   3181  N  N1    . DC  B  1 10  ? -55.846 41.661  -60.115 1.00 85.92  ? 156 DC  J N1    1 
ATOM   3182  C  C2    . DC  B  1 10  ? -57.039 41.887  -60.808 1.00 85.89  ? 156 DC  J C2    1 
ATOM   3183  O  O2    . DC  B  1 10  ? -57.265 43.016  -61.267 1.00 88.28  ? 156 DC  J O2    1 
ATOM   3184  N  N3    . DC  B  1 10  ? -57.915 40.861  -60.962 1.00 77.58  ? 156 DC  J N3    1 
ATOM   3185  C  C4    . DC  B  1 10  ? -57.637 39.664  -60.452 1.00 74.53  ? 156 DC  J C4    1 
ATOM   3186  N  N4    . DC  B  1 10  ? -58.532 38.687  -60.629 1.00 76.87  ? 156 DC  J N4    1 
ATOM   3187  C  C5    . DC  B  1 10  ? -56.430 39.413  -59.738 1.00 78.65  ? 156 DC  J C5    1 
ATOM   3188  C  C6    . DC  B  1 10  ? -55.572 40.430  -59.593 1.00 81.18  ? 156 DC  J C6    1 
ATOM   3189  P  P     . DA  B  1 11  ? -52.494 45.182  -57.445 1.00 91.29  ? 157 DA  J P     1 
ATOM   3190  O  OP1   . DA  B  1 11  ? -51.330 46.096  -57.440 1.00 76.48  ? 157 DA  J OP1   1 
ATOM   3191  O  OP2   . DA  B  1 11  ? -52.506 44.006  -56.543 1.00 76.37  ? 157 DA  J OP2   1 
ATOM   3192  O  "O5'" . DA  B  1 11  ? -53.804 46.041  -57.147 1.00 93.89  ? 157 DA  J "O5'" 1 
ATOM   3193  C  "C5'" . DA  B  1 11  ? -54.892 45.984  -58.065 1.00 91.79  ? 157 DA  J "C5'" 1 
ATOM   3194  C  "C4'" . DA  B  1 11  ? -56.021 46.880  -57.615 1.00 93.12  ? 157 DA  J "C4'" 1 
ATOM   3195  O  "O4'" . DA  B  1 11  ? -57.285 46.244  -57.914 1.00 95.69  ? 157 DA  J "O4'" 1 
ATOM   3196  C  "C3'" . DA  B  1 11  ? -56.048 47.161  -56.125 1.00 94.35  ? 157 DA  J "C3'" 1 
ATOM   3197  O  "O3'" . DA  B  1 11  ? -56.631 48.428  -55.880 1.00 94.98  ? 157 DA  J "O3'" 1 
ATOM   3198  C  "C2'" . DA  B  1 11  ? -56.903 46.021  -55.572 1.00 92.84  ? 157 DA  J "C2'" 1 
ATOM   3199  C  "C1'" . DA  B  1 11  ? -57.835 45.675  -56.739 1.00 96.01  ? 157 DA  J "C1'" 1 
ATOM   3200  N  N9    . DA  B  1 11  ? -57.984 44.234  -56.943 1.00 91.79  ? 157 DA  J N9    1 
ATOM   3201  C  C8    . DA  B  1 11  ? -56.984 43.302  -56.965 1.00 91.51  ? 157 DA  J C8    1 
ATOM   3202  N  N7    . DA  B  1 11  ? -57.407 42.075  -57.160 1.00 92.22  ? 157 DA  J N7    1 
ATOM   3203  C  C5    . DA  B  1 11  ? -58.780 42.209  -57.273 1.00 90.54  ? 157 DA  J C5    1 
ATOM   3204  C  C6    . DA  B  1 11  ? -59.808 41.271  -57.488 1.00 94.76  ? 157 DA  J C6    1 
ATOM   3205  N  N6    . DA  B  1 11  ? -59.585 39.961  -57.634 1.00 92.20  ? 157 DA  J N6    1 
ATOM   3206  N  N1    . DA  B  1 11  ? -61.077 41.733  -57.549 1.00 97.46  ? 157 DA  J N1    1 
ATOM   3207  C  C2    . DA  B  1 11  ? -61.293 43.047  -57.401 1.00 98.89  ? 157 DA  J C2    1 
ATOM   3208  N  N3    . DA  B  1 11  ? -60.406 44.025  -57.195 1.00 97.17  ? 157 DA  J N3    1 
ATOM   3209  C  C4    . DA  B  1 11  ? -59.156 43.533  -57.141 1.00 90.02  ? 157 DA  J C4    1 
ATOM   3210  P  P     . DC  B  1 12  ? -56.649 49.039  -54.395 1.00 88.18  ? 158 DC  J P     1 
ATOM   3211  O  OP1   . DC  B  1 12  ? -56.442 50.499  -54.532 1.00 81.18  ? 158 DC  J OP1   1 
ATOM   3212  O  OP2   . DC  B  1 12  ? -55.757 48.235  -53.529 1.00 83.51  ? 158 DC  J OP2   1 
ATOM   3213  O  "O5'" . DC  B  1 12  ? -58.134 48.754  -53.897 1.00 83.51  ? 158 DC  J "O5'" 1 
ATOM   3214  C  "C5'" . DC  B  1 12  ? -59.219 48.954  -54.780 1.00 85.26  ? 158 DC  J "C5'" 1 
ATOM   3215  C  "C4'" . DC  B  1 12  ? -60.510 48.501  -54.139 1.00 82.35  ? 158 DC  J "C4'" 1 
ATOM   3216  O  "O4'" . DC  B  1 12  ? -60.780 47.125  -54.513 1.00 87.08  ? 158 DC  J "O4'" 1 
ATOM   3217  C  "C3'" . DC  B  1 12  ? -60.515 48.540  -52.609 1.00 86.17  ? 158 DC  J "C3'" 1 
ATOM   3218  O  "O3'" . DC  B  1 12  ? -61.780 49.046  -52.149 1.00 84.94  ? 158 DC  J "O3'" 1 
ATOM   3219  C  "C2'" . DC  B  1 12  ? -60.301 47.070  -52.235 1.00 85.30  ? 158 DC  J "C2'" 1 
ATOM   3220  C  "C1'" . DC  B  1 12  ? -61.048 46.369  -53.357 1.00 86.15  ? 158 DC  J "C1'" 1 
ATOM   3221  N  N1    . DC  B  1 12  ? -60.609 44.968  -53.597 1.00 88.47  ? 158 DC  J N1    1 
ATOM   3222  C  C2    . DC  B  1 12  ? -61.553 43.998  -53.946 1.00 92.46  ? 158 DC  J C2    1 
ATOM   3223  O  O2    . DC  B  1 12  ? -62.741 44.323  -54.046 1.00 94.53  ? 158 DC  J O2    1 
ATOM   3224  N  N3    . DC  B  1 12  ? -61.138 42.726  -54.166 1.00 92.62  ? 158 DC  J N3    1 
ATOM   3225  C  C4    . DC  B  1 12  ? -59.845 42.418  -54.052 1.00 94.33  ? 158 DC  J C4    1 
ATOM   3226  N  N4    . DC  B  1 12  ? -59.481 41.150  -54.276 1.00 95.06  ? 158 DC  J N4    1 
ATOM   3227  C  C5    . DC  B  1 12  ? -58.869 43.394  -53.695 1.00 88.96  ? 158 DC  J C5    1 
ATOM   3228  C  C6    . DC  B  1 12  ? -59.291 44.643  -53.479 1.00 88.08  ? 158 DC  J C6    1 
ATOM   3229  P  P     . DC  B  1 13  ? -62.060 49.336  -50.590 1.00 81.45  ? 159 DC  J P     1 
ATOM   3230  O  OP1   . DC  B  1 13  ? -62.480 50.747  -50.464 1.00 83.22  ? 159 DC  J OP1   1 
ATOM   3231  O  OP2   . DC  B  1 13  ? -60.919 48.852  -49.783 1.00 87.53  ? 159 DC  J OP2   1 
ATOM   3232  O  "O5'" . DC  B  1 13  ? -63.319 48.403  -50.285 1.00 83.52  ? 159 DC  J "O5'" 1 
ATOM   3233  C  "C5'" . DC  B  1 13  ? -63.505 47.250  -51.079 1.00 85.38  ? 159 DC  J "C5'" 1 
ATOM   3234  C  "C4'" . DC  B  1 13  ? -64.782 46.528  -50.749 1.00 81.40  ? 159 DC  J "C4'" 1 
ATOM   3235  O  "O4'" . DC  B  1 13  ? -64.660 45.160  -51.206 1.00 93.71  ? 159 DC  J "O4'" 1 
ATOM   3236  C  "C3'" . DC  B  1 13  ? -65.082 46.410  -49.274 1.00 84.36  ? 159 DC  J "C3'" 1 
ATOM   3237  O  "O3'" . DC  B  1 13  ? -66.462 46.139  -49.099 1.00 88.20  ? 159 DC  J "O3'" 1 
ATOM   3238  C  "C2'" . DC  B  1 13  ? -64.221 45.217  -48.881 1.00 95.55  ? 159 DC  J "C2'" 1 
ATOM   3239  C  "C1'" . DC  B  1 13  ? -64.362 44.315  -50.106 1.00 96.64  ? 159 DC  J "C1'" 1 
ATOM   3240  N  N1    . DC  B  1 13  ? -63.122 43.529  -50.409 1.00 92.69  ? 159 DC  J N1    1 
ATOM   3241  C  C2    . DC  B  1 13  ? -63.231 42.197  -50.824 1.00 96.24  ? 159 DC  J C2    1 
ATOM   3242  O  O2    . DC  B  1 13  ? -64.353 41.696  -50.952 1.00 96.90  ? 159 DC  J O2    1 
ATOM   3243  N  N3    . DC  B  1 13  ? -62.099 41.494  -51.083 1.00 93.79  ? 159 DC  J N3    1 
ATOM   3244  C  C4    . DC  B  1 13  ? -60.906 42.070  -50.933 1.00 93.12  ? 159 DC  J C4    1 
ATOM   3245  N  N4    . DC  B  1 13  ? -59.821 41.336  -51.197 1.00 90.34  ? 159 DC  J N4    1 
ATOM   3246  C  C5    . DC  B  1 13  ? -60.774 43.424  -50.503 1.00 94.44  ? 159 DC  J C5    1 
ATOM   3247  C  C6    . DC  B  1 13  ? -61.896 44.108  -50.252 1.00 91.99  ? 159 DC  J C6    1 
ATOM   3248  P  P     . DT  B  1 14  ? -67.038 45.729  -47.658 1.00 92.56  ? 160 DT  J P     1 
ATOM   3249  O  OP1   . DT  B  1 14  ? -68.452 46.165  -47.619 1.00 93.30  ? 160 DT  J OP1   1 
ATOM   3250  O  OP2   . DT  B  1 14  ? -66.096 46.211  -46.623 1.00 85.64  ? 160 DT  J OP2   1 
ATOM   3251  O  "O5'" . DT  B  1 14  ? -66.979 44.130  -47.666 1.00 90.74  ? 160 DT  J "O5'" 1 
ATOM   3252  C  "C5'" . DT  B  1 14  ? -67.672 43.388  -48.670 1.00 91.38  ? 160 DT  J "C5'" 1 
ATOM   3253  C  "C4'" . DT  B  1 14  ? -67.862 41.946  -48.233 1.00 100.57 ? 160 DT  J "C4'" 1 
ATOM   3254  O  "O4'" . DT  B  1 14  ? -66.688 41.169  -48.591 1.00 104.03 ? 160 DT  J "O4'" 1 
ATOM   3255  C  "C3'" . DT  B  1 14  ? -68.058 41.760  -46.728 1.00 104.06 ? 160 DT  J "C3'" 1 
ATOM   3256  O  "O3'" . DT  B  1 14  ? -69.068 40.794  -46.471 1.00 102.22 ? 160 DT  J "O3'" 1 
ATOM   3257  C  "C2'" . DT  B  1 14  ? -66.689 41.289  -46.246 1.00 106.18 ? 160 DT  J "C2'" 1 
ATOM   3258  C  "C1'" . DT  B  1 14  ? -66.176 40.511  -47.450 1.00 103.99 ? 160 DT  J "C1'" 1 
ATOM   3259  N  N1    . DT  B  1 14  ? -64.682 40.492  -47.541 1.00 101.88 ? 160 DT  J N1    1 
ATOM   3260  C  C2    . DT  B  1 14  ? -64.039 39.337  -47.928 1.00 100.71 ? 160 DT  J C2    1 
ATOM   3261  O  O2    . DT  B  1 14  ? -64.624 38.307  -48.216 1.00 102.03 ? 160 DT  J O2    1 
ATOM   3262  N  N3    . DT  B  1 14  ? -62.673 39.433  -47.973 1.00 99.33  ? 160 DT  J N3    1 
ATOM   3263  C  C4    . DT  B  1 14  ? -61.902 40.542  -47.671 1.00 94.61  ? 160 DT  J C4    1 
ATOM   3264  O  O4    . DT  B  1 14  ? -60.677 40.531  -47.741 1.00 94.55  ? 160 DT  J O4    1 
ATOM   3265  C  C5    . DT  B  1 14  ? -62.638 41.714  -47.269 1.00 95.42  ? 160 DT  J C5    1 
ATOM   3266  C  C7    . DT  B  1 14  ? -61.910 42.976  -46.917 1.00 108.43 ? 160 DT  J C7    1 
ATOM   3267  C  C6    . DT  B  1 14  ? -63.975 41.633  -47.223 1.00 97.36  ? 160 DT  J C6    1 
ATOM   3268  P  P     . DG  B  1 15  ? -69.918 40.874  -45.109 1.00 102.47 ? 161 DG  J P     1 
ATOM   3269  O  OP1   . DG  B  1 15  ? -71.329 41.143  -45.464 1.00 111.29 ? 161 DG  J OP1   1 
ATOM   3270  O  OP2   . DG  B  1 15  ? -69.198 41.769  -44.174 1.00 92.87  ? 161 DG  J OP2   1 
ATOM   3271  O  "O5'" . DG  B  1 15  ? -69.820 39.402  -44.517 1.00 111.31 ? 161 DG  J "O5'" 1 
ATOM   3272  C  "C5'" . DG  B  1 15  ? -70.003 38.283  -45.365 1.00 116.38 ? 161 DG  J "C5'" 1 
ATOM   3273  C  "C4'" . DG  B  1 15  ? -69.309 37.067  -44.786 1.00 125.05 ? 161 DG  J "C4'" 1 
ATOM   3274  O  "O4'" . DG  B  1 15  ? -67.878 37.167  -45.022 1.00 120.18 ? 161 DG  J "O4'" 1 
ATOM   3275  C  "C3'" . DG  B  1 15  ? -69.483 36.887  -43.278 1.00 124.74 ? 161 DG  J "C3'" 1 
ATOM   3276  O  "O3'" . DG  B  1 15  ? -69.668 35.513  -42.976 1.00 127.20 ? 161 DG  J "O3'" 1 
ATOM   3277  C  "C2'" . DG  B  1 15  ? -68.174 37.425  -42.705 1.00 120.57 ? 161 DG  J "C2'" 1 
ATOM   3278  C  "C1'" . DG  B  1 15  ? -67.177 37.078  -43.799 1.00 119.07 ? 161 DG  J "C1'" 1 
ATOM   3279  N  N9    . DG  B  1 15  ? -66.047 37.998  -43.848 1.00 111.85 ? 161 DG  J N9    1 
ATOM   3280  C  C8    . DG  B  1 15  ? -66.061 39.337  -43.546 1.00 109.73 ? 161 DG  J C8    1 
ATOM   3281  N  N7    . DG  B  1 15  ? -64.898 39.912  -43.675 1.00 108.65 ? 161 DG  J N7    1 
ATOM   3282  C  C5    . DG  B  1 15  ? -64.057 38.887  -44.086 1.00 106.25 ? 161 DG  J C5    1 
ATOM   3283  C  C6    . DG  B  1 15  ? -62.676 38.909  -44.385 1.00 101.36 ? 161 DG  J C6    1 
ATOM   3284  O  O6    . DG  B  1 15  ? -61.898 39.872  -44.344 1.00 94.37  ? 161 DG  J O6    1 
ATOM   3285  N  N1    . DG  B  1 15  ? -62.211 37.650  -44.763 1.00 108.70 ? 161 DG  J N1    1 
ATOM   3286  C  C2    . DG  B  1 15  ? -62.987 36.516  -44.843 1.00 110.44 ? 161 DG  J C2    1 
ATOM   3287  N  N2    . DG  B  1 15  ? -62.361 35.393  -45.226 1.00 106.44 ? 161 DG  J N2    1 
ATOM   3288  N  N3    . DG  B  1 15  ? -64.284 36.484  -44.566 1.00 110.23 ? 161 DG  J N3    1 
ATOM   3289  C  C4    . DG  B  1 15  ? -64.749 37.701  -44.196 1.00 109.17 ? 161 DG  J C4    1 
ATOM   3290  P  P     . DC  B  1 16  ? -69.968 35.030  -41.471 1.00 138.52 ? 162 DC  J P     1 
ATOM   3291  O  OP1   . DC  B  1 16  ? -71.184 34.188  -41.532 1.00 150.30 ? 162 DC  J OP1   1 
ATOM   3292  O  OP2   . DC  B  1 16  ? -69.930 36.186  -40.546 1.00 120.59 ? 162 DC  J OP2   1 
ATOM   3293  O  "O5'" . DC  B  1 16  ? -68.719 34.093  -41.142 1.00 131.37 ? 162 DC  J "O5'" 1 
ATOM   3294  C  "C5'" . DC  B  1 16  ? -67.837 33.715  -42.192 1.00 128.82 ? 162 DC  J "C5'" 1 
ATOM   3295  C  "C4'" . DC  B  1 16  ? -66.901 32.609  -41.748 1.00 127.60 ? 162 DC  J "C4'" 1 
ATOM   3296  O  "O4'" . DC  B  1 16  ? -65.541 33.102  -41.745 1.00 125.61 ? 162 DC  J "O4'" 1 
ATOM   3297  C  "C3'" . DC  B  1 16  ? -67.144 32.084  -40.343 1.00 128.69 ? 162 DC  J "C3'" 1 
ATOM   3298  O  "O3'" . DC  B  1 16  ? -66.698 30.739  -40.251 1.00 134.33 ? 162 DC  J "O3'" 1 
ATOM   3299  C  "C2'" . DC  B  1 16  ? -66.287 33.017  -39.490 1.00 126.66 ? 162 DC  J "C2'" 1 
ATOM   3300  C  "C1'" . DC  B  1 16  ? -65.103 33.317  -40.414 1.00 125.25 ? 162 DC  J "C1'" 1 
ATOM   3301  N  N1    . DC  B  1 16  ? -64.610 34.722  -40.305 1.00 122.04 ? 162 DC  J N1    1 
ATOM   3302  C  C2    . DC  B  1 16  ? -63.626 35.186  -41.187 1.00 117.96 ? 162 DC  J C2    1 
ATOM   3303  O  O2    . DC  B  1 16  ? -63.171 34.418  -42.045 1.00 115.16 ? 162 DC  J O2    1 
ATOM   3304  N  N3    . DC  B  1 16  ? -63.191 36.465  -41.072 1.00 112.23 ? 162 DC  J N3    1 
ATOM   3305  C  C4    . DC  B  1 16  ? -63.704 37.263  -40.134 1.00 117.07 ? 162 DC  J C4    1 
ATOM   3306  N  N4    . DC  B  1 16  ? -63.244 38.517  -40.060 1.00 115.07 ? 162 DC  J N4    1 
ATOM   3307  C  C5    . DC  B  1 16  ? -64.707 36.809  -39.226 1.00 121.45 ? 162 DC  J C5    1 
ATOM   3308  C  C6    . DC  B  1 16  ? -65.127 35.546  -39.348 1.00 120.91 ? 162 DC  J C6    1 
ATOM   3309  P  P     . DA  B  1 17  ? -67.425 29.695  -39.267 1.00 129.90 ? 163 DA  J P     1 
ATOM   3310  O  OP1   . DA  B  1 17  ? -68.715 29.307  -39.881 1.00 128.98 ? 163 DA  J OP1   1 
ATOM   3311  O  OP2   . DA  B  1 17  ? -67.394 30.256  -37.897 1.00 120.34 ? 163 DA  J OP2   1 
ATOM   3312  O  "O5'" . DA  B  1 17  ? -66.450 28.433  -39.297 1.00 129.02 ? 163 DA  J "O5'" 1 
ATOM   3313  C  "C5'" . DA  B  1 17  ? -65.776 28.100  -40.502 1.00 124.99 ? 163 DA  J "C5'" 1 
ATOM   3314  C  "C4'" . DA  B  1 17  ? -64.272 28.088  -40.295 1.00 122.54 ? 163 DA  J "C4'" 1 
ATOM   3315  O  "O4'" . DA  B  1 17  ? -63.786 29.444  -40.111 1.00 118.90 ? 163 DA  J "O4'" 1 
ATOM   3316  C  "C3'" . DA  B  1 17  ? -63.791 27.286  -39.083 1.00 122.85 ? 163 DA  J "C3'" 1 
ATOM   3317  O  "O3'" . DA  B  1 17  ? -62.771 26.386  -39.490 1.00 114.23 ? 163 DA  J "O3'" 1 
ATOM   3318  C  "C2'" . DA  B  1 17  ? -63.264 28.357  -38.120 1.00 120.57 ? 163 DA  J "C2'" 1 
ATOM   3319  C  "C1'" . DA  B  1 17  ? -62.839 29.459  -39.071 1.00 120.58 ? 163 DA  J "C1'" 1 
ATOM   3320  N  N9    . DA  B  1 17  ? -62.847 30.782  -38.457 1.00 122.66 ? 163 DA  J N9    1 
ATOM   3321  C  C8    . DA  B  1 17  ? -63.761 31.268  -37.563 1.00 123.22 ? 163 DA  J C8    1 
ATOM   3322  N  N7    . DA  B  1 17  ? -63.519 32.498  -37.174 1.00 120.27 ? 163 DA  J N7    1 
ATOM   3323  C  C5    . DA  B  1 17  ? -62.366 32.841  -37.859 1.00 119.54 ? 163 DA  J C5    1 
ATOM   3324  C  C6    . DA  B  1 17  ? -61.593 34.018  -37.883 1.00 119.79 ? 163 DA  J C6    1 
ATOM   3325  N  N6    . DA  B  1 17  ? -61.889 35.108  -37.166 1.00 117.20 ? 163 DA  J N6    1 
ATOM   3326  N  N1    . DA  B  1 17  ? -60.499 34.031  -38.677 1.00 122.17 ? 163 DA  J N1    1 
ATOM   3327  C  C2    . DA  B  1 17  ? -60.207 32.936  -39.392 1.00 118.80 ? 163 DA  J C2    1 
ATOM   3328  N  N3    . DA  B  1 17  ? -60.858 31.775  -39.453 1.00 119.09 ? 163 DA  J N3    1 
ATOM   3329  C  C4    . DA  B  1 17  ? -61.938 31.794  -38.655 1.00 121.74 ? 163 DA  J C4    1 
ATOM   3330  P  P     . DG  B  1 18  ? -62.013 25.447  -38.431 1.00 109.12 ? 164 DG  J P     1 
ATOM   3331  O  OP1   . DG  B  1 18  ? -62.001 24.087  -39.012 1.00 122.25 ? 164 DG  J OP1   1 
ATOM   3332  O  OP2   . DG  B  1 18  ? -62.556 25.652  -37.068 1.00 109.64 ? 164 DG  J OP2   1 
ATOM   3333  O  "O5'" . DG  B  1 18  ? -60.528 26.016  -38.453 1.00 105.94 ? 164 DG  J "O5'" 1 
ATOM   3334  C  "C5'" . DG  B  1 18  ? -59.978 26.485  -39.675 1.00 112.00 ? 164 DG  J "C5'" 1 
ATOM   3335  C  "C4'" . DG  B  1 18  ? -58.680 27.229  -39.431 1.00 113.15 ? 164 DG  J "C4'" 1 
ATOM   3336  O  "O4'" . DG  B  1 18  ? -58.961 28.499  -38.794 1.00 115.57 ? 164 DG  J "O4'" 1 
ATOM   3337  C  "C3'" . DG  B  1 18  ? -57.695 26.512  -38.522 1.00 114.02 ? 164 DG  J "C3'" 1 
ATOM   3338  O  "O3'" . DG  B  1 18  ? -56.367 26.794  -38.928 1.00 120.41 ? 164 DG  J "O3'" 1 
ATOM   3339  C  "C2'" . DG  B  1 18  ? -58.002 27.095  -37.145 1.00 109.78 ? 164 DG  J "C2'" 1 
ATOM   3340  C  "C1'" . DG  B  1 18  ? -58.445 28.516  -37.476 1.00 113.46 ? 164 DG  J "C1'" 1 
ATOM   3341  N  N9    . DG  B  1 18  ? -59.491 29.007  -36.589 1.00 116.42 ? 164 DG  J N9    1 
ATOM   3342  C  C8    . DG  B  1 18  ? -60.536 28.284  -36.066 1.00 118.74 ? 164 DG  J C8    1 
ATOM   3343  N  N7    . DG  B  1 18  ? -61.323 28.987  -35.302 1.00 120.49 ? 164 DG  J N7    1 
ATOM   3344  C  C5    . DG  B  1 18  ? -60.766 30.259  -35.319 1.00 118.80 ? 164 DG  J C5    1 
ATOM   3345  C  C6    . DG  B  1 18  ? -61.185 31.446  -34.674 1.00 119.06 ? 164 DG  J C6    1 
ATOM   3346  O  O6    . DG  B  1 18  ? -62.162 31.614  -33.932 1.00 116.86 ? 164 DG  J O6    1 
ATOM   3347  N  N1    . DG  B  1 18  ? -60.335 32.511  -34.956 1.00 120.88 ? 164 DG  J N1    1 
ATOM   3348  C  C2    . DG  B  1 18  ? -59.224 32.440  -35.763 1.00 117.23 ? 164 DG  J C2    1 
ATOM   3349  N  N2    . DG  B  1 18  ? -58.528 33.575  -35.915 1.00 118.02 ? 164 DG  J N2    1 
ATOM   3350  N  N3    . DG  B  1 18  ? -58.820 31.334  -36.374 1.00 115.69 ? 164 DG  J N3    1 
ATOM   3351  C  C4    . DG  B  1 18  ? -59.637 30.287  -36.108 1.00 117.99 ? 164 DG  J C4    1 
ATOM   3352  P  P     . DA  B  1 19  ? -55.180 25.783  -38.547 1.00 119.86 ? 165 DA  J P     1 
ATOM   3353  O  OP1   . DA  B  1 19  ? -54.536 25.334  -39.802 1.00 111.98 ? 165 DA  J OP1   1 
ATOM   3354  O  OP2   . DA  B  1 19  ? -55.739 24.789  -37.601 1.00 116.04 ? 165 DA  J OP2   1 
ATOM   3355  O  "O5'" . DA  B  1 19  ? -54.156 26.694  -37.730 1.00 102.43 ? 165 DA  J "O5'" 1 
ATOM   3356  C  "C5'" . DA  B  1 19  ? -54.548 27.233  -36.485 1.00 103.12 ? 165 DA  J "C5'" 1 
ATOM   3357  C  "C4'" . DA  B  1 19  ? -54.225 28.708  -36.415 1.00 99.14  ? 165 DA  J "C4'" 1 
ATOM   3358  O  "O4'" . DA  B  1 19  ? -55.427 29.450  -36.076 1.00 109.54 ? 165 DA  J "O4'" 1 
ATOM   3359  C  "C3'" . DA  B  1 19  ? -53.198 29.071  -35.357 1.00 96.64  ? 165 DA  J "C3'" 1 
ATOM   3360  O  "O3'" . DA  B  1 19  ? -52.422 30.173  -35.788 1.00 90.07  ? 165 DA  J "O3'" 1 
ATOM   3361  C  "C2'" . DA  B  1 19  ? -54.067 29.423  -34.155 1.00 105.25 ? 165 DA  J "C2'" 1 
ATOM   3362  C  "C1'" . DA  B  1 19  ? -55.278 30.070  -34.814 1.00 108.39 ? 165 DA  J "C1'" 1 
ATOM   3363  N  N9    . DA  B  1 19  ? -56.513 29.882  -34.054 1.00 115.45 ? 165 DA  J N9    1 
ATOM   3364  C  C8    . DA  B  1 19  ? -57.145 28.698  -33.790 1.00 114.73 ? 165 DA  J C8    1 
ATOM   3365  N  N7    . DA  B  1 19  ? -58.237 28.828  -33.075 1.00 119.89 ? 165 DA  J N7    1 
ATOM   3366  C  C5    . DA  B  1 19  ? -58.328 30.192  -32.851 1.00 118.92 ? 165 DA  J C5    1 
ATOM   3367  C  C6    . DA  B  1 19  ? -59.265 30.980  -32.154 1.00 122.76 ? 165 DA  J C6    1 
ATOM   3368  N  N6    . DA  B  1 19  ? -60.335 30.472  -31.532 1.00 128.43 ? 165 DA  J N6    1 
ATOM   3369  N  N1    . DA  B  1 19  ? -59.064 32.314  -32.124 1.00 123.73 ? 165 DA  J N1    1 
ATOM   3370  C  C2    . DA  B  1 19  ? -57.994 32.819  -32.749 1.00 119.46 ? 165 DA  J C2    1 
ATOM   3371  N  N3    . DA  B  1 19  ? -57.045 32.181  -33.432 1.00 120.44 ? 165 DA  J N3    1 
ATOM   3372  C  C4    . DA  B  1 19  ? -57.273 30.858  -33.446 1.00 118.11 ? 165 DA  J C4    1 
ATOM   3373  P  P     . DT  B  1 20  ? -51.002 30.472  -35.100 1.00 77.80  ? 166 DT  J P     1 
ATOM   3374  O  OP1   . DT  B  1 20  ? -49.976 30.414  -36.162 1.00 78.64  ? 166 DT  J OP1   1 
ATOM   3375  O  OP2   . DT  B  1 20  ? -50.893 29.603  -33.905 1.00 83.04  ? 166 DT  J OP2   1 
ATOM   3376  O  "O5'" . DT  B  1 20  ? -51.136 31.984  -34.603 1.00 80.77  ? 166 DT  J "O5'" 1 
ATOM   3377  C  "C5'" . DT  B  1 20  ? -52.410 32.474  -34.243 1.00 93.08  ? 166 DT  J "C5'" 1 
ATOM   3378  C  "C4'" . DT  B  1 20  ? -52.329 33.855  -33.638 1.00 98.72  ? 166 DT  J "C4'" 1 
ATOM   3379  O  "O4'" . DT  B  1 20  ? -53.542 34.091  -32.891 1.00 112.02 ? 166 DT  J "O4'" 1 
ATOM   3380  C  "C3'" . DT  B  1 20  ? -51.222 34.053  -32.620 1.00 100.09 ? 166 DT  J "C3'" 1 
ATOM   3381  O  "O3'" . DT  B  1 20  ? -50.995 35.460  -32.434 1.00 100.06 ? 166 DT  J "O3'" 1 
ATOM   3382  C  "C2'" . DT  B  1 20  ? -51.843 33.409  -31.386 1.00 104.74 ? 166 DT  J "C2'" 1 
ATOM   3383  C  "C1'" . DT  B  1 20  ? -53.308 33.836  -31.518 1.00 113.55 ? 166 DT  J "C1'" 1 
ATOM   3384  N  N1    . DT  B  1 20  ? -54.282 32.811  -31.045 1.00 115.85 ? 166 DT  J N1    1 
ATOM   3385  C  C2    . DT  B  1 20  ? -55.519 33.217  -30.603 1.00 119.20 ? 166 DT  J C2    1 
ATOM   3386  O  O2    . DT  B  1 20  ? -55.874 34.382  -30.586 1.00 117.55 ? 166 DT  J O2    1 
ATOM   3387  N  N3    . DT  B  1 20  ? -56.337 32.204  -30.184 1.00 122.46 ? 166 DT  J N3    1 
ATOM   3388  C  C4    . DT  B  1 20  ? -56.049 30.854  -30.160 1.00 123.75 ? 166 DT  J C4    1 
ATOM   3389  O  O4    . DT  B  1 20  ? -56.856 30.020  -29.763 1.00 129.09 ? 166 DT  J O4    1 
ATOM   3390  C  C5    . DT  B  1 20  ? -54.732 30.494  -30.631 1.00 118.95 ? 166 DT  J C5    1 
ATOM   3391  C  C7    . DT  B  1 20  ? -54.302 29.055  -30.647 1.00 117.48 ? 166 DT  J C7    1 
ATOM   3392  C  C6    . DT  B  1 20  ? -53.920 31.479  -31.045 1.00 113.94 ? 166 DT  J C6    1 
ATOM   3393  P  P     . DT  B  1 21  ? -49.796 36.010  -31.510 1.00 109.39 ? 167 DT  J P     1 
ATOM   3394  O  OP1   . DT  B  1 21  ? -48.917 36.849  -32.355 1.00 86.69  ? 167 DT  J OP1   1 
ATOM   3395  O  OP2   . DT  B  1 21  ? -49.205 34.882  -30.757 1.00 99.92  ? 167 DT  J OP2   1 
ATOM   3396  O  "O5'" . DT  B  1 21  ? -50.553 36.966  -30.475 1.00 114.78 ? 167 DT  J "O5'" 1 
ATOM   3397  C  "C5'" . DT  B  1 21  ? -51.900 36.681  -30.138 1.00 112.52 ? 167 DT  J "C5'" 1 
ATOM   3398  C  "C4'" . DT  B  1 21  ? -52.488 37.722  -29.211 1.00 122.30 ? 167 DT  J "C4'" 1 
ATOM   3399  O  "O4'" . DT  B  1 21  ? -53.692 37.183  -28.622 1.00 122.04 ? 167 DT  J "O4'" 1 
ATOM   3400  C  "C3'" . DT  B  1 21  ? -51.625 38.089  -28.021 1.00 126.73 ? 167 DT  J "C3'" 1 
ATOM   3401  O  "O3'" . DT  B  1 21  ? -52.050 39.351  -27.493 1.00 137.35 ? 167 DT  J "O3'" 1 
ATOM   3402  C  "C2'" . DT  B  1 21  ? -51.918 36.941  -27.058 1.00 128.65 ? 167 DT  J "C2'" 1 
ATOM   3403  C  "C1'" . DT  B  1 21  ? -53.388 36.625  -27.355 1.00 127.24 ? 167 DT  J "C1'" 1 
ATOM   3404  N  N1    . DT  B  1 21  ? -53.685 35.158  -27.395 1.00 128.98 ? 167 DT  J N1    1 
ATOM   3405  C  C2    . DT  B  1 21  ? -54.962 34.722  -27.128 1.00 131.27 ? 167 DT  J C2    1 
ATOM   3406  O  O2    . DT  B  1 21  ? -55.883 35.476  -26.864 1.00 132.11 ? 167 DT  J O2    1 
ATOM   3407  N  N3    . DT  B  1 21  ? -55.128 33.362  -27.186 1.00 133.25 ? 167 DT  J N3    1 
ATOM   3408  C  C4    . DT  B  1 21  ? -54.163 32.412  -27.474 1.00 128.20 ? 167 DT  J C4    1 
ATOM   3409  O  O4    . DT  B  1 21  ? -54.411 31.210  -27.501 1.00 127.06 ? 167 DT  J O4    1 
ATOM   3410  C  C5    . DT  B  1 21  ? -52.843 32.935  -27.741 1.00 124.86 ? 167 DT  J C5    1 
ATOM   3411  C  C7    . DT  B  1 21  ? -51.714 32.001  -28.065 1.00 117.43 ? 167 DT  J C7    1 
ATOM   3412  C  C6    . DT  B  1 21  ? -52.670 34.266  -27.687 1.00 127.65 ? 167 DT  J C6    1 
ATOM   3413  P  P     . DC  B  1 22  ? -51.506 39.884  -26.076 1.00 140.72 ? 168 DC  J P     1 
ATOM   3414  O  OP1   . DC  B  1 22  ? -51.528 41.363  -26.130 1.00 122.86 ? 168 DC  J OP1   1 
ATOM   3415  O  OP2   . DC  B  1 22  ? -50.229 39.196  -25.773 1.00 122.94 ? 168 DC  J OP2   1 
ATOM   3416  O  "O5'" . DC  B  1 22  ? -52.624 39.396  -25.034 1.00 133.95 ? 168 DC  J "O5'" 1 
ATOM   3417  C  "C5'" . DC  B  1 22  ? -53.980 39.816  -25.199 1.00 130.09 ? 168 DC  J "C5'" 1 
ATOM   3418  C  "C4'" . DC  B  1 22  ? -54.875 39.247  -24.107 1.00 135.84 ? 168 DC  J "C4'" 1 
ATOM   3419  O  "O4'" . DC  B  1 22  ? -55.049 37.815  -24.303 1.00 139.33 ? 168 DC  J "O4'" 1 
ATOM   3420  C  "C3'" . DC  B  1 22  ? -54.357 39.414  -22.673 1.00 141.19 ? 168 DC  J "C3'" 1 
ATOM   3421  O  "O3'" . DC  B  1 22  ? -55.443 39.756  -21.808 1.00 147.19 ? 168 DC  J "O3'" 1 
ATOM   3422  C  "C2'" . DC  B  1 22  ? -53.811 38.025  -22.356 1.00 142.49 ? 168 DC  J "C2'" 1 
ATOM   3423  C  "C1'" . DC  B  1 22  ? -54.830 37.163  -23.073 1.00 140.63 ? 168 DC  J "C1'" 1 
ATOM   3424  N  N1    . DC  B  1 22  ? -54.369 35.768  -23.328 1.00 136.02 ? 168 DC  J N1    1 
ATOM   3425  C  C2    . DC  B  1 22  ? -55.247 34.700  -23.109 1.00 139.15 ? 168 DC  J C2    1 
ATOM   3426  O  O2    . DC  B  1 22  ? -56.399 34.934  -22.719 1.00 138.76 ? 168 DC  J O2    1 
ATOM   3427  N  N3    . DC  B  1 22  ? -54.811 33.436  -23.338 1.00 138.98 ? 168 DC  J N3    1 
ATOM   3428  C  C4    . DC  B  1 22  ? -53.564 33.225  -23.760 1.00 136.41 ? 168 DC  J C4    1 
ATOM   3429  N  N4    . DC  B  1 22  ? -53.182 31.961  -23.972 1.00 135.98 ? 168 DC  J N4    1 
ATOM   3430  C  C5    . DC  B  1 22  ? -52.653 34.300  -23.983 1.00 133.19 ? 168 DC  J C5    1 
ATOM   3431  C  C6    . DC  B  1 22  ? -53.092 35.543  -23.753 1.00 132.72 ? 168 DC  J C6    1 
ATOM   3432  P  P     . DT  B  1 23  ? -55.182 40.189  -20.279 1.00 155.60 ? 169 DT  J P     1 
ATOM   3433  O  OP1   . DT  B  1 23  ? -55.714 41.561  -20.125 1.00 152.18 ? 169 DT  J OP1   1 
ATOM   3434  O  OP2   . DT  B  1 23  ? -53.772 39.911  -19.923 1.00 133.88 ? 169 DT  J OP2   1 
ATOM   3435  O  "O5'" . DT  B  1 23  ? -56.112 39.194  -19.436 1.00 149.88 ? 169 DT  J "O5'" 1 
ATOM   3436  C  "C5'" . DT  B  1 23  ? -56.035 37.791  -19.656 1.00 140.41 ? 169 DT  J "C5'" 1 
ATOM   3437  C  "C4'" . DT  B  1 23  ? -56.833 37.032  -18.615 1.00 142.79 ? 169 DT  J "C4'" 1 
ATOM   3438  O  "O4'" . DT  B  1 23  ? -56.663 35.613  -18.832 1.00 142.24 ? 169 DT  J "O4'" 1 
ATOM   3439  C  "C3'" . DT  B  1 23  ? -56.394 37.262  -17.181 1.00 147.54 ? 169 DT  J "C3'" 1 
ATOM   3440  O  "O3'" . DT  B  1 23  ? -57.470 36.989  -16.289 1.00 150.86 ? 169 DT  J "O3'" 1 
ATOM   3441  C  "C2'" . DT  B  1 23  ? -55.258 36.254  -17.021 1.00 147.74 ? 169 DT  J "C2'" 1 
ATOM   3442  C  "C1'" . DT  B  1 23  ? -55.705 35.097  -17.922 1.00 148.21 ? 169 DT  J "C1'" 1 
ATOM   3443  N  N1    . DT  B  1 23  ? -54.581 34.489  -18.705 1.00 148.71 ? 169 DT  J N1    1 
ATOM   3444  C  C2    . DT  B  1 23  ? -54.576 33.132  -18.939 1.00 143.25 ? 169 DT  J C2    1 
ATOM   3445  O  O2    . DT  B  1 23  ? -55.451 32.381  -18.547 1.00 140.46 ? 169 DT  J O2    1 
ATOM   3446  N  N3    . DT  B  1 23  ? -53.501 32.681  -19.661 1.00 142.43 ? 169 DT  J N3    1 
ATOM   3447  C  C4    . DT  B  1 23  ? -52.451 33.434  -20.159 1.00 140.32 ? 169 DT  J C4    1 
ATOM   3448  O  O4    . DT  B  1 23  ? -51.529 32.934  -20.797 1.00 135.51 ? 169 DT  J O4    1 
ATOM   3449  C  C5    . DT  B  1 23  ? -52.516 34.848  -19.874 1.00 142.62 ? 169 DT  J C5    1 
ATOM   3450  C  C7    . DT  B  1 23  ? -51.434 35.767  -20.362 1.00 135.58 ? 169 DT  J C7    1 
ATOM   3451  C  C6    . DT  B  1 23  ? -53.564 35.301  -19.168 1.00 146.38 ? 169 DT  J C6    1 
ATOM   3452  P  P     . DA  B  1 24  ? -57.287 37.202  -14.706 1.00 145.80 ? 170 DA  J P     1 
ATOM   3453  O  OP1   . DA  B  1 24  ? -58.606 37.590  -14.156 1.00 139.05 ? 170 DA  J OP1   1 
ATOM   3454  O  OP2   . DA  B  1 24  ? -56.115 38.081  -14.491 1.00 136.48 ? 170 DA  J OP2   1 
ATOM   3455  O  "O5'" . DA  B  1 24  ? -56.915 35.742  -14.169 1.00 145.54 ? 170 DA  J "O5'" 1 
ATOM   3456  C  "C5'" . DA  B  1 24  ? -57.720 34.630  -14.540 1.00 144.22 ? 170 DA  J "C5'" 1 
ATOM   3457  C  "C4'" . DA  B  1 24  ? -57.283 33.367  -13.815 1.00 149.79 ? 170 DA  J "C4'" 1 
ATOM   3458  O  "O4'" . DA  B  1 24  ? -56.382 32.600  -14.659 1.00 147.01 ? 170 DA  J "O4'" 1 
ATOM   3459  C  "C3'" . DA  B  1 24  ? -56.551 33.587  -12.487 1.00 153.78 ? 170 DA  J "C3'" 1 
ATOM   3460  O  "O3'" . DA  B  1 24  ? -57.042 32.660  -11.512 1.00 159.60 ? 170 DA  J "O3'" 1 
ATOM   3461  C  "C2'" . DA  B  1 24  ? -55.089 33.318  -12.849 1.00 150.44 ? 170 DA  J "C2'" 1 
ATOM   3462  C  "C1'" . DA  B  1 24  ? -55.224 32.259  -13.932 1.00 148.08 ? 170 DA  J "C1'" 1 
ATOM   3463  N  N9    . DA  B  1 24  ? -54.091 32.229  -14.855 1.00 149.76 ? 170 DA  J N9    1 
ATOM   3464  C  C8    . DA  B  1 24  ? -53.593 33.278  -15.578 1.00 147.79 ? 170 DA  J C8    1 
ATOM   3465  N  N7    . DA  B  1 24  ? -52.564 32.963  -16.329 1.00 144.02 ? 170 DA  J N7    1 
ATOM   3466  C  C5    . DA  B  1 24  ? -52.372 31.613  -16.082 1.00 146.14 ? 170 DA  J C5    1 
ATOM   3467  C  C6    . DA  B  1 24  ? -51.435 30.683  -16.573 1.00 142.58 ? 170 DA  J C6    1 
ATOM   3468  N  N6    . DA  B  1 24  ? -50.479 30.999  -17.454 1.00 139.80 ? 170 DA  J N6    1 
ATOM   3469  N  N1    . DA  B  1 24  ? -51.518 29.412  -16.123 1.00 141.83 ? 170 DA  J N1    1 
ATOM   3470  C  C2    . DA  B  1 24  ? -52.477 29.101  -15.241 1.00 143.57 ? 170 DA  J C2    1 
ATOM   3471  N  N3    . DA  B  1 24  ? -53.413 29.887  -14.708 1.00 146.19 ? 170 DA  J N3    1 
ATOM   3472  C  C4    . DA  B  1 24  ? -53.304 31.143  -15.175 1.00 149.02 ? 170 DA  J C4    1 
ATOM   3473  P  P     . DC  B  1 25  ? -56.475 32.639  -10.005 1.00 155.16 ? 171 DC  J P     1 
ATOM   3474  O  OP1   . DC  B  1 25  ? -57.646 32.798  -9.115  1.00 146.37 ? 171 DC  J OP1   1 
ATOM   3475  O  OP2   . DC  B  1 25  ? -55.341 33.579  -9.860  1.00 144.65 ? 171 DC  J OP2   1 
ATOM   3476  O  "O5'" . DC  B  1 25  ? -55.930 31.143  -9.843  1.00 147.44 ? 171 DC  J "O5'" 1 
ATOM   3477  C  "C5'" . DC  B  1 25  ? -54.567 30.899  -9.510  1.00 148.90 ? 171 DC  J "C5'" 1 
ATOM   3478  C  "C4'" . DC  B  1 25  ? -54.177 29.475  -9.872  1.00 153.16 ? 171 DC  J "C4'" 1 
ATOM   3479  O  "O4'" . DC  B  1 25  ? -53.483 29.474  -11.147 1.00 151.20 ? 171 DC  J "O4'" 1 
ATOM   3480  C  "C3'" . DC  B  1 25  ? -53.229 28.790  -8.894  1.00 153.05 ? 171 DC  J "C3'" 1 
ATOM   3481  O  "O3'" . DC  B  1 25  ? -53.455 27.385  -8.910  1.00 151.54 ? 171 DC  J "O3'" 1 
ATOM   3482  C  "C2'" . DC  B  1 25  ? -51.866 29.136  -9.473  1.00 147.38 ? 171 DC  J "C2'" 1 
ATOM   3483  C  "C1'" . DC  B  1 25  ? -52.149 29.037  -10.966 1.00 149.35 ? 171 DC  J "C1'" 1 
ATOM   3484  N  N1    . DC  B  1 25  ? -51.260 29.890  -11.793 1.00 143.37 ? 171 DC  J N1    1 
ATOM   3485  C  C2    . DC  B  1 25  ? -50.124 29.333  -12.386 1.00 139.71 ? 171 DC  J C2    1 
ATOM   3486  O  O2    . DC  B  1 25  ? -49.879 28.132  -12.211 1.00 140.71 ? 171 DC  J O2    1 
ATOM   3487  N  N3    . DC  B  1 25  ? -49.323 30.126  -13.137 1.00 137.30 ? 171 DC  J N3    1 
ATOM   3488  C  C4    . DC  B  1 25  ? -49.623 31.416  -13.301 1.00 142.76 ? 171 DC  J C4    1 
ATOM   3489  N  N4    . DC  B  1 25  ? -48.802 32.158  -14.051 1.00 140.72 ? 171 DC  J N4    1 
ATOM   3490  C  C5    . DC  B  1 25  ? -50.777 32.002  -12.703 1.00 141.94 ? 171 DC  J C5    1 
ATOM   3491  C  C6    . DC  B  1 25  ? -51.559 31.210  -11.964 1.00 144.41 ? 171 DC  J C6    1 
ATOM   3492  P  P     . DC  B  1 26  ? -52.862 26.455  -7.742  1.00 154.97 ? 172 DC  J P     1 
ATOM   3493  O  OP1   . DC  B  1 26  ? -53.871 25.418  -7.432  1.00 156.00 ? 172 DC  J OP1   1 
ATOM   3494  O  OP2   . DC  B  1 26  ? -52.369 27.351  -6.672  1.00 149.73 ? 172 DC  J OP2   1 
ATOM   3495  O  "O5'" . DC  B  1 26  ? -51.596 25.745  -8.412  1.00 150.21 ? 172 DC  J "O5'" 1 
ATOM   3496  C  "C5'" . DC  B  1 26  ? -50.912 24.713  -7.711  1.00 146.49 ? 172 DC  J "C5'" 1 
ATOM   3497  C  "C4'" . DC  B  1 26  ? -49.619 24.343  -8.415  1.00 144.42 ? 172 DC  J "C4'" 1 
ATOM   3498  O  "O4'" . DC  B  1 26  ? -49.178 25.457  -9.238  1.00 143.46 ? 172 DC  J "O4'" 1 
ATOM   3499  C  "C3'" . DC  B  1 26  ? -48.454 24.021  -7.480  1.00 140.75 ? 172 DC  J "C3'" 1 
ATOM   3500  O  "O3'" . DC  B  1 26  ? -47.695 22.938  -7.996  1.00 140.10 ? 172 DC  J "O3'" 1 
ATOM   3501  C  "C2'" . DC  B  1 26  ? -47.651 25.317  -7.475  1.00 135.91 ? 172 DC  J "C2'" 1 
ATOM   3502  C  "C1'" . DC  B  1 26  ? -47.849 25.794  -8.904  1.00 135.99 ? 172 DC  J "C1'" 1 
ATOM   3503  N  N1    . DC  B  1 26  ? -47.677 27.265  -9.072  1.00 133.02 ? 172 DC  J N1    1 
ATOM   3504  C  C2    . DC  B  1 26  ? -47.073 27.759  -10.231 1.00 129.86 ? 172 DC  J C2    1 
ATOM   3505  O  O2    . DC  B  1 26  ? -46.694 26.964  -11.099 1.00 125.54 ? 172 DC  J O2    1 
ATOM   3506  N  N3    . DC  B  1 26  ? -46.923 29.100  -10.372 1.00 131.49 ? 172 DC  J N3    1 
ATOM   3507  C  C4    . DC  B  1 26  ? -47.346 29.925  -9.413  1.00 130.09 ? 172 DC  J C4    1 
ATOM   3508  N  N4    . DC  B  1 26  ? -47.176 31.239  -9.596  1.00 126.16 ? 172 DC  J N4    1 
ATOM   3509  C  C5    . DC  B  1 26  ? -47.962 29.439  -8.222  1.00 135.17 ? 172 DC  J C5    1 
ATOM   3510  C  C6    . DC  B  1 26  ? -48.106 28.115  -8.096  1.00 137.79 ? 172 DC  J C6    1 
ATOM   3511  P  P     . DA  B  1 27  ? -47.233 21.750  -7.018  1.00 154.20 ? 173 DA  J P     1 
ATOM   3512  O  OP1   . DA  B  1 27  ? -48.447 20.990  -6.640  1.00 152.64 ? 173 DA  J OP1   1 
ATOM   3513  O  OP2   . DA  B  1 27  ? -46.376 22.346  -5.970  1.00 146.67 ? 173 DA  J OP2   1 
ATOM   3514  O  "O5'" . DA  B  1 27  ? -46.298 20.829  -7.931  1.00 135.98 ? 173 DA  J "O5'" 1 
ATOM   3515  C  "C5'" . DA  B  1 27  ? -44.904 20.747  -7.661  1.00 128.53 ? 173 DA  J "C5'" 1 
ATOM   3516  C  "C4'" . DA  B  1 27  ? -44.095 21.028  -8.914  1.00 131.46 ? 173 DA  J "C4'" 1 
ATOM   3517  O  "O4'" . DA  B  1 27  ? -44.376 22.372  -9.382  1.00 133.83 ? 173 DA  J "O4'" 1 
ATOM   3518  C  "C3'" . DA  B  1 27  ? -42.587 20.964  -8.731  1.00 121.15 ? 173 DA  J "C3'" 1 
ATOM   3519  O  "O3'" . DA  B  1 27  ? -41.973 20.537  -9.932  1.00 110.10 ? 173 DA  J "O3'" 1 
ATOM   3520  C  "C2'" . DA  B  1 27  ? -42.229 22.408  -8.402  1.00 120.37 ? 173 DA  J "C2'" 1 
ATOM   3521  C  "C1'" . DA  B  1 27  ? -43.222 23.183  -9.259  1.00 121.45 ? 173 DA  J "C1'" 1 
ATOM   3522  N  N9    . DA  B  1 27  ? -43.622 24.454  -8.668  1.00 123.08 ? 173 DA  J N9    1 
ATOM   3523  C  C8    . DA  B  1 27  ? -44.213 24.643  -7.450  1.00 129.40 ? 173 DA  J C8    1 
ATOM   3524  N  N7    . DA  B  1 27  ? -44.465 25.900  -7.174  1.00 129.70 ? 173 DA  J N7    1 
ATOM   3525  C  C5    . DA  B  1 27  ? -44.012 26.583  -8.288  1.00 123.79 ? 173 DA  J C5    1 
ATOM   3526  C  C6    . DA  B  1 27  ? -43.993 27.951  -8.619  1.00 122.03 ? 173 DA  J C6    1 
ATOM   3527  N  N6    . DA  B  1 27  ? -44.465 28.910  -7.815  1.00 123.04 ? 173 DA  J N6    1 
ATOM   3528  N  N1    . DA  B  1 27  ? -43.468 28.297  -9.812  1.00 122.34 ? 173 DA  J N1    1 
ATOM   3529  C  C2    . DA  B  1 27  ? -42.997 27.335  -10.613 1.00 121.81 ? 173 DA  J C2    1 
ATOM   3530  N  N3    . DA  B  1 27  ? -42.960 26.019  -10.412 1.00 125.40 ? 173 DA  J N3    1 
ATOM   3531  C  C4    . DA  B  1 27  ? -43.489 25.706  -9.220  1.00 126.24 ? 173 DA  J C4    1 
ATOM   3532  P  P     . DA  B  1 28  ? -40.529 19.834  -9.888  1.00 132.97 ? 174 DA  J P     1 
ATOM   3533  O  OP1   . DA  B  1 28  ? -40.651 18.478  -10.471 1.00 138.94 ? 174 DA  J OP1   1 
ATOM   3534  O  OP2   . DA  B  1 28  ? -40.000 20.005  -8.516  1.00 128.74 ? 174 DA  J OP2   1 
ATOM   3535  O  "O5'" . DA  B  1 28  ? -39.640 20.736  -10.858 1.00 121.36 ? 174 DA  J "O5'" 1 
ATOM   3536  C  "C5'" . DA  B  1 28  ? -40.250 21.444  -11.931 1.00 115.64 ? 174 DA  J "C5'" 1 
ATOM   3537  C  "C4'" . DA  B  1 28  ? -39.402 22.636  -12.334 1.00 112.20 ? 174 DA  J "C4'" 1 
ATOM   3538  O  "O4'" . DA  B  1 28  ? -39.775 23.793  -11.539 1.00 111.43 ? 174 DA  J "O4'" 1 
ATOM   3539  C  "C3'" . DA  B  1 28  ? -37.903 22.450  -12.126 1.00 113.59 ? 174 DA  J "C3'" 1 
ATOM   3540  O  "O3'" . DA  B  1 28  ? -37.189 23.094  -13.163 1.00 115.21 ? 174 DA  J "O3'" 1 
ATOM   3541  C  "C2'" . DA  B  1 28  ? -37.660 23.123  -10.779 1.00 109.99 ? 174 DA  J "C2'" 1 
ATOM   3542  C  "C1'" . DA  B  1 28  ? -38.651 24.274  -10.831 1.00 109.59 ? 174 DA  J "C1'" 1 
ATOM   3543  N  N9    . DA  B  1 28  ? -39.095 24.714  -9.513  1.00 111.48 ? 174 DA  J N9    1 
ATOM   3544  C  C8    . DA  B  1 28  ? -39.185 23.956  -8.379  1.00 114.61 ? 174 DA  J C8    1 
ATOM   3545  N  N7    . DA  B  1 28  ? -39.622 24.617  -7.334  1.00 116.87 ? 174 DA  J N7    1 
ATOM   3546  C  C5    . DA  B  1 28  ? -39.835 25.897  -7.817  1.00 115.84 ? 174 DA  J C5    1 
ATOM   3547  C  C6    . DA  B  1 28  ? -40.299 27.076  -7.205  1.00 116.70 ? 174 DA  J C6    1 
ATOM   3548  N  N6    . DA  B  1 28  ? -40.643 27.150  -5.915  1.00 119.56 ? 174 DA  J N6    1 
ATOM   3549  N  N1    . DA  B  1 28  ? -40.394 28.182  -7.971  1.00 116.91 ? 174 DA  J N1    1 
ATOM   3550  C  C2    . DA  B  1 28  ? -40.046 28.106  -9.261  1.00 114.50 ? 174 DA  J C2    1 
ATOM   3551  N  N3    . DA  B  1 28  ? -39.600 27.055  -9.946  1.00 113.12 ? 174 DA  J N3    1 
ATOM   3552  C  C4    . DA  B  1 28  ? -39.516 25.973  -9.158  1.00 114.09 ? 174 DA  J C4    1 
ATOM   3553  P  P     . DA  B  1 29  ? -36.176 22.252  -14.082 1.00 112.85 ? 175 DA  J P     1 
ATOM   3554  O  OP1   . DA  B  1 29  ? -36.942 21.737  -15.239 1.00 113.48 ? 175 DA  J OP1   1 
ATOM   3555  O  OP2   . DA  B  1 29  ? -35.447 21.317  -13.197 1.00 106.40 ? 175 DA  J OP2   1 
ATOM   3556  O  "O5'" . DA  B  1 29  ? -35.128 23.343  -14.590 1.00 102.13 ? 175 DA  J "O5'" 1 
ATOM   3557  C  "C5'" . DA  B  1 29  ? -34.398 24.106  -13.647 1.00 93.69  ? 175 DA  J "C5'" 1 
ATOM   3558  C  "C4'" . DA  B  1 29  ? -34.807 25.563  -13.704 1.00 87.72  ? 175 DA  J "C4'" 1 
ATOM   3559  O  "O4'" . DA  B  1 29  ? -35.734 25.851  -12.623 1.00 94.02  ? 175 DA  J "O4'" 1 
ATOM   3560  C  "C3'" . DA  B  1 29  ? -33.658 26.543  -13.530 1.00 91.54  ? 175 DA  J "C3'" 1 
ATOM   3561  O  "O3'" . DA  B  1 29  ? -33.919 27.722  -14.255 1.00 86.87  ? 175 DA  J "O3'" 1 
ATOM   3562  C  "C2'" . DA  B  1 29  ? -33.673 26.799  -12.032 1.00 99.43  ? 175 DA  J "C2'" 1 
ATOM   3563  C  "C1'" . DA  B  1 29  ? -35.165 26.811  -11.752 1.00 100.67 ? 175 DA  J "C1'" 1 
ATOM   3564  N  N9    . DA  B  1 29  ? -35.494 26.450  -10.377 1.00 106.49 ? 175 DA  J N9    1 
ATOM   3565  C  C8    . DA  B  1 29  ? -35.325 25.232  -9.785  1.00 110.35 ? 175 DA  J C8    1 
ATOM   3566  N  N7    . DA  B  1 29  ? -35.708 25.194  -8.532  1.00 114.02 ? 175 DA  J N7    1 
ATOM   3567  C  C5    . DA  B  1 29  ? -36.152 26.481  -8.281  1.00 110.91 ? 175 DA  J C5    1 
ATOM   3568  C  C6    . DA  B  1 29  ? -36.685 27.093  -7.131  1.00 112.16 ? 175 DA  J C6    1 
ATOM   3569  N  N6    . DA  B  1 29  ? -36.864 26.451  -5.973  1.00 117.48 ? 175 DA  J N6    1 
ATOM   3570  N  N1    . DA  B  1 29  ? -37.029 28.393  -7.217  1.00 111.03 ? 175 DA  J N1    1 
ATOM   3571  C  C2    . DA  B  1 29  ? -36.849 29.032  -8.378  1.00 109.88 ? 175 DA  J C2    1 
ATOM   3572  N  N3    . DA  B  1 29  ? -36.359 28.565  -9.524  1.00 110.02 ? 175 DA  J N3    1 
ATOM   3573  C  C4    . DA  B  1 29  ? -36.026 27.270  -9.407  1.00 109.46 ? 175 DA  J C4    1 
ATOM   3574  P  P     . DA  B  1 30  ? -32.700 28.573  -14.857 1.00 89.73  ? 176 DA  J P     1 
ATOM   3575  O  OP1   . DA  B  1 30  ? -33.124 29.022  -16.202 1.00 79.08  ? 176 DA  J OP1   1 
ATOM   3576  O  OP2   . DA  B  1 30  ? -31.465 27.774  -14.680 1.00 76.67  ? 176 DA  J OP2   1 
ATOM   3577  O  "O5'" . DA  B  1 30  ? -32.599 29.846  -13.892 1.00 87.88  ? 176 DA  J "O5'" 1 
ATOM   3578  C  "C5'" . DA  B  1 30  ? -33.623 30.830  -13.906 1.00 79.58  ? 176 DA  J "C5'" 1 
ATOM   3579  C  "C4'" . DA  B  1 30  ? -33.440 31.820  -12.771 1.00 84.80  ? 176 DA  J "C4'" 1 
ATOM   3580  O  "O4'" . DA  B  1 30  ? -33.796 31.192  -11.511 1.00 97.32  ? 176 DA  J "O4'" 1 
ATOM   3581  C  "C3'" . DA  B  1 30  ? -32.021 32.359  -12.598 1.00 79.64  ? 176 DA  J "C3'" 1 
ATOM   3582  O  "O3'" . DA  B  1 30  ? -32.075 33.758  -12.353 1.00 77.14  ? 176 DA  J "O3'" 1 
ATOM   3583  C  "C2'" . DA  B  1 30  ? -31.495 31.587  -11.386 1.00 87.27  ? 176 DA  J "C2'" 1 
ATOM   3584  C  "C1'" . DA  B  1 30  ? -32.761 31.377  -10.571 1.00 97.76  ? 176 DA  J "C1'" 1 
ATOM   3585  N  N9    . DA  B  1 30  ? -32.708 30.197  -9.708  1.00 104.48 ? 176 DA  J N9    1 
ATOM   3586  C  C8    . DA  B  1 30  ? -32.144 28.988  -10.005 1.00 105.49 ? 176 DA  J C8    1 
ATOM   3587  N  N7    . DA  B  1 30  ? -32.249 28.102  -9.043  1.00 109.80 ? 176 DA  J N7    1 
ATOM   3588  C  C5    . DA  B  1 30  ? -32.930 28.774  -8.043  1.00 111.68 ? 176 DA  J C5    1 
ATOM   3589  C  C6    . DA  B  1 30  ? -33.354 28.385  -6.757  1.00 114.39 ? 176 DA  J C6    1 
ATOM   3590  N  N6    . DA  B  1 30  ? -33.139 27.167  -6.247  1.00 112.09 ? 176 DA  J N6    1 
ATOM   3591  N  N1    . DA  B  1 30  ? -34.009 29.299  -6.011  1.00 115.65 ? 176 DA  J N1    1 
ATOM   3592  C  C2    . DA  B  1 30  ? -34.223 30.516  -6.524  1.00 111.49 ? 176 DA  J C2    1 
ATOM   3593  N  N3    . DA  B  1 30  ? -33.872 30.998  -7.717  1.00 110.84 ? 176 DA  J N3    1 
ATOM   3594  C  C4    . DA  B  1 30  ? -33.223 30.068  -8.435  1.00 109.25 ? 176 DA  J C4    1 
ATOM   3595  P  P     . DG  B  1 31  ? -30.737 34.609  -12.088 1.00 90.23  ? 177 DG  J P     1 
ATOM   3596  O  OP1   . DG  B  1 31  ? -30.852 35.858  -12.874 1.00 81.51  ? 177 DG  J OP1   1 
ATOM   3597  O  OP2   . DG  B  1 31  ? -29.544 33.748  -12.253 1.00 81.12  ? 177 DG  J OP2   1 
ATOM   3598  O  "O5'" . DG  B  1 31  ? -30.846 34.985  -10.544 1.00 91.77  ? 177 DG  J "O5'" 1 
ATOM   3599  C  "C5'" . DG  B  1 31  ? -32.069 35.486  -10.029 1.00 93.66  ? 177 DG  J "C5'" 1 
ATOM   3600  C  "C4'" . DG  B  1 31  ? -31.990 35.649  -8.526  1.00 98.80  ? 177 DG  J "C4'" 1 
ATOM   3601  O  "O4'" . DG  B  1 31  ? -32.079 34.348  -7.888  1.00 97.83  ? 177 DG  J "O4'" 1 
ATOM   3602  C  "C3'" . DG  B  1 31  ? -30.696 36.280  -8.018  1.00 103.80 ? 177 DG  J "C3'" 1 
ATOM   3603  O  "O3'" . DG  B  1 31  ? -30.988 37.148  -6.936  1.00 106.80 ? 177 DG  J "O3'" 1 
ATOM   3604  C  "C2'" . DG  B  1 31  ? -29.880 35.067  -7.570  1.00 101.08 ? 177 DG  J "C2'" 1 
ATOM   3605  C  "C1'" . DG  B  1 31  ? -30.974 34.161  -7.033  1.00 103.23 ? 177 DG  J "C1'" 1 
ATOM   3606  N  N9    . DG  B  1 31  ? -30.622 32.746  -7.041  1.00 109.41 ? 177 DG  J N9    1 
ATOM   3607  C  C8    . DG  B  1 31  ? -30.147 32.017  -8.104  1.00 108.07 ? 177 DG  J C8    1 
ATOM   3608  N  N7    . DG  B  1 31  ? -29.925 30.765  -7.817  1.00 106.31 ? 177 DG  J N7    1 
ATOM   3609  C  C5    . DG  B  1 31  ? -30.278 30.656  -6.479  1.00 112.59 ? 177 DG  J C5    1 
ATOM   3610  C  C6    . DG  B  1 31  ? -30.250 29.533  -5.618  1.00 118.59 ? 177 DG  J C6    1 
ATOM   3611  O  O6    . DG  B  1 31  ? -29.895 28.374  -5.877  1.00 120.86 ? 177 DG  J O6    1 
ATOM   3612  N  N1    . DG  B  1 31  ? -30.692 29.856  -4.337  1.00 118.46 ? 177 DG  J N1    1 
ATOM   3613  C  C2    . DG  B  1 31  ? -31.107 31.104  -3.940  1.00 119.53 ? 177 DG  J C2    1 
ATOM   3614  N  N2    . DG  B  1 31  ? -31.498 31.223  -2.663  1.00 124.82 ? 177 DG  J N2    1 
ATOM   3615  N  N3    . DG  B  1 31  ? -31.138 32.164  -4.736  1.00 117.98 ? 177 DG  J N3    1 
ATOM   3616  C  C4    . DG  B  1 31  ? -30.711 31.866  -5.987  1.00 114.16 ? 177 DG  J C4    1 
ATOM   3617  P  P     . DT  B  1 32  ? -29.912 38.236  -6.447  1.00 108.44 ? 178 DT  J P     1 
ATOM   3618  O  OP1   . DT  B  1 32  ? -30.531 39.570  -6.619  1.00 104.53 ? 178 DT  J OP1   1 
ATOM   3619  O  OP2   . DT  B  1 32  ? -28.612 37.935  -7.092  1.00 101.15 ? 178 DT  J OP2   1 
ATOM   3620  O  "O5'" . DT  B  1 32  ? -29.770 37.930  -4.885  1.00 112.64 ? 178 DT  J "O5'" 1 
ATOM   3621  C  "C5'" . DT  B  1 32  ? -29.790 36.582  -4.432  1.00 115.10 ? 178 DT  J "C5'" 1 
ATOM   3622  C  "C4'" . DT  B  1 32  ? -29.819 36.512  -2.921  1.00 113.63 ? 178 DT  J "C4'" 1 
ATOM   3623  O  "O4'" . DT  B  1 32  ? -29.801 35.126  -2.511  1.00 114.54 ? 178 DT  J "O4'" 1 
ATOM   3624  C  "C3'" . DT  B  1 32  ? -28.620 37.133  -2.235  1.00 116.98 ? 178 DT  J "C3'" 1 
ATOM   3625  O  "O3'" . DT  B  1 32  ? -28.955 37.488  -0.901  1.00 121.85 ? 178 DT  J "O3'" 1 
ATOM   3626  C  "C2'" . DT  B  1 32  ? -27.602 35.997  -2.278  1.00 117.32 ? 178 DT  J "C2'" 1 
ATOM   3627  C  "C1'" . DT  B  1 32  ? -28.485 34.753  -2.138  1.00 119.81 ? 178 DT  J "C1'" 1 
ATOM   3628  N  N1    . DT  B  1 32  ? -28.051 33.617  -3.006  1.00 121.05 ? 178 DT  J N1    1 
ATOM   3629  C  C2    . DT  B  1 32  ? -28.202 32.327  -2.555  1.00 120.63 ? 178 DT  J C2    1 
ATOM   3630  O  O2    . DT  B  1 32  ? -28.681 32.052  -1.471  1.00 124.53 ? 178 DT  J O2    1 
ATOM   3631  N  N3    . DT  B  1 32  ? -27.773 31.362  -3.425  1.00 121.52 ? 178 DT  J N3    1 
ATOM   3632  C  C4    . DT  B  1 32  ? -27.216 31.552  -4.676  1.00 125.45 ? 178 DT  J C4    1 
ATOM   3633  O  O4    . DT  B  1 32  ? -26.858 30.617  -5.386  1.00 128.63 ? 178 DT  J O4    1 
ATOM   3634  C  C5    . DT  B  1 32  ? -27.083 32.930  -5.089  1.00 121.89 ? 178 DT  J C5    1 
ATOM   3635  C  C7    . DT  B  1 32  ? -26.492 33.263  -6.428  1.00 116.71 ? 178 DT  J C7    1 
ATOM   3636  C  C6    . DT  B  1 32  ? -27.501 33.884  -4.244  1.00 122.70 ? 178 DT  J C6    1 
ATOM   3637  P  P     . DG  B  1 33  ? -27.954 38.395  -0.030  1.00 121.05 ? 179 DG  J P     1 
ATOM   3638  O  OP1   . DG  B  1 33  ? -28.779 39.242  0.859   1.00 121.99 ? 179 DG  J OP1   1 
ATOM   3639  O  OP2   . DG  B  1 33  ? -26.980 39.023  -0.949  1.00 119.28 ? 179 DG  J OP2   1 
ATOM   3640  O  "O5'" . DG  B  1 33  ? -27.162 37.333  0.859   1.00 115.94 ? 179 DG  J "O5'" 1 
ATOM   3641  C  "C5'" . DG  B  1 33  ? -27.874 36.462  1.723   1.00 121.42 ? 179 DG  J "C5'" 1 
ATOM   3642  C  "C4'" . DG  B  1 33  ? -26.920 35.528  2.439   1.00 127.82 ? 179 DG  J "C4'" 1 
ATOM   3643  O  "O4'" . DG  B  1 33  ? -26.713 34.337  1.633   1.00 130.47 ? 179 DG  J "O4'" 1 
ATOM   3644  C  "C3'" . DG  B  1 33  ? -25.533 36.113  2.704   1.00 133.84 ? 179 DG  J "C3'" 1 
ATOM   3645  O  "O3'" . DG  B  1 33  ? -25.079 35.727  3.999   1.00 140.21 ? 179 DG  J "O3'" 1 
ATOM   3646  C  "C2'" . DG  B  1 33  ? -24.681 35.496  1.597   1.00 133.20 ? 179 DG  J "C2'" 1 
ATOM   3647  C  "C1'" . DG  B  1 33  ? -25.331 34.130  1.437   1.00 132.86 ? 179 DG  J "C1'" 1 
ATOM   3648  N  N9    . DG  B  1 33  ? -25.129 33.543  0.114   1.00 126.81 ? 179 DG  J N9    1 
ATOM   3649  C  C8    . DG  B  1 33  ? -24.989 34.217  -1.074  1.00 125.68 ? 179 DG  J C8    1 
ATOM   3650  N  N7    . DG  B  1 33  ? -24.820 33.433  -2.102  1.00 126.08 ? 179 DG  J N7    1 
ATOM   3651  C  C5    . DG  B  1 33  ? -24.847 32.154  -1.561  1.00 126.15 ? 179 DG  J C5    1 
ATOM   3652  C  C6    . DG  B  1 33  ? -24.712 30.896  -2.194  1.00 125.63 ? 179 DG  J C6    1 
ATOM   3653  O  O6    . DG  B  1 33  ? -24.538 30.655  -3.398  1.00 121.11 ? 179 DG  J O6    1 
ATOM   3654  N  N1    . DG  B  1 33  ? -24.800 29.849  -1.280  1.00 127.96 ? 179 DG  J N1    1 
ATOM   3655  C  C2    . DG  B  1 33  ? -24.990 29.999  0.073   1.00 127.26 ? 179 DG  J C2    1 
ATOM   3656  N  N2    . DG  B  1 33  ? -25.049 28.869  0.792   1.00 128.80 ? 179 DG  J N2    1 
ATOM   3657  N  N3    . DG  B  1 33  ? -25.118 31.172  0.679   1.00 127.18 ? 179 DG  J N3    1 
ATOM   3658  C  C4    . DG  B  1 33  ? -25.035 32.203  -0.198  1.00 126.28 ? 179 DG  J C4    1 
ATOM   3659  P  P     . DT  B  1 34  ? -23.877 36.521  4.715   1.00 151.54 ? 180 DT  J P     1 
ATOM   3660  O  OP1   . DT  B  1 34  ? -24.408 37.106  5.966   1.00 147.89 ? 180 DT  J OP1   1 
ATOM   3661  O  OP2   . DT  B  1 34  ? -23.231 37.401  3.713   1.00 138.80 ? 180 DT  J OP2   1 
ATOM   3662  O  "O5'" . DT  B  1 34  ? -22.840 35.364  5.088   1.00 135.86 ? 180 DT  J "O5'" 1 
ATOM   3663  C  "C5'" . DT  B  1 34  ? -22.416 34.463  4.082   1.00 135.42 ? 180 DT  J "C5'" 1 
ATOM   3664  C  "C4'" . DT  B  1 34  ? -22.339 33.046  4.611   1.00 136.72 ? 180 DT  J "C4'" 1 
ATOM   3665  O  "O4'" . DT  B  1 34  ? -22.724 32.126  3.559   1.00 136.61 ? 180 DT  J "O4'" 1 
ATOM   3666  C  "C3'" . DT  B  1 34  ? -20.946 32.608  5.015   1.00 134.67 ? 180 DT  J "C3'" 1 
ATOM   3667  O  "O3'" . DT  B  1 34  ? -21.011 31.523  5.926   1.00 132.05 ? 180 DT  J "O3'" 1 
ATOM   3668  C  "C2'" . DT  B  1 34  ? -20.360 32.176  3.680   1.00 135.23 ? 180 DT  J "C2'" 1 
ATOM   3669  C  "C1'" . DT  B  1 34  ? -21.566 31.536  2.992   1.00 133.22 ? 180 DT  J "C1'" 1 
ATOM   3670  N  N1    . DT  B  1 34  ? -21.587 31.756  1.511   1.00 129.29 ? 180 DT  J N1    1 
ATOM   3671  C  C2    . DT  B  1 34  ? -21.631 30.670  0.670   1.00 127.41 ? 180 DT  J C2    1 
ATOM   3672  O  O2    . DT  B  1 34  ? -21.668 29.519  1.068   1.00 129.77 ? 180 DT  J O2    1 
ATOM   3673  N  N3    . DT  B  1 34  ? -21.639 30.979  -0.664  1.00 126.23 ? 180 DT  J N3    1 
ATOM   3674  C  C4    . DT  B  1 34  ? -21.600 32.240  -1.232  1.00 129.44 ? 180 DT  J C4    1 
ATOM   3675  O  O4    . DT  B  1 34  ? -21.611 32.414  -2.447  1.00 130.11 ? 180 DT  J O4    1 
ATOM   3676  C  C5    . DT  B  1 34  ? -21.549 33.337  -0.294  1.00 129.80 ? 180 DT  J C5    1 
ATOM   3677  C  C7    . DT  B  1 34  ? -21.505 34.753  -0.789  1.00 121.03 ? 180 DT  J C7    1 
ATOM   3678  C  C6    . DT  B  1 34  ? -21.542 33.045  1.017   1.00 130.27 ? 180 DT  J C6    1 
ATOM   3679  P  P     . DA  B  1 35  ? -19.691 31.079  6.728   1.00 134.81 ? 181 DA  J P     1 
ATOM   3680  O  OP1   . DA  B  1 35  ? -20.124 30.369  7.951   1.00 139.14 ? 181 DA  J OP1   1 
ATOM   3681  O  OP2   . DA  B  1 35  ? -18.814 32.267  6.832   1.00 130.77 ? 181 DA  J OP2   1 
ATOM   3682  O  "O5'" . DA  B  1 35  ? -18.975 30.033  5.750   1.00 129.39 ? 181 DA  J "O5'" 1 
ATOM   3683  C  "C5'" . DA  B  1 35  ? -19.402 28.672  5.717   1.00 130.97 ? 181 DA  J "C5'" 1 
ATOM   3684  C  "C4'" . DA  B  1 35  ? -18.385 27.799  4.996   1.00 130.20 ? 181 DA  J "C4'" 1 
ATOM   3685  O  "O4'" . DA  B  1 35  ? -18.521 27.975  3.559   1.00 128.50 ? 181 DA  J "O4'" 1 
ATOM   3686  C  "C3'" . DA  B  1 35  ? -16.922 28.106  5.317   1.00 133.57 ? 181 DA  J "C3'" 1 
ATOM   3687  O  "O3'" . DA  B  1 35  ? -16.152 26.901  5.300   1.00 131.42 ? 181 DA  J "O3'" 1 
ATOM   3688  C  "C2'" . DA  B  1 35  ? -16.524 29.043  4.180   1.00 129.70 ? 181 DA  J "C2'" 1 
ATOM   3689  C  "C1'" . DA  B  1 35  ? -17.303 28.447  3.015   1.00 130.16 ? 181 DA  J "C1'" 1 
ATOM   3690  N  N9    . DA  B  1 35  ? -17.606 29.417  1.964   1.00 127.37 ? 181 DA  J N9    1 
ATOM   3691  C  C8    . DA  B  1 35  ? -17.864 30.748  2.125   1.00 123.10 ? 181 DA  J C8    1 
ATOM   3692  N  N7    . DA  B  1 35  ? -18.109 31.382  1.003   1.00 117.87 ? 181 DA  J N7    1 
ATOM   3693  C  C5    . DA  B  1 35  ? -17.998 30.398  0.036   1.00 121.05 ? 181 DA  J C5    1 
ATOM   3694  C  C6    . DA  B  1 35  ? -18.140 30.425  -1.364  1.00 119.01 ? 181 DA  J C6    1 
ATOM   3695  N  N6    . DA  B  1 35  ? -18.438 31.532  -2.052  1.00 115.97 ? 181 DA  J N6    1 
ATOM   3696  N  N1    . DA  B  1 35  ? -17.963 29.266  -2.032  1.00 120.56 ? 181 DA  J N1    1 
ATOM   3697  C  C2    . DA  B  1 35  ? -17.662 28.160  -1.339  1.00 119.55 ? 181 DA  J C2    1 
ATOM   3698  N  N3    . DA  B  1 35  ? -17.505 28.011  -0.025  1.00 116.89 ? 181 DA  J N3    1 
ATOM   3699  C  C4    . DA  B  1 35  ? -17.687 29.179  0.611   1.00 121.71 ? 181 DA  J C4    1 
ATOM   3700  P  P     . DT  B  1 36  ? -14.672 26.867  5.934   1.00 130.73 ? 182 DT  J P     1 
ATOM   3701  O  OP1   . DT  B  1 36  ? -14.664 25.837  6.995   1.00 136.16 ? 182 DT  J OP1   1 
ATOM   3702  O  OP2   . DT  B  1 36  ? -14.263 28.253  6.252   1.00 124.40 ? 182 DT  J OP2   1 
ATOM   3703  O  "O5'" . DT  B  1 36  ? -13.754 26.360  4.728   1.00 126.41 ? 182 DT  J "O5'" 1 
ATOM   3704  C  "C5'" . DT  B  1 36  ? -13.754 27.069  3.499   1.00 127.81 ? 182 DT  J "C5'" 1 
ATOM   3705  C  "C4'" . DT  B  1 36  ? -13.879 26.118  2.326   1.00 124.15 ? 182 DT  J "C4'" 1 
ATOM   3706  O  "O4'" . DT  B  1 36  ? -14.658 26.747  1.272   1.00 126.14 ? 182 DT  J "O4'" 1 
ATOM   3707  C  "C3'" . DT  B  1 36  ? -12.556 25.738  1.684   1.00 122.32 ? 182 DT  J "C3'" 1 
ATOM   3708  O  "O3'" . DT  B  1 36  ? -12.638 24.435  1.116   1.00 128.69 ? 182 DT  J "O3'" 1 
ATOM   3709  C  "C2'" . DT  B  1 36  ? -12.397 26.812  0.616   1.00 119.83 ? 182 DT  J "C2'" 1 
ATOM   3710  C  "C1'" . DT  B  1 36  ? -13.836 27.001  0.149   1.00 121.01 ? 182 DT  J "C1'" 1 
ATOM   3711  N  N1    . DT  B  1 36  ? -14.116 28.381  -0.343  1.00 116.54 ? 182 DT  J N1    1 
ATOM   3712  C  C2    . DT  B  1 36  ? -14.312 28.590  -1.689  1.00 112.69 ? 182 DT  J C2    1 
ATOM   3713  O  O2    . DT  B  1 36  ? -14.279 27.697  -2.518  1.00 107.29 ? 182 DT  J O2    1 
ATOM   3714  N  N3    . DT  B  1 36  ? -14.555 29.893  -2.034  1.00 114.78 ? 182 DT  J N3    1 
ATOM   3715  C  C4    . DT  B  1 36  ? -14.617 30.987  -1.186  1.00 118.54 ? 182 DT  J C4    1 
ATOM   3716  O  O4    . DT  B  1 36  ? -14.842 32.123  -1.593  1.00 118.08 ? 182 DT  J O4    1 
ATOM   3717  C  C5    . DT  B  1 36  ? -14.398 30.697  0.211   1.00 120.79 ? 182 DT  J C5    1 
ATOM   3718  C  C7    . DT  B  1 36  ? -14.442 31.803  1.225   1.00 121.61 ? 182 DT  J C7    1 
ATOM   3719  C  C6    . DT  B  1 36  ? -14.159 29.424  0.561   1.00 118.21 ? 182 DT  J C6    1 
ATOM   3720  P  P     . DT  B  1 37  ? -11.514 23.339  1.461   1.00 132.28 ? 183 DT  J P     1 
ATOM   3721  O  OP1   . DT  B  1 37  ? -12.205 22.084  1.836   1.00 125.09 ? 183 DT  J OP1   1 
ATOM   3722  O  OP2   . DT  B  1 37  ? -10.549 23.974  2.387   1.00 125.61 ? 183 DT  J OP2   1 
ATOM   3723  O  "O5'" . DT  B  1 37  ? -10.755 23.108  0.075   1.00 123.17 ? 183 DT  J "O5'" 1 
ATOM   3724  C  "C5'" . DT  B  1 37  ? -10.338 24.221  -0.693  1.00 121.14 ? 183 DT  J "C5'" 1 
ATOM   3725  C  "C4'" . DT  B  1 37  ? -10.864 24.115  -2.110  1.00 117.54 ? 183 DT  J "C4'" 1 
ATOM   3726  O  "O4'" . DT  B  1 37  ? -11.584 25.329  -2.457  1.00 112.65 ? 183 DT  J "O4'" 1 
ATOM   3727  C  "C3'" . DT  B  1 37  ? -9.788  23.955  -3.171  1.00 111.42 ? 183 DT  J "C3'" 1 
ATOM   3728  O  "O3'" . DT  B  1 37  ? -10.286 23.183  -4.251  1.00 101.03 ? 183 DT  J "O3'" 1 
ATOM   3729  C  "C2'" . DT  B  1 37  ? -9.520  25.398  -3.583  1.00 108.74 ? 183 DT  J "C2'" 1 
ATOM   3730  C  "C1'" . DT  B  1 37  ? -10.916 26.003  -3.504  1.00 107.47 ? 183 DT  J "C1'" 1 
ATOM   3731  N  N1    . DT  B  1 37  ? -10.916 27.463  -3.199  1.00 104.13 ? 183 DT  J N1    1 
ATOM   3732  C  C2    . DT  B  1 37  ? -11.357 28.348  -4.151  1.00 104.67 ? 183 DT  J C2    1 
ATOM   3733  O  O2    . DT  B  1 37  ? -11.753 28.004  -5.250  1.00 106.58 ? 183 DT  J O2    1 
ATOM   3734  N  N3    . DT  B  1 37  ? -11.320 29.664  -3.771  1.00 108.14 ? 183 DT  J N3    1 
ATOM   3735  C  C4    . DT  B  1 37  ? -10.894 30.172  -2.557  1.00 107.57 ? 183 DT  J C4    1 
ATOM   3736  O  O4    . DT  B  1 37  ? -10.898 31.374  -2.308  1.00 104.66 ? 183 DT  J O4    1 
ATOM   3737  C  C5    . DT  B  1 37  ? -10.444 29.189  -1.602  1.00 110.69 ? 183 DT  J C5    1 
ATOM   3738  C  C7    . DT  B  1 37  ? -9.958  29.620  -0.249  1.00 108.14 ? 183 DT  J C7    1 
ATOM   3739  C  C6    . DT  B  1 37  ? -10.474 27.896  -1.966  1.00 108.48 ? 183 DT  J C6    1 
ATOM   3740  P  P     . DT  B  1 38  ? -9.270  22.395  -5.212  1.00 107.56 ? 184 DT  J P     1 
ATOM   3741  O  OP1   . DT  B  1 38  ? -9.650  20.965  -5.200  1.00 111.35 ? 184 DT  J OP1   1 
ATOM   3742  O  OP2   . DT  B  1 38  ? -7.896  22.792  -4.831  1.00 101.26 ? 184 DT  J OP2   1 
ATOM   3743  O  "O5'" . DT  B  1 38  ? -9.578  23.003  -6.659  1.00 106.13 ? 184 DT  J "O5'" 1 
ATOM   3744  C  "C5'" . DT  B  1 38  ? -10.477 24.099  -6.786  1.00 105.57 ? 184 DT  J "C5'" 1 
ATOM   3745  C  "C4'" . DT  B  1 38  ? -10.075 25.002  -7.937  1.00 102.89 ? 184 DT  J "C4'" 1 
ATOM   3746  O  "O4'" . DT  B  1 38  ? -10.002 26.380  -7.473  1.00 98.62  ? 184 DT  J "O4'" 1 
ATOM   3747  C  "C3'" . DT  B  1 38  ? -8.707  24.706  -8.546  1.00 105.11 ? 184 DT  J "C3'" 1 
ATOM   3748  O  "O3'" . DT  B  1 38  ? -8.724  25.054  -9.919  1.00 102.33 ? 184 DT  J "O3'" 1 
ATOM   3749  C  "C2'" . DT  B  1 38  ? -7.806  25.648  -7.760  1.00 101.17 ? 184 DT  J "C2'" 1 
ATOM   3750  C  "C1'" . DT  B  1 38  ? -8.697  26.876  -7.701  1.00 99.32  ? 184 DT  J "C1'" 1 
ATOM   3751  N  N1    . DT  B  1 38  ? -8.348  27.830  -6.612  1.00 101.06 ? 184 DT  J N1    1 
ATOM   3752  C  C2    . DT  B  1 38  ? -8.780  29.132  -6.701  1.00 102.04 ? 184 DT  J C2    1 
ATOM   3753  O  O2    . DT  B  1 38  ? -9.444  29.552  -7.632  1.00 99.59  ? 184 DT  J O2    1 
ATOM   3754  N  N3    . DT  B  1 38  ? -8.408  29.932  -5.654  1.00 103.16 ? 184 DT  J N3    1 
ATOM   3755  C  C4    . DT  B  1 38  ? -7.659  29.567  -4.551  1.00 102.00 ? 184 DT  J C4    1 
ATOM   3756  O  O4    . DT  B  1 38  ? -7.376  30.361  -3.661  1.00 97.61  ? 184 DT  J O4    1 
ATOM   3757  C  C5    . DT  B  1 38  ? -7.236  28.187  -4.521  1.00 100.07 ? 184 DT  J C5    1 
ATOM   3758  C  C7    . DT  B  1 38  ? -6.418  27.674  -3.374  1.00 99.51  ? 184 DT  J C7    1 
ATOM   3759  C  C6    . DT  B  1 38  ? -7.593  27.396  -5.544  1.00 99.53  ? 184 DT  J C6    1 
ATOM   3760  P  P     . DG  B  1 39  ? -7.942  24.167  -11.007 1.00 95.99  ? 185 DG  J P     1 
ATOM   3761  O  OP1   . DG  B  1 39  ? -8.732  22.932  -11.230 1.00 89.17  ? 185 DG  J OP1   1 
ATOM   3762  O  OP2   . DG  B  1 39  ? -6.523  24.075  -10.597 1.00 98.60  ? 185 DG  J OP2   1 
ATOM   3763  O  "O5'" . DG  B  1 39  ? -8.011  25.070  -12.323 1.00 88.68  ? 185 DG  J "O5'" 1 
ATOM   3764  C  "C5'" . DG  B  1 39  ? -9.264  25.588  -12.751 1.00 83.64  ? 185 DG  J "C5'" 1 
ATOM   3765  C  "C4'" . DG  B  1 39  ? -9.186  27.085  -13.003 1.00 82.71  ? 185 DG  J "C4'" 1 
ATOM   3766  O  "O4'" . DG  B  1 39  ? -8.810  27.775  -11.784 1.00 90.63  ? 185 DG  J "O4'" 1 
ATOM   3767  C  "C3'" . DG  B  1 39  ? -8.172  27.517  -14.055 1.00 82.03  ? 185 DG  J "C3'" 1 
ATOM   3768  O  "O3'" . DG  B  1 39  ? -8.695  28.608  -14.776 1.00 76.86  ? 185 DG  J "O3'" 1 
ATOM   3769  C  "C2'" . DG  B  1 39  ? -6.971  27.933  -13.216 1.00 88.05  ? 185 DG  J "C2'" 1 
ATOM   3770  C  "C1'" . DG  B  1 39  ? -7.662  28.561  -12.021 1.00 89.08  ? 185 DG  J "C1'" 1 
ATOM   3771  N  N9    . DG  B  1 39  ? -6.854  28.554  -10.813 1.00 97.04  ? 185 DG  J N9    1 
ATOM   3772  C  C8    . DG  B  1 39  ? -6.253  27.468  -10.224 1.00 98.88  ? 185 DG  J C8    1 
ATOM   3773  N  N7    . DG  B  1 39  ? -5.598  27.765  -9.137  1.00 102.71 ? 185 DG  J N7    1 
ATOM   3774  C  C5    . DG  B  1 39  ? -5.780  29.135  -8.997  1.00 100.39 ? 185 DG  J C5    1 
ATOM   3775  C  C6    . DG  B  1 39  ? -5.304  30.019  -8.005  1.00 98.99  ? 185 DG  J C6    1 
ATOM   3776  O  O6    . DG  B  1 39  ? -4.603  29.757  -7.018  1.00 102.96 ? 185 DG  J O6    1 
ATOM   3777  N  N1    . DG  B  1 39  ? -5.721  31.328  -8.239  1.00 98.23  ? 185 DG  J N1    1 
ATOM   3778  C  C2    . DG  B  1 39  ? -6.496  31.729  -9.301  1.00 96.07  ? 185 DG  J C2    1 
ATOM   3779  N  N2    . DG  B  1 39  ? -6.794  33.034  -9.364  1.00 91.97  ? 185 DG  J N2    1 
ATOM   3780  N  N3    . DG  B  1 39  ? -6.948  30.909  -10.237 1.00 95.01  ? 185 DG  J N3    1 
ATOM   3781  C  C4    . DG  B  1 39  ? -6.552  29.633  -10.021 1.00 97.58  ? 185 DG  J C4    1 
ATOM   3782  P  P     . DG  B  1 40  ? -8.209  28.895  -16.276 1.00 71.42  ? 186 DG  J P     1 
ATOM   3783  O  OP1   . DG  B  1 40  ? -9.426  29.234  -17.047 1.00 61.59  ? 186 DG  J OP1   1 
ATOM   3784  O  OP2   . DG  B  1 40  ? -7.332  27.774  -16.699 1.00 59.58  ? 186 DG  J OP2   1 
ATOM   3785  O  "O5'" . DG  B  1 40  ? -7.304  30.204  -16.132 1.00 70.07  ? 186 DG  J "O5'" 1 
ATOM   3786  C  "C5'" . DG  B  1 40  ? -7.690  31.235  -15.232 1.00 80.59  ? 186 DG  J "C5'" 1 
ATOM   3787  C  "C4'" . DG  B  1 40  ? -6.577  32.255  -15.053 1.00 95.17  ? 186 DG  J "C4'" 1 
ATOM   3788  O  "O4'" . DG  B  1 40  ? -5.740  31.883  -13.926 1.00 98.27  ? 186 DG  J "O4'" 1 
ATOM   3789  C  "C3'" . DG  B  1 40  ? -5.623  32.403  -16.232 1.00 94.17  ? 186 DG  J "C3'" 1 
ATOM   3790  O  "O3'" . DG  B  1 40  ? -5.119  33.718  -16.247 1.00 96.33  ? 186 DG  J "O3'" 1 
ATOM   3791  C  "C2'" . DG  B  1 40  ? -4.523  31.412  -15.872 1.00 95.11  ? 186 DG  J "C2'" 1 
ATOM   3792  C  "C1'" . DG  B  1 40  ? -4.418  31.660  -14.376 1.00 99.58  ? 186 DG  J "C1'" 1 
ATOM   3793  N  N9    . DG  B  1 40  ? -3.868  30.546  -13.622 1.00 97.11  ? 186 DG  J N9    1 
ATOM   3794  C  C8    . DG  B  1 40  ? -3.618  29.272  -14.070 1.00 94.96  ? 186 DG  J C8    1 
ATOM   3795  N  N7    . DG  B  1 40  ? -3.129  28.487  -13.149 1.00 98.03  ? 186 DG  J N7    1 
ATOM   3796  C  C5    . DG  B  1 40  ? -3.057  29.296  -12.020 1.00 101.34 ? 186 DG  J C5    1 
ATOM   3797  C  C6    . DG  B  1 40  ? -2.606  29.002  -10.709 1.00 104.80 ? 186 DG  J C6    1 
ATOM   3798  O  O6    . DG  B  1 40  ? -2.165  27.929  -10.269 1.00 102.49 ? 186 DG  J O6    1 
ATOM   3799  N  N1    . DG  B  1 40  ? -2.703  30.113  -9.872  1.00 100.23 ? 186 DG  J N1    1 
ATOM   3800  C  C2    . DG  B  1 40  ? -3.177  31.346  -10.255 1.00 96.90  ? 186 DG  J C2    1 
ATOM   3801  N  N2    . DG  B  1 40  ? -3.196  32.297  -9.312  1.00 99.65  ? 186 DG  J N2    1 
ATOM   3802  N  N3    . DG  B  1 40  ? -3.600  31.630  -11.474 1.00 97.17  ? 186 DG  J N3    1 
ATOM   3803  C  C4    . DG  B  1 40  ? -3.511  30.563  -12.300 1.00 98.91  ? 186 DG  J C4    1 
ATOM   3804  P  P     . DA  B  1 41  ? -5.210  34.615  -17.572 1.00 99.47  ? 187 DA  J P     1 
ATOM   3805  O  OP1   . DA  B  1 41  ? -6.610  34.585  -18.053 1.00 105.00 ? 187 DA  J OP1   1 
ATOM   3806  O  OP2   . DA  B  1 41  ? -4.113  34.172  -18.463 1.00 93.75  ? 187 DA  J OP2   1 
ATOM   3807  O  "O5'" . DA  B  1 41  ? -4.872  36.088  -17.043 1.00 101.68 ? 187 DA  J "O5'" 1 
ATOM   3808  C  "C5'" . DA  B  1 41  ? -5.485  36.573  -15.847 1.00 99.70  ? 187 DA  J "C5'" 1 
ATOM   3809  C  "C4'" . DA  B  1 41  ? -4.483  37.325  -14.982 1.00 103.89 ? 187 DA  J "C4'" 1 
ATOM   3810  O  "O4'" . DA  B  1 41  ? -3.858  36.407  -14.045 1.00 104.38 ? 187 DA  J "O4'" 1 
ATOM   3811  C  "C3'" . DA  B  1 41  ? -3.342  37.998  -15.741 1.00 103.22 ? 187 DA  J "C3'" 1 
ATOM   3812  O  "O3'" . DA  B  1 41  ? -3.019  39.240  -15.126 1.00 111.32 ? 187 DA  J "O3'" 1 
ATOM   3813  C  "C2'" . DA  B  1 41  ? -2.203  36.991  -15.605 1.00 103.40 ? 187 DA  J "C2'" 1 
ATOM   3814  C  "C1'" . DA  B  1 41  ? -2.455  36.420  -14.218 1.00 103.95 ? 187 DA  J "C1'" 1 
ATOM   3815  N  N9    . DA  B  1 41  ? -1.959  35.055  -14.060 1.00 104.13 ? 187 DA  J N9    1 
ATOM   3816  C  C8    . DA  B  1 41  ? -1.839  34.107  -15.037 1.00 99.69  ? 187 DA  J C8    1 
ATOM   3817  N  N7    . DA  B  1 41  ? -1.361  32.963  -14.610 1.00 101.95 ? 187 DA  J N7    1 
ATOM   3818  C  C5    . DA  B  1 41  ? -1.153  33.173  -13.258 1.00 103.33 ? 187 DA  J C5    1 
ATOM   3819  C  C6    . DA  B  1 41  ? -0.656  32.342  -12.232 1.00 105.18 ? 187 DA  J C6    1 
ATOM   3820  N  N6    . DA  B  1 41  ? -0.270  31.077  -12.429 1.00 103.26 ? 187 DA  J N6    1 
ATOM   3821  N  N1    . DA  B  1 41  ? -0.576  32.863  -10.991 1.00 108.99 ? 187 DA  J N1    1 
ATOM   3822  C  C2    . DA  B  1 41  ? -0.966  34.130  -10.795 1.00 109.46 ? 187 DA  J C2    1 
ATOM   3823  N  N3    . DA  B  1 41  ? -1.446  35.005  -11.678 1.00 105.00 ? 187 DA  J N3    1 
ATOM   3824  C  C4    . DA  B  1 41  ? -1.515  34.459  -12.902 1.00 104.40 ? 187 DA  J C4    1 
ATOM   3825  P  P     . DA  B  1 42  ? -1.931  40.222  -15.788 1.00 119.79 ? 188 DA  J P     1 
ATOM   3826  O  OP1   . DA  B  1 42  ? -2.512  41.584  -15.789 1.00 102.60 ? 188 DA  J OP1   1 
ATOM   3827  O  OP2   . DA  B  1 42  ? -1.459  39.625  -17.058 1.00 114.05 ? 188 DA  J OP2   1 
ATOM   3828  O  "O5'" . DA  B  1 42  ? -0.713  40.187  -14.753 1.00 110.81 ? 188 DA  J "O5'" 1 
ATOM   3829  C  "C5'" . DA  B  1 42  ? -0.918  40.603  -13.409 1.00 107.41 ? 188 DA  J "C5'" 1 
ATOM   3830  C  "C4'" . DA  B  1 42  ? 0.367   40.504  -12.606 1.00 109.08 ? 188 DA  J "C4'" 1 
ATOM   3831  O  "O4'" . DA  B  1 42  ? 0.640   39.116  -12.291 1.00 106.41 ? 188 DA  J "O4'" 1 
ATOM   3832  C  "C3'" . DA  B  1 42  ? 1.614   41.034  -13.307 1.00 111.60 ? 188 DA  J "C3'" 1 
ATOM   3833  O  "O3'" . DA  B  1 42  ? 2.457   41.674  -12.368 1.00 111.05 ? 188 DA  J "O3'" 1 
ATOM   3834  C  "C2'" . DA  B  1 42  ? 2.261   39.770  -13.863 1.00 109.31 ? 188 DA  J "C2'" 1 
ATOM   3835  C  "C1'" . DA  B  1 42  ? 1.903   38.743  -12.800 1.00 109.06 ? 188 DA  J "C1'" 1 
ATOM   3836  N  N9    . DA  B  1 42  ? 1.794   37.388  -13.325 1.00 110.31 ? 188 DA  J N9    1 
ATOM   3837  C  C8    . DA  B  1 42  ? 1.082   36.987  -14.420 1.00 108.69 ? 188 DA  J C8    1 
ATOM   3838  N  N7    . DA  B  1 42  ? 1.161   35.700  -14.660 1.00 109.49 ? 188 DA  J N7    1 
ATOM   3839  C  C5    . DA  B  1 42  ? 1.981   35.224  -13.651 1.00 109.60 ? 188 DA  J C5    1 
ATOM   3840  C  C6    . DA  B  1 42  ? 2.453   33.934  -13.341 1.00 108.95 ? 188 DA  J C6    1 
ATOM   3841  N  N6    . DA  B  1 42  ? 2.150   32.849  -14.061 1.00 109.05 ? 188 DA  J N6    1 
ATOM   3842  N  N1    . DA  B  1 42  ? 3.255   33.804  -12.264 1.00 110.08 ? 188 DA  J N1    1 
ATOM   3843  C  C2    . DA  B  1 42  ? 3.557   34.894  -11.549 1.00 111.40 ? 188 DA  J C2    1 
ATOM   3844  N  N3    . DA  B  1 42  ? 3.174   36.155  -11.740 1.00 111.07 ? 188 DA  J N3    1 
ATOM   3845  C  C4    . DA  B  1 42  ? 2.379   36.252  -12.818 1.00 110.60 ? 188 DA  J C4    1 
ATOM   3846  P  P     . DA  B  1 43  ? 3.590   42.699  -12.861 1.00 118.49 ? 189 DA  J P     1 
ATOM   3847  O  OP1   . DA  B  1 43  ? 3.277   44.022  -12.278 1.00 114.35 ? 189 DA  J OP1   1 
ATOM   3848  O  OP2   . DA  B  1 43  ? 3.727   42.562  -14.328 1.00 115.54 ? 189 DA  J OP2   1 
ATOM   3849  O  "O5'" . DA  B  1 43  ? 4.926   42.126  -12.191 1.00 124.25 ? 189 DA  J "O5'" 1 
ATOM   3850  C  "C5'" . DA  B  1 43  ? 4.849   41.038  -11.272 1.00 116.93 ? 189 DA  J "C5'" 1 
ATOM   3851  C  "C4'" . DA  B  1 43  ? 6.178   40.310  -11.184 1.00 116.48 ? 189 DA  J "C4'" 1 
ATOM   3852  O  "O4'" . DA  B  1 43  ? 6.003   38.934  -11.615 1.00 112.92 ? 189 DA  J "O4'" 1 
ATOM   3853  C  "C3'" . DA  B  1 43  ? 7.282   40.880  -12.070 1.00 120.41 ? 189 DA  J "C3'" 1 
ATOM   3854  O  "O3'" . DA  B  1 43  ? 8.550   40.679  -11.457 1.00 121.82 ? 189 DA  J "O3'" 1 
ATOM   3855  C  "C2'" . DA  B  1 43  ? 7.143   40.047  -13.334 1.00 120.49 ? 189 DA  J "C2'" 1 
ATOM   3856  C  "C1'" . DA  B  1 43  ? 6.813   38.684  -12.746 1.00 115.95 ? 189 DA  J "C1'" 1 
ATOM   3857  N  N9    . DA  B  1 43  ? 6.077   37.825  -13.663 1.00 113.42 ? 189 DA  J N9    1 
ATOM   3858  C  C8    . DA  B  1 43  ? 5.234   38.219  -14.662 1.00 113.51 ? 189 DA  J C8    1 
ATOM   3859  N  N7    . DA  B  1 43  ? 4.710   37.224  -15.336 1.00 110.81 ? 189 DA  J N7    1 
ATOM   3860  C  C5    . DA  B  1 43  ? 5.249   36.099  -14.736 1.00 108.49 ? 189 DA  J C5    1 
ATOM   3861  C  C6    . DA  B  1 43  ? 5.089   34.725  -14.986 1.00 108.60 ? 189 DA  J C6    1 
ATOM   3862  N  N6    . DA  B  1 43  ? 4.303   34.241  -15.952 1.00 109.24 ? 189 DA  J N6    1 
ATOM   3863  N  N1    . DA  B  1 43  ? 5.771   33.863  -14.204 1.00 111.85 ? 189 DA  J N1    1 
ATOM   3864  C  C2    . DA  B  1 43  ? 6.556   34.353  -13.237 1.00 115.17 ? 189 DA  J C2    1 
ATOM   3865  N  N3    . DA  B  1 43  ? 6.785   35.623  -12.908 1.00 116.69 ? 189 DA  J N3    1 
ATOM   3866  C  C4    . DA  B  1 43  ? 6.094   36.453  -13.704 1.00 111.90 ? 189 DA  J C4    1 
ATOM   3867  P  P     . DC  B  1 44  ? 9.863   41.400  -12.043 1.00 126.77 ? 190 DC  J P     1 
ATOM   3868  O  OP1   . DC  B  1 44  ? 10.916  41.306  -11.008 1.00 121.55 ? 190 DC  J OP1   1 
ATOM   3869  O  OP2   . DC  B  1 44  ? 9.461   42.720  -12.579 1.00 120.40 ? 190 DC  J OP2   1 
ATOM   3870  O  "O5'" . DC  B  1 44  ? 10.280  40.491  -13.291 1.00 119.01 ? 190 DC  J "O5'" 1 
ATOM   3871  C  "C5'" . DC  B  1 44  ? 11.647  40.184  -13.521 1.00 122.78 ? 190 DC  J "C5'" 1 
ATOM   3872  C  "C4'" . DC  B  1 44  ? 12.007  38.847  -12.899 1.00 125.70 ? 190 DC  J "C4'" 1 
ATOM   3873  O  "O4'" . DC  B  1 44  ? 10.892  37.924  -13.060 1.00 124.44 ? 190 DC  J "O4'" 1 
ATOM   3874  C  "C3'" . DC  B  1 44  ? 13.208  38.151  -13.534 1.00 120.28 ? 190 DC  J "C3'" 1 
ATOM   3875  O  "O3'" . DC  B  1 44  ? 13.881  37.352  -12.563 1.00 121.89 ? 190 DC  J "O3'" 1 
ATOM   3876  C  "C2'" . DC  B  1 44  ? 12.542  37.288  -14.592 1.00 119.02 ? 190 DC  J "C2'" 1 
ATOM   3877  C  "C1'" . DC  B  1 44  ? 11.308  36.818  -13.836 1.00 121.49 ? 190 DC  J "C1'" 1 
ATOM   3878  N  N1    . DC  B  1 44  ? 10.191  36.396  -14.731 1.00 115.33 ? 190 DC  J N1    1 
ATOM   3879  C  C2    . DC  B  1 44  ? 9.760   35.063  -14.720 1.00 116.39 ? 190 DC  J C2    1 
ATOM   3880  O  O2    . DC  B  1 44  ? 10.306  34.258  -13.955 1.00 118.18 ? 190 DC  J O2    1 
ATOM   3881  N  N3    . DC  B  1 44  ? 8.751   34.693  -15.547 1.00 112.30 ? 190 DC  J N3    1 
ATOM   3882  C  C4    . DC  B  1 44  ? 8.189   35.591  -16.357 1.00 110.20 ? 190 DC  J C4    1 
ATOM   3883  N  N4    . DC  B  1 44  ? 7.200   35.180  -17.155 1.00 108.61 ? 190 DC  J N4    1 
ATOM   3884  C  C5    . DC  B  1 44  ? 8.618   36.951  -16.388 1.00 110.49 ? 190 DC  J C5    1 
ATOM   3885  C  C6    . DC  B  1 44  ? 9.613   37.305  -15.568 1.00 113.91 ? 190 DC  J C6    1 
ATOM   3886  P  P     . DT  B  1 45  ? 15.381  36.833  -12.832 1.00 131.39 ? 191 DT  J P     1 
ATOM   3887  O  OP1   . DT  B  1 45  ? 15.838  36.131  -11.611 1.00 118.01 ? 191 DT  J OP1   1 
ATOM   3888  O  OP2   . DT  B  1 45  ? 16.163  37.971  -13.365 1.00 117.54 ? 191 DT  J OP2   1 
ATOM   3889  O  "O5'" . DT  B  1 45  ? 15.219  35.756  -14.006 1.00 126.52 ? 191 DT  J "O5'" 1 
ATOM   3890  C  "C5'" . DT  B  1 45  ? 14.570  34.508  -13.752 1.00 125.59 ? 191 DT  J "C5'" 1 
ATOM   3891  C  "C4'" . DT  B  1 45  ? 14.568  33.639  -14.998 1.00 122.96 ? 191 DT  J "C4'" 1 
ATOM   3892  O  "O4'" . DT  B  1 45  ? 13.379  33.911  -15.790 1.00 120.76 ? 191 DT  J "O4'" 1 
ATOM   3893  C  "C3'" . DT  B  1 45  ? 15.762  33.852  -15.932 1.00 124.10 ? 191 DT  J "C3'" 1 
ATOM   3894  O  "O3'" . DT  B  1 45  ? 16.286  32.597  -16.347 1.00 121.09 ? 191 DT  J "O3'" 1 
ATOM   3895  C  "C2'" . DT  B  1 45  ? 15.162  34.630  -17.104 1.00 121.27 ? 191 DT  J "C2'" 1 
ATOM   3896  C  "C1'" . DT  B  1 45  ? 13.748  34.073  -17.140 1.00 120.03 ? 191 DT  J "C1'" 1 
ATOM   3897  N  N1    . DT  B  1 45  ? 12.755  34.978  -17.810 1.00 119.20 ? 191 DT  J N1    1 
ATOM   3898  C  C2    . DT  B  1 45  ? 11.615  34.435  -18.363 1.00 111.09 ? 191 DT  J C2    1 
ATOM   3899  O  O2    . DT  B  1 45  ? 11.360  33.243  -18.335 1.00 106.45 ? 191 DT  J O2    1 
ATOM   3900  N  N3    . DT  B  1 45  ? 10.774  35.346  -18.951 1.00 110.39 ? 191 DT  J N3    1 
ATOM   3901  C  C4    . DT  B  1 45  ? 10.956  36.716  -19.042 1.00 111.14 ? 191 DT  J C4    1 
ATOM   3902  O  O4    . DT  B  1 45  ? 10.140  37.451  -19.591 1.00 104.58 ? 191 DT  J O4    1 
ATOM   3903  C  C5    . DT  B  1 45  ? 12.171  37.219  -18.446 1.00 115.02 ? 191 DT  J C5    1 
ATOM   3904  C  C7    . DT  B  1 45  ? 12.478  38.688  -18.482 1.00 111.61 ? 191 DT  J C7    1 
ATOM   3905  C  C6    . DT  B  1 45  ? 13.004  36.337  -17.868 1.00 119.12 ? 191 DT  J C6    1 
ATOM   3906  P  P     . DG  B  1 46  ? 17.854  32.289  -16.187 1.00 124.47 ? 192 DG  J P     1 
ATOM   3907  O  OP1   . DG  B  1 46  ? 18.172  32.303  -14.741 1.00 124.62 ? 192 DG  J OP1   1 
ATOM   3908  O  OP2   . DG  B  1 46  ? 18.572  33.198  -17.110 1.00 112.44 ? 192 DG  J OP2   1 
ATOM   3909  O  "O5'" . DG  B  1 46  ? 18.016  30.796  -16.743 1.00 125.29 ? 192 DG  J "O5'" 1 
ATOM   3910  C  "C5'" . DG  B  1 46  ? 17.136  29.760  -16.300 1.00 123.65 ? 192 DG  J "C5'" 1 
ATOM   3911  C  "C4'" . DG  B  1 46  ? 16.561  28.985  -17.479 1.00 117.20 ? 192 DG  J "C4'" 1 
ATOM   3912  O  "O4'" . DG  B  1 46  ? 15.579  29.805  -18.173 1.00 118.02 ? 192 DG  J "O4'" 1 
ATOM   3913  C  "C3'" . DG  B  1 46  ? 17.573  28.572  -18.549 1.00 113.59 ? 192 DG  J "C3'" 1 
ATOM   3914  O  "O3'" . DG  B  1 46  ? 17.158  27.339  -19.155 1.00 112.79 ? 192 DG  J "O3'" 1 
ATOM   3915  C  "C2'" . DG  B  1 46  ? 17.478  29.733  -19.529 1.00 108.49 ? 192 DG  J "C2'" 1 
ATOM   3916  C  "C1'" . DG  B  1 46  ? 15.977  29.971  -19.519 1.00 111.00 ? 192 DG  J "C1'" 1 
ATOM   3917  N  N9    . DG  B  1 46  ? 15.592  31.304  -19.964 1.00 109.13 ? 192 DG  J N9    1 
ATOM   3918  C  C8    . DG  B  1 46  ? 16.184  32.494  -19.619 1.00 116.45 ? 192 DG  J C8    1 
ATOM   3919  N  N7    . DG  B  1 46  ? 15.623  33.532  -20.173 1.00 115.78 ? 192 DG  J N7    1 
ATOM   3920  C  C5    . DG  B  1 46  ? 14.593  32.997  -20.934 1.00 108.75 ? 192 DG  J C5    1 
ATOM   3921  C  C6    . DG  B  1 46  ? 13.640  33.641  -21.757 1.00 107.34 ? 192 DG  J C6    1 
ATOM   3922  O  O6    . DG  B  1 46  ? 13.515  34.852  -21.983 1.00 108.33 ? 192 DG  J O6    1 
ATOM   3923  N  N1    . DG  B  1 46  ? 12.772  32.729  -22.351 1.00 104.90 ? 192 DG  J N1    1 
ATOM   3924  C  C2    . DG  B  1 46  ? 12.820  31.368  -22.171 1.00 104.49 ? 192 DG  J C2    1 
ATOM   3925  N  N2    . DG  B  1 46  ? 11.897  30.650  -22.829 1.00 101.25 ? 192 DG  J N2    1 
ATOM   3926  N  N3    . DG  B  1 46  ? 13.709  30.751  -21.402 1.00 107.42 ? 192 DG  J N3    1 
ATOM   3927  C  C4    . DG  B  1 46  ? 14.561  31.626  -20.817 1.00 105.73 ? 192 DG  J C4    1 
ATOM   3928  P  P     . DC  B  1 47  ? 18.153  26.511  -20.113 1.00 111.31 ? 193 DC  J P     1 
ATOM   3929  O  OP1   . DC  B  1 47  ? 18.243  25.133  -19.579 1.00 106.30 ? 193 DC  J OP1   1 
ATOM   3930  O  OP2   . DC  B  1 47  ? 19.381  27.317  -20.300 1.00 106.06 ? 193 DC  J OP2   1 
ATOM   3931  O  "O5'" . DC  B  1 47  ? 17.387  26.469  -21.519 1.00 105.98 ? 193 DC  J "O5'" 1 
ATOM   3932  C  "C5'" . DC  B  1 47  ? 16.992  27.689  -22.133 1.00 112.13 ? 193 DC  J "C5'" 1 
ATOM   3933  C  "C4'" . DC  B  1 47  ? 16.266  27.455  -23.438 1.00 103.30 ? 193 DC  J "C4'" 1 
ATOM   3934  O  "O4'" . DC  B  1 47  ? 15.570  28.672  -23.806 1.00 99.88  ? 193 DC  J "O4'" 1 
ATOM   3935  C  "C3'" . DC  B  1 47  ? 17.171  27.145  -24.616 1.00 97.91  ? 193 DC  J "C3'" 1 
ATOM   3936  O  "O3'" . DC  B  1 47  ? 16.449  26.434  -25.608 1.00 95.39  ? 193 DC  J "O3'" 1 
ATOM   3937  C  "C2'" . DC  B  1 47  ? 17.552  28.541  -25.095 1.00 99.16  ? 193 DC  J "C2'" 1 
ATOM   3938  C  "C1'" . DC  B  1 47  ? 16.256  29.319  -24.864 1.00 99.54  ? 193 DC  J "C1'" 1 
ATOM   3939  N  N1    . DC  B  1 47  ? 16.477  30.749  -24.488 1.00 100.85 ? 193 DC  J N1    1 
ATOM   3940  C  C2    . DC  B  1 47  ? 15.581  31.728  -24.935 1.00 104.62 ? 193 DC  J C2    1 
ATOM   3941  O  O2    . DC  B  1 47  ? 14.613  31.389  -25.627 1.00 104.01 ? 193 DC  J O2    1 
ATOM   3942  N  N3    . DC  B  1 47  ? 15.796  33.024  -24.589 1.00 103.79 ? 193 DC  J N3    1 
ATOM   3943  C  C4    . DC  B  1 47  ? 16.850  33.349  -23.840 1.00 104.24 ? 193 DC  J C4    1 
ATOM   3944  N  N4    . DC  B  1 47  ? 17.020  34.638  -23.527 1.00 108.43 ? 193 DC  J N4    1 
ATOM   3945  C  C5    . DC  B  1 47  ? 17.776  32.365  -23.379 1.00 106.41 ? 193 DC  J C5    1 
ATOM   3946  C  C6    . DC  B  1 47  ? 17.553  31.092  -23.725 1.00 102.60 ? 193 DC  J C6    1 
ATOM   3947  P  P     . DT  B  1 48  ? 16.872  24.933  -25.993 1.00 107.32 ? 194 DT  J P     1 
ATOM   3948  O  OP1   . DT  B  1 48  ? 16.679  24.076  -24.799 1.00 107.97 ? 194 DT  J OP1   1 
ATOM   3949  O  OP2   . DT  B  1 48  ? 18.187  25.003  -26.666 1.00 104.07 ? 194 DT  J OP2   1 
ATOM   3950  O  "O5'" . DT  B  1 48  ? 15.799  24.504  -27.092 1.00 102.30 ? 194 DT  J "O5'" 1 
ATOM   3951  C  "C5'" . DT  B  1 48  ? 15.781  25.157  -28.347 1.00 98.09  ? 194 DT  J "C5'" 1 
ATOM   3952  C  "C4'" . DT  B  1 48  ? 14.400  25.706  -28.649 1.00 90.12  ? 194 DT  J "C4'" 1 
ATOM   3953  O  "O4'" . DT  B  1 48  ? 14.285  27.051  -28.104 1.00 86.68  ? 194 DT  J "O4'" 1 
ATOM   3954  C  "C3'" . DT  B  1 48  ? 14.084  25.841  -30.133 1.00 84.97  ? 194 DT  J "C3'" 1 
ATOM   3955  O  "O3'" . DT  B  1 48  ? 12.689  25.676  -30.351 1.00 79.14  ? 194 DT  J "O3'" 1 
ATOM   3956  C  "C2'" . DT  B  1 48  ? 14.529  27.266  -30.422 1.00 84.49  ? 194 DT  J "C2'" 1 
ATOM   3957  C  "C1'" . DT  B  1 48  ? 14.069  27.969  -29.156 1.00 81.40  ? 194 DT  J "C1'" 1 
ATOM   3958  N  N1    . DT  B  1 48  ? 14.812  29.229  -28.863 1.00 85.31  ? 194 DT  J N1    1 
ATOM   3959  C  C2    . DT  B  1 48  ? 14.114  30.413  -28.779 1.00 94.56  ? 194 DT  J C2    1 
ATOM   3960  O  O2    . DT  B  1 48  ? 12.906  30.489  -28.929 1.00 93.36  ? 194 DT  J O2    1 
ATOM   3961  N  N3    . DT  B  1 48  ? 14.883  31.514  -28.509 1.00 95.48  ? 194 DT  J N3    1 
ATOM   3962  C  C4    . DT  B  1 48  ? 16.251  31.553  -28.319 1.00 94.47  ? 194 DT  J C4    1 
ATOM   3963  O  O4    . DT  B  1 48  ? 16.851  32.596  -28.080 1.00 94.46  ? 194 DT  J O4    1 
ATOM   3964  C  C5    . DT  B  1 48  ? 16.926  30.280  -28.423 1.00 93.10  ? 194 DT  J C5    1 
ATOM   3965  C  C7    . DT  B  1 48  ? 18.413  30.199  -28.237 1.00 89.90  ? 194 DT  J C7    1 
ATOM   3966  C  C6    . DT  B  1 48  ? 16.182  29.190  -28.688 1.00 88.18  ? 194 DT  J C6    1 
ATOM   3967  P  P     . DC  B  1 49  ? 12.145  25.198  -31.785 1.00 73.66  ? 195 DC  J P     1 
ATOM   3968  O  OP1   . DC  B  1 49  ? 10.937  24.372  -31.568 1.00 64.40  ? 195 DC  J OP1   1 
ATOM   3969  O  OP2   . DC  B  1 49  ? 13.300  24.668  -32.547 1.00 75.13  ? 195 DC  J OP2   1 
ATOM   3970  O  "O5'" . DC  B  1 49  ? 11.716  26.555  -32.501 1.00 77.01  ? 195 DC  J "O5'" 1 
ATOM   3971  C  "C5'" . DC  B  1 49  ? 11.244  27.641  -31.732 1.00 73.44  ? 195 DC  J "C5'" 1 
ATOM   3972  C  "C4'" . DC  B  1 49  ? 11.280  28.916  -32.545 1.00 73.60  ? 195 DC  J "C4'" 1 
ATOM   3973  O  "O4'" . DC  B  1 49  ? 12.440  29.706  -32.171 1.00 79.86  ? 195 DC  J "O4'" 1 
ATOM   3974  C  "C3'" . DC  B  1 49  ? 11.377  28.721  -34.060 1.00 68.54  ? 195 DC  J "C3'" 1 
ATOM   3975  O  "O3'" . DC  B  1 49  ? 10.607  29.723  -34.701 1.00 75.71  ? 195 DC  J "O3'" 1 
ATOM   3976  C  "C2'" . DC  B  1 49  ? 12.866  28.921  -34.323 1.00 65.82  ? 195 DC  J "C2'" 1 
ATOM   3977  C  "C1'" . DC  B  1 49  ? 13.170  30.034  -33.333 1.00 77.98  ? 195 DC  J "C1'" 1 
ATOM   3978  N  N1    . DC  B  1 49  ? 14.615  30.159  -32.969 1.00 81.83  ? 195 DC  J N1    1 
ATOM   3979  C  C2    . DC  B  1 49  ? 15.103  31.384  -32.493 1.00 81.29  ? 195 DC  J C2    1 
ATOM   3980  O  O2    . DC  B  1 49  ? 14.329  32.342  -32.386 1.00 80.83  ? 195 DC  J O2    1 
ATOM   3981  N  N3    . DC  B  1 49  ? 16.412  31.485  -32.162 1.00 84.27  ? 195 DC  J N3    1 
ATOM   3982  C  C4    . DC  B  1 49  ? 17.216  30.430  -32.289 1.00 88.74  ? 195 DC  J C4    1 
ATOM   3983  N  N4    . DC  B  1 49  ? 18.499  30.581  -31.949 1.00 91.58  ? 195 DC  J N4    1 
ATOM   3984  C  C5    . DC  B  1 49  ? 16.739  29.173  -32.771 1.00 83.23  ? 195 DC  J C5    1 
ATOM   3985  C  C6    . DC  B  1 49  ? 15.445  29.085  -33.099 1.00 78.16  ? 195 DC  J C6    1 
ATOM   3986  P  P     . DC  B  1 50  ? 10.050  29.519  -36.191 1.00 59.80  ? 196 DC  J P     1 
ATOM   3987  O  OP1   . DC  B  1 50  ? 8.746   28.834  -36.069 1.00 61.57  ? 196 DC  J OP1   1 
ATOM   3988  O  OP2   . DC  B  1 50  ? 11.123  28.939  -37.032 1.00 62.82  ? 196 DC  J OP2   1 
ATOM   3989  O  "O5'" . DC  B  1 50  ? 9.811   31.010  -36.691 1.00 55.28  ? 196 DC  J "O5'" 1 
ATOM   3990  C  "C5'" . DC  B  1 50  ? 9.265   31.966  -35.799 1.00 54.30  ? 196 DC  J "C5'" 1 
ATOM   3991  C  "C4'" . DC  B  1 50  ? 9.945   33.311  -35.966 1.00 57.14  ? 196 DC  J "C4'" 1 
ATOM   3992  O  "O4'" . DC  B  1 50  ? 11.272  33.256  -35.386 1.00 60.88  ? 196 DC  J "O4'" 1 
ATOM   3993  C  "C3'" . DC  B  1 50  ? 10.130  33.779  -37.418 1.00 52.99  ? 196 DC  J "C3'" 1 
ATOM   3994  O  "O3'" . DC  B  1 50  ? 9.780   35.147  -37.534 1.00 46.60  ? 196 DC  J "O3'" 1 
ATOM   3995  C  "C2'" . DC  B  1 50  ? 11.621  33.571  -37.667 1.00 59.77  ? 196 DC  J "C2'" 1 
ATOM   3996  C  "C1'" . DC  B  1 50  ? 12.190  33.832  -36.284 1.00 65.92  ? 196 DC  J "C1'" 1 
ATOM   3997  N  N1    . DC  B  1 50  ? 13.520  33.212  -36.061 1.00 73.27  ? 196 DC  J N1    1 
ATOM   3998  C  C2    . DC  B  1 50  ? 14.556  33.983  -35.534 1.00 72.10  ? 196 DC  J C2    1 
ATOM   3999  O  O2    . DC  B  1 50  ? 14.341  35.169  -35.261 1.00 67.44  ? 196 DC  J O2    1 
ATOM   4000  N  N3    . DC  B  1 50  ? 15.767  33.405  -35.334 1.00 79.43  ? 196 DC  J N3    1 
ATOM   4001  C  C4    . DC  B  1 50  ? 15.955  32.119  -35.643 1.00 72.39  ? 196 DC  J C4    1 
ATOM   4002  N  N4    . DC  B  1 50  ? 17.164  31.595  -35.428 1.00 77.84  ? 196 DC  J N4    1 
ATOM   4003  C  C5    . DC  B  1 50  ? 14.909  31.316  -36.185 1.00 71.79  ? 196 DC  J C5    1 
ATOM   4004  C  C6    . DC  B  1 50  ? 13.720  31.897  -36.376 1.00 74.00  ? 196 DC  J C6    1 
ATOM   4005  P  P     . DA  B  1 51  ? 9.486   35.786  -38.977 1.00 50.77  ? 197 DA  J P     1 
ATOM   4006  O  OP1   . DA  B  1 51  ? 8.081   36.241  -38.968 1.00 52.98  ? 197 DA  J OP1   1 
ATOM   4007  O  OP2   . DA  B  1 51  ? 9.949   34.854  -40.025 1.00 56.75  ? 197 DA  J OP2   1 
ATOM   4008  O  "O5'" . DA  B  1 51  ? 10.469  37.041  -39.060 1.00 61.16  ? 197 DA  J "O5'" 1 
ATOM   4009  C  "C5'" . DA  B  1 51  ? 10.757  37.810  -37.906 1.00 62.66  ? 197 DA  J "C5'" 1 
ATOM   4010  C  "C4'" . DA  B  1 51  ? 12.011  38.646  -38.113 1.00 56.70  ? 197 DA  J "C4'" 1 
ATOM   4011  O  "O4'" . DA  B  1 51  ? 13.183  37.864  -37.759 1.00 62.88  ? 197 DA  J "O4'" 1 
ATOM   4012  C  "C3'" . DA  B  1 51  ? 12.254  39.118  -39.544 1.00 55.15  ? 197 DA  J "C3'" 1 
ATOM   4013  O  "O3'" . DA  B  1 51  ? 12.923  40.376  -39.520 1.00 69.15  ? 197 DA  J "O3'" 1 
ATOM   4014  C  "C2'" . DA  B  1 51  ? 13.169  38.028  -40.079 1.00 58.01  ? 197 DA  J "C2'" 1 
ATOM   4015  C  "C1'" . DA  B  1 51  ? 14.054  37.808  -38.869 1.00 65.60  ? 197 DA  J "C1'" 1 
ATOM   4016  N  N9    . DA  B  1 51  ? 14.744  36.521  -38.863 1.00 75.29  ? 197 DA  J N9    1 
ATOM   4017  C  C8    . DA  B  1 51  ? 14.248  35.315  -39.273 1.00 73.09  ? 197 DA  J C8    1 
ATOM   4018  N  N7    . DA  B  1 51  ? 15.099  34.323  -39.153 1.00 72.90  ? 197 DA  J N7    1 
ATOM   4019  C  C5    . DA  B  1 51  ? 16.229  34.919  -38.622 1.00 77.94  ? 197 DA  J C5    1 
ATOM   4020  C  C6    . DA  B  1 51  ? 17.490  34.407  -38.264 1.00 82.05  ? 197 DA  J C6    1 
ATOM   4021  N  N6    . DA  B  1 51  ? 17.823  33.118  -38.389 1.00 83.09  ? 197 DA  J N6    1 
ATOM   4022  N  N1    . DA  B  1 51  ? 18.398  35.274  -37.767 1.00 86.78  ? 197 DA  J N1    1 
ATOM   4023  C  C2    . DA  B  1 51  ? 18.060  36.564  -37.644 1.00 84.16  ? 197 DA  J C2    1 
ATOM   4024  N  N3    . DA  B  1 51  ? 16.910  37.161  -37.949 1.00 79.02  ? 197 DA  J N3    1 
ATOM   4025  C  C4    . DA  B  1 51  ? 16.029  36.275  -38.440 1.00 80.45  ? 197 DA  J C4    1 
ATOM   4026  P  P     . DT  B  1 52  ? 12.547  41.530  -40.576 1.00 79.29  ? 198 DT  J P     1 
ATOM   4027  O  OP1   . DT  B  1 52  ? 12.405  42.795  -39.822 1.00 86.76  ? 198 DT  J OP1   1 
ATOM   4028  O  OP2   . DT  B  1 52  ? 11.440  41.047  -41.432 1.00 80.15  ? 198 DT  J OP2   1 
ATOM   4029  O  "O5'" . DT  B  1 52  ? 13.845  41.648  -41.490 1.00 73.86  ? 198 DT  J "O5'" 1 
ATOM   4030  C  "C5'" . DT  B  1 52  ? 14.814  40.633  -41.451 1.00 81.62  ? 198 DT  J "C5'" 1 
ATOM   4031  C  "C4'" . DT  B  1 52  ? 16.181  41.208  -41.193 1.00 84.39  ? 198 DT  J "C4'" 1 
ATOM   4032  O  "O4'" . DT  B  1 52  ? 16.996  40.215  -40.526 1.00 82.86  ? 198 DT  J "O4'" 1 
ATOM   4033  C  "C3'" . DT  B  1 52  ? 16.939  41.580  -42.451 1.00 93.35  ? 198 DT  J "C3'" 1 
ATOM   4034  O  "O3'" . DT  B  1 52  ? 17.853  42.622  -42.179 1.00 99.12  ? 198 DT  J "O3'" 1 
ATOM   4035  C  "C2'" . DT  B  1 52  ? 17.648  40.278  -42.805 1.00 93.36  ? 198 DT  J "C2'" 1 
ATOM   4036  C  "C1'" . DT  B  1 52  ? 17.936  39.671  -41.432 1.00 89.42  ? 198 DT  J "C1'" 1 
ATOM   4037  N  N1    . DT  B  1 52  ? 17.808  38.186  -41.416 1.00 85.81  ? 198 DT  J N1    1 
ATOM   4038  C  C2    . DT  B  1 52  ? 18.793  37.427  -40.825 1.00 87.99  ? 198 DT  J C2    1 
ATOM   4039  O  O2    . DT  B  1 52  ? 19.775  37.907  -40.288 1.00 88.93  ? 198 DT  J O2    1 
ATOM   4040  N  N3    . DT  B  1 52  ? 18.582  36.076  -40.877 1.00 85.72  ? 198 DT  J N3    1 
ATOM   4041  C  C4    . DT  B  1 52  ? 17.513  35.418  -41.456 1.00 86.23  ? 198 DT  J C4    1 
ATOM   4042  O  O4    . DT  B  1 52  ? 17.414  34.195  -41.450 1.00 85.58  ? 198 DT  J O4    1 
ATOM   4043  C  C5    . DT  B  1 52  ? 16.517  36.273  -42.064 1.00 85.92  ? 198 DT  J C5    1 
ATOM   4044  C  C7    . DT  B  1 52  ? 15.309  35.675  -42.723 1.00 76.01  ? 198 DT  J C7    1 
ATOM   4045  C  C6    . DT  B  1 52  ? 16.713  37.599  -42.017 1.00 83.71  ? 198 DT  J C6    1 
ATOM   4046  P  P     . DC  B  1 53  ? 18.509  43.452  -43.387 1.00 108.12 ? 199 DC  J P     1 
ATOM   4047  O  OP1   . DC  B  1 53  ? 18.149  44.876  -43.206 1.00 106.53 ? 199 DC  J OP1   1 
ATOM   4048  O  OP2   . DC  B  1 53  ? 18.162  42.776  -44.659 1.00 103.73 ? 199 DC  J OP2   1 
ATOM   4049  O  "O5'" . DC  B  1 53  ? 20.076  43.282  -43.135 1.00 102.03 ? 199 DC  J "O5'" 1 
ATOM   4050  C  "C5'" . DC  B  1 53  ? 20.541  42.255  -42.269 1.00 95.02  ? 199 DC  J "C5'" 1 
ATOM   4051  C  "C4'" . DC  B  1 53  ? 21.751  41.566  -42.864 1.00 100.50 ? 199 DC  J "C4'" 1 
ATOM   4052  O  "O4'" . DC  B  1 53  ? 21.610  40.127  -42.722 1.00 97.08  ? 199 DC  J "O4'" 1 
ATOM   4053  C  "C3'" . DC  B  1 53  ? 21.971  41.833  -44.356 1.00 103.77 ? 199 DC  J "C3'" 1 
ATOM   4054  O  "O3'" . DC  B  1 53  ? 23.350  42.076  -44.605 1.00 109.21 ? 199 DC  J "O3'" 1 
ATOM   4055  C  "C2'" . DC  B  1 53  ? 21.495  40.542  -45.019 1.00 103.41 ? 199 DC  J "C2'" 1 
ATOM   4056  C  "C1'" . DC  B  1 53  ? 21.847  39.505  -43.965 1.00 101.24 ? 199 DC  J "C1'" 1 
ATOM   4057  N  N1    . DC  B  1 53  ? 21.013  38.265  -44.052 1.00 97.53  ? 199 DC  J N1    1 
ATOM   4058  C  C2    . DC  B  1 53  ? 21.469  37.076  -43.471 1.00 97.40  ? 199 DC  J C2    1 
ATOM   4059  O  O2    . DC  B  1 53  ? 22.559  37.068  -42.884 1.00 99.09  ? 199 DC  J O2    1 
ATOM   4060  N  N3    . DC  B  1 53  ? 20.699  35.964  -43.565 1.00 94.32  ? 199 DC  J N3    1 
ATOM   4061  C  C4    . DC  B  1 53  ? 19.531  36.012  -44.206 1.00 91.60  ? 199 DC  J C4    1 
ATOM   4062  N  N4    . DC  B  1 53  ? 18.809  34.889  -44.273 1.00 94.79  ? 199 DC  J N4    1 
ATOM   4063  C  C5    . DC  B  1 53  ? 19.051  37.211  -44.806 1.00 92.07  ? 199 DC  J C5    1 
ATOM   4064  C  C6    . DC  B  1 53  ? 19.817  38.301  -44.708 1.00 94.57  ? 199 DC  J C6    1 
ATOM   4065  P  P     . DA  B  1 54  ? 23.833  42.774  -45.971 1.00 115.35 ? 200 DA  J P     1 
ATOM   4066  O  OP1   . DA  B  1 54  ? 24.222  44.166  -45.651 1.00 114.29 ? 200 DA  J OP1   1 
ATOM   4067  O  OP2   . DA  B  1 54  ? 22.833  42.519  -47.034 1.00 96.13  ? 200 DA  J OP2   1 
ATOM   4068  O  "O5'" . DA  B  1 54  ? 25.147  41.955  -46.348 1.00 103.68 ? 200 DA  J "O5'" 1 
ATOM   4069  C  "C5'" . DA  B  1 54  ? 25.632  40.959  -45.461 1.00 95.52  ? 200 DA  J "C5'" 1 
ATOM   4070  C  "C4'" . DA  B  1 54  ? 26.354  39.879  -46.233 1.00 102.83 ? 200 DA  J "C4'" 1 
ATOM   4071  O  "O4'" . DA  B  1 54  ? 25.632  38.623  -46.101 1.00 102.07 ? 200 DA  J "O4'" 1 
ATOM   4072  C  "C3'" . DA  B  1 54  ? 26.470  40.145  -47.734 1.00 109.38 ? 200 DA  J "C3'" 1 
ATOM   4073  O  "O3'" . DA  B  1 54  ? 27.730  39.693  -48.207 1.00 108.48 ? 200 DA  J "O3'" 1 
ATOM   4074  C  "C2'" . DA  B  1 54  ? 25.322  39.321  -48.311 1.00 108.92 ? 200 DA  J "C2'" 1 
ATOM   4075  C  "C1'" . DA  B  1 54  ? 25.325  38.118  -47.383 1.00 106.37 ? 200 DA  J "C1'" 1 
ATOM   4076  N  N9    . DA  B  1 54  ? 24.038  37.423  -47.325 1.00 103.21 ? 200 DA  J N9    1 
ATOM   4077  C  C8    . DA  B  1 54  ? 22.796  37.971  -47.494 1.00 99.57  ? 200 DA  J C8    1 
ATOM   4078  N  N7    . DA  B  1 54  ? 21.816  37.103  -47.393 1.00 99.34  ? 200 DA  J N7    1 
ATOM   4079  C  C5    . DA  B  1 54  ? 22.461  35.901  -47.145 1.00 97.20  ? 200 DA  J C5    1 
ATOM   4080  C  C6    . DA  B  1 54  ? 21.983  34.591  -46.940 1.00 97.49  ? 200 DA  J C6    1 
ATOM   4081  N  N6    . DA  B  1 54  ? 20.686  34.271  -46.954 1.00 95.60  ? 200 DA  J N6    1 
ATOM   4082  N  N1    . DA  B  1 54  ? 22.894  33.620  -46.720 1.00 101.67 ? 200 DA  J N1    1 
ATOM   4083  C  C2    . DA  B  1 54  ? 24.192  33.945  -46.706 1.00 100.96 ? 200 DA  J C2    1 
ATOM   4084  N  N3    . DA  B  1 54  ? 24.760  35.137  -46.885 1.00 96.54  ? 200 DA  J N3    1 
ATOM   4085  C  C4    . DA  B  1 54  ? 23.831  36.081  -47.102 1.00 98.17  ? 200 DA  J C4    1 
ATOM   4086  P  P     . DA  B  1 55  ? 28.316  40.208  -49.613 1.00 114.16 ? 201 DA  J P     1 
ATOM   4087  O  OP1   . DA  B  1 55  ? 29.156  41.396  -49.341 1.00 110.64 ? 201 DA  J OP1   1 
ATOM   4088  O  OP2   . DA  B  1 55  ? 27.215  40.306  -50.597 1.00 115.05 ? 201 DA  J OP2   1 
ATOM   4089  O  "O5'" . DA  B  1 55  ? 29.256  39.003  -50.066 1.00 112.96 ? 201 DA  J "O5'" 1 
ATOM   4090  C  "C5'" . DA  B  1 55  ? 29.040  37.706  -49.522 1.00 109.76 ? 201 DA  J "C5'" 1 
ATOM   4091  C  "C4'" . DA  B  1 55  ? 28.799  36.692  -50.624 1.00 110.30 ? 201 DA  J "C4'" 1 
ATOM   4092  O  "O4'" . DA  B  1 55  ? 27.520  36.028  -50.411 1.00 108.79 ? 201 DA  J "O4'" 1 
ATOM   4093  C  "C3'" . DA  B  1 55  ? 28.732  37.275  -52.037 1.00 109.18 ? 201 DA  J "C3'" 1 
ATOM   4094  O  "O3'" . DA  B  1 55  ? 29.299  36.352  -52.947 1.00 110.47 ? 201 DA  J "O3'" 1 
ATOM   4095  C  "C2'" . DA  B  1 55  ? 27.232  37.408  -52.258 1.00 107.51 ? 201 DA  J "C2'" 1 
ATOM   4096  C  "C1'" . DA  B  1 55  ? 26.753  36.133  -51.591 1.00 110.08 ? 201 DA  J "C1'" 1 
ATOM   4097  N  N9    . DA  B  1 55  ? 25.332  36.144  -51.249 1.00 103.67 ? 201 DA  J N9    1 
ATOM   4098  C  C8    . DA  B  1 55  ? 24.518  37.239  -51.142 1.00 103.56 ? 201 DA  J C8    1 
ATOM   4099  N  N7    . DA  B  1 55  ? 23.278  36.947  -50.833 1.00 102.23 ? 201 DA  J N7    1 
ATOM   4100  C  C5    . DA  B  1 55  ? 23.275  35.565  -50.736 1.00 97.58  ? 201 DA  J C5    1 
ATOM   4101  C  C6    . DA  B  1 55  ? 22.259  34.636  -50.435 1.00 91.93  ? 201 DA  J C6    1 
ATOM   4102  N  N6    . DA  B  1 55  ? 21.000  34.990  -50.166 1.00 93.60  ? 201 DA  J N6    1 
ATOM   4103  N  N1    . DA  B  1 55  ? 22.589  33.327  -50.420 1.00 91.93  ? 201 DA  J N1    1 
ATOM   4104  C  C2    . DA  B  1 55  ? 23.852  32.979  -50.691 1.00 96.65  ? 201 DA  J C2    1 
ATOM   4105  N  N3    . DA  B  1 55  ? 24.892  33.759  -50.988 1.00 104.20 ? 201 DA  J N3    1 
ATOM   4106  C  C4    . DA  B  1 55  ? 24.532  35.053  -50.993 1.00 99.50  ? 201 DA  J C4    1 
ATOM   4107  P  P     . DA  B  1 56  ? 29.663  36.787  -54.451 1.00 121.81 ? 202 DA  J P     1 
ATOM   4108  O  OP1   . DA  B  1 56  ? 30.936  37.541  -54.403 1.00 125.05 ? 202 DA  J OP1   1 
ATOM   4109  O  OP2   . DA  B  1 56  ? 28.471  37.393  -55.087 1.00 107.44 ? 202 DA  J OP2   1 
ATOM   4110  O  "O5'" . DA  B  1 56  ? 29.922  35.387  -55.170 1.00 113.77 ? 202 DA  J "O5'" 1 
ATOM   4111  C  "C5'" . DA  B  1 56  ? 30.103  34.214  -54.381 1.00 113.91 ? 202 DA  J "C5'" 1 
ATOM   4112  C  "C4'" . DA  B  1 56  ? 29.389  33.031  -55.008 1.00 110.89 ? 202 DA  J "C4'" 1 
ATOM   4113  O  "O4'" . DA  B  1 56  ? 28.050  32.924  -54.458 1.00 109.27 ? 202 DA  J "O4'" 1 
ATOM   4114  C  "C3'" . DA  B  1 56  ? 29.234  33.114  -56.524 1.00 106.25 ? 202 DA  J "C3'" 1 
ATOM   4115  O  "O3'" . DA  B  1 56  ? 29.550  31.867  -57.114 1.00 104.10 ? 202 DA  J "O3'" 1 
ATOM   4116  C  "C2'" . DA  B  1 56  ? 27.763  33.483  -56.724 1.00 101.45 ? 202 DA  J "C2'" 1 
ATOM   4117  C  "C1'" . DA  B  1 56  ? 27.097  32.874  -55.498 1.00 105.10 ? 202 DA  J "C1'" 1 
ATOM   4118  N  N9    . DA  B  1 56  ? 25.912  33.613  -55.065 1.00 102.09 ? 202 DA  J N9    1 
ATOM   4119  C  C8    . DA  B  1 56  ? 25.802  34.966  -54.914 1.00 101.15 ? 202 DA  J C8    1 
ATOM   4120  N  N7    . DA  B  1 56  ? 24.618  35.361  -54.513 1.00 93.97  ? 202 DA  J N7    1 
ATOM   4121  C  C5    . DA  B  1 56  ? 23.899  34.186  -54.390 1.00 92.25  ? 202 DA  J C5    1 
ATOM   4122  C  C6    . DA  B  1 56  ? 22.572  33.925  -54.001 1.00 86.85  ? 202 DA  J C6    1 
ATOM   4123  N  N6    . DA  B  1 56  ? 21.707  34.883  -53.649 1.00 77.76  ? 202 DA  J N6    1 
ATOM   4124  N  N1    . DA  B  1 56  ? 22.166  32.637  -53.986 1.00 90.01  ? 202 DA  J N1    1 
ATOM   4125  C  C2    . DA  B  1 56  ? 23.037  31.681  -54.338 1.00 92.02  ? 202 DA  J C2    1 
ATOM   4126  N  N3    . DA  B  1 56  ? 24.308  31.804  -54.723 1.00 97.89  ? 202 DA  J N3    1 
ATOM   4127  C  C4    . DA  B  1 56  ? 24.681  33.095  -54.727 1.00 98.20  ? 202 DA  J C4    1 
ATOM   4128  P  P     . DA  B  1 57  ? 29.711  31.748  -58.707 1.00 110.00 ? 203 DA  J P     1 
ATOM   4129  O  OP1   . DA  B  1 57  ? 30.922  30.943  -58.982 1.00 116.06 ? 203 DA  J OP1   1 
ATOM   4130  O  OP2   . DA  B  1 57  ? 29.584  33.106  -59.282 1.00 112.24 ? 203 DA  J OP2   1 
ATOM   4131  O  "O5'" . DA  B  1 57  ? 28.423  30.916  -59.143 1.00 101.90 ? 203 DA  J "O5'" 1 
ATOM   4132  C  "C5'" . DA  B  1 57  ? 27.930  29.888  -58.294 1.00 100.62 ? 203 DA  J "C5'" 1 
ATOM   4133  C  "C4'" . DA  B  1 57  ? 26.571  29.406  -58.765 1.00 101.06 ? 203 DA  J "C4'" 1 
ATOM   4134  O  "O4'" . DA  B  1 57  ? 25.525  30.271  -58.238 1.00 99.77  ? 203 DA  J "O4'" 1 
ATOM   4135  C  "C3'" . DA  B  1 57  ? 26.379  29.400  -60.284 1.00 96.86  ? 203 DA  J "C3'" 1 
ATOM   4136  O  "O3'" . DA  B  1 57  ? 25.635  28.259  -60.654 1.00 91.43  ? 203 DA  J "O3'" 1 
ATOM   4137  C  "C2'" . DA  B  1 57  ? 25.577  30.678  -60.524 1.00 89.81  ? 203 DA  J "C2'" 1 
ATOM   4138  C  "C1'" . DA  B  1 57  ? 24.683  30.662  -59.299 1.00 92.58  ? 203 DA  J "C1'" 1 
ATOM   4139  N  N9    . DA  B  1 57  ? 24.077  31.949  -58.975 1.00 91.05  ? 203 DA  J N9    1 
ATOM   4140  C  C8    . DA  B  1 57  ? 24.572  33.196  -59.242 1.00 90.73  ? 203 DA  J C8    1 
ATOM   4141  N  N7    . DA  B  1 57  ? 23.798  34.173  -58.825 1.00 86.91  ? 203 DA  J N7    1 
ATOM   4142  C  C5    . DA  B  1 57  ? 22.723  33.518  -58.244 1.00 86.06  ? 203 DA  J C5    1 
ATOM   4143  C  C6    . DA  B  1 57  ? 21.553  33.982  -57.611 1.00 80.81  ? 203 DA  J C6    1 
ATOM   4144  N  N6    . DA  B  1 57  ? 21.263  35.277  -57.454 1.00 77.37  ? 203 DA  J N6    1 
ATOM   4145  N  N1    . DA  B  1 57  ? 20.687  33.059  -57.143 1.00 85.11  ? 203 DA  J N1    1 
ATOM   4146  C  C2    . DA  B  1 57  ? 20.977  31.762  -57.301 1.00 82.61  ? 203 DA  J C2    1 
ATOM   4147  N  N3    . DA  B  1 57  ? 22.040  31.206  -57.875 1.00 81.22  ? 203 DA  J N3    1 
ATOM   4148  C  C4    . DA  B  1 57  ? 22.882  32.148  -58.329 1.00 88.70  ? 203 DA  J C4    1 
ATOM   4149  P  P     . DG  B  1 58  ? 25.956  27.482  -62.020 1.00 96.31  ? 204 DG  J P     1 
ATOM   4150  O  OP1   . DG  B  1 58  ? 26.921  26.406  -61.702 1.00 101.43 ? 204 DG  J OP1   1 
ATOM   4151  O  OP2   . DG  B  1 58  ? 26.256  28.492  -63.061 1.00 93.65  ? 204 DG  J OP2   1 
ATOM   4152  O  "O5'" . DG  B  1 58  ? 24.564  26.797  -62.391 1.00 92.28  ? 204 DG  J "O5'" 1 
ATOM   4153  C  "C5'" . DG  B  1 58  ? 23.854  26.071  -61.400 1.00 82.56  ? 204 DG  J "C5'" 1 
ATOM   4154  C  "C4'" . DG  B  1 58  ? 22.380  26.430  -61.421 1.00 77.73  ? 204 DG  J "C4'" 1 
ATOM   4155  O  "O4'" . DG  B  1 58  ? 22.203  27.826  -61.046 1.00 84.86  ? 204 DG  J "O4'" 1 
ATOM   4156  C  "C3'" . DG  B  1 58  ? 21.694  26.274  -62.777 1.00 72.35  ? 204 DG  J "C3'" 1 
ATOM   4157  O  "O3'" . DG  B  1 58  ? 20.386  25.804  -62.580 1.00 68.16  ? 204 DG  J "O3'" 1 
ATOM   4158  C  "C2'" . DG  B  1 58  ? 21.681  27.701  -63.311 1.00 77.31  ? 204 DG  J "C2'" 1 
ATOM   4159  C  "C1'" . DG  B  1 58  ? 21.419  28.469  -62.028 1.00 81.39  ? 204 DG  J "C1'" 1 
ATOM   4160  N  N9    . DG  B  1 58  ? 21.808  29.872  -62.093 1.00 80.22  ? 204 DG  J N9    1 
ATOM   4161  C  C8    . DG  B  1 58  ? 22.943  30.390  -62.667 1.00 88.37  ? 204 DG  J C8    1 
ATOM   4162  N  N7    . DG  B  1 58  ? 23.026  31.687  -62.573 1.00 87.82  ? 204 DG  J N7    1 
ATOM   4163  C  C5    . DG  B  1 58  ? 21.871  32.053  -61.894 1.00 83.92  ? 204 DG  J C5    1 
ATOM   4164  C  C6    . DG  B  1 58  ? 21.414  33.332  -61.496 1.00 81.67  ? 204 DG  J C6    1 
ATOM   4165  O  O6    . DG  B  1 58  ? 21.953  34.431  -61.683 1.00 84.73  ? 204 DG  J O6    1 
ATOM   4166  N  N1    . DG  B  1 58  ? 20.193  33.262  -60.833 1.00 78.50  ? 204 DG  J N1    1 
ATOM   4167  C  C2    . DG  B  1 58  ? 19.505  32.101  -60.574 1.00 82.58  ? 204 DG  J C2    1 
ATOM   4168  N  N2    . DG  B  1 58  ? 18.346  32.234  -59.914 1.00 79.82  ? 204 DG  J N2    1 
ATOM   4169  N  N3    . DG  B  1 58  ? 19.924  30.892  -60.938 1.00 85.10  ? 204 DG  J N3    1 
ATOM   4170  C  C4    . DG  B  1 58  ? 21.110  30.946  -61.592 1.00 83.52  ? 204 DG  J C4    1 
ATOM   4171  P  P     . DG  B  1 59  ? 19.867  24.494  -63.342 1.00 62.73  ? 205 DG  J P     1 
ATOM   4172  O  OP1   . DG  B  1 59  ? 20.768  23.376  -62.984 1.00 67.43  ? 205 DG  J OP1   1 
ATOM   4173  O  OP2   . DG  B  1 59  ? 19.664  24.859  -64.763 1.00 64.35  ? 205 DG  J OP2   1 
ATOM   4174  O  "O5'" . DG  B  1 59  ? 18.437  24.232  -62.680 1.00 64.29  ? 205 DG  J "O5'" 1 
ATOM   4175  C  "C5'" . DG  B  1 59  ? 18.260  24.432  -61.278 1.00 64.59  ? 205 DG  J "C5'" 1 
ATOM   4176  C  "C4'" . DG  B  1 59  ? 17.103  25.379  -61.005 1.00 56.28  ? 205 DG  J "C4'" 1 
ATOM   4177  O  "O4'" . DG  B  1 59  ? 17.507  26.749  -61.294 1.00 65.75  ? 205 DG  J "O4'" 1 
ATOM   4178  C  "C3'" . DG  B  1 59  ? 15.850  25.125  -61.835 1.00 56.58  ? 205 DG  J "C3'" 1 
ATOM   4179  O  "O3'" . DG  B  1 59  ? 14.695  25.392  -61.047 1.00 64.17  ? 205 DG  J "O3'" 1 
ATOM   4180  C  "C2'" . DG  B  1 59  ? 16.002  26.123  -62.980 1.00 60.99  ? 205 DG  J "C2'" 1 
ATOM   4181  C  "C1'" . DG  B  1 59  ? 16.654  27.305  -62.276 1.00 65.10  ? 205 DG  J "C1'" 1 
ATOM   4182  N  N9    . DG  B  1 59  ? 17.454  28.144  -63.173 1.00 66.61  ? 205 DG  J N9    1 
ATOM   4183  C  C8    . DG  B  1 59  ? 18.344  27.714  -64.127 1.00 69.91  ? 205 DG  J C8    1 
ATOM   4184  N  N7    . DG  B  1 59  ? 18.915  28.684  -64.787 1.00 74.96  ? 205 DG  J N7    1 
ATOM   4185  C  C5    . DG  B  1 59  ? 18.369  29.839  -64.237 1.00 79.04  ? 205 DG  J C5    1 
ATOM   4186  C  C6    . DG  B  1 59  ? 18.608  31.202  -64.550 1.00 75.05  ? 205 DG  J C6    1 
ATOM   4187  O  O6    . DG  B  1 59  ? 19.375  31.671  -65.402 1.00 77.20  ? 205 DG  J O6    1 
ATOM   4188  N  N1    . DG  B  1 59  ? 17.846  32.055  -63.757 1.00 71.79  ? 205 DG  J N1    1 
ATOM   4189  C  C2    . DG  B  1 59  ? 16.965  31.649  -62.784 1.00 69.63  ? 205 DG  J C2    1 
ATOM   4190  N  N2    . DG  B  1 59  ? 16.321  32.622  -62.125 1.00 69.08  ? 205 DG  J N2    1 
ATOM   4191  N  N3    . DG  B  1 59  ? 16.731  30.375  -62.478 1.00 79.78  ? 205 DG  J N3    1 
ATOM   4192  C  C4    . DG  B  1 59  ? 17.465  29.526  -63.243 1.00 78.55  ? 205 DG  J C4    1 
ATOM   4193  P  P     . DC  B  1 60  ? 13.251  24.824  -61.471 1.00 49.50  ? 206 DC  J P     1 
ATOM   4194  O  OP1   . DC  B  1 60  ? 12.694  24.094  -60.310 1.00 70.85  ? 206 DC  J OP1   1 
ATOM   4195  O  OP2   . DC  B  1 60  ? 13.343  24.201  -62.808 1.00 55.67  ? 206 DC  J OP2   1 
ATOM   4196  O  "O5'" . DC  B  1 60  ? 12.396  26.132  -61.699 1.00 61.09  ? 206 DC  J "O5'" 1 
ATOM   4197  C  "C5'" . DC  B  1 60  ? 12.718  26.949  -62.773 1.00 63.19  ? 206 DC  J "C5'" 1 
ATOM   4198  C  "C4'" . DC  B  1 60  ? 12.257  28.354  -62.539 1.00 48.14  ? 206 DC  J "C4'" 1 
ATOM   4199  O  "O4'" . DC  B  1 60  ? 13.284  29.251  -63.020 1.00 58.50  ? 206 DC  J "O4'" 1 
ATOM   4200  C  "C3'" . DC  B  1 60  ? 11.021  28.714  -63.330 1.00 53.39  ? 206 DC  J "C3'" 1 
ATOM   4201  O  "O3'" . DC  B  1 60  ? 10.383  29.833  -62.759 1.00 48.05  ? 206 DC  J "O3'" 1 
ATOM   4202  C  "C2'" . DC  B  1 60  ? 11.623  29.041  -64.689 1.00 59.95  ? 206 DC  J "C2'" 1 
ATOM   4203  C  "C1'" . DC  B  1 60  ? 12.914  29.760  -64.290 1.00 65.28  ? 206 DC  J "C1'" 1 
ATOM   4204  N  N1    . DC  B  1 60  ? 14.042  29.534  -65.247 1.00 69.24  ? 206 DC  J N1    1 
ATOM   4205  C  C2    . DC  B  1 60  ? 14.774  30.625  -65.733 1.00 65.78  ? 206 DC  J C2    1 
ATOM   4206  O  O2    . DC  B  1 60  ? 14.483  31.763  -65.353 1.00 63.71  ? 206 DC  J O2    1 
ATOM   4207  N  N3    . DC  B  1 60  ? 15.788  30.399  -66.605 1.00 68.84  ? 206 DC  J N3    1 
ATOM   4208  C  C4    . DC  B  1 60  ? 16.073  29.152  -66.992 1.00 75.74  ? 206 DC  J C4    1 
ATOM   4209  N  N4    . DC  B  1 60  ? 17.084  28.977  -67.855 1.00 74.03  ? 206 DC  J N4    1 
ATOM   4210  C  C5    . DC  B  1 60  ? 15.335  28.031  -66.512 1.00 70.60  ? 206 DC  J C5    1 
ATOM   4211  C  C6    . DC  B  1 60  ? 14.338  28.266  -65.652 1.00 69.90  ? 206 DC  J C6    1 
ATOM   4212  P  P     . DA  B  1 61  ? 8.785   29.949  -62.795 1.00 40.55  ? 207 DA  J P     1 
ATOM   4213  O  OP1   . DA  B  1 61  ? 8.302   29.631  -61.434 1.00 50.47  ? 207 DA  J OP1   1 
ATOM   4214  O  OP2   . DA  B  1 61  ? 8.295   29.182  -63.963 1.00 39.57  ? 207 DA  J OP2   1 
ATOM   4215  O  "O5'" . DA  B  1 61  ? 8.531   31.498  -63.075 1.00 45.36  ? 207 DA  J "O5'" 1 
ATOM   4216  C  "C5'" . DA  B  1 61  ? 9.144   32.472  -62.239 1.00 49.06  ? 207 DA  J "C5'" 1 
ATOM   4217  C  "C4'" . DA  B  1 61  ? 9.435   33.743  -63.012 1.00 44.41  ? 207 DA  J "C4'" 1 
ATOM   4218  O  "O4'" . DA  B  1 61  ? 10.559  33.524  -63.906 1.00 46.96  ? 207 DA  J "O4'" 1 
ATOM   4219  C  "C3'" . DA  B  1 61  ? 8.285   34.246  -63.880 1.00 39.62  ? 207 DA  J "C3'" 1 
ATOM   4220  O  "O3'" . DA  B  1 61  ? 8.185   35.648  -63.766 1.00 36.76  ? 207 DA  J "O3'" 1 
ATOM   4221  C  "C2'" . DA  B  1 61  ? 8.693   33.822  -65.289 1.00 43.55  ? 207 DA  J "C2'" 1 
ATOM   4222  C  "C1'" . DA  B  1 61  ? 10.210  33.894  -65.220 1.00 45.77  ? 207 DA  J "C1'" 1 
ATOM   4223  N  N9    . DA  B  1 61  ? 10.863  32.970  -66.142 1.00 58.22  ? 207 DA  J N9    1 
ATOM   4224  C  C8    . DA  B  1 61  ? 10.562  31.653  -66.328 1.00 55.79  ? 207 DA  J C8    1 
ATOM   4225  N  N7    . DA  B  1 61  ? 11.309  31.057  -67.224 1.00 55.62  ? 207 DA  J N7    1 
ATOM   4226  C  C5    . DA  B  1 61  ? 12.158  32.052  -67.665 1.00 63.89  ? 207 DA  J C5    1 
ATOM   4227  C  C6    . DA  B  1 61  ? 13.192  32.061  -68.620 1.00 67.81  ? 207 DA  J C6    1 
ATOM   4228  N  N6    . DA  B  1 61  ? 13.550  30.984  -69.325 1.00 64.16  ? 207 DA  J N6    1 
ATOM   4229  N  N1    . DA  B  1 61  ? 13.847  33.223  -68.821 1.00 71.73  ? 207 DA  J N1    1 
ATOM   4230  C  C2    . DA  B  1 61  ? 13.485  34.298  -68.110 1.00 65.17  ? 207 DA  J C2    1 
ATOM   4231  N  N3    . DA  B  1 61  ? 12.531  34.412  -67.187 1.00 58.82  ? 207 DA  J N3    1 
ATOM   4232  C  C4    . DA  B  1 61  ? 11.899  33.243  -67.009 1.00 61.50  ? 207 DA  J C4    1 
ATOM   4233  P  P     . DT  B  1 62  ? 6.933   36.440  -64.386 1.00 43.44  ? 208 DT  J P     1 
ATOM   4234  O  OP1   . DT  B  1 62  ? 6.346   37.211  -63.268 1.00 51.66  ? 208 DT  J OP1   1 
ATOM   4235  O  OP2   . DT  B  1 62  ? 6.101   35.532  -65.202 1.00 34.68  ? 208 DT  J OP2   1 
ATOM   4236  O  "O5'" . DT  B  1 62  ? 7.605   37.485  -65.393 1.00 52.42  ? 208 DT  J "O5'" 1 
ATOM   4237  C  "C5'" . DT  B  1 62  ? 8.960   37.325  -65.765 1.00 47.43  ? 208 DT  J "C5'" 1 
ATOM   4238  C  "C4'" . DT  B  1 62  ? 9.308   38.187  -66.958 1.00 47.18  ? 208 DT  J "C4'" 1 
ATOM   4239  O  "O4'" . DT  B  1 62  ? 10.153  37.436  -67.865 1.00 53.41  ? 208 DT  J "O4'" 1 
ATOM   4240  C  "C3'" . DT  B  1 62  ? 8.130   38.658  -67.794 1.00 49.37  ? 208 DT  J "C3'" 1 
ATOM   4241  O  "O3'" . DT  B  1 62  ? 8.459   39.907  -68.380 1.00 61.35  ? 208 DT  J "O3'" 1 
ATOM   4242  C  "C2'" . DT  B  1 62  ? 8.009   37.556  -68.844 1.00 48.88  ? 208 DT  J "C2'" 1 
ATOM   4243  C  "C1'" . DT  B  1 62  ? 9.470   37.188  -69.079 1.00 54.90  ? 208 DT  J "C1'" 1 
ATOM   4244  N  N1    . DT  B  1 62  ? 9.688   35.754  -69.445 1.00 54.69  ? 208 DT  J N1    1 
ATOM   4245  C  C2    . DT  B  1 62  ? 10.730  35.427  -70.284 1.00 63.91  ? 208 DT  J C2    1 
ATOM   4246  O  O2    . DT  B  1 62  ? 11.487  36.250  -70.762 1.00 64.06  ? 208 DT  J O2    1 
ATOM   4247  N  N3    . DT  B  1 62  ? 10.854  34.092  -70.548 1.00 69.32  ? 208 DT  J N3    1 
ATOM   4248  C  C4    . DT  B  1 62  ? 10.063  33.069  -70.067 1.00 69.00  ? 208 DT  J C4    1 
ATOM   4249  O  O4    . DT  B  1 62  ? 10.258  31.896  -70.366 1.00 72.13  ? 208 DT  J O4    1 
ATOM   4250  C  C5    . DT  B  1 62  ? 8.991   33.477  -69.189 1.00 60.12  ? 208 DT  J C5    1 
ATOM   4251  C  C7    . DT  B  1 62  ? 8.065   32.452  -68.605 1.00 54.88  ? 208 DT  J C7    1 
ATOM   4252  C  C6    . DT  B  1 62  ? 8.859   34.785  -68.921 1.00 52.62  ? 208 DT  J C6    1 
ATOM   4253  P  P     . DG  B  1 63  ? 7.329   40.859  -69.009 1.00 55.63  ? 209 DG  J P     1 
ATOM   4254  O  OP1   . DG  B  1 63  ? 7.455   42.153  -68.309 1.00 61.31  ? 209 DG  J OP1   1 
ATOM   4255  O  OP2   . DG  B  1 63  ? 6.024   40.161  -69.000 1.00 68.28  ? 209 DG  J OP2   1 
ATOM   4256  O  "O5'" . DG  B  1 63  ? 7.793   41.003  -70.536 1.00 57.16  ? 209 DG  J "O5'" 1 
ATOM   4257  C  "C5'" . DG  B  1 63  ? 9.179   40.866  -70.871 1.00 50.95  ? 209 DG  J "C5'" 1 
ATOM   4258  C  "C4'" . DG  B  1 63  ? 9.363   40.530  -72.344 1.00 54.95  ? 209 DG  J "C4'" 1 
ATOM   4259  O  "O4'" . DG  B  1 63  ? 9.622   39.108  -72.499 1.00 64.17  ? 209 DG  J "O4'" 1 
ATOM   4260  C  "C3'" . DG  B  1 63  ? 8.164   40.840  -73.241 1.00 57.52  ? 209 DG  J "C3'" 1 
ATOM   4261  O  "O3'" . DG  B  1 63  ? 8.615   41.372  -74.471 1.00 58.85  ? 209 DG  J "O3'" 1 
ATOM   4262  C  "C2'" . DG  B  1 63  ? 7.526   39.468  -73.433 1.00 64.18  ? 209 DG  J "C2'" 1 
ATOM   4263  C  "C1'" . DG  B  1 63  ? 8.752   38.580  -73.475 1.00 62.11  ? 209 DG  J "C1'" 1 
ATOM   4264  N  N9    . DG  B  1 63  ? 8.461   37.188  -73.146 1.00 61.19  ? 209 DG  J N9    1 
ATOM   4265  C  C8    . DG  B  1 63  ? 7.504   36.731  -72.271 1.00 66.53  ? 209 DG  J C8    1 
ATOM   4266  N  N7    . DG  B  1 63  ? 7.462   35.432  -72.176 1.00 64.32  ? 209 DG  J N7    1 
ATOM   4267  C  C5    . DG  B  1 63  ? 8.452   34.998  -73.047 1.00 66.53  ? 209 DG  J C5    1 
ATOM   4268  C  C6    . DG  B  1 63  ? 8.868   33.686  -73.363 1.00 69.03  ? 209 DG  J C6    1 
ATOM   4269  O  O6    . DG  B  1 63  ? 8.430   32.615  -72.921 1.00 74.70  ? 209 DG  J O6    1 
ATOM   4270  N  N1    . DG  B  1 63  ? 9.904   33.684  -74.293 1.00 71.83  ? 209 DG  J N1    1 
ATOM   4271  C  C2    . DG  B  1 63  ? 10.466  34.811  -74.848 1.00 70.77  ? 209 DG  J C2    1 
ATOM   4272  N  N2    . DG  B  1 63  ? 11.456  34.605  -75.728 1.00 69.93  ? 209 DG  J N2    1 
ATOM   4273  N  N3    . DG  B  1 63  ? 10.084  36.051  -74.559 1.00 65.58  ? 209 DG  J N3    1 
ATOM   4274  C  C4    . DG  B  1 63  ? 9.075   36.067  -73.654 1.00 63.71  ? 209 DG  J C4    1 
ATOM   4275  P  P     . DT  B  1 64  ? 7.570   41.899  -75.574 1.00 65.09  ? 210 DT  J P     1 
ATOM   4276  O  OP1   . DT  B  1 64  ? 7.756   43.357  -75.689 1.00 72.00  ? 210 DT  J OP1   1 
ATOM   4277  O  OP2   . DT  B  1 64  ? 6.212   41.387  -75.288 1.00 67.09  ? 210 DT  J OP2   1 
ATOM   4278  O  "O5'" . DT  B  1 64  ? 8.075   41.198  -76.915 1.00 65.53  ? 210 DT  J "O5'" 1 
ATOM   4279  C  "C5'" . DT  B  1 64  ? 9.384   40.648  -76.972 1.00 69.31  ? 210 DT  J "C5'" 1 
ATOM   4280  C  "C4'" . DT  B  1 64  ? 9.584   39.863  -78.257 1.00 73.44  ? 210 DT  J "C4'" 1 
ATOM   4281  O  "O4'" . DT  B  1 64  ? 9.619   38.438  -77.963 1.00 70.87  ? 210 DT  J "O4'" 1 
ATOM   4282  C  "C3'" . DT  B  1 64  ? 8.493   40.059  -79.306 1.00 69.15  ? 210 DT  J "C3'" 1 
ATOM   4283  O  "O3'" . DT  B  1 64  ? 9.075   40.097  -80.603 1.00 69.06  ? 210 DT  J "O3'" 1 
ATOM   4284  C  "C2'" . DT  B  1 64  ? 7.607   38.830  -79.113 1.00 69.89  ? 210 DT  J "C2'" 1 
ATOM   4285  C  "C1'" . DT  B  1 64  ? 8.611   37.766  -78.690 1.00 69.14  ? 210 DT  J "C1'" 1 
ATOM   4286  N  N1    . DT  B  1 64  ? 8.007   36.705  -77.810 1.00 72.93  ? 210 DT  J N1    1 
ATOM   4287  C  C2    . DT  B  1 64  ? 8.402   35.389  -77.953 1.00 71.54  ? 210 DT  J C2    1 
ATOM   4288  O  O2    . DT  B  1 64  ? 9.238   35.020  -78.759 1.00 75.10  ? 210 DT  J O2    1 
ATOM   4289  N  N3    . DT  B  1 64  ? 7.782   34.512  -77.106 1.00 65.07  ? 210 DT  J N3    1 
ATOM   4290  C  C4    . DT  B  1 64  ? 6.826   34.802  -76.153 1.00 62.63  ? 210 DT  J C4    1 
ATOM   4291  O  O4    . DT  B  1 64  ? 6.332   33.934  -75.438 1.00 55.91  ? 210 DT  J O4    1 
ATOM   4292  C  C5    . DT  B  1 64  ? 6.453   36.198  -76.057 1.00 63.89  ? 210 DT  J C5    1 
ATOM   4293  C  C7    . DT  B  1 64  ? 5.423   36.643  -75.060 1.00 64.11  ? 210 DT  J C7    1 
ATOM   4294  C  C6    . DT  B  1 64  ? 7.052   37.068  -76.881 1.00 63.83  ? 210 DT  J C6    1 
ATOM   4295  P  P     . DT  B  1 65  ? 8.183   40.408  -81.905 1.00 80.93  ? 211 DT  J P     1 
ATOM   4296  O  OP1   . DT  B  1 65  ? 8.760   41.609  -82.547 1.00 78.23  ? 211 DT  J OP1   1 
ATOM   4297  O  OP2   . DT  B  1 65  ? 6.744   40.395  -81.549 1.00 69.66  ? 211 DT  J OP2   1 
ATOM   4298  O  "O5'" . DT  B  1 65  ? 8.461   39.144  -82.840 1.00 73.92  ? 211 DT  J "O5'" 1 
ATOM   4299  C  "C5'" . DT  B  1 65  ? 9.308   38.102  -82.373 1.00 67.53  ? 211 DT  J "C5'" 1 
ATOM   4300  C  "C4'" . DT  B  1 65  ? 9.148   36.851  -83.213 1.00 65.72  ? 211 DT  J "C4'" 1 
ATOM   4301  O  "O4'" . DT  B  1 65  ? 8.622   35.774  -82.392 1.00 71.40  ? 211 DT  J "O4'" 1 
ATOM   4302  C  "C3'" . DT  B  1 65  ? 8.193   36.973  -84.390 1.00 64.08  ? 211 DT  J "C3'" 1 
ATOM   4303  O  "O3'" . DT  B  1 65  ? 8.633   36.110  -85.438 1.00 71.43  ? 211 DT  J "O3'" 1 
ATOM   4304  C  "C2'" . DT  B  1 65  ? 6.870   36.507  -83.784 1.00 62.74  ? 211 DT  J "C2'" 1 
ATOM   4305  C  "C1'" . DT  B  1 65  ? 7.338   35.396  -82.849 1.00 61.84  ? 211 DT  J "C1'" 1 
ATOM   4306  N  N1    . DT  B  1 65  ? 6.460   35.194  -81.654 1.00 69.72  ? 211 DT  J N1    1 
ATOM   4307  C  C2    . DT  B  1 65  ? 6.316   33.927  -81.131 1.00 70.06  ? 211 DT  J C2    1 
ATOM   4308  O  O2    . DT  B  1 65  ? 6.866   32.945  -81.597 1.00 71.04  ? 211 DT  J O2    1 
ATOM   4309  N  N3    . DT  B  1 65  ? 5.497   33.848  -80.037 1.00 64.87  ? 211 DT  J N3    1 
ATOM   4310  C  C4    . DT  B  1 65  ? 4.823   34.884  -79.420 1.00 67.19  ? 211 DT  J C4    1 
ATOM   4311  O  O4    . DT  B  1 65  ? 4.105   34.708  -78.438 1.00 65.55  ? 211 DT  J O4    1 
ATOM   4312  C  C5    . DT  B  1 65  ? 5.015   36.187  -80.016 1.00 65.39  ? 211 DT  J C5    1 
ATOM   4313  C  C7    . DT  B  1 65  ? 4.331   37.388  -79.435 1.00 62.85  ? 211 DT  J C7    1 
ATOM   4314  C  C6    . DT  B  1 65  ? 5.817   36.278  -81.090 1.00 67.19  ? 211 DT  J C6    1 
ATOM   4315  P  P     . DC  B  1 66  ? 7.967   36.162  -86.900 1.00 61.21  ? 212 DC  J P     1 
ATOM   4316  O  OP1   . DC  B  1 66  ? 9.051   35.911  -87.875 1.00 59.79  ? 212 DC  J OP1   1 
ATOM   4317  O  OP2   . DC  B  1 66  ? 7.131   37.378  -87.005 1.00 60.15  ? 212 DC  J OP2   1 
ATOM   4318  O  "O5'" . DC  B  1 66  ? 7.004   34.892  -86.909 1.00 64.16  ? 212 DC  J "O5'" 1 
ATOM   4319  C  "C5'" . DC  B  1 66  ? 7.507   33.629  -86.504 1.00 54.41  ? 212 DC  J "C5'" 1 
ATOM   4320  C  "C4'" . DC  B  1 66  ? 6.388   32.613  -86.398 1.00 56.81  ? 212 DC  J "C4'" 1 
ATOM   4321  O  "O4'" . DC  B  1 66  ? 5.783   32.671  -85.077 1.00 63.91  ? 212 DC  J "O4'" 1 
ATOM   4322  C  "C3'" . DC  B  1 66  ? 5.238   32.805  -87.388 1.00 60.56  ? 212 DC  J "C3'" 1 
ATOM   4323  O  "O3'" . DC  B  1 66  ? 4.822   31.550  -87.839 1.00 66.89  ? 212 DC  J "O3'" 1 
ATOM   4324  C  "C2'" . DC  B  1 66  ? 4.156   33.446  -86.522 1.00 60.83  ? 212 DC  J "C2'" 1 
ATOM   4325  C  "C1'" . DC  B  1 66  ? 4.384   32.688  -85.232 1.00 63.43  ? 212 DC  J "C1'" 1 
ATOM   4326  N  N1    . DC  B  1 66  ? 3.769   33.307  -84.030 1.00 66.79  ? 212 DC  J N1    1 
ATOM   4327  C  C2    . DC  B  1 66  ? 3.435   32.496  -82.944 1.00 66.69  ? 212 DC  J C2    1 
ATOM   4328  O  O2    . DC  B  1 66  ? 3.661   31.281  -83.010 1.00 63.27  ? 212 DC  J O2    1 
ATOM   4329  N  N3    . DC  B  1 66  ? 2.876   33.062  -81.848 1.00 65.97  ? 212 DC  J N3    1 
ATOM   4330  C  C4    . DC  B  1 66  ? 2.650   34.372  -81.818 1.00 66.30  ? 212 DC  J C4    1 
ATOM   4331  N  N4    . DC  B  1 66  ? 2.093   34.882  -80.715 1.00 66.49  ? 212 DC  J N4    1 
ATOM   4332  C  C5    . DC  B  1 66  ? 2.982   35.219  -82.918 1.00 68.15  ? 212 DC  J C5    1 
ATOM   4333  C  C6    . DC  B  1 66  ? 3.534   34.649  -83.994 1.00 66.11  ? 212 DC  J C6    1 
ATOM   4334  P  P     . DA  B  1 67  ? 4.723   31.229  -89.405 1.00 64.51  ? 213 DA  J P     1 
ATOM   4335  O  OP1   . DA  B  1 67  ? 6.079   30.829  -89.835 1.00 58.80  ? 213 DA  J OP1   1 
ATOM   4336  O  OP2   . DA  B  1 67  ? 4.021   32.351  -90.073 1.00 57.83  ? 213 DA  J OP2   1 
ATOM   4337  O  "O5'" . DA  B  1 67  ? 3.772   29.945  -89.437 1.00 63.02  ? 213 DA  J "O5'" 1 
ATOM   4338  C  "C5'" . DA  B  1 67  ? 4.087   28.828  -88.615 1.00 61.78  ? 213 DA  J "C5'" 1 
ATOM   4339  C  "C4'" . DA  B  1 67  ? 2.880   28.356  -87.820 1.00 57.62  ? 213 DA  J "C4'" 1 
ATOM   4340  O  "O4'" . DA  B  1 67  ? 2.549   29.318  -86.787 1.00 57.39  ? 213 DA  J "O4'" 1 
ATOM   4341  C  "C3'" . DA  B  1 67  ? 1.593   28.152  -88.624 1.00 60.16  ? 213 DA  J "C3'" 1 
ATOM   4342  O  "O3'" . DA  B  1 67  ? 0.947   26.991  -88.163 1.00 54.76  ? 213 DA  J "O3'" 1 
ATOM   4343  C  "C2'" . DA  B  1 67  ? 0.779   29.391  -88.273 1.00 58.42  ? 213 DA  J "C2'" 1 
ATOM   4344  C  "C1'" . DA  B  1 67  ? 1.159   29.546  -86.817 1.00 60.75  ? 213 DA  J "C1'" 1 
ATOM   4345  N  N9    . DA  B  1 67  ? 0.895   30.865  -86.266 1.00 67.56  ? 213 DA  J N9    1 
ATOM   4346  C  C8    . DA  B  1 67  ? 1.001   32.066  -86.908 1.00 69.64  ? 213 DA  J C8    1 
ATOM   4347  N  N7    . DA  B  1 67  ? 0.712   33.097  -86.149 1.00 71.24  ? 213 DA  J N7    1 
ATOM   4348  C  C5    . DA  B  1 67  ? 0.399   32.529  -84.924 1.00 68.41  ? 213 DA  J C5    1 
ATOM   4349  C  C6    . DA  B  1 67  ? 0.009   33.087  -83.692 1.00 69.72  ? 213 DA  J C6    1 
ATOM   4350  N  N6    . DA  B  1 67  ? -0.140  34.400  -83.496 1.00 70.09  ? 213 DA  J N6    1 
ATOM   4351  N  N1    . DA  B  1 67  ? -0.229  32.240  -82.668 1.00 70.49  ? 213 DA  J N1    1 
ATOM   4352  C  C2    . DA  B  1 67  ? -0.081  30.925  -82.870 1.00 65.65  ? 213 DA  J C2    1 
ATOM   4353  N  N3    . DA  B  1 67  ? 0.281   30.286  -83.981 1.00 67.02  ? 213 DA  J N3    1 
ATOM   4354  C  C4    . DA  B  1 67  ? 0.509   31.155  -84.979 1.00 66.84  ? 213 DA  J C4    1 
ATOM   4355  P  P     . DG  B  1 68  ? 0.620   25.797  -89.176 1.00 54.55  ? 214 DG  J P     1 
ATOM   4356  O  OP1   . DG  B  1 68  ? 1.920   25.265  -89.648 1.00 65.60  ? 214 DG  J OP1   1 
ATOM   4357  O  OP2   . DG  B  1 68  ? -0.404  26.291  -90.124 1.00 57.44  ? 214 DG  J OP2   1 
ATOM   4358  O  "O5'" . DG  B  1 68  ? -0.085  24.700  -88.261 1.00 54.90  ? 214 DG  J "O5'" 1 
ATOM   4359  C  "C5'" . DG  B  1 68  ? 0.486   24.344  -87.017 1.00 57.61  ? 214 DG  J "C5'" 1 
ATOM   4360  C  "C4'" . DG  B  1 68  ? -0.582  24.227  -85.947 1.00 51.23  ? 214 DG  J "C4'" 1 
ATOM   4361  O  "O4'" . DG  B  1 68  ? -0.961  25.546  -85.476 1.00 52.89  ? 214 DG  J "O4'" 1 
ATOM   4362  C  "C3'" . DG  B  1 68  ? -1.884  23.577  -86.388 1.00 52.96  ? 214 DG  J "C3'" 1 
ATOM   4363  O  "O3'" . DG  B  1 68  ? -2.468  22.983  -85.265 1.00 55.54  ? 214 DG  J "O3'" 1 
ATOM   4364  C  "C2'" . DG  B  1 68  ? -2.700  24.786  -86.828 1.00 56.70  ? 214 DG  J "C2'" 1 
ATOM   4365  C  "C1'" . DG  B  1 68  ? -2.344  25.741  -85.707 1.00 54.32  ? 214 DG  J "C1'" 1 
ATOM   4366  N  N9    . DG  B  1 68  ? -2.553  27.145  -86.009 1.00 54.77  ? 214 DG  J N9    1 
ATOM   4367  C  C8    . DG  B  1 68  ? -2.361  27.782  -87.211 1.00 61.40  ? 214 DG  J C8    1 
ATOM   4368  N  N7    . DG  B  1 68  ? -2.604  29.063  -87.160 1.00 66.75  ? 214 DG  J N7    1 
ATOM   4369  C  C5    . DG  B  1 68  ? -2.967  29.285  -85.836 1.00 66.06  ? 214 DG  J C5    1 
ATOM   4370  C  C6    . DG  B  1 68  ? -3.337  30.477  -85.181 1.00 62.18  ? 214 DG  J C6    1 
ATOM   4371  O  O6    . DG  B  1 68  ? -3.425  31.614  -85.653 1.00 69.62  ? 214 DG  J O6    1 
ATOM   4372  N  N1    . DG  B  1 68  ? -3.626  30.259  -83.839 1.00 64.21  ? 214 DG  J N1    1 
ATOM   4373  C  C2    . DG  B  1 68  ? -3.563  29.042  -83.209 1.00 61.01  ? 214 DG  J C2    1 
ATOM   4374  N  N2    . DG  B  1 68  ? -3.876  29.031  -81.906 1.00 66.88  ? 214 DG  J N2    1 
ATOM   4375  N  N3    . DG  B  1 68  ? -3.215  27.917  -83.809 1.00 64.02  ? 214 DG  J N3    1 
ATOM   4376  C  C4    . DG  B  1 68  ? -2.932  28.114  -85.119 1.00 64.97  ? 214 DG  J C4    1 
ATOM   4377  P  P     . DC  B  1 69  ? -3.023  21.483  -85.317 1.00 58.34  ? 215 DC  J P     1 
ATOM   4378  O  OP1   . DC  B  1 69  ? -1.933  20.604  -84.842 1.00 49.18  ? 215 DC  J OP1   1 
ATOM   4379  O  OP2   . DC  B  1 69  ? -3.647  21.272  -86.642 1.00 64.81  ? 215 DC  J OP2   1 
ATOM   4380  O  "O5'" . DC  B  1 69  ? -4.195  21.510  -84.238 1.00 61.49  ? 215 DC  J "O5'" 1 
ATOM   4381  C  "C5'" . DC  B  1 69  ? -4.094  22.386  -83.123 1.00 52.36  ? 215 DC  J "C5'" 1 
ATOM   4382  C  "C4'" . DC  B  1 69  ? -5.378  23.169  -82.923 1.00 46.95  ? 215 DC  J "C4'" 1 
ATOM   4383  O  "O4'" . DC  B  1 69  ? -5.329  24.414  -83.670 1.00 54.68  ? 215 DC  J "O4'" 1 
ATOM   4384  C  "C3'" . DC  B  1 69  ? -6.657  22.465  -83.380 1.00 48.24  ? 215 DC  J "C3'" 1 
ATOM   4385  O  "O3'" . DC  B  1 69  ? -7.672  22.711  -82.439 1.00 48.30  ? 215 DC  J "O3'" 1 
ATOM   4386  C  "C2'" . DC  B  1 69  ? -6.967  23.173  -84.695 1.00 52.21  ? 215 DC  J "C2'" 1 
ATOM   4387  C  "C1'" . DC  B  1 69  ? -6.567  24.583  -84.316 1.00 56.40  ? 215 DC  J "C1'" 1 
ATOM   4388  N  N1    . DC  B  1 69  ? -6.398  25.523  -85.469 1.00 55.08  ? 215 DC  J N1    1 
ATOM   4389  C  C2    . DC  B  1 69  ? -6.498  26.905  -85.253 1.00 60.45  ? 215 DC  J C2    1 
ATOM   4390  O  O2    . DC  B  1 69  ? -6.727  27.325  -84.113 1.00 59.04  ? 215 DC  J O2    1 
ATOM   4391  N  N3    . DC  B  1 69  ? -6.336  27.745  -86.303 1.00 66.59  ? 215 DC  J N3    1 
ATOM   4392  C  C4    . DC  B  1 69  ? -6.089  27.254  -87.517 1.00 65.96  ? 215 DC  J C4    1 
ATOM   4393  N  N4    . DC  B  1 69  ? -5.939  28.123  -88.523 1.00 72.51  ? 215 DC  J N4    1 
ATOM   4394  C  C5    . DC  B  1 69  ? -5.986  25.853  -87.755 1.00 51.29  ? 215 DC  J C5    1 
ATOM   4395  C  C6    . DC  B  1 69  ? -6.147  25.034  -86.713 1.00 58.20  ? 215 DC  J C6    1 
ATOM   4396  P  P     . DT  B  1 70  ? -7.980  21.660  -81.268 1.00 51.56  ? 216 DT  J P     1 
ATOM   4397  O  OP1   . DT  B  1 70  ? -6.696  21.188  -80.706 1.00 51.55  ? 216 DT  J OP1   1 
ATOM   4398  O  OP2   . DT  B  1 70  ? -8.953  20.684  -81.807 1.00 48.90  ? 216 DT  J OP2   1 
ATOM   4399  O  "O5'" . DT  B  1 70  ? -8.717  22.551  -80.166 1.00 42.55  ? 216 DT  J "O5'" 1 
ATOM   4400  C  "C5'" . DT  B  1 70  ? -8.010  23.594  -79.518 1.00 39.27  ? 216 DT  J "C5'" 1 
ATOM   4401  C  "C4'" . DT  B  1 70  ? -8.841  24.865  -79.462 1.00 48.04  ? 216 DT  J "C4'" 1 
ATOM   4402  O  "O4'" . DT  B  1 70  ? -8.707  25.606  -80.708 1.00 56.99  ? 216 DT  J "O4'" 1 
ATOM   4403  C  "C3'" . DT  B  1 70  ? -10.343 24.657  -79.242 1.00 46.14  ? 216 DT  J "C3'" 1 
ATOM   4404  O  "O3'" . DT  B  1 70  ? -10.788 25.504  -78.206 1.00 47.83  ? 216 DT  J "O3'" 1 
ATOM   4405  C  "C2'" . DT  B  1 70  ? -10.959 25.052  -80.584 1.00 56.75  ? 216 DT  J "C2'" 1 
ATOM   4406  C  "C1'" . DT  B  1 70  ? -9.970  26.090  -81.085 1.00 52.84  ? 216 DT  J "C1'" 1 
ATOM   4407  N  N1    . DT  B  1 70  ? -10.001 26.260  -82.562 1.00 54.73  ? 216 DT  J N1    1 
ATOM   4408  C  C2    . DT  B  1 70  ? -9.932  27.525  -83.097 1.00 61.60  ? 216 DT  J C2    1 
ATOM   4409  O  O2    . DT  B  1 70  ? -9.829  28.532  -82.420 1.00 63.35  ? 216 DT  J O2    1 
ATOM   4410  N  N3    . DT  B  1 70  ? -9.980  27.572  -84.465 1.00 61.32  ? 216 DT  J N3    1 
ATOM   4411  C  C4    . DT  B  1 70  ? -10.096 26.502  -85.333 1.00 59.47  ? 216 DT  J C4    1 
ATOM   4412  O  O4    . DT  B  1 70  ? -10.131 26.645  -86.550 1.00 63.45  ? 216 DT  J O4    1 
ATOM   4413  C  C5    . DT  B  1 70  ? -10.173 25.204  -84.708 1.00 58.20  ? 216 DT  J C5    1 
ATOM   4414  C  C7    . DT  B  1 70  ? -10.304 23.970  -85.550 1.00 61.60  ? 216 DT  J C7    1 
ATOM   4415  C  C6    . DT  B  1 70  ? -10.125 25.147  -83.368 1.00 55.47  ? 216 DT  J C6    1 
ATOM   4416  P  P     . DG  B  1 71  ? -12.207 25.257  -77.495 1.00 45.75  ? 217 DG  J P     1 
ATOM   4417  O  OP1   . DG  B  1 71  ? -11.955 25.065  -76.050 1.00 35.15  ? 217 DG  J OP1   1 
ATOM   4418  O  OP2   . DG  B  1 71  ? -12.964 24.245  -78.261 1.00 47.92  ? 217 DG  J OP2   1 
ATOM   4419  O  "O5'" . DG  B  1 71  ? -12.940 26.655  -77.672 1.00 44.84  ? 217 DG  J "O5'" 1 
ATOM   4420  C  "C5'" . DG  B  1 71  ? -12.224 27.839  -77.409 1.00 47.22  ? 217 DG  J "C5'" 1 
ATOM   4421  C  "C4'" . DG  B  1 71  ? -12.895 29.025  -78.059 1.00 49.98  ? 217 DG  J "C4'" 1 
ATOM   4422  O  "O4'" . DG  B  1 71  ? -12.792 28.912  -79.497 1.00 51.63  ? 217 DG  J "O4'" 1 
ATOM   4423  C  "C3'" . DG  B  1 71  ? -14.373 29.174  -77.746 1.00 48.03  ? 217 DG  J "C3'" 1 
ATOM   4424  O  "O3'" . DG  B  1 71  ? -14.682 30.538  -77.621 1.00 53.92  ? 217 DG  J "O3'" 1 
ATOM   4425  C  "C2'" . DG  B  1 71  ? -15.057 28.548  -78.960 1.00 51.41  ? 217 DG  J "C2'" 1 
ATOM   4426  C  "C1'" . DG  B  1 71  ? -14.073 28.851  -80.082 1.00 52.53  ? 217 DG  J "C1'" 1 
ATOM   4427  N  N9    . DG  B  1 71  ? -14.039 27.823  -81.117 1.00 55.99  ? 217 DG  J N9    1 
ATOM   4428  C  C8    . DG  B  1 71  ? -14.150 26.467  -80.937 1.00 57.53  ? 217 DG  J C8    1 
ATOM   4429  N  N7    . DG  B  1 71  ? -14.073 25.788  -82.045 1.00 58.86  ? 217 DG  J N7    1 
ATOM   4430  C  C5    . DG  B  1 71  ? -13.892 26.755  -83.025 1.00 59.09  ? 217 DG  J C5    1 
ATOM   4431  C  C6    . DG  B  1 71  ? -13.744 26.615  -84.424 1.00 63.83  ? 217 DG  J C6    1 
ATOM   4432  O  O6    . DG  B  1 71  ? -13.742 25.573  -85.096 1.00 67.37  ? 217 DG  J O6    1 
ATOM   4433  N  N1    . DG  B  1 71  ? -13.585 27.848  -85.050 1.00 64.87  ? 217 DG  J N1    1 
ATOM   4434  C  C2    . DG  B  1 71  ? -13.570 29.061  -84.402 1.00 66.40  ? 217 DG  J C2    1 
ATOM   4435  N  N2    . DG  B  1 71  ? -13.407 30.145  -85.174 1.00 68.78  ? 217 DG  J N2    1 
ATOM   4436  N  N3    . DG  B  1 71  ? -13.709 29.205  -83.092 1.00 62.08  ? 217 DG  J N3    1 
ATOM   4437  C  C4    . DG  B  1 71  ? -13.864 28.012  -82.469 1.00 56.99  ? 217 DG  J C4    1 
ATOM   4438  P  P     . DA  B  1 72  ? -16.049 30.997  -76.924 1.00 51.45  ? 218 DA  J P     1 
ATOM   4439  O  OP1   . DA  B  1 72  ? -15.699 31.963  -75.861 1.00 50.53  ? 218 DA  J OP1   1 
ATOM   4440  O  OP2   . DA  B  1 72  ? -16.859 29.788  -76.637 1.00 54.75  ? 218 DA  J OP2   1 
ATOM   4441  O  "O5'" . DA  B  1 72  ? -16.785 31.803  -78.074 1.00 63.30  ? 218 DA  J "O5'" 1 
ATOM   4442  C  "C5'" . DA  B  1 72  ? -16.044 32.704  -78.866 1.00 66.02  ? 218 DA  J "C5'" 1 
ATOM   4443  C  "C4'" . DA  B  1 72  ? -16.744 32.932  -80.183 1.00 68.88  ? 218 DA  J "C4'" 1 
ATOM   4444  O  "O4'" . DA  B  1 72  ? -16.489 31.813  -81.067 1.00 68.24  ? 218 DA  J "O4'" 1 
ATOM   4445  C  "C3'" . DA  B  1 72  ? -18.264 33.062  -80.074 1.00 74.56  ? 218 DA  J "C3'" 1 
ATOM   4446  O  "O3'" . DA  B  1 72  ? -18.674 34.217  -80.773 1.00 78.50  ? 218 DA  J "O3'" 1 
ATOM   4447  C  "C2'" . DA  B  1 72  ? -18.791 31.774  -80.721 1.00 62.23  ? 218 DA  J "C2'" 1 
ATOM   4448  C  "C1'" . DA  B  1 72  ? -17.684 31.445  -81.707 1.00 68.65  ? 218 DA  J "C1'" 1 
ATOM   4449  N  N9    . DA  B  1 72  ? -17.604 30.027  -82.048 1.00 64.75  ? 218 DA  J N9    1 
ATOM   4450  C  C8    . DA  B  1 72  ? -17.804 28.965  -81.212 1.00 64.95  ? 218 DA  J C8    1 
ATOM   4451  N  N7    . DA  B  1 72  ? -17.661 27.797  -81.795 1.00 62.34  ? 218 DA  J N7    1 
ATOM   4452  C  C5    . DA  B  1 72  ? -17.345 28.116  -83.105 1.00 59.38  ? 218 DA  J C5    1 
ATOM   4453  C  C6    . DA  B  1 72  ? -17.071 27.321  -84.233 1.00 60.08  ? 218 DA  J C6    1 
ATOM   4454  N  N6    . DA  B  1 72  ? -17.076 25.985  -84.207 1.00 65.79  ? 218 DA  J N6    1 
ATOM   4455  N  N1    . DA  B  1 72  ? -16.792 27.953  -85.391 1.00 63.69  ? 218 DA  J N1    1 
ATOM   4456  C  C2    . DA  B  1 72  ? -16.788 29.292  -85.413 1.00 67.86  ? 218 DA  J C2    1 
ATOM   4457  N  N3    . DA  B  1 72  ? -17.028 30.146  -84.418 1.00 68.40  ? 218 DA  J N3    1 
ATOM   4458  C  C4    . DA  B  1 72  ? -17.303 29.486  -83.279 1.00 64.47  ? 218 DA  J C4    1 
ATOM   4459  P  P     . DA  B  1 73  ? -20.180 34.767  -80.677 1.00 77.01  ? 219 DA  J P     1 
ATOM   4460  O  OP1   . DA  B  1 73  ? -20.083 36.122  -80.085 1.00 60.25  ? 219 DA  J OP1   1 
ATOM   4461  O  OP2   . DA  B  1 73  ? -21.073 33.746  -80.081 1.00 66.83  ? 219 DA  J OP2   1 
ATOM   4462  O  "O5'" . DA  B  1 73  ? -20.583 34.897  -82.210 1.00 78.38  ? 219 DA  J "O5'" 1 
ATOM   4463  C  "C5'" . DA  B  1 73  ? -19.552 34.994  -83.188 1.00 74.13  ? 219 DA  J "C5'" 1 
ATOM   4464  C  "C4'" . DA  B  1 73  ? -20.076 34.623  -84.554 1.00 66.71  ? 219 DA  J "C4'" 1 
ATOM   4465  O  "O4'" . DA  B  1 73  ? -19.707 33.253  -84.858 1.00 71.85  ? 219 DA  J "O4'" 1 
ATOM   4466  C  "C3'" . DA  B  1 73  ? -21.594 34.707  -84.694 1.00 71.92  ? 219 DA  J "C3'" 1 
ATOM   4467  O  "O3'" . DA  B  1 73  ? -21.926 35.353  -85.915 1.00 84.82  ? 219 DA  J "O3'" 1 
ATOM   4468  C  "C2'" . DA  B  1 73  ? -22.032 33.243  -84.683 1.00 69.18  ? 219 DA  J "C2'" 1 
ATOM   4469  C  "C1'" . DA  B  1 73  ? -20.836 32.555  -85.318 1.00 71.23  ? 219 DA  J "C1'" 1 
ATOM   4470  N  N9    . DA  B  1 73  ? -20.706 31.160  -84.924 1.00 64.19  ? 219 DA  J N9    1 
ATOM   4471  C  C8    . DA  B  1 73  ? -20.891 30.641  -83.676 1.00 64.12  ? 219 DA  J C8    1 
ATOM   4472  N  N7    . DA  B  1 73  ? -20.721 29.344  -83.611 1.00 64.33  ? 219 DA  J N7    1 
ATOM   4473  C  C5    . DA  B  1 73  ? -20.399 28.988  -84.909 1.00 67.99  ? 219 DA  J C5    1 
ATOM   4474  C  C6    . DA  B  1 73  ? -20.098 27.749  -85.505 1.00 65.15  ? 219 DA  J C6    1 
ATOM   4475  N  N6    . DA  B  1 73  ? -20.073 26.596  -84.831 1.00 60.22  ? 219 DA  J N6    1 
ATOM   4476  N  N1    . DA  B  1 73  ? -19.821 27.741  -86.825 1.00 68.37  ? 219 DA  J N1    1 
ATOM   4477  C  C2    . DA  B  1 73  ? -19.848 28.899  -87.497 1.00 69.50  ? 219 DA  J C2    1 
ATOM   4478  N  N3    . DA  B  1 73  ? -20.118 30.124  -87.046 1.00 70.90  ? 219 DA  J N3    1 
ATOM   4479  C  C4    . DA  B  1 73  ? -20.387 30.098  -85.732 1.00 67.41  ? 219 DA  J C4    1 
ATOM   4480  P  P     . DT  B  1 74  ? -23.443 35.772  -86.244 1.00 88.98  ? 220 DT  J P     1 
ATOM   4481  O  OP1   . DT  B  1 74  ? -23.434 37.230  -86.484 1.00 88.92  ? 220 DT  J OP1   1 
ATOM   4482  O  OP2   . DT  B  1 74  ? -24.358 35.205  -85.227 1.00 83.57  ? 220 DT  J OP2   1 
ATOM   4483  O  "O5'" . DT  B  1 74  ? -23.734 35.015  -87.618 1.00 78.39  ? 220 DT  J "O5'" 1 
ATOM   4484  C  "C5'" . DT  B  1 74  ? -22.816 34.044  -88.078 1.00 71.22  ? 220 DT  J "C5'" 1 
ATOM   4485  C  "C4'" . DT  B  1 74  ? -23.467 33.107  -89.069 1.00 72.28  ? 220 DT  J "C4'" 1 
ATOM   4486  O  "O4'" . DT  B  1 74  ? -23.097 31.740  -88.749 1.00 77.19  ? 220 DT  J "O4'" 1 
ATOM   4487  C  "C3'" . DT  B  1 74  ? -24.992 33.145  -89.095 1.00 74.98  ? 220 DT  J "C3'" 1 
ATOM   4488  O  "O3'" . DT  B  1 74  ? -25.442 33.020  -90.446 1.00 85.63  ? 220 DT  J "O3'" 1 
ATOM   4489  C  "C2'" . DT  B  1 74  ? -25.376 31.934  -88.247 1.00 77.98  ? 220 DT  J "C2'" 1 
ATOM   4490  C  "C1'" . DT  B  1 74  ? -24.255 30.957  -88.577 1.00 75.67  ? 220 DT  J "C1'" 1 
ATOM   4491  N  N1    . DT  B  1 74  ? -23.993 29.954  -87.494 1.00 72.32  ? 220 DT  J N1    1 
ATOM   4492  C  C2    . DT  B  1 74  ? -23.567 28.690  -87.833 1.00 71.83  ? 220 DT  J C2    1 
ATOM   4493  O  O2    . DT  B  1 74  ? -23.384 28.331  -88.981 1.00 72.46  ? 220 DT  J O2    1 
ATOM   4494  N  N3    . DT  B  1 74  ? -23.360 27.851  -86.769 1.00 73.68  ? 220 DT  J N3    1 
ATOM   4495  C  C4    . DT  B  1 74  ? -23.534 28.143  -85.427 1.00 77.33  ? 220 DT  J C4    1 
ATOM   4496  O  O4    . DT  B  1 74  ? -23.319 27.320  -84.541 1.00 77.77  ? 220 DT  J O4    1 
ATOM   4497  C  C5    . DT  B  1 74  ? -23.983 29.486  -85.141 1.00 74.37  ? 220 DT  J C5    1 
ATOM   4498  C  C7    . DT  B  1 74  ? -24.208 29.922  -83.722 1.00 74.06  ? 220 DT  J C7    1 
ATOM   4499  C  C6    . DT  B  1 74  ? -24.188 30.316  -86.176 1.00 74.56  ? 220 DT  J C6    1 
ATOM   4500  P  P     . DT  B  1 75  ? -27.004 33.109  -90.824 1.00 87.74  ? 221 DT  J P     1 
ATOM   4501  O  OP1   . DT  B  1 75  ? -27.114 34.077  -91.938 1.00 86.18  ? 221 DT  J OP1   1 
ATOM   4502  O  OP2   . DT  B  1 75  ? -27.796 33.348  -89.595 1.00 75.76  ? 221 DT  J OP2   1 
ATOM   4503  O  "O5'" . DT  B  1 75  ? -27.329 31.640  -91.376 1.00 73.04  ? 221 DT  J "O5'" 1 
ATOM   4504  C  "C5'" . DT  B  1 75  ? -26.263 30.819  -91.846 1.00 68.59  ? 221 DT  J "C5'" 1 
ATOM   4505  C  "C4'" . DT  B  1 75  ? -26.736 29.405  -92.155 1.00 78.67  ? 221 DT  J "C4'" 1 
ATOM   4506  O  "O4'" . DT  B  1 75  ? -26.370 28.510  -91.073 1.00 79.22  ? 221 DT  J "O4'" 1 
ATOM   4507  C  "C3'" . DT  B  1 75  ? -28.239 29.236  -92.351 1.00 81.87  ? 221 DT  J "C3'" 1 
ATOM   4508  O  "O3'" . DT  B  1 75  ? -28.473 28.264  -93.368 1.00 82.59  ? 221 DT  J "O3'" 1 
ATOM   4509  C  "C2'" . DT  B  1 75  ? -28.702 28.741  -90.982 1.00 78.12  ? 221 DT  J "C2'" 1 
ATOM   4510  C  "C1'" . DT  B  1 75  ? -27.524 27.875  -90.559 1.00 77.30  ? 221 DT  J "C1'" 1 
ATOM   4511  N  N1    . DT  B  1 75  ? -27.361 27.748  -89.075 1.00 75.29  ? 221 DT  J N1    1 
ATOM   4512  C  C2    . DT  B  1 75  ? -26.983 26.535  -88.539 1.00 71.42  ? 221 DT  J C2    1 
ATOM   4513  O  O2    . DT  B  1 75  ? -26.780 25.540  -89.212 1.00 71.71  ? 221 DT  J O2    1 
ATOM   4514  N  N3    . DT  B  1 75  ? -26.851 26.528  -87.176 1.00 73.03  ? 221 DT  J N3    1 
ATOM   4515  C  C4    . DT  B  1 75  ? -27.048 27.588  -86.310 1.00 77.71  ? 221 DT  J C4    1 
ATOM   4516  O  O4    . DT  B  1 75  ? -26.904 27.479  -85.095 1.00 77.17  ? 221 DT  J O4    1 
ATOM   4517  C  C5    . DT  B  1 75  ? -27.443 28.831  -86.935 1.00 74.19  ? 221 DT  J C5    1 
ATOM   4518  C  C7    . DT  B  1 75  ? -27.692 30.050  -86.097 1.00 70.54  ? 221 DT  J C7    1 
ATOM   4519  C  C6    . DT  B  1 75  ? -27.576 28.851  -88.272 1.00 73.06  ? 221 DT  J C6    1 
ATOM   4520  P  P     . DC  B  1 76  ? -29.900 28.159  -94.101 1.00 92.68  ? 222 DC  J P     1 
ATOM   4521  O  OP1   . DC  B  1 76  ? -29.659 28.134  -95.562 1.00 81.69  ? 222 DC  J OP1   1 
ATOM   4522  O  OP2   . DC  B  1 76  ? -30.805 29.178  -93.518 1.00 82.42  ? 222 DC  J OP2   1 
ATOM   4523  O  "O5'" . DC  B  1 76  ? -30.422 26.716  -93.669 1.00 87.18  ? 222 DC  J "O5'" 1 
ATOM   4524  C  "C5'" . DC  B  1 76  ? -29.519 25.619  -93.675 1.00 88.56  ? 222 DC  J "C5'" 1 
ATOM   4525  C  "C4'" . DC  B  1 76  ? -30.107 24.438  -92.934 1.00 86.40  ? 222 DC  J "C4'" 1 
ATOM   4526  O  "O4'" . DC  B  1 76  ? -29.685 24.465  -91.543 1.00 83.40  ? 222 DC  J "O4'" 1 
ATOM   4527  C  "C3'" . DC  B  1 76  ? -31.635 24.399  -92.908 1.00 90.71  ? 222 DC  J "C3'" 1 
ATOM   4528  O  "O3'" . DC  B  1 76  ? -32.062 23.076  -93.056 1.00 99.26  ? 222 DC  J "O3'" 1 
ATOM   4529  C  "C2'" . DC  B  1 76  ? -31.961 24.917  -91.513 1.00 89.68  ? 222 DC  J "C2'" 1 
ATOM   4530  C  "C1'" . DC  B  1 76  ? -30.820 24.304  -90.725 1.00 82.88  ? 222 DC  J "C1'" 1 
ATOM   4531  N  N1    . DC  B  1 76  ? -30.577 24.959  -89.418 1.00 77.16  ? 222 DC  J N1    1 
ATOM   4532  C  C2    . DC  B  1 76  ? -30.077 24.201  -88.357 1.00 77.02  ? 222 DC  J C2    1 
ATOM   4533  O  O2    . DC  B  1 76  ? -29.835 22.999  -88.538 1.00 74.80  ? 222 DC  J O2    1 
ATOM   4534  N  N3    . DC  B  1 76  ? -29.865 24.807  -87.160 1.00 73.73  ? 222 DC  J N3    1 
ATOM   4535  C  C4    . DC  B  1 76  ? -30.139 26.105  -87.011 1.00 72.93  ? 222 DC  J C4    1 
ATOM   4536  N  N4    . DC  B  1 76  ? -29.917 26.658  -85.815 1.00 71.28  ? 222 DC  J N4    1 
ATOM   4537  C  C5    . DC  B  1 76  ? -30.655 26.893  -88.083 1.00 74.25  ? 222 DC  J C5    1 
ATOM   4538  C  C6    . DC  B  1 76  ? -30.859 26.284  -89.256 1.00 73.97  ? 222 DC  J C6    1 
ATOM   4539  P  P     . DA  B  1 77  ? -33.158 22.694  -94.160 1.00 110.84 ? 223 DA  J P     1 
ATOM   4540  O  OP1   . DA  B  1 77  ? -32.509 22.803  -95.488 1.00 105.51 ? 223 DA  J OP1   1 
ATOM   4541  O  OP2   . DA  B  1 77  ? -34.382 23.475  -93.866 1.00 92.04  ? 223 DA  J OP2   1 
ATOM   4542  O  "O5'" . DA  B  1 77  ? -33.445 21.155  -93.848 1.00 103.15 ? 223 DA  J "O5'" 1 
ATOM   4543  C  "C5'" . DA  B  1 77  ? -32.369 20.311  -93.447 1.00 92.29  ? 223 DA  J "C5'" 1 
ATOM   4544  C  "C4'" . DA  B  1 77  ? -32.706 19.565  -92.167 1.00 89.38  ? 223 DA  J "C4'" 1 
ATOM   4545  O  "O4'" . DA  B  1 77  ? -32.442 20.405  -91.008 1.00 91.90  ? 223 DA  J "O4'" 1 
ATOM   4546  C  "C3'" . DA  B  1 77  ? -34.164 19.124  -92.032 1.00 87.52  ? 223 DA  J "C3'" 1 
ATOM   4547  O  "O3'" . DA  B  1 77  ? -34.200 17.847  -91.446 1.00 92.33  ? 223 DA  J "O3'" 1 
ATOM   4548  C  "C2'" . DA  B  1 77  ? -34.742 20.170  -91.083 1.00 86.89  ? 223 DA  J "C2'" 1 
ATOM   4549  C  "C1'" . DA  B  1 77  ? -33.561 20.350  -90.152 1.00 87.22  ? 223 DA  J "C1'" 1 
ATOM   4550  N  N9    . DA  B  1 77  ? -33.603 21.565  -89.341 1.00 85.72  ? 223 DA  J N9    1 
ATOM   4551  C  C8    . DA  B  1 77  ? -34.111 22.785  -89.697 1.00 86.69  ? 223 DA  J C8    1 
ATOM   4552  N  N7    . DA  B  1 77  ? -34.001 23.698  -88.758 1.00 76.62  ? 223 DA  J N7    1 
ATOM   4553  C  C5    . DA  B  1 77  ? -33.378 23.029  -87.717 1.00 74.75  ? 223 DA  J C5    1 
ATOM   4554  C  C6    . DA  B  1 77  ? -32.975 23.439  -86.432 1.00 74.25  ? 223 DA  J C6    1 
ATOM   4555  N  N6    . DA  B  1 77  ? -33.152 24.679  -85.968 1.00 76.21  ? 223 DA  J N6    1 
ATOM   4556  N  N1    . DA  B  1 77  ? -32.378 22.521  -85.639 1.00 77.48  ? 223 DA  J N1    1 
ATOM   4557  C  C2    . DA  B  1 77  ? -32.198 21.279  -86.109 1.00 77.23  ? 223 DA  J C2    1 
ATOM   4558  N  N3    . DA  B  1 77  ? -32.534 20.778  -87.298 1.00 81.28  ? 223 DA  J N3    1 
ATOM   4559  C  C4    . DA  B  1 77  ? -33.125 21.714  -88.061 1.00 81.73  ? 223 DA  J C4    1 
ATOM   4560  P  P     . DG  B  1 78  ? -35.209 16.730  -91.994 1.00 95.76  ? 224 DG  J P     1 
ATOM   4561  O  OP1   . DG  B  1 78  ? -34.581 16.098  -93.179 1.00 88.56  ? 224 DG  J OP1   1 
ATOM   4562  O  OP2   . DG  B  1 78  ? -36.540 17.374  -92.090 1.00 79.49  ? 224 DG  J OP2   1 
ATOM   4563  O  "O5'" . DG  B  1 78  ? -35.256 15.655  -90.811 1.00 86.40  ? 224 DG  J "O5'" 1 
ATOM   4564  C  "C5'" . DG  B  1 78  ? -34.114 15.467  -89.975 1.00 83.30  ? 224 DG  J "C5'" 1 
ATOM   4565  C  "C4'" . DG  B  1 78  ? -34.507 15.452  -88.506 1.00 78.33  ? 224 DG  J "C4'" 1 
ATOM   4566  O  "O4'" . DG  B  1 78  ? -34.562 16.812  -87.990 1.00 79.92  ? 224 DG  J "O4'" 1 
ATOM   4567  C  "C3'" . DG  B  1 78  ? -35.881 14.856  -88.201 1.00 81.89  ? 224 DG  J "C3'" 1 
ATOM   4568  O  "O3'" . DG  B  1 78  ? -35.852 14.287  -86.923 1.00 77.68  ? 224 DG  J "O3'" 1 
ATOM   4569  C  "C2'" . DG  B  1 78  ? -36.751 16.102  -88.183 1.00 82.49  ? 224 DG  J "C2'" 1 
ATOM   4570  C  "C1'" . DG  B  1 78  ? -35.829 17.011  -87.403 1.00 79.65  ? 224 DG  J "C1'" 1 
ATOM   4571  N  N9    . DG  B  1 78  ? -36.173 18.421  -87.469 1.00 79.16  ? 224 DG  J N9    1 
ATOM   4572  C  C8    . DG  B  1 78  ? -36.742 19.091  -88.522 1.00 82.12  ? 224 DG  J C8    1 
ATOM   4573  N  N7    . DG  B  1 78  ? -36.933 20.359  -88.285 1.00 82.08  ? 224 DG  J N7    1 
ATOM   4574  C  C5    . DG  B  1 78  ? -36.461 20.537  -86.990 1.00 82.21  ? 224 DG  J C5    1 
ATOM   4575  C  C6    . DG  B  1 78  ? -36.407 21.702  -86.191 1.00 78.38  ? 224 DG  J C6    1 
ATOM   4576  O  O6    . DG  B  1 78  ? -36.779 22.847  -86.479 1.00 81.77  ? 224 DG  J O6    1 
ATOM   4577  N  N1    . DG  B  1 78  ? -35.856 21.444  -84.938 1.00 72.39  ? 224 DG  J N1    1 
ATOM   4578  C  C2    . DG  B  1 78  ? -35.411 20.215  -84.513 1.00 74.80  ? 224 DG  J C2    1 
ATOM   4579  N  N2    . DG  B  1 78  ? -34.909 20.162  -83.271 1.00 73.16  ? 224 DG  J N2    1 
ATOM   4580  N  N3    . DG  B  1 78  ? -35.455 19.115  -85.253 1.00 79.09  ? 224 DG  J N3    1 
ATOM   4581  C  C4    . DG  B  1 78  ? -35.991 19.352  -86.476 1.00 82.35  ? 224 DG  J C4    1 
ATOM   4582  P  P     . DC  B  1 79  ? -35.777 12.700  -86.720 1.00 85.76  ? 225 DC  J P     1 
ATOM   4583  O  OP1   . DC  B  1 79  ? -34.527 12.223  -87.356 1.00 77.77  ? 225 DC  J OP1   1 
ATOM   4584  O  OP2   . DC  B  1 79  ? -37.085 12.133  -87.121 1.00 79.18  ? 225 DC  J OP2   1 
ATOM   4585  O  "O5'" . DC  B  1 79  ? -35.655 12.560  -85.132 1.00 88.93  ? 225 DC  J "O5'" 1 
ATOM   4586  C  "C5'" . DC  B  1 79  ? -34.877 13.508  -84.401 1.00 78.50  ? 225 DC  J "C5'" 1 
ATOM   4587  C  "C4'" . DC  B  1 79  ? -35.721 14.247  -83.371 1.00 78.48  ? 225 DC  J "C4'" 1 
ATOM   4588  O  "O4'" . DC  B  1 79  ? -36.295 15.455  -83.947 1.00 79.74  ? 225 DC  J "O4'" 1 
ATOM   4589  C  "C3'" . DC  B  1 79  ? -36.901 13.459  -82.789 1.00 81.73  ? 225 DC  J "C3'" 1 
ATOM   4590  O  "O3'" . DC  B  1 79  ? -36.940 13.659  -81.395 1.00 82.35  ? 225 DC  J "O3'" 1 
ATOM   4591  C  "C2'" . DC  B  1 79  ? -38.107 14.120  -83.454 1.00 82.11  ? 225 DC  J "C2'" 1 
ATOM   4592  C  "C1'" . DC  B  1 79  ? -37.625 15.555  -83.502 1.00 79.41  ? 225 DC  J "C1'" 1 
ATOM   4593  N  N1    . DC  B  1 79  ? -38.392 16.425  -84.432 1.00 84.44  ? 225 DC  J N1    1 
ATOM   4594  C  C2    . DC  B  1 79  ? -38.542 17.790  -84.141 1.00 85.36  ? 225 DC  J C2    1 
ATOM   4595  O  O2    . DC  B  1 79  ? -38.023 18.251  -83.113 1.00 81.70  ? 225 DC  J O2    1 
ATOM   4596  N  N3    . DC  B  1 79  ? -39.247 18.570  -84.999 1.00 81.40  ? 225 DC  J N3    1 
ATOM   4597  C  C4    . DC  B  1 79  ? -39.790 18.035  -86.097 1.00 85.62  ? 225 DC  J C4    1 
ATOM   4598  N  N4    . DC  B  1 79  ? -40.477 18.843  -86.913 1.00 85.81  ? 225 DC  J N4    1 
ATOM   4599  C  C5    . DC  B  1 79  ? -39.654 16.648  -86.404 1.00 87.82  ? 225 DC  J C5    1 
ATOM   4600  C  C6    . DC  B  1 79  ? -38.956 15.888  -85.551 1.00 83.66  ? 225 DC  J C6    1 
ATOM   4601  P  P     . DT  B  1 80  ? -36.886 12.419  -80.381 1.00 86.68  ? 226 DT  J P     1 
ATOM   4602  O  OP1   . DT  B  1 80  ? -35.711 11.597  -80.748 1.00 85.46  ? 226 DT  J OP1   1 
ATOM   4603  O  OP2   . DT  B  1 80  ? -38.237 11.813  -80.326 1.00 65.80  ? 226 DT  J OP2   1 
ATOM   4604  O  "O5'" . DT  B  1 80  ? -36.605 13.123  -78.975 1.00 84.50  ? 226 DT  J "O5'" 1 
ATOM   4605  C  "C5'" . DT  B  1 80  ? -35.646 14.171  -78.899 1.00 73.79  ? 226 DT  J "C5'" 1 
ATOM   4606  C  "C4'" . DT  B  1 80  ? -36.240 15.415  -78.257 1.00 65.53  ? 226 DT  J "C4'" 1 
ATOM   4607  O  "O4'" . DT  B  1 80  ? -37.059 16.139  -79.214 1.00 66.88  ? 226 DT  J "O4'" 1 
ATOM   4608  C  "C3'" . DT  B  1 80  ? -37.139 15.165  -77.047 1.00 67.78  ? 226 DT  J "C3'" 1 
ATOM   4609  O  "O3'" . DT  B  1 80  ? -36.879 16.152  -76.075 1.00 64.63  ? 226 DT  J "O3'" 1 
ATOM   4610  C  "C2'" . DT  B  1 80  ? -38.540 15.331  -77.630 1.00 66.92  ? 226 DT  J "C2'" 1 
ATOM   4611  C  "C1'" . DT  B  1 80  ? -38.285 16.466  -78.598 1.00 67.85  ? 226 DT  J "C1'" 1 
ATOM   4612  N  N1    . DT  B  1 80  ? -39.318 16.625  -79.651 1.00 73.37  ? 226 DT  J N1    1 
ATOM   4613  C  C2    . DT  B  1 80  ? -39.705 17.891  -80.012 1.00 72.82  ? 226 DT  J C2    1 
ATOM   4614  O  O2    . DT  B  1 80  ? -39.250 18.897  -79.499 1.00 78.11  ? 226 DT  J O2    1 
ATOM   4615  N  N3    . DT  B  1 80  ? -40.648 17.944  -81.000 1.00 73.18  ? 226 DT  J N3    1 
ATOM   4616  C  C4    . DT  B  1 80  ? -41.231 16.877  -81.654 1.00 80.09  ? 226 DT  J C4    1 
ATOM   4617  O  O4    . DT  B  1 80  ? -42.074 17.030  -82.532 1.00 81.85  ? 226 DT  J O4    1 
ATOM   4618  C  C5    . DT  B  1 80  ? -40.778 15.571  -81.231 1.00 81.20  ? 226 DT  J C5    1 
ATOM   4619  C  C7    . DT  B  1 80  ? -41.341 14.334  -81.867 1.00 80.48  ? 226 DT  J C7    1 
ATOM   4620  C  C6    . DT  B  1 80  ? -39.852 15.509  -80.260 1.00 78.61  ? 226 DT  J C6    1 
ATOM   4621  P  P     . DG  B  1 81  ? -36.863 15.774  -74.519 1.00 62.39  ? 227 DG  J P     1 
ATOM   4622  O  OP1   . DG  B  1 81  ? -35.449 15.832  -74.090 1.00 63.62  ? 227 DG  J OP1   1 
ATOM   4623  O  OP2   . DG  B  1 81  ? -37.675 14.550  -74.326 1.00 61.27  ? 227 DG  J OP2   1 
ATOM   4624  O  "O5'" . DG  B  1 81  ? -37.663 16.969  -73.834 1.00 61.81  ? 227 DG  J "O5'" 1 
ATOM   4625  C  "C5'" . DG  B  1 81  ? -37.420 18.301  -74.238 1.00 57.94  ? 227 DG  J "C5'" 1 
ATOM   4626  C  "C4'" . DG  B  1 81  ? -38.720 19.071  -74.323 1.00 56.13  ? 227 DG  J "C4'" 1 
ATOM   4627  O  "O4'" . DG  B  1 81  ? -39.490 18.605  -75.461 1.00 62.69  ? 227 DG  J "O4'" 1 
ATOM   4628  C  "C3'" . DG  B  1 81  ? -39.641 18.929  -73.108 1.00 57.97  ? 227 DG  J "C3'" 1 
ATOM   4629  O  "O3'" . DG  B  1 81  ? -40.189 20.191  -72.797 1.00 55.67  ? 227 DG  J "O3'" 1 
ATOM   4630  C  "C2'" . DG  B  1 81  ? -40.711 17.959  -73.600 1.00 53.54  ? 227 DG  J "C2'" 1 
ATOM   4631  C  "C1'" . DG  B  1 81  ? -40.817 18.370  -75.050 1.00 60.71  ? 227 DG  J "C1'" 1 
ATOM   4632  N  N9    . DG  B  1 81  ? -41.393 17.344  -75.905 1.00 62.34  ? 227 DG  J N9    1 
ATOM   4633  C  C8    . DG  B  1 81  ? -41.271 15.983  -75.763 1.00 73.59  ? 227 DG  J C8    1 
ATOM   4634  N  N7    . DG  B  1 81  ? -41.896 15.307  -76.686 1.00 74.91  ? 227 DG  J N7    1 
ATOM   4635  C  C5    . DG  B  1 81  ? -42.467 16.284  -77.491 1.00 72.73  ? 227 DG  J C5    1 
ATOM   4636  C  C6    . DG  B  1 81  ? -43.263 16.155  -78.652 1.00 77.83  ? 227 DG  J C6    1 
ATOM   4637  O  O6    . DG  B  1 81  ? -43.635 15.115  -79.219 1.00 80.42  ? 227 DG  J O6    1 
ATOM   4638  N  N1    . DG  B  1 81  ? -43.636 17.398  -79.160 1.00 76.15  ? 227 DG  J N1    1 
ATOM   4639  C  C2    . DG  B  1 81  ? -43.283 18.609  -78.613 1.00 71.89  ? 227 DG  J C2    1 
ATOM   4640  N  N2    . DG  B  1 81  ? -43.739 19.699  -79.243 1.00 72.51  ? 227 DG  J N2    1 
ATOM   4641  N  N3    . DG  B  1 81  ? -42.536 18.743  -77.527 1.00 66.20  ? 227 DG  J N3    1 
ATOM   4642  C  C4    . DG  B  1 81  ? -42.166 17.542  -77.021 1.00 63.59  ? 227 DG  J C4    1 
ATOM   4643  P  P     . DA  B  1 82  ? -41.083 20.420  -71.482 1.00 51.87  ? 228 DA  J P     1 
ATOM   4644  O  OP1   . DA  B  1 82  ? -40.245 21.160  -70.512 1.00 55.56  ? 228 DA  J OP1   1 
ATOM   4645  O  OP2   . DA  B  1 82  ? -41.734 19.164  -71.051 1.00 49.63  ? 228 DA  J OP2   1 
ATOM   4646  O  "O5'" . DA  B  1 82  ? -42.200 21.415  -72.019 1.00 57.64  ? 228 DA  J "O5'" 1 
ATOM   4647  C  "C5'" . DA  B  1 82  ? -41.822 22.455  -72.911 1.00 53.83  ? 228 DA  J "C5'" 1 
ATOM   4648  C  "C4'" . DA  B  1 82  ? -43.037 23.166  -73.472 1.00 58.95  ? 228 DA  J "C4'" 1 
ATOM   4649  O  "O4'" . DA  B  1 82  ? -43.628 22.368  -74.524 1.00 57.99  ? 228 DA  J "O4'" 1 
ATOM   4650  C  "C3'" . DA  B  1 82  ? -44.147 23.438  -72.469 1.00 56.82  ? 228 DA  J "C3'" 1 
ATOM   4651  O  "O3'" . DA  B  1 82  ? -44.755 24.676  -72.766 1.00 55.77  ? 228 DA  J "O3'" 1 
ATOM   4652  C  "C2'" . DA  B  1 82  ? -45.107 22.266  -72.674 1.00 58.25  ? 228 DA  J "C2'" 1 
ATOM   4653  C  "C1'" . DA  B  1 82  ? -44.917 21.926  -74.151 1.00 62.29  ? 228 DA  J "C1'" 1 
ATOM   4654  N  N9    . DA  B  1 82  ? -45.007 20.495  -74.442 1.00 63.28  ? 228 DA  J N9    1 
ATOM   4655  C  C8    . DA  B  1 82  ? -44.570 19.461  -73.657 1.00 63.52  ? 228 DA  J C8    1 
ATOM   4656  N  N7    . DA  B  1 82  ? -44.779 18.272  -74.179 1.00 66.42  ? 228 DA  J N7    1 
ATOM   4657  C  C5    . DA  B  1 82  ? -45.391 18.547  -75.393 1.00 67.74  ? 228 DA  J C5    1 
ATOM   4658  C  C6    . DA  B  1 82  ? -45.866 17.716  -76.425 1.00 65.03  ? 228 DA  J C6    1 
ATOM   4659  N  N6    . DA  B  1 82  ? -45.790 16.385  -76.390 1.00 70.51  ? 228 DA  J N6    1 
ATOM   4660  N  N1    . DA  B  1 82  ? -46.423 18.310  -77.500 1.00 69.31  ? 228 DA  J N1    1 
ATOM   4661  C  C2    . DA  B  1 82  ? -46.499 19.645  -77.534 1.00 68.36  ? 228 DA  J C2    1 
ATOM   4662  N  N3    . DA  B  1 82  ? -46.089 20.530  -76.628 1.00 66.49  ? 228 DA  J N3    1 
ATOM   4663  C  C4    . DA  B  1 82  ? -45.537 19.910  -75.571 1.00 67.52  ? 228 DA  J C4    1 
ATOM   4664  P  P     . DA  B  1 83  ? -45.759 25.359  -71.718 1.00 58.92  ? 229 DA  J P     1 
ATOM   4665  O  OP1   . DA  B  1 83  ? -45.404 26.794  -71.638 1.00 55.06  ? 229 DA  J OP1   1 
ATOM   4666  O  OP2   . DA  B  1 83  ? -45.778 24.533  -70.490 1.00 61.77  ? 229 DA  J OP2   1 
ATOM   4667  O  "O5'" . DA  B  1 83  ? -47.181 25.218  -72.435 1.00 68.88  ? 229 DA  J "O5'" 1 
ATOM   4668  C  "C5'" . DA  B  1 83  ? -47.309 25.572  -73.810 1.00 67.08  ? 229 DA  J "C5'" 1 
ATOM   4669  C  "C4'" . DA  B  1 83  ? -48.671 25.184  -74.362 1.00 66.48  ? 229 DA  J "C4'" 1 
ATOM   4670  O  "O4'" . DA  B  1 83  ? -48.629 23.824  -74.862 1.00 60.69  ? 229 DA  J "O4'" 1 
ATOM   4671  C  "C3'" . DA  B  1 83  ? -49.826 25.244  -73.363 1.00 65.92  ? 229 DA  J "C3'" 1 
ATOM   4672  O  "O3'" . DA  B  1 83  ? -50.960 25.837  -73.985 1.00 76.42  ? 229 DA  J "O3'" 1 
ATOM   4673  C  "C2'" . DA  B  1 83  ? -50.071 23.775  -73.025 1.00 65.09  ? 229 DA  J "C2'" 1 
ATOM   4674  C  "C1'" . DA  B  1 83  ? -49.703 23.090  -74.331 1.00 61.10  ? 229 DA  J "C1'" 1 
ATOM   4675  N  N9    . DA  B  1 83  ? -49.263 21.711  -74.158 1.00 66.81  ? 229 DA  J N9    1 
ATOM   4676  C  C8    . DA  B  1 83  ? -48.519 21.210  -73.128 1.00 70.35  ? 229 DA  J C8    1 
ATOM   4677  N  N7    . DA  B  1 83  ? -48.266 19.927  -73.232 1.00 71.13  ? 229 DA  J N7    1 
ATOM   4678  C  C5    . DA  B  1 83  ? -48.884 19.562  -74.415 1.00 70.53  ? 229 DA  J C5    1 
ATOM   4679  C  C6    . DA  B  1 83  ? -48.987 18.331  -75.091 1.00 72.79  ? 229 DA  J C6    1 
ATOM   4680  N  N6    . DA  B  1 83  ? -48.439 17.198  -74.641 1.00 75.52  ? 229 DA  J N6    1 
ATOM   4681  N  N1    . DA  B  1 83  ? -49.675 18.309  -76.250 1.00 74.16  ? 229 DA  J N1    1 
ATOM   4682  C  C2    . DA  B  1 83  ? -50.222 19.446  -76.697 1.00 74.72  ? 229 DA  J C2    1 
ATOM   4683  N  N3    . DA  B  1 83  ? -50.194 20.660  -76.151 1.00 73.45  ? 229 DA  J N3    1 
ATOM   4684  C  C4    . DA  B  1 83  ? -49.503 20.649  -75.000 1.00 70.31  ? 229 DA  J C4    1 
ATOM   4685  P  P     . DC  B  1 84  ? -52.236 26.295  -73.121 1.00 69.27  ? 230 DC  J P     1 
ATOM   4686  O  OP1   . DC  B  1 84  ? -52.464 27.721  -73.418 1.00 69.53  ? 230 DC  J OP1   1 
ATOM   4687  O  OP2   . DC  B  1 84  ? -52.075 25.843  -71.722 1.00 70.70  ? 230 DC  J OP2   1 
ATOM   4688  O  "O5'" . DC  B  1 84  ? -53.434 25.465  -73.765 1.00 72.79  ? 230 DC  J "O5'" 1 
ATOM   4689  C  "C5'" . DC  B  1 84  ? -53.206 24.690  -74.933 1.00 76.67  ? 230 DC  J "C5'" 1 
ATOM   4690  C  "C4'" . DC  B  1 84  ? -54.260 23.614  -75.064 1.00 77.93  ? 230 DC  J "C4'" 1 
ATOM   4691  O  "O4'" . DC  B  1 84  ? -53.625 22.308  -75.055 1.00 73.23  ? 230 DC  J "O4'" 1 
ATOM   4692  C  "C3'" . DC  B  1 84  ? -55.289 23.593  -73.932 1.00 85.31  ? 230 DC  J "C3'" 1 
ATOM   4693  O  "O3'" . DC  B  1 84  ? -56.573 23.327  -74.458 1.00 91.13  ? 230 DC  J "O3'" 1 
ATOM   4694  C  "C2'" . DC  B  1 84  ? -54.801 22.448  -73.052 1.00 85.66  ? 230 DC  J "C2'" 1 
ATOM   4695  C  "C1'" . DC  B  1 84  ? -54.255 21.493  -74.095 1.00 81.29  ? 230 DC  J "C1'" 1 
ATOM   4696  N  N1    . DC  B  1 84  ? -53.258 20.534  -73.550 1.00 79.05  ? 230 DC  J N1    1 
ATOM   4697  C  C2    . DC  B  1 84  ? -53.075 19.295  -74.173 1.00 80.96  ? 230 DC  J C2    1 
ATOM   4698  O  O2    . DC  B  1 84  ? -53.737 19.021  -75.180 1.00 85.89  ? 230 DC  J O2    1 
ATOM   4699  N  N3    . DC  B  1 84  ? -52.169 18.431  -73.658 1.00 83.37  ? 230 DC  J N3    1 
ATOM   4700  C  C4    . DC  B  1 84  ? -51.473 18.763  -72.570 1.00 82.23  ? 230 DC  J C4    1 
ATOM   4701  N  N4    . DC  B  1 84  ? -50.588 17.877  -72.100 1.00 80.04  ? 230 DC  J N4    1 
ATOM   4702  C  C5    . DC  B  1 84  ? -51.649 20.020  -71.919 1.00 76.82  ? 230 DC  J C5    1 
ATOM   4703  C  C6    . DC  B  1 84  ? -52.545 20.864  -72.436 1.00 75.54  ? 230 DC  J C6    1 
ATOM   4704  P  P     . DA  B  1 85  ? -57.891 23.628  -73.590 1.00 104.21 ? 231 DA  J P     1 
ATOM   4705  O  OP1   . DA  B  1 85  ? -58.447 24.916  -74.063 1.00 105.27 ? 231 DA  J OP1   1 
ATOM   4706  O  OP2   . DA  B  1 85  ? -57.581 23.454  -72.153 1.00 94.43  ? 231 DA  J OP2   1 
ATOM   4707  O  "O5'" . DA  B  1 85  ? -58.873 22.445  -74.013 1.00 106.05 ? 231 DA  J "O5'" 1 
ATOM   4708  C  "C5'" . DA  B  1 85  ? -58.897 22.007  -75.365 1.00 109.12 ? 231 DA  J "C5'" 1 
ATOM   4709  C  "C4'" . DA  B  1 85  ? -59.168 20.516  -75.449 1.00 117.89 ? 231 DA  J "C4'" 1 
ATOM   4710  O  "O4'" . DA  B  1 85  ? -58.019 19.779  -74.946 1.00 110.58 ? 231 DA  J "O4'" 1 
ATOM   4711  C  "C3'" . DA  B  1 85  ? -60.371 20.028  -74.640 1.00 122.51 ? 231 DA  J "C3'" 1 
ATOM   4712  O  "O3'" . DA  B  1 85  ? -61.068 19.024  -75.375 1.00 128.68 ? 231 DA  J "O3'" 1 
ATOM   4713  C  "C2'" . DA  B  1 85  ? -59.721 19.456  -73.384 1.00 118.17 ? 231 DA  J "C2'" 1 
ATOM   4714  C  "C1'" . DA  B  1 85  ? -58.445 18.866  -73.960 1.00 113.89 ? 231 DA  J "C1'" 1 
ATOM   4715  N  N9    . DA  B  1 85  ? -57.382 18.711  -72.974 1.00 109.91 ? 231 DA  J N9    1 
ATOM   4716  C  C8    . DA  B  1 85  ? -57.005 19.615  -72.019 1.00 107.43 ? 231 DA  J C8    1 
ATOM   4717  N  N7    . DA  B  1 85  ? -56.015 19.203  -71.262 1.00 100.27 ? 231 DA  J N7    1 
ATOM   4718  C  C5    . DA  B  1 85  ? -55.724 17.942  -71.755 1.00 103.38 ? 231 DA  J C5    1 
ATOM   4719  C  C6    . DA  B  1 85  ? -54.770 16.975  -71.382 1.00 101.92 ? 231 DA  J C6    1 
ATOM   4720  N  N6    . DA  B  1 85  ? -53.898 17.148  -70.382 1.00 98.74  ? 231 DA  J N6    1 
ATOM   4721  N  N1    . DA  B  1 85  ? -54.746 15.819  -72.082 1.00 102.85 ? 231 DA  J N1    1 
ATOM   4722  C  C2    . DA  B  1 85  ? -55.620 15.650  -73.083 1.00 104.93 ? 231 DA  J C2    1 
ATOM   4723  N  N3    . DA  B  1 85  ? -56.561 16.485  -73.523 1.00 108.14 ? 231 DA  J N3    1 
ATOM   4724  C  C4    . DA  B  1 85  ? -56.560 17.623  -72.810 1.00 107.45 ? 231 DA  J C4    1 
ATOM   4725  P  P     . DT  B  1 86  ? -62.531 18.535  -74.918 1.00 130.96 ? 232 DT  J P     1 
ATOM   4726  O  OP1   . DT  B  1 86  ? -63.457 18.822  -76.037 1.00 128.80 ? 232 DT  J OP1   1 
ATOM   4727  O  OP2   . DT  B  1 86  ? -62.817 19.082  -73.572 1.00 124.28 ? 232 DT  J OP2   1 
ATOM   4728  O  "O5'" . DT  B  1 86  ? -62.369 16.948  -74.790 1.00 126.47 ? 232 DT  J "O5'" 1 
ATOM   4729  C  "C5'" . DT  B  1 86  ? -61.107 16.396  -74.436 1.00 122.28 ? 232 DT  J "C5'" 1 
ATOM   4730  C  "C4'" . DT  B  1 86  ? -61.235 14.931  -74.068 1.00 122.72 ? 232 DT  J "C4'" 1 
ATOM   4731  O  "O4'" . DT  B  1 86  ? -60.067 14.530  -73.309 1.00 120.41 ? 232 DT  J "O4'" 1 
ATOM   4732  C  "C3'" . DT  B  1 86  ? -62.421 14.596  -73.180 1.00 126.71 ? 232 DT  J "C3'" 1 
ATOM   4733  O  "O3'" . DT  B  1 86  ? -62.795 13.234  -73.366 1.00 132.09 ? 232 DT  J "O3'" 1 
ATOM   4734  C  "C2'" . DT  B  1 86  ? -61.853 14.839  -71.786 1.00 123.34 ? 232 DT  J "C2'" 1 
ATOM   4735  C  "C1'" . DT  B  1 86  ? -60.415 14.347  -71.946 1.00 121.29 ? 232 DT  J "C1'" 1 
ATOM   4736  N  N1    . DT  B  1 86  ? -59.432 15.090  -71.099 1.00 117.23 ? 232 DT  J N1    1 
ATOM   4737  C  C2    . DT  B  1 86  ? -58.213 14.515  -70.821 1.00 114.77 ? 232 DT  J C2    1 
ATOM   4738  O  O2    . DT  B  1 86  ? -57.883 13.418  -71.237 1.00 115.53 ? 232 DT  J O2    1 
ATOM   4739  N  N3    . DT  B  1 86  ? -57.386 15.275  -70.036 1.00 108.93 ? 232 DT  J N3    1 
ATOM   4740  C  C4    . DT  B  1 86  ? -57.650 16.526  -69.508 1.00 112.06 ? 232 DT  J C4    1 
ATOM   4741  O  O4    . DT  B  1 86  ? -56.840 17.130  -68.812 1.00 111.32 ? 232 DT  J O4    1 
ATOM   4742  C  C5    . DT  B  1 86  ? -58.946 17.073  -69.835 1.00 118.19 ? 232 DT  J C5    1 
ATOM   4743  C  C7    . DT  B  1 86  ? -59.346 18.425  -69.319 1.00 112.68 ? 232 DT  J C7    1 
ATOM   4744  C  C6    . DT  B  1 86  ? -59.766 16.337  -70.604 1.00 120.57 ? 232 DT  J C6    1 
ATOM   4745  P  P     . DG  B  1 87  ? -64.195 12.689  -72.794 1.00 145.09 ? 233 DG  J P     1 
ATOM   4746  O  OP1   . DG  B  1 87  ? -64.826 11.874  -73.857 1.00 142.49 ? 233 DG  J OP1   1 
ATOM   4747  O  OP2   . DG  B  1 87  ? -64.926 13.839  -72.214 1.00 131.69 ? 233 DG  J OP2   1 
ATOM   4748  O  "O5'" . DG  B  1 87  ? -63.766 11.722  -71.594 1.00 132.61 ? 233 DG  J "O5'" 1 
ATOM   4749  C  "C5'" . DG  B  1 87  ? -62.928 10.600  -71.854 1.00 127.01 ? 233 DG  J "C5'" 1 
ATOM   4750  C  "C4'" . DG  B  1 87  ? -62.330 10.055  -70.568 1.00 124.60 ? 233 DG  J "C4'" 1 
ATOM   4751  O  "O4'" . DG  B  1 87  ? -61.378 11.010  -70.021 1.00 124.53 ? 233 DG  J "O4'" 1 
ATOM   4752  C  "C3'" . DG  B  1 87  ? -63.334 9.779   -69.446 1.00 123.34 ? 233 DG  J "C3'" 1 
ATOM   4753  O  "O3'" . DG  B  1 87  ? -62.950 8.607   -68.751 1.00 120.68 ? 233 DG  J "O3'" 1 
ATOM   4754  C  "C2'" . DG  B  1 87  ? -63.185 11.011  -68.561 1.00 125.87 ? 233 DG  J "C2'" 1 
ATOM   4755  C  "C1'" . DG  B  1 87  ? -61.689 11.235  -68.665 1.00 124.35 ? 233 DG  J "C1'" 1 
ATOM   4756  N  N9    . DG  B  1 87  ? -61.265 12.580  -68.294 1.00 124.16 ? 233 DG  J N9    1 
ATOM   4757  C  C8    . DG  B  1 87  ? -61.939 13.758  -68.518 1.00 127.08 ? 233 DG  J C8    1 
ATOM   4758  N  N7    . DG  B  1 87  ? -61.310 14.810  -68.069 1.00 119.04 ? 233 DG  J N7    1 
ATOM   4759  C  C5    . DG  B  1 87  ? -60.147 14.294  -67.509 1.00 122.40 ? 233 DG  J C5    1 
ATOM   4760  C  C6    . DG  B  1 87  ? -59.073 14.955  -66.867 1.00 117.48 ? 233 DG  J C6    1 
ATOM   4761  O  O6    . DG  B  1 87  ? -58.934 16.169  -66.660 1.00 114.70 ? 233 DG  J O6    1 
ATOM   4762  N  N1    . DG  B  1 87  ? -58.092 14.056  -66.447 1.00 117.20 ? 233 DG  J N1    1 
ATOM   4763  C  C2    . DG  B  1 87  ? -58.144 12.691  -66.625 1.00 117.12 ? 233 DG  J C2    1 
ATOM   4764  N  N2    . DG  B  1 87  ? -57.105 11.988  -66.150 1.00 110.81 ? 233 DG  J N2    1 
ATOM   4765  N  N3    . DG  B  1 87  ? -59.145 12.061  -67.227 1.00 118.56 ? 233 DG  J N3    1 
ATOM   4766  C  C4    . DG  B  1 87  ? -60.107 12.922  -67.640 1.00 122.26 ? 233 DG  J C4    1 
ATOM   4767  P  P     . DC  B  1 88  ? -64.011 7.802   -67.852 1.00 122.62 ? 234 DC  J P     1 
ATOM   4768  O  OP1   . DC  B  1 88  ? -64.831 6.979   -68.767 1.00 124.59 ? 234 DC  J OP1   1 
ATOM   4769  O  OP2   . DC  B  1 88  ? -64.665 8.759   -66.930 1.00 116.26 ? 234 DC  J OP2   1 
ATOM   4770  O  "O5'" . DC  B  1 88  ? -63.091 6.835   -66.969 1.00 125.26 ? 234 DC  J "O5'" 1 
ATOM   4771  C  "C5'" . DC  B  1 88  ? -61.858 6.350   -67.494 1.00 118.40 ? 234 DC  J "C5'" 1 
ATOM   4772  C  "C4'" . DC  B  1 88  ? -60.738 6.505   -66.478 1.00 122.11 ? 234 DC  J "C4'" 1 
ATOM   4773  O  "O4'" . DC  B  1 88  ? -60.418 7.914   -66.312 1.00 125.13 ? 234 DC  J "O4'" 1 
ATOM   4774  C  "C3'" . DC  B  1 88  ? -61.058 5.972   -65.081 1.00 117.64 ? 234 DC  J "C3'" 1 
ATOM   4775  O  "O3'" . DC  B  1 88  ? -59.932 5.283   -64.553 1.00 119.13 ? 234 DC  J "O3'" 1 
ATOM   4776  C  "C2'" . DC  B  1 88  ? -61.362 7.240   -64.286 1.00 117.40 ? 234 DC  J "C2'" 1 
ATOM   4777  C  "C1'" . DC  B  1 88  ? -60.425 8.241   -64.941 1.00 120.35 ? 234 DC  J "C1'" 1 
ATOM   4778  N  N1    . DC  B  1 88  ? -60.870 9.658   -64.793 1.00 119.44 ? 234 DC  J N1    1 
ATOM   4779  C  C2    . DC  B  1 88  ? -59.925 10.662  -64.545 1.00 119.69 ? 234 DC  J C2    1 
ATOM   4780  O  O2    . DC  B  1 88  ? -58.728 10.359  -64.458 1.00 117.73 ? 234 DC  J O2    1 
ATOM   4781  N  N3    . DC  B  1 88  ? -60.350 11.943  -64.411 1.00 116.41 ? 234 DC  J N3    1 
ATOM   4782  C  C4    . DC  B  1 88  ? -61.649 12.230  -64.513 1.00 117.21 ? 234 DC  J C4    1 
ATOM   4783  N  N4    . DC  B  1 88  ? -62.021 13.508  -64.374 1.00 113.76 ? 234 DC  J N4    1 
ATOM   4784  C  C5    . DC  B  1 88  ? -62.625 11.221  -64.761 1.00 119.81 ? 234 DC  J C5    1 
ATOM   4785  C  C6    . DC  B  1 88  ? -62.196 9.962   -64.892 1.00 119.73 ? 234 DC  J C6    1 
ATOM   4786  P  P     . DC  B  1 89  ? -60.143 4.054   -63.542 1.00 123.66 ? 235 DC  J P     1 
ATOM   4787  O  OP1   . DC  B  1 89  ? -59.577 2.842   -64.175 1.00 117.69 ? 235 DC  J OP1   1 
ATOM   4788  O  OP2   . DC  B  1 89  ? -61.560 4.077   -63.113 1.00 124.07 ? 235 DC  J OP2   1 
ATOM   4789  O  "O5'" . DC  B  1 89  ? -59.262 4.445   -62.265 1.00 128.09 ? 235 DC  J "O5'" 1 
ATOM   4790  C  "C5'" . DC  B  1 89  ? -57.886 4.789   -62.414 1.00 118.52 ? 235 DC  J "C5'" 1 
ATOM   4791  C  "C4'" . DC  B  1 89  ? -57.380 5.541   -61.191 1.00 110.08 ? 235 DC  J "C4'" 1 
ATOM   4792  O  "O4'" . DC  B  1 89  ? -57.878 6.905   -61.215 1.00 111.34 ? 235 DC  J "O4'" 1 
ATOM   4793  C  "C3'" . DC  B  1 89  ? -57.816 4.967   -59.842 1.00 111.74 ? 235 DC  J "C3'" 1 
ATOM   4794  O  "O3'" . DC  B  1 89  ? -56.799 5.187   -58.882 1.00 108.31 ? 235 DC  J "O3'" 1 
ATOM   4795  C  "C2'" . DC  B  1 89  ? -59.052 5.801   -59.519 1.00 114.46 ? 235 DC  J "C2'" 1 
ATOM   4796  C  "C1'" . DC  B  1 89  ? -58.610 7.162   -60.032 1.00 114.27 ? 235 DC  J "C1'" 1 
ATOM   4797  N  N1    . DC  B  1 89  ? -59.733 8.076   -60.365 1.00 119.22 ? 235 DC  J N1    1 
ATOM   4798  C  C2    . DC  B  1 89  ? -59.553 9.458   -60.246 1.00 120.62 ? 235 DC  J C2    1 
ATOM   4799  O  O2    . DC  B  1 89  ? -58.461 9.892   -59.859 1.00 112.74 ? 235 DC  J O2    1 
ATOM   4800  N  N3    . DC  B  1 89  ? -60.583 10.283  -60.559 1.00 122.11 ? 235 DC  J N3    1 
ATOM   4801  C  C4    . DC  B  1 89  ? -61.744 9.774   -60.974 1.00 118.91 ? 235 DC  J C4    1 
ATOM   4802  N  N4    . DC  B  1 89  ? -62.729 10.628  -61.270 1.00 117.30 ? 235 DC  J N4    1 
ATOM   4803  C  C5    . DC  B  1 89  ? -61.947 8.368   -61.101 1.00 119.37 ? 235 DC  J C5    1 
ATOM   4804  C  C6    . DC  B  1 89  ? -60.924 7.563   -60.791 1.00 120.62 ? 235 DC  J C6    1 
ATOM   4805  P  P     . DT  B  1 90  ? -55.774 4.016   -58.483 1.00 113.20 ? 236 DT  J P     1 
ATOM   4806  O  OP1   . DT  B  1 90  ? -55.137 3.516   -59.722 1.00 106.07 ? 236 DT  J OP1   1 
ATOM   4807  O  OP2   . DT  B  1 90  ? -56.486 3.082   -57.582 1.00 114.29 ? 236 DT  J OP2   1 
ATOM   4808  O  "O5'" . DT  B  1 90  ? -54.664 4.778   -57.622 1.00 106.25 ? 236 DT  J "O5'" 1 
ATOM   4809  C  "C5'" . DT  B  1 90  ? -53.943 5.857   -58.201 1.00 103.57 ? 236 DT  J "C5'" 1 
ATOM   4810  C  "C4'" . DT  B  1 90  ? -54.114 7.130   -57.387 1.00 102.70 ? 236 DT  J "C4'" 1 
ATOM   4811  O  "O4'" . DT  B  1 90  ? -55.488 7.592   -57.465 1.00 100.28 ? 236 DT  J "O4'" 1 
ATOM   4812  C  "C3'" . DT  B  1 90  ? -53.787 7.006   -55.893 1.00 99.22  ? 236 DT  J "C3'" 1 
ATOM   4813  O  "O3'" . DT  B  1 90  ? -52.883 8.030   -55.518 1.00 92.07  ? 236 DT  J "O3'" 1 
ATOM   4814  C  "C2'" . DT  B  1 90  ? -55.144 7.182   -55.209 1.00 96.31  ? 236 DT  J "C2'" 1 
ATOM   4815  C  "C1'" . DT  B  1 90  ? -55.873 8.068   -56.201 1.00 101.05 ? 236 DT  J "C1'" 1 
ATOM   4816  N  N1    . DT  B  1 90  ? -57.355 7.985   -56.086 1.00 111.07 ? 236 DT  J N1    1 
ATOM   4817  C  C2    . DT  B  1 90  ? -58.084 9.142   -55.944 1.00 108.43 ? 236 DT  J C2    1 
ATOM   4818  O  O2    . DT  B  1 90  ? -57.581 10.250  -55.916 1.00 107.45 ? 236 DT  J O2    1 
ATOM   4819  N  N3    . DT  B  1 90  ? -59.436 8.956   -55.841 1.00 114.40 ? 236 DT  J N3    1 
ATOM   4820  C  C4    . DT  B  1 90  ? -60.117 7.753   -55.861 1.00 118.40 ? 236 DT  J C4    1 
ATOM   4821  O  O4    . DT  B  1 90  ? -61.338 7.690   -55.760 1.00 123.44 ? 236 DT  J O4    1 
ATOM   4822  C  C5    . DT  B  1 90  ? -59.291 6.577   -56.007 1.00 113.64 ? 236 DT  J C5    1 
ATOM   4823  C  C7    . DT  B  1 90  ? -59.915 5.214   -56.040 1.00 119.31 ? 236 DT  J C7    1 
ATOM   4824  C  C6    . DT  B  1 90  ? -57.966 6.749   -56.109 1.00 112.05 ? 236 DT  J C6    1 
ATOM   4825  P  P     . DT  B  1 91  ? -52.115 7.969   -54.110 1.00 84.80  ? 237 DT  J P     1 
ATOM   4826  O  OP1   . DT  B  1 91  ? -50.672 7.891   -54.422 1.00 87.49  ? 237 DT  J OP1   1 
ATOM   4827  O  OP2   . DT  B  1 91  ? -52.729 6.920   -53.267 1.00 83.98  ? 237 DT  J OP2   1 
ATOM   4828  O  "O5'" . DT  B  1 91  ? -52.435 9.385   -53.445 1.00 70.44  ? 237 DT  J "O5'" 1 
ATOM   4829  C  "C5'" . DT  B  1 91  ? -52.308 10.568  -54.218 1.00 74.33  ? 237 DT  J "C5'" 1 
ATOM   4830  C  "C4'" . DT  B  1 91  ? -53.159 11.689  -53.649 1.00 73.58  ? 237 DT  J "C4'" 1 
ATOM   4831  O  "O4'" . DT  B  1 91  ? -54.566 11.342  -53.749 1.00 85.69  ? 237 DT  J "O4'" 1 
ATOM   4832  C  "C3'" . DT  B  1 91  ? -52.901 12.028  -52.182 1.00 67.60  ? 237 DT  J "C3'" 1 
ATOM   4833  O  "O3'" . DT  B  1 91  ? -52.894 13.438  -52.023 1.00 70.12  ? 237 DT  J "O3'" 1 
ATOM   4834  C  "C2'" . DT  B  1 91  ? -54.085 11.380  -51.460 1.00 82.91  ? 237 DT  J "C2'" 1 
ATOM   4835  C  "C1'" . DT  B  1 91  ? -55.191 11.516  -52.496 1.00 89.25  ? 237 DT  J "C1'" 1 
ATOM   4836  N  N1    . DT  B  1 91  ? -56.274 10.489  -52.365 1.00 97.08  ? 237 DT  J N1    1 
ATOM   4837  C  C2    . DT  B  1 91  ? -57.592 10.880  -52.462 1.00 103.71 ? 237 DT  J C2    1 
ATOM   4838  O  O2    . DT  B  1 91  ? -57.937 12.035  -52.642 1.00 101.73 ? 237 DT  J O2    1 
ATOM   4839  N  N3    . DT  B  1 91  ? -58.501 9.862   -52.338 1.00 107.07 ? 237 DT  J N3    1 
ATOM   4840  C  C4    . DT  B  1 91  ? -58.232 8.521   -52.134 1.00 105.43 ? 237 DT  J C4    1 
ATOM   4841  O  O4    . DT  B  1 91  ? -59.119 7.681   -52.035 1.00 114.19 ? 237 DT  J O4    1 
ATOM   4842  C  C5    . DT  B  1 91  ? -56.833 8.178   -52.045 1.00 100.34 ? 237 DT  J C5    1 
ATOM   4843  C  C7    . DT  B  1 91  ? -56.420 6.754   -51.822 1.00 93.47  ? 237 DT  J C7    1 
ATOM   4844  C  C6    . DT  B  1 91  ? -55.932 9.166   -52.165 1.00 96.08  ? 237 DT  J C6    1 
ATOM   4845  P  P     . DT  B  1 92  ? -52.415 14.108  -50.644 1.00 68.09  ? 238 DT  J P     1 
ATOM   4846  O  OP1   . DT  B  1 92  ? -51.431 15.164  -50.971 1.00 62.74  ? 238 DT  J OP1   1 
ATOM   4847  O  OP2   . DT  B  1 92  ? -52.057 13.024  -49.700 1.00 65.57  ? 238 DT  J OP2   1 
ATOM   4848  O  "O5'" . DT  B  1 92  ? -53.734 14.823  -50.109 1.00 76.75  ? 238 DT  J "O5'" 1 
ATOM   4849  C  "C5'" . DT  B  1 92  ? -54.911 14.799  -50.897 1.00 79.83  ? 238 DT  J "C5'" 1 
ATOM   4850  C  "C4'" . DT  B  1 92  ? -56.059 15.466  -50.172 1.00 90.51  ? 238 DT  J "C4'" 1 
ATOM   4851  O  "O4'" . DT  B  1 92  ? -57.193 14.565  -50.133 1.00 93.66  ? 238 DT  J "O4'" 1 
ATOM   4852  C  "C3'" . DT  B  1 92  ? -55.779 15.834  -48.726 1.00 91.29  ? 238 DT  J "C3'" 1 
ATOM   4853  O  "O3'" . DT  B  1 92  ? -56.552 16.974  -48.372 1.00 92.29  ? 238 DT  J "O3'" 1 
ATOM   4854  C  "C2'" . DT  B  1 92  ? -56.220 14.579  -47.971 1.00 98.41  ? 238 DT  J "C2'" 1 
ATOM   4855  C  "C1'" . DT  B  1 92  ? -57.383 14.069  -48.823 1.00 98.77  ? 238 DT  J "C1'" 1 
ATOM   4856  N  N1    . DT  B  1 92  ? -57.461 12.581  -48.900 1.00 101.89 ? 238 DT  J N1    1 
ATOM   4857  C  C2    . DT  B  1 92  ? -58.626 11.992  -49.333 1.00 107.44 ? 238 DT  J C2    1 
ATOM   4858  O  O2    . DT  B  1 92  ? -59.615 12.626  -49.656 1.00 107.50 ? 238 DT  J O2    1 
ATOM   4859  N  N3    . DT  B  1 92  ? -58.596 10.624  -49.373 1.00 108.40 ? 238 DT  J N3    1 
ATOM   4860  C  C4    . DT  B  1 92  ? -57.539 9.801   -49.035 1.00 105.61 ? 238 DT  J C4    1 
ATOM   4861  O  O4    . DT  B  1 92  ? -57.611 8.578   -49.102 1.00 100.97 ? 238 DT  J O4    1 
ATOM   4862  C  C5    . DT  B  1 92  ? -56.345 10.482  -48.591 1.00 105.37 ? 238 DT  J C5    1 
ATOM   4863  C  C7    . DT  B  1 92  ? -55.132 9.695   -48.193 1.00 98.94  ? 238 DT  J C7    1 
ATOM   4864  C  C6    . DT  B  1 92  ? -56.363 11.824  -48.547 1.00 102.36 ? 238 DT  J C6    1 
ATOM   4865  P  P     . DT  B  1 93  ? -56.330 17.725  -46.969 1.00 88.60  ? 239 DT  J P     1 
ATOM   4866  O  OP1   . DT  B  1 93  ? -55.976 19.129  -47.271 1.00 86.98  ? 239 DT  J OP1   1 
ATOM   4867  O  OP2   . DT  B  1 93  ? -55.427 16.920  -46.119 1.00 91.96  ? 239 DT  J OP2   1 
ATOM   4868  O  "O5'" . DT  B  1 93  ? -57.786 17.690  -46.307 1.00 109.40 ? 239 DT  J "O5'" 1 
ATOM   4869  C  "C5'" . DT  B  1 93  ? -58.859 17.039  -46.992 1.00 102.50 ? 239 DT  J "C5'" 1 
ATOM   4870  C  "C4'" . DT  B  1 93  ? -59.861 16.459  -46.011 1.00 106.95 ? 239 DT  J "C4'" 1 
ATOM   4871  O  "O4'" . DT  B  1 93  ? -59.998 15.026  -46.241 1.00 108.17 ? 239 DT  J "O4'" 1 
ATOM   4872  C  "C3'" . DT  B  1 93  ? -59.477 16.594  -44.536 1.00 118.42 ? 239 DT  J "C3'" 1 
ATOM   4873  O  "O3'" . DT  B  1 93  ? -60.652 16.673  -43.752 1.00 123.13 ? 239 DT  J "O3'" 1 
ATOM   4874  C  "C2'" . DT  B  1 93  ? -58.771 15.273  -44.287 1.00 119.52 ? 239 DT  J "C2'" 1 
ATOM   4875  C  "C1'" . DT  B  1 93  ? -59.718 14.353  -45.033 1.00 115.12 ? 239 DT  J "C1'" 1 
ATOM   4876  N  N1    . DT  B  1 93  ? -59.162 13.007  -45.326 1.00 114.85 ? 239 DT  J N1    1 
ATOM   4877  C  C2    . DT  B  1 93  ? -59.972 12.067  -45.913 1.00 115.17 ? 239 DT  J C2    1 
ATOM   4878  O  O2    . DT  B  1 93  ? -61.126 12.287  -46.226 1.00 118.54 ? 239 DT  J O2    1 
ATOM   4879  N  N3    . DT  B  1 93  ? -59.377 10.855  -46.131 1.00 114.71 ? 239 DT  J N3    1 
ATOM   4880  C  C4    . DT  B  1 93  ? -58.080 10.494  -45.818 1.00 116.88 ? 239 DT  J C4    1 
ATOM   4881  O  O4    . DT  B  1 93  ? -57.637 9.374   -46.053 1.00 119.97 ? 239 DT  J O4    1 
ATOM   4882  C  C5    . DT  B  1 93  ? -57.285 11.526  -45.197 1.00 112.41 ? 239 DT  J C5    1 
ATOM   4883  C  C7    . DT  B  1 93  ? -55.861 11.253  -44.813 1.00 112.99 ? 239 DT  J C7    1 
ATOM   4884  C  C6    . DT  B  1 93  ? -57.858 12.718  -44.980 1.00 111.89 ? 239 DT  J C6    1 
ATOM   4885  P  P     . DG  B  1 94  ? -61.070 18.038  -43.018 1.00 139.05 ? 240 DG  J P     1 
ATOM   4886  O  OP1   . DG  B  1 94  ? -60.945 19.146  -43.993 1.00 126.20 ? 240 DG  J OP1   1 
ATOM   4887  O  OP2   . DG  B  1 94  ? -60.341 18.106  -41.731 1.00 134.30 ? 240 DG  J OP2   1 
ATOM   4888  O  "O5'" . DG  B  1 94  ? -62.617 17.803  -42.686 1.00 137.17 ? 240 DG  J "O5'" 1 
ATOM   4889  C  "C5'" . DG  B  1 94  ? -63.257 16.599  -43.118 1.00 127.42 ? 240 DG  J "C5'" 1 
ATOM   4890  C  "C4'" . DG  B  1 94  ? -63.468 15.646  -41.952 1.00 132.41 ? 240 DG  J "C4'" 1 
ATOM   4891  O  "O4'" . DG  B  1 94  ? -62.924 14.343  -42.283 1.00 127.55 ? 240 DG  J "O4'" 1 
ATOM   4892  C  "C3'" . DG  B  1 94  ? -62.802 16.071  -40.638 1.00 137.12 ? 240 DG  J "C3'" 1 
ATOM   4893  O  "O3'" . DG  B  1 94  ? -63.755 16.075  -39.583 1.00 147.06 ? 240 DG  J "O3'" 1 
ATOM   4894  C  "C2'" . DG  B  1 94  ? -61.714 15.018  -40.411 1.00 134.75 ? 240 DG  J "C2'" 1 
ATOM   4895  C  "C1'" . DG  B  1 94  ? -62.271 13.817  -41.154 1.00 131.04 ? 240 DG  J "C1'" 1 
ATOM   4896  N  N9    . DG  B  1 94  ? -61.237 12.893  -41.606 1.00 126.57 ? 240 DG  J N9    1 
ATOM   4897  C  C8    . DG  B  1 94  ? -59.897 13.159  -41.748 1.00 125.57 ? 240 DG  J C8    1 
ATOM   4898  N  N7    . DG  B  1 94  ? -59.205 12.138  -42.171 1.00 121.86 ? 240 DG  J N7    1 
ATOM   4899  C  C5    . DG  B  1 94  ? -60.147 11.129  -42.318 1.00 126.37 ? 240 DG  J C5    1 
ATOM   4900  C  C6    . DG  B  1 94  ? -59.987 9.790   -42.747 1.00 130.11 ? 240 DG  J C6    1 
ATOM   4901  O  O6    . DG  B  1 94  ? -58.946 9.215   -43.095 1.00 130.48 ? 240 DG  J O6    1 
ATOM   4902  N  N1    . DG  B  1 94  ? -61.201 9.102   -42.752 1.00 132.61 ? 240 DG  J N1    1 
ATOM   4903  C  C2    . DG  B  1 94  ? -62.413 9.642   -42.387 1.00 133.08 ? 240 DG  J C2    1 
ATOM   4904  N  N2    . DG  B  1 94  ? -63.475 8.824   -42.456 1.00 131.81 ? 240 DG  J N2    1 
ATOM   4905  N  N3    . DG  B  1 94  ? -62.575 10.896  -41.982 1.00 131.66 ? 240 DG  J N3    1 
ATOM   4906  C  C4    . DG  B  1 94  ? -61.404 11.578  -41.973 1.00 129.09 ? 240 DG  J C4    1 
ATOM   4907  P  P     . DA  B  1 95  ? -63.327 16.559  -38.111 1.00 160.69 ? 241 DA  J P     1 
ATOM   4908  O  OP1   . DA  B  1 95  ? -64.504 17.211  -37.495 1.00 151.13 ? 241 DA  J OP1   1 
ATOM   4909  O  OP2   . DA  B  1 95  ? -62.048 17.297  -38.221 1.00 152.64 ? 241 DA  J OP2   1 
ATOM   4910  O  "O5'" . DA  B  1 95  ? -63.020 15.197  -37.334 1.00 147.88 ? 241 DA  J "O5'" 1 
ATOM   4911  C  "C5'" . DA  B  1 95  ? -63.836 14.806  -36.245 1.00 143.56 ? 241 DA  J "C5'" 1 
ATOM   4912  C  "C4'" . DA  B  1 95  ? -64.620 13.553  -36.585 1.00 146.77 ? 241 DA  J "C4'" 1 
ATOM   4913  O  "O4'" . DA  B  1 95  ? -63.904 12.793  -37.598 1.00 145.47 ? 241 DA  J "O4'" 1 
ATOM   4914  C  "C3'" . DA  B  1 95  ? -64.824 12.595  -35.419 1.00 148.97 ? 241 DA  J "C3'" 1 
ATOM   4915  O  "O3'" . DA  B  1 95  ? -66.059 11.907  -35.569 1.00 151.72 ? 241 DA  J "O3'" 1 
ATOM   4916  C  "C2'" . DA  B  1 95  ? -63.636 11.653  -35.566 1.00 144.32 ? 241 DA  J "C2'" 1 
ATOM   4917  C  "C1'" . DA  B  1 95  ? -63.547 11.526  -37.080 1.00 141.71 ? 241 DA  J "C1'" 1 
ATOM   4918  N  N9    . DA  B  1 95  ? -62.209 11.185  -37.558 1.00 137.14 ? 241 DA  J N9    1 
ATOM   4919  C  C8    . DA  B  1 95  ? -61.061 11.906  -37.381 1.00 136.54 ? 241 DA  J C8    1 
ATOM   4920  N  N7    . DA  B  1 95  ? -60.000 11.355  -37.922 1.00 133.35 ? 241 DA  J N7    1 
ATOM   4921  C  C5    . DA  B  1 95  ? -60.486 10.191  -38.494 1.00 132.86 ? 241 DA  J C5    1 
ATOM   4922  C  C6    . DA  B  1 95  ? -59.862 9.160   -39.222 1.00 131.77 ? 241 DA  J C6    1 
ATOM   4923  N  N6    . DA  B  1 95  ? -58.556 9.148   -39.505 1.00 127.97 ? 241 DA  J N6    1 
ATOM   4924  N  N1    . DA  B  1 95  ? -60.636 8.139   -39.651 1.00 132.56 ? 241 DA  J N1    1 
ATOM   4925  C  C2    . DA  B  1 95  ? -61.944 8.157   -39.366 1.00 131.21 ? 241 DA  J C2    1 
ATOM   4926  N  N3    . DA  B  1 95  ? -62.642 9.070   -38.692 1.00 132.19 ? 241 DA  J N3    1 
ATOM   4927  C  C4    . DA  B  1 95  ? -61.846 10.070  -38.279 1.00 133.11 ? 241 DA  J C4    1 
ATOM   4928  P  P     . DT  B  1 96  ? -66.715 11.132  -34.323 1.00 157.53 ? 242 DT  J P     1 
ATOM   4929  O  OP1   . DT  B  1 96  ? -68.012 11.786  -34.035 1.00 155.66 ? 242 DT  J OP1   1 
ATOM   4930  O  OP2   . DT  B  1 96  ? -65.697 11.023  -33.252 1.00 142.90 ? 242 DT  J OP2   1 
ATOM   4931  O  "O5'" . DT  B  1 96  ? -66.994 9.664   -34.896 1.00 150.61 ? 242 DT  J "O5'" 1 
ATOM   4932  C  "C5'" . DT  B  1 96  ? -66.053 9.059   -35.775 1.00 143.91 ? 242 DT  J "C5'" 1 
ATOM   4933  C  "C4'" . DT  B  1 96  ? -65.496 7.781   -35.177 1.00 142.60 ? 242 DT  J "C4'" 1 
ATOM   4934  O  "O4'" . DT  B  1 96  ? -64.144 7.570   -35.660 1.00 145.42 ? 242 DT  J "O4'" 1 
ATOM   4935  C  "C3'" . DT  B  1 96  ? -65.429 7.756   -33.650 1.00 144.85 ? 242 DT  J "C3'" 1 
ATOM   4936  O  "O3'" . DT  B  1 96  ? -66.013 6.549   -33.174 1.00 149.91 ? 242 DT  J "O3'" 1 
ATOM   4937  C  "C2'" . DT  B  1 96  ? -63.930 7.841   -33.337 1.00 142.59 ? 242 DT  J "C2'" 1 
ATOM   4938  C  "C1'" . DT  B  1 96  ? -63.285 7.261   -34.587 1.00 141.53 ? 242 DT  J "C1'" 1 
ATOM   4939  N  N1    . DT  B  1 96  ? -61.941 7.852   -34.884 1.00 138.64 ? 242 DT  J N1    1 
ATOM   4940  C  C2    . DT  B  1 96  ? -61.065 7.168   -35.694 1.00 133.29 ? 242 DT  J C2    1 
ATOM   4941  O  O2    . DT  B  1 96  ? -61.320 6.086   -36.192 1.00 129.79 ? 242 DT  J O2    1 
ATOM   4942  N  N3    . DT  B  1 96  ? -59.867 7.802   -35.905 1.00 130.61 ? 242 DT  J N3    1 
ATOM   4943  C  C4    . DT  B  1 96  ? -59.467 9.027   -35.398 1.00 130.42 ? 242 DT  J C4    1 
ATOM   4944  O  O4    . DT  B  1 96  ? -58.366 9.512   -35.642 1.00 128.45 ? 242 DT  J O4    1 
ATOM   4945  C  C5    . DT  B  1 96  ? -60.432 9.690   -34.555 1.00 133.24 ? 242 DT  J C5    1 
ATOM   4946  C  C7    . DT  B  1 96  ? -60.112 11.024  -33.945 1.00 129.88 ? 242 DT  J C7    1 
ATOM   4947  C  C6    . DT  B  1 96  ? -61.608 9.079   -34.342 1.00 137.00 ? 242 DT  J C6    1 
ATOM   4948  P  P     . DG  B  1 97  ? -66.149 6.244   -31.601 1.00 162.05 ? 243 DG  J P     1 
ATOM   4949  O  OP1   . DG  B  1 97  ? -67.568 5.917   -31.338 1.00 158.20 ? 243 DG  J OP1   1 
ATOM   4950  O  OP2   . DG  B  1 97  ? -65.496 7.313   -30.810 1.00 148.60 ? 243 DG  J OP2   1 
ATOM   4951  O  "O5'" . DG  B  1 97  ? -65.299 4.907   -31.435 1.00 147.21 ? 243 DG  J "O5'" 1 
ATOM   4952  C  "C5'" . DG  B  1 97  ? -65.262 3.971   -32.505 1.00 140.71 ? 243 DG  J "C5'" 1 
ATOM   4953  C  "C4'" . DG  B  1 97  ? -64.095 3.023   -32.340 1.00 133.17 ? 243 DG  J "C4'" 1 
ATOM   4954  O  "O4'" . DG  B  1 97  ? -62.907 3.607   -32.932 1.00 133.89 ? 243 DG  J "O4'" 1 
ATOM   4955  C  "C3'" . DG  B  1 97  ? -63.746 2.700   -30.890 1.00 128.35 ? 243 DG  J "C3'" 1 
ATOM   4956  O  "O3'" . DG  B  1 97  ? -63.543 1.306   -30.750 1.00 127.06 ? 243 DG  J "O3'" 1 
ATOM   4957  C  "C2'" . DG  B  1 97  ? -62.467 3.502   -30.636 1.00 126.64 ? 243 DG  J "C2'" 1 
ATOM   4958  C  "C1'" . DG  B  1 97  ? -61.838 3.550   -32.018 1.00 128.83 ? 243 DG  J "C1'" 1 
ATOM   4959  N  N9    . DG  B  1 97  ? -60.994 4.721   -32.226 1.00 127.63 ? 243 DG  J N9    1 
ATOM   4960  C  C8    . DG  B  1 97  ? -61.196 5.987   -31.727 1.00 129.87 ? 243 DG  J C8    1 
ATOM   4961  N  N7    . DG  B  1 97  ? -60.272 6.838   -32.079 1.00 126.84 ? 243 DG  J N7    1 
ATOM   4962  C  C5    . DG  B  1 97  ? -59.402 6.089   -32.862 1.00 125.53 ? 243 DG  J C5    1 
ATOM   4963  C  C6    . DG  B  1 97  ? -58.213 6.473   -33.526 1.00 121.06 ? 243 DG  J C6    1 
ATOM   4964  O  O6    . DG  B  1 97  ? -57.671 7.588   -33.547 1.00 120.33 ? 243 DG  J O6    1 
ATOM   4965  N  N1    . DG  B  1 97  ? -57.636 5.404   -34.208 1.00 121.16 ? 243 DG  J N1    1 
ATOM   4966  C  C2    . DG  B  1 97  ? -58.147 4.126   -34.248 1.00 121.94 ? 243 DG  J C2    1 
ATOM   4967  N  N2    . DG  B  1 97  ? -57.450 3.226   -34.958 1.00 119.09 ? 243 DG  J N2    1 
ATOM   4968  N  N3    . DG  B  1 97  ? -59.261 3.754   -33.632 1.00 123.13 ? 243 DG  J N3    1 
ATOM   4969  C  C4    . DG  B  1 97  ? -59.834 4.784   -32.962 1.00 125.27 ? 243 DG  J C4    1 
ATOM   4970  P  P     . DG  B  1 98  ? -63.071 0.680   -29.348 1.00 137.20 ? 244 DG  J P     1 
ATOM   4971  O  OP1   . DG  B  1 98  ? -63.788 -0.604  -29.182 1.00 134.61 ? 244 DG  J OP1   1 
ATOM   4972  O  OP2   . DG  B  1 98  ? -63.169 1.708   -28.287 1.00 125.45 ? 244 DG  J OP2   1 
ATOM   4973  O  "O5'" . DG  B  1 98  ? -61.533 0.348   -29.608 1.00 127.07 ? 244 DG  J "O5'" 1 
ATOM   4974  C  "C5'" . DG  B  1 98  ? -61.165 -0.355  -30.787 1.00 118.56 ? 244 DG  J "C5'" 1 
ATOM   4975  C  "C4'" . DG  B  1 98  ? -59.660 -0.484  -30.895 1.00 110.93 ? 244 DG  J "C4'" 1 
ATOM   4976  O  "O4'" . DG  B  1 98  ? -59.078 0.808   -31.218 1.00 116.78 ? 244 DG  J "O4'" 1 
ATOM   4977  C  "C3'" . DG  B  1 98  ? -58.960 -0.953  -29.623 1.00 106.22 ? 244 DG  J "C3'" 1 
ATOM   4978  O  "O3'" . DG  B  1 98  ? -57.881 -1.786  -29.976 1.00 104.15 ? 244 DG  J "O3'" 1 
ATOM   4979  C  "C2'" . DG  B  1 98  ? -58.469 0.357   -29.014 1.00 112.57 ? 244 DG  J "C2'" 1 
ATOM   4980  C  "C1'" . DG  B  1 98  ? -58.079 1.116   -30.271 1.00 115.87 ? 244 DG  J "C1'" 1 
ATOM   4981  N  N9    . DG  B  1 98  ? -58.020 2.568   -30.110 1.00 111.73 ? 244 DG  J N9    1 
ATOM   4982  C  C8    . DG  B  1 98  ? -58.794 3.350   -29.285 1.00 113.51 ? 244 DG  J C8    1 
ATOM   4983  N  N7    . DG  B  1 98  ? -58.513 4.623   -29.362 1.00 109.89 ? 244 DG  J N7    1 
ATOM   4984  C  C5    . DG  B  1 98  ? -57.493 4.688   -30.304 1.00 115.88 ? 244 DG  J C5    1 
ATOM   4985  C  C6    . DG  B  1 98  ? -56.779 5.804   -30.801 1.00 112.51 ? 244 DG  J C6    1 
ATOM   4986  O  O6    . DG  B  1 98  ? -56.918 6.997   -30.505 1.00 114.66 ? 244 DG  J O6    1 
ATOM   4987  N  N1    . DG  B  1 98  ? -55.824 5.427   -31.743 1.00 109.29 ? 244 DG  J N1    1 
ATOM   4988  C  C2    . DG  B  1 98  ? -55.586 4.133   -32.148 1.00 110.94 ? 244 DG  J C2    1 
ATOM   4989  N  N2    . DG  B  1 98  ? -54.624 3.964   -33.066 1.00 108.30 ? 244 DG  J N2    1 
ATOM   4990  N  N3    . DG  B  1 98  ? -56.245 3.079   -31.688 1.00 112.88 ? 244 DG  J N3    1 
ATOM   4991  C  C4    . DG  B  1 98  ? -57.179 3.430   -30.771 1.00 116.06 ? 244 DG  J C4    1 
ATOM   4992  P  P     . DA  B  1 99  ? -57.434 -2.998  -29.023 1.00 112.45 ? 245 DA  J P     1 
ATOM   4993  O  OP1   . DA  B  1 99  ? -57.855 -4.255  -29.682 1.00 98.78  ? 245 DA  J OP1   1 
ATOM   4994  O  OP2   . DA  B  1 99  ? -57.888 -2.694  -27.648 1.00 103.64 ? 245 DA  J OP2   1 
ATOM   4995  O  "O5'" . DA  B  1 99  ? -55.836 -2.900  -29.045 1.00 120.76 ? 245 DA  J "O5'" 1 
ATOM   4996  C  "C5'" . DA  B  1 99  ? -55.172 -2.428  -30.220 1.00 111.37 ? 245 DA  J "C5'" 1 
ATOM   4997  C  "C4'" . DA  B  1 99  ? -54.027 -1.491  -29.866 1.00 104.38 ? 245 DA  J "C4'" 1 
ATOM   4998  O  "O4'" . DA  B  1 99  ? -54.514 -0.126  -29.734 1.00 101.02 ? 245 DA  J "O4'" 1 
ATOM   4999  C  "C3'" . DA  B  1 99  ? -53.303 -1.811  -28.553 1.00 103.86 ? 245 DA  J "C3'" 1 
ATOM   5000  O  "O3'" . DA  B  1 99  ? -51.910 -1.772  -28.763 1.00 101.69 ? 245 DA  J "O3'" 1 
ATOM   5001  C  "C2'" . DA  B  1 99  ? -53.748 -0.680  -27.625 1.00 103.36 ? 245 DA  J "C2'" 1 
ATOM   5002  C  "C1'" . DA  B  1 99  ? -53.891 0.457   -28.617 1.00 102.83 ? 245 DA  J "C1'" 1 
ATOM   5003  N  N9    . DA  B  1 99  ? -54.707 1.570   -28.133 1.00 110.36 ? 245 DA  J N9    1 
ATOM   5004  C  C8    . DA  B  1 99  ? -55.799 1.499   -27.316 1.00 110.97 ? 245 DA  J C8    1 
ATOM   5005  N  N7    . DA  B  1 99  ? -56.332 2.666   -27.038 1.00 110.53 ? 245 DA  J N7    1 
ATOM   5006  C  C5    . DA  B  1 99  ? -55.529 3.568   -27.715 1.00 111.20 ? 245 DA  J C5    1 
ATOM   5007  C  C6    . DA  B  1 99  ? -55.562 4.973   -27.825 1.00 108.72 ? 245 DA  J C6    1 
ATOM   5008  N  N6    . DA  B  1 99  ? -56.481 5.738   -27.227 1.00 109.44 ? 245 DA  J N6    1 
ATOM   5009  N  N1    . DA  B  1 99  ? -54.614 5.562   -28.582 1.00 105.75 ? 245 DA  J N1    1 
ATOM   5010  C  C2    . DA  B  1 99  ? -53.698 4.794   -29.183 1.00 107.64 ? 245 DA  J C2    1 
ATOM   5011  N  N3    . DA  B  1 99  ? -53.564 3.469   -29.153 1.00 109.01 ? 245 DA  J N3    1 
ATOM   5012  C  C4    . DA  B  1 99  ? -54.520 2.911   -28.394 1.00 111.17 ? 245 DA  J C4    1 
ATOM   5013  P  P     . DG  B  1 100 ? -51.096 -3.120  -29.065 1.00 97.06  ? 246 DG  J P     1 
ATOM   5014  O  OP1   . DG  B  1 100 ? -51.889 -3.920  -30.024 1.00 98.41  ? 246 DG  J OP1   1 
ATOM   5015  O  OP2   . DG  B  1 100 ? -50.700 -3.696  -27.761 1.00 103.90 ? 246 DG  J OP2   1 
ATOM   5016  O  "O5'" . DG  B  1 100 ? -49.769 -2.604  -29.792 1.00 99.56  ? 246 DG  J "O5'" 1 
ATOM   5017  C  "C5'" . DG  B  1 100 ? -49.868 -1.801  -30.964 1.00 95.47  ? 246 DG  J "C5'" 1 
ATOM   5018  C  "C4'" . DG  B  1 100 ? -48.865 -0.655  -30.939 1.00 95.47  ? 246 DG  J "C4'" 1 
ATOM   5019  O  "O4'" . DG  B  1 100 ? -49.427 0.482   -30.233 1.00 96.51  ? 246 DG  J "O4'" 1 
ATOM   5020  C  "C3'" . DG  B  1 100 ? -47.540 -0.951  -30.250 1.00 95.73  ? 246 DG  J "C3'" 1 
ATOM   5021  O  "O3'" . DG  B  1 100 ? -46.505 -0.192  -30.867 1.00 92.10  ? 246 DG  J "O3'" 1 
ATOM   5022  C  "C2'" . DG  B  1 100 ? -47.802 -0.484  -28.820 1.00 100.47 ? 246 DG  J "C2'" 1 
ATOM   5023  C  "C1'" . DG  B  1 100 ? -48.691 0.734   -29.049 1.00 99.47  ? 246 DG  J "C1'" 1 
ATOM   5024  N  N9    . DG  B  1 100 ? -49.646 0.979   -27.973 1.00 102.76 ? 246 DG  J N9    1 
ATOM   5025  C  C8    . DG  B  1 100 ? -50.199 0.049   -27.123 1.00 106.85 ? 246 DG  J C8    1 
ATOM   5026  N  N7    . DG  B  1 100 ? -51.040 0.562   -26.268 1.00 108.50 ? 246 DG  J N7    1 
ATOM   5027  C  C5    . DG  B  1 100 ? -51.049 1.918   -26.574 1.00 109.30 ? 246 DG  J C5    1 
ATOM   5028  C  C6    . DG  B  1 100 ? -51.771 2.982   -25.984 1.00 110.73 ? 246 DG  J C6    1 
ATOM   5029  O  O6    . DG  B  1 100 ? -52.576 2.936   -25.045 1.00 112.74 ? 246 DG  J O6    1 
ATOM   5030  N  N1    . DG  B  1 100 ? -51.487 4.200   -26.597 1.00 108.95 ? 246 DG  J N1    1 
ATOM   5031  C  C2    . DG  B  1 100 ? -50.615 4.366   -27.646 1.00 107.70 ? 246 DG  J C2    1 
ATOM   5032  N  N2    . DG  B  1 100 ? -50.470 5.615   -28.107 1.00 109.19 ? 246 DG  J N2    1 
ATOM   5033  N  N3    . DG  B  1 100 ? -49.934 3.378   -28.207 1.00 106.52 ? 246 DG  J N3    1 
ATOM   5034  C  C4    . DG  B  1 100 ? -50.199 2.187   -27.622 1.00 105.50 ? 246 DG  J C4    1 
ATOM   5035  P  P     . DC  B  1 101 ? -45.007 -0.771  -30.953 1.00 96.81  ? 247 DC  J P     1 
ATOM   5036  O  OP1   . DC  B  1 101 ? -44.618 -0.842  -32.379 1.00 97.15  ? 247 DC  J OP1   1 
ATOM   5037  O  OP2   . DC  B  1 101 ? -44.933 -1.974  -30.094 1.00 98.42  ? 247 DC  J OP2   1 
ATOM   5038  O  "O5'" . DC  B  1 101 ? -44.134 0.358   -30.252 1.00 88.32  ? 247 DC  J "O5'" 1 
ATOM   5039  C  "C5'" . DC  B  1 101 ? -44.457 0.757   -28.942 1.00 94.38  ? 247 DC  J "C5'" 1 
ATOM   5040  C  "C4'" . DC  B  1 101 ? -44.468 2.263   -28.830 1.00 85.62  ? 247 DC  J "C4'" 1 
ATOM   5041  O  "O4'" . DC  B  1 101 ? -45.740 2.692   -28.279 1.00 87.00  ? 247 DC  J "O4'" 1 
ATOM   5042  C  "C3'" . DC  B  1 101 ? -43.424 2.816   -27.885 1.00 84.83  ? 247 DC  J "C3'" 1 
ATOM   5043  O  "O3'" . DC  B  1 101 ? -43.146 4.154   -28.218 1.00 79.99  ? 247 DC  J "O3'" 1 
ATOM   5044  C  "C2'" . DC  B  1 101 ? -44.144 2.718   -26.551 1.00 92.83  ? 247 DC  J "C2'" 1 
ATOM   5045  C  "C1'" . DC  B  1 101 ? -45.557 3.129   -26.943 1.00 95.58  ? 247 DC  J "C1'" 1 
ATOM   5046  N  N1    . DC  B  1 101 ? -46.610 2.508   -26.089 1.00 102.20 ? 247 DC  J N1    1 
ATOM   5047  C  C2    . DC  B  1 101 ? -47.582 3.316   -25.484 1.00 107.27 ? 247 DC  J C2    1 
ATOM   5048  O  O2    . DC  B  1 101 ? -47.558 4.538   -25.676 1.00 105.16 ? 247 DC  J O2    1 
ATOM   5049  N  N3    . DC  B  1 101 ? -48.530 2.731   -24.709 1.00 107.91 ? 247 DC  J N3    1 
ATOM   5050  C  C4    . DC  B  1 101 ? -48.524 1.408   -24.530 1.00 109.92 ? 247 DC  J C4    1 
ATOM   5051  N  N4    . DC  B  1 101 ? -49.476 0.877   -23.755 1.00 107.77 ? 247 DC  J N4    1 
ATOM   5052  C  C5    . DC  B  1 101 ? -47.538 0.572   -25.132 1.00 107.17 ? 247 DC  J C5    1 
ATOM   5053  C  C6    . DC  B  1 101 ? -46.610 1.158   -25.894 1.00 102.14 ? 247 DC  J C6    1 
ATOM   5054  P  P     . DA  B  1 102 ? -41.640 4.621   -28.522 1.00 63.90  ? 248 DA  J P     1 
ATOM   5055  O  OP1   . DA  B  1 102 ? -41.171 3.914   -29.731 1.00 68.24  ? 248 DA  J OP1   1 
ATOM   5056  O  OP2   . DA  B  1 102 ? -40.848 4.535   -27.277 1.00 53.89  ? 248 DA  J OP2   1 
ATOM   5057  O  "O5'" . DA  B  1 102 ? -41.817 6.159   -28.888 1.00 76.45  ? 248 DA  J "O5'" 1 
ATOM   5058  C  "C5'" . DA  B  1 102 ? -41.112 7.126   -28.158 1.00 81.34  ? 248 DA  J "C5'" 1 
ATOM   5059  C  "C4'" . DA  B  1 102 ? -42.043 7.968   -27.312 1.00 84.54  ? 248 DA  J "C4'" 1 
ATOM   5060  O  "O4'" . DA  B  1 102 ? -43.017 7.118   -26.649 1.00 87.22  ? 248 DA  J "O4'" 1 
ATOM   5061  C  "C3'" . DA  B  1 102 ? -41.339 8.747   -26.213 1.00 91.21  ? 248 DA  J "C3'" 1 
ATOM   5062  O  "O3'" . DA  B  1 102 ? -41.896 10.034  -26.098 1.00 85.06  ? 248 DA  J "O3'" 1 
ATOM   5063  C  "C2'" . DA  B  1 102 ? -41.591 7.906   -24.967 1.00 94.94  ? 248 DA  J "C2'" 1 
ATOM   5064  C  "C1'" . DA  B  1 102 ? -42.967 7.329   -25.253 1.00 95.22  ? 248 DA  J "C1'" 1 
ATOM   5065  N  N9    . DA  B  1 102 ? -43.204 6.050   -24.592 1.00 99.76  ? 248 DA  J N9    1 
ATOM   5066  C  C8    . DA  B  1 102 ? -42.413 4.937   -24.654 1.00 102.86 ? 248 DA  J C8    1 
ATOM   5067  N  N7    . DA  B  1 102 ? -42.870 3.923   -23.960 1.00 105.23 ? 248 DA  J N7    1 
ATOM   5068  C  C5    . DA  B  1 102 ? -44.048 4.399   -23.412 1.00 106.28 ? 248 DA  J C5    1 
ATOM   5069  C  C6    . DA  B  1 102 ? -45.007 3.807   -22.571 1.00 111.12 ? 248 DA  J C6    1 
ATOM   5070  N  N6    . DA  B  1 102 ? -44.919 2.549   -22.131 1.00 114.81 ? 248 DA  J N6    1 
ATOM   5071  N  N1    . DA  B  1 102 ? -46.062 4.559   -22.200 1.00 112.26 ? 248 DA  J N1    1 
ATOM   5072  C  C2    . DA  B  1 102 ? -46.143 5.818   -22.643 1.00 111.41 ? 248 DA  J C2    1 
ATOM   5073  N  N3    . DA  B  1 102 ? -45.306 6.484   -23.438 1.00 107.83 ? 248 DA  J N3    1 
ATOM   5074  C  C4    . DA  B  1 102 ? -44.268 5.710   -23.788 1.00 102.90 ? 248 DA  J C4    1 
ATOM   5075  P  P     . DG  B  1 103 ? -40.966 11.249  -25.629 1.00 85.70  ? 249 DG  J P     1 
ATOM   5076  O  OP1   . DG  B  1 103 ? -41.204 12.381  -26.553 1.00 100.70 ? 249 DG  J OP1   1 
ATOM   5077  O  OP2   . DG  B  1 103 ? -39.604 10.690  -25.462 1.00 86.01  ? 249 DG  J OP2   1 
ATOM   5078  O  "O5'" . DG  B  1 103 ? -41.515 11.610  -24.169 1.00 102.03 ? 249 DG  J "O5'" 1 
ATOM   5079  C  "C5'" . DG  B  1 103 ? -42.845 11.257  -23.807 1.00 103.69 ? 249 DG  J "C5'" 1 
ATOM   5080  C  "C4'" . DG  B  1 103 ? -43.066 11.410  -22.312 1.00 106.61 ? 249 DG  J "C4'" 1 
ATOM   5081  O  "O4'" . DG  B  1 103 ? -43.360 10.113  -21.728 1.00 100.47 ? 249 DG  J "O4'" 1 
ATOM   5082  C  "C3'" . DG  B  1 103 ? -41.884 11.965  -21.526 1.00 108.69 ? 249 DG  J "C3'" 1 
ATOM   5083  O  "O3'" . DG  B  1 103 ? -42.373 12.744  -20.422 1.00 109.97 ? 249 DG  J "O3'" 1 
ATOM   5084  C  "C2'" . DG  B  1 103 ? -41.173 10.691  -21.067 1.00 104.35 ? 249 DG  J "C2'" 1 
ATOM   5085  C  "C1'" . DG  B  1 103 ? -42.347 9.750   -20.812 1.00 108.41 ? 249 DG  J "C1'" 1 
ATOM   5086  N  N9    . DG  B  1 103 ? -42.026 8.342   -21.024 1.00 108.61 ? 249 DG  J N9    1 
ATOM   5087  C  C8    . DG  B  1 103 ? -41.002 7.836   -21.784 1.00 110.69 ? 249 DG  J C8    1 
ATOM   5088  N  N7    . DG  B  1 103 ? -40.962 6.533   -21.804 1.00 113.15 ? 249 DG  J N7    1 
ATOM   5089  C  C5    . DG  B  1 103 ? -42.028 6.147   -21.002 1.00 114.28 ? 249 DG  J C5    1 
ATOM   5090  C  C6    . DG  B  1 103 ? -42.482 4.853   -20.648 1.00 116.07 ? 249 DG  J C6    1 
ATOM   5091  O  O6    . DG  B  1 103 ? -42.013 3.754   -20.983 1.00 113.64 ? 249 DG  J O6    1 
ATOM   5092  N  N1    . DG  B  1 103 ? -43.594 4.908   -19.814 1.00 116.86 ? 249 DG  J N1    1 
ATOM   5093  C  C2    . DG  B  1 103 ? -44.194 6.065   -19.378 1.00 117.97 ? 249 DG  J C2    1 
ATOM   5094  N  N2    . DG  B  1 103 ? -45.260 5.915   -18.578 1.00 122.96 ? 249 DG  J N2    1 
ATOM   5095  N  N3    . DG  B  1 103 ? -43.780 7.285   -19.702 1.00 115.65 ? 249 DG  J N3    1 
ATOM   5096  C  C4    . DG  B  1 103 ? -42.695 7.249   -20.515 1.00 112.21 ? 249 DG  J C4    1 
ATOM   5097  P  P     . DT  B  1 104 ? -41.382 13.589  -19.475 1.00 117.95 ? 250 DT  J P     1 
ATOM   5098  O  OP1   . DT  B  1 104 ? -41.811 15.004  -19.536 1.00 124.16 ? 250 DT  J OP1   1 
ATOM   5099  O  OP2   . DT  B  1 104 ? -39.977 13.243  -19.789 1.00 117.97 ? 250 DT  J OP2   1 
ATOM   5100  O  "O5'" . DT  B  1 104 ? -41.720 13.027  -18.019 1.00 114.54 ? 250 DT  J "O5'" 1 
ATOM   5101  C  "C5'" . DT  B  1 104 ? -42.319 11.747  -17.901 1.00 114.05 ? 250 DT  J "C5'" 1 
ATOM   5102  C  "C4'" . DT  B  1 104 ? -42.647 11.412  -16.466 1.00 117.62 ? 250 DT  J "C4'" 1 
ATOM   5103  O  "O4'" . DT  B  1 104 ? -42.962 9.997   -16.378 1.00 112.57 ? 250 DT  J "O4'" 1 
ATOM   5104  C  "C3'" . DT  B  1 104 ? -41.514 11.641  -15.479 1.00 127.11 ? 250 DT  J "C3'" 1 
ATOM   5105  O  "O3'" . DT  B  1 104 ? -42.048 11.938  -14.188 1.00 134.41 ? 250 DT  J "O3'" 1 
ATOM   5106  C  "C2'" . DT  B  1 104 ? -40.785 10.300  -15.504 1.00 129.82 ? 250 DT  J "C2'" 1 
ATOM   5107  C  "C1'" . DT  B  1 104 ? -41.934 9.310   -15.690 1.00 124.87 ? 250 DT  J "C1'" 1 
ATOM   5108  N  N1    . DT  B  1 104 ? -41.547 8.092   -16.479 1.00 125.98 ? 250 DT  J N1    1 
ATOM   5109  C  C2    . DT  B  1 104 ? -42.262 6.923   -16.321 1.00 125.81 ? 250 DT  J C2    1 
ATOM   5110  O  O2    . DT  B  1 104 ? -43.219 6.818   -15.575 1.00 125.66 ? 250 DT  J O2    1 
ATOM   5111  N  N3    . DT  B  1 104 ? -41.816 5.872   -17.080 1.00 121.86 ? 250 DT  J N3    1 
ATOM   5112  C  C4    . DT  B  1 104 ? -40.747 5.869   -17.959 1.00 121.80 ? 250 DT  J C4    1 
ATOM   5113  O  O4    . DT  B  1 104 ? -40.422 4.869   -18.592 1.00 117.79 ? 250 DT  J O4    1 
ATOM   5114  C  C5    . DT  B  1 104 ? -40.036 7.123   -18.073 1.00 123.37 ? 250 DT  J C5    1 
ATOM   5115  C  C7    . DT  B  1 104 ? -38.857 7.243   -18.995 1.00 120.89 ? 250 DT  J C7    1 
ATOM   5116  C  C6    . DT  B  1 104 ? -40.465 8.159   -17.335 1.00 121.31 ? 250 DT  J C6    1 
ATOM   5117  P  P     . DT  B  1 105 ? -41.131 12.618  -13.053 1.00 144.81 ? 251 DT  J P     1 
ATOM   5118  O  OP1   . DT  B  1 105 ? -41.723 13.931  -12.712 1.00 138.38 ? 251 DT  J OP1   1 
ATOM   5119  O  OP2   . DT  B  1 105 ? -39.718 12.544  -13.487 1.00 137.95 ? 251 DT  J OP2   1 
ATOM   5120  O  "O5'" . DT  B  1 105 ? -41.304 11.632  -11.809 1.00 130.04 ? 251 DT  J "O5'" 1 
ATOM   5121  C  "C5'" . DT  B  1 105 ? -41.202 10.241  -12.020 1.00 129.76 ? 251 DT  J "C5'" 1 
ATOM   5122  C  "C4'" . DT  B  1 105 ? -42.099 9.470   -11.078 1.00 137.39 ? 251 DT  J "C4'" 1 
ATOM   5123  O  "O4'" . DT  B  1 105 ? -42.466 8.222   -11.710 1.00 135.39 ? 251 DT  J "O4'" 1 
ATOM   5124  C  "C3'" . DT  B  1 105 ? -41.425 9.044   -9.793  1.00 144.93 ? 251 DT  J "C3'" 1 
ATOM   5125  O  "O3'" . DT  B  1 105 ? -42.403 8.660   -8.829  1.00 147.19 ? 251 DT  J "O3'" 1 
ATOM   5126  C  "C2'" . DT  B  1 105 ? -40.617 7.847   -10.275 1.00 141.60 ? 251 DT  J "C2'" 1 
ATOM   5127  C  "C1'" . DT  B  1 105 ? -41.585 7.200   -11.272 1.00 136.35 ? 251 DT  J "C1'" 1 
ATOM   5128  N  N1    . DT  B  1 105 ? -40.904 6.610   -12.466 1.00 134.35 ? 251 DT  J N1    1 
ATOM   5129  C  C2    . DT  B  1 105 ? -41.359 5.418   -12.982 1.00 134.62 ? 251 DT  J C2    1 
ATOM   5130  O  O2    . DT  B  1 105 ? -42.307 4.808   -12.520 1.00 134.78 ? 251 DT  J O2    1 
ATOM   5131  N  N3    . DT  B  1 105 ? -40.663 4.962   -14.070 1.00 131.39 ? 251 DT  J N3    1 
ATOM   5132  C  C4    . DT  B  1 105 ? -39.577 5.564   -14.679 1.00 130.01 ? 251 DT  J C4    1 
ATOM   5133  O  O4    . DT  B  1 105 ? -39.016 5.073   -15.654 1.00 130.38 ? 251 DT  J O4    1 
ATOM   5134  C  C5    . DT  B  1 105 ? -39.148 6.810   -14.086 1.00 128.97 ? 251 DT  J C5    1 
ATOM   5135  C  C7    . DT  B  1 105 ? -37.980 7.557   -14.659 1.00 127.45 ? 251 DT  J C7    1 
ATOM   5136  C  C6    . DT  B  1 105 ? -39.823 7.264   -13.020 1.00 130.32 ? 251 DT  J C6    1 
ATOM   5137  P  P     . DT  B  1 106 ? -42.057 8.711   -7.259  1.00 151.90 ? 252 DT  J P     1 
ATOM   5138  O  OP1   . DT  B  1 106 ? -43.108 9.518   -6.601  1.00 150.50 ? 252 DT  J OP1   1 
ATOM   5139  O  OP2   . DT  B  1 106 ? -40.636 9.103   -7.122  1.00 141.88 ? 252 DT  J OP2   1 
ATOM   5140  O  "O5'" . DT  B  1 106 ? -42.198 7.189   -6.779  1.00 149.19 ? 252 DT  J "O5'" 1 
ATOM   5141  C  "C5'" . DT  B  1 106 ? -42.213 6.136   -7.739  1.00 144.90 ? 252 DT  J "C5'" 1 
ATOM   5142  C  "C4'" . DT  B  1 106 ? -41.571 4.877   -7.183  1.00 144.60 ? 252 DT  J "C4'" 1 
ATOM   5143  O  "O4'" . DT  B  1 106 ? -40.893 4.165   -8.255  1.00 143.83 ? 252 DT  J "O4'" 1 
ATOM   5144  C  "C3'" . DT  B  1 106 ? -40.512 5.109   -6.110  1.00 146.62 ? 252 DT  J "C3'" 1 
ATOM   5145  O  "O3'" . DT  B  1 106 ? -40.529 4.029   -5.182  1.00 146.87 ? 252 DT  J "O3'" 1 
ATOM   5146  C  "C2'" . DT  B  1 106 ? -39.221 5.134   -6.922  1.00 142.63 ? 252 DT  J "C2'" 1 
ATOM   5147  C  "C1'" . DT  B  1 106 ? -39.510 4.066   -7.967  1.00 144.00 ? 252 DT  J "C1'" 1 
ATOM   5148  N  N1    . DT  B  1 106 ? -38.747 4.244   -9.241  1.00 139.21 ? 252 DT  J N1    1 
ATOM   5149  C  C2    . DT  B  1 106 ? -38.587 3.169   -10.084 1.00 137.46 ? 252 DT  J C2    1 
ATOM   5150  O  O2    . DT  B  1 106 ? -39.037 2.061   -9.848  1.00 136.48 ? 252 DT  J O2    1 
ATOM   5151  N  N3    . DT  B  1 106 ? -37.875 3.438   -11.224 1.00 132.35 ? 252 DT  J N3    1 
ATOM   5152  C  C4    . DT  B  1 106 ? -37.320 4.647   -11.598 1.00 130.86 ? 252 DT  J C4    1 
ATOM   5153  O  O4    . DT  B  1 106 ? -36.700 4.787   -12.646 1.00 129.46 ? 252 DT  J O4    1 
ATOM   5154  C  C5    . DT  B  1 106 ? -37.523 5.734   -10.669 1.00 134.30 ? 252 DT  J C5    1 
ATOM   5155  C  C7    . DT  B  1 106 ? -36.966 7.096   -10.966 1.00 131.76 ? 252 DT  J C7    1 
ATOM   5156  C  C6    . DT  B  1 106 ? -38.217 5.482   -9.548  1.00 137.20 ? 252 DT  J C6    1 
ATOM   5157  P  P     . DC  B  1 107 ? -39.573 4.050   -3.891  1.00 144.39 ? 253 DC  J P     1 
ATOM   5158  O  OP1   . DC  B  1 107 ? -40.196 3.191   -2.861  1.00 144.80 ? 253 DC  J OP1   1 
ATOM   5159  O  OP2   . DC  B  1 107 ? -39.252 5.462   -3.586  1.00 143.65 ? 253 DC  J OP2   1 
ATOM   5160  O  "O5'" . DC  B  1 107 ? -38.232 3.347   -4.403  1.00 143.61 ? 253 DC  J "O5'" 1 
ATOM   5161  C  "C5'" . DC  B  1 107 ? -37.576 2.394   -3.588  1.00 140.01 ? 253 DC  J "C5'" 1 
ATOM   5162  C  "C4'" . DC  B  1 107 ? -37.297 1.128   -4.374  1.00 140.76 ? 253 DC  J "C4'" 1 
ATOM   5163  O  "O4'" . DC  B  1 107 ? -37.236 1.440   -5.789  1.00 141.14 ? 253 DC  J "O4'" 1 
ATOM   5164  C  "C3'" . DC  B  1 107 ? -35.978 0.452   -4.041  1.00 138.49 ? 253 DC  J "C3'" 1 
ATOM   5165  O  "O3'" . DC  B  1 107 ? -36.093 -0.949  -4.205  1.00 135.77 ? 253 DC  J "O3'" 1 
ATOM   5166  C  "C2'" . DC  B  1 107 ? -35.016 1.062   -5.055  1.00 139.40 ? 253 DC  J "C2'" 1 
ATOM   5167  C  "C1'" . DC  B  1 107 ? -35.913 1.289   -6.269  1.00 138.03 ? 253 DC  J "C1'" 1 
ATOM   5168  N  N1    . DC  B  1 107 ? -35.549 2.512   -7.048  1.00 135.17 ? 253 DC  J N1    1 
ATOM   5169  C  C2    . DC  B  1 107 ? -35.212 2.398   -8.401  1.00 131.69 ? 253 DC  J C2    1 
ATOM   5170  O  O2    . DC  B  1 107 ? -35.230 1.284   -8.934  1.00 129.33 ? 253 DC  J O2    1 
ATOM   5171  N  N3    . DC  B  1 107 ? -34.880 3.518   -9.092  1.00 131.99 ? 253 DC  J N3    1 
ATOM   5172  C  C4    . DC  B  1 107 ? -34.873 4.704   -8.479  1.00 131.62 ? 253 DC  J C4    1 
ATOM   5173  N  N4    . DC  B  1 107 ? -34.537 5.778   -9.201  1.00 125.38 ? 253 DC  J N4    1 
ATOM   5174  C  C5    . DC  B  1 107 ? -35.209 4.840   -7.100  1.00 131.47 ? 253 DC  J C5    1 
ATOM   5175  C  C6    . DC  B  1 107 ? -35.536 3.729   -6.430  1.00 133.34 ? 253 DC  J C6    1 
ATOM   5176  P  P     . DC  B  1 108 ? -35.752 -1.924  -2.975  1.00 151.25 ? 254 DC  J P     1 
ATOM   5177  O  OP1   . DC  B  1 108 ? -36.857 -2.900  -2.851  1.00 149.70 ? 254 DC  J OP1   1 
ATOM   5178  O  OP2   . DC  B  1 108 ? -35.385 -1.066  -1.826  1.00 145.89 ? 254 DC  J OP2   1 
ATOM   5179  O  "O5'" . DC  B  1 108 ? -34.426 -2.687  -3.440  1.00 143.32 ? 254 DC  J "O5'" 1 
ATOM   5180  C  "C5'" . DC  B  1 108 ? -33.151 -2.086  -3.241  1.00 137.54 ? 254 DC  J "C5'" 1 
ATOM   5181  C  "C4'" . DC  B  1 108 ? -32.249 -2.337  -4.434  1.00 133.47 ? 254 DC  J "C4'" 1 
ATOM   5182  O  "O4'" . DC  B  1 108 ? -32.415 -1.264  -5.402  1.00 131.02 ? 254 DC  J "O4'" 1 
ATOM   5183  C  "C3'" . DC  B  1 108 ? -30.754 -2.384  -4.118  1.00 130.49 ? 254 DC  J "C3'" 1 
ATOM   5184  O  "O3'" . DC  B  1 108 ? -30.125 -3.364  -4.932  1.00 132.46 ? 254 DC  J "O3'" 1 
ATOM   5185  C  "C2'" . DC  B  1 108 ? -30.292 -0.981  -4.493  1.00 124.92 ? 254 DC  J "C2'" 1 
ATOM   5186  C  "C1'" . DC  B  1 108 ? -31.150 -0.730  -5.720  1.00 126.60 ? 254 DC  J "C1'" 1 
ATOM   5187  N  N1    . DC  B  1 108 ? -31.310 0.706   -6.064  1.00 127.37 ? 254 DC  J N1    1 
ATOM   5188  C  C2    . DC  B  1 108 ? -31.161 1.116   -7.393  1.00 123.80 ? 254 DC  J C2    1 
ATOM   5189  O  O2    . DC  B  1 108 ? -30.901 0.271   -8.258  1.00 118.28 ? 254 DC  J O2    1 
ATOM   5190  N  N3    . DC  B  1 108 ? -31.311 2.429   -7.695  1.00 124.11 ? 254 DC  J N3    1 
ATOM   5191  C  C4    . DC  B  1 108 ? -31.593 3.307   -6.732  1.00 123.79 ? 254 DC  J C4    1 
ATOM   5192  N  N4    . DC  B  1 108 ? -31.731 4.590   -7.078  1.00 121.70 ? 254 DC  J N4    1 
ATOM   5193  C  C5    . DC  B  1 108 ? -31.747 2.908   -5.371  1.00 125.94 ? 254 DC  J C5    1 
ATOM   5194  C  C6    . DC  B  1 108 ? -31.597 1.611   -5.085  1.00 128.11 ? 254 DC  J C6    1 
ATOM   5195  P  P     . DA  B  1 109 ? -29.653 -4.765  -4.304  1.00 139.93 ? 255 DA  J P     1 
ATOM   5196  O  OP1   . DA  B  1 109 ? -30.856 -5.611  -4.149  1.00 141.81 ? 255 DA  J OP1   1 
ATOM   5197  O  OP2   . DA  B  1 109 ? -28.782 -4.478  -3.141  1.00 136.74 ? 255 DA  J OP2   1 
ATOM   5198  O  "O5'" . DA  B  1 109 ? -28.734 -5.399  -5.444  1.00 131.45 ? 255 DA  J "O5'" 1 
ATOM   5199  C  "C5'" . DA  B  1 109 ? -29.267 -5.623  -6.739  1.00 129.09 ? 255 DA  J "C5'" 1 
ATOM   5200  C  "C4'" . DA  B  1 109 ? -28.236 -5.306  -7.806  1.00 124.41 ? 255 DA  J "C4'" 1 
ATOM   5201  O  "O4'" . DA  B  1 109 ? -28.284 -3.892  -8.121  1.00 119.45 ? 255 DA  J "O4'" 1 
ATOM   5202  C  "C3'" . DA  B  1 109 ? -26.790 -5.622  -7.423  1.00 120.02 ? 255 DA  J "C3'" 1 
ATOM   5203  O  "O3'" . DA  B  1 109 ? -26.143 -6.283  -8.507  1.00 115.98 ? 255 DA  J "O3'" 1 
ATOM   5204  C  "C2'" . DA  B  1 109 ? -26.183 -4.249  -7.125  1.00 113.66 ? 255 DA  J "C2'" 1 
ATOM   5205  C  "C1'" . DA  B  1 109 ? -27.002 -3.317  -8.004  1.00 119.01 ? 255 DA  J "C1'" 1 
ATOM   5206  N  N9    . DA  B  1 109 ? -27.156 -1.984  -7.429  1.00 120.13 ? 255 DA  J N9    1 
ATOM   5207  C  C8    . DA  B  1 109 ? -27.148 -1.657  -6.102  1.00 120.00 ? 255 DA  J C8    1 
ATOM   5208  N  N7    . DA  B  1 109 ? -27.312 -0.377  -5.870  1.00 119.29 ? 255 DA  J N7    1 
ATOM   5209  C  C5    . DA  B  1 109 ? -27.439 0.176   -7.133  1.00 117.14 ? 255 DA  J C5    1 
ATOM   5210  C  C6    . DA  B  1 109 ? -27.638 1.498   -7.574  1.00 117.31 ? 255 DA  J C6    1 
ATOM   5211  N  N6    . DA  B  1 109 ? -27.746 2.540   -6.744  1.00 117.54 ? 255 DA  J N6    1 
ATOM   5212  N  N1    . DA  B  1 109 ? -27.720 1.709   -8.905  1.00 119.05 ? 255 DA  J N1    1 
ATOM   5213  C  C2    . DA  B  1 109 ? -27.611 0.662   -9.732  1.00 116.57 ? 255 DA  J C2    1 
ATOM   5214  N  N3    . DA  B  1 109 ? -27.424 -0.624  -9.436  1.00 118.21 ? 255 DA  J N3    1 
ATOM   5215  C  C4    . DA  B  1 109 ? -27.346 -0.801  -8.107  1.00 118.72 ? 255 DA  J C4    1 
ATOM   5216  P  P     . DA  B  1 110 ? -24.540 -6.344  -8.621  1.00 122.77 ? 256 DA  J P     1 
ATOM   5217  O  OP1   . DA  B  1 110 ? -24.227 -7.569  -9.391  1.00 129.06 ? 256 DA  J OP1   1 
ATOM   5218  O  OP2   . DA  B  1 110 ? -23.906 -6.149  -7.296  1.00 120.62 ? 256 DA  J OP2   1 
ATOM   5219  O  "O5'" . DA  B  1 110 ? -24.202 -5.095  -9.549  1.00 117.24 ? 256 DA  J "O5'" 1 
ATOM   5220  C  "C5'" . DA  B  1 110 ? -24.965 -4.882  -10.729 1.00 113.06 ? 256 DA  J "C5'" 1 
ATOM   5221  C  "C4'" . DA  B  1 110 ? -24.305 -3.855  -11.626 1.00 107.88 ? 256 DA  J "C4'" 1 
ATOM   5222  O  "O4'" . DA  B  1 110 ? -24.470 -2.534  -11.055 1.00 104.95 ? 256 DA  J "O4'" 1 
ATOM   5223  C  "C3'" . DA  B  1 110 ? -22.811 -4.053  -11.843 1.00 108.16 ? 256 DA  J "C3'" 1 
ATOM   5224  O  "O3'" . DA  B  1 110 ? -22.481 -3.754  -13.198 1.00 106.28 ? 256 DA  J "O3'" 1 
ATOM   5225  C  "C2'" . DA  B  1 110 ? -22.167 -3.080  -10.850 1.00 102.83 ? 256 DA  J "C2'" 1 
ATOM   5226  C  "C1'" . DA  B  1 110 ? -23.221 -1.989  -10.683 1.00 102.77 ? 256 DA  J "C1'" 1 
ATOM   5227  N  N9    . DA  B  1 110 ? -23.330 -1.501  -9.310  1.00 108.14 ? 256 DA  J N9    1 
ATOM   5228  C  C8    . DA  B  1 110 ? -23.040 -2.190  -8.163  1.00 108.52 ? 256 DA  J C8    1 
ATOM   5229  N  N7    . DA  B  1 110 ? -23.234 -1.496  -7.066  1.00 109.53 ? 256 DA  J N7    1 
ATOM   5230  C  C5    . DA  B  1 110 ? -23.684 -0.268  -7.524  1.00 110.20 ? 256 DA  J C5    1 
ATOM   5231  C  C6    . DA  B  1 110 ? -24.067 0.912   -6.858  1.00 108.51 ? 256 DA  J C6    1 
ATOM   5232  N  N6    . DA  B  1 110 ? -24.055 1.045   -5.530  1.00 113.26 ? 256 DA  J N6    1 
ATOM   5233  N  N1    . DA  B  1 110 ? -24.464 1.956   -7.614  1.00 110.11 ? 256 DA  J N1    1 
ATOM   5234  C  C2    . DA  B  1 110 ? -24.475 1.821   -8.945  1.00 111.14 ? 256 DA  J C2    1 
ATOM   5235  N  N3    . DA  B  1 110 ? -24.139 0.765   -9.683  1.00 108.76 ? 256 DA  J N3    1 
ATOM   5236  C  C4    . DA  B  1 110 ? -23.749 -0.255  -8.905  1.00 110.80 ? 256 DA  J C4    1 
ATOM   5237  P  P     . DA  B  1 111 ? -20.952 -3.659  -13.689 1.00 107.22 ? 257 DA  J P     1 
ATOM   5238  O  OP1   . DA  B  1 111 ? -20.918 -4.208  -15.062 1.00 110.01 ? 257 DA  J OP1   1 
ATOM   5239  O  OP2   . DA  B  1 111 ? -20.037 -4.221  -12.669 1.00 97.95  ? 257 DA  J OP2   1 
ATOM   5240  O  "O5'" . DA  B  1 111 ? -20.710 -2.086  -13.780 1.00 99.80  ? 257 DA  J "O5'" 1 
ATOM   5241  C  "C5'" . DA  B  1 111 ? -21.739 -1.255  -14.304 1.00 97.89  ? 257 DA  J "C5'" 1 
ATOM   5242  C  "C4'" . DA  B  1 111 ? -21.420 0.210   -14.087 1.00 95.60  ? 257 DA  J "C4'" 1 
ATOM   5243  O  "O4'" . DA  B  1 111 ? -21.688 0.572   -12.706 1.00 98.41  ? 257 DA  J "O4'" 1 
ATOM   5244  C  "C3'" . DA  B  1 111 ? -19.967 0.599   -14.356 1.00 88.26  ? 257 DA  J "C3'" 1 
ATOM   5245  O  "O3'" . DA  B  1 111 ? -19.931 1.852   -14.999 1.00 85.71  ? 257 DA  J "O3'" 1 
ATOM   5246  C  "C2'" . DA  B  1 111 ? -19.369 0.676   -12.956 1.00 92.22  ? 257 DA  J "C2'" 1 
ATOM   5247  C  "C1'" . DA  B  1 111 ? -20.549 1.190   -12.152 1.00 95.77  ? 257 DA  J "C1'" 1 
ATOM   5248  N  N9    . DA  B  1 111 ? -20.475 0.840   -10.741 1.00 101.33 ? 257 DA  J N9    1 
ATOM   5249  C  C8    . DA  B  1 111 ? -20.068 -0.352  -10.212 1.00 103.08 ? 257 DA  J C8    1 
ATOM   5250  N  N7    . DA  B  1 111 ? -20.099 -0.386  -8.902  1.00 104.27 ? 257 DA  J N7    1 
ATOM   5251  C  C5    . DA  B  1 111 ? -20.557 0.872   -8.549  1.00 106.14 ? 257 DA  J C5    1 
ATOM   5252  C  C6    . DA  B  1 111 ? -20.811 1.472   -7.301  1.00 110.50 ? 257 DA  J C6    1 
ATOM   5253  N  N6    . DA  B  1 111 ? -20.629 0.847   -6.134  1.00 112.47 ? 257 DA  J N6    1 
ATOM   5254  N  N1    . DA  B  1 111 ? -21.262 2.744   -7.300  1.00 112.15 ? 257 DA  J N1    1 
ATOM   5255  C  C2    . DA  B  1 111 ? -21.443 3.366   -8.471  1.00 107.84 ? 257 DA  J C2    1 
ATOM   5256  N  N3    . DA  B  1 111 ? -21.239 2.905   -9.704  1.00 103.38 ? 257 DA  J N3    1 
ATOM   5257  C  C4    . DA  B  1 111 ? -20.792 1.640   -9.672  1.00 103.29 ? 257 DA  J C4    1 
ATOM   5258  P  P     . DT  B  1 112 ? -18.583 2.384   -15.688 1.00 77.39  ? 258 DT  J P     1 
ATOM   5259  O  OP1   . DT  B  1 112 ? -18.884 2.440   -17.137 1.00 62.91  ? 258 DT  J OP1   1 
ATOM   5260  O  OP2   . DT  B  1 112 ? -17.426 1.604   -15.185 1.00 61.41  ? 258 DT  J OP2   1 
ATOM   5261  O  "O5'" . DT  B  1 112 ? -18.447 3.871   -15.115 1.00 76.97  ? 258 DT  J "O5'" 1 
ATOM   5262  C  "C5'" . DT  B  1 112 ? -19.469 4.377   -14.266 1.00 80.33  ? 258 DT  J "C5'" 1 
ATOM   5263  C  "C4'" . DT  B  1 112 ? -19.046 5.668   -13.599 1.00 78.07  ? 258 DT  J "C4'" 1 
ATOM   5264  O  "O4'" . DT  B  1 112 ? -19.167 5.528   -12.160 1.00 82.71  ? 258 DT  J "O4'" 1 
ATOM   5265  C  "C3'" . DT  B  1 112 ? -17.611 6.097   -13.859 1.00 75.41  ? 258 DT  J "C3'" 1 
ATOM   5266  O  "O3'" . DT  B  1 112 ? -17.539 7.523   -13.867 1.00 65.19  ? 258 DT  J "O3'" 1 
ATOM   5267  C  "C2'" . DT  B  1 112 ? -16.867 5.486   -12.674 1.00 85.90  ? 258 DT  J "C2'" 1 
ATOM   5268  C  "C1'" . DT  B  1 112 ? -17.893 5.591   -11.553 1.00 88.37  ? 258 DT  J "C1'" 1 
ATOM   5269  N  N1    . DT  B  1 112 ? -17.789 4.483   -10.561 1.00 96.72  ? 258 DT  J N1    1 
ATOM   5270  C  C2    . DT  B  1 112 ? -18.204 4.691   -9.266  1.00 104.10 ? 258 DT  J C2    1 
ATOM   5271  O  O2    . DT  B  1 112 ? -18.667 5.748   -8.872  1.00 103.91 ? 258 DT  J O2    1 
ATOM   5272  N  N3    . DT  B  1 112 ? -18.060 3.607   -8.439  1.00 107.06 ? 258 DT  J N3    1 
ATOM   5273  C  C4    . DT  B  1 112 ? -17.549 2.364   -8.771  1.00 104.38 ? 258 DT  J C4    1 
ATOM   5274  O  O4    . DT  B  1 112 ? -17.460 1.452   -7.955  1.00 106.78 ? 258 DT  J O4    1 
ATOM   5275  C  C5    . DT  B  1 112 ? -17.130 2.216   -10.146 1.00 99.53  ? 258 DT  J C5    1 
ATOM   5276  C  C7    . DT  B  1 112 ? -16.559 0.914   -10.627 1.00 94.34  ? 258 DT  J C7    1 
ATOM   5277  C  C6    . DT  B  1 112 ? -17.268 3.269   -10.962 1.00 97.16  ? 258 DT  J C6    1 
ATOM   5278  P  P     . DA  B  1 113 ? -16.128 8.291   -13.918 1.00 71.07  ? 259 DA  J P     1 
ATOM   5279  O  OP1   . DA  B  1 113 ? -16.233 9.354   -14.937 1.00 61.90  ? 259 DA  J OP1   1 
ATOM   5280  O  OP2   . DA  B  1 113 ? -15.015 7.324   -14.043 1.00 82.15  ? 259 DA  J OP2   1 
ATOM   5281  O  "O5'" . DA  B  1 113 ? -16.044 8.984   -12.486 1.00 80.16  ? 259 DA  J "O5'" 1 
ATOM   5282  C  "C5'" . DA  B  1 113 ? -17.160 9.723   -11.993 1.00 87.56  ? 259 DA  J "C5'" 1 
ATOM   5283  C  "C4'" . DA  B  1 113 ? -16.887 10.271  -10.602 1.00 92.14  ? 259 DA  J "C4'" 1 
ATOM   5284  O  "O4'" . DA  B  1 113 ? -16.852 9.181   -9.647  1.00 91.89  ? 259 DA  J "O4'" 1 
ATOM   5285  C  "C3'" . DA  B  1 113 ? -15.562 11.002  -10.444 1.00 92.47  ? 259 DA  J "C3'" 1 
ATOM   5286  O  "O3'" . DA  B  1 113 ? -15.686 12.034  -9.471  1.00 98.84  ? 259 DA  J "O3'" 1 
ATOM   5287  C  "C2'" . DA  B  1 113 ? -14.625 9.896   -9.973  1.00 100.72 ? 259 DA  J "C2'" 1 
ATOM   5288  C  "C1'" . DA  B  1 113 ? -15.550 9.039   -9.115  1.00 99.09  ? 259 DA  J "C1'" 1 
ATOM   5289  N  N9    . DA  B  1 113 ? -15.204 7.625   -9.143  1.00 100.35 ? 259 DA  J N9    1 
ATOM   5290  C  C8    . DA  B  1 113 ? -14.815 6.897   -10.231 1.00 101.23 ? 259 DA  J C8    1 
ATOM   5291  N  N7    . DA  B  1 113 ? -14.567 5.638   -9.964  1.00 104.67 ? 259 DA  J N7    1 
ATOM   5292  C  C5    . DA  B  1 113 ? -14.811 5.533   -8.606  1.00 108.01 ? 259 DA  J C5    1 
ATOM   5293  C  C6    . DA  B  1 113 ? -14.729 4.451   -7.709  1.00 112.06 ? 259 DA  J C6    1 
ATOM   5294  N  N6    . DA  B  1 113 ? -14.363 3.218   -8.074  1.00 111.29 ? 259 DA  J N6    1 
ATOM   5295  N  N1    . DA  B  1 113 ? -15.041 4.686   -6.417  1.00 116.75 ? 259 DA  J N1    1 
ATOM   5296  C  C2    . DA  B  1 113 ? -15.406 5.923   -6.057  1.00 117.58 ? 259 DA  J C2    1 
ATOM   5297  N  N3    . DA  B  1 113 ? -15.521 7.017   -6.809  1.00 110.98 ? 259 DA  J N3    1 
ATOM   5298  C  C4    . DA  B  1 113 ? -15.205 6.751   -8.084  1.00 106.74 ? 259 DA  J C4    1 
ATOM   5299  P  P     . DC  B  1 114 ? -14.881 13.416  -9.649  1.00 117.33 ? 260 DC  J P     1 
ATOM   5300  O  OP1   . DC  B  1 114 ? -15.863 14.519  -9.551  1.00 110.26 ? 260 DC  J OP1   1 
ATOM   5301  O  OP2   . DC  B  1 114 ? -14.020 13.302  -10.848 1.00 103.04 ? 260 DC  J OP2   1 
ATOM   5302  O  "O5'" . DC  B  1 114 ? -13.926 13.469  -8.369  1.00 105.96 ? 260 DC  J "O5'" 1 
ATOM   5303  C  "C5'" . DC  B  1 114 ? -13.208 12.314  -7.977  1.00 107.13 ? 260 DC  J "C5'" 1 
ATOM   5304  C  "C4'" . DC  B  1 114 ? -13.217 12.161  -6.471  1.00 115.46 ? 260 DC  J "C4'" 1 
ATOM   5305  O  "O4'" . DC  B  1 114 ? -13.546 10.794  -6.124  1.00 113.81 ? 260 DC  J "O4'" 1 
ATOM   5306  C  "C3'" . DC  B  1 114 ? -11.888 12.471  -5.800  1.00 122.57 ? 260 DC  J "C3'" 1 
ATOM   5307  O  "O3'" . DC  B  1 114 ? -12.092 13.147  -4.571  1.00 128.15 ? 260 DC  J "O3'" 1 
ATOM   5308  C  "C2'" . DC  B  1 114 ? -11.245 11.100  -5.601  1.00 123.47 ? 260 DC  J "C2'" 1 
ATOM   5309  C  "C1'" . DC  B  1 114 ? -12.430 10.137  -5.558  1.00 119.56 ? 260 DC  J "C1'" 1 
ATOM   5310  N  N1    . DC  B  1 114 ? -12.178 8.877   -6.325  1.00 116.84 ? 260 DC  J N1    1 
ATOM   5311  C  C2    . DC  B  1 114 ? -12.154 7.648   -5.657  1.00 117.37 ? 260 DC  J C2    1 
ATOM   5312  O  O2    . DC  B  1 114 ? -12.357 7.620   -4.438  1.00 121.20 ? 260 DC  J O2    1 
ATOM   5313  N  N3    . DC  B  1 114 ? -11.915 6.518   -6.367  1.00 116.76 ? 260 DC  J N3    1 
ATOM   5314  C  C4    . DC  B  1 114 ? -11.700 6.588   -7.681  1.00 115.29 ? 260 DC  J C4    1 
ATOM   5315  N  N4    . DC  B  1 114 ? -11.469 5.447   -8.339  1.00 114.86 ? 260 DC  J N4    1 
ATOM   5316  C  C5    . DC  B  1 114 ? -11.713 7.831   -8.380  1.00 115.08 ? 260 DC  J C5    1 
ATOM   5317  C  C6    . DC  B  1 114 ? -11.949 8.938   -7.669  1.00 114.57 ? 260 DC  J C6    1 
ATOM   5318  P  P     . DA  B  1 115 ? -11.020 14.237  -4.076  1.00 137.25 ? 261 DA  J P     1 
ATOM   5319  O  OP1   . DA  B  1 115 ? -11.699 15.135  -3.115  1.00 136.10 ? 261 DA  J OP1   1 
ATOM   5320  O  OP2   . DA  B  1 115 ? -10.356 14.799  -5.275  1.00 121.11 ? 261 DA  J OP2   1 
ATOM   5321  O  "O5'" . DA  B  1 115 ? -9.931  13.370  -3.295  1.00 127.86 ? 261 DA  J "O5'" 1 
ATOM   5322  C  "C5'" . DA  B  1 115 ? -10.321 12.552  -2.197  1.00 130.09 ? 261 DA  J "C5'" 1 
ATOM   5323  C  "C4'" . DA  B  1 115 ? -9.116  11.832  -1.620  1.00 132.96 ? 261 DA  J "C4'" 1 
ATOM   5324  O  "O4'" . DA  B  1 115 ? -8.991  10.522  -2.240  1.00 131.26 ? 261 DA  J "O4'" 1 
ATOM   5325  C  "C3'" . DA  B  1 115 ? -7.785  12.539  -1.856  1.00 135.05 ? 261 DA  J "C3'" 1 
ATOM   5326  O  "O3'" . DA  B  1 115 ? -6.922  12.363  -0.735  1.00 140.89 ? 261 DA  J "O3'" 1 
ATOM   5327  C  "C2'" . DA  B  1 115 ? -7.246  11.837  -3.099  1.00 131.11 ? 261 DA  J "C2'" 1 
ATOM   5328  C  "C1'" . DA  B  1 115 ? -7.736  10.413  -2.882  1.00 130.59 ? 261 DA  J "C1'" 1 
ATOM   5329  N  N9    . DA  B  1 115 ? -7.913  9.674   -4.129  1.00 126.16 ? 261 DA  J N9    1 
ATOM   5330  C  C8    . DA  B  1 115 ? -8.096  10.201  -5.376  1.00 124.34 ? 261 DA  J C8    1 
ATOM   5331  N  N7    . DA  B  1 115 ? -8.227  9.301   -6.319  1.00 121.73 ? 261 DA  J N7    1 
ATOM   5332  C  C5    . DA  B  1 115 ? -8.114  8.097   -5.646  1.00 122.21 ? 261 DA  J C5    1 
ATOM   5333  C  C6    . DA  B  1 115 ? -8.162  6.760   -6.083  1.00 123.85 ? 261 DA  J C6    1 
ATOM   5334  N  N6    . DA  B  1 115 ? -8.345  6.409   -7.360  1.00 121.83 ? 261 DA  J N6    1 
ATOM   5335  N  N1    . DA  B  1 115 ? -8.014  5.794   -5.153  1.00 126.29 ? 261 DA  J N1    1 
ATOM   5336  C  C2    . DA  B  1 115 ? -7.830  6.150   -3.876  1.00 124.37 ? 261 DA  J C2    1 
ATOM   5337  N  N3    . DA  B  1 115 ? -7.769  7.371   -3.347  1.00 124.98 ? 261 DA  J N3    1 
ATOM   5338  C  C4    . DA  B  1 115 ? -7.919  8.308   -4.294  1.00 123.81 ? 261 DA  J C4    1 
ATOM   5339  P  P     . DC  B  1 116 ? -5.734  13.413  -0.457  1.00 147.21 ? 262 DC  J P     1 
ATOM   5340  O  OP1   . DC  B  1 116 ? -5.928  13.965  0.902   1.00 151.73 ? 262 DC  J OP1   1 
ATOM   5341  O  OP2   . DC  B  1 116 ? -5.642  14.323  -1.620  1.00 137.82 ? 262 DC  J OP2   1 
ATOM   5342  O  "O5'" . DC  B  1 116 ? -4.419  12.508  -0.454  1.00 135.97 ? 262 DC  J "O5'" 1 
ATOM   5343  C  "C5'" . DC  B  1 116 ? -4.285  11.465  -1.398  1.00 130.52 ? 262 DC  J "C5'" 1 
ATOM   5344  C  "C4'" . DC  B  1 116 ? -3.912  10.171  -0.714  1.00 129.63 ? 262 DC  J "C4'" 1 
ATOM   5345  O  "O4'" . DC  B  1 116 ? -4.483  9.056   -1.444  1.00 128.58 ? 262 DC  J "O4'" 1 
ATOM   5346  C  "C3'" . DC  B  1 116 ? -2.423  9.898   -0.671  1.00 132.49 ? 262 DC  J "C3'" 1 
ATOM   5347  O  "O3'" . DC  B  1 116 ? -2.117  9.053   0.423   1.00 138.65 ? 262 DC  J "O3'" 1 
ATOM   5348  C  "C2'" . DC  B  1 116 ? -2.192  9.200   -2.005  1.00 130.26 ? 262 DC  J "C2'" 1 
ATOM   5349  C  "C1'" . DC  B  1 116 ? -3.464  8.368   -2.148  1.00 128.76 ? 262 DC  J "C1'" 1 
ATOM   5350  N  N1    . DC  B  1 116 ? -3.905  8.191   -3.567  1.00 125.33 ? 262 DC  J N1    1 
ATOM   5351  C  C2    . DC  B  1 116 ? -4.158  6.906   -4.061  1.00 124.23 ? 262 DC  J C2    1 
ATOM   5352  O  O2    . DC  B  1 116 ? -4.011  5.931   -3.312  1.00 122.95 ? 262 DC  J O2    1 
ATOM   5353  N  N3    . DC  B  1 116 ? -4.558  6.765   -5.349  1.00 124.63 ? 262 DC  J N3    1 
ATOM   5354  C  C4    . DC  B  1 116 ? -4.704  7.841   -6.126  1.00 124.73 ? 262 DC  J C4    1 
ATOM   5355  N  N4    . DC  B  1 116 ? -5.100  7.652   -7.390  1.00 122.39 ? 262 DC  J N4    1 
ATOM   5356  C  C5    . DC  B  1 116 ? -4.450  9.158   -5.640  1.00 123.10 ? 262 DC  J C5    1 
ATOM   5357  C  C6    . DC  B  1 116 ? -4.057  9.285   -4.369  1.00 123.28 ? 262 DC  J C6    1 
ATOM   5358  P  P     . DT  B  1 117 ? -0.608  8.959   0.964   1.00 141.52 ? 263 DT  J P     1 
ATOM   5359  O  OP1   . DT  B  1 117 ? -0.662  8.736   2.426   1.00 135.10 ? 263 DT  J OP1   1 
ATOM   5360  O  OP2   . DT  B  1 117 ? 0.126   10.122  0.414   1.00 133.71 ? 263 DT  J OP2   1 
ATOM   5361  O  "O5'" . DT  B  1 117 ? -0.033  7.650   0.253   1.00 129.03 ? 263 DT  J "O5'" 1 
ATOM   5362  C  "C5'" . DT  B  1 117 ? -0.872  6.520   0.062   1.00 125.76 ? 263 DT  J "C5'" 1 
ATOM   5363  C  "C4'" . DT  B  1 117 ? -0.236  5.549   -0.912  1.00 125.57 ? 263 DT  J "C4'" 1 
ATOM   5364  O  "O4'" . DT  B  1 117 ? -0.840  5.697   -2.221  1.00 126.56 ? 263 DT  J "O4'" 1 
ATOM   5365  C  "C3'" . DT  B  1 117 ? 1.274   5.733   -1.107  1.00 124.81 ? 263 DT  J "C3'" 1 
ATOM   5366  O  "O3'" . DT  B  1 117 ? 1.947   4.507   -0.812  1.00 125.49 ? 263 DT  J "O3'" 1 
ATOM   5367  C  "C2'" . DT  B  1 117 ? 1.415   6.144   -2.579  1.00 123.25 ? 263 DT  J "C2'" 1 
ATOM   5368  C  "C1'" . DT  B  1 117 ? 0.156   5.575   -3.205  1.00 123.34 ? 263 DT  J "C1'" 1 
ATOM   5369  N  N1    . DT  B  1 117 ? -0.283  6.319   -4.419  1.00 123.39 ? 263 DT  J N1    1 
ATOM   5370  C  C2    . DT  B  1 117 ? -0.665  5.619   -5.538  1.00 118.64 ? 263 DT  J C2    1 
ATOM   5371  O  O2    . DT  B  1 117 ? -0.670  4.403   -5.596  1.00 115.85 ? 263 DT  J O2    1 
ATOM   5372  N  N3    . DT  B  1 117 ? -1.049  6.401   -6.598  1.00 116.78 ? 263 DT  J N3    1 
ATOM   5373  C  C4    . DT  B  1 117 ? -1.084  7.783   -6.648  1.00 117.19 ? 263 DT  J C4    1 
ATOM   5374  O  O4    . DT  B  1 117 ? -1.445  8.395   -7.649  1.00 114.63 ? 263 DT  J O4    1 
ATOM   5375  C  C5    . DT  B  1 117 ? -0.667  8.456   -5.440  1.00 125.37 ? 263 DT  J C5    1 
ATOM   5376  C  C7    . DT  B  1 117 ? -0.662  9.956   -5.372  1.00 119.06 ? 263 DT  J C7    1 
ATOM   5377  C  C6    . DT  B  1 117 ? -0.288  7.699   -4.399  1.00 127.11 ? 263 DT  J C6    1 
ATOM   5378  P  P     . DT  B  1 118 ? 3.469   4.246   -1.265  1.00 125.04 ? 264 DT  J P     1 
ATOM   5379  O  OP1   . DT  B  1 118 ? 4.092   3.444   -0.190  1.00 127.73 ? 264 DT  J OP1   1 
ATOM   5380  O  OP2   . DT  B  1 118 ? 4.138   5.496   -1.695  1.00 113.20 ? 264 DT  J OP2   1 
ATOM   5381  O  "O5'" . DT  B  1 118 ? 3.304   3.318   -2.547  1.00 120.82 ? 264 DT  J "O5'" 1 
ATOM   5382  C  "C5'" . DT  B  1 118 ? 4.438   2.903   -3.263  1.00 124.13 ? 264 DT  J "C5'" 1 
ATOM   5383  C  "C4'" . DT  B  1 118 ? 4.091   1.742   -4.165  1.00 117.41 ? 264 DT  J "C4'" 1 
ATOM   5384  O  "O4'" . DT  B  1 118 ? 3.012   2.127   -5.055  1.00 114.51 ? 264 DT  J "O4'" 1 
ATOM   5385  C  "C3'" . DT  B  1 118 ? 5.217   1.289   -5.069  1.00 112.74 ? 264 DT  J "C3'" 1 
ATOM   5386  O  "O3'" . DT  B  1 118 ? 5.055   -0.076  -5.378  1.00 110.16 ? 264 DT  J "O3'" 1 
ATOM   5387  C  "C2'" . DT  B  1 118 ? 5.026   2.172   -6.295  1.00 110.60 ? 264 DT  J "C2'" 1 
ATOM   5388  C  "C1'" . DT  B  1 118 ? 3.505   2.288   -6.372  1.00 114.13 ? 264 DT  J "C1'" 1 
ATOM   5389  N  N1    . DT  B  1 118 ? 3.038   3.608   -6.897  1.00 114.48 ? 264 DT  J N1    1 
ATOM   5390  C  C2    . DT  B  1 118 ? 2.449   3.669   -8.139  1.00 111.82 ? 264 DT  J C2    1 
ATOM   5391  O  O2    . DT  B  1 118 ? 2.276   2.692   -8.846  1.00 110.54 ? 264 DT  J O2    1 
ATOM   5392  N  N3    . DT  B  1 118 ? 2.062   4.924   -8.527  1.00 110.54 ? 264 DT  J N3    1 
ATOM   5393  C  C4    . DT  B  1 118 ? 2.204   6.101   -7.815  1.00 110.57 ? 264 DT  J C4    1 
ATOM   5394  O  O4    . DT  B  1 118 ? 1.823   7.182   -8.251  1.00 108.70 ? 264 DT  J O4    1 
ATOM   5395  C  C5    . DT  B  1 118 ? 2.833   5.968   -6.523  1.00 112.53 ? 264 DT  J C5    1 
ATOM   5396  C  C7    . DT  B  1 118 ? 3.042   7.176   -5.661  1.00 107.85 ? 264 DT  J C7    1 
ATOM   5397  C  C6    . DT  B  1 118 ? 3.216   4.743   -6.131  1.00 115.38 ? 264 DT  J C6    1 
ATOM   5398  P  P     . DT  B  1 119 ? 6.233   -0.873  -6.118  1.00 114.48 ? 265 DT  J P     1 
ATOM   5399  O  OP1   . DT  B  1 119 ? 6.228   -2.264  -5.612  1.00 121.72 ? 265 DT  J OP1   1 
ATOM   5400  O  OP2   . DT  B  1 119 ? 7.460   -0.050  -6.012  1.00 109.56 ? 265 DT  J OP2   1 
ATOM   5401  O  "O5'" . DT  B  1 119 ? 5.778   -0.866  -7.647  1.00 119.51 ? 265 DT  J "O5'" 1 
ATOM   5402  C  "C5'" . DT  B  1 119 ? 4.396   -0.977  -7.979  1.00 115.48 ? 265 DT  J "C5'" 1 
ATOM   5403  C  "C4'" . DT  B  1 119 ? 4.201   -0.838  -9.474  1.00 106.80 ? 265 DT  J "C4'" 1 
ATOM   5404  O  "O4'" . DT  B  1 119 ? 3.935   0.548   -9.802  1.00 106.08 ? 265 DT  J "O4'" 1 
ATOM   5405  C  "C3'" . DT  B  1 119 ? 5.409   -1.256  -10.304 1.00 105.79 ? 265 DT  J "C3'" 1 
ATOM   5406  O  "O3'" . DT  B  1 119 ? 4.995   -2.031  -11.406 1.00 103.11 ? 265 DT  J "O3'" 1 
ATOM   5407  C  "C2'" . DT  B  1 119 ? 6.036   0.069   -10.741 1.00 103.96 ? 265 DT  J "C2'" 1 
ATOM   5408  C  "C1'" . DT  B  1 119 ? 4.830   0.994   -10.797 1.00 108.10 ? 265 DT  J "C1'" 1 
ATOM   5409  N  N1    . DT  B  1 119 ? 5.162   2.411   -10.505 1.00 108.04 ? 265 DT  J N1    1 
ATOM   5410  C  C2    . DT  B  1 119 ? 4.524   3.410   -11.199 1.00 107.11 ? 265 DT  J C2    1 
ATOM   5411  O  O2    . DT  B  1 119 ? 3.691   3.196   -12.063 1.00 104.75 ? 265 DT  J O2    1 
ATOM   5412  N  N3    . DT  B  1 119 ? 4.898   4.679   -10.847 1.00 109.02 ? 265 DT  J N3    1 
ATOM   5413  C  C4    . DT  B  1 119 ? 5.827   5.041   -9.888  1.00 111.61 ? 265 DT  J C4    1 
ATOM   5414  O  O4    . DT  B  1 119 ? 6.096   6.214   -9.644  1.00 110.46 ? 265 DT  J O4    1 
ATOM   5415  C  C5    . DT  B  1 119 ? 6.458   3.942   -9.195  1.00 111.98 ? 265 DT  J C5    1 
ATOM   5416  C  C7    . DT  B  1 119 ? 7.484   4.208   -8.132  1.00 109.87 ? 265 DT  J C7    1 
ATOM   5417  C  C6    . DT  B  1 119 ? 6.099   2.696   -9.534  1.00 108.22 ? 265 DT  J C6    1 
ATOM   5418  P  P     . DT  B  1 120 ? 6.061   -2.950  -12.172 1.00 105.40 ? 266 DT  J P     1 
ATOM   5419  O  OP1   . DT  B  1 120 ? 5.328   -4.096  -12.756 1.00 99.72  ? 266 DT  J OP1   1 
ATOM   5420  O  OP2   . DT  B  1 120 ? 7.201   -3.186  -11.259 1.00 109.59 ? 266 DT  J OP2   1 
ATOM   5421  O  "O5'" . DT  B  1 120 ? 6.589   -2.008  -13.344 1.00 108.06 ? 266 DT  J "O5'" 1 
ATOM   5422  C  "C5'" . DT  B  1 120 ? 6.263   -2.314  -14.681 1.00 105.23 ? 266 DT  J "C5'" 1 
ATOM   5423  C  "C4'" . DT  B  1 120 ? 5.625   -1.125  -15.373 1.00 94.73  ? 266 DT  J "C4'" 1 
ATOM   5424  O  "O4'" . DT  B  1 120 ? 5.687   0.045   -14.517 1.00 96.47  ? 266 DT  J "O4'" 1 
ATOM   5425  C  "C3'" . DT  B  1 120 ? 6.297   -0.731  -16.688 1.00 92.74  ? 266 DT  J "C3'" 1 
ATOM   5426  O  "O3'" . DT  B  1 120 ? 5.339   -0.645  -17.709 1.00 87.17  ? 266 DT  J "O3'" 1 
ATOM   5427  C  "C2'" . DT  B  1 120 ? 6.923   0.631   -16.391 1.00 92.24  ? 266 DT  J "C2'" 1 
ATOM   5428  C  "C1'" . DT  B  1 120 ? 6.012   1.162   -15.305 1.00 92.72  ? 266 DT  J "C1'" 1 
ATOM   5429  N  N1    . DT  B  1 120 ? 6.666   2.186   -14.451 1.00 99.50  ? 266 DT  J N1    1 
ATOM   5430  C  C2    . DT  B  1 120 ? 6.202   3.479   -14.481 1.00 100.33 ? 266 DT  J C2    1 
ATOM   5431  O  O2    . DT  B  1 120 ? 5.263   3.833   -15.170 1.00 101.00 ? 266 DT  J O2    1 
ATOM   5432  N  N3    . DT  B  1 120 ? 6.875   4.349   -13.668 1.00 102.80 ? 266 DT  J N3    1 
ATOM   5433  C  C4    . DT  B  1 120 ? 7.949   4.063   -12.846 1.00 108.50 ? 266 DT  J C4    1 
ATOM   5434  O  O4    . DT  B  1 120 ? 8.489   4.917   -12.149 1.00 109.85 ? 266 DT  J O4    1 
ATOM   5435  C  C5    . DT  B  1 120 ? 8.392   2.687   -12.865 1.00 111.01 ? 266 DT  J C5    1 
ATOM   5436  C  C7    . DT  B  1 120 ? 9.549   2.255   -12.015 1.00 112.89 ? 266 DT  J C7    1 
ATOM   5437  C  C6    . DT  B  1 120 ? 7.739   1.826   -13.661 1.00 106.24 ? 266 DT  J C6    1 
ATOM   5438  P  P     . DG  B  1 121 ? 5.571   -1.435  -19.084 1.00 85.90  ? 267 DG  J P     1 
ATOM   5439  O  OP1   . DG  B  1 121 ? 4.897   -2.747  -18.978 1.00 86.83  ? 267 DG  J OP1   1 
ATOM   5440  O  OP2   . DG  B  1 121 ? 7.017   -1.356  -19.394 1.00 86.77  ? 267 DG  J OP2   1 
ATOM   5441  O  "O5'" . DG  B  1 121 ? 4.787   -0.556  -20.154 1.00 92.85  ? 267 DG  J "O5'" 1 
ATOM   5442  C  "C5'" . DG  B  1 121 ? 3.606   0.124   -19.772 1.00 89.97  ? 267 DG  J "C5'" 1 
ATOM   5443  C  "C4'" . DG  B  1 121 ? 3.642   1.561   -20.253 1.00 89.82  ? 267 DG  J "C4'" 1 
ATOM   5444  O  "O4'" . DG  B  1 121 ? 4.575   2.327   -19.447 1.00 83.66  ? 267 DG  J "O4'" 1 
ATOM   5445  C  "C3'" . DG  B  1 121 ? 4.081   1.742   -21.700 1.00 88.66  ? 267 DG  J "C3'" 1 
ATOM   5446  O  "O3'" . DG  B  1 121 ? 3.333   2.783   -22.286 1.00 92.25  ? 267 DG  J "O3'" 1 
ATOM   5447  C  "C2'" . DG  B  1 121 ? 5.560   2.106   -21.576 1.00 86.95  ? 267 DG  J "C2'" 1 
ATOM   5448  C  "C1'" . DG  B  1 121 ? 5.593   2.873   -20.262 1.00 85.49  ? 267 DG  J "C1'" 1 
ATOM   5449  N  N9    . DG  B  1 121 ? 6.854   2.730   -19.551 1.00 94.23  ? 267 DG  J N9    1 
ATOM   5450  C  C8    . DG  B  1 121 ? 7.671   1.625   -19.532 1.00 99.87  ? 267 DG  J C8    1 
ATOM   5451  N  N7    . DG  B  1 121 ? 8.737   1.779   -18.797 1.00 101.46 ? 267 DG  J N7    1 
ATOM   5452  C  C5    . DG  B  1 121 ? 8.617   3.066   -18.293 1.00 98.02  ? 267 DG  J C5    1 
ATOM   5453  C  C6    . DG  B  1 121 ? 9.474   3.789   -17.435 1.00 99.64  ? 267 DG  J C6    1 
ATOM   5454  O  O6    . DG  B  1 121 ? 10.543  3.420   -16.932 1.00 102.19 ? 267 DG  J O6    1 
ATOM   5455  N  N1    . DG  B  1 121 ? 8.982   5.064   -17.173 1.00 101.97 ? 267 DG  J N1    1 
ATOM   5456  C  C2    . DG  B  1 121 ? 7.808   5.573   -17.679 1.00 99.41  ? 267 DG  J C2    1 
ATOM   5457  N  N2    . DG  B  1 121 ? 7.496   6.824   -17.315 1.00 104.18 ? 267 DG  J N2    1 
ATOM   5458  N  N3    . DG  B  1 121 ? 6.996   4.906   -18.484 1.00 92.47  ? 267 DG  J N3    1 
ATOM   5459  C  C4    . DG  B  1 121 ? 7.462   3.664   -18.748 1.00 95.97  ? 267 DG  J C4    1 
ATOM   5460  P  P     . DG  B  1 122 ? 3.297   2.969   -23.878 1.00 88.91  ? 268 DG  J P     1 
ATOM   5461  O  OP1   . DG  B  1 122 ? 1.891   2.750   -24.295 1.00 64.05  ? 268 DG  J OP1   1 
ATOM   5462  O  OP2   . DG  B  1 122 ? 4.405   2.169   -24.464 1.00 71.37  ? 268 DG  J OP2   1 
ATOM   5463  O  "O5'" . DG  B  1 122 ? 3.651   4.515   -24.057 1.00 73.31  ? 268 DG  J "O5'" 1 
ATOM   5464  C  "C5'" . DG  B  1 122 ? 4.518   5.119   -23.126 1.00 76.36  ? 268 DG  J "C5'" 1 
ATOM   5465  C  "C4'" . DG  B  1 122 ? 4.733   6.586   -23.422 1.00 71.51  ? 268 DG  J "C4'" 1 
ATOM   5466  O  "O4'" . DG  B  1 122 ? 5.914   7.022   -22.730 1.00 77.17  ? 268 DG  J "O4'" 1 
ATOM   5467  C  "C3'" . DG  B  1 122 ? 5.033   6.922   -24.865 1.00 72.12  ? 268 DG  J "C3'" 1 
ATOM   5468  O  "O3'" . DG  B  1 122 ? 4.846   8.322   -25.049 1.00 68.28  ? 268 DG  J "O3'" 1 
ATOM   5469  C  "C2'" . DG  B  1 122 ? 6.507   6.529   -24.974 1.00 74.36  ? 268 DG  J "C2'" 1 
ATOM   5470  C  "C1'" . DG  B  1 122 ? 7.037   6.794   -23.560 1.00 78.93  ? 268 DG  J "C1'" 1 
ATOM   5471  N  N9    . DG  B  1 122 ? 7.794   5.675   -23.011 1.00 87.83  ? 268 DG  J N9    1 
ATOM   5472  C  C8    . DG  B  1 122 ? 7.700   4.352   -23.374 1.00 92.75  ? 268 DG  J C8    1 
ATOM   5473  N  N7    . DG  B  1 122 ? 8.499   3.573   -22.706 1.00 94.69  ? 268 DG  J N7    1 
ATOM   5474  C  C5    . DG  B  1 122 ? 9.175   4.432   -21.849 1.00 98.38  ? 268 DG  J C5    1 
ATOM   5475  C  C6    . DG  B  1 122 ? 10.174  4.161   -20.883 1.00 101.88 ? 268 DG  J C6    1 
ATOM   5476  O  O6    . DG  B  1 122 ? 10.681  3.068   -20.584 1.00 100.18 ? 268 DG  J O6    1 
ATOM   5477  N  N1    . DG  B  1 122 ? 10.584  5.322   -20.229 1.00 98.36  ? 268 DG  J N1    1 
ATOM   5478  C  C2    . DG  B  1 122 ? 10.091  6.582   -20.480 1.00 98.10  ? 268 DG  J C2    1 
ATOM   5479  N  N2    . DG  B  1 122 ? 10.610  7.580   -19.751 1.00 104.10 ? 268 DG  J N2    1 
ATOM   5480  N  N3    . DG  B  1 122 ? 9.158   6.847   -21.381 1.00 91.24  ? 268 DG  J N3    1 
ATOM   5481  C  C4    . DG  B  1 122 ? 8.748   5.730   -22.024 1.00 91.60  ? 268 DG  J C4    1 
ATOM   5482  P  P     . DT  B  1 123 ? 5.139   9.050   -26.454 1.00 62.59  ? 269 DT  J P     1 
ATOM   5483  O  OP1   . DT  B  1 123 ? 3.871   9.721   -26.817 1.00 53.64  ? 269 DT  J OP1   1 
ATOM   5484  O  OP2   . DT  B  1 123 ? 5.786   8.135   -27.419 1.00 64.48  ? 269 DT  J OP2   1 
ATOM   5485  O  "O5'" . DT  B  1 123 ? 6.224   10.157  -26.070 1.00 65.21  ? 269 DT  J "O5'" 1 
ATOM   5486  C  "C5'" . DT  B  1 123 ? 6.143   10.816  -24.812 1.00 69.06  ? 269 DT  J "C5'" 1 
ATOM   5487  C  "C4'" . DT  B  1 123 ? 7.450   11.511  -24.473 1.00 73.80  ? 269 DT  J "C4'" 1 
ATOM   5488  O  "O4'" . DT  B  1 123 ? 8.341   10.586  -23.795 1.00 77.22  ? 269 DT  J "O4'" 1 
ATOM   5489  C  "C3'" . DT  B  1 123 ? 8.220   12.055  -25.670 1.00 74.99  ? 269 DT  J "C3'" 1 
ATOM   5490  O  "O3'" . DT  B  1 123 ? 8.751   13.327  -25.357 1.00 76.64  ? 269 DT  J "O3'" 1 
ATOM   5491  C  "C2'" . DT  B  1 123 ? 9.322   11.017  -25.884 1.00 84.28  ? 269 DT  J "C2'" 1 
ATOM   5492  C  "C1'" . DT  B  1 123 ? 9.579   10.521  -24.468 1.00 82.71  ? 269 DT  J "C1'" 1 
ATOM   5493  N  N1    . DT  B  1 123 ? 10.054  9.112   -24.416 1.00 89.55  ? 269 DT  J N1    1 
ATOM   5494  C  C2    . DT  B  1 123 ? 10.816  8.692   -23.349 1.00 97.73  ? 269 DT  J C2    1 
ATOM   5495  O  O2    . DT  B  1 123 ? 11.140  9.422   -22.428 1.00 96.11  ? 269 DT  J O2    1 
ATOM   5496  N  N3    . DT  B  1 123 ? 11.189  7.374   -23.398 1.00 100.82 ? 269 DT  J N3    1 
ATOM   5497  C  C4    . DT  B  1 123 ? 10.883  6.454   -24.387 1.00 99.47  ? 269 DT  J C4    1 
ATOM   5498  O  O4    . DT  B  1 123 ? 11.267  5.289   -24.342 1.00 106.01 ? 269 DT  J O4    1 
ATOM   5499  C  C5    . DT  B  1 123 ? 10.079  6.960   -25.473 1.00 95.15  ? 269 DT  J C5    1 
ATOM   5500  C  C7    . DT  B  1 123 ? 9.684   6.055   -26.604 1.00 86.93  ? 269 DT  J C7    1 
ATOM   5501  C  C6    . DT  B  1 123 ? 9.708   8.248   -25.435 1.00 91.04  ? 269 DT  J C6    1 
ATOM   5502  P  P     . DA  B  1 124 ? 9.111   14.368  -26.524 1.00 81.63  ? 270 DA  J P     1 
ATOM   5503  O  OP1   . DA  B  1 124 ? 8.195   15.524  -26.389 1.00 73.49  ? 270 DA  J OP1   1 
ATOM   5504  O  OP2   . DA  B  1 124 ? 9.187   13.627  -27.803 1.00 82.20  ? 270 DA  J OP2   1 
ATOM   5505  O  "O5'" . DA  B  1 124 ? 10.599  14.828  -26.167 1.00 95.62  ? 270 DA  J "O5'" 1 
ATOM   5506  C  "C5'" . DA  B  1 124 ? 10.936  15.176  -24.826 1.00 97.12  ? 270 DA  J "C5'" 1 
ATOM   5507  C  "C4'" . DA  B  1 124 ? 12.441  15.150  -24.625 1.00 100.06 ? 270 DA  J "C4'" 1 
ATOM   5508  O  "O4'" . DA  B  1 124 ? 12.893  13.773  -24.549 1.00 95.52  ? 270 DA  J "O4'" 1 
ATOM   5509  C  "C3'" . DA  B  1 124 ? 13.249  15.800  -25.744 1.00 109.84 ? 270 DA  J "C3'" 1 
ATOM   5510  O  "O3'" . DA  B  1 124 ? 14.383  16.477  -25.210 1.00 116.92 ? 270 DA  J "O3'" 1 
ATOM   5511  C  "C2'" . DA  B  1 124 ? 13.657  14.611  -26.609 1.00 108.37 ? 270 DA  J "C2'" 1 
ATOM   5512  C  "C1'" . DA  B  1 124 ? 13.827  13.509  -25.575 1.00 102.51 ? 270 DA  J "C1'" 1 
ATOM   5513  N  N9    . DA  B  1 124 ? 13.548  12.184  -26.107 1.00 106.04 ? 270 DA  J N9    1 
ATOM   5514  C  C8    . DA  B  1 124 ? 12.924  11.888  -27.286 1.00 108.49 ? 270 DA  J C8    1 
ATOM   5515  N  N7    . DA  B  1 124 ? 12.801  10.602  -27.512 1.00 110.62 ? 270 DA  J N7    1 
ATOM   5516  C  C5    . DA  B  1 124 ? 13.384  10.014  -26.403 1.00 106.28 ? 270 DA  J C5    1 
ATOM   5517  C  C6    . DA  B  1 124 ? 13.574  8.670   -26.035 1.00 103.08 ? 270 DA  J C6    1 
ATOM   5518  N  N6    . DA  B  1 124 ? 13.176  7.640   -26.786 1.00 102.20 ? 270 DA  J N6    1 
ATOM   5519  N  N1    . DA  B  1 124 ? 14.193  8.426   -24.862 1.00 111.08 ? 270 DA  J N1    1 
ATOM   5520  C  C2    . DA  B  1 124 ? 14.590  9.461   -24.113 1.00 110.34 ? 270 DA  J C2    1 
ATOM   5521  N  N3    . DA  B  1 124 ? 14.467  10.765  -24.354 1.00 107.77 ? 270 DA  J N3    1 
ATOM   5522  C  C4    . DA  B  1 124 ? 13.850  10.975  -25.526 1.00 109.14 ? 270 DA  J C4    1 
ATOM   5523  P  P     . DG  B  1 125 ? 15.057  17.683  -26.033 1.00 131.02 ? 271 DG  J P     1 
ATOM   5524  O  OP1   . DG  B  1 125 ? 16.303  18.062  -25.328 1.00 132.01 ? 271 DG  J OP1   1 
ATOM   5525  O  OP2   . DG  B  1 125 ? 14.018  18.716  -26.250 1.00 111.39 ? 271 DG  J OP2   1 
ATOM   5526  O  "O5'" . DG  B  1 125 ? 15.388  17.029  -27.461 1.00 125.17 ? 271 DG  J "O5'" 1 
ATOM   5527  C  "C5'" . DG  B  1 125 ? 16.735  16.915  -27.921 1.00 131.36 ? 271 DG  J "C5'" 1 
ATOM   5528  C  "C4'" . DG  B  1 125 ? 17.505  15.866  -27.133 1.00 132.13 ? 271 DG  J "C4'" 1 
ATOM   5529  O  "O4'" . DG  B  1 125 ? 16.834  14.583  -27.224 1.00 125.09 ? 271 DG  J "O4'" 1 
ATOM   5530  C  "C3'" . DG  B  1 125 ? 18.945  15.628  -27.607 1.00 137.79 ? 271 DG  J "C3'" 1 
ATOM   5531  O  "O3'" . DG  B  1 125 ? 19.846  15.762  -26.516 1.00 138.87 ? 271 DG  J "O3'" 1 
ATOM   5532  C  "C2'" . DG  B  1 125 ? 18.924  14.195  -28.145 1.00 133.27 ? 271 DG  J "C2'" 1 
ATOM   5533  C  "C1'" . DG  B  1 125 ? 17.811  13.580  -27.320 1.00 126.57 ? 271 DG  J "C1'" 1 
ATOM   5534  N  N9    . DG  B  1 125 ? 17.215  12.398  -27.930 1.00 125.96 ? 271 DG  J N9    1 
ATOM   5535  C  C8    . DG  B  1 125 ? 16.395  12.356  -29.033 1.00 122.57 ? 271 DG  J C8    1 
ATOM   5536  N  N7    . DG  B  1 125 ? 16.015  11.149  -29.350 1.00 122.92 ? 271 DG  J N7    1 
ATOM   5537  C  C5    . DG  B  1 125 ? 16.623  10.339  -28.397 1.00 124.39 ? 271 DG  J C5    1 
ATOM   5538  C  C6    . DG  B  1 125 ? 16.578  8.933   -28.230 1.00 123.23 ? 271 DG  J C6    1 
ATOM   5539  O  O6    . DG  B  1 125 ? 15.972  8.098   -28.916 1.00 124.33 ? 271 DG  J O6    1 
ATOM   5540  N  N1    . DG  B  1 125 ? 17.338  8.518   -27.138 1.00 120.59 ? 271 DG  J N1    1 
ATOM   5541  C  C2    . DG  B  1 125 ? 18.050  9.355   -26.311 1.00 121.86 ? 271 DG  J C2    1 
ATOM   5542  N  N2    . DG  B  1 125 ? 18.722  8.770   -25.309 1.00 124.92 ? 271 DG  J N2    1 
ATOM   5543  N  N3    . DG  B  1 125 ? 18.100  10.673  -26.457 1.00 122.31 ? 271 DG  J N3    1 
ATOM   5544  C  C4    . DG  B  1 125 ? 17.366  11.093  -27.517 1.00 125.05 ? 271 DG  J C4    1 
ATOM   5545  P  P     . DA  B  1 126 ? 21.416  15.955  -26.790 1.00 137.02 ? 272 DA  J P     1 
ATOM   5546  O  OP1   . DA  B  1 126 ? 21.976  16.720  -25.653 1.00 128.12 ? 272 DA  J OP1   1 
ATOM   5547  O  OP2   . DA  B  1 126 ? 21.568  16.461  -28.173 1.00 139.01 ? 272 DA  J OP2   1 
ATOM   5548  O  "O5'" . DA  B  1 126 ? 21.997  14.466  -26.768 1.00 134.27 ? 272 DA  J "O5'" 1 
ATOM   5549  C  "C5'" . DA  B  1 126 ? 23.208  14.169  -27.449 1.00 135.74 ? 272 DA  J "C5'" 1 
ATOM   5550  C  "C4'" . DA  B  1 126 ? 23.521  12.688  -27.370 1.00 140.27 ? 272 DA  J "C4'" 1 
ATOM   5551  O  "O4'" . DA  B  1 126 ? 22.311  11.925  -27.633 1.00 136.95 ? 272 DA  J "O4'" 1 
ATOM   5552  C  "C3'" . DA  B  1 126 ? 24.560  12.197  -28.376 1.00 146.71 ? 272 DA  J "C3'" 1 
ATOM   5553  O  "O3'" . DA  B  1 126 ? 25.385  11.197  -27.784 1.00 151.15 ? 272 DA  J "O3'" 1 
ATOM   5554  C  "C2'" . DA  B  1 126 ? 23.703  11.625  -29.501 1.00 143.52 ? 272 DA  J "C2'" 1 
ATOM   5555  C  "C1'" . DA  B  1 126 ? 22.518  11.060  -28.730 1.00 139.61 ? 272 DA  J "C1'" 1 
ATOM   5556  N  N9    . DA  B  1 126 ? 21.289  11.005  -29.520 1.00 135.81 ? 272 DA  J N9    1 
ATOM   5557  C  C8    . DA  B  1 126 ? 20.706  12.031  -30.212 1.00 134.04 ? 272 DA  J C8    1 
ATOM   5558  N  N7    . DA  B  1 126 ? 19.605  11.688  -30.839 1.00 131.19 ? 272 DA  J N7    1 
ATOM   5559  C  C5    . DA  B  1 126 ? 19.456  10.343  -30.539 1.00 130.33 ? 272 DA  J C5    1 
ATOM   5560  C  C6    . DA  B  1 126 ? 18.482  9.390   -30.902 1.00 128.76 ? 272 DA  J C6    1 
ATOM   5561  N  N6    . DA  B  1 126 ? 17.431  9.670   -31.679 1.00 128.19 ? 272 DA  J N6    1 
ATOM   5562  N  N1    . DA  B  1 126 ? 18.631  8.133   -30.431 1.00 126.64 ? 272 DA  J N1    1 
ATOM   5563  C  C2    . DA  B  1 126 ? 19.683  7.856   -29.652 1.00 129.19 ? 272 DA  J C2    1 
ATOM   5564  N  N3    . DA  B  1 126 ? 20.661  8.666   -29.245 1.00 130.52 ? 272 DA  J N3    1 
ATOM   5565  C  C4    . DA  B  1 126 ? 20.487  9.906   -29.728 1.00 130.64 ? 272 DA  J C4    1 
ATOM   5566  P  P     . DA  B  1 127 ? 26.648  10.608  -28.586 1.00 157.14 ? 273 DA  J P     1 
ATOM   5567  O  OP1   . DA  B  1 127 ? 27.714  10.318  -27.601 1.00 149.33 ? 273 DA  J OP1   1 
ATOM   5568  O  OP2   . DA  B  1 127 ? 26.926  11.510  -29.727 1.00 151.00 ? 273 DA  J OP2   1 
ATOM   5569  O  "O5'" . DA  B  1 127 ? 26.112  9.221   -29.175 1.00 149.43 ? 273 DA  J "O5'" 1 
ATOM   5570  C  "C5'" . DA  B  1 127 ? 25.708  8.185   -28.289 1.00 142.39 ? 273 DA  J "C5'" 1 
ATOM   5571  C  "C4'" . DA  B  1 127 ? 25.451  6.890   -29.043 1.00 148.21 ? 273 DA  J "C4'" 1 
ATOM   5572  O  "O4'" . DA  B  1 127 ? 24.175  6.968   -29.729 1.00 142.48 ? 273 DA  J "O4'" 1 
ATOM   5573  C  "C3'" . DA  B  1 127 ? 26.490  6.534   -30.103 1.00 149.07 ? 273 DA  J "C3'" 1 
ATOM   5574  O  "O3'" . DA  B  1 127 ? 26.718  5.128   -30.100 1.00 153.73 ? 273 DA  J "O3'" 1 
ATOM   5575  C  "C2'" . DA  B  1 127 ? 25.841  7.005   -31.405 1.00 141.76 ? 273 DA  J "C2'" 1 
ATOM   5576  C  "C1'" . DA  B  1 127 ? 24.352  6.839   -31.126 1.00 137.80 ? 273 DA  J "C1'" 1 
ATOM   5577  N  N9    . DA  B  1 127 ? 23.539  7.860   -31.782 1.00 136.82 ? 273 DA  J N9    1 
ATOM   5578  C  C8    . DA  B  1 127 ? 23.880  9.169   -31.991 1.00 139.43 ? 273 DA  J C8    1 
ATOM   5579  N  N7    . DA  B  1 127 ? 22.955  9.867   -32.605 1.00 135.17 ? 273 DA  J N7    1 
ATOM   5580  C  C5    . DA  B  1 127 ? 21.934  8.955   -32.815 1.00 133.91 ? 273 DA  J C5    1 
ATOM   5581  C  C6    . DA  B  1 127 ? 20.668  9.072   -33.422 1.00 128.27 ? 273 DA  J C6    1 
ATOM   5582  N  N6    . DA  B  1 127 ? 20.209  10.213  -33.948 1.00 127.55 ? 273 DA  J N6    1 
ATOM   5583  N  N1    . DA  B  1 127 ? 19.890  7.969   -33.468 1.00 125.14 ? 273 DA  J N1    1 
ATOM   5584  C  C2    . DA  B  1 127 ? 20.356  6.829   -32.940 1.00 127.40 ? 273 DA  J C2    1 
ATOM   5585  N  N3    . DA  B  1 127 ? 21.526  6.596   -32.343 1.00 130.33 ? 273 DA  J N3    1 
ATOM   5586  C  C4    . DA  B  1 127 ? 22.276  7.711   -32.313 1.00 133.79 ? 273 DA  J C4    1 
ATOM   5587  P  P     . DT  B  1 128 ? 27.836  4.463   -31.048 1.00 168.48 ? 274 DT  J P     1 
ATOM   5588  O  OP1   . DT  B  1 128 ? 28.792  3.752   -30.170 1.00 161.16 ? 274 DT  J OP1   1 
ATOM   5589  O  OP2   . DT  B  1 128 ? 28.351  5.468   -32.007 1.00 154.16 ? 274 DT  J OP2   1 
ATOM   5590  O  "O5'" . DT  B  1 128 ? 27.010  3.371   -31.871 1.00 152.22 ? 274 DT  J "O5'" 1 
ATOM   5591  C  "C5'" . DT  B  1 128 ? 26.840  3.511   -33.271 1.00 144.24 ? 274 DT  J "C5'" 1 
ATOM   5592  C  "C4'" . DT  B  1 128 ? 25.609  2.759   -33.737 1.00 137.92 ? 274 DT  J "C4'" 1 
ATOM   5593  O  "O4'" . DT  B  1 128 ? 24.484  3.679   -33.814 1.00 135.40 ? 274 DT  J "O4'" 1 
ATOM   5594  C  "C3'" . DT  B  1 128 ? 25.725  2.139   -35.123 1.00 136.20 ? 274 DT  J "C3'" 1 
ATOM   5595  O  "O3'" . DT  B  1 128 ? 24.912  0.963   -35.196 1.00 131.59 ? 274 DT  J "O3'" 1 
ATOM   5596  C  "C2'" . DT  B  1 128 ? 25.188  3.256   -36.011 1.00 134.67 ? 274 DT  J "C2'" 1 
ATOM   5597  C  "C1'" . DT  B  1 128 ? 24.042  3.778   -35.154 1.00 134.39 ? 274 DT  J "C1'" 1 
ATOM   5598  N  N1    . DT  B  1 128 ? 23.668  5.204   -35.441 1.00 128.19 ? 274 DT  J N1    1 
ATOM   5599  C  C2    . DT  B  1 128 ? 22.399  5.490   -35.894 1.00 124.74 ? 274 DT  J C2    1 
ATOM   5600  O  O2    . DT  B  1 128 ? 21.545  4.639   -36.074 1.00 121.08 ? 274 DT  J O2    1 
ATOM   5601  N  N3    . DT  B  1 128 ? 22.160  6.819   -36.128 1.00 122.27 ? 274 DT  J N3    1 
ATOM   5602  C  C4    . DT  B  1 128 ? 23.044  7.870   -35.962 1.00 123.40 ? 274 DT  J C4    1 
ATOM   5603  O  O4    . DT  B  1 128 ? 22.733  9.032   -36.200 1.00 124.09 ? 274 DT  J O4    1 
ATOM   5604  C  C5    . DT  B  1 128 ? 24.357  7.503   -35.487 1.00 127.18 ? 274 DT  J C5    1 
ATOM   5605  C  C7    . DT  B  1 128 ? 25.401  8.558   -35.268 1.00 126.67 ? 274 DT  J C7    1 
ATOM   5606  C  C6    . DT  B  1 128 ? 24.604  6.203   -35.253 1.00 128.04 ? 274 DT  J C6    1 
ATOM   5607  P  P     . DC  B  1 129 ? 25.292  -0.239  -36.197 1.00 136.06 ? 275 DC  J P     1 
ATOM   5608  O  OP1   . DC  B  1 129 ? 25.402  -1.485  -35.404 1.00 125.61 ? 275 DC  J OP1   1 
ATOM   5609  O  OP2   . DC  B  1 129 ? 26.426  0.219   -37.033 1.00 125.33 ? 275 DC  J OP2   1 
ATOM   5610  O  "O5'" . DC  B  1 129 ? 24.010  -0.349  -37.144 1.00 135.36 ? 275 DC  J "O5'" 1 
ATOM   5611  C  "C5'" . DC  B  1 129 ? 23.509  0.826   -37.737 1.00 130.96 ? 275 DC  J "C5'" 1 
ATOM   5612  C  "C4'" . DC  B  1 129 ? 22.172  0.610   -38.407 1.00 120.59 ? 275 DC  J "C4'" 1 
ATOM   5613  O  "O4'" . DC  B  1 129 ? 21.564  1.901   -38.630 1.00 116.10 ? 275 DC  J "O4'" 1 
ATOM   5614  C  "C3'" . DC  B  1 129 ? 22.251  0.010   -39.792 1.00 115.49 ? 275 DC  J "C3'" 1 
ATOM   5615  O  "O3'" . DC  B  1 129 ? 20.962  -0.463  -40.179 1.00 109.16 ? 275 DC  J "O3'" 1 
ATOM   5616  C  "C2'" . DC  B  1 129 ? 22.680  1.224   -40.617 1.00 111.05 ? 275 DC  J "C2'" 1 
ATOM   5617  C  "C1'" . DC  B  1 129 ? 21.919  2.365   -39.924 1.00 117.70 ? 275 DC  J "C1'" 1 
ATOM   5618  N  N1    . DC  B  1 129 ? 22.716  3.641   -39.783 1.00 121.61 ? 275 DC  J N1    1 
ATOM   5619  C  C2    . DC  B  1 129 ? 22.104  4.873   -40.048 1.00 116.81 ? 275 DC  J C2    1 
ATOM   5620  O  O2    . DC  B  1 129 ? 20.915  4.895   -40.392 1.00 105.54 ? 275 DC  J O2    1 
ATOM   5621  N  N3    . DC  B  1 129 ? 22.834  6.011   -39.917 1.00 118.36 ? 275 DC  J N3    1 
ATOM   5622  C  C4    . DC  B  1 129 ? 24.113  5.948   -39.543 1.00 119.69 ? 275 DC  J C4    1 
ATOM   5623  N  N4    . DC  B  1 129 ? 24.790  7.097   -39.428 1.00 118.12 ? 275 DC  J N4    1 
ATOM   5624  C  C5    . DC  B  1 129 ? 24.754  4.704   -39.270 1.00 121.59 ? 275 DC  J C5    1 
ATOM   5625  C  C6    . DC  B  1 129 ? 24.028  3.589   -39.403 1.00 119.11 ? 275 DC  J C6    1 
ATOM   5626  P  P     . DT  B  1 130 ? 20.797  -1.499  -41.398 1.00 106.15 ? 276 DT  J P     1 
ATOM   5627  O  OP1   . DT  B  1 130 ? 20.084  -2.688  -40.878 1.00 96.68  ? 276 DT  J OP1   1 
ATOM   5628  O  OP2   . DT  B  1 130 ? 22.114  -1.648  -42.056 1.00 105.32 ? 276 DT  J OP2   1 
ATOM   5629  O  "O5'" . DT  B  1 130 ? 19.828  -0.734  -42.416 1.00 100.56 ? 276 DT  J "O5'" 1 
ATOM   5630  C  "C5'" . DT  B  1 130 ? 19.587  0.655   -42.242 1.00 98.79  ? 276 DT  J "C5'" 1 
ATOM   5631  C  "C4'" . DT  B  1 130 ? 19.087  1.289   -43.524 1.00 92.73  ? 276 DT  J "C4'" 1 
ATOM   5632  O  "O4'" . DT  B  1 130 ? 19.537  2.670   -43.575 1.00 95.95  ? 276 DT  J "O4'" 1 
ATOM   5633  C  "C3'" . DT  B  1 130 ? 19.610  0.656   -44.807 1.00 81.57  ? 276 DT  J "C3'" 1 
ATOM   5634  O  "O3'" . DT  B  1 130 ? 18.702  0.912   -45.859 1.00 71.57  ? 276 DT  J "O3'" 1 
ATOM   5635  C  "C2'" . DT  B  1 130 ? 20.898  1.431   -45.018 1.00 87.23  ? 276 DT  J "C2'" 1 
ATOM   5636  C  "C1'" . DT  B  1 130 ? 20.425  2.833   -44.664 1.00 92.78  ? 276 DT  J "C1'" 1 
ATOM   5637  N  N1    . DT  B  1 130 ? 21.520  3.758   -44.257 1.00 100.10 ? 276 DT  J N1    1 
ATOM   5638  C  C2    . DT  B  1 130 ? 21.357  5.111   -44.441 1.00 102.66 ? 276 DT  J C2    1 
ATOM   5639  O  O2    . DT  B  1 130 ? 20.351  5.604   -44.921 1.00 99.69  ? 276 DT  J O2    1 
ATOM   5640  N  N3    . DT  B  1 130 ? 22.419  5.877   -44.037 1.00 111.05 ? 276 DT  J N3    1 
ATOM   5641  C  C4    . DT  B  1 130 ? 23.605  5.434   -43.480 1.00 113.58 ? 276 DT  J C4    1 
ATOM   5642  O  O4    . DT  B  1 130 ? 24.502  6.204   -43.149 1.00 113.94 ? 276 DT  J O4    1 
ATOM   5643  C  C5    . DT  B  1 130 ? 23.713  4.001   -43.316 1.00 112.68 ? 276 DT  J C5    1 
ATOM   5644  C  C7    . DT  B  1 130 ? 24.954  3.399   -42.725 1.00 113.90 ? 276 DT  J C7    1 
ATOM   5645  C  C6    . DT  B  1 130 ? 22.677  3.242   -43.709 1.00 110.76 ? 276 DT  J C6    1 
ATOM   5646  P  P     . DG  B  1 131 ? 17.640  -0.197  -46.324 1.00 66.19  ? 277 DG  J P     1 
ATOM   5647  O  OP1   . DG  B  1 131 ? 17.648  -1.302  -45.341 1.00 88.97  ? 277 DG  J OP1   1 
ATOM   5648  O  OP2   . DG  B  1 131 ? 17.881  -0.461  -47.761 1.00 64.06  ? 277 DG  J OP2   1 
ATOM   5649  O  "O5'" . DG  B  1 131 ? 16.239  0.555   -46.232 1.00 71.88  ? 277 DG  J "O5'" 1 
ATOM   5650  C  "C5'" . DG  B  1 131 ? 15.501  0.795   -47.414 1.00 70.21  ? 277 DG  J "C5'" 1 
ATOM   5651  C  "C4'" . DG  B  1 131 ? 15.016  2.235   -47.486 1.00 64.85  ? 277 DG  J "C4'" 1 
ATOM   5652  O  "O4'" . DG  B  1 131 ? 16.065  3.141   -47.056 1.00 66.18  ? 277 DG  J "O4'" 1 
ATOM   5653  C  "C3'" . DG  B  1 131 ? 14.635  2.692   -48.881 1.00 62.73  ? 277 DG  J "C3'" 1 
ATOM   5654  O  "O3'" . DG  B  1 131 ? 13.613  3.654   -48.816 1.00 48.79  ? 277 DG  J "O3'" 1 
ATOM   5655  C  "C2'" . DG  B  1 131 ? 15.935  3.283   -49.415 1.00 64.57  ? 277 DG  J "C2'" 1 
ATOM   5656  C  "C1'" . DG  B  1 131 ? 16.562  3.881   -48.162 1.00 69.86  ? 277 DG  J "C1'" 1 
ATOM   5657  N  N9    . DG  B  1 131 ? 18.020  3.789   -48.151 1.00 81.65  ? 277 DG  J N9    1 
ATOM   5658  C  C8    . DG  B  1 131 ? 18.772  2.640   -48.194 1.00 86.20  ? 277 DG  J C8    1 
ATOM   5659  N  N7    . DG  B  1 131 ? 20.057  2.855   -48.158 1.00 86.85  ? 277 DG  J N7    1 
ATOM   5660  C  C5    . DG  B  1 131 ? 20.167  4.236   -48.090 1.00 91.47  ? 277 DG  J C5    1 
ATOM   5661  C  C6    . DG  B  1 131 ? 21.319  5.052   -48.030 1.00 99.28  ? 277 DG  J C6    1 
ATOM   5662  O  O6    . DG  B  1 131 ? 22.506  4.700   -48.023 1.00 101.83 ? 277 DG  J O6    1 
ATOM   5663  N  N1    . DG  B  1 131 ? 20.990  6.405   -47.971 1.00 101.01 ? 277 DG  J N1    1 
ATOM   5664  C  C2    . DG  B  1 131 ? 19.710  6.904   -47.970 1.00 94.15  ? 277 DG  J C2    1 
ATOM   5665  N  N2    . DG  B  1 131 ? 19.594  8.238   -47.908 1.00 94.87  ? 277 DG  J N2    1 
ATOM   5666  N  N3    . DG  B  1 131 ? 18.618  6.149   -48.026 1.00 89.59  ? 277 DG  J N3    1 
ATOM   5667  C  C4    . DG  B  1 131 ? 18.922  4.829   -48.084 1.00 87.17  ? 277 DG  J C4    1 
ATOM   5668  P  P     . DC  B  1 132 ? 12.676  3.886   -50.096 1.00 51.51  ? 278 DC  J P     1 
ATOM   5669  O  OP1   . DC  B  1 132 ? 11.289  4.060   -49.609 1.00 57.33  ? 278 DC  J OP1   1 
ATOM   5670  O  OP2   . DC  B  1 132 ? 12.988  2.825   -51.079 1.00 59.24  ? 278 DC  J OP2   1 
ATOM   5671  O  "O5'" . DC  B  1 132 ? 13.218  5.255   -50.711 1.00 62.76  ? 278 DC  J "O5'" 1 
ATOM   5672  C  "C5'" . DC  B  1 132 ? 13.650  6.294   -49.846 1.00 61.60  ? 278 DC  J "C5'" 1 
ATOM   5673  C  "C4'" . DC  B  1 132 ? 14.500  7.298   -50.598 1.00 67.93  ? 278 DC  J "C4'" 1 
ATOM   5674  O  "O4'" . DC  B  1 132 ? 15.896  6.914   -50.525 1.00 74.11  ? 278 DC  J "O4'" 1 
ATOM   5675  C  "C3'" . DC  B  1 132 ? 14.178  7.433   -52.087 1.00 73.84  ? 278 DC  J "C3'" 1 
ATOM   5676  O  "O3'" . DC  B  1 132 ? 14.261  8.791   -52.462 1.00 86.41  ? 278 DC  J "O3'" 1 
ATOM   5677  C  "C2'" . DC  B  1 132 ? 15.284  6.617   -52.748 1.00 73.71  ? 278 DC  J "C2'" 1 
ATOM   5678  C  "C1'" . DC  B  1 132 ? 16.446  6.923   -51.823 1.00 80.05  ? 278 DC  J "C1'" 1 
ATOM   5679  N  N1    . DC  B  1 132 ? 17.538  5.919   -51.876 1.00 85.44  ? 278 DC  J N1    1 
ATOM   5680  C  C2    . DC  B  1 132 ? 18.842  6.297   -51.537 1.00 89.47  ? 278 DC  J C2    1 
ATOM   5681  O  O2    . DC  B  1 132 ? 19.065  7.466   -51.202 1.00 90.49  ? 278 DC  J O2    1 
ATOM   5682  N  N3    . DC  B  1 132 ? 19.825  5.368   -51.583 1.00 91.47  ? 278 DC  J N3    1 
ATOM   5683  C  C4    . DC  B  1 132 ? 19.544  4.118   -51.947 1.00 93.87  ? 278 DC  J C4    1 
ATOM   5684  N  N4    . DC  B  1 132 ? 20.549  3.236   -51.979 1.00 97.28  ? 278 DC  J N4    1 
ATOM   5685  C  C5    . DC  B  1 132 ? 18.221  3.714   -52.297 1.00 88.76  ? 278 DC  J C5    1 
ATOM   5686  C  C6    . DC  B  1 132 ? 17.260  4.639   -52.249 1.00 82.24  ? 278 DC  J C6    1 
ATOM   5687  P  P     . DA  B  1 133 ? 13.112  9.462   -53.356 1.00 80.09  ? 279 DA  J P     1 
ATOM   5688  O  OP1   . DA  B  1 133 ? 11.852  9.414   -52.578 1.00 77.18  ? 279 DA  J OP1   1 
ATOM   5689  O  OP2   . DA  B  1 133 ? 13.174  8.863   -54.709 1.00 72.62  ? 279 DA  J OP2   1 
ATOM   5690  O  "O5'" . DA  B  1 133 ? 13.592  10.978  -53.487 1.00 89.38  ? 279 DA  J "O5'" 1 
ATOM   5691  C  "C5'" . DA  B  1 133 ? 14.349  11.571  -52.441 1.00 89.37  ? 279 DA  J "C5'" 1 
ATOM   5692  C  "C4'" . DA  B  1 133 ? 15.615  12.217  -52.982 1.00 96.94  ? 279 DA  J "C4'" 1 
ATOM   5693  O  "O4'" . DA  B  1 133 ? 16.650  11.211  -53.151 1.00 91.42  ? 279 DA  J "O4'" 1 
ATOM   5694  C  "C3'" . DA  B  1 133 ? 15.475  12.903  -54.338 1.00 93.85  ? 279 DA  J "C3'" 1 
ATOM   5695  O  "O3'" . DA  B  1 133 ? 16.323  14.049  -54.376 1.00 104.87 ? 279 DA  J "O3'" 1 
ATOM   5696  C  "C2'" . DA  B  1 133 ? 15.947  11.819  -55.304 1.00 92.98  ? 279 DA  J "C2'" 1 
ATOM   5697  C  "C1'" . DA  B  1 133 ? 17.069  11.176  -54.501 1.00 94.26  ? 279 DA  J "C1'" 1 
ATOM   5698  N  N9    . DA  B  1 133 ? 17.327  9.785   -54.860 1.00 95.15  ? 279 DA  J N9    1 
ATOM   5699  C  C8    . DA  B  1 133 ? 16.461  8.913   -55.460 1.00 95.89  ? 279 DA  J C8    1 
ATOM   5700  N  N7    . DA  B  1 133 ? 16.966  7.717   -55.653 1.00 98.00  ? 279 DA  J N7    1 
ATOM   5701  C  C5    . DA  B  1 133 ? 18.249  7.810   -55.138 1.00 98.55  ? 279 DA  J C5    1 
ATOM   5702  C  C6    . DA  B  1 133 ? 19.304  6.880   -55.039 1.00 101.42 ? 279 DA  J C6    1 
ATOM   5703  N  N6    . DA  B  1 133 ? 19.219  5.620   -55.476 1.00 104.40 ? 279 DA  J N6    1 
ATOM   5704  N  N1    . DA  B  1 133 ? 20.454  7.297   -54.475 1.00 102.36 ? 279 DA  J N1    1 
ATOM   5705  C  C2    . DA  B  1 133 ? 20.537  8.558   -54.044 1.00 101.31 ? 279 DA  J C2    1 
ATOM   5706  N  N3    . DA  B  1 133 ? 19.618  9.520   -54.080 1.00 97.86  ? 279 DA  J N3    1 
ATOM   5707  C  C4    . DA  B  1 133 ? 18.487  9.077   -54.647 1.00 95.50  ? 279 DA  J C4    1 
ATOM   5708  P  P     . DG  B  1 134 ? 16.119  15.196  -55.484 1.00 103.34 ? 280 DG  J P     1 
ATOM   5709  O  OP1   . DG  B  1 134 ? 15.858  16.461  -54.762 1.00 102.49 ? 280 DG  J OP1   1 
ATOM   5710  O  OP2   . DG  B  1 134 ? 15.151  14.708  -56.493 1.00 100.91 ? 280 DG  J OP2   1 
ATOM   5711  O  "O5'" . DG  B  1 134 ? 17.557  15.291  -56.176 1.00 103.27 ? 280 DG  J "O5'" 1 
ATOM   5712  C  "C5'" . DG  B  1 134 ? 18.324  14.112  -56.307 1.00 105.36 ? 280 DG  J "C5'" 1 
ATOM   5713  C  "C4'" . DG  B  1 134 ? 19.685  14.384  -56.898 1.00 102.93 ? 280 DG  J "C4'" 1 
ATOM   5714  O  "O4'" . DG  B  1 134 ? 20.374  13.120  -57.026 1.00 100.62 ? 280 DG  J "O4'" 1 
ATOM   5715  C  "C3'" . DG  B  1 134 ? 19.669  14.933  -58.311 1.00 110.65 ? 280 DG  J "C3'" 1 
ATOM   5716  O  "O3'" . DG  B  1 134 ? 20.962  15.452  -58.627 1.00 115.77 ? 280 DG  J "O3'" 1 
ATOM   5717  C  "C2'" . DG  B  1 134 ? 19.365  13.669  -59.101 1.00 106.27 ? 280 DG  J "C2'" 1 
ATOM   5718  C  "C1'" . DG  B  1 134 ? 20.186  12.623  -58.342 1.00 109.35 ? 280 DG  J "C1'" 1 
ATOM   5719  N  N9    . DG  B  1 134 ? 19.528  11.319  -58.279 1.00 110.13 ? 280 DG  J N9    1 
ATOM   5720  C  C8    . DG  B  1 134 ? 18.176  11.071  -58.340 1.00 104.23 ? 280 DG  J C8    1 
ATOM   5721  N  N7    . DG  B  1 134 ? 17.876  9.804   -58.282 1.00 97.08  ? 280 DG  J N7    1 
ATOM   5722  C  C5    . DG  B  1 134 ? 19.107  9.168   -58.185 1.00 104.99 ? 280 DG  J C5    1 
ATOM   5723  C  C6    . DG  B  1 134 ? 19.416  7.791   -58.092 1.00 105.95 ? 280 DG  J C6    1 
ATOM   5724  O  O6    . DG  B  1 134 ? 18.636  6.830   -58.074 1.00 100.82 ? 280 DG  J O6    1 
ATOM   5725  N  N1    . DG  B  1 134 ? 20.789  7.575   -58.008 1.00 111.28 ? 280 DG  J N1    1 
ATOM   5726  C  C2    . DG  B  1 134 ? 21.744  8.565   -58.018 1.00 111.03 ? 280 DG  J C2    1 
ATOM   5727  N  N2    . DG  B  1 134 ? 23.020  8.161   -57.932 1.00 113.14 ? 280 DG  J N2    1 
ATOM   5728  N  N3    . DG  B  1 134 ? 21.468  9.860   -58.107 1.00 108.22 ? 280 DG  J N3    1 
ATOM   5729  C  C4    . DG  B  1 134 ? 20.134  10.087  -58.184 1.00 107.35 ? 280 DG  J C4    1 
ATOM   5730  P  P     . DG  B  1 135 ? 21.289  16.120  -60.056 1.00 106.95 ? 281 DG  J P     1 
ATOM   5731  O  OP1   . DG  B  1 135 ? 21.289  17.585  -59.857 1.00 110.58 ? 281 DG  J OP1   1 
ATOM   5732  O  OP2   . DG  B  1 135 ? 20.455  15.542  -61.134 1.00 97.45  ? 281 DG  J OP2   1 
ATOM   5733  O  "O5'" . DG  B  1 135 ? 22.791  15.648  -60.323 1.00 119.06 ? 281 DG  J "O5'" 1 
ATOM   5734  C  "C5'" . DG  B  1 135 ? 23.284  14.472  -59.682 1.00 111.87 ? 281 DG  J "C5'" 1 
ATOM   5735  C  "C4'" . DG  B  1 135 ? 24.097  13.640  -60.650 1.00 117.03 ? 281 DG  J "C4'" 1 
ATOM   5736  O  "O4'" . DG  B  1 135 ? 23.714  12.240  -60.527 1.00 115.98 ? 281 DG  J "O4'" 1 
ATOM   5737  C  "C3'" . DG  B  1 135 ? 23.892  13.999  -62.119 1.00 121.35 ? 281 DG  J "C3'" 1 
ATOM   5738  O  "O3'" . DG  B  1 135 ? 25.108  13.812  -62.838 1.00 130.39 ? 281 DG  J "O3'" 1 
ATOM   5739  C  "C2'" . DG  B  1 135 ? 22.823  13.003  -62.549 1.00 120.17 ? 281 DG  J "C2'" 1 
ATOM   5740  C  "C1'" . DG  B  1 135 ? 23.251  11.767  -61.775 1.00 117.93 ? 281 DG  J "C1'" 1 
ATOM   5741  N  N9    . DG  B  1 135 ? 22.161  10.819  -61.553 1.00 116.07 ? 281 DG  J N9    1 
ATOM   5742  C  C8    . DG  B  1 135 ? 20.832  11.118  -61.378 1.00 111.51 ? 281 DG  J C8    1 
ATOM   5743  N  N7    . DG  B  1 135 ? 20.078  10.068  -61.214 1.00 109.82 ? 281 DG  J N7    1 
ATOM   5744  C  C5    . DG  B  1 135 ? 20.962  8.999   -61.286 1.00 112.45 ? 281 DG  J C5    1 
ATOM   5745  C  C6    . DG  B  1 135 ? 20.721  7.608   -61.179 1.00 113.32 ? 281 DG  J C6    1 
ATOM   5746  O  O6    . DG  B  1 135 ? 19.642  7.027   -60.990 1.00 106.81 ? 281 DG  J O6    1 
ATOM   5747  N  N1    . DG  B  1 135 ? 21.895  6.869   -61.314 1.00 118.88 ? 281 DG  J N1    1 
ATOM   5748  C  C2    . DG  B  1 135 ? 23.143  7.407   -61.526 1.00 118.59 ? 281 DG  J C2    1 
ATOM   5749  N  N2    . DG  B  1 135 ? 24.156  6.534   -61.631 1.00 122.81 ? 281 DG  J N2    1 
ATOM   5750  N  N3    . DG  B  1 135 ? 23.383  8.710   -61.629 1.00 117.33 ? 281 DG  J N3    1 
ATOM   5751  C  C4    . DG  B  1 135 ? 22.250  9.444   -61.499 1.00 115.57 ? 281 DG  J C4    1 
ATOM   5752  P  P     . DT  B  1 136 ? 25.292  14.424  -64.314 1.00 138.77 ? 282 DT  J P     1 
ATOM   5753  O  OP1   . DT  B  1 136 ? 26.457  15.336  -64.267 1.00 136.54 ? 282 DT  J OP1   1 
ATOM   5754  O  OP2   . DT  B  1 136 ? 23.982  14.928  -64.787 1.00 120.44 ? 282 DT  J OP2   1 
ATOM   5755  O  "O5'" . DT  B  1 136 ? 25.678  13.148  -65.198 1.00 127.74 ? 282 DT  J "O5'" 1 
ATOM   5756  C  "C5'" . DT  B  1 136 ? 25.007  11.919  -64.978 1.00 121.16 ? 282 DT  J "C5'" 1 
ATOM   5757  C  "C4'" . DT  B  1 136 ? 25.772  10.765  -65.584 1.00 121.23 ? 282 DT  J "C4'" 1 
ATOM   5758  O  "O4'" . DT  B  1 136 ? 25.236  9.520   -65.080 1.00 124.39 ? 282 DT  J "O4'" 1 
ATOM   5759  C  "C3'" . DT  B  1 136 ? 25.679  10.675  -67.096 1.00 126.00 ? 282 DT  J "C3'" 1 
ATOM   5760  O  "O3'" . DT  B  1 136 ? 26.867  10.129  -67.634 1.00 133.57 ? 282 DT  J "O3'" 1 
ATOM   5761  C  "C2'" . DT  B  1 136 ? 24.481  9.759   -67.324 1.00 126.81 ? 282 DT  J "C2'" 1 
ATOM   5762  C  "C1'" . DT  B  1 136 ? 24.453  8.882   -66.071 1.00 126.34 ? 282 DT  J "C1'" 1 
ATOM   5763  N  N1    . DT  B  1 136 ? 23.070  8.684   -65.535 1.00 122.66 ? 282 DT  J N1    1 
ATOM   5764  C  C2    . DT  B  1 136 ? 22.643  7.417   -65.213 1.00 117.93 ? 282 DT  J C2    1 
ATOM   5765  O  O2    . DT  B  1 136 ? 23.343  6.427   -65.325 1.00 118.05 ? 282 DT  J O2    1 
ATOM   5766  N  N3    . DT  B  1 136 ? 21.357  7.350   -64.742 1.00 115.51 ? 282 DT  J N3    1 
ATOM   5767  C  C4    . DT  B  1 136 ? 20.472  8.401   -64.572 1.00 115.83 ? 282 DT  J C4    1 
ATOM   5768  O  O4    . DT  B  1 136 ? 19.335  8.239   -64.141 1.00 112.53 ? 282 DT  J O4    1 
ATOM   5769  C  C5    . DT  B  1 136 ? 20.982  9.701   -64.936 1.00 116.58 ? 282 DT  J C5    1 
ATOM   5770  C  C7    . DT  B  1 136 ? 20.117  10.919  -64.794 1.00 114.18 ? 282 DT  J C7    1 
ATOM   5771  C  C6    . DT  B  1 136 ? 22.239  9.778   -65.397 1.00 120.04 ? 282 DT  J C6    1 
ATOM   5772  P  P     . DG  B  1 137 ? 27.164  10.272  -69.205 1.00 140.00 ? 283 DG  J P     1 
ATOM   5773  O  OP1   . DG  B  1 137 ? 28.629  10.394  -69.387 1.00 132.16 ? 283 DG  J OP1   1 
ATOM   5774  O  OP2   . DG  B  1 137 ? 26.272  11.336  -69.721 1.00 132.79 ? 283 DG  J OP2   1 
ATOM   5775  O  "O5'" . DG  B  1 137 ? 26.649  8.886   -69.818 1.00 131.16 ? 283 DG  J "O5'" 1 
ATOM   5776  C  "C5'" . DG  B  1 137 ? 26.963  7.655   -69.171 1.00 125.21 ? 283 DG  J "C5'" 1 
ATOM   5777  C  "C4'" . DG  B  1 137 ? 26.141  6.515   -69.749 1.00 129.47 ? 283 DG  J "C4'" 1 
ATOM   5778  O  "O4'" . DG  B  1 137 ? 24.827  6.495   -69.126 1.00 131.35 ? 283 DG  J "O4'" 1 
ATOM   5779  C  "C3'" . DG  B  1 137 ? 25.893  6.594   -71.257 1.00 135.32 ? 283 DG  J "C3'" 1 
ATOM   5780  O  "O3'" . DG  B  1 137 ? 25.962  5.290   -71.835 1.00 141.95 ? 283 DG  J "O3'" 1 
ATOM   5781  C  "C2'" . DG  B  1 137 ? 24.481  7.169   -71.338 1.00 134.18 ? 283 DG  J "C2'" 1 
ATOM   5782  C  "C1'" . DG  B  1 137 ? 23.830  6.523   -70.127 1.00 133.68 ? 283 DG  J "C1'" 1 
ATOM   5783  N  N9    . DG  B  1 137 ? 22.679  7.267   -69.619 1.00 129.04 ? 283 DG  J N9    1 
ATOM   5784  C  C8    . DG  B  1 137 ? 22.494  8.629   -69.652 1.00 125.76 ? 283 DG  J C8    1 
ATOM   5785  N  N7    . DG  B  1 137 ? 21.368  9.015   -69.120 1.00 122.07 ? 283 DG  J N7    1 
ATOM   5786  C  C5    . DG  B  1 137 ? 20.761  7.832   -68.714 1.00 122.91 ? 283 DG  J C5    1 
ATOM   5787  C  C6    . DG  B  1 137 ? 19.515  7.619   -68.079 1.00 115.91 ? 283 DG  J C6    1 
ATOM   5788  O  O6    . DG  B  1 137 ? 18.676  8.463   -67.735 1.00 118.64 ? 283 DG  J O6    1 
ATOM   5789  N  N1    . DG  B  1 137 ? 19.279  6.266   -67.845 1.00 109.79 ? 283 DG  J N1    1 
ATOM   5790  C  C2    . DG  B  1 137 ? 20.139  5.247   -68.184 1.00 113.95 ? 283 DG  J C2    1 
ATOM   5791  N  N2    . DG  B  1 137 ? 19.737  4.004   -67.878 1.00 109.30 ? 283 DG  J N2    1 
ATOM   5792  N  N3    . DG  B  1 137 ? 21.311  5.432   -68.782 1.00 117.44 ? 283 DG  J N3    1 
ATOM   5793  C  C4    . DG  B  1 137 ? 21.555  6.746   -69.017 1.00 124.68 ? 283 DG  J C4    1 
ATOM   5794  P  P     . DG  B  1 138 ? 26.070  5.108   -73.430 1.00 151.71 ? 284 DG  J P     1 
ATOM   5795  O  OP1   . DG  B  1 138 ? 27.378  4.482   -73.719 1.00 143.27 ? 284 DG  J OP1   1 
ATOM   5796  O  OP2   . DG  B  1 138 ? 25.717  6.393   -74.077 1.00 139.80 ? 284 DG  J OP2   1 
ATOM   5797  O  "O5'" . DG  B  1 138 ? 24.918  4.051   -73.775 1.00 139.26 ? 284 DG  J "O5'" 1 
ATOM   5798  C  "C5'" . DG  B  1 138 ? 25.086  2.676   -73.438 1.00 136.17 ? 284 DG  J "C5'" 1 
ATOM   5799  C  "C4'" . DG  B  1 138 ? 23.749  1.950   -73.437 1.00 140.72 ? 284 DG  J "C4'" 1 
ATOM   5800  O  "O4'" . DG  B  1 138 ? 22.806  2.674   -72.600 1.00 139.50 ? 284 DG  J "O4'" 1 
ATOM   5801  C  "C3'" . DG  B  1 138 ? 23.080  1.813   -74.803 1.00 137.22 ? 284 DG  J "C3'" 1 
ATOM   5802  O  "O3'" . DG  B  1 138 ? 22.389  0.565   -74.884 1.00 137.63 ? 284 DG  J "O3'" 1 
ATOM   5803  C  "C2'" . DG  B  1 138 ? 22.116  2.995   -74.826 1.00 133.44 ? 284 DG  J "C2'" 1 
ATOM   5804  C  "C1'" . DG  B  1 138 ? 21.691  3.087   -73.366 1.00 133.67 ? 284 DG  J "C1'" 1 
ATOM   5805  N  N9    . DG  B  1 138 ? 21.320  4.444   -72.961 1.00 128.80 ? 284 DG  J N9    1 
ATOM   5806  C  C8    . DG  B  1 138 ? 22.023  5.600   -73.206 1.00 126.06 ? 284 DG  J C8    1 
ATOM   5807  N  N7    . DG  B  1 138 ? 21.448  6.671   -72.733 1.00 119.66 ? 284 DG  J N7    1 
ATOM   5808  C  C5    . DG  B  1 138 ? 20.285  6.199   -72.138 1.00 117.60 ? 284 DG  J C5    1 
ATOM   5809  C  C6    . DG  B  1 138 ? 19.259  6.900   -71.461 1.00 114.28 ? 284 DG  J C6    1 
ATOM   5810  O  O6    . DG  B  1 138 ? 19.173  8.118   -71.245 1.00 110.06 ? 284 DG  J O6    1 
ATOM   5811  N  N1    . DG  B  1 138 ? 18.259  6.041   -71.010 1.00 110.31 ? 284 DG  J N1    1 
ATOM   5812  C  C2    . DG  B  1 138 ? 18.251  4.678   -71.192 1.00 111.13 ? 284 DG  J C2    1 
ATOM   5813  N  N2    . DG  B  1 138 ? 17.199  4.017   -70.686 1.00 106.50 ? 284 DG  J N2    1 
ATOM   5814  N  N3    . DG  B  1 138 ? 19.206  4.008   -71.826 1.00 115.72 ? 284 DG  J N3    1 
ATOM   5815  C  C4    . DG  B  1 138 ? 20.189  4.829   -72.271 1.00 119.74 ? 284 DG  J C4    1 
ATOM   5816  P  P     . DA  B  1 139 ? 21.735  0.072   -76.270 1.00 147.11 ? 285 DA  J P     1 
ATOM   5817  O  OP1   . DA  B  1 139 ? 22.359  -1.221  -76.626 1.00 135.36 ? 285 DA  J OP1   1 
ATOM   5818  O  OP2   . DA  B  1 139 ? 21.761  1.181   -77.249 1.00 143.28 ? 285 DA  J OP2   1 
ATOM   5819  O  "O5'" . DA  B  1 139 ? 20.209  -0.201  -75.886 1.00 137.11 ? 285 DA  J "O5'" 1 
ATOM   5820  C  "C5'" . DA  B  1 139 ? 19.894  -1.172  -74.898 1.00 134.89 ? 285 DA  J "C5'" 1 
ATOM   5821  C  "C4'" . DA  B  1 139 ? 18.415  -1.144  -74.560 1.00 136.76 ? 285 DA  J "C4'" 1 
ATOM   5822  O  "O4'" . DA  B  1 139 ? 18.085  0.118   -73.919 1.00 133.67 ? 285 DA  J "O4'" 1 
ATOM   5823  C  "C3'" . DA  B  1 139 ? 17.473  -1.275  -75.755 1.00 133.48 ? 285 DA  J "C3'" 1 
ATOM   5824  O  "O3'" . DA  B  1 139 ? 16.356  -2.078  -75.396 1.00 139.04 ? 285 DA  J "O3'" 1 
ATOM   5825  C  "C2'" . DA  B  1 139 ? 17.065  0.172   -76.033 1.00 128.80 ? 285 DA  J "C2'" 1 
ATOM   5826  C  "C1'" . DA  B  1 139 ? 17.053  0.768   -74.632 1.00 128.44 ? 285 DA  J "C1'" 1 
ATOM   5827  N  N9    . DA  B  1 139 ? 17.317  2.206   -74.612 1.00 122.42 ? 285 DA  J N9    1 
ATOM   5828  C  C8    . DA  B  1 139 ? 18.457  2.837   -75.025 1.00 118.43 ? 285 DA  J C8    1 
ATOM   5829  N  N7    . DA  B  1 139 ? 18.419  4.142   -74.892 1.00 112.03 ? 285 DA  J N7    1 
ATOM   5830  C  C5    . DA  B  1 139 ? 17.168  4.386   -74.352 1.00 108.18 ? 285 DA  J C5    1 
ATOM   5831  C  C6    . DA  B  1 139 ? 16.515  5.575   -73.973 1.00 104.40 ? 285 DA  J C6    1 
ATOM   5832  N  N6    . DA  B  1 139 ? 17.068  6.788   -74.092 1.00 101.82 ? 285 DA  J N6    1 
ATOM   5833  N  N1    . DA  B  1 139 ? 15.269  5.470   -73.466 1.00 100.63 ? 285 DA  J N1    1 
ATOM   5834  C  C2    . DA  B  1 139 ? 14.720  4.254   -73.350 1.00 102.96 ? 285 DA  J C2    1 
ATOM   5835  N  N3    . DA  B  1 139 ? 15.235  3.067   -73.671 1.00 106.57 ? 285 DA  J N3    1 
ATOM   5836  C  C4    . DA  B  1 139 ? 16.473  3.204   -74.171 1.00 111.21 ? 285 DA  J C4    1 
ATOM   5837  P  P     . DT  B  1 140 ? 15.319  -2.594  -76.510 1.00 149.86 ? 286 DT  J P     1 
ATOM   5838  O  OP1   . DT  B  1 140 ? 15.327  -4.074  -76.476 1.00 145.67 ? 286 DT  J OP1   1 
ATOM   5839  O  OP2   . DT  B  1 140 ? 15.600  -1.894  -77.785 1.00 131.07 ? 286 DT  J OP2   1 
ATOM   5840  O  "O5'" . DT  B  1 140 ? 13.908  -2.088  -75.956 1.00 134.35 ? 286 DT  J "O5'" 1 
ATOM   5841  C  "C5'" . DT  B  1 140 ? 13.871  -1.074  -74.959 1.00 125.63 ? 286 DT  J "C5'" 1 
ATOM   5842  C  "C4'" . DT  B  1 140 ? 12.483  -0.480  -74.837 1.00 119.78 ? 286 DT  J "C4'" 1 
ATOM   5843  O  "O4'" . DT  B  1 140 ? 12.592  0.957   -74.661 1.00 112.30 ? 286 DT  J "O4'" 1 
ATOM   5844  C  "C3'" . DT  B  1 140 ? 11.582  -0.687  -76.050 1.00 116.78 ? 286 DT  J "C3'" 1 
ATOM   5845  O  "O3'" . DT  B  1 140 ? 10.231  -0.846  -75.624 1.00 110.89 ? 286 DT  J "O3'" 1 
ATOM   5846  C  "C2'" . DT  B  1 140 ? 11.787  0.597   -76.847 1.00 106.09 ? 286 DT  J "C2'" 1 
ATOM   5847  C  "C1'" . DT  B  1 140 ? 11.981  1.629   -75.744 1.00 108.04 ? 286 DT  J "C1'" 1 
ATOM   5848  N  N1    . DT  B  1 140 ? 12.860  2.763   -76.155 1.00 104.57 ? 286 DT  J N1    1 
ATOM   5849  C  C2    . DT  B  1 140 ? 12.501  4.052   -75.827 1.00 95.52  ? 286 DT  J C2    1 
ATOM   5850  O  O2    . DT  B  1 140 ? 11.494  4.329   -75.198 1.00 91.81  ? 286 DT  J O2    1 
ATOM   5851  N  N3    . DT  B  1 140 ? 13.374  5.014   -76.259 1.00 92.31  ? 286 DT  J N3    1 
ATOM   5852  C  C4    . DT  B  1 140 ? 14.541  4.822   -76.973 1.00 95.53  ? 286 DT  J C4    1 
ATOM   5853  O  O4    . DT  B  1 140 ? 15.260  5.754   -77.315 1.00 93.03  ? 286 DT  J O4    1 
ATOM   5854  C  C5    . DT  B  1 140 ? 14.856  3.448   -77.287 1.00 103.33 ? 286 DT  J C5    1 
ATOM   5855  C  C7    . DT  B  1 140 ? 16.098  3.116   -78.060 1.00 107.46 ? 286 DT  J C7    1 
ATOM   5856  C  C6    . DT  B  1 140 ? 14.009  2.497   -76.869 1.00 103.27 ? 286 DT  J C6    1 
ATOM   5857  P  P     . DA  B  1 141 ? 9.028   -0.908  -76.690 1.00 120.48 ? 287 DA  J P     1 
ATOM   5858  O  OP1   . DA  B  1 141 ? 8.020   -1.847  -76.152 1.00 123.96 ? 287 DA  J OP1   1 
ATOM   5859  O  OP2   . DA  B  1 141 ? 9.574   -1.133  -78.049 1.00 114.24 ? 287 DA  J OP2   1 
ATOM   5860  O  "O5'" . DA  B  1 141 ? 8.405   0.558   -76.618 1.00 109.42 ? 287 DA  J "O5'" 1 
ATOM   5861  C  "C5'" . DA  B  1 141 ? 8.062   1.102   -75.352 1.00 104.23 ? 287 DA  J "C5'" 1 
ATOM   5862  C  "C4'" . DA  B  1 141 ? 7.719   2.574   -75.462 1.00 96.73  ? 287 DA  J "C4'" 1 
ATOM   5863  O  "O4'" . DA  B  1 141 ? 8.883   3.319   -75.892 1.00 84.03  ? 287 DA  J "O4'" 1 
ATOM   5864  C  "C3'" . DA  B  1 141 ? 6.600   2.904   -76.451 1.00 88.76  ? 287 DA  J "C3'" 1 
ATOM   5865  O  "O3'" . DA  B  1 141 ? 5.625   3.696   -75.800 1.00 82.48  ? 287 DA  J "O3'" 1 
ATOM   5866  C  "C2'" . DA  B  1 141 ? 7.310   3.674   -77.572 1.00 83.12  ? 287 DA  J "C2'" 1 
ATOM   5867  C  "C1'" . DA  B  1 141 ? 8.496   4.278   -76.839 1.00 84.18  ? 287 DA  J "C1'" 1 
ATOM   5868  N  N9    . DA  B  1 141 ? 9.643   4.554   -77.700 1.00 85.38  ? 287 DA  J N9    1 
ATOM   5869  C  C8    . DA  B  1 141 ? 10.446  3.641   -78.319 1.00 90.19  ? 287 DA  J C8    1 
ATOM   5870  N  N7    . DA  B  1 141 ? 11.413  4.178   -79.025 1.00 87.65  ? 287 DA  J N7    1 
ATOM   5871  C  C5    . DA  B  1 141 ? 11.233  5.538   -78.855 1.00 84.74  ? 287 DA  J C5    1 
ATOM   5872  C  C6    . DA  B  1 141 ? 11.933  6.656   -79.348 1.00 87.40  ? 287 DA  J C6    1 
ATOM   5873  N  N6    . DA  B  1 141 ? 12.999  6.561   -80.148 1.00 88.22  ? 287 DA  J N6    1 
ATOM   5874  N  N1    . DA  B  1 141 ? 11.492  7.879   -78.987 1.00 86.24  ? 287 DA  J N1    1 
ATOM   5875  C  C2    . DA  B  1 141 ? 10.422  7.969   -78.189 1.00 85.40  ? 287 DA  J C2    1 
ATOM   5876  N  N3    . DA  B  1 141 ? 9.685   6.993   -77.661 1.00 85.68  ? 287 DA  J N3    1 
ATOM   5877  C  C4    . DA  B  1 141 ? 10.147  5.790   -78.039 1.00 88.48  ? 287 DA  J C4    1 
ATOM   5878  P  P     . DT  B  1 142 ? 4.220   4.009   -76.509 1.00 97.45  ? 288 DT  J P     1 
ATOM   5879  O  OP1   . DT  B  1 142 ? 3.168   3.948   -75.468 1.00 94.51  ? 288 DT  J OP1   1 
ATOM   5880  O  OP2   . DT  B  1 142 ? 4.109   3.164   -77.719 1.00 88.04  ? 288 DT  J OP2   1 
ATOM   5881  O  "O5'" . DT  B  1 142 ? 4.387   5.529   -76.959 1.00 92.84  ? 288 DT  J "O5'" 1 
ATOM   5882  C  "C5'" . DT  B  1 142 ? 5.257   6.372   -76.219 1.00 85.32  ? 288 DT  J "C5'" 1 
ATOM   5883  C  "C4'" . DT  B  1 142 ? 5.173   7.798   -76.707 1.00 78.68  ? 288 DT  J "C4'" 1 
ATOM   5884  O  "O4'" . DT  B  1 142 ? 6.377   8.133   -77.438 1.00 81.69  ? 288 DT  J "O4'" 1 
ATOM   5885  C  "C3'" . DT  B  1 142 ? 4.010   8.090   -77.646 1.00 84.50  ? 288 DT  J "C3'" 1 
ATOM   5886  O  "O3'" . DT  B  1 142 ? 3.515   9.389   -77.378 1.00 82.91  ? 288 DT  J "O3'" 1 
ATOM   5887  C  "C2'" . DT  B  1 142 ? 4.655   7.998   -79.028 1.00 80.23  ? 288 DT  J "C2'" 1 
ATOM   5888  C  "C1'" . DT  B  1 142 ? 6.051   8.536   -78.751 1.00 82.21  ? 288 DT  J "C1'" 1 
ATOM   5889  N  N1    . DT  B  1 142 ? 7.089   7.994   -79.660 1.00 80.38  ? 288 DT  J N1    1 
ATOM   5890  C  C2    . DT  B  1 142 ? 8.059   8.836   -80.152 1.00 81.41  ? 288 DT  J C2    1 
ATOM   5891  O  O2    . DT  B  1 142 ? 8.113   10.023  -79.884 1.00 82.43  ? 288 DT  J O2    1 
ATOM   5892  N  N3    . DT  B  1 142 ? 8.975   8.235   -80.971 1.00 83.09  ? 288 DT  J N3    1 
ATOM   5893  C  C4    . DT  B  1 142 ? 9.018   6.904   -81.339 1.00 84.80  ? 288 DT  J C4    1 
ATOM   5894  O  O4    . DT  B  1 142 ? 9.885   6.460   -82.084 1.00 84.55  ? 288 DT  J O4    1 
ATOM   5895  C  C5    . DT  B  1 142 ? 7.970   6.074   -80.785 1.00 84.58  ? 288 DT  J C5    1 
ATOM   5896  C  C7    . DT  B  1 142 ? 7.908   4.613   -81.111 1.00 71.97  ? 288 DT  J C7    1 
ATOM   5897  C  C6    . DT  B  1 142 ? 7.069   6.654   -79.981 1.00 85.86  ? 288 DT  J C6    1 
ATOM   5898  P  P     . DT  B  1 143 ? 2.244   9.965   -78.169 1.00 77.93  ? 289 DT  J P     1 
ATOM   5899  O  OP1   . DT  B  1 143 ? 1.424   10.675  -77.164 1.00 73.33  ? 289 DT  J OP1   1 
ATOM   5900  O  OP2   . DT  B  1 143 ? 1.634   8.885   -78.980 1.00 69.69  ? 289 DT  J OP2   1 
ATOM   5901  O  "O5'" . DT  B  1 143 ? 2.897   11.034  -79.158 1.00 73.93  ? 289 DT  J "O5'" 1 
ATOM   5902  C  "C5'" . DT  B  1 143 ? 3.954   11.856  -78.691 1.00 66.57  ? 289 DT  J "C5'" 1 
ATOM   5903  C  "C4'" . DT  B  1 143 ? 4.557   12.667  -79.822 1.00 68.49  ? 289 DT  J "C4'" 1 
ATOM   5904  O  "O4'" . DT  B  1 143 ? 5.564   11.880  -80.510 1.00 74.76  ? 289 DT  J "O4'" 1 
ATOM   5905  C  "C3'" . DT  B  1 143 ? 3.571   13.139  -80.897 1.00 61.28  ? 289 DT  J "C3'" 1 
ATOM   5906  O  "O3'" . DT  B  1 143 ? 3.856   14.495  -81.236 1.00 55.67  ? 289 DT  J "O3'" 1 
ATOM   5907  C  "C2'" . DT  B  1 143 ? 3.861   12.195  -82.064 1.00 65.43  ? 289 DT  J "C2'" 1 
ATOM   5908  C  "C1'" . DT  B  1 143 ? 5.358   11.979  -81.898 1.00 70.37  ? 289 DT  J "C1'" 1 
ATOM   5909  N  N1    . DT  B  1 143 ? 5.868   10.733  -82.539 1.00 78.83  ? 289 DT  J N1    1 
ATOM   5910  C  C2    . DT  B  1 143 ? 7.042   10.777  -83.258 1.00 77.04  ? 289 DT  J C2    1 
ATOM   5911  O  O2    . DT  B  1 143 ? 7.696   11.793  -83.407 1.00 72.65  ? 289 DT  J O2    1 
ATOM   5912  N  N3    . DT  B  1 143 ? 7.425   9.580   -83.800 1.00 80.79  ? 289 DT  J N3    1 
ATOM   5913  C  C4    . DT  B  1 143 ? 6.767   8.366   -83.698 1.00 81.08  ? 289 DT  J C4    1 
ATOM   5914  O  O4    . DT  B  1 143 ? 7.193   7.343   -84.223 1.00 83.19  ? 289 DT  J O4    1 
ATOM   5915  C  C5    . DT  B  1 143 ? 5.545   8.389   -82.929 1.00 78.45  ? 289 DT  J C5    1 
ATOM   5916  C  C7    . DT  B  1 143 ? 4.744   7.134   -82.748 1.00 80.35  ? 289 DT  J C7    1 
ATOM   5917  C  C6    . DT  B  1 143 ? 5.160   9.556   -82.392 1.00 81.89  ? 289 DT  J C6    1 
ATOM   5918  P  P     . DG  B  1 144 ? 2.744   15.429  -81.923 1.00 49.71  ? 290 DG  J P     1 
ATOM   5919  O  OP1   . DG  B  1 144 ? 2.634   16.670  -81.124 1.00 56.85  ? 290 DG  J OP1   1 
ATOM   5920  O  OP2   . DG  B  1 144 ? 1.542   14.612  -82.195 1.00 52.99  ? 290 DG  J OP2   1 
ATOM   5921  O  "O5'" . DG  B  1 144 ? 3.404   15.828  -83.317 1.00 57.07  ? 290 DG  J "O5'" 1 
ATOM   5922  C  "C5'" . DG  B  1 144 ? 4.717   16.372  -83.342 1.00 63.61  ? 290 DG  J "C5'" 1 
ATOM   5923  C  "C4'" . DG  B  1 144 ? 5.324   16.259  -84.730 1.00 66.24  ? 290 DG  J "C4'" 1 
ATOM   5924  O  "O4'" . DG  B  1 144 ? 5.743   14.891  -84.971 1.00 63.73  ? 290 DG  J "O4'" 1 
ATOM   5925  C  "C3'" . DG  B  1 144 ? 4.383   16.625  -85.883 1.00 71.82  ? 290 DG  J "C3'" 1 
ATOM   5926  O  "O3'" . DG  B  1 144 ? 5.094   17.366  -86.852 1.00 77.22  ? 290 DG  J "O3'" 1 
ATOM   5927  C  "C2'" . DG  B  1 144 ? 3.963   15.263  -86.424 1.00 63.77  ? 290 DG  J "C2'" 1 
ATOM   5928  C  "C1'" . DG  B  1 144 ? 5.232   14.464  -86.213 1.00 71.87  ? 290 DG  J "C1'" 1 
ATOM   5929  N  N9    . DG  B  1 144 ? 5.004   13.024  -86.166 1.00 74.61  ? 290 DG  J N9    1 
ATOM   5930  C  C8    . DG  B  1 144 ? 3.921   12.374  -85.627 1.00 76.22  ? 290 DG  J C8    1 
ATOM   5931  N  N7    . DG  B  1 144 ? 3.984   11.076  -85.740 1.00 78.30  ? 290 DG  J N7    1 
ATOM   5932  C  C5    . DG  B  1 144 ? 5.184   10.852  -86.401 1.00 80.18  ? 290 DG  J C5    1 
ATOM   5933  C  C6    . DG  B  1 144 ? 5.791   9.639   -86.801 1.00 87.86  ? 290 DG  J C6    1 
ATOM   5934  O  O6    . DG  B  1 144 ? 5.371   8.482   -86.645 1.00 87.74  ? 290 DG  J O6    1 
ATOM   5935  N  N1    . DG  B  1 144 ? 7.008   9.860   -87.444 1.00 85.58  ? 290 DG  J N1    1 
ATOM   5936  C  C2    . DG  B  1 144 ? 7.565   11.099  -87.669 1.00 83.35  ? 290 DG  J C2    1 
ATOM   5937  N  N2    . DG  B  1 144 ? 8.744   11.115  -88.307 1.00 88.86  ? 290 DG  J N2    1 
ATOM   5938  N  N3    . DG  B  1 144 ? 7.006   12.241  -87.299 1.00 74.66  ? 290 DG  J N3    1 
ATOM   5939  C  C4    . DG  B  1 144 ? 5.822   12.042  -86.672 1.00 74.61  ? 290 DG  J C4    1 
ATOM   5940  P  P     . DA  B  1 145 ? 4.332   18.100  -88.061 1.00 77.31  ? 291 DA  J P     1 
ATOM   5941  O  OP1   . DA  B  1 145 ? 4.298   19.544  -87.741 1.00 84.45  ? 291 DA  J OP1   1 
ATOM   5942  O  OP2   . DA  B  1 145 ? 3.067   17.393  -88.363 1.00 65.74  ? 291 DA  J OP2   1 
ATOM   5943  O  "O5'" . DA  B  1 145 ? 5.333   17.888  -89.286 1.00 85.50  ? 291 DA  J "O5'" 1 
ATOM   5944  C  "C5'" . DA  B  1 145 ? 6.728   18.146  -89.107 1.00 85.15  ? 291 DA  J "C5'" 1 
ATOM   5945  C  "C4'" . DA  B  1 145 ? 7.562   17.392  -90.130 1.00 89.56  ? 291 DA  J "C4'" 1 
ATOM   5946  O  "O4'" . DA  B  1 145 ? 7.524   15.969  -89.838 1.00 84.54  ? 291 DA  J "O4'" 1 
ATOM   5947  C  "C3'" . DA  B  1 145 ? 7.099   17.544  -91.578 1.00 94.45  ? 291 DA  J "C3'" 1 
ATOM   5948  O  "O3'" . DA  B  1 145 ? 8.226   17.638  -92.448 1.00 100.47 ? 291 DA  J "O3'" 1 
ATOM   5949  C  "C2'" . DA  B  1 145 ? 6.307   16.263  -91.819 1.00 83.06  ? 291 DA  J "C2'" 1 
ATOM   5950  C  "C1'" . DA  B  1 145 ? 7.076   15.259  -90.974 1.00 85.54  ? 291 DA  J "C1'" 1 
ATOM   5951  N  N9    . DA  B  1 145 ? 6.261   14.127  -90.529 1.00 85.49  ? 291 DA  J N9    1 
ATOM   5952  C  C8    . DA  B  1 145 ? 5.088   14.181  -89.827 1.00 84.34  ? 291 DA  J C8    1 
ATOM   5953  N  N7    . DA  B  1 145 ? 4.572   13.003  -89.564 1.00 82.76  ? 291 DA  J N7    1 
ATOM   5954  C  C5    . DA  B  1 145 ? 5.468   12.114  -90.132 1.00 85.29  ? 291 DA  J C5    1 
ATOM   5955  C  C6    . DA  B  1 145 ? 5.494   10.706  -90.203 1.00 89.63  ? 291 DA  J C6    1 
ATOM   5956  N  N6    . DA  B  1 145 ? 4.549   9.925   -89.670 1.00 88.75  ? 291 DA  J N6    1 
ATOM   5957  N  N1    . DA  B  1 145 ? 6.531   10.131  -90.846 1.00 88.67  ? 291 DA  J N1    1 
ATOM   5958  C  C2    . DA  B  1 145 ? 7.474   10.916  -91.379 1.00 88.51  ? 291 DA  J C2    1 
ATOM   5959  N  N3    . DA  B  1 145 ? 7.558   12.246  -91.378 1.00 89.08  ? 291 DA  J N3    1 
ATOM   5960  C  C4    . DA  B  1 145 ? 6.514   12.789  -90.733 1.00 84.87  ? 291 DA  J C4    1 
ATOM   5961  P  P     . DT  B  1 146 ? 8.082   18.340  -93.888 1.00 103.31 ? 292 DT  J P     1 
ATOM   5962  O  OP1   . DT  B  1 146 ? 8.906   19.570  -93.880 1.00 103.11 ? 292 DT  J OP1   1 
ATOM   5963  O  OP2   . DT  B  1 146 ? 6.640   18.417  -94.211 1.00 93.22  ? 292 DT  J OP2   1 
ATOM   5964  O  "O5'" . DT  B  1 146 ? 8.751   17.291  -94.888 1.00 91.42  ? 292 DT  J "O5'" 1 
ATOM   5965  C  "C5'" . DT  B  1 146 ? 8.350   15.934  -94.856 1.00 94.85  ? 292 DT  J "C5'" 1 
ATOM   5966  C  "C4'" . DT  B  1 146 ? 8.918   15.175  -96.039 1.00 104.13 ? 292 DT  J "C4'" 1 
ATOM   5967  O  "O4'" . DT  B  1 146 ? 8.775   13.760  -95.808 1.00 104.92 ? 292 DT  J "O4'" 1 
ATOM   5968  C  "C3'" . DT  B  1 146 ? 8.217   15.427  -97.361 1.00 110.22 ? 292 DT  J "C3'" 1 
ATOM   5969  O  "O3'" . DT  B  1 146 ? 9.099   15.151  -98.445 1.00 105.72 ? 292 DT  J "O3'" 1 
ATOM   5970  C  "C2'" . DT  B  1 146 ? 7.057   14.434  -97.313 1.00 106.32 ? 292 DT  J "C2'" 1 
ATOM   5971  C  "C1'" . DT  B  1 146 ? 7.627   13.278  -96.481 1.00 107.95 ? 292 DT  J "C1'" 1 
ATOM   5972  N  N1    . DT  B  1 146 ? 6.678   12.770  -95.461 1.00 104.67 ? 292 DT  J N1    1 
ATOM   5973  C  C2    . DT  B  1 146 ? 6.723   11.446  -95.090 1.00 109.82 ? 292 DT  J C2    1 
ATOM   5974  O  O2    . DT  B  1 146 ? 7.514   10.644  -95.559 1.00 117.17 ? 292 DT  J O2    1 
ATOM   5975  N  N3    . DT  B  1 146 ? 5.802   11.088  -94.143 1.00 103.39 ? 292 DT  J N3    1 
ATOM   5976  C  C4    . DT  B  1 146 ? 4.864   11.906  -93.543 1.00 100.30 ? 292 DT  J C4    1 
ATOM   5977  O  O4    . DT  B  1 146 ? 4.078   11.493  -92.699 1.00 98.80  ? 292 DT  J O4    1 
ATOM   5978  C  C5    . DT  B  1 146 ? 4.874   13.281  -93.980 1.00 97.86  ? 292 DT  J C5    1 
ATOM   5979  C  C7    . DT  B  1 146 ? 3.904   14.263  -93.405 1.00 94.60  ? 292 DT  J C7    1 
ATOM   5980  C  C6    . DT  B  1 146 ? 5.769   13.639  -94.905 1.00 99.51  ? 292 DT  J C6    1 
ATOM   5981  N  N     . PRO C  2 38  ? -60.654 28.244  -80.370 1.00 113.21 ? 38  PRO A N     1 
ATOM   5982  C  CA    . PRO C  2 38  ? -59.534 27.536  -79.748 1.00 109.09 ? 38  PRO A CA    1 
ATOM   5983  C  C     . PRO C  2 38  ? -58.364 28.472  -79.455 1.00 105.40 ? 38  PRO A C     1 
ATOM   5984  O  O     . PRO C  2 38  ? -57.898 29.171  -80.355 1.00 103.82 ? 38  PRO A O     1 
ATOM   5985  C  CB    . PRO C  2 38  ? -59.154 26.480  -80.798 1.00 100.84 ? 38  PRO A CB    1 
ATOM   5986  C  CG    . PRO C  2 38  ? -60.160 26.618  -81.927 1.00 106.54 ? 38  PRO A CG    1 
ATOM   5987  C  CD    . PRO C  2 38  ? -61.306 27.423  -81.399 1.00 115.15 ? 38  PRO A CD    1 
ATOM   5988  N  N     . HIS C  2 39  ? -57.896 28.471  -78.210 1.00 104.53 ? 39  HIS A N     1 
ATOM   5989  C  CA    . HIS C  2 39  ? -56.782 29.325  -77.810 1.00 97.25  ? 39  HIS A CA    1 
ATOM   5990  C  C     . HIS C  2 39  ? -55.601 28.501  -77.319 1.00 91.97  ? 39  HIS A C     1 
ATOM   5991  O  O     . HIS C  2 39  ? -55.782 27.500  -76.623 1.00 92.71  ? 39  HIS A O     1 
ATOM   5992  C  CB    . HIS C  2 39  ? -57.219 30.303  -76.722 1.00 98.07  ? 39  HIS A CB    1 
ATOM   5993  C  CG    . HIS C  2 39  ? -56.099 31.124  -76.165 1.00 101.84 ? 39  HIS A CG    1 
ATOM   5994  N  ND1   . HIS C  2 39  ? -55.755 32.360  -76.672 1.00 100.23 ? 39  HIS A ND1   1 
ATOM   5995  C  CD2   . HIS C  2 39  ? -55.240 30.883  -75.146 1.00 91.28  ? 39  HIS A CD2   1 
ATOM   5996  C  CE1   . HIS C  2 39  ? -54.737 32.846  -75.986 1.00 91.05  ? 39  HIS A CE1   1 
ATOM   5997  N  NE2   . HIS C  2 39  ? -54.404 31.970  -75.055 1.00 91.99  ? 39  HIS A NE2   1 
ATOM   5998  N  N     . ARG C  2 40  ? -54.394 28.925  -77.686 1.00 80.99  ? 40  ARG A N     1 
ATOM   5999  C  CA    . ARG C  2 40  ? -53.181 28.223  -77.278 1.00 81.14  ? 40  ARG A CA    1 
ATOM   6000  C  C     . ARG C  2 40  ? -52.043 29.184  -76.961 1.00 76.89  ? 40  ARG A C     1 
ATOM   6001  O  O     . ARG C  2 40  ? -51.725 30.071  -77.754 1.00 75.70  ? 40  ARG A O     1 
ATOM   6002  C  CB    . ARG C  2 40  ? -52.731 27.244  -78.363 1.00 66.41  ? 40  ARG A CB    1 
ATOM   6003  C  CG    . ARG C  2 40  ? -53.608 26.018  -78.501 1.00 70.09  ? 40  ARG A CG    1 
ATOM   6004  C  CD    . ARG C  2 40  ? -53.044 25.065  -79.532 1.00 79.91  ? 40  ARG A CD    1 
ATOM   6005  N  NE    . ARG C  2 40  ? -51.711 24.597  -79.169 1.00 68.39  ? 40  ARG A NE    1 
ATOM   6006  C  CZ    . ARG C  2 40  ? -51.482 23.533  -78.410 1.00 66.08  ? 40  ARG A CZ    1 
ATOM   6007  N  NH1   . ARG C  2 40  ? -52.498 22.829  -77.930 1.00 64.07  ? 40  ARG A NH1   1 
ATOM   6008  N  NH2   . ARG C  2 40  ? -50.237 23.175  -78.128 1.00 68.21  ? 40  ARG A NH2   1 
ATOM   6009  N  N     . TYR C  2 41  ? -51.431 29.001  -75.796 1.00 75.92  ? 41  TYR A N     1 
ATOM   6010  C  CA    . TYR C  2 41  ? -50.244 29.767  -75.441 1.00 75.00  ? 41  TYR A CA    1 
ATOM   6011  C  C     . TYR C  2 41  ? -49.011 29.110  -76.054 1.00 70.63  ? 41  TYR A C     1 
ATOM   6012  O  O     . TYR C  2 41  ? -48.941 27.883  -76.158 1.00 63.17  ? 41  TYR A O     1 
ATOM   6013  C  CB    . TYR C  2 41  ? -50.099 29.888  -73.919 1.00 66.09  ? 41  TYR A CB    1 
ATOM   6014  C  CG    . TYR C  2 41  ? -51.049 30.887  -73.285 1.00 70.38  ? 41  TYR A CG    1 
ATOM   6015  C  CD1   . TYR C  2 41  ? -50.902 32.252  -73.506 1.00 73.10  ? 41  TYR A CD1   1 
ATOM   6016  C  CD2   . TYR C  2 41  ? -52.082 30.468  -72.456 1.00 69.95  ? 41  TYR A CD2   1 
ATOM   6017  C  CE1   . TYR C  2 41  ? -51.764 33.165  -72.929 1.00 73.52  ? 41  TYR A CE1   1 
ATOM   6018  C  CE2   . TYR C  2 41  ? -52.948 31.372  -71.875 1.00 64.06  ? 41  TYR A CE2   1 
ATOM   6019  C  CZ    . TYR C  2 41  ? -52.785 32.717  -72.114 1.00 73.34  ? 41  TYR A CZ    1 
ATOM   6020  O  OH    . TYR C  2 41  ? -53.646 33.621  -71.537 1.00 78.31  ? 41  TYR A OH    1 
ATOM   6021  N  N     . ARG C  2 42  ? -48.052 29.928  -76.478 1.00 65.69  ? 42  ARG A N     1 
ATOM   6022  C  CA    . ARG C  2 42  ? -46.822 29.416  -77.073 1.00 63.83  ? 42  ARG A CA    1 
ATOM   6023  C  C     . ARG C  2 42  ? -46.002 28.684  -76.020 1.00 65.94  ? 42  ARG A C     1 
ATOM   6024  O  O     . ARG C  2 42  ? -46.028 29.061  -74.848 1.00 64.94  ? 42  ARG A O     1 
ATOM   6025  C  CB    . ARG C  2 42  ? -46.003 30.552  -77.691 1.00 62.59  ? 42  ARG A CB    1 
ATOM   6026  C  CG    . ARG C  2 42  ? -46.731 31.318  -78.782 1.00 72.03  ? 42  ARG A CG    1 
ATOM   6027  C  CD    . ARG C  2 42  ? -45.964 32.563  -79.198 1.00 80.37  ? 42  ARG A CD    1 
ATOM   6028  N  NE    . ARG C  2 42  ? -44.750 32.254  -79.947 1.00 81.58  ? 42  ARG A NE    1 
ATOM   6029  C  CZ    . ARG C  2 42  ? -43.836 33.158  -80.287 1.00 93.60  ? 42  ARG A CZ    1 
ATOM   6030  N  NH1   . ARG C  2 42  ? -43.991 34.427  -79.933 1.00 94.25  ? 42  ARG A NH1   1 
ATOM   6031  N  NH2   . ARG C  2 42  ? -42.759 32.790  -80.972 1.00 95.45  ? 42  ARG A NH2   1 
ATOM   6032  N  N     . PRO C  2 43  ? -45.282 27.626  -76.430 1.00 64.08  ? 43  PRO A N     1 
ATOM   6033  C  CA    . PRO C  2 43  ? -44.419 26.896  -75.495 1.00 63.51  ? 43  PRO A CA    1 
ATOM   6034  C  C     . PRO C  2 43  ? -43.429 27.826  -74.802 1.00 62.26  ? 43  PRO A C     1 
ATOM   6035  O  O     . PRO C  2 43  ? -42.776 28.637  -75.460 1.00 55.89  ? 43  PRO A O     1 
ATOM   6036  C  CB    . PRO C  2 43  ? -43.697 25.877  -76.388 1.00 58.24  ? 43  PRO A CB    1 
ATOM   6037  C  CG    . PRO C  2 43  ? -43.958 26.313  -77.792 1.00 62.34  ? 43  PRO A CG    1 
ATOM   6038  C  CD    . PRO C  2 43  ? -45.259 27.035  -77.776 1.00 63.75  ? 43  PRO A CD    1 
ATOM   6039  N  N     . GLY C  2 44  ? -43.347 27.716  -73.479 1.00 62.73  ? 44  GLY A N     1 
ATOM   6040  C  CA    . GLY C  2 44  ? -42.500 28.584  -72.683 1.00 54.58  ? 44  GLY A CA    1 
ATOM   6041  C  C     . GLY C  2 44  ? -43.316 29.511  -71.804 1.00 55.03  ? 44  GLY A C     1 
ATOM   6042  O  O     . GLY C  2 44  ? -42.925 29.817  -70.678 1.00 56.71  ? 44  GLY A O     1 
ATOM   6043  N  N     . THR C  2 45  ? -44.462 29.946  -72.322 1.00 58.61  ? 45  THR A N     1 
ATOM   6044  C  CA    . THR C  2 45  ? -45.311 30.935  -71.659 1.00 56.35  ? 45  THR A CA    1 
ATOM   6045  C  C     . THR C  2 45  ? -45.903 30.423  -70.354 1.00 54.66  ? 45  THR A C     1 
ATOM   6046  O  O     . THR C  2 45  ? -45.710 31.014  -69.285 1.00 53.77  ? 45  THR A O     1 
ATOM   6047  C  CB    . THR C  2 45  ? -46.462 31.371  -72.578 1.00 59.88  ? 45  THR A CB    1 
ATOM   6048  O  OG1   . THR C  2 45  ? -45.928 31.938  -73.781 1.00 61.66  ? 45  THR A OG1   1 
ATOM   6049  C  CG2   . THR C  2 45  ? -47.342 32.393  -71.883 1.00 64.67  ? 45  THR A CG2   1 
ATOM   6050  N  N     . VAL C  2 46  ? -46.639 29.324  -70.454 1.00 59.68  ? 46  VAL A N     1 
ATOM   6051  C  CA    . VAL C  2 46  ? -47.209 28.683  -69.281 1.00 60.82  ? 46  VAL A CA    1 
ATOM   6052  C  C     . VAL C  2 46  ? -46.101 28.308  -68.306 1.00 57.50  ? 46  VAL A C     1 
ATOM   6053  O  O     . VAL C  2 46  ? -46.278 28.409  -67.097 1.00 54.46  ? 46  VAL A O     1 
ATOM   6054  C  CB    . VAL C  2 46  ? -48.014 27.428  -69.657 1.00 63.04  ? 46  VAL A CB    1 
ATOM   6055  C  CG1   . VAL C  2 46  ? -48.733 26.870  -68.439 1.00 60.33  ? 46  VAL A CG1   1 
ATOM   6056  C  CG2   . VAL C  2 46  ? -49.004 27.752  -70.765 1.00 65.18  ? 46  VAL A CG2   1 
ATOM   6057  N  N     . ALA C  2 47  ? -44.956 27.888  -68.842 1.00 58.04  ? 47  ALA A N     1 
ATOM   6058  C  CA    . ALA C  2 47  ? -43.825 27.486  -68.010 1.00 55.32  ? 47  ALA A CA    1 
ATOM   6059  C  C     . ALA C  2 47  ? -43.354 28.646  -67.138 1.00 49.92  ? 47  ALA A C     1 
ATOM   6060  O  O     . ALA C  2 47  ? -43.201 28.491  -65.926 1.00 50.53  ? 47  ALA A O     1 
ATOM   6061  C  CB    . ALA C  2 47  ? -42.686 26.964  -68.872 1.00 50.70  ? 47  ALA A CB    1 
ATOM   6062  N  N     . LEU C  2 48  ? -43.138 29.805  -67.756 1.00 49.01  ? 48  LEU A N     1 
ATOM   6063  C  CA    . LEU C  2 48  ? -42.765 31.017  -67.027 1.00 45.69  ? 48  LEU A CA    1 
ATOM   6064  C  C     . LEU C  2 48  ? -43.838 31.389  -66.003 1.00 48.85  ? 48  LEU A C     1 
ATOM   6065  O  O     . LEU C  2 48  ? -43.522 31.770  -64.862 1.00 47.89  ? 48  LEU A O     1 
ATOM   6066  C  CB    . LEU C  2 48  ? -42.528 32.173  -68.001 1.00 44.99  ? 48  LEU A CB    1 
ATOM   6067  C  CG    . LEU C  2 48  ? -41.205 32.132  -68.772 1.00 47.52  ? 48  LEU A CG    1 
ATOM   6068  C  CD1   . LEU C  2 48  ? -41.311 32.909  -70.073 1.00 38.75  ? 48  LEU A CD1   1 
ATOM   6069  C  CD2   . LEU C  2 48  ? -40.068 32.674  -67.914 1.00 39.40  ? 48  LEU A CD2   1 
ATOM   6070  N  N     . ARG C  2 49  ? -45.102 31.266  -66.416 1.00 53.14  ? 49  ARG A N     1 
ATOM   6071  C  CA    . ARG C  2 49  ? -46.231 31.464  -65.508 1.00 54.54  ? 49  ARG A CA    1 
ATOM   6072  C  C     . ARG C  2 49  ? -46.046 30.626  -64.246 1.00 53.26  ? 49  ARG A C     1 
ATOM   6073  O  O     . ARG C  2 49  ? -46.131 31.135  -63.123 1.00 51.48  ? 49  ARG A O     1 
ATOM   6074  C  CB    . ARG C  2 49  ? -47.560 31.098  -66.185 1.00 54.05  ? 49  ARG A CB    1 
ATOM   6075  C  CG    . ARG C  2 49  ? -48.253 32.241  -66.925 1.00 62.90  ? 49  ARG A CG    1 
ATOM   6076  C  CD    . ARG C  2 49  ? -49.768 32.017  -67.012 1.00 59.95  ? 49  ARG A CD    1 
ATOM   6077  N  NE    . ARG C  2 49  ? -50.184 31.303  -68.216 1.00 64.79  ? 49  ARG A NE    1 
ATOM   6078  C  CZ    . ARG C  2 49  ? -51.053 30.297  -68.216 1.00 68.75  ? 49  ARG A CZ    1 
ATOM   6079  N  NH1   . ARG C  2 49  ? -51.591 29.885  -67.075 1.00 70.88  ? 49  ARG A NH1   1 
ATOM   6080  N  NH2   . ARG C  2 49  ? -51.383 29.698  -69.352 1.00 65.94  ? 49  ARG A NH2   1 
ATOM   6081  N  N     . GLU C  2 50  ? -45.771 29.341  -64.445 1.00 46.63  ? 50  GLU A N     1 
ATOM   6082  C  CA    . GLU C  2 50  ? -45.629 28.408  -63.342 1.00 49.25  ? 50  GLU A CA    1 
ATOM   6083  C  C     . GLU C  2 50  ? -44.429 28.754  -62.474 1.00 47.84  ? 50  GLU A C     1 
ATOM   6084  O  O     . GLU C  2 50  ? -44.493 28.634  -61.253 1.00 48.91  ? 50  GLU A O     1 
ATOM   6085  C  CB    . GLU C  2 50  ? -45.504 26.982  -63.864 1.00 51.39  ? 50  GLU A CB    1 
ATOM   6086  C  CG    . GLU C  2 50  ? -46.755 26.448  -64.530 1.00 51.87  ? 50  GLU A CG    1 
ATOM   6087  C  CD    . GLU C  2 50  ? -46.533 25.080  -65.135 1.00 57.09  ? 50  GLU A CD    1 
ATOM   6088  O  OE1   . GLU C  2 50  ? -45.673 24.337  -64.616 1.00 57.33  ? 50  GLU A OE1   1 
ATOM   6089  O  OE2   . GLU C  2 50  ? -47.212 24.750  -66.130 1.00 67.53  ? 50  GLU A OE2   1 
ATOM   6090  N  N     . ILE C  2 51  ? -43.338 29.185  -63.102 1.00 46.85  ? 51  ILE A N     1 
ATOM   6091  C  CA    . ILE C  2 51  ? -42.157 29.596  -62.353 1.00 44.67  ? 51  ILE A CA    1 
ATOM   6092  C  C     . ILE C  2 51  ? -42.512 30.726  -61.399 1.00 43.03  ? 51  ILE A C     1 
ATOM   6093  O  O     . ILE C  2 51  ? -42.143 30.696  -60.224 1.00 43.18  ? 51  ILE A O     1 
ATOM   6094  C  CB    . ILE C  2 51  ? -41.004 30.051  -63.272 1.00 44.55  ? 51  ILE A CB    1 
ATOM   6095  C  CG1   . ILE C  2 51  ? -40.466 28.867  -64.079 1.00 47.19  ? 51  ILE A CG1   1 
ATOM   6096  C  CG2   . ILE C  2 51  ? -39.877 30.655  -62.452 1.00 34.61  ? 51  ILE A CG2   1 
ATOM   6097  C  CD1   . ILE C  2 51  ? -39.205 29.181  -64.864 1.00 40.38  ? 51  ILE A CD1   1 
ATOM   6098  N  N     . ARG C  2 52  ? -43.247 31.714  -61.894 1.00 43.73  ? 52  ARG A N     1 
ATOM   6099  C  CA    . ARG C  2 52  ? -43.622 32.831  -61.033 1.00 45.54  ? 52  ARG A CA    1 
ATOM   6100  C  C     . ARG C  2 52  ? -44.576 32.377  -59.921 1.00 47.22  ? 52  ARG A C     1 
ATOM   6101  O  O     . ARG C  2 52  ? -44.419 32.757  -58.744 1.00 46.77  ? 52  ARG A O     1 
ATOM   6102  C  CB    . ARG C  2 52  ? -44.239 33.958  -61.863 1.00 46.09  ? 52  ARG A CB    1 
ATOM   6103  C  CG    . ARG C  2 52  ? -43.260 34.546  -62.867 1.00 47.19  ? 52  ARG A CG    1 
ATOM   6104  C  CD    . ARG C  2 52  ? -43.733 35.871  -63.441 1.00 58.12  ? 52  ARG A CD    1 
ATOM   6105  N  NE    . ARG C  2 52  ? -42.783 36.385  -64.427 1.00 63.19  ? 52  ARG A NE    1 
ATOM   6106  C  CZ    . ARG C  2 52  ? -42.912 36.224  -65.740 1.00 60.57  ? 52  ARG A CZ    1 
ATOM   6107  N  NH1   . ARG C  2 52  ? -43.960 35.568  -66.226 1.00 57.00  ? 52  ARG A NH1   1 
ATOM   6108  N  NH2   . ARG C  2 52  ? -41.998 36.715  -66.567 1.00 49.16  ? 52  ARG A NH2   1 
ATOM   6109  N  N     . ARG C  2 53  ? -45.543 31.542  -60.291 1.00 46.62  ? 53  ARG A N     1 
ATOM   6110  C  CA    . ARG C  2 53  ? -46.518 31.042  -59.329 1.00 46.76  ? 53  ARG A CA    1 
ATOM   6111  C  C     . ARG C  2 53  ? -45.854 30.306  -58.173 1.00 46.37  ? 53  ARG A C     1 
ATOM   6112  O  O     . ARG C  2 53  ? -46.098 30.614  -57.007 1.00 47.24  ? 53  ARG A O     1 
ATOM   6113  C  CB    . ARG C  2 53  ? -47.528 30.110  -59.997 1.00 42.84  ? 53  ARG A CB    1 
ATOM   6114  C  CG    . ARG C  2 53  ? -48.430 29.399  -58.989 1.00 50.56  ? 53  ARG A CG    1 
ATOM   6115  C  CD    . ARG C  2 53  ? -49.385 28.420  -59.653 1.00 54.54  ? 53  ARG A CD    1 
ATOM   6116  N  NE    . ARG C  2 53  ? -49.930 28.972  -60.889 1.00 78.93  ? 53  ARG A NE    1 
ATOM   6117  C  CZ    . ARG C  2 53  ? -50.080 28.284  -62.017 1.00 71.73  ? 53  ARG A CZ    1 
ATOM   6118  N  NH1   . ARG C  2 53  ? -49.735 27.005  -62.065 1.00 56.91  ? 53  ARG A NH1   1 
ATOM   6119  N  NH2   . ARG C  2 53  ? -50.582 28.875  -63.094 1.00 73.08  ? 53  ARG A NH2   1 
ATOM   6120  N  N     . TYR C  2 54  ? -45.013 29.332  -58.495 1.00 45.88  ? 54  TYR A N     1 
ATOM   6121  C  CA    . TYR C  2 54  ? -44.446 28.485  -57.460 1.00 46.55  ? 54  TYR A CA    1 
ATOM   6122  C  C     . TYR C  2 54  ? -43.275 29.160  -56.758 1.00 44.24  ? 54  TYR A C     1 
ATOM   6123  O  O     . TYR C  2 54  ? -42.925 28.786  -55.640 1.00 48.59  ? 54  TYR A O     1 
ATOM   6124  C  CB    . TYR C  2 54  ? -44.030 27.135  -58.042 1.00 44.74  ? 54  TYR A CB    1 
ATOM   6125  C  CG    . TYR C  2 54  ? -45.210 26.299  -58.476 1.00 45.47  ? 54  TYR A CG    1 
ATOM   6126  C  CD1   . TYR C  2 54  ? -46.135 25.836  -57.550 1.00 47.43  ? 54  TYR A CD1   1 
ATOM   6127  C  CD2   . TYR C  2 54  ? -45.405 25.981  -59.812 1.00 46.34  ? 54  TYR A CD2   1 
ATOM   6128  C  CE1   . TYR C  2 54  ? -47.218 25.075  -57.946 1.00 49.28  ? 54  TYR A CE1   1 
ATOM   6129  C  CE2   . TYR C  2 54  ? -46.484 25.221  -60.216 1.00 43.15  ? 54  TYR A CE2   1 
ATOM   6130  C  CZ    . TYR C  2 54  ? -47.386 24.772  -59.282 1.00 44.99  ? 54  TYR A CZ    1 
ATOM   6131  O  OH    . TYR C  2 54  ? -48.460 24.017  -59.692 1.00 48.38  ? 54  TYR A OH    1 
ATOM   6132  N  N     . GLN C  2 55  ? -42.672 30.160  -57.389 1.00 37.13  ? 55  GLN A N     1 
ATOM   6133  C  CA    . GLN C  2 55  ? -41.686 30.947  -56.663 1.00 40.18  ? 55  GLN A CA    1 
ATOM   6134  C  C     . GLN C  2 55  ? -42.383 31.879  -55.681 1.00 41.69  ? 55  GLN A C     1 
ATOM   6135  O  O     . GLN C  2 55  ? -41.763 32.359  -54.734 1.00 45.94  ? 55  GLN A O     1 
ATOM   6136  C  CB    . GLN C  2 55  ? -40.782 31.734  -57.612 1.00 38.98  ? 55  GLN A CB    1 
ATOM   6137  C  CG    . GLN C  2 55  ? -39.685 30.873  -58.214 1.00 43.44  ? 55  GLN A CG    1 
ATOM   6138  C  CD    . GLN C  2 55  ? -38.679 31.659  -59.020 1.00 43.69  ? 55  GLN A CD    1 
ATOM   6139  O  OE1   . GLN C  2 55  ? -38.815 32.868  -59.200 1.00 52.58  ? 55  GLN A OE1   1 
ATOM   6140  N  NE2   . GLN C  2 55  ? -37.664 30.970  -59.526 1.00 42.86  ? 55  GLN A NE2   1 
ATOM   6141  N  N     . LYS C  2 56  ? -43.674 32.129  -55.891 1.00 45.12  ? 56  LYS A N     1 
ATOM   6142  C  CA    . LYS C  2 56  ? -44.428 32.915  -54.913 1.00 42.86  ? 56  LYS A CA    1 
ATOM   6143  C  C     . LYS C  2 56  ? -44.906 32.086  -53.712 1.00 48.67  ? 56  LYS A C     1 
ATOM   6144  O  O     . LYS C  2 56  ? -44.913 32.577  -52.584 1.00 49.60  ? 56  LYS A O     1 
ATOM   6145  C  CB    . LYS C  2 56  ? -45.623 33.597  -55.578 1.00 43.99  ? 56  LYS A CB    1 
ATOM   6146  C  CG    . LYS C  2 56  ? -45.246 34.820  -56.401 1.00 62.30  ? 56  LYS A CG    1 
ATOM   6147  C  CD    . LYS C  2 56  ? -46.463 35.672  -56.728 1.00 72.97  ? 56  LYS A CD    1 
ATOM   6148  C  CE    . LYS C  2 56  ? -46.084 36.886  -57.564 1.00 72.88  ? 56  LYS A CE    1 
ATOM   6149  N  NZ    . LYS C  2 56  ? -47.245 37.801  -57.745 1.00 76.17  ? 56  LYS A NZ    1 
ATOM   6150  N  N     . SER C  2 57  ? -45.296 30.835  -53.943 1.00 43.62  ? 57  SER A N     1 
ATOM   6151  C  CA    . SER C  2 57  ? -45.863 30.018  -52.873 1.00 41.81  ? 57  SER A CA    1 
ATOM   6152  C  C     . SER C  2 57  ? -44.794 29.345  -52.011 1.00 50.42  ? 57  SER A C     1 
ATOM   6153  O  O     . SER C  2 57  ? -43.600 29.437  -52.298 1.00 48.90  ? 57  SER A O     1 
ATOM   6154  C  CB    . SER C  2 57  ? -46.797 28.953  -53.453 1.00 50.56  ? 57  SER A CB    1 
ATOM   6155  O  OG    . SER C  2 57  ? -46.087 28.018  -54.244 1.00 57.17  ? 57  SER A OG    1 
ATOM   6156  N  N     . THR C  2 58  ? -45.237 28.676  -50.946 1.00 48.83  ? 58  THR A N     1 
ATOM   6157  C  CA    . THR C  2 58  ? -44.347 27.932  -50.059 1.00 42.06  ? 58  THR A CA    1 
ATOM   6158  C  C     . THR C  2 58  ? -44.895 26.533  -49.787 1.00 44.54  ? 58  THR A C     1 
ATOM   6159  O  O     . THR C  2 58  ? -44.352 25.785  -48.977 1.00 42.43  ? 58  THR A O     1 
ATOM   6160  C  CB    . THR C  2 58  ? -44.143 28.651  -48.713 1.00 38.03  ? 58  THR A CB    1 
ATOM   6161  O  OG1   . THR C  2 58  ? -45.392 28.738  -48.022 1.00 44.57  ? 58  THR A OG1   1 
ATOM   6162  C  CG2   . THR C  2 58  ? -43.584 30.049  -48.927 1.00 40.58  ? 58  THR A CG2   1 
ATOM   6163  N  N     . GLU C  2 59  ? -45.987 26.199  -50.463 1.00 47.13  ? 59  GLU A N     1 
ATOM   6164  C  CA    . GLU C  2 59  ? -46.613 24.885  -50.354 1.00 52.61  ? 59  GLU A CA    1 
ATOM   6165  C  C     . GLU C  2 59  ? -45.665 23.751  -50.738 1.00 44.47  ? 59  GLU A C     1 
ATOM   6166  O  O     . GLU C  2 59  ? -44.889 23.879  -51.686 1.00 42.00  ? 59  GLU A O     1 
ATOM   6167  C  CB    . GLU C  2 59  ? -47.854 24.831  -51.249 1.00 55.16  ? 59  GLU A CB    1 
ATOM   6168  C  CG    . GLU C  2 59  ? -47.566 25.330  -52.666 1.00 60.72  ? 59  GLU A CG    1 
ATOM   6169  C  CD    . GLU C  2 59  ? -48.720 25.121  -53.624 1.00 72.54  ? 59  GLU A CD    1 
ATOM   6170  O  OE1   . GLU C  2 59  ? -49.745 24.537  -53.208 1.00 77.99  ? 59  GLU A OE1   1 
ATOM   6171  O  OE2   . GLU C  2 59  ? -48.593 25.537  -54.797 1.00 71.25  ? 59  GLU A OE2   1 
ATOM   6172  N  N     . LEU C  2 60  ? -45.728 22.644  -50.004 1.00 39.53  ? 60  LEU A N     1 
ATOM   6173  C  CA    . LEU C  2 60  ? -45.043 21.429  -50.430 1.00 47.88  ? 60  LEU A CA    1 
ATOM   6174  C  C     . LEU C  2 60  ? -45.630 20.991  -51.772 1.00 49.23  ? 60  LEU A C     1 
ATOM   6175  O  O     . LEU C  2 60  ? -46.829 21.132  -52.005 1.00 55.01  ? 60  LEU A O     1 
ATOM   6176  C  CB    . LEU C  2 60  ? -45.173 20.321  -49.384 1.00 47.02  ? 60  LEU A CB    1 
ATOM   6177  C  CG    . LEU C  2 60  ? -44.360 20.513  -48.101 1.00 53.38  ? 60  LEU A CG    1 
ATOM   6178  C  CD1   . LEU C  2 60  ? -44.800 19.533  -47.023 1.00 51.19  ? 60  LEU A CD1   1 
ATOM   6179  C  CD2   . LEU C  2 60  ? -42.872 20.366  -48.384 1.00 49.78  ? 60  LEU A CD2   1 
ATOM   6180  N  N     . LEU C  2 61  ? -44.787 20.473  -52.658 1.00 43.31  ? 61  LEU A N     1 
ATOM   6181  C  CA    . LEU C  2 61  ? -45.204 20.264  -54.037 1.00 46.06  ? 61  LEU A CA    1 
ATOM   6182  C  C     . LEU C  2 61  ? -45.339 18.790  -54.379 1.00 52.47  ? 61  LEU A C     1 
ATOM   6183  O  O     . LEU C  2 61  ? -46.031 18.428  -55.331 1.00 54.92  ? 61  LEU A O     1 
ATOM   6184  C  CB    . LEU C  2 61  ? -44.222 20.950  -54.984 1.00 50.16  ? 61  LEU A CB    1 
ATOM   6185  C  CG    . LEU C  2 61  ? -44.089 22.451  -54.708 1.00 42.32  ? 61  LEU A CG    1 
ATOM   6186  C  CD1   . LEU C  2 61  ? -43.125 23.107  -55.678 1.00 40.06  ? 61  LEU A CD1   1 
ATOM   6187  C  CD2   . LEU C  2 61  ? -45.450 23.118  -54.754 1.00 45.42  ? 61  LEU A CD2   1 
ATOM   6188  N  N     . ILE C  2 62  ? -44.675 17.940  -53.604 1.00 51.06  ? 62  ILE A N     1 
ATOM   6189  C  CA    . ILE C  2 62  ? -44.915 16.509  -53.695 1.00 44.65  ? 62  ILE A CA    1 
ATOM   6190  C  C     . ILE C  2 62  ? -46.144 16.188  -52.858 1.00 46.57  ? 62  ILE A C     1 
ATOM   6191  O  O     . ILE C  2 62  ? -46.291 16.698  -51.748 1.00 50.00  ? 62  ILE A O     1 
ATOM   6192  C  CB    . ILE C  2 62  ? -43.718 15.683  -53.200 1.00 46.27  ? 62  ILE A CB    1 
ATOM   6193  C  CG1   . ILE C  2 62  ? -42.450 16.073  -53.952 1.00 44.18  ? 62  ILE A CG1   1 
ATOM   6194  C  CG2   . ILE C  2 62  ? -43.987 14.196  -53.377 1.00 48.53  ? 62  ILE A CG2   1 
ATOM   6195  C  CD1   . ILE C  2 62  ? -41.189 15.464  -53.375 1.00 33.51  ? 62  ILE A CD1   1 
ATOM   6196  N  N     . ARG C  2 63  ? -47.030 15.358  -53.397 1.00 50.14  ? 63  ARG A N     1 
ATOM   6197  C  CA    . ARG C  2 63  ? -48.227 14.942  -52.678 1.00 50.07  ? 63  ARG A CA    1 
ATOM   6198  C  C     . ARG C  2 63  ? -47.878 14.113  -51.449 1.00 45.85  ? 63  ARG A C     1 
ATOM   6199  O  O     . ARG C  2 63  ? -47.035 13.222  -51.510 1.00 49.14  ? 63  ARG A O     1 
ATOM   6200  C  CB    . ARG C  2 63  ? -49.157 14.176  -53.619 1.00 56.86  ? 63  ARG A CB    1 
ATOM   6201  C  CG    . ARG C  2 63  ? -48.902 14.517  -55.077 1.00 60.20  ? 63  ARG A CG    1 
ATOM   6202  C  CD    . ARG C  2 63  ? -50.062 14.093  -55.929 1.00 59.01  ? 63  ARG A CD    1 
ATOM   6203  N  NE    . ARG C  2 63  ? -51.269 14.775  -55.467 1.00 78.20  ? 63  ARG A NE    1 
ATOM   6204  C  CZ    . ARG C  2 63  ? -52.512 14.366  -55.707 1.00 84.05  ? 63  ARG A CZ    1 
ATOM   6205  N  NH1   . ARG C  2 63  ? -52.735 13.297  -56.470 1.00 69.51  ? 63  ARG A NH1   1 
ATOM   6206  N  NH2   . ARG C  2 63  ? -53.537 15.064  -55.226 1.00 80.87  ? 63  ARG A NH2   1 
ATOM   6207  N  N     . LYS C  2 64  ? -48.557 14.404  -50.344 1.00 47.96  ? 64  LYS A N     1 
ATOM   6208  C  CA    . LYS C  2 64  ? -48.140 13.929  -49.027 1.00 50.11  ? 64  LYS A CA    1 
ATOM   6209  C  C     . LYS C  2 64  ? -48.140 12.411  -48.858 1.00 55.47  ? 64  LYS A C     1 
ATOM   6210  O  O     . LYS C  2 64  ? -47.157 11.838  -48.388 1.00 54.72  ? 64  LYS A O     1 
ATOM   6211  C  CB    . LYS C  2 64  ? -49.022 14.560  -47.948 1.00 50.09  ? 64  LYS A CB    1 
ATOM   6212  C  CG    . LYS C  2 64  ? -49.014 16.077  -47.986 1.00 60.19  ? 64  LYS A CG    1 
ATOM   6213  C  CD    . LYS C  2 64  ? -48.906 16.668  -46.597 1.00 63.05  ? 64  LYS A CD    1 
ATOM   6214  C  CE    . LYS C  2 64  ? -48.257 18.033  -46.641 1.00 58.11  ? 64  LYS A CE    1 
ATOM   6215  N  NZ    . LYS C  2 64  ? -48.136 18.597  -45.274 1.00 64.13  ? 64  LYS A NZ    1 
ATOM   6216  N  N     . LEU C  2 65  ? -49.237 11.760  -49.227 1.00 61.03  ? 65  LEU A N     1 
ATOM   6217  C  CA    . LEU C  2 65  ? -49.350 10.318  -49.023 1.00 54.40  ? 65  LEU A CA    1 
ATOM   6218  C  C     . LEU C  2 65  ? -48.308 9.499   -49.807 1.00 49.02  ? 65  LEU A C     1 
ATOM   6219  O  O     . LEU C  2 65  ? -47.670 8.632   -49.215 1.00 52.50  ? 65  LEU A O     1 
ATOM   6220  C  CB    . LEU C  2 65  ? -50.768 9.830   -49.358 1.00 58.26  ? 65  LEU A CB    1 
ATOM   6221  C  CG    . LEU C  2 65  ? -51.001 8.318   -49.232 1.00 59.61  ? 65  LEU A CG    1 
ATOM   6222  C  CD1   . LEU C  2 65  ? -50.775 7.839   -47.807 1.00 50.78  ? 65  LEU A CD1   1 
ATOM   6223  C  CD2   . LEU C  2 65  ? -52.394 7.947   -49.707 1.00 66.29  ? 65  LEU A CD2   1 
ATOM   6224  N  N     . PRO C  2 66  ? -48.125 9.756   -51.122 1.00 50.64  ? 66  PRO A N     1 
ATOM   6225  C  CA    . PRO C  2 66  ? -47.095 8.985   -51.837 1.00 52.52  ? 66  PRO A CA    1 
ATOM   6226  C  C     . PRO C  2 66  ? -45.715 9.123   -51.204 1.00 54.80  ? 66  PRO A C     1 
ATOM   6227  O  O     . PRO C  2 66  ? -44.933 8.163   -51.140 1.00 52.52  ? 66  PRO A O     1 
ATOM   6228  C  CB    . PRO C  2 66  ? -47.102 9.601   -53.236 1.00 50.85  ? 66  PRO A CB    1 
ATOM   6229  C  CG    . PRO C  2 66  ? -48.460 10.155  -53.390 1.00 56.44  ? 66  PRO A CG    1 
ATOM   6230  C  CD    . PRO C  2 66  ? -48.844 10.663  -52.037 1.00 54.75  ? 66  PRO A CD    1 
ATOM   6231  N  N     . PHE C  2 67  ? -45.430 10.328  -50.725 1.00 55.56  ? 67  PHE A N     1 
ATOM   6232  C  CA    . PHE C  2 67  ? -44.168 10.603  -50.063 1.00 50.53  ? 67  PHE A CA    1 
ATOM   6233  C  C     . PHE C  2 67  ? -44.054 9.842   -48.747 1.00 48.65  ? 67  PHE A C     1 
ATOM   6234  O  O     . PHE C  2 67  ? -42.997 9.308   -48.424 1.00 54.96  ? 67  PHE A O     1 
ATOM   6235  C  CB    . PHE C  2 67  ? -44.005 12.101  -49.815 1.00 49.41  ? 67  PHE A CB    1 
ATOM   6236  C  CG    . PHE C  2 67  ? -42.697 12.461  -49.184 1.00 52.62  ? 67  PHE A CG    1 
ATOM   6237  C  CD1   . PHE C  2 67  ? -41.565 12.627  -49.963 1.00 44.19  ? 67  PHE A CD1   1 
ATOM   6238  C  CD2   . PHE C  2 67  ? -42.593 12.619  -47.812 1.00 50.66  ? 67  PHE A CD2   1 
ATOM   6239  C  CE1   . PHE C  2 67  ? -40.360 12.950  -49.387 1.00 37.66  ? 67  PHE A CE1   1 
ATOM   6240  C  CE2   . PHE C  2 67  ? -41.387 12.943  -47.231 1.00 41.69  ? 67  PHE A CE2   1 
ATOM   6241  C  CZ    . PHE C  2 67  ? -40.270 13.106  -48.020 1.00 41.15  ? 67  PHE A CZ    1 
ATOM   6242  N  N     . GLN C  2 68  ? -45.141 9.794   -47.986 1.00 49.60  ? 68  GLN A N     1 
ATOM   6243  C  CA    . GLN C  2 68  ? -45.133 9.082   -46.714 1.00 51.54  ? 68  GLN A CA    1 
ATOM   6244  C  C     . GLN C  2 68  ? -44.922 7.584   -46.951 1.00 51.61  ? 68  GLN A C     1 
ATOM   6245  O  O     . GLN C  2 68  ? -44.214 6.909   -46.202 1.00 49.72  ? 68  GLN A O     1 
ATOM   6246  C  CB    . GLN C  2 68  ? -46.432 9.339   -45.953 1.00 48.58  ? 68  GLN A CB    1 
ATOM   6247  C  CG    . GLN C  2 68  ? -46.295 9.170   -44.452 1.00 60.45  ? 68  GLN A CG    1 
ATOM   6248  C  CD    . GLN C  2 68  ? -47.500 9.687   -43.697 1.00 65.92  ? 68  GLN A CD    1 
ATOM   6249  O  OE1   . GLN C  2 68  ? -47.396 10.096  -42.538 1.00 60.58  ? 68  GLN A OE1   1 
ATOM   6250  N  NE2   . GLN C  2 68  ? -48.657 9.673   -44.353 1.00 69.11  ? 68  GLN A NE2   1 
ATOM   6251  N  N     . ARG C  2 69  ? -45.540 7.088   -48.016 1.00 48.43  ? 69  ARG A N     1 
ATOM   6252  C  CA    . ARG C  2 69  ? -45.365 5.721   -48.487 1.00 47.49  ? 69  ARG A CA    1 
ATOM   6253  C  C     . ARG C  2 69  ? -43.887 5.418   -48.739 1.00 49.00  ? 69  ARG A C     1 
ATOM   6254  O  O     . ARG C  2 69  ? -43.309 4.477   -48.164 1.00 46.96  ? 69  ARG A O     1 
ATOM   6255  C  CB    . ARG C  2 69  ? -46.183 5.527   -49.767 1.00 56.59  ? 69  ARG A CB    1 
ATOM   6256  C  CG    . ARG C  2 69  ? -46.648 4.116   -50.065 1.00 65.54  ? 69  ARG A CG    1 
ATOM   6257  C  CD    . ARG C  2 69  ? -47.451 4.098   -51.368 1.00 60.54  ? 69  ARG A CD    1 
ATOM   6258  N  NE    . ARG C  2 69  ? -48.636 4.946   -51.293 1.00 58.11  ? 69  ARG A NE    1 
ATOM   6259  C  CZ    . ARG C  2 69  ? -49.096 5.691   -52.295 1.00 62.78  ? 69  ARG A CZ    1 
ATOM   6260  N  NH1   . ARG C  2 69  ? -48.470 5.707   -53.465 1.00 66.16  ? 69  ARG A NH1   1 
ATOM   6261  N  NH2   . ARG C  2 69  ? -50.184 6.427   -52.123 1.00 60.82  ? 69  ARG A NH2   1 
ATOM   6262  N  N     . LEU C  2 70  ? -43.288 6.239   -49.601 1.00 51.95  ? 70  LEU A N     1 
ATOM   6263  C  CA    . LEU C  2 70  ? -41.864 6.159   -49.930 1.00 50.55  ? 70  LEU A CA    1 
ATOM   6264  C  C     . LEU C  2 70  ? -40.953 6.158   -48.691 1.00 51.12  ? 70  LEU A C     1 
ATOM   6265  O  O     . LEU C  2 70  ? -40.062 5.300   -48.542 1.00 46.02  ? 70  LEU A O     1 
ATOM   6266  C  CB    . LEU C  2 70  ? -41.492 7.328   -50.839 1.00 49.47  ? 70  LEU A CB    1 
ATOM   6267  C  CG    . LEU C  2 70  ? -40.086 7.357   -51.424 1.00 48.24  ? 70  LEU A CG    1 
ATOM   6268  C  CD1   . LEU C  2 70  ? -39.883 6.174   -52.344 1.00 48.08  ? 70  LEU A CD1   1 
ATOM   6269  C  CD2   . LEU C  2 70  ? -39.866 8.658   -52.163 1.00 45.98  ? 70  LEU A CD2   1 
ATOM   6270  N  N     . VAL C  2 71  ? -41.186 7.130   -47.811 1.00 43.86  ? 71  VAL A N     1 
ATOM   6271  C  CA    . VAL C  2 71  ? -40.447 7.247   -46.562 1.00 42.22  ? 71  VAL A CA    1 
ATOM   6272  C  C     . VAL C  2 71  ? -40.530 5.972   -45.739 1.00 49.71  ? 71  VAL A C     1 
ATOM   6273  O  O     . VAL C  2 71  ? -39.505 5.441   -45.314 1.00 51.04  ? 71  VAL A O     1 
ATOM   6274  C  CB    . VAL C  2 71  ? -40.963 8.418   -45.711 1.00 49.22  ? 71  VAL A CB    1 
ATOM   6275  C  CG1   . VAL C  2 71  ? -40.450 8.308   -44.280 1.00 43.33  ? 71  VAL A CG1   1 
ATOM   6276  C  CG2   . VAL C  2 71  ? -40.555 9.740   -46.334 1.00 49.13  ? 71  VAL A CG2   1 
ATOM   6277  N  N     . ARG C  2 72  ? -41.748 5.478   -45.526 1.00 55.05  ? 72  ARG A N     1 
ATOM   6278  C  CA    . ARG C  2 72  ? -41.946 4.282   -44.707 1.00 51.93  ? 72  ARG A CA    1 
ATOM   6279  C  C     . ARG C  2 72  ? -41.287 3.041   -45.304 1.00 49.14  ? 72  ARG A C     1 
ATOM   6280  O  O     . ARG C  2 72  ? -40.781 2.203   -44.560 1.00 45.70  ? 72  ARG A O     1 
ATOM   6281  C  CB    . ARG C  2 72  ? -43.436 4.029   -44.480 1.00 53.62  ? 72  ARG A CB    1 
ATOM   6282  C  CG    . ARG C  2 72  ? -44.092 5.115   -43.648 1.00 57.96  ? 72  ARG A CG    1 
ATOM   6283  C  CD    . ARG C  2 72  ? -45.559 4.844   -43.385 1.00 53.88  ? 72  ARG A CD    1 
ATOM   6284  N  NE    . ARG C  2 72  ? -46.221 6.058   -42.920 1.00 65.46  ? 72  ARG A NE    1 
ATOM   6285  C  CZ    . ARG C  2 72  ? -46.247 6.460   -41.654 1.00 62.08  ? 72  ARG A CZ    1 
ATOM   6286  N  NH1   . ARG C  2 72  ? -45.660 5.733   -40.713 1.00 54.45  ? 72  ARG A NH1   1 
ATOM   6287  N  NH2   . ARG C  2 72  ? -46.868 7.586   -41.330 1.00 51.63  ? 72  ARG A NH2   1 
ATOM   6288  N  N     . GLU C  2 73  ? -41.286 2.930   -46.634 1.00 48.28  ? 73  GLU A N     1 
ATOM   6289  C  CA    . GLU C  2 73  ? -40.571 1.841   -47.316 1.00 47.53  ? 73  GLU A CA    1 
ATOM   6290  C  C     . GLU C  2 73  ? -39.050 1.892   -47.097 1.00 50.95  ? 73  GLU A C     1 
ATOM   6291  O  O     . GLU C  2 73  ? -38.431 0.920   -46.602 1.00 52.55  ? 73  GLU A O     1 
ATOM   6292  C  CB    . GLU C  2 73  ? -40.869 1.879   -48.817 1.00 46.32  ? 73  GLU A CB    1 
ATOM   6293  C  CG    . GLU C  2 73  ? -39.976 0.979   -49.655 1.00 47.33  ? 73  GLU A CG    1 
ATOM   6294  C  CD    . GLU C  2 73  ? -40.033 1.318   -51.138 1.00 65.07  ? 73  GLU A CD    1 
ATOM   6295  O  OE1   . GLU C  2 73  ? -41.141 1.307   -51.715 1.00 67.55  ? 73  GLU A OE1   1 
ATOM   6296  O  OE2   . GLU C  2 73  ? -38.970 1.601   -51.730 1.00 66.34  ? 73  GLU A OE2   1 
ATOM   6297  N  N     . ILE C  2 74  ? -38.454 3.024   -47.478 1.00 52.00  ? 74  ILE A N     1 
ATOM   6298  C  CA    . ILE C  2 74  ? -37.015 3.225   -47.313 1.00 44.33  ? 74  ILE A CA    1 
ATOM   6299  C  C     . ILE C  2 74  ? -36.610 2.955   -45.873 1.00 46.44  ? 74  ILE A C     1 
ATOM   6300  O  O     . ILE C  2 74  ? -35.648 2.229   -45.612 1.00 48.26  ? 74  ILE A O     1 
ATOM   6301  C  CB    . ILE C  2 74  ? -36.582 4.650   -47.705 1.00 38.06  ? 74  ILE A CB    1 
ATOM   6302  C  CG1   . ILE C  2 74  ? -36.680 4.843   -49.215 1.00 40.28  ? 74  ILE A CG1   1 
ATOM   6303  C  CG2   . ILE C  2 74  ? -35.164 4.920   -47.251 1.00 37.82  ? 74  ILE A CG2   1 
ATOM   6304  C  CD1   . ILE C  2 74  ? -36.423 6.258   -49.660 1.00 38.32  ? 74  ILE A CD1   1 
ATOM   6305  N  N     . ALA C  2 75  ? -37.372 3.523   -44.942 1.00 46.69  ? 75  ALA A N     1 
ATOM   6306  C  CA    . ALA C  2 75  ? -37.119 3.337   -43.518 1.00 53.14  ? 75  ALA A CA    1 
ATOM   6307  C  C     . ALA C  2 75  ? -37.247 1.875   -43.126 1.00 52.62  ? 75  ALA A C     1 
ATOM   6308  O  O     . ALA C  2 75  ? -36.505 1.388   -42.269 1.00 49.54  ? 75  ALA A O     1 
ATOM   6309  C  CB    . ALA C  2 75  ? -38.069 4.186   -42.696 1.00 50.35  ? 75  ALA A CB    1 
ATOM   6310  N  N     . GLN C  2 76  ? -38.193 1.183   -43.758 1.00 52.10  ? 76  GLN A N     1 
ATOM   6311  C  CA    . GLN C  2 76  ? -38.414 -0.234  -43.491 1.00 55.46  ? 76  GLN A CA    1 
ATOM   6312  C  C     . GLN C  2 76  ? -37.171 -1.037  -43.807 1.00 51.13  ? 76  GLN A C     1 
ATOM   6313  O  O     . GLN C  2 76  ? -36.856 -1.991  -43.100 1.00 59.17  ? 76  GLN A O     1 
ATOM   6314  C  CB    . GLN C  2 76  ? -39.601 -0.771  -44.295 1.00 59.60  ? 76  GLN A CB    1 
ATOM   6315  C  CG    . GLN C  2 76  ? -39.789 -2.280  -44.215 1.00 59.31  ? 76  GLN A CG    1 
ATOM   6316  C  CD    . GLN C  2 76  ? -40.357 -2.744  -42.888 1.00 70.18  ? 76  GLN A CD    1 
ATOM   6317  O  OE1   . GLN C  2 76  ? -40.496 -1.964  -41.947 1.00 76.24  ? 76  GLN A OE1   1 
ATOM   6318  N  NE2   . GLN C  2 76  ? -40.689 -4.029  -42.808 1.00 72.53  ? 76  GLN A NE2   1 
ATOM   6319  N  N     . ASP C  2 77  ? -36.452 -0.650  -44.858 1.00 47.09  ? 77  ASP A N     1 
ATOM   6320  C  CA    . ASP C  2 77  ? -35.204 -1.355  -45.174 1.00 40.61  ? 77  ASP A CA    1 
ATOM   6321  C  C     . ASP C  2 77  ? -34.107 -1.244  -44.096 1.00 43.78  ? 77  ASP A C     1 
ATOM   6322  O  O     . ASP C  2 77  ? -33.149 -2.012  -44.119 1.00 41.01  ? 77  ASP A O     1 
ATOM   6323  C  CB    . ASP C  2 77  ? -34.638 -0.865  -46.508 1.00 49.55  ? 77  ASP A CB    1 
ATOM   6324  C  CG    . ASP C  2 77  ? -35.494 -1.271  -47.693 1.00 60.83  ? 77  ASP A CG    1 
ATOM   6325  O  OD1   . ASP C  2 77  ? -36.325 -2.195  -47.549 1.00 66.30  ? 77  ASP A OD1   1 
ATOM   6326  O  OD2   . ASP C  2 77  ? -35.335 -0.663  -48.773 1.00 63.82  ? 77  ASP A OD2   1 
ATOM   6327  N  N     . PHE C  2 78  ? -34.236 -0.302  -43.162 1.00 49.31  ? 78  PHE A N     1 
ATOM   6328  C  CA    . PHE C  2 78  ? -33.206 -0.100  -42.133 1.00 45.69  ? 78  PHE A CA    1 
ATOM   6329  C  C     . PHE C  2 78  ? -33.600 -0.670  -40.774 1.00 48.24  ? 78  PHE A C     1 
ATOM   6330  O  O     . PHE C  2 78  ? -32.762 -1.176  -40.029 1.00 46.77  ? 78  PHE A O     1 
ATOM   6331  C  CB    . PHE C  2 78  ? -32.886 1.389   -41.963 1.00 54.02  ? 78  PHE A CB    1 
ATOM   6332  C  CG    . PHE C  2 78  ? -32.299 2.036   -43.184 1.00 53.79  ? 78  PHE A CG    1 
ATOM   6333  C  CD1   . PHE C  2 78  ? -31.089 1.604   -43.701 1.00 48.90  ? 78  PHE A CD1   1 
ATOM   6334  C  CD2   . PHE C  2 78  ? -32.946 3.096   -43.797 1.00 49.44  ? 78  PHE A CD2   1 
ATOM   6335  C  CE1   . PHE C  2 78  ? -30.543 2.206   -44.818 1.00 51.45  ? 78  PHE A CE1   1 
ATOM   6336  C  CE2   . PHE C  2 78  ? -32.408 3.701   -44.913 1.00 45.07  ? 78  PHE A CE2   1 
ATOM   6337  C  CZ    . PHE C  2 78  ? -31.203 3.254   -45.425 1.00 50.90  ? 78  PHE A CZ    1 
ATOM   6338  N  N     . LYS C  2 79  ? -34.877 -0.544  -40.439 1.00 53.99  ? 79  LYS A N     1 
ATOM   6339  C  CA    . LYS C  2 79  ? -35.417 -1.141  -39.228 1.00 50.19  ? 79  LYS A CA    1 
ATOM   6340  C  C     . LYS C  2 79  ? -36.905 -1.363  -39.437 1.00 62.29  ? 79  LYS A C     1 
ATOM   6341  O  O     . LYS C  2 79  ? -37.585 -0.521  -40.024 1.00 67.28  ? 79  LYS A O     1 
ATOM   6342  C  CB    . LYS C  2 79  ? -35.159 -0.257  -38.010 1.00 50.91  ? 79  LYS A CB    1 
ATOM   6343  C  CG    . LYS C  2 79  ? -35.609 -0.876  -36.699 1.00 59.94  ? 79  LYS A CG    1 
ATOM   6344  C  CD    . LYS C  2 79  ? -35.173 -0.047  -35.503 1.00 57.63  ? 79  LYS A CD    1 
ATOM   6345  C  CE    . LYS C  2 79  ? -35.520 -0.752  -34.200 1.00 70.14  ? 79  LYS A CE    1 
ATOM   6346  N  NZ    . LYS C  2 79  ? -34.985 -2.145  -34.169 1.00 85.35  ? 79  LYS A NZ    1 
ATOM   6347  N  N     . THR C  2 80  ? -37.409 -2.501  -38.973 1.00 62.86  ? 80  THR A N     1 
ATOM   6348  C  CA    . THR C  2 80  ? -38.795 -2.868  -39.235 1.00 64.53  ? 80  THR A CA    1 
ATOM   6349  C  C     . THR C  2 80  ? -39.721 -2.482  -38.093 1.00 63.57  ? 80  THR A C     1 
ATOM   6350  O  O     . THR C  2 80  ? -39.266 -2.163  -36.992 1.00 60.54  ? 80  THR A O     1 
ATOM   6351  C  CB    . THR C  2 80  ? -38.938 -4.377  -39.490 1.00 69.02  ? 80  THR A CB    1 
ATOM   6352  O  OG1   . THR C  2 80  ? -38.376 -5.102  -38.390 1.00 72.15  ? 80  THR A OG1   1 
ATOM   6353  C  CG2   . THR C  2 80  ? -38.219 -4.771  -40.766 1.00 68.86  ? 80  THR A CG2   1 
ATOM   6354  N  N     . ASP C  2 81  ? -41.022 -2.522  -38.376 1.00 64.98  ? 81  ASP A N     1 
ATOM   6355  C  CA    . ASP C  2 81  ? -42.062 -2.226  -37.396 1.00 70.45  ? 81  ASP A CA    1 
ATOM   6356  C  C     . ASP C  2 81  ? -41.870 -0.830  -36.816 1.00 69.90  ? 81  ASP A C     1 
ATOM   6357  O  O     . ASP C  2 81  ? -42.053 -0.607  -35.620 1.00 73.96  ? 81  ASP A O     1 
ATOM   6358  C  CB    . ASP C  2 81  ? -42.070 -3.278  -36.281 1.00 75.93  ? 81  ASP A CB    1 
ATOM   6359  C  CG    . ASP C  2 81  ? -43.376 -3.306  -35.510 1.00 84.16  ? 81  ASP A CG    1 
ATOM   6360  O  OD1   . ASP C  2 81  ? -44.415 -2.905  -36.080 1.00 76.10  ? 81  ASP A OD1   1 
ATOM   6361  O  OD2   . ASP C  2 81  ? -43.361 -3.728  -34.333 1.00 88.26  ? 81  ASP A OD2   1 
ATOM   6362  N  N     . LEU C  2 82  ? -41.494 0.107   -37.677 1.00 66.56  ? 82  LEU A N     1 
ATOM   6363  C  CA    . LEU C  2 82  ? -41.205 1.463   -37.241 1.00 63.62  ? 82  LEU A CA    1 
ATOM   6364  C  C     . LEU C  2 82  ? -42.434 2.352   -37.321 1.00 57.14  ? 82  LEU A C     1 
ATOM   6365  O  O     . LEU C  2 82  ? -43.283 2.183   -38.193 1.00 53.50  ? 82  LEU A O     1 
ATOM   6366  C  CB    . LEU C  2 82  ? -40.072 2.065   -38.075 1.00 60.21  ? 82  LEU A CB    1 
ATOM   6367  C  CG    . LEU C  2 82  ? -38.655 1.784   -37.582 1.00 54.34  ? 82  LEU A CG    1 
ATOM   6368  C  CD1   . LEU C  2 82  ? -37.633 2.384   -38.529 1.00 52.27  ? 82  LEU A CD1   1 
ATOM   6369  C  CD2   . LEU C  2 82  ? -38.479 2.337   -36.181 1.00 53.51  ? 82  LEU A CD2   1 
ATOM   6370  N  N     . ARG C  2 83  ? -42.517 3.297   -36.394 1.00 53.86  ? 83  ARG A N     1 
ATOM   6371  C  CA    . ARG C  2 83  ? -43.565 4.302   -36.414 1.00 56.31  ? 83  ARG A CA    1 
ATOM   6372  C  C     . ARG C  2 83  ? -42.957 5.677   -36.685 1.00 56.26  ? 83  ARG A C     1 
ATOM   6373  O  O     . ARG C  2 83  ? -41.779 5.909   -36.414 1.00 54.02  ? 83  ARG A O     1 
ATOM   6374  C  CB    . ARG C  2 83  ? -44.336 4.295   -35.096 1.00 63.17  ? 83  ARG A CB    1 
ATOM   6375  C  CG    . ARG C  2 83  ? -44.984 2.958   -34.788 1.00 69.23  ? 83  ARG A CG    1 
ATOM   6376  C  CD    . ARG C  2 83  ? -45.893 3.030   -33.577 1.00 77.15  ? 83  ARG A CD    1 
ATOM   6377  N  NE    . ARG C  2 83  ? -46.937 2.013   -33.644 1.00 87.49  ? 83  ARG A NE    1 
ATOM   6378  C  CZ    . ARG C  2 83  ? -48.231 2.272   -33.503 1.00 91.52  ? 83  ARG A CZ    1 
ATOM   6379  N  NH1   . ARG C  2 83  ? -48.636 3.515   -33.283 1.00 86.15  ? 83  ARG A NH1   1 
ATOM   6380  N  NH2   . ARG C  2 83  ? -49.122 1.292   -33.585 1.00 89.82  ? 83  ARG A NH2   1 
ATOM   6381  N  N     . PHE C  2 84  ? -43.766 6.582   -37.225 1.00 57.16  ? 84  PHE A N     1 
ATOM   6382  C  CA    . PHE C  2 84  ? -43.295 7.910   -37.599 1.00 50.28  ? 84  PHE A CA    1 
ATOM   6383  C  C     . PHE C  2 84  ? -44.160 9.021   -37.030 1.00 50.36  ? 84  PHE A C     1 
ATOM   6384  O  O     . PHE C  2 84  ? -45.375 9.041   -37.237 1.00 57.37  ? 84  PHE A O     1 
ATOM   6385  C  CB    . PHE C  2 84  ? -43.246 8.049   -39.122 1.00 46.50  ? 84  PHE A CB    1 
ATOM   6386  C  CG    . PHE C  2 84  ? -41.965 7.575   -39.734 1.00 52.29  ? 84  PHE A CG    1 
ATOM   6387  C  CD1   . PHE C  2 84  ? -40.880 8.430   -39.849 1.00 47.31  ? 84  PHE A CD1   1 
ATOM   6388  C  CD2   . PHE C  2 84  ? -41.845 6.279   -40.204 1.00 47.37  ? 84  PHE A CD2   1 
ATOM   6389  C  CE1   . PHE C  2 84  ? -39.699 7.999   -40.416 1.00 45.90  ? 84  PHE A CE1   1 
ATOM   6390  C  CE2   . PHE C  2 84  ? -40.666 5.842   -40.772 1.00 45.37  ? 84  PHE A CE2   1 
ATOM   6391  C  CZ    . PHE C  2 84  ? -39.592 6.704   -40.878 1.00 46.36  ? 84  PHE A CZ    1 
ATOM   6392  N  N     . GLN C  2 85  ? -43.533 9.946   -36.312 1.00 46.64  ? 85  GLN A N     1 
ATOM   6393  C  CA    . GLN C  2 85  ? -44.200 11.189  -35.959 1.00 46.17  ? 85  GLN A CA    1 
ATOM   6394  C  C     . GLN C  2 85  ? -44.573 11.917  -37.247 1.00 52.04  ? 85  GLN A C     1 
ATOM   6395  O  O     . GLN C  2 85  ? -43.788 11.944  -38.200 1.00 48.67  ? 85  GLN A O     1 
ATOM   6396  C  CB    . GLN C  2 85  ? -43.308 12.072  -35.081 1.00 40.80  ? 85  GLN A CB    1 
ATOM   6397  C  CG    . GLN C  2 85  ? -43.049 11.515  -33.696 1.00 40.23  ? 85  GLN A CG    1 
ATOM   6398  C  CD    . GLN C  2 85  ? -42.529 12.564  -32.730 1.00 45.63  ? 85  GLN A CD    1 
ATOM   6399  O  OE1   . GLN C  2 85  ? -42.136 13.662  -33.131 1.00 42.55  ? 85  GLN A OE1   1 
ATOM   6400  N  NE2   . GLN C  2 85  ? -42.521 12.228  -31.445 1.00 43.94  ? 85  GLN A NE2   1 
ATOM   6401  N  N     . SER C  2 86  ? -45.775 12.484  -37.287 1.00 52.33  ? 86  SER A N     1 
ATOM   6402  C  CA    . SER C  2 86  ? -46.212 13.246  -38.450 1.00 45.44  ? 86  SER A CA    1 
ATOM   6403  C  C     . SER C  2 86  ? -45.280 14.430  -38.685 1.00 44.10  ? 86  SER A C     1 
ATOM   6404  O  O     . SER C  2 86  ? -44.994 14.788  -39.829 1.00 48.79  ? 86  SER A O     1 
ATOM   6405  C  CB    . SER C  2 86  ? -47.655 13.722  -38.275 1.00 42.21  ? 86  SER A CB    1 
ATOM   6406  O  OG    . SER C  2 86  ? -47.820 14.389  -37.038 1.00 56.31  ? 86  SER A OG    1 
ATOM   6407  N  N     . SER C  2 87  ? -44.792 15.023  -37.599 1.00 43.99  ? 87  SER A N     1 
ATOM   6408  C  CA    . SER C  2 87  ? -43.841 16.122  -37.699 1.00 45.53  ? 87  SER A CA    1 
ATOM   6409  C  C     . SER C  2 87  ? -42.500 15.648  -38.271 1.00 48.17  ? 87  SER A C     1 
ATOM   6410  O  O     . SER C  2 87  ? -41.771 16.425  -38.884 1.00 43.80  ? 87  SER A O     1 
ATOM   6411  C  CB    . SER C  2 87  ? -43.628 16.774  -36.336 1.00 44.07  ? 87  SER A CB    1 
ATOM   6412  O  OG    . SER C  2 87  ? -43.007 15.876  -35.437 1.00 53.64  ? 87  SER A OG    1 
ATOM   6413  N  N     . ALA C  2 88  ? -42.182 14.371  -38.073 1.00 48.33  ? 88  ALA A N     1 
ATOM   6414  C  CA    . ALA C  2 88  ? -40.949 13.798  -38.609 1.00 45.02  ? 88  ALA A CA    1 
ATOM   6415  C  C     . ALA C  2 88  ? -41.044 13.601  -40.120 1.00 43.61  ? 88  ALA A C     1 
ATOM   6416  O  O     . ALA C  2 88  ? -40.105 13.908  -40.861 1.00 46.44  ? 88  ALA A O     1 
ATOM   6417  C  CB    . ALA C  2 88  ? -40.635 12.482  -37.923 1.00 44.95  ? 88  ALA A CB    1 
ATOM   6418  N  N     . VAL C  2 89  ? -42.180 13.082  -40.572 1.00 46.62  ? 89  VAL A N     1 
ATOM   6419  C  CA    . VAL C  2 89  ? -42.426 12.922  -41.998 1.00 43.07  ? 89  VAL A CA    1 
ATOM   6420  C  C     . VAL C  2 89  ? -42.456 14.289  -42.673 1.00 46.47  ? 89  VAL A C     1 
ATOM   6421  O  O     . VAL C  2 89  ? -41.908 14.469  -43.765 1.00 48.02  ? 89  VAL A O     1 
ATOM   6422  C  CB    . VAL C  2 89  ? -43.746 12.181  -42.267 1.00 38.81  ? 89  VAL A CB    1 
ATOM   6423  C  CG1   . VAL C  2 89  ? -43.930 11.951  -43.757 1.00 43.18  ? 89  VAL A CG1   1 
ATOM   6424  C  CG2   . VAL C  2 89  ? -43.769 10.863  -41.520 1.00 42.75  ? 89  VAL A CG2   1 
ATOM   6425  N  N     . MET C  2 90  ? -43.084 15.255  -42.006 1.00 43.42  ? 90  MET A N     1 
ATOM   6426  C  CA    . MET C  2 90  ? -43.160 16.611  -42.531 1.00 44.41  ? 90  MET A CA    1 
ATOM   6427  C  C     . MET C  2 90  ? -41.781 17.254  -42.616 1.00 45.26  ? 90  MET A C     1 
ATOM   6428  O  O     . MET C  2 90  ? -41.465 17.917  -43.601 1.00 44.82  ? 90  MET A O     1 
ATOM   6429  C  CB    . MET C  2 90  ? -44.094 17.468  -41.676 1.00 54.32  ? 90  MET A CB    1 
ATOM   6430  C  CG    . MET C  2 90  ? -45.574 17.273  -41.987 1.00 49.74  ? 90  MET A CG    1 
ATOM   6431  S  SD    . MET C  2 90  ? -45.960 17.580  -43.726 1.00 73.80  ? 90  MET A SD    1 
ATOM   6432  C  CE    . MET C  2 90  ? -46.090 15.911  -44.374 1.00 54.80  ? 90  MET A CE    1 
ATOM   6433  N  N     . ALA C  2 91  ? -40.964 17.053  -41.586 1.00 43.25  ? 91  ALA A N     1 
ATOM   6434  C  CA    . ALA C  2 91  ? -39.603 17.576  -41.587 1.00 39.45  ? 91  ALA A CA    1 
ATOM   6435  C  C     . ALA C  2 91  ? -38.827 16.985  -42.755 1.00 45.66  ? 91  ALA A C     1 
ATOM   6436  O  O     . ALA C  2 91  ? -38.147 17.710  -43.494 1.00 46.78  ? 91  ALA A O     1 
ATOM   6437  C  CB    . ALA C  2 91  ? -38.908 17.274  -40.275 1.00 36.97  ? 91  ALA A CB    1 
ATOM   6438  N  N     . LEU C  2 92  ? -38.941 15.669  -42.924 1.00 43.41  ? 92  LEU A N     1 
ATOM   6439  C  CA    . LEU C  2 92  ? -38.337 14.999  -44.073 1.00 39.31  ? 92  LEU A CA    1 
ATOM   6440  C  C     . LEU C  2 92  ? -38.763 15.648  -45.388 1.00 42.62  ? 92  LEU A C     1 
ATOM   6441  O  O     . LEU C  2 92  ? -37.910 15.986  -46.205 1.00 44.64  ? 92  LEU A O     1 
ATOM   6442  C  CB    . LEU C  2 92  ? -38.691 13.510  -44.089 1.00 42.53  ? 92  LEU A CB    1 
ATOM   6443  C  CG    . LEU C  2 92  ? -37.809 12.565  -43.264 1.00 45.25  ? 92  LEU A CG    1 
ATOM   6444  C  CD1   . LEU C  2 92  ? -38.378 11.158  -43.273 1.00 44.91  ? 92  LEU A CD1   1 
ATOM   6445  C  CD2   . LEU C  2 92  ? -36.379 12.557  -43.778 1.00 34.52  ? 92  LEU A CD2   1 
ATOM   6446  N  N     . GLN C  2 93  ? -40.066 15.844  -45.592 1.00 40.69  ? 93  GLN A N     1 
ATOM   6447  C  CA    . GLN C  2 93  ? -40.534 16.401  -46.864 1.00 40.21  ? 93  GLN A CA    1 
ATOM   6448  C  C     . GLN C  2 93  ? -40.044 17.833  -47.079 1.00 44.65  ? 93  GLN A C     1 
ATOM   6449  O  O     . GLN C  2 93  ? -39.675 18.207  -48.191 1.00 45.50  ? 93  GLN A O     1 
ATOM   6450  C  CB    . GLN C  2 93  ? -42.059 16.355  -46.959 1.00 39.39  ? 93  GLN A CB    1 
ATOM   6451  C  CG    . GLN C  2 93  ? -42.571 16.544  -48.379 1.00 41.67  ? 93  GLN A CG    1 
ATOM   6452  C  CD    . GLN C  2 93  ? -44.061 16.297  -48.515 1.00 48.92  ? 93  GLN A CD    1 
ATOM   6453  O  OE1   . GLN C  2 93  ? -44.704 15.785  -47.600 1.00 53.43  ? 93  GLN A OE1   1 
ATOM   6454  N  NE2   . GLN C  2 93  ? -44.619 16.668  -49.662 1.00 47.27  ? 93  GLN A NE2   1 
ATOM   6455  N  N     . GLU C  2 94  ? -40.039 18.631  -46.018 1.00 40.14  ? 94  GLU A N     1 
ATOM   6456  C  CA    . GLU C  2 94  ? -39.503 19.981  -46.089 1.00 40.75  ? 94  GLU A CA    1 
ATOM   6457  C  C     . GLU C  2 94  ? -38.044 19.965  -46.553 1.00 43.64  ? 94  GLU A C     1 
ATOM   6458  O  O     . GLU C  2 94  ? -37.696 20.574  -47.575 1.00 47.29  ? 94  GLU A O     1 
ATOM   6459  C  CB    . GLU C  2 94  ? -39.619 20.668  -44.728 1.00 42.52  ? 94  GLU A CB    1 
ATOM   6460  C  CG    . GLU C  2 94  ? -41.026 21.083  -44.353 1.00 42.35  ? 94  GLU A CG    1 
ATOM   6461  C  CD    . GLU C  2 94  ? -41.476 22.336  -45.068 1.00 51.24  ? 94  GLU A CD    1 
ATOM   6462  O  OE1   . GLU C  2 94  ? -40.606 23.125  -45.498 1.00 49.38  ? 94  GLU A OE1   1 
ATOM   6463  O  OE2   . GLU C  2 94  ? -42.704 22.531  -45.199 1.00 56.07  ? 94  GLU A OE2   1 
ATOM   6464  N  N     . ALA C  2 95  ? -37.206 19.251  -45.801 1.00 39.73  ? 95  ALA A N     1 
ATOM   6465  C  CA    . ALA C  2 95  ? -35.778 19.154  -46.095 1.00 44.65  ? 95  ALA A CA    1 
ATOM   6466  C  C     . ALA C  2 95  ? -35.548 18.704  -47.525 1.00 40.25  ? 95  ALA A C     1 
ATOM   6467  O  O     . ALA C  2 95  ? -34.701 19.238  -48.253 1.00 44.46  ? 95  ALA A O     1 
ATOM   6468  C  CB    . ALA C  2 95  ? -35.109 18.194  -45.136 1.00 34.16  ? 95  ALA A CB    1 
ATOM   6469  N  N     . CYS C  2 96  ? -36.341 17.719  -47.912 1.00 39.47  ? 96  CYS A N     1 
ATOM   6470  C  CA    . CYS C  2 96  ? -36.255 17.095  -49.218 1.00 41.34  ? 96  CYS A CA    1 
ATOM   6471  C  C     . CYS C  2 96  ? -36.590 18.029  -50.379 1.00 40.87  ? 96  CYS A C     1 
ATOM   6472  O  O     . CYS C  2 96  ? -35.829 18.144  -51.338 1.00 37.23  ? 96  CYS A O     1 
ATOM   6473  C  CB    . CYS C  2 96  ? -37.190 15.898  -49.251 1.00 39.88  ? 96  CYS A CB    1 
ATOM   6474  S  SG    . CYS C  2 96  ? -36.694 14.697  -50.437 1.00 58.97  ? 96  CYS A SG    1 
ATOM   6475  N  N     . GLU C  2 97  ? -37.743 18.680  -50.295 1.00 41.49  ? 97  GLU A N     1 
ATOM   6476  C  CA    . GLU C  2 97  ? -38.171 19.582  -51.348 1.00 39.20  ? 97  GLU A CA    1 
ATOM   6477  C  C     . GLU C  2 97  ? -37.236 20.786  -51.443 1.00 38.67  ? 97  GLU A C     1 
ATOM   6478  O  O     . GLU C  2 97  ? -36.946 21.268  -52.544 1.00 32.16  ? 97  GLU A O     1 
ATOM   6479  C  CB    . GLU C  2 97  ? -39.613 20.024  -51.116 1.00 46.53  ? 97  GLU A CB    1 
ATOM   6480  C  CG    . GLU C  2 97  ? -40.615 18.878  -51.191 1.00 43.73  ? 97  GLU A CG    1 
ATOM   6481  C  CD    . GLU C  2 97  ? -42.004 19.345  -51.575 1.00 50.88  ? 97  GLU A CD    1 
ATOM   6482  O  OE1   . GLU C  2 97  ? -42.174 20.554  -51.842 1.00 55.21  ? 97  GLU A OE1   1 
ATOM   6483  O  OE2   . GLU C  2 97  ? -42.928 18.506  -51.609 1.00 52.82  ? 97  GLU A OE2   1 
ATOM   6484  N  N     . ALA C  2 98  ? -36.747 21.257  -50.296 1.00 38.15  ? 98  ALA A N     1 
ATOM   6485  C  CA    . ALA C  2 98  ? -35.732 22.312  -50.298 1.00 33.67  ? 98  ALA A CA    1 
ATOM   6486  C  C     . ALA C  2 98  ? -34.481 21.854  -51.057 1.00 37.43  ? 98  ALA A C     1 
ATOM   6487  O  O     . ALA C  2 98  ? -33.957 22.576  -51.923 1.00 38.07  ? 98  ALA A O     1 
ATOM   6488  C  CB    . ALA C  2 98  ? -35.378 22.713  -48.884 1.00 28.28  ? 98  ALA A CB    1 
ATOM   6489  N  N     . TYR C  2 99  ? -34.022 20.645  -50.739 1.00 35.22  ? 99  TYR A N     1 
ATOM   6490  C  CA    . TYR C  2 99  ? -32.860 20.065  -51.403 1.00 30.69  ? 99  TYR A CA    1 
ATOM   6491  C  C     . TYR C  2 99  ? -33.041 19.993  -52.915 1.00 33.73  ? 99  TYR A C     1 
ATOM   6492  O  O     . TYR C  2 99  ? -32.161 20.410  -53.677 1.00 41.07  ? 99  TYR A O     1 
ATOM   6493  C  CB    . TYR C  2 99  ? -32.570 18.667  -50.855 1.00 34.38  ? 99  TYR A CB    1 
ATOM   6494  C  CG    . TYR C  2 99  ? -31.560 17.893  -51.678 1.00 34.94  ? 99  TYR A CG    1 
ATOM   6495  C  CD1   . TYR C  2 99  ? -30.207 18.208  -51.637 1.00 35.14  ? 99  TYR A CD1   1 
ATOM   6496  C  CD2   . TYR C  2 99  ? -31.963 16.853  -52.502 1.00 34.20  ? 99  TYR A CD2   1 
ATOM   6497  C  CE1   . TYR C  2 99  ? -29.284 17.507  -52.389 1.00 27.12  ? 99  TYR A CE1   1 
ATOM   6498  C  CE2   . TYR C  2 99  ? -31.046 16.148  -53.261 1.00 40.24  ? 99  TYR A CE2   1 
ATOM   6499  C  CZ    . TYR C  2 99  ? -29.709 16.478  -53.199 1.00 33.97  ? 99  TYR A CZ    1 
ATOM   6500  O  OH    . TYR C  2 99  ? -28.797 15.773  -53.952 1.00 34.58  ? 99  TYR A OH    1 
ATOM   6501  N  N     . LEU C  2 100 ? -34.183 19.468  -53.348 1.00 33.74  ? 100 LEU A N     1 
ATOM   6502  C  CA    . LEU C  2 100 ? -34.427 19.276  -54.771 1.00 32.04  ? 100 LEU A CA    1 
ATOM   6503  C  C     . LEU C  2 100 ? -34.574 20.608  -55.503 1.00 37.79  ? 100 LEU A C     1 
ATOM   6504  O  O     . LEU C  2 100 ? -34.147 20.725  -56.650 1.00 39.96  ? 100 LEU A O     1 
ATOM   6505  C  CB    . LEU C  2 100 ? -35.669 18.406  -54.997 1.00 37.42  ? 100 LEU A CB    1 
ATOM   6506  C  CG    . LEU C  2 100 ? -35.484 16.884  -54.889 1.00 38.43  ? 100 LEU A CG    1 
ATOM   6507  C  CD1   . LEU C  2 100 ? -36.795 16.150  -55.122 1.00 34.17  ? 100 LEU A CD1   1 
ATOM   6508  C  CD2   . LEU C  2 100 ? -34.434 16.386  -55.863 1.00 38.95  ? 100 LEU A CD2   1 
ATOM   6509  N  N     . VAL C  2 101 ? -35.164 21.612  -54.851 1.00 39.79  ? 101 VAL A N     1 
ATOM   6510  C  CA    . VAL C  2 101 ? -35.321 22.927  -55.484 1.00 33.14  ? 101 VAL A CA    1 
ATOM   6511  C  C     . VAL C  2 101 ? -33.965 23.606  -55.664 1.00 33.55  ? 101 VAL A C     1 
ATOM   6512  O  O     . VAL C  2 101 ? -33.675 24.164  -56.736 1.00 33.89  ? 101 VAL A O     1 
ATOM   6513  C  CB    . VAL C  2 101 ? -36.262 23.849  -54.677 1.00 36.72  ? 101 VAL A CB    1 
ATOM   6514  C  CG1   . VAL C  2 101 ? -36.153 25.283  -55.167 1.00 35.47  ? 101 VAL A CG1   1 
ATOM   6515  C  CG2   . VAL C  2 101 ? -37.701 23.363  -54.780 1.00 29.77  ? 101 VAL A CG2   1 
ATOM   6516  N  N     . GLY C  2 102 ? -33.127 23.538  -54.629 1.00 28.91  ? 102 GLY A N     1 
ATOM   6517  C  CA    . GLY C  2 102 ? -31.764 24.036  -54.738 1.00 25.90  ? 102 GLY A CA    1 
ATOM   6518  C  C     . GLY C  2 102 ? -30.981 23.353  -55.851 1.00 33.40  ? 102 GLY A C     1 
ATOM   6519  O  O     . GLY C  2 102 ? -30.358 24.018  -56.705 1.00 35.73  ? 102 GLY A O     1 
ATOM   6520  N  N     . LEU C  2 103 ? -31.019 22.020  -55.856 1.00 35.04  ? 103 LEU A N     1 
ATOM   6521  C  CA    . LEU C  2 103 ? -30.333 21.254  -56.896 1.00 33.84  ? 103 LEU A CA    1 
ATOM   6522  C  C     . LEU C  2 103 ? -30.850 21.629  -58.281 1.00 35.37  ? 103 LEU A C     1 
ATOM   6523  O  O     . LEU C  2 103 ? -30.085 21.671  -59.242 1.00 37.89  ? 103 LEU A O     1 
ATOM   6524  C  CB    . LEU C  2 103 ? -30.485 19.746  -56.679 1.00 34.18  ? 103 LEU A CB    1 
ATOM   6525  C  CG    . LEU C  2 103 ? -29.731 18.895  -57.710 1.00 30.58  ? 103 LEU A CG    1 
ATOM   6526  C  CD1   . LEU C  2 103 ? -28.236 19.154  -57.606 1.00 34.59  ? 103 LEU A CD1   1 
ATOM   6527  C  CD2   . LEU C  2 103 ? -30.036 17.409  -57.577 1.00 27.86  ? 103 LEU A CD2   1 
ATOM   6528  N  N     . PHE C  2 104 ? -32.145 21.907  -58.387 1.00 32.61  ? 104 PHE A N     1 
ATOM   6529  C  CA    . PHE C  2 104 ? -32.699 22.330  -59.667 1.00 35.52  ? 104 PHE A CA    1 
ATOM   6530  C  C     . PHE C  2 104 ? -32.148 23.695  -60.072 1.00 39.47  ? 104 PHE A C     1 
ATOM   6531  O  O     . PHE C  2 104 ? -31.930 23.944  -61.255 1.00 39.85  ? 104 PHE A O     1 
ATOM   6532  C  CB    . PHE C  2 104 ? -34.226 22.354  -59.618 1.00 34.07  ? 104 PHE A CB    1 
ATOM   6533  C  CG    . PHE C  2 104 ? -34.858 21.040  -59.974 1.00 32.62  ? 104 PHE A CG    1 
ATOM   6534  C  CD1   . PHE C  2 104 ? -34.487 20.373  -61.125 1.00 34.28  ? 104 PHE A CD1   1 
ATOM   6535  C  CD2   . PHE C  2 104 ? -35.809 20.466  -59.153 1.00 30.89  ? 104 PHE A CD2   1 
ATOM   6536  C  CE1   . PHE C  2 104 ? -35.057 19.164  -61.454 1.00 38.41  ? 104 PHE A CE1   1 
ATOM   6537  C  CE2   . PHE C  2 104 ? -36.385 19.259  -59.477 1.00 34.50  ? 104 PHE A CE2   1 
ATOM   6538  C  CZ    . PHE C  2 104 ? -36.008 18.604  -60.627 1.00 40.40  ? 104 PHE A CZ    1 
ATOM   6539  N  N     . GLU C  2 105 ? -31.908 24.572  -59.099 1.00 37.38  ? 105 GLU A N     1 
ATOM   6540  C  CA    . GLU C  2 105 ? -31.256 25.848  -59.402 1.00 33.86  ? 105 GLU A CA    1 
ATOM   6541  C  C     . GLU C  2 105 ? -29.869 25.625  -60.006 1.00 37.41  ? 105 GLU A C     1 
ATOM   6542  O  O     . GLU C  2 105 ? -29.577 26.105  -61.110 1.00 39.12  ? 105 GLU A O     1 
ATOM   6543  C  CB    . GLU C  2 105 ? -31.141 26.718  -58.148 1.00 29.75  ? 105 GLU A CB    1 
ATOM   6544  C  CG    . GLU C  2 105 ? -32.475 27.102  -57.541 1.00 33.79  ? 105 GLU A CG    1 
ATOM   6545  C  CD    . GLU C  2 105 ? -32.345 27.624  -56.126 1.00 38.94  ? 105 GLU A CD    1 
ATOM   6546  O  OE1   . GLU C  2 105 ? -31.228 28.038  -55.743 1.00 52.83  ? 105 GLU A OE1   1 
ATOM   6547  O  OE2   . GLU C  2 105 ? -33.355 27.607  -55.391 1.00 37.65  ? 105 GLU A OE2   1 
ATOM   6548  N  N     . ASP C  2 106 ? -29.015 24.893  -59.291 1.00 36.98  ? 106 ASP A N     1 
ATOM   6549  C  CA    . ASP C  2 106 ? -27.652 24.664  -59.787 1.00 34.96  ? 106 ASP A CA    1 
ATOM   6550  C  C     . ASP C  2 106 ? -27.650 23.934  -61.140 1.00 40.02  ? 106 ASP A C     1 
ATOM   6551  O  O     . ASP C  2 106 ? -26.799 24.183  -62.012 1.00 35.94  ? 106 ASP A O     1 
ATOM   6552  C  CB    . ASP C  2 106 ? -26.835 23.865  -58.770 1.00 41.46  ? 106 ASP A CB    1 
ATOM   6553  C  CG    . ASP C  2 106 ? -26.660 24.597  -57.453 1.00 45.58  ? 106 ASP A CG    1 
ATOM   6554  O  OD1   . ASP C  2 106 ? -26.958 25.812  -57.397 1.00 47.70  ? 106 ASP A OD1   1 
ATOM   6555  O  OD2   . ASP C  2 106 ? -26.220 23.951  -56.473 1.00 45.24  ? 106 ASP A OD2   1 
ATOM   6556  N  N     . THR C  2 107 ? -28.611 23.029  -61.302 1.00 38.87  ? 107 THR A N     1 
ATOM   6557  C  CA    . THR C  2 107 ? -28.774 22.277  -62.542 1.00 40.20  ? 107 THR A CA    1 
ATOM   6558  C  C     . THR C  2 107 ? -29.103 23.222  -63.688 1.00 38.67  ? 107 THR A C     1 
ATOM   6559  O  O     . THR C  2 107 ? -28.536 23.126  -64.785 1.00 37.77  ? 107 THR A O     1 
ATOM   6560  C  CB    . THR C  2 107 ? -29.881 21.206  -62.412 1.00 38.41  ? 107 THR A CB    1 
ATOM   6561  O  OG1   . THR C  2 107 ? -29.428 20.148  -61.557 1.00 39.05  ? 107 THR A OG1   1 
ATOM   6562  C  CG2   . THR C  2 107 ? -30.241 20.630  -63.767 1.00 36.56  ? 107 THR A CG2   1 
ATOM   6563  N  N     . ASN C  2 108 ? -30.017 24.147  -63.422 1.00 39.57  ? 108 ASN A N     1 
ATOM   6564  C  CA    . ASN C  2 108 ? -30.409 25.116  -64.426 1.00 38.31  ? 108 ASN A CA    1 
ATOM   6565  C  C     . ASN C  2 108 ? -29.216 25.974  -64.813 1.00 36.46  ? 108 ASN A C     1 
ATOM   6566  O  O     . ASN C  2 108 ? -29.004 26.258  -65.996 1.00 35.08  ? 108 ASN A O     1 
ATOM   6567  C  CB    . ASN C  2 108 ? -31.559 25.984  -63.929 1.00 33.88  ? 108 ASN A CB    1 
ATOM   6568  C  CG    . ASN C  2 108 ? -32.305 26.645  -65.059 1.00 38.25  ? 108 ASN A CG    1 
ATOM   6569  O  OD1   . ASN C  2 108 ? -32.458 26.066  -66.135 1.00 44.72  ? 108 ASN A OD1   1 
ATOM   6570  N  ND2   . ASN C  2 108 ? -32.757 27.871  -64.835 1.00 37.97  ? 108 ASN A ND2   1 
ATOM   6571  N  N     . LEU C  2 109 ? -28.424 26.366  -63.818 1.00 29.63  ? 109 LEU A N     1 
ATOM   6572  C  CA    . LEU C  2 109 ? -27.207 27.115  -64.106 1.00 37.55  ? 109 LEU A CA    1 
ATOM   6573  C  C     . LEU C  2 109 ? -26.270 26.321  -65.022 1.00 39.38  ? 109 LEU A C     1 
ATOM   6574  O  O     . LEU C  2 109 ? -25.684 26.884  -65.946 1.00 42.03  ? 109 LEU A O     1 
ATOM   6575  C  CB    . LEU C  2 109 ? -26.485 27.505  -62.816 1.00 34.47  ? 109 LEU A CB    1 
ATOM   6576  C  CG    . LEU C  2 109 ? -27.099 28.685  -62.061 1.00 34.47  ? 109 LEU A CG    1 
ATOM   6577  C  CD1   . LEU C  2 109 ? -26.190 29.148  -60.941 1.00 32.62  ? 109 LEU A CD1   1 
ATOM   6578  C  CD2   . LEU C  2 109 ? -27.401 29.826  -63.013 1.00 33.17  ? 109 LEU A CD2   1 
ATOM   6579  N  N     . CYS C  2 110 ? -26.138 25.019  -64.784 1.00 34.75  ? 110 CYS A N     1 
ATOM   6580  C  CA    . CYS C  2 110 ? -25.295 24.199  -65.653 1.00 35.47  ? 110 CYS A CA    1 
ATOM   6581  C  C     . CYS C  2 110 ? -25.840 24.111  -67.082 1.00 40.74  ? 110 CYS A C     1 
ATOM   6582  O  O     . CYS C  2 110 ? -25.076 24.165  -68.044 1.00 38.54  ? 110 CYS A O     1 
ATOM   6583  C  CB    . CYS C  2 110 ? -25.134 22.794  -65.078 1.00 37.98  ? 110 CYS A CB    1 
ATOM   6584  S  SG    . CYS C  2 110 ? -24.318 22.758  -63.475 1.00 38.03  ? 110 CYS A SG    1 
ATOM   6585  N  N     . ALA C  2 111 ? -27.156 23.980  -67.224 1.00 42.26  ? 111 ALA A N     1 
ATOM   6586  C  CA    . ALA C  2 111 ? -27.757 23.938  -68.558 1.00 40.48  ? 111 ALA A CA    1 
ATOM   6587  C  C     . ALA C  2 111 ? -27.572 25.264  -69.307 1.00 38.82  ? 111 ALA A C     1 
ATOM   6588  O  O     . ALA C  2 111 ? -27.311 25.278  -70.508 1.00 39.84  ? 111 ALA A O     1 
ATOM   6589  C  CB    . ALA C  2 111 ? -29.231 23.583  -68.466 1.00 38.92  ? 111 ALA A CB    1 
ATOM   6590  N  N     . ILE C  2 112 ? -27.710 26.378  -68.598 1.00 36.51  ? 112 ILE A N     1 
ATOM   6591  C  CA    . ILE C  2 112 ? -27.515 27.688  -69.210 1.00 38.84  ? 112 ILE A CA    1 
ATOM   6592  C  C     . ILE C  2 112 ? -26.036 27.878  -69.549 1.00 40.89  ? 112 ILE A C     1 
ATOM   6593  O  O     . ILE C  2 112 ? -25.680 28.559  -70.511 1.00 42.23  ? 112 ILE A O     1 
ATOM   6594  C  CB    . ILE C  2 112 ? -28.018 28.823  -68.282 1.00 32.56  ? 112 ILE A CB    1 
ATOM   6595  C  CG1   . ILE C  2 112 ? -29.523 28.680  -68.065 1.00 35.41  ? 112 ILE A CG1   1 
ATOM   6596  C  CG2   . ILE C  2 112 ? -27.728 30.184  -68.873 1.00 26.65  ? 112 ILE A CG2   1 
ATOM   6597  C  CD1   . ILE C  2 112 ? -30.079 29.603  -67.017 1.00 38.82  ? 112 ILE A CD1   1 
ATOM   6598  N  N     . HIS C  2 113 ? -25.169 27.248  -68.767 1.00 42.05  ? 113 HIS A N     1 
ATOM   6599  C  CA    . HIS C  2 113 ? -23.739 27.343  -69.014 1.00 38.20  ? 113 HIS A CA    1 
ATOM   6600  C  C     . HIS C  2 113 ? -23.383 26.713  -70.351 1.00 43.77  ? 113 HIS A C     1 
ATOM   6601  O  O     . HIS C  2 113 ? -22.441 27.142  -71.021 1.00 42.52  ? 113 HIS A O     1 
ATOM   6602  C  CB    . HIS C  2 113 ? -22.951 26.665  -67.900 1.00 34.69  ? 113 HIS A CB    1 
ATOM   6603  C  CG    . HIS C  2 113 ? -21.472 26.850  -68.015 1.00 33.47  ? 113 HIS A CG    1 
ATOM   6604  N  ND1   . HIS C  2 113 ? -20.849 28.039  -67.714 1.00 33.12  ? 113 HIS A ND1   1 
ATOM   6605  C  CD2   . HIS C  2 113 ? -20.494 25.997  -68.400 1.00 37.65  ? 113 HIS A CD2   1 
ATOM   6606  C  CE1   . HIS C  2 113 ? -19.547 27.911  -67.905 1.00 30.87  ? 113 HIS A CE1   1 
ATOM   6607  N  NE2   . HIS C  2 113 ? -19.306 26.684  -68.324 1.00 28.37  ? 113 HIS A NE2   1 
ATOM   6608  N  N     . ALA C  2 114 ? -24.149 25.692  -70.726 1.00 43.93  ? 114 ALA A N     1 
ATOM   6609  C  CA    . ALA C  2 114 ? -23.908 24.937  -71.949 1.00 34.96  ? 114 ALA A CA    1 
ATOM   6610  C  C     . ALA C  2 114 ? -24.702 25.511  -73.113 1.00 41.18  ? 114 ALA A C     1 
ATOM   6611  O  O     . ALA C  2 114 ? -24.955 24.820  -74.105 1.00 39.14  ? 114 ALA A O     1 
ATOM   6612  C  CB    . ALA C  2 114 ? -24.258 23.487  -71.739 1.00 40.53  ? 114 ALA A CB    1 
ATOM   6613  N  N     . LYS C  2 115 ? -25.088 26.779  -72.976 1.00 39.09  ? 115 LYS A N     1 
ATOM   6614  C  CA    . LYS C  2 115 ? -25.859 27.487  -73.995 1.00 43.46  ? 115 LYS A CA    1 
ATOM   6615  C  C     . LYS C  2 115 ? -27.156 26.750  -74.309 1.00 44.47  ? 115 LYS A C     1 
ATOM   6616  O  O     . LYS C  2 115 ? -27.607 26.714  -75.454 1.00 44.74  ? 115 LYS A O     1 
ATOM   6617  C  CB    . LYS C  2 115 ? -25.026 27.680  -75.266 1.00 45.06  ? 115 LYS A CB    1 
ATOM   6618  C  CG    . LYS C  2 115 ? -23.774 28.523  -75.057 1.00 52.34  ? 115 LYS A CG    1 
ATOM   6619  C  CD    . LYS C  2 115 ? -22.944 28.618  -76.327 1.00 69.51  ? 115 LYS A CD    1 
ATOM   6620  C  CE    . LYS C  2 115 ? -21.878 29.699  -76.206 1.00 74.98  ? 115 LYS A CE    1 
ATOM   6621  N  NZ    . LYS C  2 115 ? -21.067 29.821  -77.451 1.00 79.36  ? 115 LYS A NZ    1 
ATOM   6622  N  N     . ARG C  2 116 ? -27.745 26.159  -73.274 1.00 41.52  ? 116 ARG A N     1 
ATOM   6623  C  CA    . ARG C  2 116 ? -29.032 25.490  -73.392 1.00 39.80  ? 116 ARG A CA    1 
ATOM   6624  C  C     . ARG C  2 116 ? -30.055 26.122  -72.463 1.00 36.60  ? 116 ARG A C     1 
ATOM   6625  O  O     . ARG C  2 116 ? -29.727 26.952  -71.616 1.00 39.72  ? 116 ARG A O     1 
ATOM   6626  C  CB    . ARG C  2 116 ? -28.902 23.992  -73.086 1.00 42.82  ? 116 ARG A CB    1 
ATOM   6627  C  CG    . ARG C  2 116 ? -28.284 23.178  -74.205 1.00 40.04  ? 116 ARG A CG    1 
ATOM   6628  C  CD    . ARG C  2 116 ? -28.299 21.694  -73.898 1.00 40.42  ? 116 ARG A CD    1 
ATOM   6629  N  NE    . ARG C  2 116 ? -27.255 21.306  -72.954 1.00 42.95  ? 116 ARG A NE    1 
ATOM   6630  C  CZ    . ARG C  2 116 ? -27.477 20.972  -71.688 1.00 43.23  ? 116 ARG A CZ    1 
ATOM   6631  N  NH1   . ARG C  2 116 ? -28.711 20.970  -71.208 1.00 47.57  ? 116 ARG A NH1   1 
ATOM   6632  N  NH2   . ARG C  2 116 ? -26.464 20.634  -70.901 1.00 42.82  ? 116 ARG A NH2   1 
ATOM   6633  N  N     . VAL C  2 117 ? -31.302 25.708  -72.625 1.00 40.78  ? 117 VAL A N     1 
ATOM   6634  C  CA    . VAL C  2 117 ? -32.405 26.251  -71.850 1.00 40.75  ? 117 VAL A CA    1 
ATOM   6635  C  C     . VAL C  2 117 ? -33.134 25.080  -71.190 1.00 38.39  ? 117 VAL A C     1 
ATOM   6636  O  O     . VAL C  2 117 ? -33.879 25.244  -70.219 1.00 38.24  ? 117 VAL A O     1 
ATOM   6637  C  CB    . VAL C  2 117 ? -33.334 27.102  -72.756 1.00 43.32  ? 117 VAL A CB    1 
ATOM   6638  C  CG1   . VAL C  2 117 ? -34.807 26.766  -72.553 1.00 45.26  ? 117 VAL A CG1   1 
ATOM   6639  C  CG2   . VAL C  2 117 ? -33.047 28.595  -72.562 1.00 38.22  ? 117 VAL A CG2   1 
ATOM   6640  N  N     . THR C  2 118 ? -32.846 23.885  -71.703 1.00 43.04  ? 118 THR A N     1 
ATOM   6641  C  CA    . THR C  2 118 ? -33.394 22.633  -71.195 1.00 44.57  ? 118 THR A CA    1 
ATOM   6642  C  C     . THR C  2 118 ? -32.434 21.970  -70.215 1.00 40.57  ? 118 THR A C     1 
ATOM   6643  O  O     . THR C  2 118 ? -31.282 21.721  -70.560 1.00 42.26  ? 118 THR A O     1 
ATOM   6644  C  CB    . THR C  2 118 ? -33.668 21.629  -72.342 1.00 46.21  ? 118 THR A CB    1 
ATOM   6645  O  OG1   . THR C  2 118 ? -34.285 22.295  -73.451 1.00 44.15  ? 118 THR A OG1   1 
ATOM   6646  C  CG2   . THR C  2 118 ? -34.558 20.499  -71.860 1.00 43.80  ? 118 THR A CG2   1 
ATOM   6647  N  N     . ILE C  2 119 ? -32.894 21.671  -69.004 1.00 41.80  ? 119 ILE A N     1 
ATOM   6648  C  CA    . ILE C  2 119 ? -32.055 20.915  -68.074 1.00 41.85  ? 119 ILE A CA    1 
ATOM   6649  C  C     . ILE C  2 119 ? -32.042 19.429  -68.440 1.00 45.23  ? 119 ILE A C     1 
ATOM   6650  O  O     . ILE C  2 119 ? -33.057 18.866  -68.857 1.00 45.00  ? 119 ILE A O     1 
ATOM   6651  C  CB    . ILE C  2 119 ? -32.509 21.072  -66.612 1.00 32.86  ? 119 ILE A CB    1 
ATOM   6652  C  CG1   . ILE C  2 119 ? -33.949 20.591  -66.431 1.00 34.41  ? 119 ILE A CG1   1 
ATOM   6653  C  CG2   . ILE C  2 119 ? -32.355 22.509  -66.166 1.00 38.73  ? 119 ILE A CG2   1 
ATOM   6654  C  CD1   . ILE C  2 119 ? -34.348 20.400  -64.982 1.00 33.99  ? 119 ILE A CD1   1 
ATOM   6655  N  N     . MET C  2 120 ? -30.881 18.802  -68.289 1.00 36.27  ? 120 MET A N     1 
ATOM   6656  C  CA    . MET C  2 120 ? -30.712 17.407  -68.665 1.00 38.64  ? 120 MET A CA    1 
ATOM   6657  C  C     . MET C  2 120 ? -30.058 16.647  -67.518 1.00 40.23  ? 120 MET A C     1 
ATOM   6658  O  O     . MET C  2 120 ? -29.513 17.269  -66.613 1.00 39.82  ? 120 MET A O     1 
ATOM   6659  C  CB    . MET C  2 120 ? -29.877 17.306  -69.942 1.00 36.93  ? 120 MET A CB    1 
ATOM   6660  C  CG    . MET C  2 120 ? -30.517 17.987  -71.128 1.00 39.13  ? 120 MET A CG    1 
ATOM   6661  S  SD    . MET C  2 120 ? -29.552 17.849  -72.636 1.00 43.61  ? 120 MET A SD    1 
ATOM   6662  C  CE    . MET C  2 120 ? -30.563 18.839  -73.740 1.00 44.84  ? 120 MET A CE    1 
ATOM   6663  N  N     . PRO C  2 121 ? -30.126 15.302  -67.538 1.00 42.33  ? 121 PRO A N     1 
ATOM   6664  C  CA    . PRO C  2 121 ? -29.472 14.538  -66.471 1.00 44.06  ? 121 PRO A CA    1 
ATOM   6665  C  C     . PRO C  2 121 ? -28.006 14.925  -66.343 1.00 45.48  ? 121 PRO A C     1 
ATOM   6666  O  O     . PRO C  2 121 ? -27.481 15.032  -65.238 1.00 43.90  ? 121 PRO A O     1 
ATOM   6667  C  CB    . PRO C  2 121 ? -29.624 13.085  -66.934 1.00 43.54  ? 121 PRO A CB    1 
ATOM   6668  C  CG    . PRO C  2 121 ? -30.841 13.095  -67.782 1.00 42.14  ? 121 PRO A CG    1 
ATOM   6669  C  CD    . PRO C  2 121 ? -30.829 14.419  -68.488 1.00 42.23  ? 121 PRO A CD    1 
ATOM   6670  N  N     . LYS C  2 122 ? -27.378 15.148  -67.490 1.00 42.29  ? 122 LYS A N     1 
ATOM   6671  C  CA    . LYS C  2 122 ? -26.015 15.647  -67.591 1.00 40.44  ? 122 LYS A CA    1 
ATOM   6672  C  C     . LYS C  2 122 ? -25.756 16.835  -66.658 1.00 40.93  ? 122 LYS A C     1 
ATOM   6673  O  O     . LYS C  2 122 ? -24.734 16.897  -65.957 1.00 40.76  ? 122 LYS A O     1 
ATOM   6674  C  CB    . LYS C  2 122 ? -25.761 16.035  -69.043 1.00 38.15  ? 122 LYS A CB    1 
ATOM   6675  C  CG    . LYS C  2 122 ? -24.411 16.596  -69.351 1.00 41.39  ? 122 LYS A CG    1 
ATOM   6676  C  CD    . LYS C  2 122 ? -24.464 17.314  -70.687 1.00 46.58  ? 122 LYS A CD    1 
ATOM   6677  C  CE    . LYS C  2 122 ? -25.268 16.529  -71.707 1.00 36.86  ? 122 LYS A CE    1 
ATOM   6678  N  NZ    . LYS C  2 122 ? -25.312 17.235  -73.015 1.00 54.90  ? 122 LYS A NZ    1 
ATOM   6679  N  N     . ASP C  2 123 ? -26.710 17.762  -66.643 1.00 40.06  ? 123 ASP A N     1 
ATOM   6680  C  CA    . ASP C  2 123 ? -26.635 18.957  -65.809 1.00 38.16  ? 123 ASP A CA    1 
ATOM   6681  C  C     . ASP C  2 123 ? -26.697 18.624  -64.311 1.00 39.53  ? 123 ASP A C     1 
ATOM   6682  O  O     . ASP C  2 123 ? -25.899 19.143  -63.517 1.00 41.31  ? 123 ASP A O     1 
ATOM   6683  C  CB    . ASP C  2 123 ? -27.760 19.926  -66.185 1.00 35.88  ? 123 ASP A CB    1 
ATOM   6684  C  CG    . ASP C  2 123 ? -27.715 20.343  -67.653 1.00 40.23  ? 123 ASP A CG    1 
ATOM   6685  O  OD1   . ASP C  2 123 ? -26.616 20.664  -68.150 1.00 47.66  ? 123 ASP A OD1   1 
ATOM   6686  O  OD2   . ASP C  2 123 ? -28.778 20.357  -68.312 1.00 37.13  ? 123 ASP A OD2   1 
ATOM   6687  N  N     . ILE C  2 124 ? -27.642 17.767  -63.926 1.00 38.01  ? 124 ILE A N     1 
ATOM   6688  C  CA    . ILE C  2 124 ? -27.762 17.337  -62.534 1.00 37.73  ? 124 ILE A CA    1 
ATOM   6689  C  C     . ILE C  2 124 ? -26.486 16.645  -62.086 1.00 38.17  ? 124 ILE A C     1 
ATOM   6690  O  O     . ILE C  2 124 ? -26.013 16.843  -60.965 1.00 36.57  ? 124 ILE A O     1 
ATOM   6691  C  CB    . ILE C  2 124 ? -28.947 16.382  -62.323 1.00 38.27  ? 124 ILE A CB    1 
ATOM   6692  C  CG1   . ILE C  2 124 ? -30.268 17.098  -62.589 1.00 39.99  ? 124 ILE A CG1   1 
ATOM   6693  C  CG2   . ILE C  2 124 ? -28.952 15.831  -60.900 1.00 33.98  ? 124 ILE A CG2   1 
ATOM   6694  C  CD1   . ILE C  2 124 ? -31.483 16.252  -62.257 1.00 45.68  ? 124 ILE A CD1   1 
ATOM   6695  N  N     . GLN C  2 125 ? -25.928 15.839  -62.979 1.00 40.56  ? 125 GLN A N     1 
ATOM   6696  C  CA    . GLN C  2 125 ? -24.681 15.142  -62.711 1.00 44.03  ? 125 GLN A CA    1 
ATOM   6697  C  C     . GLN C  2 125 ? -23.570 16.136  -62.418 1.00 38.09  ? 125 GLN A C     1 
ATOM   6698  O  O     . GLN C  2 125 ? -22.927 16.050  -61.377 1.00 39.74  ? 125 GLN A O     1 
ATOM   6699  C  CB    . GLN C  2 125 ? -24.307 14.245  -63.889 1.00 47.94  ? 125 GLN A CB    1 
ATOM   6700  C  CG    . GLN C  2 125 ? -25.278 13.101  -64.102 1.00 49.84  ? 125 GLN A CG    1 
ATOM   6701  C  CD    . GLN C  2 125 ? -25.095 12.418  -65.439 1.00 58.46  ? 125 GLN A CD    1 
ATOM   6702  O  OE1   . GLN C  2 125 ? -24.142 12.698  -66.171 1.00 56.03  ? 125 GLN A OE1   1 
ATOM   6703  N  NE2   . GLN C  2 125 ? -26.014 11.514  -65.770 1.00 54.95  ? 125 GLN A NE2   1 
ATOM   6704  N  N     . LEU C  2 126 ? -23.363 17.088  -63.325 1.00 40.72  ? 126 LEU A N     1 
ATOM   6705  C  CA    . LEU C  2 126 ? -22.318 18.098  -63.132 1.00 38.90  ? 126 LEU A CA    1 
ATOM   6706  C  C     . LEU C  2 126 ? -22.478 18.863  -61.817 1.00 40.02  ? 126 LEU A C     1 
ATOM   6707  O  O     . LEU C  2 126 ? -21.519 18.996  -61.038 1.00 41.52  ? 126 LEU A O     1 
ATOM   6708  C  CB    . LEU C  2 126 ? -22.305 19.081  -64.298 1.00 34.80  ? 126 LEU A CB    1 
ATOM   6709  C  CG    . LEU C  2 126 ? -21.224 20.150  -64.192 1.00 38.23  ? 126 LEU A CG    1 
ATOM   6710  C  CD1   . LEU C  2 126 ? -19.838 19.528  -64.111 1.00 35.12  ? 126 LEU A CD1   1 
ATOM   6711  C  CD2   . LEU C  2 126 ? -21.330 21.093  -65.362 1.00 35.54  ? 126 LEU A CD2   1 
ATOM   6712  N  N     . ALA C  2 127 ? -23.690 19.357  -61.571 1.00 33.15  ? 127 ALA A N     1 
ATOM   6713  C  CA    . ALA C  2 127 ? -23.988 20.023  -60.310 1.00 29.20  ? 127 ALA A CA    1 
ATOM   6714  C  C     . ALA C  2 127 ? -23.627 19.159  -59.098 1.00 32.13  ? 127 ALA A C     1 
ATOM   6715  O  O     . ALA C  2 127 ? -22.976 19.628  -58.168 1.00 28.74  ? 127 ALA A O     1 
ATOM   6716  C  CB    . ALA C  2 127 ? -25.453 20.413  -60.256 1.00 36.12  ? 127 ALA A CB    1 
ATOM   6717  N  N     . ARG C  2 128 ? -24.032 17.894  -59.110 1.00 35.79  ? 128 ARG A N     1 
ATOM   6718  C  CA    . ARG C  2 128 ? -23.810 17.044  -57.943 1.00 37.43  ? 128 ARG A CA    1 
ATOM   6719  C  C     . ARG C  2 128 ? -22.339 16.674  -57.767 1.00 38.55  ? 128 ARG A C     1 
ATOM   6720  O  O     . ARG C  2 128 ? -21.880 16.474  -56.642 1.00 38.28  ? 128 ARG A O     1 
ATOM   6721  C  CB    . ARG C  2 128 ? -24.671 15.784  -58.025 1.00 32.82  ? 128 ARG A CB    1 
ATOM   6722  C  CG    . ARG C  2 128 ? -26.152 16.082  -57.892 1.00 37.43  ? 128 ARG A CG    1 
ATOM   6723  C  CD    . ARG C  2 128 ? -26.971 14.830  -57.729 1.00 39.43  ? 128 ARG A CD    1 
ATOM   6724  N  NE    . ARG C  2 128 ? -26.636 14.117  -56.503 1.00 42.00  ? 128 ARG A NE    1 
ATOM   6725  C  CZ    . ARG C  2 128 ? -26.257 12.846  -56.459 1.00 36.43  ? 128 ARG A CZ    1 
ATOM   6726  N  NH1   . ARG C  2 128 ? -26.155 12.142  -57.579 1.00 41.17  ? 128 ARG A NH1   1 
ATOM   6727  N  NH2   . ARG C  2 128 ? -25.976 12.280  -55.295 1.00 42.55  ? 128 ARG A NH2   1 
ATOM   6728  N  N     . ARG C  2 129 ? -21.598 16.596  -58.869 1.00 35.13  ? 129 ARG A N     1 
ATOM   6729  C  CA    . ARG C  2 129 ? -20.163 16.346  -58.787 1.00 37.60  ? 129 ARG A CA    1 
ATOM   6730  C  C     . ARG C  2 129 ? -19.468 17.533  -58.141 1.00 36.98  ? 129 ARG A C     1 
ATOM   6731  O  O     . ARG C  2 129 ? -18.646 17.374  -57.245 1.00 36.90  ? 129 ARG A O     1 
ATOM   6732  C  CB    . ARG C  2 129 ? -19.565 16.078  -60.168 1.00 34.75  ? 129 ARG A CB    1 
ATOM   6733  C  CG    . ARG C  2 129 ? -19.094 14.649  -60.355 1.00 51.24  ? 129 ARG A CG    1 
ATOM   6734  C  CD    . ARG C  2 129 ? -18.370 14.456  -61.681 1.00 66.03  ? 129 ARG A CD    1 
ATOM   6735  N  NE    . ARG C  2 129 ? -19.105 13.571  -62.584 1.00 72.41  ? 129 ARG A NE    1 
ATOM   6736  C  CZ    . ARG C  2 129 ? -19.494 13.907  -63.810 1.00 71.75  ? 129 ARG A CZ    1 
ATOM   6737  N  NH1   . ARG C  2 129 ? -19.217 15.115  -64.292 1.00 51.25  ? 129 ARG A NH1   1 
ATOM   6738  N  NH2   . ARG C  2 129 ? -20.158 13.033  -64.557 1.00 79.62  ? 129 ARG A NH2   1 
ATOM   6739  N  N     . ILE C  2 130 ? -19.816 18.729  -58.596 1.00 37.56  ? 130 ILE A N     1 
ATOM   6740  C  CA    . ILE C  2 130 ? -19.189 19.935  -58.081 1.00 33.01  ? 130 ILE A CA    1 
ATOM   6741  C  C     . ILE C  2 130 ? -19.625 20.218  -56.636 1.00 35.07  ? 130 ILE A C     1 
ATOM   6742  O  O     . ILE C  2 130 ? -18.873 20.791  -55.843 1.00 31.08  ? 130 ILE A O     1 
ATOM   6743  C  CB    . ILE C  2 130 ? -19.504 21.115  -59.004 1.00 33.31  ? 130 ILE A CB    1 
ATOM   6744  C  CG1   . ILE C  2 130 ? -18.925 20.821  -60.387 1.00 33.67  ? 130 ILE A CG1   1 
ATOM   6745  C  CG2   . ILE C  2 130 ? -18.940 22.420  -58.466 1.00 31.76  ? 130 ILE A CG2   1 
ATOM   6746  C  CD1   . ILE C  2 130 ? -19.236 21.883  -61.405 1.00 44.09  ? 130 ILE A CD1   1 
ATOM   6747  N  N     . ARG C  2 131 ? -20.828 19.783  -56.285 1.00 34.84  ? 131 ARG A N     1 
ATOM   6748  C  CA    . ARG C  2 131 ? -21.317 19.930  -54.920 1.00 31.16  ? 131 ARG A CA    1 
ATOM   6749  C  C     . ARG C  2 131 ? -20.557 19.051  -53.932 1.00 33.45  ? 131 ARG A C     1 
ATOM   6750  O  O     . ARG C  2 131 ? -20.613 19.272  -52.722 1.00 37.90  ? 131 ARG A O     1 
ATOM   6751  C  CB    . ARG C  2 131 ? -22.802 19.590  -54.851 1.00 35.47  ? 131 ARG A CB    1 
ATOM   6752  C  CG    . ARG C  2 131 ? -23.738 20.688  -55.288 1.00 28.67  ? 131 ARG A CG    1 
ATOM   6753  C  CD    . ARG C  2 131 ? -25.169 20.208  -55.162 1.00 33.70  ? 131 ARG A CD    1 
ATOM   6754  N  NE    . ARG C  2 131 ? -26.139 21.296  -55.211 1.00 36.38  ? 131 ARG A NE    1 
ATOM   6755  C  CZ    . ARG C  2 131 ? -27.241 21.332  -54.472 1.00 35.57  ? 131 ARG A CZ    1 
ATOM   6756  N  NH1   . ARG C  2 131 ? -27.499 20.339  -53.630 1.00 35.94  ? 131 ARG A NH1   1 
ATOM   6757  N  NH2   . ARG C  2 131 ? -28.083 22.354  -54.573 1.00 30.93  ? 131 ARG A NH2   1 
ATOM   6758  N  N     . GLY C  2 132 ? -19.867 18.038  -54.445 1.00 37.05  ? 132 GLY A N     1 
ATOM   6759  C  CA    . GLY C  2 132 ? -19.143 17.111  -53.595 1.00 33.85  ? 132 GLY A CA    1 
ATOM   6760  C  C     . GLY C  2 132 ? -19.965 15.896  -53.208 1.00 44.64  ? 132 GLY A C     1 
ATOM   6761  O  O     . GLY C  2 132 ? -19.547 15.085  -52.380 1.00 53.85  ? 132 GLY A O     1 
ATOM   6762  N  N     . GLU C  2 133 ? -21.141 15.762  -53.810 1.00 44.59  ? 133 GLU A N     1 
ATOM   6763  C  CA    . GLU C  2 133 ? -21.991 14.605  -53.557 1.00 42.66  ? 133 GLU A CA    1 
ATOM   6764  C  C     . GLU C  2 133 ? -21.552 13.441  -54.446 1.00 49.75  ? 133 GLU A C     1 
ATOM   6765  O  O     . GLU C  2 133 ? -22.056 12.327  -54.319 1.00 54.65  ? 133 GLU A O     1 
ATOM   6766  C  CB    . GLU C  2 133 ? -23.464 14.962  -53.792 1.00 42.17  ? 133 GLU A CB    1 
ATOM   6767  C  CG    . GLU C  2 133 ? -23.940 16.169  -52.969 1.00 42.77  ? 133 GLU A CG    1 
ATOM   6768  C  CD    . GLU C  2 133 ? -25.341 16.650  -53.333 1.00 43.87  ? 133 GLU A CD    1 
ATOM   6769  O  OE1   . GLU C  2 133 ? -26.096 15.888  -53.979 1.00 36.24  ? 133 GLU A OE1   1 
ATOM   6770  O  OE2   . GLU C  2 133 ? -25.687 17.797  -52.964 1.00 38.33  ? 133 GLU A OE2   1 
ATOM   6771  N  N     . ARG C  2 134 ? -20.607 13.722  -55.346 1.00 55.31  ? 134 ARG A N     1 
ATOM   6772  C  CA    . ARG C  2 134 ? -20.009 12.728  -56.246 1.00 53.66  ? 134 ARG A CA    1 
ATOM   6773  C  C     . ARG C  2 134 ? -18.563 13.080  -56.612 1.00 60.68  ? 134 ARG A C     1 
ATOM   6774  O  O     . ARG C  2 134 ? -18.250 14.252  -56.839 1.00 54.15  ? 134 ARG A O     1 
ATOM   6775  C  CB    . ARG C  2 134 ? -20.804 12.608  -57.550 1.00 54.77  ? 134 ARG A CB    1 
ATOM   6776  C  CG    . ARG C  2 134 ? -22.283 12.342  -57.423 1.00 57.39  ? 134 ARG A CG    1 
ATOM   6777  C  CD    . ARG C  2 134 ? -22.948 12.565  -58.764 1.00 59.75  ? 134 ARG A CD    1 
ATOM   6778  N  NE    . ARG C  2 134 ? -22.140 12.015  -59.847 1.00 63.46  ? 134 ARG A NE    1 
ATOM   6779  C  CZ    . ARG C  2 134 ? -22.581 11.847  -61.089 1.00 75.94  ? 134 ARG A CZ    1 
ATOM   6780  N  NH1   . ARG C  2 134 ? -23.829 12.175  -61.390 1.00 72.12  ? 134 ARG A NH1   1 
ATOM   6781  N  NH2   . ARG C  2 134 ? -21.782 11.339  -62.022 1.00 73.29  ? 134 ARG A NH2   1 
ATOM   6782  N  N     . ALA C  2 135 ? -17.702 12.061  -56.671 1.00 63.94  ? 135 ALA A N     1 
ATOM   6783  C  CA    . ALA C  2 135 ? -16.371 12.130  -57.309 1.00 73.79  ? 135 ALA A CA    1 
ATOM   6784  C  C     . ALA C  2 135 ? -15.522 13.396  -57.044 1.00 72.07  ? 135 ALA A C     1 
ATOM   6785  O  O     . ALA C  2 135 ? -15.687 14.122  -56.058 1.00 66.40  ? 135 ALA A O     1 
ATOM   6786  C  CB    . ALA C  2 135 ? -16.535 11.937  -58.823 1.00 49.62  ? 135 ALA A CB    1 
ATOM   6787  O  OXT   . ALA C  2 135 ? -14.612 13.714  -57.821 1.00 46.61  ? 135 ALA A OXT   1 
ATOM   6788  N  N     . LEU D  3 22  ? -50.994 -1.652  -58.702 1.00 102.87 ? 22  LEU B N     1 
ATOM   6789  C  CA    . LEU D  3 22  ? -49.621 -1.833  -58.247 1.00 104.92 ? 22  LEU B CA    1 
ATOM   6790  C  C     . LEU D  3 22  ? -48.649 -0.952  -59.027 1.00 113.08 ? 22  LEU B C     1 
ATOM   6791  O  O     . LEU D  3 22  ? -48.581 -1.013  -60.254 1.00 116.58 ? 22  LEU B O     1 
ATOM   6792  C  CB    . LEU D  3 22  ? -49.204 -3.304  -58.368 1.00 104.80 ? 22  LEU B CB    1 
ATOM   6793  C  CG    . LEU D  3 22  ? -47.836 -3.752  -57.823 1.00 109.43 ? 22  LEU B CG    1 
ATOM   6794  C  CD1   . LEU D  3 22  ? -47.395 -2.944  -56.604 1.00 108.93 ? 22  LEU B CD1   1 
ATOM   6795  C  CD2   . LEU D  3 22  ? -47.845 -5.247  -57.515 1.00 95.38  ? 22  LEU B CD2   1 
ATOM   6796  N  N     . ARG D  3 23  ? -47.918 -0.116  -58.299 1.00 111.68 ? 23  ARG B N     1 
ATOM   6797  C  CA    . ARG D  3 23  ? -46.821 0.663   -58.862 1.00 103.48 ? 23  ARG B CA    1 
ATOM   6798  C  C     . ARG D  3 23  ? -45.786 0.883   -57.766 1.00 96.03  ? 23  ARG B C     1 
ATOM   6799  O  O     . ARG D  3 23  ? -46.110 0.804   -56.578 1.00 88.90  ? 23  ARG B O     1 
ATOM   6800  C  CB    . ARG D  3 23  ? -47.312 2.000   -59.426 1.00 93.23  ? 23  ARG B CB    1 
ATOM   6801  C  CG    . ARG D  3 23  ? -47.727 3.009   -58.368 1.00 93.02  ? 23  ARG B CG    1 
ATOM   6802  C  CD    . ARG D  3 23  ? -47.961 4.385   -58.978 1.00 87.58  ? 23  ARG B CD    1 
ATOM   6803  N  NE    . ARG D  3 23  ? -48.410 5.357   -57.984 1.00 87.92  ? 23  ARG B NE    1 
ATOM   6804  C  CZ    . ARG D  3 23  ? -48.588 6.653   -58.227 1.00 84.71  ? 23  ARG B CZ    1 
ATOM   6805  N  NH1   . ARG D  3 23  ? -48.356 7.144   -59.439 1.00 73.10  ? 23  ARG B NH1   1 
ATOM   6806  N  NH2   . ARG D  3 23  ? -49.000 7.459   -57.257 1.00 84.11  ? 23  ARG B NH2   1 
ATOM   6807  N  N     . ASP D  3 24  ? -44.542 1.145   -58.156 1.00 90.07  ? 24  ASP B N     1 
ATOM   6808  C  CA    . ASP D  3 24  ? -43.489 1.355   -57.169 1.00 84.79  ? 24  ASP B CA    1 
ATOM   6809  C  C     . ASP D  3 24  ? -43.696 2.685   -56.453 1.00 78.12  ? 24  ASP B C     1 
ATOM   6810  O  O     . ASP D  3 24  ? -44.300 3.610   -57.001 1.00 76.51  ? 24  ASP B O     1 
ATOM   6811  C  CB    . ASP D  3 24  ? -42.106 1.302   -57.819 1.00 85.20  ? 24  ASP B CB    1 
ATOM   6812  C  CG    . ASP D  3 24  ? -41.043 0.761   -56.877 1.00 95.28  ? 24  ASP B CG    1 
ATOM   6813  O  OD1   . ASP D  3 24  ? -40.974 1.230   -55.719 1.00 84.46  ? 24  ASP B OD1   1 
ATOM   6814  O  OD2   . ASP D  3 24  ? -40.283 -0.140  -57.293 1.00 102.23 ? 24  ASP B OD2   1 
ATOM   6815  N  N     . ASN D  3 25  ? -43.201 2.771   -55.222 1.00 73.48  ? 25  ASN B N     1 
ATOM   6816  C  CA    . ASN D  3 25  ? -43.441 3.940   -54.385 1.00 71.10  ? 25  ASN B CA    1 
ATOM   6817  C  C     . ASN D  3 25  ? -42.710 5.187   -54.871 1.00 62.65  ? 25  ASN B C     1 
ATOM   6818  O  O     . ASN D  3 25  ? -43.262 6.286   -54.823 1.00 58.41  ? 25  ASN B O     1 
ATOM   6819  C  CB    . ASN D  3 25  ? -43.056 3.636   -52.938 1.00 69.03  ? 25  ASN B CB    1 
ATOM   6820  C  CG    . ASN D  3 25  ? -43.938 2.571   -52.315 1.00 63.01  ? 25  ASN B CG    1 
ATOM   6821  O  OD1   . ASN D  3 25  ? -45.137 2.511   -52.587 1.00 59.95  ? 25  ASN B OD1   1 
ATOM   6822  N  ND2   . ASN D  3 25  ? -43.349 1.721   -51.484 1.00 52.48  ? 25  ASN B ND2   1 
ATOM   6823  N  N     . ILE D  3 26  ? -41.477 5.013   -55.344 1.00 61.84  ? 26  ILE B N     1 
ATOM   6824  C  CA    . ILE D  3 26  ? -40.702 6.129   -55.878 1.00 63.16  ? 26  ILE B CA    1 
ATOM   6825  C  C     . ILE D  3 26  ? -41.357 6.656   -57.153 1.00 61.61  ? 26  ILE B C     1 
ATOM   6826  O  O     . ILE D  3 26  ? -41.210 7.830   -57.499 1.00 58.28  ? 26  ILE B O     1 
ATOM   6827  C  CB    . ILE D  3 26  ? -39.230 5.730   -56.162 1.00 61.28  ? 26  ILE B CB    1 
ATOM   6828  C  CG1   . ILE D  3 26  ? -38.393 6.959   -56.529 1.00 54.73  ? 26  ILE B CG1   1 
ATOM   6829  C  CG2   . ILE D  3 26  ? -39.152 4.693   -57.271 1.00 58.52  ? 26  ILE B CG2   1 
ATOM   6830  C  CD1   . ILE D  3 26  ? -38.409 8.052   -55.485 1.00 49.17  ? 26  ILE B CD1   1 
ATOM   6831  N  N     . GLN D  3 27  ? -42.097 5.788   -57.839 1.00 60.58  ? 27  GLN B N     1 
ATOM   6832  C  CA    . GLN D  3 27  ? -42.846 6.199   -59.018 1.00 60.35  ? 27  GLN B CA    1 
ATOM   6833  C  C     . GLN D  3 27  ? -44.081 6.976   -58.582 1.00 61.10  ? 27  GLN B C     1 
ATOM   6834  O  O     . GLN D  3 27  ? -44.719 7.656   -59.385 1.00 62.23  ? 27  GLN B O     1 
ATOM   6835  C  CB    . GLN D  3 27  ? -43.229 4.991   -59.868 1.00 56.69  ? 27  GLN B CB    1 
ATOM   6836  C  CG    . GLN D  3 27  ? -42.034 4.245   -60.434 1.00 56.80  ? 27  GLN B CG    1 
ATOM   6837  C  CD    . GLN D  3 27  ? -41.200 5.099   -61.372 1.00 60.51  ? 27  GLN B CD    1 
ATOM   6838  O  OE1   . GLN D  3 27  ? -41.732 5.807   -62.228 1.00 57.44  ? 27  GLN B OE1   1 
ATOM   6839  N  NE2   . GLN D  3 27  ? -39.883 5.041   -61.208 1.00 65.31  ? 27  GLN B NE2   1 
ATOM   6840  N  N     . GLY D  3 28  ? -44.401 6.872   -57.295 1.00 61.12  ? 28  GLY B N     1 
ATOM   6841  C  CA    . GLY D  3 28  ? -45.465 7.659   -56.702 1.00 59.65  ? 28  GLY B CA    1 
ATOM   6842  C  C     . GLY D  3 28  ? -45.062 9.116   -56.627 1.00 56.76  ? 28  GLY B C     1 
ATOM   6843  O  O     . GLY D  3 28  ? -45.908 9.996   -56.484 1.00 59.32  ? 28  GLY B O     1 
ATOM   6844  N  N     . ILE D  3 29  ? -43.757 9.364   -56.700 1.00 55.98  ? 29  ILE B N     1 
ATOM   6845  C  CA    . ILE D  3 29  ? -43.234 10.709  -56.883 1.00 51.21  ? 29  ILE B CA    1 
ATOM   6846  C  C     . ILE D  3 29  ? -43.372 11.050  -58.358 1.00 51.35  ? 29  ILE B C     1 
ATOM   6847  O  O     . ILE D  3 29  ? -42.505 10.716  -59.166 1.00 54.08  ? 29  ILE B O     1 
ATOM   6848  C  CB    . ILE D  3 29  ? -41.768 10.823  -56.442 1.00 50.66  ? 29  ILE B CB    1 
ATOM   6849  C  CG1   . ILE D  3 29  ? -41.598 10.251  -55.036 1.00 52.05  ? 29  ILE B CG1   1 
ATOM   6850  C  CG2   . ILE D  3 29  ? -41.307 12.268  -56.486 1.00 48.27  ? 29  ILE B CG2   1 
ATOM   6851  C  CD1   . ILE D  3 29  ? -42.330 11.029  -53.978 1.00 50.50  ? 29  ILE B CD1   1 
ATOM   6852  N  N     . THR D  3 30  ? -44.471 11.710  -58.703 1.00 48.55  ? 30  THR B N     1 
ATOM   6853  C  CA    . THR D  3 30  ? -44.908 11.795  -60.092 1.00 52.87  ? 30  THR B CA    1 
ATOM   6854  C  C     . THR D  3 30  ? -44.170 12.841  -60.918 1.00 50.03  ? 30  THR B C     1 
ATOM   6855  O  O     . THR D  3 30  ? -43.494 13.716  -60.385 1.00 54.76  ? 30  THR B O     1 
ATOM   6856  C  CB    . THR D  3 30  ? -46.426 12.090  -60.179 1.00 53.96  ? 30  THR B CB    1 
ATOM   6857  O  OG1   . THR D  3 30  ? -46.713 13.362  -59.579 1.00 56.48  ? 30  THR B OG1   1 
ATOM   6858  C  CG2   . THR D  3 30  ? -47.216 11.010  -59.468 1.00 49.20  ? 30  THR B CG2   1 
ATOM   6859  N  N     . LYS D  3 31  ? -44.317 12.733  -62.233 1.00 54.15  ? 31  LYS B N     1 
ATOM   6860  C  CA    . LYS D  3 31  ? -43.740 13.696  -63.165 1.00 51.41  ? 31  LYS B CA    1 
ATOM   6861  C  C     . LYS D  3 31  ? -44.193 15.143  -62.925 1.00 51.05  ? 31  LYS B C     1 
ATOM   6862  O  O     . LYS D  3 31  ? -43.358 16.042  -62.892 1.00 55.53  ? 31  LYS B O     1 
ATOM   6863  C  CB    . LYS D  3 31  ? -44.056 13.286  -64.608 1.00 46.70  ? 31  LYS B CB    1 
ATOM   6864  C  CG    . LYS D  3 31  ? -43.822 14.386  -65.623 1.00 45.74  ? 31  LYS B CG    1 
ATOM   6865  C  CD    . LYS D  3 31  ? -44.253 13.962  -67.011 1.00 50.29  ? 31  LYS B CD    1 
ATOM   6866  C  CE    . LYS D  3 31  ? -43.979 15.059  -68.028 1.00 57.49  ? 31  LYS B CE    1 
ATOM   6867  N  NZ    . LYS D  3 31  ? -44.343 14.617  -69.404 1.00 63.63  ? 31  LYS B NZ    1 
ATOM   6868  N  N     . PRO D  3 32  ? -45.509 15.386  -62.764 1.00 53.03  ? 32  PRO B N     1 
ATOM   6869  C  CA    . PRO D  3 32  ? -45.872 16.796  -62.573 1.00 49.65  ? 32  PRO B CA    1 
ATOM   6870  C  C     . PRO D  3 32  ? -45.383 17.399  -61.251 1.00 51.95  ? 32  PRO B C     1 
ATOM   6871  O  O     . PRO D  3 32  ? -45.177 18.609  -61.189 1.00 54.51  ? 32  PRO B O     1 
ATOM   6872  C  CB    . PRO D  3 32  ? -47.404 16.769  -62.620 1.00 51.89  ? 32  PRO B CB    1 
ATOM   6873  C  CG    . PRO D  3 32  ? -47.774 15.381  -62.266 1.00 54.70  ? 32  PRO B CG    1 
ATOM   6874  C  CD    . PRO D  3 32  ? -46.703 14.526  -62.848 1.00 50.92  ? 32  PRO B CD    1 
ATOM   6875  N  N     . ALA D  3 33  ? -45.198 16.582  -60.219 1.00 56.57  ? 33  ALA B N     1 
ATOM   6876  C  CA    . ALA D  3 33  ? -44.702 17.087  -58.940 1.00 49.86  ? 33  ALA B CA    1 
ATOM   6877  C  C     . ALA D  3 33  ? -43.240 17.503  -59.073 1.00 48.60  ? 33  ALA B C     1 
ATOM   6878  O  O     . ALA D  3 33  ? -42.834 18.582  -58.615 1.00 47.12  ? 33  ALA B O     1 
ATOM   6879  C  CB    . ALA D  3 33  ? -44.865 16.045  -57.859 1.00 45.35  ? 33  ALA B CB    1 
ATOM   6880  N  N     . ILE D  3 34  ? -42.458 16.635  -59.710 1.00 44.87  ? 34  ILE B N     1 
ATOM   6881  C  CA    . ILE D  3 34  ? -41.071 16.936  -60.050 1.00 46.97  ? 34  ILE B CA    1 
ATOM   6882  C  C     . ILE D  3 34  ? -41.004 18.204  -60.890 1.00 46.51  ? 34  ILE B C     1 
ATOM   6883  O  O     . ILE D  3 34  ? -40.147 19.066  -60.676 1.00 51.19  ? 34  ILE B O     1 
ATOM   6884  C  CB    . ILE D  3 34  ? -40.417 15.778  -60.817 1.00 44.48  ? 34  ILE B CB    1 
ATOM   6885  C  CG1   . ILE D  3 34  ? -40.242 14.567  -59.900 1.00 37.52  ? 34  ILE B CG1   1 
ATOM   6886  C  CG2   . ILE D  3 34  ? -39.080 16.205  -61.398 1.00 41.21  ? 34  ILE B CG2   1 
ATOM   6887  C  CD1   . ILE D  3 34  ? -39.762 13.331  -60.625 1.00 44.62  ? 34  ILE B CD1   1 
ATOM   6888  N  N     . ARG D  3 35  ? -41.929 18.316  -61.836 1.00 47.69  ? 35  ARG B N     1 
ATOM   6889  C  CA    . ARG D  3 35  ? -42.031 19.498  -62.674 1.00 45.91  ? 35  ARG B CA    1 
ATOM   6890  C  C     . ARG D  3 35  ? -42.258 20.748  -61.827 1.00 48.82  ? 35  ARG B C     1 
ATOM   6891  O  O     . ARG D  3 35  ? -41.576 21.751  -62.027 1.00 51.89  ? 35  ARG B O     1 
ATOM   6892  C  CB    . ARG D  3 35  ? -43.150 19.329  -63.703 1.00 48.58  ? 35  ARG B CB    1 
ATOM   6893  C  CG    . ARG D  3 35  ? -43.357 20.534  -64.602 1.00 57.04  ? 35  ARG B CG    1 
ATOM   6894  C  CD    . ARG D  3 35  ? -44.265 20.191  -65.769 1.00 62.20  ? 35  ARG B CD    1 
ATOM   6895  N  NE    . ARG D  3 35  ? -43.590 19.348  -66.754 1.00 63.78  ? 35  ARG B NE    1 
ATOM   6896  C  CZ    . ARG D  3 35  ? -43.154 19.783  -67.934 1.00 65.73  ? 35  ARG B CZ    1 
ATOM   6897  N  NH1   . ARG D  3 35  ? -43.333 21.051  -68.285 1.00 56.00  ? 35  ARG B NH1   1 
ATOM   6898  N  NH2   . ARG D  3 35  ? -42.547 18.948  -68.769 1.00 65.53  ? 35  ARG B NH2   1 
ATOM   6899  N  N     . ARG D  3 36  ? -43.190 20.683  -60.873 1.00 49.77  ? 36  ARG B N     1 
ATOM   6900  C  CA    . ARG D  3 36  ? -43.472 21.821  -59.986 1.00 46.56  ? 36  ARG B CA    1 
ATOM   6901  C  C     . ARG D  3 36  ? -42.234 22.228  -59.190 1.00 41.75  ? 36  ARG B C     1 
ATOM   6902  O  O     . ARG D  3 36  ? -41.916 23.418  -59.076 1.00 46.27  ? 36  ARG B O     1 
ATOM   6903  C  CB    . ARG D  3 36  ? -44.627 21.503  -59.028 1.00 42.55  ? 36  ARG B CB    1 
ATOM   6904  C  CG    . ARG D  3 36  ? -45.989 21.378  -59.702 1.00 49.17  ? 36  ARG B CG    1 
ATOM   6905  C  CD    . ARG D  3 36  ? -47.134 21.337  -58.691 1.00 43.17  ? 36  ARG B CD    1 
ATOM   6906  N  NE    . ARG D  3 36  ? -47.122 20.127  -57.873 1.00 51.42  ? 36  ARG B NE    1 
ATOM   6907  C  CZ    . ARG D  3 36  ? -47.704 18.981  -58.216 1.00 52.58  ? 36  ARG B CZ    1 
ATOM   6908  N  NH1   . ARG D  3 36  ? -48.351 18.878  -59.368 1.00 53.49  ? 36  ARG B NH1   1 
ATOM   6909  N  NH2   . ARG D  3 36  ? -47.637 17.933  -57.406 1.00 51.09  ? 36  ARG B NH2   1 
ATOM   6910  N  N     . LEU D  3 37  ? -41.534 21.235  -58.646 1.00 44.49  ? 37  LEU B N     1 
ATOM   6911  C  CA    . LEU D  3 37  ? -40.291 21.488  -57.919 1.00 39.82  ? 37  LEU B CA    1 
ATOM   6912  C  C     . LEU D  3 37  ? -39.265 22.188  -58.803 1.00 42.56  ? 37  LEU B C     1 
ATOM   6913  O  O     . LEU D  3 37  ? -38.599 23.129  -58.373 1.00 41.39  ? 37  LEU B O     1 
ATOM   6914  C  CB    . LEU D  3 37  ? -39.709 20.182  -57.380 1.00 43.98  ? 37  LEU B CB    1 
ATOM   6915  C  CG    . LEU D  3 37  ? -40.385 19.596  -56.140 1.00 45.95  ? 37  LEU B CG    1 
ATOM   6916  C  CD1   . LEU D  3 37  ? -39.949 18.156  -55.939 1.00 41.82  ? 37  LEU B CD1   1 
ATOM   6917  C  CD2   . LEU D  3 37  ? -40.062 20.431  -54.914 1.00 41.10  ? 37  LEU B CD2   1 
ATOM   6918  N  N     . ALA D  3 38  ? -39.142 21.724  -60.043 1.00 43.32  ? 38  ALA B N     1 
ATOM   6919  C  CA    . ALA D  3 38  ? -38.235 22.348  -60.998 1.00 38.44  ? 38  ALA B CA    1 
ATOM   6920  C  C     . ALA D  3 38  ? -38.630 23.800  -61.231 1.00 43.20  ? 38  ALA B C     1 
ATOM   6921  O  O     . ALA D  3 38  ? -37.778 24.686  -61.315 1.00 41.68  ? 38  ALA B O     1 
ATOM   6922  C  CB    . ALA D  3 38  ? -38.233 21.583  -62.308 1.00 36.30  ? 38  ALA B CB    1 
ATOM   6923  N  N     . ARG D  3 39  ? -39.935 24.027  -61.336 1.00 46.32  ? 39  ARG B N     1 
ATOM   6924  C  CA    . ARG D  3 39  ? -40.475 25.358  -61.549 1.00 42.45  ? 39  ARG B CA    1 
ATOM   6925  C  C     . ARG D  3 39  ? -40.073 26.287  -60.414 1.00 39.89  ? 39  ARG B C     1 
ATOM   6926  O  O     . ARG D  3 39  ? -39.680 27.424  -60.654 1.00 43.41  ? 39  ARG B O     1 
ATOM   6927  C  CB    . ARG D  3 39  ? -41.998 25.303  -61.679 1.00 46.81  ? 39  ARG B CB    1 
ATOM   6928  C  CG    . ARG D  3 39  ? -42.492 24.611  -62.937 1.00 44.91  ? 39  ARG B CG    1 
ATOM   6929  C  CD    . ARG D  3 39  ? -42.252 25.463  -64.171 1.00 46.48  ? 39  ARG B CD    1 
ATOM   6930  N  NE    . ARG D  3 39  ? -42.726 24.800  -65.380 1.00 45.29  ? 39  ARG B NE    1 
ATOM   6931  C  CZ    . ARG D  3 39  ? -41.924 24.330  -66.329 1.00 55.29  ? 39  ARG B CZ    1 
ATOM   6932  N  NH1   . ARG D  3 39  ? -40.610 24.462  -66.207 1.00 54.51  ? 39  ARG B NH1   1 
ATOM   6933  N  NH2   . ARG D  3 39  ? -42.428 23.731  -67.399 1.00 61.30  ? 39  ARG B NH2   1 
ATOM   6934  N  N     . ARG D  3 40  ? -40.155 25.807  -59.178 1.00 39.06  ? 40  ARG B N     1 
ATOM   6935  C  CA    . ARG D  3 40  ? -39.739 26.640  -58.053 1.00 40.59  ? 40  ARG B CA    1 
ATOM   6936  C  C     . ARG D  3 40  ? -38.233 26.941  -58.135 1.00 43.51  ? 40  ARG B C     1 
ATOM   6937  O  O     . ARG D  3 40  ? -37.756 27.955  -57.615 1.00 40.61  ? 40  ARG B O     1 
ATOM   6938  C  CB    . ARG D  3 40  ? -40.091 25.973  -56.720 1.00 35.55  ? 40  ARG B CB    1 
ATOM   6939  C  CG    . ARG D  3 40  ? -39.798 26.845  -55.507 1.00 39.99  ? 40  ARG B CG    1 
ATOM   6940  C  CD    . ARG D  3 40  ? -40.414 26.293  -54.235 1.00 35.04  ? 40  ARG B CD    1 
ATOM   6941  N  NE    . ARG D  3 40  ? -41.867 26.409  -54.244 1.00 43.82  ? 40  ARG B NE    1 
ATOM   6942  C  CZ    . ARG D  3 40  ? -42.660 25.918  -53.298 1.00 48.54  ? 40  ARG B CZ    1 
ATOM   6943  N  NH1   . ARG D  3 40  ? -42.139 25.273  -52.262 1.00 46.23  ? 40  ARG B NH1   1 
ATOM   6944  N  NH2   . ARG D  3 40  ? -43.974 26.072  -53.387 1.00 51.25  ? 40  ARG B NH2   1 
ATOM   6945  N  N     . GLY D  3 41  ? -37.495 26.067  -58.814 1.00 41.68  ? 41  GLY B N     1 
ATOM   6946  C  CA    . GLY D  3 41  ? -36.060 26.235  -58.970 1.00 37.18  ? 41  GLY B CA    1 
ATOM   6947  C  C     . GLY D  3 41  ? -35.679 27.056  -60.187 1.00 35.21  ? 41  GLY B C     1 
ATOM   6948  O  O     . GLY D  3 41  ? -34.496 27.249  -60.476 1.00 29.39  ? 41  GLY B O     1 
ATOM   6949  N  N     . GLY D  3 42  ? -36.691 27.526  -60.910 1.00 35.23  ? 42  GLY B N     1 
ATOM   6950  C  CA    . GLY D  3 42  ? -36.482 28.408  -62.042 1.00 33.50  ? 42  GLY B CA    1 
ATOM   6951  C  C     . GLY D  3 42  ? -36.316 27.731  -63.390 1.00 35.75  ? 42  GLY B C     1 
ATOM   6952  O  O     . GLY D  3 42  ? -35.928 28.384  -64.358 1.00 40.38  ? 42  GLY B O     1 
ATOM   6953  N  N     . VAL D  3 43  ? -36.614 26.438  -63.476 1.00 33.24  ? 43  VAL B N     1 
ATOM   6954  C  CA    . VAL D  3 43  ? -36.413 25.716  -64.729 1.00 36.39  ? 43  VAL B CA    1 
ATOM   6955  C  C     . VAL D  3 43  ? -37.575 25.925  -65.696 1.00 39.25  ? 43  VAL B C     1 
ATOM   6956  O  O     . VAL D  3 43  ? -38.739 25.755  -65.336 1.00 40.28  ? 43  VAL B O     1 
ATOM   6957  C  CB    . VAL D  3 43  ? -36.212 24.210  -64.487 1.00 37.57  ? 43  VAL B CB    1 
ATOM   6958  C  CG1   . VAL D  3 43  ? -36.154 23.465  -65.808 1.00 36.30  ? 43  VAL B CG1   1 
ATOM   6959  C  CG2   . VAL D  3 43  ? -34.942 23.976  -63.694 1.00 36.00  ? 43  VAL B CG2   1 
ATOM   6960  N  N     . LYS D  3 44  ? -37.243 26.292  -66.929 1.00 44.68  ? 44  LYS B N     1 
ATOM   6961  C  CA    . LYS D  3 44  ? -38.241 26.627  -67.935 1.00 39.64  ? 44  LYS B CA    1 
ATOM   6962  C  C     . LYS D  3 44  ? -38.578 25.441  -68.837 1.00 46.45  ? 44  LYS B C     1 
ATOM   6963  O  O     . LYS D  3 44  ? -39.731 25.250  -69.226 1.00 58.12  ? 44  LYS B O     1 
ATOM   6964  C  CB    . LYS D  3 44  ? -37.745 27.802  -68.775 1.00 40.42  ? 44  LYS B CB    1 
ATOM   6965  C  CG    . LYS D  3 44  ? -38.653 28.192  -69.921 1.00 49.33  ? 44  LYS B CG    1 
ATOM   6966  C  CD    . LYS D  3 44  ? -38.143 29.445  -70.611 1.00 50.68  ? 44  LYS B CD    1 
ATOM   6967  C  CE    . LYS D  3 44  ? -38.969 29.769  -71.840 1.00 52.50  ? 44  LYS B CE    1 
ATOM   6968  N  NZ    . LYS D  3 44  ? -38.649 31.117  -72.374 1.00 49.41  ? 44  LYS B NZ    1 
ATOM   6969  N  N     . ARG D  3 45  ? -37.569 24.639  -69.160 1.00 44.46  ? 45  ARG B N     1 
ATOM   6970  C  CA    . ARG D  3 45  ? -37.742 23.524  -70.083 1.00 45.70  ? 45  ARG B CA    1 
ATOM   6971  C  C     . ARG D  3 45  ? -37.058 22.266  -69.545 1.00 46.86  ? 45  ARG B C     1 
ATOM   6972  O  O     . ARG D  3 45  ? -35.919 22.327  -69.080 1.00 40.32  ? 45  ARG B O     1 
ATOM   6973  C  CB    . ARG D  3 45  ? -37.188 23.897  -71.458 1.00 45.79  ? 45  ARG B CB    1 
ATOM   6974  C  CG    . ARG D  3 45  ? -37.803 23.135  -72.609 1.00 46.12  ? 45  ARG B CG    1 
ATOM   6975  C  CD    . ARG D  3 45  ? -37.426 23.775  -73.931 1.00 51.59  ? 45  ARG B CD    1 
ATOM   6976  N  NE    . ARG D  3 45  ? -38.086 23.122  -75.055 1.00 55.25  ? 45  ARG B NE    1 
ATOM   6977  C  CZ    . ARG D  3 45  ? -37.585 22.078  -75.703 1.00 59.54  ? 45  ARG B CZ    1 
ATOM   6978  N  NH1   . ARG D  3 45  ? -36.415 21.570  -75.335 1.00 51.14  ? 45  ARG B NH1   1 
ATOM   6979  N  NH2   . ARG D  3 45  ? -38.252 21.540  -76.716 1.00 71.05  ? 45  ARG B NH2   1 
ATOM   6980  N  N     . ILE D  3 46  ? -37.751 21.130  -69.619 1.00 46.85  ? 46  ILE B N     1 
ATOM   6981  C  CA    . ILE D  3 46  ? -37.301 19.907  -68.955 1.00 41.62  ? 46  ILE B CA    1 
ATOM   6982  C  C     . ILE D  3 46  ? -37.204 18.695  -69.882 1.00 45.59  ? 46  ILE B C     1 
ATOM   6983  O  O     . ILE D  3 46  ? -38.207 18.237  -70.422 1.00 53.07  ? 46  ILE B O     1 
ATOM   6984  C  CB    . ILE D  3 46  ? -38.240 19.539  -67.788 1.00 40.13  ? 46  ILE B CB    1 
ATOM   6985  C  CG1   . ILE D  3 46  ? -38.282 20.668  -66.756 1.00 38.06  ? 46  ILE B CG1   1 
ATOM   6986  C  CG2   . ILE D  3 46  ? -37.795 18.244  -67.141 1.00 40.88  ? 46  ILE B CG2   1 
ATOM   6987  C  CD1   . ILE D  3 46  ? -39.256 20.435  -65.629 1.00 38.46  ? 46  ILE B CD1   1 
ATOM   6988  N  N     . SER D  3 47  ? -35.991 18.174  -70.049 1.00 49.04  ? 47  SER B N     1 
ATOM   6989  C  CA    . SER D  3 47  ? -35.761 16.947  -70.810 1.00 42.00  ? 47  SER B CA    1 
ATOM   6990  C  C     . SER D  3 47  ? -36.542 15.772  -70.236 1.00 44.11  ? 47  SER B C     1 
ATOM   6991  O  O     . SER D  3 47  ? -36.674 15.638  -69.020 1.00 39.74  ? 47  SER B O     1 
ATOM   6992  C  CB    . SER D  3 47  ? -34.269 16.607  -70.833 1.00 41.10  ? 47  SER B CB    1 
ATOM   6993  O  OG    . SER D  3 47  ? -34.069 15.202  -70.857 1.00 48.48  ? 47  SER B OG    1 
ATOM   6994  N  N     . GLY D  3 48  ? -37.042 14.912  -71.117 1.00 46.45  ? 48  GLY B N     1 
ATOM   6995  C  CA    . GLY D  3 48  ? -37.839 13.771  -70.703 1.00 42.02  ? 48  GLY B CA    1 
ATOM   6996  C  C     . GLY D  3 48  ? -37.128 12.772  -69.809 1.00 46.11  ? 48  GLY B C     1 
ATOM   6997  O  O     . GLY D  3 48  ? -37.774 11.953  -69.160 1.00 49.17  ? 48  GLY B O     1 
ATOM   6998  N  N     . LEU D  3 49  ? -35.800 12.831  -69.768 1.00 46.39  ? 49  LEU B N     1 
ATOM   6999  C  CA    . LEU D  3 49  ? -35.023 11.885  -68.973 1.00 46.00  ? 49  LEU B CA    1 
ATOM   7000  C  C     . LEU D  3 49  ? -34.751 12.400  -67.563 1.00 45.81  ? 49  LEU B C     1 
ATOM   7001  O  O     . LEU D  3 49  ? -34.138 11.708  -66.750 1.00 45.83  ? 49  LEU B O     1 
ATOM   7002  C  CB    . LEU D  3 49  ? -33.699 11.568  -69.670 1.00 54.13  ? 49  LEU B CB    1 
ATOM   7003  C  CG    . LEU D  3 49  ? -33.759 10.638  -70.884 1.00 52.06  ? 49  LEU B CG    1 
ATOM   7004  C  CD1   . LEU D  3 49  ? -32.467 10.723  -71.679 1.00 48.48  ? 49  LEU B CD1   1 
ATOM   7005  C  CD2   . LEU D  3 49  ? -34.021 9.208   -70.444 1.00 39.98  ? 49  LEU B CD2   1 
ATOM   7006  N  N     . ILE D  3 50  ? -35.215 13.613  -67.278 1.00 48.36  ? 50  ILE B N     1 
ATOM   7007  C  CA    . ILE D  3 50  ? -34.957 14.259  -65.994 1.00 45.06  ? 50  ILE B CA    1 
ATOM   7008  C  C     . ILE D  3 50  ? -35.678 13.567  -64.839 1.00 43.87  ? 50  ILE B C     1 
ATOM   7009  O  O     . ILE D  3 50  ? -35.149 13.472  -63.738 1.00 46.27  ? 50  ILE B O     1 
ATOM   7010  C  CB    . ILE D  3 50  ? -35.364 15.753  -66.036 1.00 40.37  ? 50  ILE B CB    1 
ATOM   7011  C  CG1   . ILE D  3 50  ? -34.225 16.597  -66.609 1.00 37.56  ? 50  ILE B CG1   1 
ATOM   7012  C  CG2   . ILE D  3 50  ? -35.727 16.267  -64.653 1.00 40.99  ? 50  ILE B CG2   1 
ATOM   7013  C  CD1   . ILE D  3 50  ? -32.994 16.609  -65.740 1.00 40.48  ? 50  ILE B CD1   1 
ATOM   7014  N  N     . TYR D  3 51  ? -36.873 13.055  -65.096 1.00 42.85  ? 51  TYR B N     1 
ATOM   7015  C  CA    . TYR D  3 51  ? -37.723 12.578  -64.010 1.00 45.39  ? 51  TYR B CA    1 
ATOM   7016  C  C     . TYR D  3 51  ? -37.170 11.328  -63.310 1.00 45.15  ? 51  TYR B C     1 
ATOM   7017  O  O     . TYR D  3 51  ? -37.179 11.248  -62.077 1.00 47.38  ? 51  TYR B O     1 
ATOM   7018  C  CB    . TYR D  3 51  ? -39.138 12.349  -64.544 1.00 42.70  ? 51  TYR B CB    1 
ATOM   7019  C  CG    . TYR D  3 51  ? -39.652 13.568  -65.279 1.00 44.54  ? 51  TYR B CG    1 
ATOM   7020  C  CD1   . TYR D  3 51  ? -40.114 14.679  -64.583 1.00 44.72  ? 51  TYR B CD1   1 
ATOM   7021  C  CD2   . TYR D  3 51  ? -39.637 13.625  -66.664 1.00 41.06  ? 51  TYR B CD2   1 
ATOM   7022  C  CE1   . TYR D  3 51  ? -40.562 15.806  -65.250 1.00 43.38  ? 51  TYR B CE1   1 
ATOM   7023  C  CE2   . TYR D  3 51  ? -40.083 14.745  -67.337 1.00 42.49  ? 51  TYR B CE2   1 
ATOM   7024  C  CZ    . TYR D  3 51  ? -40.544 15.832  -66.628 1.00 45.47  ? 51  TYR B CZ    1 
ATOM   7025  O  OH    . TYR D  3 51  ? -40.990 16.947  -67.303 1.00 49.52  ? 51  TYR B OH    1 
ATOM   7026  N  N     . GLU D  3 52  ? -36.662 10.373  -64.082 1.00 45.53  ? 52  GLU B N     1 
ATOM   7027  C  CA    . GLU D  3 52  ? -36.054 9.184   -63.497 1.00 42.40  ? 52  GLU B CA    1 
ATOM   7028  C  C     . GLU D  3 52  ? -34.781 9.535   -62.735 1.00 45.99  ? 52  GLU B C     1 
ATOM   7029  O  O     . GLU D  3 52  ? -34.553 9.043   -61.624 1.00 51.47  ? 52  GLU B O     1 
ATOM   7030  C  CB    . GLU D  3 52  ? -35.756 8.146   -64.576 1.00 43.03  ? 52  GLU B CB    1 
ATOM   7031  C  CG    . GLU D  3 52  ? -36.895 7.172   -64.807 1.00 50.70  ? 52  GLU B CG    1 
ATOM   7032  C  CD    . GLU D  3 52  ? -37.373 6.529   -63.517 1.00 61.64  ? 52  GLU B CD    1 
ATOM   7033  O  OE1   . GLU D  3 52  ? -36.606 5.737   -62.931 1.00 60.39  ? 52  GLU B OE1   1 
ATOM   7034  O  OE2   . GLU D  3 52  ? -38.508 6.827   -63.081 1.00 62.94  ? 52  GLU B OE2   1 
ATOM   7035  N  N     . GLU D  3 53  ? -33.958 10.388  -63.340 1.00 44.81  ? 53  GLU B N     1 
ATOM   7036  C  CA    . GLU D  3 53  ? -32.749 10.900  -62.695 1.00 49.26  ? 53  GLU B CA    1 
ATOM   7037  C  C     . GLU D  3 53  ? -33.071 11.514  -61.333 1.00 45.65  ? 53  GLU B C     1 
ATOM   7038  O  O     . GLU D  3 53  ? -32.418 11.223  -60.318 1.00 45.67  ? 53  GLU B O     1 
ATOM   7039  C  CB    . GLU D  3 53  ? -32.077 11.947  -63.587 1.00 45.89  ? 53  GLU B CB    1 
ATOM   7040  C  CG    . GLU D  3 53  ? -30.669 12.308  -63.164 1.00 45.12  ? 53  GLU B CG    1 
ATOM   7041  C  CD    . GLU D  3 53  ? -29.701 11.174  -63.400 1.00 55.49  ? 53  GLU B CD    1 
ATOM   7042  O  OE1   . GLU D  3 53  ? -29.855 10.479  -64.427 1.00 52.48  ? 53  GLU B OE1   1 
ATOM   7043  O  OE2   . GLU D  3 53  ? -28.793 10.975  -62.565 1.00 63.50  ? 53  GLU B OE2   1 
ATOM   7044  N  N     . THR D  3 54  ? -34.096 12.361  -61.335 1.00 39.60  ? 54  THR B N     1 
ATOM   7045  C  CA    . THR D  3 54  ? -34.539 13.069  -60.151 1.00 37.92  ? 54  THR B CA    1 
ATOM   7046  C  C     . THR D  3 54  ? -34.994 12.089  -59.092 1.00 40.30  ? 54  THR B C     1 
ATOM   7047  O  O     . THR D  3 54  ? -34.672 12.247  -57.913 1.00 42.42  ? 54  THR B O     1 
ATOM   7048  C  CB    . THR D  3 54  ? -35.685 14.041  -60.466 1.00 40.02  ? 54  THR B CB    1 
ATOM   7049  O  OG1   . THR D  3 54  ? -35.251 14.996  -61.444 1.00 48.04  ? 54  THR B OG1   1 
ATOM   7050  C  CG2   . THR D  3 54  ? -36.116 14.773  -59.208 1.00 35.93  ? 54  THR B CG2   1 
ATOM   7051  N  N     . ARG D  3 55  ? -35.736 11.070  -59.512 1.00 39.33  ? 55  ARG B N     1 
ATOM   7052  C  CA    . ARG D  3 55  ? -36.196 10.060  -58.568 1.00 43.02  ? 55  ARG B CA    1 
ATOM   7053  C  C     . ARG D  3 55  ? -35.009 9.359   -57.921 1.00 39.89  ? 55  ARG B C     1 
ATOM   7054  O  O     . ARG D  3 55  ? -35.015 9.096   -56.715 1.00 38.27  ? 55  ARG B O     1 
ATOM   7055  C  CB    . ARG D  3 55  ? -37.113 9.048   -59.254 1.00 46.58  ? 55  ARG B CB    1 
ATOM   7056  C  CG    . ARG D  3 55  ? -38.488 9.605   -59.557 1.00 47.31  ? 55  ARG B CG    1 
ATOM   7057  C  CD    . ARG D  3 55  ? -39.430 8.554   -60.113 1.00 53.19  ? 55  ARG B CD    1 
ATOM   7058  N  NE    . ARG D  3 55  ? -40.656 9.181   -60.596 1.00 55.90  ? 55  ARG B NE    1 
ATOM   7059  C  CZ    . ARG D  3 55  ? -40.891 9.486   -61.868 1.00 52.21  ? 55  ARG B CZ    1 
ATOM   7060  N  NH1   . ARG D  3 55  ? -39.993 9.198   -62.804 1.00 46.72  ? 55  ARG B NH1   1 
ATOM   7061  N  NH2   . ARG D  3 55  ? -42.032 10.071  -62.205 1.00 47.23  ? 55  ARG B NH2   1 
ATOM   7062  N  N     . GLY D  3 56  ? -33.987 9.076   -58.723 1.00 33.15  ? 56  GLY B N     1 
ATOM   7063  C  CA    . GLY D  3 56  ? -32.782 8.459   -58.207 1.00 27.67  ? 56  GLY B CA    1 
ATOM   7064  C  C     . GLY D  3 56  ? -32.124 9.308   -57.133 1.00 39.98  ? 56  GLY B C     1 
ATOM   7065  O  O     . GLY D  3 56  ? -31.873 8.842   -56.009 1.00 42.91  ? 56  GLY B O     1 
ATOM   7066  N  N     . VAL D  3 57  ? -31.850 10.564  -57.474 1.00 38.93  ? 57  VAL B N     1 
ATOM   7067  C  CA    . VAL D  3 57  ? -31.190 11.466  -56.536 1.00 33.83  ? 57  VAL B CA    1 
ATOM   7068  C  C     . VAL D  3 57  ? -31.996 11.576  -55.240 1.00 37.60  ? 57  VAL B C     1 
ATOM   7069  O  O     . VAL D  3 57  ? -31.447 11.501  -54.133 1.00 38.16  ? 57  VAL B O     1 
ATOM   7070  C  CB    . VAL D  3 57  ? -30.996 12.864  -57.153 1.00 31.61  ? 57  VAL B CB    1 
ATOM   7071  C  CG1   . VAL D  3 57  ? -30.583 13.869  -56.090 1.00 43.66  ? 57  VAL B CG1   1 
ATOM   7072  C  CG2   . VAL D  3 57  ? -29.975 12.812  -58.269 1.00 30.01  ? 57  VAL B CG2   1 
ATOM   7073  N  N     . LEU D  3 58  ? -33.305 11.739  -55.399 1.00 35.76  ? 58  LEU B N     1 
ATOM   7074  C  CA    . LEU D  3 58  ? -34.241 11.831  -54.285 1.00 33.59  ? 58  LEU B CA    1 
ATOM   7075  C  C     . LEU D  3 58  ? -34.158 10.606  -53.371 1.00 37.92  ? 58  LEU B C     1 
ATOM   7076  O  O     . LEU D  3 58  ? -34.147 10.722  -52.134 1.00 38.89  ? 58  LEU B O     1 
ATOM   7077  C  CB    . LEU D  3 58  ? -35.653 12.006  -54.841 1.00 36.50  ? 58  LEU B CB    1 
ATOM   7078  C  CG    . LEU D  3 58  ? -36.879 11.668  -54.000 1.00 44.61  ? 58  LEU B CG    1 
ATOM   7079  C  CD1   . LEU D  3 58  ? -36.859 12.423  -52.718 1.00 34.76  ? 58  LEU B CD1   1 
ATOM   7080  C  CD2   . LEU D  3 58  ? -38.151 11.971  -54.771 1.00 45.01  ? 58  LEU B CD2   1 
ATOM   7081  N  N     . LYS D  3 59  ? -34.090 9.433   -53.988 1.00 32.04  ? 59  LYS B N     1 
ATOM   7082  C  CA    . LYS D  3 59  ? -33.956 8.194   -53.241 1.00 34.98  ? 59  LYS B CA    1 
ATOM   7083  C  C     . LYS D  3 59  ? -32.648 8.152   -52.455 1.00 38.95  ? 59  LYS B C     1 
ATOM   7084  O  O     . LYS D  3 59  ? -32.652 7.762   -51.294 1.00 40.05  ? 59  LYS B O     1 
ATOM   7085  C  CB    . LYS D  3 59  ? -34.048 6.990   -54.179 1.00 40.06  ? 59  LYS B CB    1 
ATOM   7086  C  CG    . LYS D  3 59  ? -34.152 5.652   -53.474 1.00 41.67  ? 59  LYS B CG    1 
ATOM   7087  C  CD    . LYS D  3 59  ? -34.869 4.633   -54.353 1.00 58.25  ? 59  LYS B CD    1 
ATOM   7088  C  CE    . LYS D  3 59  ? -34.850 3.247   -53.730 1.00 52.49  ? 59  LYS B CE    1 
ATOM   7089  N  NZ    . LYS D  3 59  ? -33.472 2.683   -53.737 1.00 59.43  ? 59  LYS B NZ    1 
ATOM   7090  N  N     . VAL D  3 60  ? -31.535 8.549   -53.074 1.00 36.85  ? 60  VAL B N     1 
ATOM   7091  C  CA    . VAL D  3 60  ? -30.259 8.600   -52.350 1.00 31.02  ? 60  VAL B CA    1 
ATOM   7092  C  C     . VAL D  3 60  ? -30.331 9.533   -51.135 1.00 35.67  ? 60  VAL B C     1 
ATOM   7093  O  O     . VAL D  3 60  ? -29.914 9.163   -50.026 1.00 39.81  ? 60  VAL B O     1 
ATOM   7094  C  CB    . VAL D  3 60  ? -29.100 9.073   -53.246 1.00 31.47  ? 60  VAL B CB    1 
ATOM   7095  C  CG1   . VAL D  3 60  ? -27.851 9.275   -52.415 1.00 32.75  ? 60  VAL B CG1   1 
ATOM   7096  C  CG2   . VAL D  3 60  ? -28.840 8.090   -54.357 1.00 25.08  ? 60  VAL B CG2   1 
ATOM   7097  N  N     . PHE D  3 61  ? -30.857 10.739  -51.353 1.00 28.13  ? 61  PHE B N     1 
ATOM   7098  C  CA    . PHE D  3 61  ? -31.032 11.710  -50.274 1.00 34.19  ? 61  PHE B CA    1 
ATOM   7099  C  C     . PHE D  3 61  ? -31.807 11.119  -49.097 1.00 37.20  ? 61  PHE B C     1 
ATOM   7100  O  O     . PHE D  3 61  ? -31.354 11.158  -47.936 1.00 36.75  ? 61  PHE B O     1 
ATOM   7101  C  CB    . PHE D  3 61  ? -31.758 12.961  -50.784 1.00 35.94  ? 61  PHE B CB    1 
ATOM   7102  C  CG    . PHE D  3 61  ? -31.839 14.069  -49.766 1.00 39.07  ? 61  PHE B CG    1 
ATOM   7103  C  CD1   . PHE D  3 61  ? -30.836 15.026  -49.678 1.00 41.60  ? 61  PHE B CD1   1 
ATOM   7104  C  CD2   . PHE D  3 61  ? -32.905 14.145  -48.884 1.00 34.26  ? 61  PHE B CD2   1 
ATOM   7105  C  CE1   . PHE D  3 61  ? -30.902 16.042  -48.734 1.00 33.87  ? 61  PHE B CE1   1 
ATOM   7106  C  CE2   . PHE D  3 61  ? -32.975 15.157  -47.938 1.00 30.55  ? 61  PHE B CE2   1 
ATOM   7107  C  CZ    . PHE D  3 61  ? -31.976 16.105  -47.865 1.00 30.01  ? 61  PHE B CZ    1 
ATOM   7108  N  N     . LEU D  3 62  ? -32.981 10.574  -49.408 1.00 37.78  ? 62  LEU B N     1 
ATOM   7109  C  CA    . LEU D  3 62  ? -33.846 10.003  -48.381 1.00 38.68  ? 62  LEU B CA    1 
ATOM   7110  C  C     . LEU D  3 62  ? -33.213 8.805   -47.681 1.00 38.21  ? 62  LEU B C     1 
ATOM   7111  O  O     . LEU D  3 62  ? -33.345 8.659   -46.472 1.00 41.66  ? 62  LEU B O     1 
ATOM   7112  C  CB    . LEU D  3 62  ? -35.188 9.602   -48.982 1.00 39.63  ? 62  LEU B CB    1 
ATOM   7113  C  CG    . LEU D  3 62  ? -36.294 10.633  -48.797 1.00 37.90  ? 62  LEU B CG    1 
ATOM   7114  C  CD1   . LEU D  3 62  ? -37.508 10.260  -49.623 1.00 39.73  ? 62  LEU B CD1   1 
ATOM   7115  C  CD2   . LEU D  3 62  ? -36.646 10.729  -47.330 1.00 38.83  ? 62  LEU B CD2   1 
ATOM   7116  N  N     . GLU D  3 63  ? -32.534 7.949   -48.437 1.00 33.12  ? 63  GLU B N     1 
ATOM   7117  C  CA    . GLU D  3 63  ? -31.814 6.828   -47.842 1.00 35.02  ? 63  GLU B CA    1 
ATOM   7118  C  C     . GLU D  3 63  ? -30.818 7.333   -46.808 1.00 38.32  ? 63  GLU B C     1 
ATOM   7119  O  O     . GLU D  3 63  ? -30.832 6.866   -45.671 1.00 38.58  ? 63  GLU B O     1 
ATOM   7120  C  CB    . GLU D  3 63  ? -31.093 6.003   -48.910 1.00 35.93  ? 63  GLU B CB    1 
ATOM   7121  C  CG    . GLU D  3 63  ? -32.011 5.137   -49.752 1.00 36.07  ? 63  GLU B CG    1 
ATOM   7122  C  CD    . GLU D  3 63  ? -31.307 4.531   -50.951 1.00 44.60  ? 63  GLU B CD    1 
ATOM   7123  O  OE1   . GLU D  3 63  ? -30.083 4.741   -51.101 1.00 44.78  ? 63  GLU B OE1   1 
ATOM   7124  O  OE2   . GLU D  3 63  ? -31.982 3.852   -51.753 1.00 52.73  ? 63  GLU B OE2   1 
ATOM   7125  N  N     . ASN D  3 64  ? -29.975 8.296   -47.191 1.00 37.92  ? 64  ASN B N     1 
ATOM   7126  C  CA    . ASN D  3 64  ? -28.961 8.817   -46.266 1.00 36.44  ? 64  ASN B CA    1 
ATOM   7127  C  C     . ASN D  3 64  ? -29.560 9.401   -44.992 1.00 34.22  ? 64  ASN B C     1 
ATOM   7128  O  O     . ASN D  3 64  ? -29.173 9.031   -43.857 1.00 39.07  ? 64  ASN B O     1 
ATOM   7129  C  CB    . ASN D  3 64  ? -28.105 9.878   -46.948 1.00 34.29  ? 64  ASN B CB    1 
ATOM   7130  C  CG    . ASN D  3 64  ? -27.275 9.318   -48.077 1.00 38.32  ? 64  ASN B CG    1 
ATOM   7131  O  OD1   . ASN D  3 64  ? -27.045 8.112   -48.156 1.00 47.09  ? 64  ASN B OD1   1 
ATOM   7132  N  ND2   . ASN D  3 64  ? -26.801 10.195  -48.950 1.00 46.04  ? 64  ASN B ND2   1 
ATOM   7133  N  N     . VAL D  3 65  ? -30.521 10.301  -45.184 1.00 32.75  ? 65  VAL B N     1 
ATOM   7134  C  CA    . VAL D  3 65  ? -31.134 10.976  -44.051 1.00 34.33  ? 65  VAL B CA    1 
ATOM   7135  C  C     . VAL D  3 65  ? -31.827 9.981   -43.127 1.00 36.49  ? 65  VAL B C     1 
ATOM   7136  O  O     . VAL D  3 65  ? -31.564 9.953   -41.919 1.00 36.78  ? 65  VAL B O     1 
ATOM   7137  C  CB    . VAL D  3 65  ? -32.140 12.041  -44.506 1.00 34.00  ? 65  VAL B CB    1 
ATOM   7138  C  CG1   . VAL D  3 65  ? -32.775 12.700  -43.308 1.00 32.59  ? 65  VAL B CG1   1 
ATOM   7139  C  CG2   . VAL D  3 65  ? -31.442 13.088  -45.352 1.00 42.07  ? 65  VAL B CG2   1 
ATOM   7140  N  N     . ILE D  3 66  ? -32.694 9.153   -43.700 1.00 34.97  ? 66  ILE B N     1 
ATOM   7141  C  CA    . ILE D  3 66  ? -33.464 8.200   -42.910 1.00 36.61  ? 66  ILE B CA    1 
ATOM   7142  C  C     . ILE D  3 66  ? -32.552 7.215   -42.185 1.00 39.11  ? 66  ILE B C     1 
ATOM   7143  O  O     . ILE D  3 66  ? -32.789 6.904   -41.021 1.00 37.26  ? 66  ILE B O     1 
ATOM   7144  C  CB    . ILE D  3 66  ? -34.476 7.429   -43.779 1.00 40.77  ? 66  ILE B CB    1 
ATOM   7145  C  CG1   . ILE D  3 66  ? -35.582 8.372   -44.261 1.00 34.49  ? 66  ILE B CG1   1 
ATOM   7146  C  CG2   . ILE D  3 66  ? -35.083 6.272   -42.997 1.00 40.77  ? 66  ILE B CG2   1 
ATOM   7147  C  CD1   . ILE D  3 66  ? -36.608 7.710   -45.140 1.00 37.27  ? 66  ILE B CD1   1 
ATOM   7148  N  N     . ARG D  3 67  ? -31.507 6.742   -42.859 1.00 35.38  ? 67  ARG B N     1 
ATOM   7149  C  CA    . ARG D  3 67  ? -30.536 5.862   -42.214 1.00 38.41  ? 67  ARG B CA    1 
ATOM   7150  C  C     . ARG D  3 67  ? -29.978 6.503   -40.947 1.00 33.72  ? 67  ARG B C     1 
ATOM   7151  O  O     . ARG D  3 67  ? -29.998 5.885   -39.871 1.00 34.93  ? 67  ARG B O     1 
ATOM   7152  C  CB    . ARG D  3 67  ? -29.395 5.511   -43.169 1.00 44.04  ? 67  ARG B CB    1 
ATOM   7153  C  CG    . ARG D  3 67  ? -28.300 4.671   -42.533 1.00 45.98  ? 67  ARG B CG    1 
ATOM   7154  C  CD    . ARG D  3 67  ? -27.156 4.408   -43.505 1.00 55.12  ? 67  ARG B CD    1 
ATOM   7155  N  NE    . ARG D  3 67  ? -27.598 3.651   -44.673 1.00 65.27  ? 67  ARG B NE    1 
ATOM   7156  C  CZ    . ARG D  3 67  ? -27.480 4.074   -45.930 1.00 70.95  ? 67  ARG B CZ    1 
ATOM   7157  N  NH1   . ARG D  3 67  ? -26.926 5.253   -46.189 1.00 58.53  ? 67  ARG B NH1   1 
ATOM   7158  N  NH2   . ARG D  3 67  ? -27.916 3.316   -46.929 1.00 64.05  ? 67  ARG B NH2   1 
ATOM   7159  N  N     . ASP D  3 68  ? -29.504 7.745   -41.063 1.00 36.33  ? 68  ASP B N     1 
ATOM   7160  C  CA    . ASP D  3 68  ? -28.976 8.428   -39.875 1.00 38.25  ? 68  ASP B CA    1 
ATOM   7161  C  C     . ASP D  3 68  ? -30.039 8.580   -38.771 1.00 36.03  ? 68  ASP B C     1 
ATOM   7162  O  O     . ASP D  3 68  ? -29.780 8.305   -37.586 1.00 33.77  ? 68  ASP B O     1 
ATOM   7163  C  CB    . ASP D  3 68  ? -28.413 9.802   -40.248 1.00 41.76  ? 68  ASP B CB    1 
ATOM   7164  C  CG    . ASP D  3 68  ? -26.977 9.738   -40.742 1.00 40.61  ? 68  ASP B CG    1 
ATOM   7165  O  OD1   . ASP D  3 68  ? -26.538 8.660   -41.189 1.00 42.58  ? 68  ASP B OD1   1 
ATOM   7166  O  OD2   . ASP D  3 68  ? -26.283 10.776  -40.690 1.00 51.60  ? 68  ASP B OD2   1 
ATOM   7167  N  N     . ALA D  3 69  ? -31.234 9.007   -39.175 1.00 37.67  ? 69  ALA B N     1 
ATOM   7168  C  CA    . ALA D  3 69  ? -32.334 9.269   -38.242 1.00 41.97  ? 69  ALA B CA    1 
ATOM   7169  C  C     . ALA D  3 69  ? -32.720 8.020   -37.452 1.00 39.45  ? 69  ALA B C     1 
ATOM   7170  O  O     . ALA D  3 69  ? -32.805 8.042   -36.222 1.00 42.29  ? 69  ALA B O     1 
ATOM   7171  C  CB    . ALA D  3 69  ? -33.543 9.810   -38.998 1.00 38.54  ? 69  ALA B CB    1 
ATOM   7172  N  N     . VAL D  3 70  ? -32.954 6.936   -38.177 1.00 36.63  ? 70  VAL B N     1 
ATOM   7173  C  CA    . VAL D  3 70  ? -33.237 5.642   -37.582 1.00 39.33  ? 70  VAL B CA    1 
ATOM   7174  C  C     . VAL D  3 70  ? -32.092 5.198   -36.669 1.00 39.99  ? 70  VAL B C     1 
ATOM   7175  O  O     . VAL D  3 70  ? -32.333 4.579   -35.638 1.00 44.98  ? 70  VAL B O     1 
ATOM   7176  C  CB    . VAL D  3 70  ? -33.497 4.577   -38.672 1.00 37.14  ? 70  VAL B CB    1 
ATOM   7177  C  CG1   . VAL D  3 70  ? -33.442 3.171   -38.096 1.00 40.93  ? 70  VAL B CG1   1 
ATOM   7178  C  CG2   . VAL D  3 70  ? -34.836 4.833   -39.347 1.00 35.72  ? 70  VAL B CG2   1 
ATOM   7179  N  N     . THR D  3 71  ? -30.852 5.518   -37.026 1.00 34.41  ? 71  THR B N     1 
ATOM   7180  C  CA    . THR D  3 71  ? -29.749 5.202   -36.120 1.00 32.65  ? 71  THR B CA    1 
ATOM   7181  C  C     . THR D  3 71  ? -29.917 5.919   -34.777 1.00 36.96  ? 71  THR B C     1 
ATOM   7182  O  O     . THR D  3 71  ? -29.719 5.323   -33.701 1.00 38.27  ? 71  THR B O     1 
ATOM   7183  C  CB    . THR D  3 71  ? -28.401 5.569   -36.728 1.00 31.64  ? 71  THR B CB    1 
ATOM   7184  O  OG1   . THR D  3 71  ? -28.260 4.916   -37.995 1.00 36.93  ? 71  THR B OG1   1 
ATOM   7185  C  CG2   . THR D  3 71  ? -27.287 5.134   -35.819 1.00 25.62  ? 71  THR B CG2   1 
ATOM   7186  N  N     . TYR D  3 72  ? -30.298 7.195   -34.839 1.00 41.34  ? 72  TYR B N     1 
ATOM   7187  C  CA    . TYR D  3 72  ? -30.626 7.930   -33.614 1.00 39.41  ? 72  TYR B CA    1 
ATOM   7188  C  C     . TYR D  3 72  ? -31.758 7.246   -32.838 1.00 45.51  ? 72  TYR B C     1 
ATOM   7189  O  O     . TYR D  3 72  ? -31.689 7.094   -31.610 1.00 46.79  ? 72  TYR B O     1 
ATOM   7190  C  CB    . TYR D  3 72  ? -31.010 9.376   -33.933 1.00 39.83  ? 72  TYR B CB    1 
ATOM   7191  C  CG    . TYR D  3 72  ? -29.820 10.254  -34.243 1.00 42.16  ? 72  TYR B CG    1 
ATOM   7192  C  CD1   . TYR D  3 72  ? -28.879 10.543  -33.262 1.00 40.21  ? 72  TYR B CD1   1 
ATOM   7193  C  CD2   . TYR D  3 72  ? -29.639 10.801  -35.506 1.00 38.31  ? 72  TYR B CD2   1 
ATOM   7194  C  CE1   . TYR D  3 72  ? -27.785 11.337  -33.529 1.00 34.60  ? 72  TYR B CE1   1 
ATOM   7195  C  CE2   . TYR D  3 72  ? -28.545 11.604  -35.784 1.00 34.99  ? 72  TYR B CE2   1 
ATOM   7196  C  CZ    . TYR D  3 72  ? -27.624 11.865  -34.792 1.00 33.16  ? 72  TYR B CZ    1 
ATOM   7197  O  OH    . TYR D  3 72  ? -26.532 12.655  -35.047 1.00 40.95  ? 72  TYR B OH    1 
ATOM   7198  N  N     . THR D  3 73  ? -32.791 6.829   -33.567 1.00 43.88  ? 73  THR B N     1 
ATOM   7199  C  CA    . THR D  3 73  ? -33.926 6.127   -32.974 1.00 43.92  ? 73  THR B CA    1 
ATOM   7200  C  C     . THR D  3 73  ? -33.476 4.895   -32.189 1.00 46.52  ? 73  THR B C     1 
ATOM   7201  O  O     . THR D  3 73  ? -33.762 4.773   -30.998 1.00 49.23  ? 73  THR B O     1 
ATOM   7202  C  CB    . THR D  3 73  ? -34.942 5.685   -34.045 1.00 38.70  ? 73  THR B CB    1 
ATOM   7203  O  OG1   . THR D  3 73  ? -35.228 6.776   -34.926 1.00 36.37  ? 73  THR B OG1   1 
ATOM   7204  C  CG2   . THR D  3 73  ? -36.231 5.218   -33.393 1.00 47.87  ? 73  THR B CG2   1 
ATOM   7205  N  N     . GLU D  3 74  ? -32.776 3.991   -32.869 1.00 45.07  ? 74  GLU B N     1 
ATOM   7206  C  CA    . GLU D  3 74  ? -32.226 2.788   -32.251 1.00 45.01  ? 74  GLU B CA    1 
ATOM   7207  C  C     . GLU D  3 74  ? -31.427 3.119   -31.002 1.00 49.63  ? 74  GLU B C     1 
ATOM   7208  O  O     . GLU D  3 74  ? -31.542 2.429   -29.990 1.00 49.32  ? 74  GLU B O     1 
ATOM   7209  C  CB    . GLU D  3 74  ? -31.325 2.031   -33.228 1.00 45.95  ? 74  GLU B CB    1 
ATOM   7210  C  CG    . GLU D  3 74  ? -32.041 1.281   -34.329 1.00 58.69  ? 74  GLU B CG    1 
ATOM   7211  C  CD    . GLU D  3 74  ? -31.079 0.455   -35.170 1.00 80.81  ? 74  GLU B CD    1 
ATOM   7212  O  OE1   . GLU D  3 74  ? -29.988 0.118   -34.661 1.00 86.66  ? 74  GLU B OE1   1 
ATOM   7213  O  OE2   . GLU D  3 74  ? -31.408 0.147   -36.337 1.00 78.54  ? 74  GLU B OE2   1 
ATOM   7214  N  N     . HIS D  3 75  ? -30.606 4.165   -31.066 1.00 48.72  ? 75  HIS B N     1 
ATOM   7215  C  CA    . HIS D  3 75  ? -29.825 4.509   -29.886 1.00 42.52  ? 75  HIS B CA    1 
ATOM   7216  C  C     . HIS D  3 75  ? -30.733 4.929   -28.742 1.00 47.20  ? 75  HIS B C     1 
ATOM   7217  O  O     . HIS D  3 75  ? -30.447 4.648   -27.579 1.00 55.03  ? 75  HIS B O     1 
ATOM   7218  C  CB    . HIS D  3 75  ? -28.821 5.613   -30.178 1.00 42.35  ? 75  HIS B CB    1 
ATOM   7219  C  CG    . HIS D  3 75  ? -27.833 5.817   -29.077 1.00 41.00  ? 75  HIS B CG    1 
ATOM   7220  N  ND1   . HIS D  3 75  ? -26.716 5.022   -28.926 1.00 44.18  ? 75  HIS B ND1   1 
ATOM   7221  C  CD2   . HIS D  3 75  ? -27.798 6.710   -28.061 1.00 44.54  ? 75  HIS B CD2   1 
ATOM   7222  C  CE1   . HIS D  3 75  ? -26.031 5.425   -27.871 1.00 45.63  ? 75  HIS B CE1   1 
ATOM   7223  N  NE2   . HIS D  3 75  ? -26.667 6.448   -27.327 1.00 47.21  ? 75  HIS B NE2   1 
ATOM   7224  N  N     . ALA D  3 76  ? -31.836 5.590   -29.076 1.00 46.10  ? 76  ALA B N     1 
ATOM   7225  C  CA    . ALA D  3 76  ? -32.787 6.037   -28.062 1.00 47.97  ? 76  ALA B CA    1 
ATOM   7226  C  C     . ALA D  3 76  ? -33.728 4.917   -27.598 1.00 57.22  ? 76  ALA B C     1 
ATOM   7227  O  O     . ALA D  3 76  ? -34.686 5.169   -26.859 1.00 50.91  ? 76  ALA B O     1 
ATOM   7228  C  CB    . ALA D  3 76  ? -33.591 7.198   -28.589 1.00 46.90  ? 76  ALA B CB    1 
ATOM   7229  N  N     . LYS D  3 77  ? -33.452 3.690   -28.040 1.00 53.00  ? 77  LYS B N     1 
ATOM   7230  C  CA    . LYS D  3 77  ? -34.272 2.522   -27.709 1.00 50.76  ? 77  LYS B CA    1 
ATOM   7231  C  C     . LYS D  3 77  ? -35.757 2.749   -28.003 1.00 49.53  ? 77  LYS B C     1 
ATOM   7232  O  O     . LYS D  3 77  ? -36.622 2.242   -27.289 1.00 49.70  ? 77  LYS B O     1 
ATOM   7233  C  CB    . LYS D  3 77  ? -34.096 2.144   -26.238 1.00 53.46  ? 77  LYS B CB    1 
ATOM   7234  C  CG    . LYS D  3 77  ? -32.687 1.748   -25.850 1.00 52.18  ? 77  LYS B CG    1 
ATOM   7235  C  CD    . LYS D  3 77  ? -32.484 1.925   -24.356 1.00 59.07  ? 77  LYS B CD    1 
ATOM   7236  C  CE    . LYS D  3 77  ? -31.208 1.257   -23.886 1.00 72.09  ? 77  LYS B CE    1 
ATOM   7237  N  NZ    . LYS D  3 77  ? -31.090 1.316   -22.406 1.00 90.38  ? 77  LYS B NZ    1 
ATOM   7238  N  N     . ARG D  3 78  ? -36.044 3.518   -29.046 1.00 47.09  ? 78  ARG B N     1 
ATOM   7239  C  CA    . ARG D  3 78  ? -37.419 3.827   -29.407 1.00 49.00  ? 78  ARG B CA    1 
ATOM   7240  C  C     . ARG D  3 78  ? -37.835 3.048   -30.649 1.00 47.81  ? 78  ARG B C     1 
ATOM   7241  O  O     . ARG D  3 78  ? -37.015 2.378   -31.275 1.00 49.72  ? 78  ARG B O     1 
ATOM   7242  C  CB    . ARG D  3 78  ? -37.594 5.336   -29.632 1.00 52.75  ? 78  ARG B CB    1 
ATOM   7243  C  CG    . ARG D  3 78  ? -37.450 6.180   -28.366 1.00 49.49  ? 78  ARG B CG    1 
ATOM   7244  C  CD    . ARG D  3 78  ? -37.747 7.663   -28.607 1.00 50.70  ? 78  ARG B CD    1 
ATOM   7245  N  NE    . ARG D  3 78  ? -36.552 8.436   -28.938 1.00 55.80  ? 78  ARG B NE    1 
ATOM   7246  C  CZ    . ARG D  3 78  ? -36.227 8.822   -30.168 1.00 47.15  ? 78  ARG B CZ    1 
ATOM   7247  N  NH1   . ARG D  3 78  ? -37.012 8.514   -31.191 1.00 51.13  ? 78  ARG B NH1   1 
ATOM   7248  N  NH2   . ARG D  3 78  ? -35.118 9.516   -30.376 1.00 47.45  ? 78  ARG B NH2   1 
ATOM   7249  N  N     . LYS D  3 79  ? -39.118 3.127   -30.991 1.00 53.09  ? 79  LYS B N     1 
ATOM   7250  C  CA    . LYS D  3 79  ? -39.644 2.490   -32.195 1.00 52.68  ? 79  LYS B CA    1 
ATOM   7251  C  C     . LYS D  3 79  ? -40.332 3.536   -33.053 1.00 52.88  ? 79  LYS B C     1 
ATOM   7252  O  O     . LYS D  3 79  ? -40.872 3.237   -34.119 1.00 53.97  ? 79  LYS B O     1 
ATOM   7253  C  CB    . LYS D  3 79  ? -40.623 1.371   -31.843 1.00 59.16  ? 79  LYS B CB    1 
ATOM   7254  C  CG    . LYS D  3 79  ? -40.013 0.233   -31.045 1.00 63.73  ? 79  LYS B CG    1 
ATOM   7255  C  CD    . LYS D  3 79  ? -40.952 -0.951  -30.983 1.00 67.69  ? 79  LYS B CD    1 
ATOM   7256  C  CE    . LYS D  3 79  ? -41.397 -1.345  -32.379 1.00 77.19  ? 79  LYS B CE    1 
ATOM   7257  N  NZ    . LYS D  3 79  ? -40.234 -1.518  -33.299 1.00 73.99  ? 79  LYS B NZ    1 
ATOM   7258  N  N     . THR D  3 80  ? -40.313 4.769   -32.564 1.00 53.08  ? 80  THR B N     1 
ATOM   7259  C  CA    . THR D  3 80  ? -40.940 5.883   -33.255 1.00 58.28  ? 80  THR B CA    1 
ATOM   7260  C  C     . THR D  3 80  ? -39.892 6.909   -33.670 1.00 49.51  ? 80  THR B C     1 
ATOM   7261  O  O     . THR D  3 80  ? -39.242 7.532   -32.829 1.00 49.38  ? 80  THR B O     1 
ATOM   7262  C  CB    . THR D  3 80  ? -42.006 6.564   -32.371 1.00 59.21  ? 80  THR B CB    1 
ATOM   7263  O  OG1   . THR D  3 80  ? -42.887 5.571   -31.829 1.00 60.95  ? 80  THR B OG1   1 
ATOM   7264  C  CG2   . THR D  3 80  ? -42.807 7.579   -33.178 1.00 46.82  ? 80  THR B CG2   1 
ATOM   7265  N  N     . VAL D  3 81  ? -39.722 7.071   -34.974 1.00 44.13  ? 81  VAL B N     1 
ATOM   7266  C  CA    . VAL D  3 81  ? -38.823 8.089   -35.486 1.00 46.22  ? 81  VAL B CA    1 
ATOM   7267  C  C     . VAL D  3 81  ? -39.411 9.459   -35.187 1.00 45.85  ? 81  VAL B C     1 
ATOM   7268  O  O     . VAL D  3 81  ? -40.444 9.828   -35.741 1.00 45.15  ? 81  VAL B O     1 
ATOM   7269  C  CB    . VAL D  3 81  ? -38.589 7.933   -36.997 1.00 45.90  ? 81  VAL B CB    1 
ATOM   7270  C  CG1   . VAL D  3 81  ? -37.724 9.071   -37.521 1.00 47.64  ? 81  VAL B CG1   1 
ATOM   7271  C  CG2   . VAL D  3 81  ? -37.950 6.586   -37.294 1.00 43.48  ? 81  VAL B CG2   1 
ATOM   7272  N  N     . THR D  3 82  ? -38.765 10.205  -34.295 1.00 49.20  ? 82  THR B N     1 
ATOM   7273  C  CA    . THR D  3 82  ? -39.251 11.533  -33.916 1.00 47.27  ? 82  THR B CA    1 
ATOM   7274  C  C     . THR D  3 82  ? -38.705 12.612  -34.841 1.00 44.73  ? 82  THR B C     1 
ATOM   7275  O  O     . THR D  3 82  ? -37.724 12.391  -35.548 1.00 46.12  ? 82  THR B O     1 
ATOM   7276  C  CB    . THR D  3 82  ? -38.872 11.883  -32.469 1.00 45.76  ? 82  THR B CB    1 
ATOM   7277  O  OG1   . THR D  3 82  ? -37.446 11.998  -32.358 1.00 46.50  ? 82  THR B OG1   1 
ATOM   7278  C  CG2   . THR D  3 82  ? -39.378 10.808  -31.517 1.00 51.05  ? 82  THR B CG2   1 
ATOM   7279  N  N     . ALA D  3 83  ? -39.339 13.780  -34.834 1.00 48.01  ? 83  ALA B N     1 
ATOM   7280  C  CA    . ALA D  3 83  ? -38.894 14.877  -35.681 1.00 41.08  ? 83  ALA B CA    1 
ATOM   7281  C  C     . ALA D  3 83  ? -37.486 15.306  -35.294 1.00 39.82  ? 83  ALA B C     1 
ATOM   7282  O  O     . ALA D  3 83  ? -36.703 15.705  -36.150 1.00 42.65  ? 83  ALA B O     1 
ATOM   7283  C  CB    . ALA D  3 83  ? -39.848 16.041  -35.592 1.00 43.12  ? 83  ALA B CB    1 
ATOM   7284  N  N     . MET D  3 84  ? -37.160 15.209  -34.009 1.00 33.97  ? 84  MET B N     1 
ATOM   7285  C  CA    . MET D  3 84  ? -35.820 15.548  -33.550 1.00 37.65  ? 84  MET B CA    1 
ATOM   7286  C  C     . MET D  3 84  ? -34.770 14.609  -34.141 1.00 47.08  ? 84  MET B C     1 
ATOM   7287  O  O     . MET D  3 84  ? -33.659 15.043  -34.445 1.00 41.62  ? 84  MET B O     1 
ATOM   7288  C  CB    . MET D  3 84  ? -35.737 15.520  -32.024 1.00 36.88  ? 84  MET B CB    1 
ATOM   7289  C  CG    . MET D  3 84  ? -36.303 16.751  -31.347 1.00 45.17  ? 84  MET B CG    1 
ATOM   7290  S  SD    . MET D  3 84  ? -35.804 18.289  -32.148 1.00 55.18  ? 84  MET B SD    1 
ATOM   7291  C  CE    . MET D  3 84  ? -34.032 18.268  -31.878 1.00 49.55  ? 84  MET B CE    1 
ATOM   7292  N  N     . ASP D  3 85  ? -35.112 13.329  -34.292 1.00 40.13  ? 85  ASP B N     1 
ATOM   7293  C  CA    . ASP D  3 85  ? -34.194 12.375  -34.914 1.00 42.19  ? 85  ASP B CA    1 
ATOM   7294  C  C     . ASP D  3 85  ? -33.846 12.845  -36.318 1.00 41.96  ? 85  ASP B C     1 
ATOM   7295  O  O     . ASP D  3 85  ? -32.681 12.861  -36.717 1.00 48.21  ? 85  ASP B O     1 
ATOM   7296  C  CB    . ASP D  3 85  ? -34.799 10.967  -34.975 1.00 46.99  ? 85  ASP B CB    1 
ATOM   7297  C  CG    . ASP D  3 85  ? -34.875 10.296  -33.616 1.00 49.82  ? 85  ASP B CG    1 
ATOM   7298  O  OD1   . ASP D  3 85  ? -34.003 10.571  -32.759 1.00 49.21  ? 85  ASP B OD1   1 
ATOM   7299  O  OD2   . ASP D  3 85  ? -35.813 9.492   -33.413 1.00 42.99  ? 85  ASP B OD2   1 
ATOM   7300  N  N     . VAL D  3 86  ? -34.875 13.239  -37.058 1.00 40.82  ? 86  VAL B N     1 
ATOM   7301  C  CA    . VAL D  3 86  ? -34.707 13.730  -38.417 1.00 40.58  ? 86  VAL B CA    1 
ATOM   7302  C  C     . VAL D  3 86  ? -33.890 15.026  -38.447 1.00 40.60  ? 86  VAL B C     1 
ATOM   7303  O  O     . VAL D  3 86  ? -33.014 15.183  -39.290 1.00 42.23  ? 86  VAL B O     1 
ATOM   7304  C  CB    . VAL D  3 86  ? -36.072 13.950  -39.092 1.00 40.99  ? 86  VAL B CB    1 
ATOM   7305  C  CG1   . VAL D  3 86  ? -35.899 14.533  -40.484 1.00 42.73  ? 86  VAL B CG1   1 
ATOM   7306  C  CG2   . VAL D  3 86  ? -36.837 12.633  -39.153 1.00 37.14  ? 86  VAL B CG2   1 
ATOM   7307  N  N     . VAL D  3 87  ? -34.162 15.936  -37.516 1.00 38.72  ? 87  VAL B N     1 
ATOM   7308  C  CA    . VAL D  3 87  ? -33.435 17.201  -37.437 1.00 36.89  ? 87  VAL B CA    1 
ATOM   7309  C  C     . VAL D  3 87  ? -31.949 16.972  -37.136 1.00 38.73  ? 87  VAL B C     1 
ATOM   7310  O  O     . VAL D  3 87  ? -31.078 17.599  -37.742 1.00 40.01  ? 87  VAL B O     1 
ATOM   7311  C  CB    . VAL D  3 87  ? -34.054 18.133  -36.365 1.00 39.06  ? 87  VAL B CB    1 
ATOM   7312  C  CG1   . VAL D  3 87  ? -33.179 19.349  -36.125 1.00 31.51  ? 87  VAL B CG1   1 
ATOM   7313  C  CG2   . VAL D  3 87  ? -35.455 18.557  -36.778 1.00 33.63  ? 87  VAL B CG2   1 
ATOM   7314  N  N     . TYR D  3 88  ? -31.665 16.059  -36.214 1.00 40.13  ? 88  TYR B N     1 
ATOM   7315  C  CA    . TYR D  3 88  ? -30.294 15.711  -35.853 1.00 37.66  ? 88  TYR B CA    1 
ATOM   7316  C  C     . TYR D  3 88  ? -29.561 15.053  -37.019 1.00 40.16  ? 88  TYR B C     1 
ATOM   7317  O  O     . TYR D  3 88  ? -28.374 15.312  -37.255 1.00 43.79  ? 88  TYR B O     1 
ATOM   7318  C  CB    . TYR D  3 88  ? -30.283 14.778  -34.643 1.00 40.15  ? 88  TYR B CB    1 
ATOM   7319  C  CG    . TYR D  3 88  ? -30.633 15.443  -33.332 1.00 45.58  ? 88  TYR B CG    1 
ATOM   7320  C  CD1   . TYR D  3 88  ? -30.252 16.749  -33.070 1.00 52.19  ? 88  TYR B CD1   1 
ATOM   7321  C  CD2   . TYR D  3 88  ? -31.348 14.763  -32.355 1.00 49.31  ? 88  TYR B CD2   1 
ATOM   7322  C  CE1   . TYR D  3 88  ? -30.570 17.359  -31.871 1.00 55.21  ? 88  TYR B CE1   1 
ATOM   7323  C  CE2   . TYR D  3 88  ? -31.668 15.362  -31.154 1.00 50.76  ? 88  TYR B CE2   1 
ATOM   7324  C  CZ    . TYR D  3 88  ? -31.272 16.659  -30.916 1.00 55.47  ? 88  TYR B CZ    1 
ATOM   7325  O  OH    . TYR D  3 88  ? -31.589 17.267  -29.720 1.00 62.13  ? 88  TYR B OH    1 
ATOM   7326  N  N     . ALA D  3 89  ? -30.276 14.197  -37.747 1.00 41.59  ? 89  ALA B N     1 
ATOM   7327  C  CA    . ALA D  3 89  ? -29.706 13.517  -38.909 1.00 40.23  ? 89  ALA B CA    1 
ATOM   7328  C  C     . ALA D  3 89  ? -29.379 14.528  -39.994 1.00 40.54  ? 89  ALA B C     1 
ATOM   7329  O  O     . ALA D  3 89  ? -28.319 14.471  -40.614 1.00 37.34  ? 89  ALA B O     1 
ATOM   7330  C  CB    . ALA D  3 89  ? -30.662 12.459  -39.441 1.00 37.73  ? 89  ALA B CB    1 
ATOM   7331  N  N     . LEU D  3 90  ? -30.304 15.456  -40.212 1.00 39.35  ? 90  LEU B N     1 
ATOM   7332  C  CA    . LEU D  3 90  ? -30.113 16.518  -41.181 1.00 34.83  ? 90  LEU B CA    1 
ATOM   7333  C  C     . LEU D  3 90  ? -28.931 17.406  -40.795 1.00 42.16  ? 90  LEU B C     1 
ATOM   7334  O  O     . LEU D  3 90  ? -28.182 17.857  -41.664 1.00 37.67  ? 90  LEU B O     1 
ATOM   7335  C  CB    . LEU D  3 90  ? -31.387 17.346  -41.315 1.00 30.75  ? 90  LEU B CB    1 
ATOM   7336  C  CG    . LEU D  3 90  ? -32.510 16.672  -42.108 1.00 37.01  ? 90  LEU B CG    1 
ATOM   7337  C  CD1   . LEU D  3 90  ? -33.838 17.391  -41.915 1.00 28.54  ? 90  LEU B CD1   1 
ATOM   7338  C  CD2   . LEU D  3 90  ? -32.145 16.585  -43.584 1.00 32.18  ? 90  LEU B CD2   1 
ATOM   7339  N  N     . LYS D  3 91  ? -28.753 17.646  -39.498 1.00 39.63  ? 91  LYS B N     1 
ATOM   7340  C  CA    . LYS D  3 91  ? -27.619 18.446  -39.047 1.00 39.14  ? 91  LYS B CA    1 
ATOM   7341  C  C     . LYS D  3 91  ? -26.321 17.684  -39.284 1.00 40.73  ? 91  LYS B C     1 
ATOM   7342  O  O     . LYS D  3 91  ? -25.294 18.283  -39.594 1.00 46.55  ? 91  LYS B O     1 
ATOM   7343  C  CB    . LYS D  3 91  ? -27.757 18.830  -37.573 1.00 39.11  ? 91  LYS B CB    1 
ATOM   7344  C  CG    . LYS D  3 91  ? -26.704 19.824  -37.093 1.00 39.62  ? 91  LYS B CG    1 
ATOM   7345  C  CD    . LYS D  3 91  ? -27.091 20.435  -35.749 1.00 52.83  ? 91  LYS B CD    1 
ATOM   7346  C  CE    . LYS D  3 91  ? -25.959 21.265  -35.147 1.00 57.06  ? 91  LYS B CE    1 
ATOM   7347  N  NZ    . LYS D  3 91  ? -24.909 20.419  -34.498 1.00 47.92  ? 91  LYS B NZ    1 
ATOM   7348  N  N     . ARG D  3 92  ? -26.367 16.362  -39.149 1.00 41.49  ? 92  ARG B N     1 
ATOM   7349  C  CA    . ARG D  3 92  ? -25.196 15.549  -39.468 1.00 44.14  ? 92  ARG B CA    1 
ATOM   7350  C  C     . ARG D  3 92  ? -24.800 15.667  -40.938 1.00 45.03  ? 92  ARG B C     1 
ATOM   7351  O  O     . ARG D  3 92  ? -23.612 15.714  -41.254 1.00 52.53  ? 92  ARG B O     1 
ATOM   7352  C  CB    . ARG D  3 92  ? -25.440 14.078  -39.129 1.00 47.66  ? 92  ARG B CB    1 
ATOM   7353  C  CG    . ARG D  3 92  ? -25.001 13.683  -37.744 1.00 48.58  ? 92  ARG B CG    1 
ATOM   7354  C  CD    . ARG D  3 92  ? -24.512 12.248  -37.719 1.00 45.63  ? 92  ARG B CD    1 
ATOM   7355  N  NE    . ARG D  3 92  ? -23.145 12.130  -38.217 1.00 48.27  ? 92  ARG B NE    1 
ATOM   7356  C  CZ    . ARG D  3 92  ? -22.826 11.621  -39.401 1.00 53.83  ? 92  ARG B CZ    1 
ATOM   7357  N  NH1   . ARG D  3 92  ? -23.780 11.174  -40.210 1.00 54.56  ? 92  ARG B NH1   1 
ATOM   7358  N  NH2   . ARG D  3 92  ? -21.554 11.553  -39.775 1.00 49.05  ? 92  ARG B NH2   1 
ATOM   7359  N  N     . GLN D  3 93  ? -25.791 15.705  -41.831 1.00 38.40  ? 93  GLN B N     1 
ATOM   7360  C  CA    . GLN D  3 93  ? -25.530 15.772  -43.271 1.00 38.55  ? 93  GLN B CA    1 
ATOM   7361  C  C     . GLN D  3 93  ? -25.264 17.201  -43.744 1.00 39.22  ? 93  GLN B C     1 
ATOM   7362  O  O     . GLN D  3 93  ? -25.237 17.461  -44.945 1.00 32.46  ? 93  GLN B O     1 
ATOM   7363  C  CB    . GLN D  3 93  ? -26.703 15.195  -44.071 1.00 42.05  ? 93  GLN B CB    1 
ATOM   7364  C  CG    . GLN D  3 93  ? -27.268 13.898  -43.535 1.00 44.12  ? 93  GLN B CG    1 
ATOM   7365  C  CD    . GLN D  3 93  ? -26.466 12.692  -43.963 1.00 50.16  ? 93  GLN B CD    1 
ATOM   7366  O  OE1   . GLN D  3 93  ? -25.964 12.631  -45.086 1.00 53.88  ? 93  GLN B OE1   1 
ATOM   7367  N  NE2   . GLN D  3 93  ? -26.330 11.725  -43.063 1.00 43.46  ? 93  GLN B NE2   1 
ATOM   7368  N  N     . GLY D  3 94  ? -25.081 18.121  -42.799 1.00 37.96  ? 94  GLY B N     1 
ATOM   7369  C  CA    . GLY D  3 94  ? -24.865 19.520  -43.119 1.00 38.41  ? 94  GLY B CA    1 
ATOM   7370  C  C     . GLY D  3 94  ? -26.060 20.182  -43.784 1.00 41.79  ? 94  GLY B C     1 
ATOM   7371  O  O     . GLY D  3 94  ? -25.895 21.041  -44.649 1.00 45.01  ? 94  GLY B O     1 
ATOM   7372  N  N     . ARG D  3 95  ? -27.265 19.781  -43.386 1.00 41.23  ? 95  ARG B N     1 
ATOM   7373  C  CA    . ARG D  3 95  ? -28.486 20.354  -43.943 1.00 37.79  ? 95  ARG B CA    1 
ATOM   7374  C  C     . ARG D  3 95  ? -29.463 20.776  -42.852 1.00 39.04  ? 95  ARG B C     1 
ATOM   7375  O  O     . ARG D  3 95  ? -30.620 20.354  -42.854 1.00 38.62  ? 95  ARG B O     1 
ATOM   7376  C  CB    . ARG D  3 95  ? -29.167 19.366  -44.892 1.00 37.13  ? 95  ARG B CB    1 
ATOM   7377  C  CG    . ARG D  3 95  ? -28.369 19.080  -46.147 1.00 39.33  ? 95  ARG B CG    1 
ATOM   7378  C  CD    . ARG D  3 95  ? -29.271 18.747  -47.310 1.00 35.49  ? 95  ARG B CD    1 
ATOM   7379  N  NE    . ARG D  3 95  ? -30.081 19.895  -47.710 1.00 46.71  ? 95  ARG B NE    1 
ATOM   7380  C  CZ    . ARG D  3 95  ? -29.761 20.719  -48.700 1.00 41.57  ? 95  ARG B CZ    1 
ATOM   7381  N  NH1   . ARG D  3 95  ? -28.649 20.516  -49.393 1.00 42.82  ? 95  ARG B NH1   1 
ATOM   7382  N  NH2   . ARG D  3 95  ? -30.553 21.738  -49.001 1.00 39.66  ? 95  ARG B NH2   1 
ATOM   7383  N  N     . THR D  3 96  ? -28.984 21.626  -41.944 1.00 41.14  ? 96  THR B N     1 
ATOM   7384  C  CA    . THR D  3 96  ? -29.748 22.108  -40.795 1.00 32.96  ? 96  THR B CA    1 
ATOM   7385  C  C     . THR D  3 96  ? -31.148 22.589  -41.163 1.00 38.10  ? 96  THR B C     1 
ATOM   7386  O  O     . THR D  3 96  ? -31.307 23.446  -42.031 1.00 40.88  ? 96  THR B O     1 
ATOM   7387  C  CB    . THR D  3 96  ? -29.001 23.256  -40.093 1.00 30.26  ? 96  THR B CB    1 
ATOM   7388  O  OG1   . THR D  3 96  ? -27.723 22.791  -39.650 1.00 41.78  ? 96  THR B OG1   1 
ATOM   7389  C  CG2   . THR D  3 96  ? -29.782 23.766  -38.892 1.00 33.87  ? 96  THR B CG2   1 
ATOM   7390  N  N     . LEU D  3 97  ? -32.159 22.021  -40.508 1.00 39.38  ? 97  LEU B N     1 
ATOM   7391  C  CA    . LEU D  3 97  ? -33.546 22.441  -40.703 1.00 34.88  ? 97  LEU B CA    1 
ATOM   7392  C  C     . LEU D  3 97  ? -34.045 23.228  -39.493 1.00 39.30  ? 97  LEU B C     1 
ATOM   7393  O  O     . LEU D  3 97  ? -33.859 22.808  -38.349 1.00 41.11  ? 97  LEU B O     1 
ATOM   7394  C  CB    . LEU D  3 97  ? -34.441 21.225  -40.954 1.00 32.29  ? 97  LEU B CB    1 
ATOM   7395  C  CG    . LEU D  3 97  ? -35.937 21.402  -41.244 1.00 32.77  ? 97  LEU B CG    1 
ATOM   7396  C  CD1   . LEU D  3 97  ? -36.177 22.064  -42.586 1.00 29.94  ? 97  LEU B CD1   1 
ATOM   7397  C  CD2   . LEU D  3 97  ? -36.641 20.050  -41.196 1.00 37.45  ? 97  LEU B CD2   1 
ATOM   7398  N  N     . TYR D  3 98  ? -34.658 24.380  -39.753 1.00 39.71  ? 98  TYR B N     1 
ATOM   7399  C  CA    . TYR D  3 98  ? -35.299 25.175  -38.709 1.00 34.42  ? 98  TYR B CA    1 
ATOM   7400  C  C     . TYR D  3 98  ? -36.801 24.921  -38.693 1.00 40.79  ? 98  TYR B C     1 
ATOM   7401  O  O     . TYR D  3 98  ? -37.437 24.879  -39.746 1.00 41.42  ? 98  TYR B O     1 
ATOM   7402  C  CB    . TYR D  3 98  ? -35.056 26.668  -38.920 1.00 36.12  ? 98  TYR B CB    1 
ATOM   7403  C  CG    . TYR D  3 98  ? -33.681 27.184  -38.560 1.00 36.03  ? 98  TYR B CG    1 
ATOM   7404  C  CD1   . TYR D  3 98  ? -32.675 26.334  -38.131 1.00 37.30  ? 98  TYR B CD1   1 
ATOM   7405  C  CD2   . TYR D  3 98  ? -33.400 28.540  -38.641 1.00 33.47  ? 98  TYR B CD2   1 
ATOM   7406  C  CE1   . TYR D  3 98  ? -31.424 26.822  -37.801 1.00 35.76  ? 98  TYR B CE1   1 
ATOM   7407  C  CE2   . TYR D  3 98  ? -32.161 29.033  -38.315 1.00 37.98  ? 98  TYR B CE2   1 
ATOM   7408  C  CZ    . TYR D  3 98  ? -31.175 28.175  -37.895 1.00 39.61  ? 98  TYR B CZ    1 
ATOM   7409  O  OH    . TYR D  3 98  ? -29.937 28.684  -37.573 1.00 39.82  ? 98  TYR B OH    1 
ATOM   7410  N  N     . GLY D  3 99  ? -37.375 24.761  -37.504 1.00 47.03  ? 99  GLY B N     1 
ATOM   7411  C  CA    . GLY D  3 99  ? -38.821 24.717  -37.381 1.00 41.64  ? 99  GLY B CA    1 
ATOM   7412  C  C     . GLY D  3 99  ? -39.445 23.451  -36.826 1.00 49.46  ? 99  GLY B C     1 
ATOM   7413  O  O     . GLY D  3 99  ? -40.668 23.373  -36.703 1.00 50.30  ? 99  GLY B O     1 
ATOM   7414  N  N     . PHE D  3 100 ? -38.632 22.457  -36.479 1.00 42.84  ? 100 PHE B N     1 
ATOM   7415  C  CA    . PHE D  3 100 ? -39.196 21.214  -35.978 1.00 36.44  ? 100 PHE B CA    1 
ATOM   7416  C  C     . PHE D  3 100 ? -38.613 20.780  -34.634 1.00 48.56  ? 100 PHE B C     1 
ATOM   7417  O  O     . PHE D  3 100 ? -38.244 19.618  -34.453 1.00 52.86  ? 100 PHE B O     1 
ATOM   7418  C  CB    . PHE D  3 100 ? -39.022 20.105  -37.018 1.00 40.57  ? 100 PHE B CB    1 
ATOM   7419  C  CG    . PHE D  3 100 ? -39.889 20.275  -38.238 1.00 37.63  ? 100 PHE B CG    1 
ATOM   7420  C  CD1   . PHE D  3 100 ? -39.467 21.050  -39.306 1.00 40.55  ? 100 PHE B CD1   1 
ATOM   7421  C  CD2   . PHE D  3 100 ? -41.127 19.656  -38.320 1.00 37.78  ? 100 PHE B CD2   1 
ATOM   7422  C  CE1   . PHE D  3 100 ? -40.267 21.203  -40.433 1.00 43.66  ? 100 PHE B CE1   1 
ATOM   7423  C  CE2   . PHE D  3 100 ? -41.931 19.805  -39.443 1.00 37.15  ? 100 PHE B CE2   1 
ATOM   7424  C  CZ    . PHE D  3 100 ? -41.501 20.579  -40.499 1.00 37.49  ? 100 PHE B CZ    1 
ATOM   7425  N  N     . GLY D  3 101 ? -38.554 21.711  -33.687 1.00 49.20  ? 101 GLY B N     1 
ATOM   7426  C  CA    . GLY D  3 101 ? -38.201 21.381  -32.317 1.00 52.52  ? 101 GLY B CA    1 
ATOM   7427  C  C     . GLY D  3 101 ? -36.774 21.728  -31.942 1.00 70.69  ? 101 GLY B C     1 
ATOM   7428  O  O     . GLY D  3 101 ? -36.407 21.684  -30.765 1.00 79.55  ? 101 GLY B O     1 
ATOM   7429  N  N     . GLY D  3 102 ? -35.968 22.075  -32.942 1.00 66.33  ? 102 GLY B N     1 
ATOM   7430  C  CA    . GLY D  3 102 ? -34.579 22.434  -32.714 1.00 58.63  ? 102 GLY B CA    1 
ATOM   7431  C  C     . GLY D  3 102 ? -33.926 23.034  -33.946 1.00 64.71  ? 102 GLY B C     1 
ATOM   7432  O  O     . GLY D  3 102 ? -33.032 23.877  -33.846 1.00 62.03  ? 102 GLY B O     1 
ATOM   7433  O  OXT   . GLY D  3 102 ? -34.275 22.695  -35.078 1.00 66.14  ? 102 GLY B OXT   1 
ATOM   7434  N  N     . VAL E  4 14  ? 0.613   -5.653  -12.163 1.00 82.21  ? 14  VAL C N     1 
ATOM   7435  C  CA    . VAL E  4 14  ? 0.315   -4.547  -13.066 1.00 82.87  ? 14  VAL C CA    1 
ATOM   7436  C  C     . VAL E  4 14  ? -0.008  -5.063  -14.461 1.00 81.46  ? 14  VAL C C     1 
ATOM   7437  O  O     . VAL E  4 14  ? 0.800   -5.753  -15.083 1.00 79.11  ? 14  VAL C O     1 
ATOM   7438  C  CB    . VAL E  4 14  ? 1.488   -3.551  -13.153 1.00 85.80  ? 14  VAL C CB    1 
ATOM   7439  C  CG1   . VAL E  4 14  ? 1.155   -2.425  -14.119 1.00 79.49  ? 14  VAL C CG1   1 
ATOM   7440  C  CG2   . VAL E  4 14  ? 1.818   -2.995  -11.774 1.00 86.74  ? 14  VAL C CG2   1 
ATOM   7441  N  N     . LYS E  4 15  ? -1.195  -4.723  -14.949 1.00 78.26  ? 15  LYS C N     1 
ATOM   7442  C  CA    . LYS E  4 15  ? -1.650  -5.203  -16.244 1.00 74.67  ? 15  LYS C CA    1 
ATOM   7443  C  C     . LYS E  4 15  ? -2.188  -4.050  -17.084 1.00 66.37  ? 15  LYS C C     1 
ATOM   7444  O  O     . LYS E  4 15  ? -3.213  -3.452  -16.749 1.00 67.12  ? 15  LYS C O     1 
ATOM   7445  C  CB    . LYS E  4 15  ? -2.725  -6.280  -16.064 1.00 74.67  ? 15  LYS C CB    1 
ATOM   7446  C  CG    . LYS E  4 15  ? -2.847  -7.263  -17.219 1.00 69.52  ? 15  LYS C CG    1 
ATOM   7447  C  CD    . LYS E  4 15  ? -1.787  -8.349  -17.136 1.00 68.73  ? 15  LYS C CD    1 
ATOM   7448  C  CE    . LYS E  4 15  ? -2.147  -9.555  -17.999 1.00 77.74  ? 15  LYS C CE    1 
ATOM   7449  N  NZ    . LYS E  4 15  ? -2.232  -9.232  -19.456 1.00 63.70  ? 15  LYS C NZ    1 
ATOM   7450  N  N     . SER E  4 16  ? -1.483  -3.735  -18.167 1.00 60.92  ? 16  SER C N     1 
ATOM   7451  C  CA    . SER E  4 16  ? -1.943  -2.731  -19.122 1.00 52.28  ? 16  SER C CA    1 
ATOM   7452  C  C     . SER E  4 16  ? -3.359  -3.025  -19.586 1.00 55.11  ? 16  SER C C     1 
ATOM   7453  O  O     . SER E  4 16  ? -3.691  -4.168  -19.897 1.00 53.89  ? 16  SER C O     1 
ATOM   7454  C  CB    . SER E  4 16  ? -1.011  -2.669  -20.331 1.00 52.45  ? 16  SER C CB    1 
ATOM   7455  O  OG    . SER E  4 16  ? -1.730  -2.382  -21.520 1.00 44.95  ? 16  SER C OG    1 
ATOM   7456  N  N     . ARG E  4 17  ? -4.201  -1.998  -19.608 1.00 54.15  ? 17  ARG C N     1 
ATOM   7457  C  CA    . ARG E  4 17  ? -5.577  -2.146  -20.071 1.00 51.28  ? 17  ARG C CA    1 
ATOM   7458  C  C     . ARG E  4 17  ? -5.614  -2.472  -21.561 1.00 50.15  ? 17  ARG C C     1 
ATOM   7459  O  O     . ARG E  4 17  ? -6.491  -3.205  -22.032 1.00 48.20  ? 17  ARG C O     1 
ATOM   7460  C  CB    . ARG E  4 17  ? -6.377  -0.877  -19.781 1.00 53.96  ? 17  ARG C CB    1 
ATOM   7461  C  CG    . ARG E  4 17  ? -6.448  -0.528  -18.307 1.00 52.26  ? 17  ARG C CG    1 
ATOM   7462  C  CD    . ARG E  4 17  ? -7.782  0.098   -17.960 1.00 47.73  ? 17  ARG C CD    1 
ATOM   7463  N  NE    . ARG E  4 17  ? -7.789  1.536   -18.191 1.00 56.30  ? 17  ARG C NE    1 
ATOM   7464  C  CZ    . ARG E  4 17  ? -8.870  2.237   -18.522 1.00 50.96  ? 17  ARG C CZ    1 
ATOM   7465  N  NH1   . ARG E  4 17  ? -10.046 1.637   -18.678 1.00 54.30  ? 17  ARG C NH1   1 
ATOM   7466  N  NH2   . ARG E  4 17  ? -8.770  3.540   -18.703 1.00 39.42  ? 17  ARG C NH2   1 
ATOM   7467  N  N     . SER E  4 18  ? -4.652  -1.922  -22.295 1.00 48.01  ? 18  SER C N     1 
ATOM   7468  C  CA    . SER E  4 18  ? -4.476  -2.254  -23.697 1.00 44.84  ? 18  SER C CA    1 
ATOM   7469  C  C     . SER E  4 18  ? -4.271  -3.760  -23.837 1.00 47.94  ? 18  SER C C     1 
ATOM   7470  O  O     . SER E  4 18  ? -4.960  -4.425  -24.613 1.00 40.60  ? 18  SER C O     1 
ATOM   7471  C  CB    . SER E  4 18  ? -3.291  -1.490  -24.280 1.00 38.47  ? 18  SER C CB    1 
ATOM   7472  O  OG    . SER E  4 18  ? -3.368  -0.114  -23.954 1.00 44.06  ? 18  SER C OG    1 
ATOM   7473  N  N     . SER E  4 19  ? -3.330  -4.288  -23.061 1.00 51.88  ? 19  SER C N     1 
ATOM   7474  C  CA    . SER E  4 19  ? -3.064  -5.721  -23.037 1.00 47.92  ? 19  SER C CA    1 
ATOM   7475  C  C     . SER E  4 19  ? -4.336  -6.508  -22.757 1.00 46.83  ? 19  SER C C     1 
ATOM   7476  O  O     . SER E  4 19  ? -4.667  -7.447  -23.479 1.00 43.74  ? 19  SER C O     1 
ATOM   7477  C  CB    . SER E  4 19  ? -2.004  -6.053  -21.989 1.00 45.53  ? 19  SER C CB    1 
ATOM   7478  O  OG    . SER E  4 19  ? -1.794  -7.449  -21.916 1.00 50.51  ? 19  SER C OG    1 
ATOM   7479  N  N     . ARG E  4 20  ? -5.057  -6.106  -21.716 1.00 45.35  ? 20  ARG C N     1 
ATOM   7480  C  CA    . ARG E  4 20  ? -6.298  -6.769  -21.344 1.00 39.78  ? 20  ARG C CA    1 
ATOM   7481  C  C     . ARG E  4 20  ? -7.341  -6.697  -22.451 1.00 42.39  ? 20  ARG C C     1 
ATOM   7482  O  O     . ARG E  4 20  ? -8.255  -7.515  -22.495 1.00 45.63  ? 20  ARG C O     1 
ATOM   7483  C  CB    . ARG E  4 20  ? -6.864  -6.158  -20.066 1.00 42.38  ? 20  ARG C CB    1 
ATOM   7484  C  CG    . ARG E  4 20  ? -5.942  -6.253  -18.870 1.00 48.28  ? 20  ARG C CG    1 
ATOM   7485  C  CD    . ARG E  4 20  ? -6.598  -5.626  -17.665 1.00 46.87  ? 20  ARG C CD    1 
ATOM   7486  N  NE    . ARG E  4 20  ? -8.006  -6.003  -17.587 1.00 50.84  ? 20  ARG C NE    1 
ATOM   7487  C  CZ    . ARG E  4 20  ? -8.918  -5.333  -16.892 1.00 59.10  ? 20  ARG C CZ    1 
ATOM   7488  N  NH1   . ARG E  4 20  ? -8.568  -4.250  -16.208 1.00 56.30  ? 20  ARG C NH1   1 
ATOM   7489  N  NH2   . ARG E  4 20  ? -10.180 -5.745  -16.878 1.00 55.97  ? 20  ARG C NH2   1 
ATOM   7490  N  N     . ALA E  4 21  ? -7.210  -5.716  -23.340 1.00 45.29  ? 21  ALA C N     1 
ATOM   7491  C  CA    . ALA E  4 21  ? -8.150  -5.576  -24.450 1.00 45.76  ? 21  ALA C CA    1 
ATOM   7492  C  C     . ALA E  4 21  ? -7.592  -6.185  -25.734 1.00 40.91  ? 21  ALA C C     1 
ATOM   7493  O  O     . ALA E  4 21  ? -8.294  -6.299  -26.739 1.00 39.51  ? 21  ALA C O     1 
ATOM   7494  C  CB    . ALA E  4 21  ? -8.502  -4.110  -24.664 1.00 42.96  ? 21  ALA C CB    1 
ATOM   7495  N  N     . GLY E  4 22  ? -6.326  -6.583  -25.691 1.00 43.19  ? 22  GLY C N     1 
ATOM   7496  C  CA    . GLY E  4 22  ? -5.667  -7.152  -26.851 1.00 35.89  ? 22  GLY C CA    1 
ATOM   7497  C  C     . GLY E  4 22  ? -5.409  -6.105  -27.912 1.00 33.74  ? 22  GLY C C     1 
ATOM   7498  O  O     . GLY E  4 22  ? -5.594  -6.359  -29.101 1.00 35.41  ? 22  GLY C O     1 
ATOM   7499  N  N     . LEU E  4 23  ? -4.970  -4.927  -27.474 1.00 41.74  ? 23  LEU C N     1 
ATOM   7500  C  CA    . LEU E  4 23  ? -4.796  -3.776  -28.355 1.00 32.88  ? 23  LEU C CA    1 
ATOM   7501  C  C     . LEU E  4 23  ? -3.385  -3.198  -28.305 1.00 31.06  ? 23  LEU C C     1 
ATOM   7502  O  O     . LEU E  4 23  ? -2.711  -3.263  -27.280 1.00 31.02  ? 23  LEU C O     1 
ATOM   7503  C  CB    . LEU E  4 23  ? -5.801  -2.678  -27.996 1.00 36.16  ? 23  LEU C CB    1 
ATOM   7504  C  CG    . LEU E  4 23  ? -7.300  -2.957  -28.132 1.00 37.53  ? 23  LEU C CG    1 
ATOM   7505  C  CD1   . LEU E  4 23  ? -8.098  -1.693  -27.834 1.00 40.22  ? 23  LEU C CD1   1 
ATOM   7506  C  CD2   . LEU E  4 23  ? -7.631  -3.481  -29.520 1.00 32.48  ? 23  LEU C CD2   1 
ATOM   7507  N  N     . GLN E  4 24  ? -2.949  -2.620  -29.418 1.00 35.35  ? 24  GLN C N     1 
ATOM   7508  C  CA    . GLN E  4 24  ? -1.683  -1.905  -29.463 1.00 30.32  ? 24  GLN C CA    1 
ATOM   7509  C  C     . GLN E  4 24  ? -1.888  -0.457  -29.036 1.00 39.23  ? 24  GLN C C     1 
ATOM   7510  O  O     . GLN E  4 24  ? -1.035  0.134   -28.377 1.00 48.23  ? 24  GLN C O     1 
ATOM   7511  C  CB    . GLN E  4 24  ? -1.078  -1.964  -30.866 1.00 37.58  ? 24  GLN C CB    1 
ATOM   7512  C  CG    . GLN E  4 24  ? -0.945  -3.377  -31.435 1.00 40.46  ? 24  GLN C CG    1 
ATOM   7513  C  CD    . GLN E  4 24  ? 0.043   -4.228  -30.662 1.00 33.72  ? 24  GLN C CD    1 
ATOM   7514  O  OE1   . GLN E  4 24  ? 1.054   -3.733  -30.160 1.00 39.11  ? 24  GLN C OE1   1 
ATOM   7515  N  NE2   . GLN E  4 24  ? -0.256  -5.512  -30.545 1.00 29.45  ? 24  GLN C NE2   1 
ATOM   7516  N  N     . PHE E  4 25  ? -3.031  0.111   -29.411 1.00 37.74  ? 25  PHE C N     1 
ATOM   7517  C  CA    . PHE E  4 25  ? -3.342  1.499   -29.080 1.00 40.41  ? 25  PHE C CA    1 
ATOM   7518  C  C     . PHE E  4 25  ? -3.570  1.674   -27.577 1.00 45.81  ? 25  PHE C C     1 
ATOM   7519  O  O     . PHE E  4 25  ? -4.101  0.779   -26.919 1.00 45.02  ? 25  PHE C O     1 
ATOM   7520  C  CB    . PHE E  4 25  ? -4.559  1.972   -29.882 1.00 37.12  ? 25  PHE C CB    1 
ATOM   7521  C  CG    . PHE E  4 25  ? -4.198  2.625   -31.187 1.00 33.95  ? 25  PHE C CG    1 
ATOM   7522  C  CD1   . PHE E  4 25  ? -3.281  2.039   -32.036 1.00 31.75  ? 25  PHE C CD1   1 
ATOM   7523  C  CD2   . PHE E  4 25  ? -4.760  3.836   -31.554 1.00 38.55  ? 25  PHE C CD2   1 
ATOM   7524  C  CE1   . PHE E  4 25  ? -2.939  2.640   -33.229 1.00 33.95  ? 25  PHE C CE1   1 
ATOM   7525  C  CE2   . PHE E  4 25  ? -4.421  4.441   -32.747 1.00 33.09  ? 25  PHE C CE2   1 
ATOM   7526  C  CZ    . PHE E  4 25  ? -3.510  3.842   -33.585 1.00 35.09  ? 25  PHE C CZ    1 
ATOM   7527  N  N     . PRO E  4 26  ? -3.148  2.826   -27.025 1.00 44.31  ? 26  PRO C N     1 
ATOM   7528  C  CA    . PRO E  4 26  ? -3.140  3.046   -25.573 1.00 37.85  ? 26  PRO C CA    1 
ATOM   7529  C  C     . PRO E  4 26  ? -4.514  3.343   -24.992 1.00 43.40  ? 26  PRO C C     1 
ATOM   7530  O  O     . PRO E  4 26  ? -4.982  4.475   -25.083 1.00 47.40  ? 26  PRO C O     1 
ATOM   7531  C  CB    . PRO E  4 26  ? -2.218  4.252   -25.413 1.00 39.88  ? 26  PRO C CB    1 
ATOM   7532  C  CG    . PRO E  4 26  ? -2.368  4.996   -26.684 1.00 43.29  ? 26  PRO C CG    1 
ATOM   7533  C  CD    . PRO E  4 26  ? -2.564  3.964   -27.755 1.00 41.71  ? 26  PRO C CD    1 
ATOM   7534  N  N     . VAL E  4 27  ? -5.141  2.336   -24.390 1.00 42.15  ? 27  VAL C N     1 
ATOM   7535  C  CA    . VAL E  4 27  ? -6.477  2.485   -23.822 1.00 37.02  ? 27  VAL C CA    1 
ATOM   7536  C  C     . VAL E  4 27  ? -6.516  3.564   -22.733 1.00 40.61  ? 27  VAL C C     1 
ATOM   7537  O  O     . VAL E  4 27  ? -7.439  4.378   -22.697 1.00 44.79  ? 27  VAL C O     1 
ATOM   7538  C  CB    . VAL E  4 27  ? -6.989  1.137   -23.257 1.00 39.16  ? 27  VAL C CB    1 
ATOM   7539  C  CG1   . VAL E  4 27  ? -8.197  1.337   -22.365 1.00 42.17  ? 27  VAL C CG1   1 
ATOM   7540  C  CG2   . VAL E  4 27  ? -7.333  0.185   -24.393 1.00 36.61  ? 27  VAL C CG2   1 
ATOM   7541  N  N     . GLY E  4 28  ? -5.507  3.587   -21.867 1.00 44.12  ? 28  GLY C N     1 
ATOM   7542  C  CA    . GLY E  4 28  ? -5.446  4.563   -20.788 1.00 46.69  ? 28  GLY C CA    1 
ATOM   7543  C  C     . GLY E  4 28  ? -5.335  6.001   -21.270 1.00 48.77  ? 28  GLY C C     1 
ATOM   7544  O  O     . GLY E  4 28  ? -6.006  6.905   -20.758 1.00 46.53  ? 28  GLY C O     1 
ATOM   7545  N  N     . ARG E  4 29  ? -4.479  6.216   -22.260 1.00 48.32  ? 29  ARG C N     1 
ATOM   7546  C  CA    . ARG E  4 29  ? -4.334  7.538   -22.845 1.00 49.37  ? 29  ARG C CA    1 
ATOM   7547  C  C     . ARG E  4 29  ? -5.650  7.993   -23.461 1.00 45.45  ? 29  ARG C C     1 
ATOM   7548  O  O     . ARG E  4 29  ? -6.091  9.115   -23.225 1.00 47.77  ? 29  ARG C O     1 
ATOM   7549  C  CB    . ARG E  4 29  ? -3.226  7.558   -23.899 1.00 44.31  ? 29  ARG C CB    1 
ATOM   7550  C  CG    . ARG E  4 29  ? -2.976  8.940   -24.462 1.00 46.15  ? 29  ARG C CG    1 
ATOM   7551  C  CD    . ARG E  4 29  ? -1.863  8.943   -25.484 1.00 40.11  ? 29  ARG C CD    1 
ATOM   7552  N  NE    . ARG E  4 29  ? -0.549  8.859   -24.866 1.00 41.98  ? 29  ARG C NE    1 
ATOM   7553  C  CZ    . ARG E  4 29  ? 0.589   8.969   -25.541 1.00 47.63  ? 29  ARG C CZ    1 
ATOM   7554  N  NH1   . ARG E  4 29  ? 0.558   9.169   -26.850 1.00 44.63  ? 29  ARG C NH1   1 
ATOM   7555  N  NH2   . ARG E  4 29  ? 1.753   8.883   -24.912 1.00 49.59  ? 29  ARG C NH2   1 
ATOM   7556  N  N     . VAL E  4 30  ? -6.277  7.115   -24.241 1.00 40.76  ? 30  VAL C N     1 
ATOM   7557  C  CA    . VAL E  4 30  ? -7.558  7.426   -24.863 1.00 40.84  ? 30  VAL C CA    1 
ATOM   7558  C  C     . VAL E  4 30  ? -8.612  7.779   -23.809 1.00 44.91  ? 30  VAL C C     1 
ATOM   7559  O  O     . VAL E  4 30  ? -9.379  8.732   -23.993 1.00 51.06  ? 30  VAL C O     1 
ATOM   7560  C  CB    . VAL E  4 30  ? -8.062  6.257   -25.744 1.00 36.74  ? 30  VAL C CB    1 
ATOM   7561  C  CG1   . VAL E  4 30  ? -9.503  6.489   -26.190 1.00 32.97  ? 30  VAL C CG1   1 
ATOM   7562  C  CG2   . VAL E  4 30  ? -7.163  6.079   -26.951 1.00 30.72  ? 30  VAL C CG2   1 
ATOM   7563  N  N     . HIS E  4 31  ? -8.640  7.040   -22.699 1.00 43.26  ? 31  HIS C N     1 
ATOM   7564  C  CA    . HIS E  4 31  ? -9.563  7.370   -21.610 1.00 46.93  ? 31  HIS C CA    1 
ATOM   7565  C  C     . HIS E  4 31  ? -9.283  8.770   -21.067 1.00 50.84  ? 31  HIS C C     1 
ATOM   7566  O  O     . HIS E  4 31  ? -10.210 9.553   -20.836 1.00 50.60  ? 31  HIS C O     1 
ATOM   7567  C  CB    . HIS E  4 31  ? -9.481  6.351   -20.470 1.00 42.11  ? 31  HIS C CB    1 
ATOM   7568  C  CG    . HIS E  4 31  ? -10.663 6.383   -19.541 1.00 51.03  ? 31  HIS C CG    1 
ATOM   7569  N  ND1   . HIS E  4 31  ? -10.901 5.411   -18.603 1.00 48.07  ? 31  HIS C ND1   1 
ATOM   7570  C  CD2   . HIS E  4 31  ? -11.678 7.277   -19.432 1.00 55.78  ? 31  HIS C CD2   1 
ATOM   7571  C  CE1   . HIS E  4 31  ? -12.015 5.699   -17.941 1.00 47.38  ? 31  HIS C CE1   1 
ATOM   7572  N  NE2   . HIS E  4 31  ? -12.500 6.822   -18.426 1.00 56.87  ? 31  HIS C NE2   1 
ATOM   7573  N  N     . ARG E  4 32  ? -8.004  9.084   -20.871 1.00 48.94  ? 32  ARG C N     1 
ATOM   7574  C  CA    . ARG E  4 32  ? -7.627  10.401  -20.368 1.00 49.01  ? 32  ARG C CA    1 
ATOM   7575  C  C     . ARG E  4 32  ? -8.080  11.517  -21.307 1.00 56.10  ? 32  ARG C C     1 
ATOM   7576  O  O     . ARG E  4 32  ? -8.623  12.528  -20.857 1.00 55.60  ? 32  ARG C O     1 
ATOM   7577  C  CB    . ARG E  4 32  ? -6.118  10.495  -20.158 1.00 46.10  ? 32  ARG C CB    1 
ATOM   7578  C  CG    . ARG E  4 32  ? -5.690  11.785  -19.491 1.00 47.56  ? 32  ARG C CG    1 
ATOM   7579  C  CD    . ARG E  4 32  ? -4.201  12.023  -19.633 1.00 56.48  ? 32  ARG C CD    1 
ATOM   7580  N  NE    . ARG E  4 32  ? -3.866  12.595  -20.932 1.00 62.49  ? 32  ARG C NE    1 
ATOM   7581  C  CZ    . ARG E  4 32  ? -2.872  12.173  -21.706 1.00 63.12  ? 32  ARG C CZ    1 
ATOM   7582  N  NH1   . ARG E  4 32  ? -2.106  11.162  -21.322 1.00 58.11  ? 32  ARG C NH1   1 
ATOM   7583  N  NH2   . ARG E  4 32  ? -2.647  12.764  -22.871 1.00 68.12  ? 32  ARG C NH2   1 
ATOM   7584  N  N     . LEU E  4 33  ? -7.852  11.331  -22.606 1.00 50.26  ? 33  LEU C N     1 
ATOM   7585  C  CA    . LEU E  4 33  ? -8.232  12.331  -23.597 1.00 48.07  ? 33  LEU C CA    1 
ATOM   7586  C  C     . LEU E  4 33  ? -9.747  12.511  -23.613 1.00 48.29  ? 33  LEU C C     1 
ATOM   7587  O  O     . LEU E  4 33  ? -10.248 13.635  -23.770 1.00 50.15  ? 33  LEU C O     1 
ATOM   7588  C  CB    . LEU E  4 33  ? -7.720  11.946  -24.990 1.00 39.34  ? 33  LEU C CB    1 
ATOM   7589  C  CG    . LEU E  4 33  ? -6.199  11.920  -25.174 1.00 40.99  ? 33  LEU C CG    1 
ATOM   7590  C  CD1   . LEU E  4 33  ? -5.829  11.608  -26.614 1.00 39.15  ? 33  LEU C CD1   1 
ATOM   7591  C  CD2   . LEU E  4 33  ? -5.572  13.230  -24.738 1.00 39.90  ? 33  LEU C CD2   1 
ATOM   7592  N  N     . LEU E  4 34  ? -10.472 11.408  -23.438 1.00 44.79  ? 34  LEU C N     1 
ATOM   7593  C  CA    . LEU E  4 34  ? -11.925 11.477  -23.324 1.00 42.46  ? 34  LEU C CA    1 
ATOM   7594  C  C     . LEU E  4 34  ? -12.327 12.331  -22.123 1.00 47.78  ? 34  LEU C C     1 
ATOM   7595  O  O     . LEU E  4 34  ? -13.190 13.203  -22.234 1.00 50.20  ? 34  LEU C O     1 
ATOM   7596  C  CB    . LEU E  4 34  ? -12.534 10.079  -23.211 1.00 43.25  ? 34  LEU C CB    1 
ATOM   7597  C  CG    . LEU E  4 34  ? -12.686 9.255   -24.492 1.00 41.45  ? 34  LEU C CG    1 
ATOM   7598  C  CD1   . LEU E  4 34  ? -13.417 7.943   -24.206 1.00 36.48  ? 34  LEU C CD1   1 
ATOM   7599  C  CD2   . LEU E  4 34  ? -13.419 10.054  -25.558 1.00 31.13  ? 34  LEU C CD2   1 
ATOM   7600  N  N     . ARG E  4 35  ? -11.686 12.093  -20.981 1.00 52.23  ? 35  ARG C N     1 
ATOM   7601  C  CA    . ARG E  4 35  ? -11.966 12.877  -19.780 1.00 53.13  ? 35  ARG C CA    1 
ATOM   7602  C  C     . ARG E  4 35  ? -11.662 14.364  -19.973 1.00 49.32  ? 35  ARG C C     1 
ATOM   7603  O  O     . ARG E  4 35  ? -12.406 15.219  -19.494 1.00 53.37  ? 35  ARG C O     1 
ATOM   7604  C  CB    . ARG E  4 35  ? -11.172 12.341  -18.583 1.00 55.10  ? 35  ARG C CB    1 
ATOM   7605  C  CG    . ARG E  4 35  ? -11.707 11.035  -18.003 1.00 57.87  ? 35  ARG C CG    1 
ATOM   7606  C  CD    . ARG E  4 35  ? -11.096 10.734  -16.634 1.00 57.70  ? 35  ARG C CD    1 
ATOM   7607  N  NE    . ARG E  4 35  ? -9.719  10.256  -16.728 1.00 58.04  ? 35  ARG C NE    1 
ATOM   7608  C  CZ    . ARG E  4 35  ? -9.378  8.972   -16.734 1.00 65.26  ? 35  ARG C CZ    1 
ATOM   7609  N  NH1   . ARG E  4 35  ? -10.318 8.038   -16.653 1.00 64.97  ? 35  ARG C NH1   1 
ATOM   7610  N  NH2   . ARG E  4 35  ? -8.101  8.619   -16.824 1.00 58.73  ? 35  ARG C NH2   1 
ATOM   7611  N  N     . GLN E  4 36  ? -10.578 14.666  -20.681 1.00 45.42  ? 36  GLN C N     1 
ATOM   7612  C  CA    . GLN E  4 36  ? -10.116 16.045  -20.834 1.00 49.45  ? 36  GLN C CA    1 
ATOM   7613  C  C     . GLN E  4 36  ? -10.709 16.774  -22.039 1.00 49.17  ? 36  GLN C C     1 
ATOM   7614  O  O     . GLN E  4 36  ? -10.390 17.935  -22.278 1.00 51.04  ? 36  GLN C O     1 
ATOM   7615  C  CB    . GLN E  4 36  ? -8.590  16.080  -20.940 1.00 50.48  ? 36  GLN C CB    1 
ATOM   7616  C  CG    . GLN E  4 36  ? -7.863  15.809  -19.636 1.00 53.32  ? 36  GLN C CG    1 
ATOM   7617  C  CD    . GLN E  4 36  ? -6.356  15.869  -19.796 1.00 60.72  ? 36  GLN C CD    1 
ATOM   7618  O  OE1   . GLN E  4 36  ? -5.843  15.979  -20.912 1.00 58.86  ? 36  GLN C OE1   1 
ATOM   7619  N  NE2   . GLN E  4 36  ? -5.636  15.783  -18.682 1.00 70.15  ? 36  GLN C NE2   1 
ATOM   7620  N  N     . GLY E  4 37  ? -11.562 16.103  -22.802 1.00 50.75  ? 37  GLY C N     1 
ATOM   7621  C  CA    . GLY E  4 37  ? -12.085 16.707  -24.014 1.00 41.63  ? 37  GLY C CA    1 
ATOM   7622  C  C     . GLY E  4 37  ? -13.427 17.404  -23.893 1.00 42.25  ? 37  GLY C C     1 
ATOM   7623  O  O     . GLY E  4 37  ? -13.937 17.942  -24.881 1.00 42.11  ? 37  GLY C O     1 
ATOM   7624  N  N     . ASN E  4 38  ? -13.994 17.400  -22.689 1.00 45.58  ? 38  ASN C N     1 
ATOM   7625  C  CA    . ASN E  4 38  ? -15.312 17.982  -22.451 1.00 42.18  ? 38  ASN C CA    1 
ATOM   7626  C  C     . ASN E  4 38  ? -16.367 17.371  -23.357 1.00 40.68  ? 38  ASN C C     1 
ATOM   7627  O  O     . ASN E  4 38  ? -16.981 18.068  -24.163 1.00 45.95  ? 38  ASN C O     1 
ATOM   7628  C  CB    . ASN E  4 38  ? -15.281 19.501  -22.651 1.00 43.33  ? 38  ASN C CB    1 
ATOM   7629  C  CG    . ASN E  4 38  ? -14.181 20.169  -21.861 1.00 49.37  ? 38  ASN C CG    1 
ATOM   7630  O  OD1   . ASN E  4 38  ? -13.337 20.872  -22.421 1.00 49.50  ? 38  ASN C OD1   1 
ATOM   7631  N  ND2   . ASN E  4 38  ? -14.180 19.951  -20.551 1.00 50.37  ? 38  ASN C ND2   1 
ATOM   7632  N  N     . TYR E  4 39  ? -16.569 16.065  -23.237 1.00 41.64  ? 39  TYR C N     1 
ATOM   7633  C  CA    . TYR E  4 39  ? -17.567 15.386  -24.054 1.00 41.11  ? 39  TYR C CA    1 
ATOM   7634  C  C     . TYR E  4 39  ? -18.751 14.965  -23.201 1.00 35.13  ? 39  TYR C C     1 
ATOM   7635  O  O     . TYR E  4 39  ? -19.886 14.928  -23.669 1.00 38.48  ? 39  TYR C O     1 
ATOM   7636  C  CB    . TYR E  4 39  ? -16.956 14.175  -24.765 1.00 36.59  ? 39  TYR C CB    1 
ATOM   7637  C  CG    . TYR E  4 39  ? -15.830 14.525  -25.716 1.00 36.97  ? 39  TYR C CG    1 
ATOM   7638  C  CD1   . TYR E  4 39  ? -16.092 15.091  -26.961 1.00 34.18  ? 39  TYR C CD1   1 
ATOM   7639  C  CD2   . TYR E  4 39  ? -14.509 14.284  -25.373 1.00 34.17  ? 39  TYR C CD2   1 
ATOM   7640  C  CE1   . TYR E  4 39  ? -15.063 15.414  -27.831 1.00 32.45  ? 39  TYR C CE1   1 
ATOM   7641  C  CE2   . TYR E  4 39  ? -13.476 14.596  -26.242 1.00 37.61  ? 39  TYR C CE2   1 
ATOM   7642  C  CZ    . TYR E  4 39  ? -13.757 15.163  -27.464 1.00 33.01  ? 39  TYR C CZ    1 
ATOM   7643  O  OH    . TYR E  4 39  ? -12.723 15.472  -28.316 1.00 32.53  ? 39  TYR C OH    1 
ATOM   7644  N  N     . ALA E  4 40  ? -18.473 14.661  -21.939 1.00 32.99  ? 40  ALA C N     1 
ATOM   7645  C  CA    . ALA E  4 40  ? -19.505 14.237  -21.007 1.00 38.52  ? 40  ALA C CA    1 
ATOM   7646  C  C     . ALA E  4 40  ? -18.992 14.341  -19.579 1.00 41.36  ? 40  ALA C C     1 
ATOM   7647  O  O     . ALA E  4 40  ? -17.785 14.425  -19.350 1.00 41.65  ? 40  ALA C O     1 
ATOM   7648  C  CB    . ALA E  4 40  ? -19.952 12.811  -21.312 1.00 42.06  ? 40  ALA C CB    1 
ATOM   7649  N  N     . GLN E  4 41  ? -19.910 14.333  -18.620 1.00 42.05  ? 41  GLN C N     1 
ATOM   7650  C  CA    . GLN E  4 41  ? -19.529 14.406  -17.217 1.00 51.70  ? 41  GLN C CA    1 
ATOM   7651  C  C     . GLN E  4 41  ? -18.681 13.201  -16.813 1.00 56.25  ? 41  GLN C C     1 
ATOM   7652  O  O     . GLN E  4 41  ? -17.610 13.356  -16.227 1.00 62.96  ? 41  GLN C O     1 
ATOM   7653  C  CB    . GLN E  4 41  ? -20.770 14.513  -16.330 1.00 54.30  ? 41  GLN C CB    1 
ATOM   7654  C  CG    . GLN E  4 41  ? -21.365 15.912  -16.294 1.00 68.72  ? 41  GLN C CG    1 
ATOM   7655  C  CD    . GLN E  4 41  ? -20.367 16.950  -15.805 1.00 76.70  ? 41  GLN C CD    1 
ATOM   7656  O  OE1   . GLN E  4 41  ? -20.002 17.877  -16.535 1.00 66.66  ? 41  GLN C OE1   1 
ATOM   7657  N  NE2   . GLN E  4 41  ? -19.916 16.796  -14.563 1.00 73.05  ? 41  GLN C NE2   1 
ATOM   7658  N  N     . ARG E  4 42  ? -19.152 12.003  -17.139 1.00 49.03  ? 42  ARG C N     1 
ATOM   7659  C  CA    . ARG E  4 42  ? -18.407 10.792  -16.822 1.00 53.52  ? 42  ARG C CA    1 
ATOM   7660  C  C     . ARG E  4 42  ? -18.173 9.913   -18.055 1.00 55.30  ? 42  ARG C C     1 
ATOM   7661  O  O     . ARG E  4 42  ? -18.949 9.941   -19.015 1.00 47.49  ? 42  ARG C O     1 
ATOM   7662  C  CB    . ARG E  4 42  ? -19.126 9.994   -15.728 1.00 64.88  ? 42  ARG C CB    1 
ATOM   7663  C  CG    . ARG E  4 42  ? -20.638 10.149  -15.692 1.00 63.11  ? 42  ARG C CG    1 
ATOM   7664  C  CD    . ARG E  4 42  ? -21.258 9.182   -14.690 1.00 69.26  ? 42  ARG C CD    1 
ATOM   7665  N  NE    . ARG E  4 42  ? -20.880 9.479   -13.311 1.00 78.40  ? 42  ARG C NE    1 
ATOM   7666  C  CZ    . ARG E  4 42  ? -21.078 8.652   -12.288 1.00 81.91  ? 42  ARG C CZ    1 
ATOM   7667  N  NH1   . ARG E  4 42  ? -21.644 7.469   -12.489 1.00 77.80  ? 42  ARG C NH1   1 
ATOM   7668  N  NH2   . ARG E  4 42  ? -20.706 9.005   -11.065 1.00 86.00  ? 42  ARG C NH2   1 
ATOM   7669  N  N     . ILE E  4 43  ? -17.090 9.141   -18.023 1.00 52.06  ? 43  ILE C N     1 
ATOM   7670  C  CA    . ILE E  4 43  ? -16.748 8.259   -19.132 1.00 46.49  ? 43  ILE C CA    1 
ATOM   7671  C  C     . ILE E  4 43  ? -16.725 6.796   -18.708 1.00 45.28  ? 43  ILE C C     1 
ATOM   7672  O  O     . ILE E  4 43  ? -15.930 6.402   -17.854 1.00 49.53  ? 43  ILE C O     1 
ATOM   7673  C  CB    . ILE E  4 43  ? -15.379 8.610   -19.736 1.00 47.33  ? 43  ILE C CB    1 
ATOM   7674  C  CG1   . ILE E  4 43  ? -15.342 10.077  -20.168 1.00 45.78  ? 43  ILE C CG1   1 
ATOM   7675  C  CG2   . ILE E  4 43  ? -15.070 7.695   -20.908 1.00 37.56  ? 43  ILE C CG2   1 
ATOM   7676  C  CD1   . ILE E  4 43  ? -16.447 10.463  -21.127 1.00 44.87  ? 43  ILE C CD1   1 
ATOM   7677  N  N     . GLY E  4 44  ? -17.595 5.997   -19.319 1.00 44.98  ? 44  GLY C N     1 
ATOM   7678  C  CA    . GLY E  4 44  ? -17.640 4.569   -19.066 1.00 44.94  ? 44  GLY C CA    1 
ATOM   7679  C  C     . GLY E  4 44  ? -16.325 3.879   -19.379 1.00 46.45  ? 44  GLY C C     1 
ATOM   7680  O  O     . GLY E  4 44  ? -15.582 4.312   -20.259 1.00 43.52  ? 44  GLY C O     1 
ATOM   7681  N  N     . ALA E  4 45  ? -16.044 2.799   -18.657 1.00 41.63  ? 45  ALA C N     1 
ATOM   7682  C  CA    . ALA E  4 45  ? -14.774 2.093   -18.771 1.00 40.81  ? 45  ALA C CA    1 
ATOM   7683  C  C     . ALA E  4 45  ? -14.600 1.411   -20.130 1.00 42.87  ? 45  ALA C C     1 
ATOM   7684  O  O     . ALA E  4 45  ? -13.478 1.198   -20.592 1.00 43.75  ? 45  ALA C O     1 
ATOM   7685  C  CB    . ALA E  4 45  ? -14.650 1.074   -17.656 1.00 46.25  ? 45  ALA C CB    1 
ATOM   7686  N  N     . GLY E  4 46  ? -15.710 1.068   -20.767 1.00 35.60  ? 46  GLY C N     1 
ATOM   7687  C  CA    . GLY E  4 46  ? -15.654 0.409   -22.056 1.00 37.46  ? 46  GLY C CA    1 
ATOM   7688  C  C     . GLY E  4 46  ? -15.410 1.358   -23.216 1.00 41.25  ? 46  GLY C C     1 
ATOM   7689  O  O     . GLY E  4 46  ? -14.855 0.960   -24.243 1.00 37.72  ? 46  GLY C O     1 
ATOM   7690  N  N     . ALA E  4 47  ? -15.827 2.612   -23.060 1.00 40.96  ? 47  ALA C N     1 
ATOM   7691  C  CA    . ALA E  4 47  ? -15.705 3.589   -24.136 1.00 36.31  ? 47  ALA C CA    1 
ATOM   7692  C  C     . ALA E  4 47  ? -14.264 3.755   -24.632 1.00 34.35  ? 47  ALA C C     1 
ATOM   7693  O  O     . ALA E  4 47  ? -14.028 3.649   -25.831 1.00 33.16  ? 47  ALA C O     1 
ATOM   7694  C  CB    . ALA E  4 47  ? -16.279 4.934   -23.705 1.00 41.35  ? 47  ALA C CB    1 
ATOM   7695  N  N     . PRO E  4 48  ? -13.291 3.996   -23.731 1.00 31.48  ? 48  PRO C N     1 
ATOM   7696  C  CA    . PRO E  4 48  ? -11.937 4.147   -24.278 1.00 30.66  ? 48  PRO C CA    1 
ATOM   7697  C  C     . PRO E  4 48  ? -11.402 2.878   -24.932 1.00 34.75  ? 48  PRO C C     1 
ATOM   7698  O  O     . PRO E  4 48  ? -10.607 2.967   -25.870 1.00 35.84  ? 48  PRO C O     1 
ATOM   7699  C  CB    . PRO E  4 48  ? -11.101 4.504   -23.051 1.00 38.52  ? 48  PRO C CB    1 
ATOM   7700  C  CG    . PRO E  4 48  ? -11.866 3.962   -21.900 1.00 37.81  ? 48  PRO C CG    1 
ATOM   7701  C  CD    . PRO E  4 48  ? -13.300 4.136   -22.264 1.00 34.07  ? 48  PRO C CD    1 
ATOM   7702  N  N     . VAL E  4 49  ? -11.834 1.720   -24.440 1.00 34.61  ? 49  VAL C N     1 
ATOM   7703  C  CA    . VAL E  4 49  ? -11.452 0.441   -25.024 1.00 27.92  ? 49  VAL C CA    1 
ATOM   7704  C  C     . VAL E  4 49  ? -11.946 0.366   -26.463 1.00 30.64  ? 49  VAL C C     1 
ATOM   7705  O  O     . VAL E  4 49  ? -11.178 0.100   -27.397 1.00 30.22  ? 49  VAL C O     1 
ATOM   7706  C  CB    . VAL E  4 49  ? -12.024 -0.739  -24.206 1.00 39.01  ? 49  VAL C CB    1 
ATOM   7707  C  CG1   . VAL E  4 49  ? -11.844 -2.068  -24.947 1.00 37.77  ? 49  VAL C CG1   1 
ATOM   7708  C  CG2   . VAL E  4 49  ? -11.388 -0.787  -22.818 1.00 33.43  ? 49  VAL C CG2   1 
ATOM   7709  N  N     . TYR E  4 50  ? -13.236 0.629   -26.626 1.00 31.36  ? 50  TYR C N     1 
ATOM   7710  C  CA    . TYR E  4 50  ? -13.901 0.593   -27.920 1.00 30.02  ? 50  TYR C CA    1 
ATOM   7711  C  C     . TYR E  4 50  ? -13.300 1.595   -28.900 1.00 32.34  ? 50  TYR C C     1 
ATOM   7712  O  O     . TYR E  4 50  ? -13.042 1.272   -30.065 1.00 39.24  ? 50  TYR C O     1 
ATOM   7713  C  CB    . TYR E  4 50  ? -15.389 0.878   -27.734 1.00 33.47  ? 50  TYR C CB    1 
ATOM   7714  C  CG    . TYR E  4 50  ? -16.275 0.373   -28.843 1.00 33.10  ? 50  TYR C CG    1 
ATOM   7715  C  CD1   . TYR E  4 50  ? -16.162 0.870   -30.133 1.00 32.69  ? 50  TYR C CD1   1 
ATOM   7716  C  CD2   . TYR E  4 50  ? -17.244 -0.587  -28.595 1.00 33.55  ? 50  TYR C CD2   1 
ATOM   7717  C  CE1   . TYR E  4 50  ? -16.973 0.415   -31.144 1.00 35.11  ? 50  TYR C CE1   1 
ATOM   7718  C  CE2   . TYR E  4 50  ? -18.062 -1.049  -29.603 1.00 33.50  ? 50  TYR C CE2   1 
ATOM   7719  C  CZ    . TYR E  4 50  ? -17.923 -0.543  -30.873 1.00 36.30  ? 50  TYR C CZ    1 
ATOM   7720  O  OH    . TYR E  4 50  ? -18.737 -0.998  -31.881 1.00 46.31  ? 50  TYR C OH    1 
ATOM   7721  N  N     . LEU E  4 51  ? -13.092 2.818   -28.422 1.00 34.73  ? 51  LEU C N     1 
ATOM   7722  C  CA    . LEU E  4 51  ? -12.587 3.894   -29.262 1.00 31.30  ? 51  LEU C CA    1 
ATOM   7723  C  C     . LEU E  4 51  ? -11.169 3.596   -29.701 1.00 29.78  ? 51  LEU C C     1 
ATOM   7724  O  O     . LEU E  4 51  ? -10.859 3.699   -30.884 1.00 32.29  ? 51  LEU C O     1 
ATOM   7725  C  CB    . LEU E  4 51  ? -12.648 5.238   -28.531 1.00 32.22  ? 51  LEU C CB    1 
ATOM   7726  C  CG    . LEU E  4 51  ? -12.161 6.465   -29.308 1.00 33.47  ? 51  LEU C CG    1 
ATOM   7727  C  CD1   . LEU E  4 51  ? -12.828 6.572   -30.670 1.00 28.65  ? 51  LEU C CD1   1 
ATOM   7728  C  CD2   . LEU E  4 51  ? -12.406 7.724   -28.501 1.00 36.56  ? 51  LEU C CD2   1 
ATOM   7729  N  N     . ALA E  4 52  ? -10.312 3.213   -28.758 1.00 25.72  ? 52  ALA C N     1 
ATOM   7730  C  CA    . ALA E  4 52  ? -8.935  2.878   -29.110 1.00 30.75  ? 52  ALA C CA    1 
ATOM   7731  C  C     . ALA E  4 52  ? -8.890  1.700   -30.092 1.00 35.59  ? 52  ALA C C     1 
ATOM   7732  O  O     . ALA E  4 52  ? -8.073  1.687   -31.017 1.00 38.65  ? 52  ALA C O     1 
ATOM   7733  C  CB    . ALA E  4 52  ? -8.128  2.572   -27.871 1.00 29.79  ? 52  ALA C CB    1 
ATOM   7734  N  N     . ALA E  4 53  ? -9.777  0.724   -29.901 1.00 30.49  ? 53  ALA C N     1 
ATOM   7735  C  CA    . ALA E  4 53  ? -9.884  -0.394  -30.836 1.00 30.43  ? 53  ALA C CA    1 
ATOM   7736  C  C     . ALA E  4 53  ? -10.209 0.079   -32.248 1.00 33.32  ? 53  ALA C C     1 
ATOM   7737  O  O     . ALA E  4 53  ? -9.559  -0.336  -33.212 1.00 39.08  ? 53  ALA C O     1 
ATOM   7738  C  CB    . ALA E  4 53  ? -10.934 -1.382  -30.370 1.00 35.57  ? 53  ALA C CB    1 
ATOM   7739  N  N     . VAL E  4 54  ? -11.222 0.935   -32.368 1.00 32.29  ? 54  VAL C N     1 
ATOM   7740  C  CA    . VAL E  4 54  ? -11.621 1.463   -33.672 1.00 31.79  ? 54  VAL C CA    1 
ATOM   7741  C  C     . VAL E  4 54  ? -10.491 2.273   -34.322 1.00 31.02  ? 54  VAL C C     1 
ATOM   7742  O  O     . VAL E  4 54  ? -10.228 2.155   -35.527 1.00 29.35  ? 54  VAL C O     1 
ATOM   7743  C  CB    . VAL E  4 54  ? -12.883 2.338   -33.548 1.00 33.93  ? 54  VAL C CB    1 
ATOM   7744  C  CG1   . VAL E  4 54  ? -13.092 3.177   -34.797 1.00 28.32  ? 54  VAL C CG1   1 
ATOM   7745  C  CG2   . VAL E  4 54  ? -14.100 1.466   -33.266 1.00 31.14  ? 54  VAL C CG2   1 
ATOM   7746  N  N     . LEU E  4 55  ? -9.814  3.077   -33.510 1.00 26.60  ? 55  LEU C N     1 
ATOM   7747  C  CA    . LEU E  4 55  ? -8.734  3.917   -34.001 1.00 28.61  ? 55  LEU C CA    1 
ATOM   7748  C  C     . LEU E  4 55  ? -7.617  3.059   -34.552 1.00 33.76  ? 55  LEU C C     1 
ATOM   7749  O  O     . LEU E  4 55  ? -7.093  3.324   -35.642 1.00 32.59  ? 55  LEU C O     1 
ATOM   7750  C  CB    . LEU E  4 55  ? -8.212  4.831   -32.890 1.00 33.04  ? 55  LEU C CB    1 
ATOM   7751  C  CG    . LEU E  4 55  ? -9.200  5.917   -32.451 1.00 30.81  ? 55  LEU C CG    1 
ATOM   7752  C  CD1   . LEU E  4 55  ? -8.662  6.699   -31.272 1.00 33.06  ? 55  LEU C CD1   1 
ATOM   7753  C  CD2   . LEU E  4 55  ? -9.521  6.844   -33.611 1.00 23.11  ? 55  LEU C CD2   1 
ATOM   7754  N  N     . GLU E  4 56  ? -7.271  2.020   -33.797 1.00 36.03  ? 56  GLU C N     1 
ATOM   7755  C  CA    . GLU E  4 56  ? -6.245  1.072   -34.210 1.00 31.39  ? 56  GLU C CA    1 
ATOM   7756  C  C     . GLU E  4 56  ? -6.632  0.349   -35.495 1.00 29.93  ? 56  GLU C C     1 
ATOM   7757  O  O     . GLU E  4 56  ? -5.797  0.165   -36.384 1.00 31.31  ? 56  GLU C O     1 
ATOM   7758  C  CB    . GLU E  4 56  ? -5.983  0.055   -33.103 1.00 35.42  ? 56  GLU C CB    1 
ATOM   7759  C  CG    . GLU E  4 56  ? -5.008  -1.044  -33.495 1.00 31.37  ? 56  GLU C CG    1 
ATOM   7760  C  CD    . GLU E  4 56  ? -4.705  -1.982  -32.344 1.00 41.77  ? 56  GLU C CD    1 
ATOM   7761  O  OE1   . GLU E  4 56  ? -4.592  -1.495  -31.194 1.00 35.62  ? 56  GLU C OE1   1 
ATOM   7762  O  OE2   . GLU E  4 56  ? -4.585  -3.205  -32.594 1.00 45.37  ? 56  GLU C OE2   1 
ATOM   7763  N  N     . TYR E  4 57  ? -7.894  -0.061  -35.596 1.00 30.19  ? 57  TYR C N     1 
ATOM   7764  C  CA    . TYR E  4 57  ? -8.359  -0.731  -36.806 1.00 29.98  ? 57  TYR C CA    1 
ATOM   7765  C  C     . TYR E  4 57  ? -8.226  0.164   -38.039 1.00 36.40  ? 57  TYR C C     1 
ATOM   7766  O  O     . TYR E  4 57  ? -7.677  -0.263  -39.061 1.00 32.76  ? 57  TYR C O     1 
ATOM   7767  C  CB    . TYR E  4 57  ? -9.812  -1.185  -36.673 1.00 30.33  ? 57  TYR C CB    1 
ATOM   7768  C  CG    . TYR E  4 57  ? -10.431 -1.454  -38.027 1.00 34.20  ? 57  TYR C CG    1 
ATOM   7769  C  CD1   . TYR E  4 57  ? -9.970  -2.494  -38.828 1.00 37.90  ? 57  TYR C CD1   1 
ATOM   7770  C  CD2   . TYR E  4 57  ? -11.455 -0.656  -38.514 1.00 36.66  ? 57  TYR C CD2   1 
ATOM   7771  C  CE1   . TYR E  4 57  ? -10.518 -2.734  -40.074 1.00 41.69  ? 57  TYR C CE1   1 
ATOM   7772  C  CE2   . TYR E  4 57  ? -12.013 -0.888  -39.756 1.00 40.39  ? 57  TYR C CE2   1 
ATOM   7773  C  CZ    . TYR E  4 57  ? -11.540 -1.928  -40.534 1.00 47.90  ? 57  TYR C CZ    1 
ATOM   7774  O  OH    . TYR E  4 57  ? -12.096 -2.160  -41.775 1.00 47.96  ? 57  TYR C OH    1 
ATOM   7775  N  N     . LEU E  4 58  ? -8.740  1.394   -37.944 1.00 32.45  ? 58  LEU C N     1 
ATOM   7776  C  CA    . LEU E  4 58  ? -8.668  2.338   -39.057 1.00 24.68  ? 58  LEU C CA    1 
ATOM   7777  C  C     . LEU E  4 58  ? -7.221  2.628   -39.444 1.00 27.17  ? 58  LEU C C     1 
ATOM   7778  O  O     . LEU E  4 58  ? -6.877  2.665   -40.640 1.00 29.05  ? 58  LEU C O     1 
ATOM   7779  C  CB    . LEU E  4 58  ? -9.391  3.632   -38.708 1.00 28.33  ? 58  LEU C CB    1 
ATOM   7780  C  CG    . LEU E  4 58  ? -10.914 3.557   -38.687 1.00 30.07  ? 58  LEU C CG    1 
ATOM   7781  C  CD1   . LEU E  4 58  ? -11.495 4.807   -38.057 1.00 19.68  ? 58  LEU C CD1   1 
ATOM   7782  C  CD2   . LEU E  4 58  ? -11.449 3.369   -40.099 1.00 29.75  ? 58  LEU C CD2   1 
ATOM   7783  N  N     . THR E  4 59  ? -6.379  2.827   -38.432 1.00 22.98  ? 59  THR C N     1 
ATOM   7784  C  CA    . THR E  4 59  ? -4.949  2.995   -38.652 1.00 22.81  ? 59  THR C CA    1 
ATOM   7785  C  C     . THR E  4 59  ? -4.416  1.832   -39.477 1.00 27.19  ? 59  THR C C     1 
ATOM   7786  O  O     . THR E  4 59  ? -3.697  2.032   -40.457 1.00 28.29  ? 59  THR C O     1 
ATOM   7787  C  CB    . THR E  4 59  ? -4.172  3.072   -37.331 1.00 26.79  ? 59  THR C CB    1 
ATOM   7788  O  OG1   . THR E  4 59  ? -4.645  4.182   -36.559 1.00 29.94  ? 59  THR C OG1   1 
ATOM   7789  C  CG2   . THR E  4 59  ? -2.685  3.228   -37.592 1.00 23.55  ? 59  THR C CG2   1 
ATOM   7790  N  N     . ALA E  4 60  ? -4.798  0.618   -39.087 1.00 27.97  ? 60  ALA C N     1 
ATOM   7791  C  CA    . ALA E  4 60  ? -4.330  -0.592  -39.760 1.00 28.75  ? 60  ALA C CA    1 
ATOM   7792  C  C     . ALA E  4 60  ? -4.779  -0.638  -41.213 1.00 28.99  ? 60  ALA C C     1 
ATOM   7793  O  O     . ALA E  4 60  ? -4.006  -1.008  -42.090 1.00 25.64  ? 60  ALA C O     1 
ATOM   7794  C  CB    . ALA E  4 60  ? -4.813  -1.831  -39.022 1.00 30.53  ? 60  ALA C CB    1 
ATOM   7795  N  N     . GLU E  4 61  ? -6.030  -0.263  -41.458 1.00 28.69  ? 61  GLU C N     1 
ATOM   7796  C  CA    . GLU E  4 61  ? -6.573  -0.221  -42.811 1.00 29.26  ? 61  GLU C CA    1 
ATOM   7797  C  C     . GLU E  4 61  ? -5.821  0.770   -43.730 1.00 34.13  ? 61  GLU C C     1 
ATOM   7798  O  O     . GLU E  4 61  ? -5.379  0.391   -44.843 1.00 35.26  ? 61  GLU C O     1 
ATOM   7799  C  CB    . GLU E  4 61  ? -8.063  0.128   -42.756 1.00 31.93  ? 61  GLU C CB    1 
ATOM   7800  C  CG    . GLU E  4 61  ? -8.751  0.152   -44.109 1.00 44.14  ? 61  GLU C CG    1 
ATOM   7801  C  CD    . GLU E  4 61  ? -8.913  -1.235  -44.712 1.00 54.30  ? 61  GLU C CD    1 
ATOM   7802  O  OE1   . GLU E  4 61  ? -9.131  -2.196  -43.944 1.00 49.86  ? 61  GLU C OE1   1 
ATOM   7803  O  OE2   . GLU E  4 61  ? -8.824  -1.363  -45.954 1.00 54.62  ? 61  GLU C OE2   1 
ATOM   7804  N  N     . VAL E  4 62  ? -5.652  2.026   -43.298 1.00 23.56  ? 62  VAL C N     1 
ATOM   7805  C  CA    . VAL E  4 62  ? -4.990  2.945   -44.224 1.00 28.46  ? 62  VAL C CA    1 
ATOM   7806  C  C     . VAL E  4 62  ? -3.503  2.603   -44.322 1.00 26.46  ? 62  VAL C C     1 
ATOM   7807  O  O     . VAL E  4 62  ? -2.903  2.805   -45.377 1.00 27.11  ? 62  VAL C O     1 
ATOM   7808  C  CB    . VAL E  4 62  ? -5.182  4.470   -43.874 1.00 28.63  ? 62  VAL C CB    1 
ATOM   7809  C  CG1   . VAL E  4 62  ? -6.318  4.696   -42.889 1.00 30.21  ? 62  VAL C CG1   1 
ATOM   7810  C  CG2   . VAL E  4 62  ? -3.881  5.119   -43.402 1.00 22.95  ? 62  VAL C CG2   1 
ATOM   7811  N  N     . LEU E  4 63  ? -2.911  2.049   -43.266 1.00 24.36  ? 63  LEU C N     1 
ATOM   7812  C  CA    . LEU E  4 63  ? -1.506  1.637   -43.365 1.00 26.12  ? 63  LEU C CA    1 
ATOM   7813  C  C     . LEU E  4 63  ? -1.349  0.449   -44.314 1.00 28.77  ? 63  LEU C C     1 
ATOM   7814  O  O     . LEU E  4 63  ? -0.367  0.359   -45.032 1.00 33.25  ? 63  LEU C O     1 
ATOM   7815  C  CB    . LEU E  4 63  ? -0.924  1.295   -41.997 1.00 26.40  ? 63  LEU C CB    1 
ATOM   7816  C  CG    . LEU E  4 63  ? -0.422  2.500   -41.196 1.00 28.55  ? 63  LEU C CG    1 
ATOM   7817  C  CD1   . LEU E  4 63  ? 0.248   2.060   -39.913 1.00 27.34  ? 63  LEU C CD1   1 
ATOM   7818  C  CD2   . LEU E  4 63  ? 0.526   3.345   -42.030 1.00 29.33  ? 63  LEU C CD2   1 
ATOM   7819  N  N     . GLU E  4 64  ? -2.327  -0.450  -44.327 1.00 28.23  ? 64  GLU C N     1 
ATOM   7820  C  CA    . GLU E  4 64  ? -2.335  -1.565  -45.267 1.00 25.38  ? 64  GLU C CA    1 
ATOM   7821  C  C     . GLU E  4 64  ? -2.351  -1.060  -46.700 1.00 30.64  ? 64  GLU C C     1 
ATOM   7822  O  O     . GLU E  4 64  ? -1.458  -1.387  -47.497 1.00 37.33  ? 64  GLU C O     1 
ATOM   7823  C  CB    . GLU E  4 64  ? -3.540  -2.480  -45.010 1.00 27.58  ? 64  GLU C CB    1 
ATOM   7824  C  CG    . GLU E  4 64  ? -3.723  -3.599  -46.031 1.00 32.86  ? 64  GLU C CG    1 
ATOM   7825  C  CD    . GLU E  4 64  ? -2.801  -4.796  -45.797 1.00 35.41  ? 64  GLU C CD    1 
ATOM   7826  O  OE1   . GLU E  4 64  ? -1.913  -4.713  -44.927 1.00 37.18  ? 64  GLU C OE1   1 
ATOM   7827  O  OE2   . GLU E  4 64  ? -2.959  -5.824  -46.490 1.00 42.55  ? 64  GLU C OE2   1 
ATOM   7828  N  N     . LEU E  4 65  ? -3.350  -0.242  -47.029 1.00 38.89  ? 65  LEU C N     1 
ATOM   7829  C  CA    . LEU E  4 65  ? -3.451  0.281   -48.399 1.00 34.42  ? 65  LEU C CA    1 
ATOM   7830  C  C     . LEU E  4 65  ? -2.246  1.147   -48.811 1.00 32.85  ? 65  LEU C C     1 
ATOM   7831  O  O     . LEU E  4 65  ? -1.791  1.104   -49.967 1.00 37.40  ? 65  LEU C O     1 
ATOM   7832  C  CB    . LEU E  4 65  ? -4.741  1.080   -48.554 1.00 36.07  ? 65  LEU C CB    1 
ATOM   7833  C  CG    . LEU E  4 65  ? -6.029  0.271   -48.424 1.00 29.97  ? 65  LEU C CG    1 
ATOM   7834  C  CD1   . LEU E  4 65  ? -7.221  1.197   -48.465 1.00 38.52  ? 65  LEU C CD1   1 
ATOM   7835  C  CD2   . LEU E  4 65  ? -6.110  -0.749  -49.538 1.00 24.74  ? 65  LEU C CD2   1 
ATOM   7836  N  N     . ALA E  4 66  ? -1.731  1.929   -47.865 1.00 28.74  ? 66  ALA C N     1 
ATOM   7837  C  CA    . ALA E  4 66  ? -0.583  2.788   -48.132 1.00 31.86  ? 66  ALA C CA    1 
ATOM   7838  C  C     . ALA E  4 66  ? 0.666   1.951   -48.379 1.00 35.81  ? 66  ALA C C     1 
ATOM   7839  O  O     . ALA E  4 66  ? 1.405   2.195   -49.333 1.00 33.01  ? 66  ALA C O     1 
ATOM   7840  C  CB    . ALA E  4 66  ? -0.362  3.755   -46.984 1.00 30.62  ? 66  ALA C CB    1 
ATOM   7841  N  N     . GLY E  4 67  ? 0.891   0.961   -47.522 1.00 30.44  ? 67  GLY C N     1 
ATOM   7842  C  CA    . GLY E  4 67  ? 1.958   -0.001  -47.724 1.00 29.49  ? 67  GLY C CA    1 
ATOM   7843  C  C     . GLY E  4 67  ? 1.888   -0.641  -49.098 1.00 31.42  ? 67  GLY C C     1 
ATOM   7844  O  O     . GLY E  4 67  ? 2.923   -0.871  -49.744 1.00 36.50  ? 67  GLY C O     1 
ATOM   7845  N  N     . ASN E  4 68  ? 0.669   -0.924  -49.556 1.00 28.82  ? 68  ASN C N     1 
ATOM   7846  C  CA    . ASN E  4 68  ? 0.501   -1.425  -50.916 1.00 29.96  ? 68  ASN C CA    1 
ATOM   7847  C  C     . ASN E  4 68  ? 0.992   -0.400  -51.931 1.00 36.56  ? 68  ASN C C     1 
ATOM   7848  O  O     . ASN E  4 68  ? 1.688   -0.749  -52.890 1.00 33.79  ? 68  ASN C O     1 
ATOM   7849  C  CB    . ASN E  4 68  ? -0.958  -1.780  -51.209 1.00 34.52  ? 68  ASN C CB    1 
ATOM   7850  C  CG    . ASN E  4 68  ? -1.397  -3.082  -50.553 1.00 36.10  ? 68  ASN C CG    1 
ATOM   7851  O  OD1   . ASN E  4 68  ? -0.580  -3.854  -50.052 1.00 31.10  ? 68  ASN C OD1   1 
ATOM   7852  N  ND2   . ASN E  4 68  ? -2.700  -3.328  -50.560 1.00 34.74  ? 68  ASN C ND2   1 
ATOM   7853  N  N     . ALA E  4 69  ? 0.635   0.868   -51.719 1.00 36.12  ? 69  ALA C N     1 
ATOM   7854  C  CA    . ALA E  4 69  ? 1.039   1.916   -52.657 1.00 31.48  ? 69  ALA C CA    1 
ATOM   7855  C  C     . ALA E  4 69  ? 2.560   2.047   -52.709 1.00 35.81  ? 69  ALA C C     1 
ATOM   7856  O  O     . ALA E  4 69  ? 3.149   2.259   -53.772 1.00 34.60  ? 69  ALA C O     1 
ATOM   7857  C  CB    . ALA E  4 69  ? 0.408   3.238   -52.281 1.00 32.04  ? 69  ALA C CB    1 
ATOM   7858  N  N     . ALA E  4 70  ? 3.190   1.917   -51.550 1.00 32.77  ? 70  ALA C N     1 
ATOM   7859  C  CA    . ALA E  4 70  ? 4.634   1.988   -51.461 1.00 32.61  ? 70  ALA C CA    1 
ATOM   7860  C  C     . ALA E  4 70  ? 5.244   0.862   -52.274 1.00 40.91  ? 70  ALA C C     1 
ATOM   7861  O  O     . ALA E  4 70  ? 6.117   1.103   -53.106 1.00 43.90  ? 70  ALA C O     1 
ATOM   7862  C  CB    . ALA E  4 70  ? 5.089   1.917   -50.015 1.00 30.13  ? 70  ALA C CB    1 
ATOM   7863  N  N     . ARG E  4 71  ? 4.773   -0.364  -52.043 1.00 41.44  ? 71  ARG C N     1 
ATOM   7864  C  CA    . ARG E  4 71  ? 5.301   -1.509  -52.780 1.00 38.15  ? 71  ARG C CA    1 
ATOM   7865  C  C     . ARG E  4 71  ? 5.117   -1.364  -54.292 1.00 40.53  ? 71  ARG C C     1 
ATOM   7866  O  O     . ARG E  4 71  ? 6.028   -1.669  -55.056 1.00 43.99  ? 71  ARG C O     1 
ATOM   7867  C  CB    . ARG E  4 71  ? 4.650   -2.804  -52.311 1.00 41.35  ? 71  ARG C CB    1 
ATOM   7868  C  CG    . ARG E  4 71  ? 5.027   -4.007  -53.163 1.00 39.90  ? 71  ARG C CG    1 
ATOM   7869  C  CD    . ARG E  4 71  ? 4.380   -5.277  -52.662 1.00 50.50  ? 71  ARG C CD    1 
ATOM   7870  N  NE    . ARG E  4 71  ? 2.937   -5.123  -52.489 1.00 47.98  ? 71  ARG C NE    1 
ATOM   7871  C  CZ    . ARG E  4 71  ? 2.337   -5.034  -51.306 1.00 46.31  ? 71  ARG C CZ    1 
ATOM   7872  N  NH1   . ARG E  4 71  ? 3.050   -5.085  -50.184 1.00 45.29  ? 71  ARG C NH1   1 
ATOM   7873  N  NH2   . ARG E  4 71  ? 1.022   -4.894  -51.244 1.00 46.62  ? 71  ARG C NH2   1 
ATOM   7874  N  N     . ASP E  4 72  ? 3.948   -0.897  -54.721 1.00 42.17  ? 72  ASP C N     1 
ATOM   7875  C  CA    . ASP E  4 72  ? 3.702   -0.651  -56.144 1.00 42.20  ? 72  ASP C CA    1 
ATOM   7876  C  C     . ASP E  4 72  ? 4.684   0.364   -56.748 1.00 51.62  ? 72  ASP C C     1 
ATOM   7877  O  O     . ASP E  4 72  ? 4.986   0.309   -57.939 1.00 59.00  ? 72  ASP C O     1 
ATOM   7878  C  CB    . ASP E  4 72  ? 2.268   -0.163  -56.361 1.00 41.97  ? 72  ASP C CB    1 
ATOM   7879  C  CG    . ASP E  4 72  ? 1.233   -1.249  -56.108 1.00 54.50  ? 72  ASP C CG    1 
ATOM   7880  O  OD1   . ASP E  4 72  ? 1.562   -2.448  -56.260 1.00 47.69  ? 72  ASP C OD1   1 
ATOM   7881  O  OD2   . ASP E  4 72  ? 0.085   -0.898  -55.753 1.00 53.31  ? 72  ASP C OD2   1 
ATOM   7882  N  N     . ASN E  4 73  ? 5.175   1.290   -55.930 1.00 47.81  ? 73  ASN C N     1 
ATOM   7883  C  CA    . ASN E  4 73  ? 6.093   2.319   -56.410 1.00 53.69  ? 73  ASN C CA    1 
ATOM   7884  C  C     . ASN E  4 73  ? 7.566   2.011   -56.116 1.00 52.94  ? 73  ASN C C     1 
ATOM   7885  O  O     . ASN E  4 73  ? 8.408   2.912   -56.121 1.00 52.80  ? 73  ASN C O     1 
ATOM   7886  C  CB    . ASN E  4 73  ? 5.715   3.682   -55.809 1.00 55.55  ? 73  ASN C CB    1 
ATOM   7887  C  CG    . ASN E  4 73  ? 5.158   4.642   -56.840 1.00 55.31  ? 73  ASN C CG    1 
ATOM   7888  O  OD1   . ASN E  4 73  ? 5.918   5.278   -57.571 1.00 60.73  ? 73  ASN C OD1   1 
ATOM   7889  N  ND2   . ASN E  4 73  ? 3.830   4.761   -56.899 1.00 50.66  ? 73  ASN C ND2   1 
ATOM   7890  N  N     . LYS E  4 74  ? 7.863   0.735   -55.874 1.00 48.30  ? 74  LYS C N     1 
ATOM   7891  C  CA    . LYS E  4 74  ? 9.231   0.271   -55.614 1.00 48.11  ? 74  LYS C CA    1 
ATOM   7892  C  C     . LYS E  4 74  ? 9.838   0.905   -54.354 1.00 48.28  ? 74  LYS C C     1 
ATOM   7893  O  O     . LYS E  4 74  ? 11.054  1.012   -54.237 1.00 44.67  ? 74  LYS C O     1 
ATOM   7894  C  CB    . LYS E  4 74  ? 10.135  0.562   -56.821 1.00 59.10  ? 74  LYS C CB    1 
ATOM   7895  C  CG    . LYS E  4 74  ? 9.941   -0.374  -58.015 1.00 56.87  ? 74  LYS C CG    1 
ATOM   7896  C  CD    . LYS E  4 74  ? 10.544  0.216   -59.291 1.00 72.47  ? 74  LYS C CD    1 
ATOM   7897  C  CE    . LYS E  4 74  ? 10.618  1.752   -59.202 1.00 83.20  ? 74  LYS C CE    1 
ATOM   7898  N  NZ    . LYS E  4 74  ? 11.272  2.393   -60.381 1.00 74.88  ? 74  LYS C NZ    1 
ATOM   7899  N  N     . LYS E  4 75  ? 8.998   1.345   -53.423 1.00 44.45  ? 75  LYS C N     1 
ATOM   7900  C  CA    . LYS E  4 75  ? 9.471   2.062   -52.244 1.00 44.25  ? 75  LYS C CA    1 
ATOM   7901  C  C     . LYS E  4 75  ? 9.326   1.254   -50.959 1.00 44.05  ? 75  LYS C C     1 
ATOM   7902  O  O     . LYS E  4 75  ? 8.299   0.622   -50.722 1.00 52.65  ? 75  LYS C O     1 
ATOM   7903  C  CB    . LYS E  4 75  ? 8.712   3.380   -52.097 1.00 45.33  ? 75  LYS C CB    1 
ATOM   7904  C  CG    . LYS E  4 75  ? 8.798   4.291   -53.304 1.00 46.20  ? 75  LYS C CG    1 
ATOM   7905  C  CD    . LYS E  4 75  ? 10.220  4.784   -53.527 1.00 47.24  ? 75  LYS C CD    1 
ATOM   7906  C  CE    . LYS E  4 75  ? 10.351  5.498   -54.868 1.00 47.68  ? 75  LYS C CE    1 
ATOM   7907  N  NZ    . LYS E  4 75  ? 9.336   6.571   -55.040 1.00 49.71  ? 75  LYS C NZ    1 
ATOM   7908  N  N     . THR E  4 76  ? 10.355  1.301   -50.123 1.00 42.89  ? 76  THR C N     1 
ATOM   7909  C  CA    . THR E  4 76  ? 10.325  0.644   -48.825 1.00 38.82  ? 76  THR C CA    1 
ATOM   7910  C  C     . THR E  4 76  ? 9.552   1.495   -47.827 1.00 41.39  ? 76  THR C C     1 
ATOM   7911  O  O     . THR E  4 76  ? 8.828   0.983   -46.968 1.00 40.07  ? 76  THR C O     1 
ATOM   7912  C  CB    . THR E  4 76  ? 11.759  0.389   -48.298 1.00 43.80  ? 76  THR C CB    1 
ATOM   7913  O  OG1   . THR E  4 76  ? 12.257  -0.838  -48.837 1.00 52.77  ? 76  THR C OG1   1 
ATOM   7914  C  CG2   . THR E  4 76  ? 11.798  0.314   -46.770 1.00 37.26  ? 76  THR C CG2   1 
ATOM   7915  N  N     . ARG E  4 77  ? 9.707   2.807   -47.952 1.00 42.28  ? 77  ARG C N     1 
ATOM   7916  C  CA    . ARG E  4 77  ? 9.171   3.722   -46.958 1.00 39.16  ? 77  ARG C CA    1 
ATOM   7917  C  C     . ARG E  4 77  ? 7.931   4.471   -47.448 1.00 34.24  ? 77  ARG C C     1 
ATOM   7918  O  O     . ARG E  4 77  ? 7.947   5.117   -48.498 1.00 35.97  ? 77  ARG C O     1 
ATOM   7919  C  CB    . ARG E  4 77  ? 10.249  4.714   -46.534 1.00 37.01  ? 77  ARG C CB    1 
ATOM   7920  C  CG    . ARG E  4 77  ? 10.112  5.158   -45.104 1.00 44.20  ? 77  ARG C CG    1 
ATOM   7921  C  CD    . ARG E  4 77  ? 11.143  6.197   -44.748 1.00 50.14  ? 77  ARG C CD    1 
ATOM   7922  N  NE    . ARG E  4 77  ? 12.504  5.755   -45.022 1.00 53.87  ? 77  ARG C NE    1 
ATOM   7923  C  CZ    . ARG E  4 77  ? 13.348  6.402   -45.818 1.00 57.80  ? 77  ARG C CZ    1 
ATOM   7924  N  NH1   . ARG E  4 77  ? 12.965  7.520   -46.420 1.00 49.33  ? 77  ARG C NH1   1 
ATOM   7925  N  NH2   . ARG E  4 77  ? 14.572  5.932   -46.011 1.00 61.68  ? 77  ARG C NH2   1 
ATOM   7926  N  N     . ILE E  4 78  ? 6.859   4.367   -46.672 1.00 30.20  ? 78  ILE C N     1 
ATOM   7927  C  CA    . ILE E  4 78  ? 5.614   5.066   -46.956 1.00 34.58  ? 78  ILE C CA    1 
ATOM   7928  C  C     . ILE E  4 78  ? 5.786   6.583   -46.857 1.00 37.90  ? 78  ILE C C     1 
ATOM   7929  O  O     . ILE E  4 78  ? 6.337   7.097   -45.881 1.00 31.53  ? 78  ILE C O     1 
ATOM   7930  C  CB    . ILE E  4 78  ? 4.490   4.620   -45.992 1.00 31.66  ? 78  ILE C CB    1 
ATOM   7931  C  CG1   . ILE E  4 78  ? 4.104   3.163   -46.265 1.00 30.53  ? 78  ILE C CG1   1 
ATOM   7932  C  CG2   . ILE E  4 78  ? 3.281   5.536   -46.104 1.00 21.10  ? 78  ILE C CG2   1 
ATOM   7933  C  CD1   . ILE E  4 78  ? 3.055   2.613   -45.322 1.00 23.98  ? 78  ILE C CD1   1 
ATOM   7934  N  N     . THR E  4 79  ? 5.315   7.285   -47.884 1.00 34.89  ? 79  THR C N     1 
ATOM   7935  C  CA    . THR E  4 79  ? 5.351   8.739   -47.927 1.00 31.46  ? 79  THR C CA    1 
ATOM   7936  C  C     . THR E  4 79  ? 3.925   9.294   -47.913 1.00 34.22  ? 79  THR C C     1 
ATOM   7937  O  O     . THR E  4 79  ? 2.965   8.530   -48.035 1.00 33.36  ? 79  THR C O     1 
ATOM   7938  C  CB    . THR E  4 79  ? 6.094   9.231   -49.181 1.00 28.06  ? 79  THR C CB    1 
ATOM   7939  O  OG1   . THR E  4 79  ? 5.352   8.869   -50.353 1.00 26.48  ? 79  THR C OG1   1 
ATOM   7940  C  CG2   . THR E  4 79  ? 7.480   8.623   -49.245 1.00 25.56  ? 79  THR C CG2   1 
ATOM   7941  N  N     . PRO E  4 80  ? 3.773   10.621  -47.746 1.00 36.24  ? 80  PRO C N     1 
ATOM   7942  C  CA    . PRO E  4 80  ? 2.452   11.241  -47.923 1.00 27.47  ? 80  PRO C CA    1 
ATOM   7943  C  C     . PRO E  4 80  ? 1.802   10.914  -49.269 1.00 28.55  ? 80  PRO C C     1 
ATOM   7944  O  O     . PRO E  4 80  ? 0.575   10.814  -49.348 1.00 30.05  ? 80  PRO C O     1 
ATOM   7945  C  CB    . PRO E  4 80  ? 2.764   12.729  -47.817 1.00 26.73  ? 80  PRO C CB    1 
ATOM   7946  C  CG    . PRO E  4 80  ? 3.892   12.772  -46.823 1.00 29.55  ? 80  PRO C CG    1 
ATOM   7947  C  CD    . PRO E  4 80  ? 4.737   11.560  -47.138 1.00 31.03  ? 80  PRO C CD    1 
ATOM   7948  N  N     . ARG E  4 81  ? 2.617   10.742  -50.308 1.00 27.80  ? 81  ARG C N     1 
ATOM   7949  C  CA    . ARG E  4 81  ? 2.110   10.382  -51.630 1.00 25.61  ? 81  ARG C CA    1 
ATOM   7950  C  C     . ARG E  4 81  ? 1.412   9.022   -51.607 1.00 29.71  ? 81  ARG C C     1 
ATOM   7951  O  O     . ARG E  4 81  ? 0.306   8.869   -52.134 1.00 29.23  ? 81  ARG C O     1 
ATOM   7952  C  CB    . ARG E  4 81  ? 3.248   10.375  -52.650 1.00 18.18  ? 81  ARG C CB    1 
ATOM   7953  C  CG    . ARG E  4 81  ? 2.839   9.915   -54.028 1.00 20.25  ? 81  ARG C CG    1 
ATOM   7954  C  CD    . ARG E  4 81  ? 1.766   10.808  -54.632 1.00 24.48  ? 81  ARG C CD    1 
ATOM   7955  N  NE    . ARG E  4 81  ? 1.536   10.509  -56.043 1.00 25.62  ? 81  ARG C NE    1 
ATOM   7956  C  CZ    . ARG E  4 81  ? 0.596   11.085  -56.785 1.00 23.56  ? 81  ARG C CZ    1 
ATOM   7957  N  NH1   . ARG E  4 81  ? -0.197  11.997  -56.251 1.00 26.68  ? 81  ARG C NH1   1 
ATOM   7958  N  NH2   . ARG E  4 81  ? 0.452   10.755  -58.060 1.00 25.71  ? 81  ARG C NH2   1 
ATOM   7959  N  N     . HIS E  4 82  ? 2.057   8.040   -50.982 1.00 31.22  ? 82  HIS C N     1 
ATOM   7960  C  CA    . HIS E  4 82  ? 1.494   6.698   -50.881 1.00 29.89  ? 82  HIS C CA    1 
ATOM   7961  C  C     . HIS E  4 82  ? 0.186   6.724   -50.107 1.00 29.21  ? 82  HIS C C     1 
ATOM   7962  O  O     . HIS E  4 82  ? -0.767  6.034   -50.472 1.00 33.16  ? 82  HIS C O     1 
ATOM   7963  C  CB    . HIS E  4 82  ? 2.486   5.743   -50.218 1.00 26.55  ? 82  HIS C CB    1 
ATOM   7964  C  CG    . HIS E  4 82  ? 3.796   5.653   -50.933 1.00 25.96  ? 82  HIS C CG    1 
ATOM   7965  N  ND1   . HIS E  4 82  ? 5.006   5.678   -50.276 1.00 28.43  ? 82  HIS C ND1   1 
ATOM   7966  C  CD2   . HIS E  4 82  ? 4.083   5.556   -52.251 1.00 24.21  ? 82  HIS C CD2   1 
ATOM   7967  C  CE1   . HIS E  4 82  ? 5.985   5.595   -51.160 1.00 27.47  ? 82  HIS C CE1   1 
ATOM   7968  N  NE2   . HIS E  4 82  ? 5.452   5.519   -52.365 1.00 26.34  ? 82  HIS C NE2   1 
ATOM   7969  N  N     . LEU E  4 83  ? 0.143   7.531   -49.050 1.00 26.35  ? 83  LEU C N     1 
ATOM   7970  C  CA    . LEU E  4 83  ? -1.066  7.687   -48.250 1.00 24.89  ? 83  LEU C CA    1 
ATOM   7971  C  C     . LEU E  4 83  ? -2.202  8.263   -49.092 1.00 29.03  ? 83  LEU C C     1 
ATOM   7972  O  O     . LEU E  4 83  ? -3.338  7.773   -49.050 1.00 27.13  ? 83  LEU C O     1 
ATOM   7973  C  CB    . LEU E  4 83  ? -0.797  8.580   -47.041 1.00 20.04  ? 83  LEU C CB    1 
ATOM   7974  C  CG    . LEU E  4 83  ? 0.010   7.994   -45.881 1.00 22.52  ? 83  LEU C CG    1 
ATOM   7975  C  CD1   . LEU E  4 83  ? 0.511   9.088   -44.949 1.00 26.98  ? 83  LEU C CD1   1 
ATOM   7976  C  CD2   . LEU E  4 83  ? -0.843  7.030   -45.101 1.00 23.91  ? 83  LEU C CD2   1 
ATOM   7977  N  N     . GLN E  4 84  ? -1.889  9.300   -49.864 1.00 32.26  ? 84  GLN C N     1 
ATOM   7978  C  CA    . GLN E  4 84  ? -2.893  9.932   -50.712 1.00 25.59  ? 84  GLN C CA    1 
ATOM   7979  C  C     . GLN E  4 84  ? -3.439  8.952   -51.740 1.00 27.32  ? 84  GLN C C     1 
ATOM   7980  O  O     . GLN E  4 84  ? -4.651  8.816   -51.874 1.00 27.26  ? 84  GLN C O     1 
ATOM   7981  C  CB    . GLN E  4 84  ? -2.315  11.156  -51.415 1.00 23.88  ? 84  GLN C CB    1 
ATOM   7982  C  CG    . GLN E  4 84  ? -3.190  11.702  -52.534 1.00 26.61  ? 84  GLN C CG    1 
ATOM   7983  C  CD    . GLN E  4 84  ? -4.343  12.564  -52.042 1.00 30.90  ? 84  GLN C CD    1 
ATOM   7984  O  OE1   . GLN E  4 84  ? -4.852  12.388  -50.931 1.00 34.11  ? 84  GLN C OE1   1 
ATOM   7985  N  NE2   . GLN E  4 84  ? -4.758  13.507  -52.873 1.00 27.75  ? 84  GLN C NE2   1 
ATOM   7986  N  N     . LEU E  4 85  ? -2.547  8.276   -52.463 1.00 24.61  ? 85  LEU C N     1 
ATOM   7987  C  CA    . LEU E  4 85  ? -2.967  7.273   -53.442 1.00 29.26  ? 85  LEU C CA    1 
ATOM   7988  C  C     . LEU E  4 85  ? -3.828  6.175   -52.806 1.00 31.35  ? 85  LEU C C     1 
ATOM   7989  O  O     . LEU E  4 85  ? -4.833  5.758   -53.377 1.00 30.40  ? 85  LEU C O     1 
ATOM   7990  C  CB    . LEU E  4 85  ? -1.751  6.630   -54.114 1.00 31.79  ? 85  LEU C CB    1 
ATOM   7991  C  CG    . LEU E  4 85  ? -0.775  7.514   -54.885 1.00 28.30  ? 85  LEU C CG    1 
ATOM   7992  C  CD1   . LEU E  4 85  ? 0.461   6.708   -55.226 1.00 27.32  ? 85  LEU C CD1   1 
ATOM   7993  C  CD2   . LEU E  4 85  ? -1.415  8.071   -56.143 1.00 27.22  ? 85  LEU C CD2   1 
ATOM   7994  N  N     . ALA E  4 86  ? -3.420  5.711   -51.627 1.00 24.24  ? 86  ALA C N     1 
ATOM   7995  C  CA    . ALA E  4 86  ? -4.153  4.673   -50.911 1.00 26.22  ? 86  ALA C CA    1 
ATOM   7996  C  C     . ALA E  4 86  ? -5.567  5.116   -50.578 1.00 31.09  ? 86  ALA C C     1 
ATOM   7997  O  O     . ALA E  4 86  ? -6.527  4.370   -50.759 1.00 37.49  ? 86  ALA C O     1 
ATOM   7998  C  CB    . ALA E  4 86  ? -3.422  4.291   -49.640 1.00 27.00  ? 86  ALA C CB    1 
ATOM   7999  N  N     . ILE E  4 87  ? -5.679  6.338   -50.076 1.00 33.48  ? 87  ILE C N     1 
ATOM   8000  C  CA    . ILE E  4 87  ? -6.958  6.891   -49.654 1.00 33.83  ? 87  ILE C CA    1 
ATOM   8001  C  C     . ILE E  4 87  ? -7.890  7.208   -50.837 1.00 35.78  ? 87  ILE C C     1 
ATOM   8002  O  O     . ILE E  4 87  ? -9.041  6.773   -50.864 1.00 34.26  ? 87  ILE C O     1 
ATOM   8003  C  CB    . ILE E  4 87  ? -6.717  8.151   -48.799 1.00 31.79  ? 87  ILE C CB    1 
ATOM   8004  C  CG1   . ILE E  4 87  ? -6.177  7.720   -47.435 1.00 32.07  ? 87  ILE C CG1   1 
ATOM   8005  C  CG2   . ILE E  4 87  ? -7.986  8.978   -48.658 1.00 25.52  ? 87  ILE C CG2   1 
ATOM   8006  C  CD1   . ILE E  4 87  ? -5.603  8.823   -46.610 1.00 27.40  ? 87  ILE C CD1   1 
ATOM   8007  N  N     . ARG E  4 88  ? -7.389  7.941   -51.824 1.00 31.24  ? 88  ARG C N     1 
ATOM   8008  C  CA    . ARG E  4 88  ? -8.225  8.369   -52.937 1.00 31.07  ? 88  ARG C CA    1 
ATOM   8009  C  C     . ARG E  4 88  ? -8.654  7.204   -53.827 1.00 34.55  ? 88  ARG C C     1 
ATOM   8010  O  O     . ARG E  4 88  ? -9.666  7.290   -54.521 1.00 39.75  ? 88  ARG C O     1 
ATOM   8011  C  CB    . ARG E  4 88  ? -7.501  9.431   -53.772 1.00 22.84  ? 88  ARG C CB    1 
ATOM   8012  C  CG    . ARG E  4 88  ? -7.126  10.684  -52.982 1.00 29.75  ? 88  ARG C CG    1 
ATOM   8013  C  CD    . ARG E  4 88  ? -8.305  11.198  -52.159 1.00 28.01  ? 88  ARG C CD    1 
ATOM   8014  N  NE    . ARG E  4 88  ? -7.885  12.092  -51.085 1.00 21.67  ? 88  ARG C NE    1 
ATOM   8015  C  CZ    . ARG E  4 88  ? -8.662  12.458  -50.068 1.00 25.18  ? 88  ARG C CZ    1 
ATOM   8016  N  NH1   . ARG E  4 88  ? -9.905  11.999  -49.975 1.00 27.07  ? 88  ARG C NH1   1 
ATOM   8017  N  NH2   . ARG E  4 88  ? -8.195  13.277  -49.136 1.00 21.46  ? 88  ARG C NH2   1 
ATOM   8018  N  N     . ASN E  4 89  ? -7.897  6.112   -53.804 1.00 33.41  ? 89  ASN C N     1 
ATOM   8019  C  CA    . ASN E  4 89  ? -8.243  4.952   -54.623 1.00 31.85  ? 89  ASN C CA    1 
ATOM   8020  C  C     . ASN E  4 89  ? -9.209  4.016   -53.919 1.00 31.33  ? 89  ASN C C     1 
ATOM   8021  O  O     . ASN E  4 89  ? -9.702  3.066   -54.519 1.00 35.71  ? 89  ASN C O     1 
ATOM   8022  C  CB    . ASN E  4 89  ? -6.992  4.184   -55.027 1.00 27.17  ? 89  ASN C CB    1 
ATOM   8023  C  CG    . ASN E  4 89  ? -6.298  4.802   -56.212 1.00 32.31  ? 89  ASN C CG    1 
ATOM   8024  O  OD1   . ASN E  4 89  ? -6.944  5.221   -57.176 1.00 38.18  ? 89  ASN C OD1   1 
ATOM   8025  N  ND2   . ASN E  4 89  ? -4.974  4.871   -56.151 1.00 30.96  ? 89  ASN C ND2   1 
ATOM   8026  N  N     . ASP E  4 90  ? -9.480  4.298   -52.648 1.00 31.36  ? 90  ASP C N     1 
ATOM   8027  C  CA    . ASP E  4 90  ? -10.411 3.508   -51.854 1.00 26.78  ? 90  ASP C CA    1 
ATOM   8028  C  C     . ASP E  4 90  ? -11.689 4.281   -51.575 1.00 35.32  ? 90  ASP C C     1 
ATOM   8029  O  O     . ASP E  4 90  ? -11.666 5.236   -50.805 1.00 43.35  ? 90  ASP C O     1 
ATOM   8030  C  CB    . ASP E  4 90  ? -9.766  3.101   -50.534 1.00 32.35  ? 90  ASP C CB    1 
ATOM   8031  C  CG    . ASP E  4 90  ? -10.712 2.333   -49.645 1.00 43.25  ? 90  ASP C CG    1 
ATOM   8032  O  OD1   . ASP E  4 90  ? -10.862 1.113   -49.859 1.00 52.18  ? 90  ASP C OD1   1 
ATOM   8033  O  OD2   . ASP E  4 90  ? -11.314 2.950   -48.743 1.00 43.26  ? 90  ASP C OD2   1 
ATOM   8034  N  N     . GLU E  4 91  ? -12.797 3.863   -52.181 1.00 36.97  ? 91  GLU C N     1 
ATOM   8035  C  CA    . GLU E  4 91  ? -14.069 4.584   -52.074 1.00 33.15  ? 91  GLU C CA    1 
ATOM   8036  C  C     . GLU E  4 91  ? -14.435 4.965   -50.640 1.00 32.03  ? 91  GLU C C     1 
ATOM   8037  O  O     . GLU E  4 91  ? -14.829 6.100   -50.362 1.00 36.44  ? 91  GLU C O     1 
ATOM   8038  C  CB    . GLU E  4 91  ? -15.198 3.747   -52.675 1.00 38.82  ? 91  GLU C CB    1 
ATOM   8039  C  CG    . GLU E  4 91  ? -15.154 3.627   -54.190 1.00 51.95  ? 91  GLU C CG    1 
ATOM   8040  C  CD    . GLU E  4 91  ? -16.243 2.716   -54.729 1.00 65.66  ? 91  GLU C CD    1 
ATOM   8041  O  OE1   . GLU E  4 91  ? -17.145 2.347   -53.947 1.00 65.28  ? 91  GLU C OE1   1 
ATOM   8042  O  OE2   . GLU E  4 91  ? -16.193 2.365   -55.930 1.00 67.64  ? 91  GLU C OE2   1 
ATOM   8043  N  N     . GLU E  4 92  ? -14.288 4.020   -49.725 1.00 33.91  ? 92  GLU C N     1 
ATOM   8044  C  CA    . GLU E  4 92  ? -14.734 4.240   -48.360 1.00 37.65  ? 92  GLU C CA    1 
ATOM   8045  C  C     . GLU E  4 92  ? -13.838 5.221   -47.617 1.00 35.20  ? 92  GLU C C     1 
ATOM   8046  O  O     . GLU E  4 92  ? -14.326 6.161   -46.986 1.00 34.78  ? 92  GLU C O     1 
ATOM   8047  C  CB    . GLU E  4 92  ? -14.810 2.912   -47.616 1.00 32.63  ? 92  GLU C CB    1 
ATOM   8048  C  CG    . GLU E  4 92  ? -15.695 1.902   -48.315 1.00 34.02  ? 92  GLU C CG    1 
ATOM   8049  C  CD    . GLU E  4 92  ? -16.687 1.253   -47.377 1.00 45.88  ? 92  GLU C CD    1 
ATOM   8050  O  OE1   . GLU E  4 92  ? -16.400 1.199   -46.162 1.00 46.52  ? 92  GLU C OE1   1 
ATOM   8051  O  OE2   . GLU E  4 92  ? -17.753 0.803   -47.853 1.00 48.46  ? 92  GLU C OE2   1 
ATOM   8052  N  N     . LEU E  4 93  ? -12.529 5.010   -47.692 1.00 34.55  ? 93  LEU C N     1 
ATOM   8053  C  CA    . LEU E  4 93  ? -11.597 5.939   -47.074 1.00 31.99  ? 93  LEU C CA    1 
ATOM   8054  C  C     . LEU E  4 93  ? -11.657 7.301   -47.772 1.00 33.45  ? 93  LEU C C     1 
ATOM   8055  O  O     . LEU E  4 93  ? -11.556 8.343   -47.126 1.00 31.31  ? 93  LEU C O     1 
ATOM   8056  C  CB    . LEU E  4 93  ? -10.178 5.381   -47.104 1.00 30.20  ? 93  LEU C CB    1 
ATOM   8057  C  CG    . LEU E  4 93  ? -9.842  4.329   -46.046 1.00 31.22  ? 93  LEU C CG    1 
ATOM   8058  C  CD1   . LEU E  4 93  ? -8.414  3.841   -46.226 1.00 28.95  ? 93  LEU C CD1   1 
ATOM   8059  C  CD2   . LEU E  4 93  ? -10.046 4.877   -44.637 1.00 28.25  ? 93  LEU C CD2   1 
ATOM   8060  N  N     . ASN E  4 94  ? -11.834 7.292   -49.089 1.00 31.29  ? 94  ASN C N     1 
ATOM   8061  C  CA    . ASN E  4 94  ? -11.980 8.540   -49.815 1.00 30.79  ? 94  ASN C CA    1 
ATOM   8062  C  C     . ASN E  4 94  ? -13.166 9.337   -49.310 1.00 33.47  ? 94  ASN C C     1 
ATOM   8063  O  O     . ASN E  4 94  ? -13.091 10.555  -49.197 1.00 39.45  ? 94  ASN C O     1 
ATOM   8064  C  CB    . ASN E  4 94  ? -12.141 8.308   -51.313 1.00 34.88  ? 94  ASN C CB    1 
ATOM   8065  C  CG    . ASN E  4 94  ? -12.285 9.607   -52.076 1.00 33.63  ? 94  ASN C CG    1 
ATOM   8066  O  OD1   . ASN E  4 94  ? -11.479 10.520  -51.911 1.00 33.26  ? 94  ASN C OD1   1 
ATOM   8067  N  ND2   . ASN E  4 94  ? -13.321 9.707   -52.900 1.00 35.64  ? 94  ASN C ND2   1 
ATOM   8068  N  N     . LYS E  4 95  ? -14.264 8.651   -49.013 1.00 34.71  ? 95  LYS C N     1 
ATOM   8069  C  CA    . LYS E  4 95  ? -15.453 9.329   -48.512 1.00 32.23  ? 95  LYS C CA    1 
ATOM   8070  C  C     . LYS E  4 95  ? -15.258 9.796   -47.078 1.00 33.52  ? 95  LYS C C     1 
ATOM   8071  O  O     . LYS E  4 95  ? -15.690 10.884  -46.713 1.00 38.62  ? 95  LYS C O     1 
ATOM   8072  C  CB    . LYS E  4 95  ? -16.679 8.420   -48.604 1.00 37.21  ? 95  LYS C CB    1 
ATOM   8073  C  CG    . LYS E  4 95  ? -17.978 9.110   -48.210 1.00 39.17  ? 95  LYS C CG    1 
ATOM   8074  C  CD    . LYS E  4 95  ? -19.192 8.375   -48.762 1.00 56.83  ? 95  LYS C CD    1 
ATOM   8075  C  CE    . LYS E  4 95  ? -20.443 9.251   -48.717 1.00 72.54  ? 95  LYS C CE    1 
ATOM   8076  N  NZ    . LYS E  4 95  ? -21.475 8.815   -49.707 1.00 70.42  ? 95  LYS C NZ    1 
ATOM   8077  N  N     . LEU E  4 96  ? -14.614 8.966   -46.263 1.00 35.70  ? 96  LEU C N     1 
ATOM   8078  C  CA    . LEU E  4 96  ? -14.368 9.308   -44.866 1.00 30.86  ? 96  LEU C CA    1 
ATOM   8079  C  C     . LEU E  4 96  ? -13.517 10.566  -44.756 1.00 36.92  ? 96  LEU C C     1 
ATOM   8080  O  O     . LEU E  4 96  ? -13.696 11.383  -43.847 1.00 33.88  ? 96  LEU C O     1 
ATOM   8081  C  CB    . LEU E  4 96  ? -13.681 8.148   -44.146 1.00 28.57  ? 96  LEU C CB    1 
ATOM   8082  C  CG    . LEU E  4 96  ? -13.237 8.411   -42.705 1.00 32.04  ? 96  LEU C CG    1 
ATOM   8083  C  CD1   . LEU E  4 96  ? -14.436 8.699   -41.805 1.00 25.84  ? 96  LEU C CD1   1 
ATOM   8084  C  CD2   . LEU E  4 96  ? -12.430 7.236   -42.173 1.00 30.47  ? 96  LEU C CD2   1 
ATOM   8085  N  N     . LEU E  4 97  ? -12.593 10.710  -45.701 1.00 34.14  ? 97  LEU C N     1 
ATOM   8086  C  CA    . LEU E  4 97  ? -11.650 11.814  -45.707 1.00 31.29  ? 97  LEU C CA    1 
ATOM   8087  C  C     . LEU E  4 97  ? -11.852 12.687  -46.945 1.00 37.95  ? 97  LEU C C     1 
ATOM   8088  O  O     . LEU E  4 97  ? -10.893 13.227  -47.511 1.00 33.79  ? 97  LEU C O     1 
ATOM   8089  C  CB    . LEU E  4 97  ? -10.225 11.278  -45.653 1.00 25.35  ? 97  LEU C CB    1 
ATOM   8090  C  CG    . LEU E  4 97  ? -9.919  10.342  -44.484 1.00 28.04  ? 97  LEU C CG    1 
ATOM   8091  C  CD1   . LEU E  4 97  ? -8.550  9.698   -44.647 1.00 29.64  ? 97  LEU C CD1   1 
ATOM   8092  C  CD2   . LEU E  4 97  ? -9.995  11.091  -43.171 1.00 32.03  ? 97  LEU C CD2   1 
ATOM   8093  N  N     . GLY E  4 98  ? -13.111 12.826  -47.352 1.00 35.36  ? 98  GLY C N     1 
ATOM   8094  C  CA    . GLY E  4 98  ? -13.454 13.532  -48.574 1.00 35.78  ? 98  GLY C CA    1 
ATOM   8095  C  C     . GLY E  4 98  ? -13.309 15.035  -48.476 1.00 34.69  ? 98  GLY C C     1 
ATOM   8096  O  O     . GLY E  4 98  ? -13.428 15.743  -49.475 1.00 32.40  ? 98  GLY C O     1 
ATOM   8097  N  N     . ARG E  4 99  ? -13.063 15.526  -47.267 1.00 29.08  ? 99  ARG C N     1 
ATOM   8098  C  CA    . ARG E  4 99  ? -12.862 16.950  -47.064 1.00 29.86  ? 99  ARG C CA    1 
ATOM   8099  C  C     . ARG E  4 99  ? -11.593 17.191  -46.260 1.00 34.05  ? 99  ARG C C     1 
ATOM   8100  O  O     . ARG E  4 99  ? -11.448 18.207  -45.583 1.00 39.06  ? 99  ARG C O     1 
ATOM   8101  C  CB    . ARG E  4 99  ? -14.072 17.567  -46.373 1.00 26.74  ? 99  ARG C CB    1 
ATOM   8102  C  CG    . ARG E  4 99  ? -15.328 17.484  -47.205 1.00 32.11  ? 99  ARG C CG    1 
ATOM   8103  C  CD    . ARG E  4 99  ? -16.018 18.829  -47.307 1.00 51.64  ? 99  ARG C CD    1 
ATOM   8104  N  NE    . ARG E  4 99  ? -15.161 19.840  -47.919 1.00 58.07  ? 99  ARG C NE    1 
ATOM   8105  C  CZ    . ARG E  4 99  ? -15.402 21.146  -47.877 1.00 58.36  ? 99  ARG C CZ    1 
ATOM   8106  N  NH1   . ARG E  4 99  ? -16.477 21.607  -47.246 1.00 65.76  ? 99  ARG C NH1   1 
ATOM   8107  N  NH2   . ARG E  4 99  ? -14.569 21.992  -48.464 1.00 51.73  ? 99  ARG C NH2   1 
ATOM   8108  N  N     . VAL E  4 100 ? -10.675 16.239  -46.355 1.00 29.21  ? 100 VAL C N     1 
ATOM   8109  C  CA    . VAL E  4 100 ? -9.379  16.327  -45.704 1.00 24.93  ? 100 VAL C CA    1 
ATOM   8110  C  C     . VAL E  4 100 ? -8.299  16.581  -46.750 1.00 25.06  ? 100 VAL C C     1 
ATOM   8111  O  O     . VAL E  4 100 ? -8.373  16.054  -47.861 1.00 28.32  ? 100 VAL C O     1 
ATOM   8112  C  CB    . VAL E  4 100 ? -9.075  15.031  -44.921 1.00 31.00  ? 100 VAL C CB    1 
ATOM   8113  C  CG1   . VAL E  4 100 ? -7.582  14.845  -44.707 1.00 31.33  ? 100 VAL C CG1   1 
ATOM   8114  C  CG2   . VAL E  4 100 ? -9.819  15.026  -43.600 1.00 33.76  ? 100 VAL C CG2   1 
ATOM   8115  N  N     . THR E  4 101 ? -7.312  17.403  -46.414 1.00 23.69  ? 101 THR C N     1 
ATOM   8116  C  CA    . THR E  4 101 ? -6.203  17.648  -47.324 1.00 21.89  ? 101 THR C CA    1 
ATOM   8117  C  C     . THR E  4 101 ? -4.929  17.029  -46.784 1.00 25.12  ? 101 THR C C     1 
ATOM   8118  O  O     . THR E  4 101 ? -4.544  17.264  -45.639 1.00 28.00  ? 101 THR C O     1 
ATOM   8119  C  CB    . THR E  4 101 ? -5.987  19.153  -47.566 1.00 24.64  ? 101 THR C CB    1 
ATOM   8120  O  OG1   . THR E  4 101 ? -7.092  19.674  -48.315 1.00 35.28  ? 101 THR C OG1   1 
ATOM   8121  C  CG2   . THR E  4 101 ? -4.695  19.403  -48.339 1.00 18.80  ? 101 THR C CG2   1 
ATOM   8122  N  N     . ILE E  4 102 ? -4.281  16.229  -47.618 1.00 20.07  ? 102 ILE C N     1 
ATOM   8123  C  CA    . ILE E  4 102 ? -3.057  15.554  -47.222 1.00 24.11  ? 102 ILE C CA    1 
ATOM   8124  C  C     . ILE E  4 102 ? -1.857  16.290  -47.787 1.00 22.46  ? 102 ILE C C     1 
ATOM   8125  O  O     . ILE E  4 102 ? -1.629  16.284  -48.995 1.00 23.77  ? 102 ILE C O     1 
ATOM   8126  C  CB    . ILE E  4 102 ? -3.056  14.081  -47.692 1.00 29.52  ? 102 ILE C CB    1 
ATOM   8127  C  CG1   . ILE E  4 102 ? -4.045  13.261  -46.865 1.00 21.77  ? 102 ILE C CG1   1 
ATOM   8128  C  CG2   . ILE E  4 102 ? -1.669  13.468  -47.604 1.00 20.16  ? 102 ILE C CG2   1 
ATOM   8129  C  CD1   . ILE E  4 102 ? -4.207  11.887  -47.389 1.00 26.31  ? 102 ILE C CD1   1 
ATOM   8130  N  N     . ALA E  4 103 ? -1.102  16.937  -46.907 1.00 22.31  ? 103 ALA C N     1 
ATOM   8131  C  CA    . ALA E  4 103 ? 0.053   17.717  -47.324 1.00 26.35  ? 103 ALA C CA    1 
ATOM   8132  C  C     . ALA E  4 103 ? 1.052   16.846  -48.069 1.00 29.69  ? 103 ALA C C     1 
ATOM   8133  O  O     . ALA E  4 103 ? 1.335   15.727  -47.650 1.00 36.45  ? 103 ALA C O     1 
ATOM   8134  C  CB    . ALA E  4 103 ? 0.715   18.377  -46.122 1.00 25.87  ? 103 ALA C CB    1 
ATOM   8135  N  N     . GLN E  4 104 ? 1.573   17.373  -49.174 1.00 23.23  ? 104 GLN C N     1 
ATOM   8136  C  CA    . GLN E  4 104 ? 2.557   16.685  -50.009 1.00 27.66  ? 104 GLN C CA    1 
ATOM   8137  C  C     . GLN E  4 104 ? 2.020   15.385  -50.605 1.00 29.48  ? 104 GLN C C     1 
ATOM   8138  O  O     . GLN E  4 104 ? 2.785   14.493  -50.966 1.00 34.71  ? 104 GLN C O     1 
ATOM   8139  C  CB    . GLN E  4 104 ? 3.839   16.413  -49.220 1.00 25.73  ? 104 GLN C CB    1 
ATOM   8140  C  CG    . GLN E  4 104 ? 4.638   17.657  -48.859 1.00 37.26  ? 104 GLN C CG    1 
ATOM   8141  C  CD    . GLN E  4 104 ? 5.270   18.336  -50.070 1.00 53.88  ? 104 GLN C CD    1 
ATOM   8142  O  OE1   . GLN E  4 104 ? 4.585   18.976  -50.877 1.00 46.37  ? 104 GLN C OE1   1 
ATOM   8143  N  NE2   . GLN E  4 104 ? 6.587   18.203  -50.197 1.00 54.03  ? 104 GLN C NE2   1 
ATOM   8144  N  N     . GLY E  4 105 ? 0.702   15.299  -50.742 1.00 29.20  ? 105 GLY C N     1 
ATOM   8145  C  CA    . GLY E  4 105 ? 0.068   14.105  -51.266 1.00 24.01  ? 105 GLY C CA    1 
ATOM   8146  C  C     . GLY E  4 105 ? -0.179  14.116  -52.764 1.00 27.91  ? 105 GLY C C     1 
ATOM   8147  O  O     . GLY E  4 105 ? -0.305  13.054  -53.375 1.00 27.67  ? 105 GLY C O     1 
ATOM   8148  N  N     . GLY E  4 106 ? -0.246  15.302  -53.362 1.00 24.21  ? 106 GLY C N     1 
ATOM   8149  C  CA    . GLY E  4 106 ? -0.528  15.411  -54.783 1.00 17.58  ? 106 GLY C CA    1 
ATOM   8150  C  C     . GLY E  4 106 ? -1.922  14.917  -55.119 1.00 21.93  ? 106 GLY C C     1 
ATOM   8151  O  O     . GLY E  4 106 ? -2.805  14.911  -54.262 1.00 23.96  ? 106 GLY C O     1 
ATOM   8152  N  N     . VAL E  4 107 ? -2.122  14.501  -56.367 1.00 23.87  ? 107 VAL C N     1 
ATOM   8153  C  CA    . VAL E  4 107 ? -3.426  14.020  -56.820 1.00 22.43  ? 107 VAL C CA    1 
ATOM   8154  C  C     . VAL E  4 107 ? -3.320  12.691  -57.559 1.00 25.85  ? 107 VAL C C     1 
ATOM   8155  O  O     . VAL E  4 107 ? -2.221  12.254  -57.901 1.00 29.85  ? 107 VAL C O     1 
ATOM   8156  C  CB    . VAL E  4 107 ? -4.105  15.034  -57.755 1.00 27.72  ? 107 VAL C CB    1 
ATOM   8157  C  CG1   . VAL E  4 107 ? -4.350  16.356  -57.036 1.00 14.25  ? 107 VAL C CG1   1 
ATOM   8158  C  CG2   . VAL E  4 107 ? -3.275  15.224  -59.022 1.00 21.06  ? 107 VAL C CG2   1 
ATOM   8159  N  N     . LEU E  4 108 ? -4.459  12.047  -57.804 1.00 29.91  ? 108 LEU C N     1 
ATOM   8160  C  CA    . LEU E  4 108 ? -4.481  10.844  -58.639 1.00 26.00  ? 108 LEU C CA    1 
ATOM   8161  C  C     . LEU E  4 108 ? -4.314  11.237  -60.092 1.00 27.35  ? 108 LEU C C     1 
ATOM   8162  O  O     . LEU E  4 108 ? -4.984  12.161  -60.564 1.00 33.82  ? 108 LEU C O     1 
ATOM   8163  C  CB    . LEU E  4 108 ? -5.785  10.064  -58.476 1.00 19.70  ? 108 LEU C CB    1 
ATOM   8164  C  CG    . LEU E  4 108 ? -6.106  9.453   -57.118 1.00 24.55  ? 108 LEU C CG    1 
ATOM   8165  C  CD1   . LEU E  4 108 ? -7.356  8.605   -57.224 1.00 20.82  ? 108 LEU C CD1   1 
ATOM   8166  C  CD2   . LEU E  4 108 ? -4.933  8.634   -56.624 1.00 28.62  ? 108 LEU C CD2   1 
ATOM   8167  N  N     . PRO E  4 109 ? -3.401  10.563  -60.803 1.00 32.02  ? 109 PRO C N     1 
ATOM   8168  C  CA    . PRO E  4 109 ? -3.346  10.736  -62.258 1.00 27.84  ? 109 PRO C CA    1 
ATOM   8169  C  C     . PRO E  4 109 ? -4.726  10.520  -62.852 1.00 29.32  ? 109 PRO C C     1 
ATOM   8170  O  O     . PRO E  4 109 ? -5.335  9.484   -62.606 1.00 37.00  ? 109 PRO C O     1 
ATOM   8171  C  CB    . PRO E  4 109 ? -2.368  9.654   -62.702 1.00 25.83  ? 109 PRO C CB    1 
ATOM   8172  C  CG    . PRO E  4 109 ? -1.443  9.502   -61.521 1.00 33.21  ? 109 PRO C CG    1 
ATOM   8173  C  CD    . PRO E  4 109 ? -2.297  9.728   -60.296 1.00 28.55  ? 109 PRO C CD    1 
ATOM   8174  N  N     . ASN E  4 110 ? -5.228  11.511  -63.576 1.00 33.86  ? 110 ASN C N     1 
ATOM   8175  C  CA    . ASN E  4 110 ? -6.558  11.446  -64.161 1.00 29.47  ? 110 ASN C CA    1 
ATOM   8176  C  C     . ASN E  4 110 ? -6.706  12.507  -65.241 1.00 36.49  ? 110 ASN C C     1 
ATOM   8177  O  O     . ASN E  4 110 ? -6.620  13.702  -64.960 1.00 41.76  ? 110 ASN C O     1 
ATOM   8178  C  CB    . ASN E  4 110 ? -7.627  11.625  -63.081 1.00 36.91  ? 110 ASN C CB    1 
ATOM   8179  C  CG    . ASN E  4 110 ? -9.033  11.366  -63.595 1.00 43.01  ? 110 ASN C CG    1 
ATOM   8180  O  OD1   . ASN E  4 110 ? -9.220  10.854  -64.699 1.00 44.65  ? 110 ASN C OD1   1 
ATOM   8181  N  ND2   . ASN E  4 110 ? -10.030 11.710  -62.787 1.00 38.78  ? 110 ASN C ND2   1 
ATOM   8182  N  N     . ILE E  4 111 ? -6.910  12.061  -66.477 1.00 38.94  ? 111 ILE C N     1 
ATOM   8183  C  CA    . ILE E  4 111 ? -7.119  12.959  -67.605 1.00 33.25  ? 111 ILE C CA    1 
ATOM   8184  C  C     . ILE E  4 111 ? -8.449  12.657  -68.284 1.00 39.09  ? 111 ILE C C     1 
ATOM   8185  O  O     . ILE E  4 111 ? -8.670  11.545  -68.761 1.00 46.15  ? 111 ILE C O     1 
ATOM   8186  C  CB    . ILE E  4 111 ? -5.994  12.840  -68.650 1.00 33.61  ? 111 ILE C CB    1 
ATOM   8187  C  CG1   . ILE E  4 111 ? -4.621  13.038  -68.004 1.00 35.51  ? 111 ILE C CG1   1 
ATOM   8188  C  CG2   . ILE E  4 111 ? -6.200  13.847  -69.763 1.00 35.99  ? 111 ILE C CG2   1 
ATOM   8189  C  CD1   . ILE E  4 111 ? -3.464  12.892  -68.981 1.00 28.13  ? 111 ILE C CD1   1 
ATOM   8190  N  N     . GLN E  4 112 ? -9.334  13.647  -68.314 1.00 43.44  ? 112 GLN C N     1 
ATOM   8191  C  CA    . GLN E  4 112 ? -10.609 13.523  -69.006 1.00 32.01  ? 112 GLN C CA    1 
ATOM   8192  C  C     . GLN E  4 112 ? -10.383 13.047  -70.433 1.00 38.69  ? 112 GLN C C     1 
ATOM   8193  O  O     . GLN E  4 112 ? -9.581  13.630  -71.161 1.00 41.64  ? 112 GLN C O     1 
ATOM   8194  C  CB    . GLN E  4 112 ? -11.344 14.862  -69.010 1.00 35.02  ? 112 GLN C CB    1 
ATOM   8195  C  CG    . GLN E  4 112 ? -11.578 15.439  -67.635 1.00 35.52  ? 112 GLN C CG    1 
ATOM   8196  C  CD    . GLN E  4 112 ? -12.539 14.612  -66.818 1.00 37.74  ? 112 GLN C CD    1 
ATOM   8197  O  OE1   . GLN E  4 112 ? -13.710 14.463  -67.179 1.00 36.65  ? 112 GLN C OE1   1 
ATOM   8198  N  NE2   . GLN E  4 112 ? -12.054 14.068  -65.706 1.00 29.21  ? 112 GLN C NE2   1 
ATOM   8199  N  N     . ALA E  4 113 ? -11.093 11.990  -70.821 1.00 42.49  ? 113 ALA C N     1 
ATOM   8200  C  CA    . ALA E  4 113 ? -10.900 11.342  -72.118 1.00 37.36  ? 113 ALA C CA    1 
ATOM   8201  C  C     . ALA E  4 113 ? -10.951 12.310  -73.301 1.00 39.98  ? 113 ALA C C     1 
ATOM   8202  O  O     . ALA E  4 113 ? -10.194 12.158  -74.261 1.00 42.69  ? 113 ALA C O     1 
ATOM   8203  C  CB    . ALA E  4 113 ? -11.931 10.244  -72.302 1.00 29.79  ? 113 ALA C CB    1 
ATOM   8204  N  N     . VAL E  4 114 ? -11.826 13.311  -73.220 1.00 40.32  ? 114 VAL C N     1 
ATOM   8205  C  CA    . VAL E  4 114 ? -12.042 14.249  -74.324 1.00 38.05  ? 114 VAL C CA    1 
ATOM   8206  C  C     . VAL E  4 114 ? -10.814 15.124  -74.574 1.00 45.85  ? 114 VAL C C     1 
ATOM   8207  O  O     . VAL E  4 114 ? -10.755 15.866  -75.558 1.00 48.12  ? 114 VAL C O     1 
ATOM   8208  C  CB    . VAL E  4 114 ? -13.258 15.161  -74.052 1.00 43.99  ? 114 VAL C CB    1 
ATOM   8209  C  CG1   . VAL E  4 114 ? -12.886 16.264  -73.072 1.00 39.01  ? 114 VAL C CG1   1 
ATOM   8210  C  CG2   . VAL E  4 114 ? -13.792 15.756  -75.347 1.00 45.00  ? 114 VAL C CG2   1 
ATOM   8211  N  N     . LEU E  4 115 ? -9.829  15.033  -73.685 1.00 46.17  ? 115 LEU C N     1 
ATOM   8212  C  CA    . LEU E  4 115 ? -8.624  15.850  -73.798 1.00 45.95  ? 115 LEU C CA    1 
ATOM   8213  C  C     . LEU E  4 115 ? -7.499  15.132  -74.543 1.00 42.38  ? 115 LEU C C     1 
ATOM   8214  O  O     . LEU E  4 115 ? -6.457  15.722  -74.831 1.00 38.09  ? 115 LEU C O     1 
ATOM   8215  C  CB    . LEU E  4 115 ? -8.146  16.276  -72.411 1.00 40.49  ? 115 LEU C CB    1 
ATOM   8216  C  CG    . LEU E  4 115 ? -9.178  17.062  -71.606 1.00 40.85  ? 115 LEU C CG    1 
ATOM   8217  C  CD1   . LEU E  4 115 ? -8.558  17.599  -70.323 1.00 40.48  ? 115 LEU C CD1   1 
ATOM   8218  C  CD2   . LEU E  4 115 ? -9.774  18.185  -72.451 1.00 33.73  ? 115 LEU C CD2   1 
ATOM   8219  N  N     . LEU E  4 116 ? -7.724  13.863  -74.862 1.00 46.50  ? 116 LEU C N     1 
ATOM   8220  C  CA    . LEU E  4 116 ? -6.731  13.053  -75.554 1.00 46.19  ? 116 LEU C CA    1 
ATOM   8221  C  C     . LEU E  4 116 ? -6.821  13.244  -77.069 1.00 49.47  ? 116 LEU C C     1 
ATOM   8222  O  O     . LEU E  4 116 ? -7.885  13.566  -77.597 1.00 52.44  ? 116 LEU C O     1 
ATOM   8223  C  CB    . LEU E  4 116 ? -6.913  11.575  -75.188 1.00 45.35  ? 116 LEU C CB    1 
ATOM   8224  C  CG    . LEU E  4 116 ? -6.853  11.237  -73.694 1.00 45.13  ? 116 LEU C CG    1 
ATOM   8225  C  CD1   . LEU E  4 116 ? -7.139  9.769   -73.468 1.00 37.35  ? 116 LEU C CD1   1 
ATOM   8226  C  CD2   . LEU E  4 116 ? -5.508  11.616  -73.086 1.00 42.31  ? 116 LEU C CD2   1 
ATOM   8227  N  N     . PRO E  4 117 ? -5.694  13.048  -77.773 1.00 59.28  ? 117 PRO C N     1 
ATOM   8228  C  CA    . PRO E  4 117 ? -5.637  13.113  -79.241 1.00 60.71  ? 117 PRO C CA    1 
ATOM   8229  C  C     . PRO E  4 117 ? -6.525  12.059  -79.918 1.00 71.29  ? 117 PRO C C     1 
ATOM   8230  O  O     . PRO E  4 117 ? -6.732  10.986  -79.346 1.00 67.96  ? 117 PRO C O     1 
ATOM   8231  C  CB    . PRO E  4 117 ? -4.159  12.843  -79.548 1.00 52.96  ? 117 PRO C CB    1 
ATOM   8232  C  CG    . PRO E  4 117 ? -3.435  13.190  -78.288 1.00 43.98  ? 117 PRO C CG    1 
ATOM   8233  C  CD    . PRO E  4 117 ? -4.362  12.826  -77.181 1.00 48.77  ? 117 PRO C CD    1 
ATOM   8234  N  N     . LYS E  4 118 ? -7.013  12.365  -81.122 1.00 78.09  ? 118 LYS C N     1 
ATOM   8235  C  CA    . LYS E  4 118 ? -7.947  11.523  -81.888 1.00 88.19  ? 118 LYS C CA    1 
ATOM   8236  C  C     . LYS E  4 118 ? -9.156  11.129  -81.025 1.00 97.84  ? 118 LYS C C     1 
ATOM   8237  O  O     . LYS E  4 118 ? -10.160 11.842  -81.045 1.00 104.76 ? 118 LYS C O     1 
ATOM   8238  C  CB    . LYS E  4 118 ? -7.225  10.285  -82.466 1.00 84.43  ? 118 LYS C CB    1 
ATOM   8239  C  CG    . LYS E  4 118 ? -8.105  9.060   -82.749 1.00 91.67  ? 118 LYS C CG    1 
ATOM   8240  C  CD    . LYS E  4 118 ? -9.146  9.317   -83.839 1.00 98.57  ? 118 LYS C CD    1 
ATOM   8241  C  CE    . LYS E  4 118 ? -9.923  8.046   -84.160 1.00 100.02 ? 118 LYS C CE    1 
ATOM   8242  N  NZ    . LYS E  4 118 ? -10.865 7.683   -83.059 1.00 92.20  ? 118 LYS C NZ    1 
ATOM   8243  N  N     . ARG F  5 34  ? 7.671   18.171  -24.125 1.00 107.71 ? 33  ARG D N     1 
ATOM   8244  C  CA    . ARG F  5 34  ? 6.633   17.330  -23.531 1.00 97.82  ? 33  ARG D CA    1 
ATOM   8245  C  C     . ARG F  5 34  ? 5.471   17.064  -24.496 1.00 90.68  ? 33  ARG D C     1 
ATOM   8246  O  O     . ARG F  5 34  ? 4.316   17.210  -24.120 1.00 92.23  ? 33  ARG D O     1 
ATOM   8247  C  CB    . ARG F  5 34  ? 6.082   17.981  -22.257 1.00 106.78 ? 33  ARG D CB    1 
ATOM   8248  C  CG    . ARG F  5 34  ? 7.089   18.144  -21.136 1.00 127.40 ? 33  ARG D CG    1 
ATOM   8249  C  CD    . ARG F  5 34  ? 6.434   18.883  -19.996 1.00 124.63 ? 33  ARG D CD    1 
ATOM   8250  N  NE    . ARG F  5 34  ? 5.988   20.205  -20.430 1.00 112.00 ? 33  ARG D NE    1 
ATOM   8251  C  CZ    . ARG F  5 34  ? 5.272   21.040  -19.683 1.00 119.01 ? 33  ARG D CZ    1 
ATOM   8252  N  NH1   . ARG F  5 34  ? 4.894   20.669  -18.468 1.00 115.60 ? 33  ARG D NH1   1 
ATOM   8253  N  NH2   . ARG F  5 34  ? 4.914   22.234  -20.153 1.00 123.64 ? 33  ARG D NH2   1 
ATOM   8254  N  N     . LYS F  5 35  ? 5.753   16.723  -25.747 1.00 75.11  ? 34  LYS D N     1 
ATOM   8255  C  CA    . LYS F  5 35  ? 4.668   16.466  -26.686 1.00 79.91  ? 34  LYS D CA    1 
ATOM   8256  C  C     . LYS F  5 35  ? 4.509   14.973  -26.977 1.00 73.99  ? 34  LYS D C     1 
ATOM   8257  O  O     . LYS F  5 35  ? 5.430   14.306  -27.463 1.00 75.15  ? 34  LYS D O     1 
ATOM   8258  C  CB    . LYS F  5 35  ? 4.879   17.246  -27.988 1.00 78.43  ? 34  LYS D CB    1 
ATOM   8259  C  CG    . LYS F  5 35  ? 6.280   17.185  -28.565 1.00 86.48  ? 34  LYS D CG    1 
ATOM   8260  C  CD    . LYS F  5 35  ? 6.334   17.919  -29.908 1.00 93.65  ? 34  LYS D CD    1 
ATOM   8261  C  CE    . LYS F  5 35  ? 7.747   17.927  -30.480 1.00 92.34  ? 34  LYS D CE    1 
ATOM   8262  N  NZ    . LYS F  5 35  ? 8.714   18.647  -29.601 1.00 86.23  ? 34  LYS D NZ    1 
ATOM   8263  N  N     . GLU F  5 36  ? 3.320   14.459  -26.688 1.00 61.93  ? 35  GLU D N     1 
ATOM   8264  C  CA    . GLU F  5 36  ? 3.036   13.050  -26.913 1.00 58.41  ? 35  GLU D CA    1 
ATOM   8265  C  C     . GLU F  5 36  ? 2.247   12.845  -28.202 1.00 52.40  ? 35  GLU D C     1 
ATOM   8266  O  O     . GLU F  5 36  ? 1.516   13.728  -28.645 1.00 54.33  ? 35  GLU D O     1 
ATOM   8267  C  CB    . GLU F  5 36  ? 2.272   12.461  -25.727 1.00 47.46  ? 35  GLU D CB    1 
ATOM   8268  C  CG    . GLU F  5 36  ? 0.832   12.906  -25.661 1.00 47.95  ? 35  GLU D CG    1 
ATOM   8269  C  CD    . GLU F  5 36  ? 0.123   12.392  -24.432 1.00 56.38  ? 35  GLU D CD    1 
ATOM   8270  O  OE1   . GLU F  5 36  ? 0.806   12.058  -23.440 1.00 48.72  ? 35  GLU D OE1   1 
ATOM   8271  O  OE2   . GLU F  5 36  ? -1.122  12.304  -24.467 1.00 60.93  ? 35  GLU D OE2   1 
ATOM   8272  N  N     . SER F  5 37  ? 2.406   11.670  -28.800 1.00 49.49  ? 36  SER D N     1 
ATOM   8273  C  CA    . SER F  5 37  ? 1.725   11.343  -30.042 1.00 41.84  ? 36  SER D CA    1 
ATOM   8274  C  C     . SER F  5 37  ? 1.372   9.862   -30.087 1.00 40.14  ? 36  SER D C     1 
ATOM   8275  O  O     . SER F  5 37  ? 1.566   9.136   -29.118 1.00 37.99  ? 36  SER D O     1 
ATOM   8276  C  CB    . SER F  5 37  ? 2.592   11.715  -31.245 1.00 43.29  ? 36  SER D CB    1 
ATOM   8277  O  OG    . SER F  5 37  ? 3.826   11.025  -31.207 1.00 50.27  ? 36  SER D OG    1 
ATOM   8278  N  N     . TYR F  5 38  ? 0.848   9.423   -31.222 1.00 43.66  ? 37  TYR D N     1 
ATOM   8279  C  CA    . TYR F  5 38  ? 0.468   8.033   -31.400 1.00 39.53  ? 37  TYR D CA    1 
ATOM   8280  C  C     . TYR F  5 38  ? 1.547   7.261   -32.149 1.00 41.23  ? 37  TYR D C     1 
ATOM   8281  O  O     . TYR F  5 38  ? 1.343   6.107   -32.528 1.00 37.17  ? 37  TYR D O     1 
ATOM   8282  C  CB    . TYR F  5 38  ? -0.850  7.939   -32.162 1.00 34.66  ? 37  TYR D CB    1 
ATOM   8283  C  CG    . TYR F  5 38  ? -2.051  8.419   -31.391 1.00 36.40  ? 37  TYR D CG    1 
ATOM   8284  C  CD1   . TYR F  5 38  ? -2.675  7.601   -30.458 1.00 39.48  ? 37  TYR D CD1   1 
ATOM   8285  C  CD2   . TYR F  5 38  ? -2.578  9.682   -31.610 1.00 36.43  ? 37  TYR D CD2   1 
ATOM   8286  C  CE1   . TYR F  5 38  ? -3.785  8.031   -29.756 1.00 34.01  ? 37  TYR D CE1   1 
ATOM   8287  C  CE2   . TYR F  5 38  ? -3.685  10.118  -30.917 1.00 33.56  ? 37  TYR D CE2   1 
ATOM   8288  C  CZ    . TYR F  5 38  ? -4.282  9.289   -29.992 1.00 29.88  ? 37  TYR D CZ    1 
ATOM   8289  O  OH    . TYR F  5 38  ? -5.384  9.726   -29.300 1.00 46.39  ? 37  TYR D OH    1 
ATOM   8290  N  N     . SER F  5 39  ? 2.695   7.903   -32.348 1.00 42.91  ? 38  SER D N     1 
ATOM   8291  C  CA    . SER F  5 39  ? 3.727   7.394   -33.247 1.00 40.18  ? 38  SER D CA    1 
ATOM   8292  C  C     . SER F  5 39  ? 4.139   5.943   -33.017 1.00 38.02  ? 38  SER D C     1 
ATOM   8293  O  O     . SER F  5 39  ? 4.204   5.172   -33.970 1.00 39.92  ? 38  SER D O     1 
ATOM   8294  C  CB    . SER F  5 39  ? 4.966   8.282   -33.170 1.00 37.63  ? 38  SER D CB    1 
ATOM   8295  O  OG    . SER F  5 39  ? 4.802   9.416   -33.996 1.00 41.93  ? 38  SER D OG    1 
ATOM   8296  N  N     . ILE F  5 40  ? 4.418   5.567   -31.773 1.00 39.38  ? 39  ILE D N     1 
ATOM   8297  C  CA    . ILE F  5 40  ? 4.914   4.219   -31.510 1.00 39.75  ? 39  ILE D CA    1 
ATOM   8298  C  C     . ILE F  5 40  ? 3.822   3.174   -31.759 1.00 40.00  ? 39  ILE D C     1 
ATOM   8299  O  O     . ILE F  5 40  ? 4.107   2.072   -32.225 1.00 41.22  ? 39  ILE D O     1 
ATOM   8300  C  CB    . ILE F  5 40  ? 5.467   4.079   -30.073 1.00 35.39  ? 39  ILE D CB    1 
ATOM   8301  C  CG1   . ILE F  5 40  ? 4.384   4.343   -29.030 1.00 41.14  ? 39  ILE D CG1   1 
ATOM   8302  C  CG2   . ILE F  5 40  ? 6.648   5.015   -29.865 1.00 23.49  ? 39  ILE D CG2   1 
ATOM   8303  C  CD1   . ILE F  5 40  ? 4.891   4.254   -27.611 1.00 48.24  ? 39  ILE D CD1   1 
ATOM   8304  N  N     . TYR F  5 41  ? 2.575   3.539   -31.480 1.00 36.25  ? 40  TYR D N     1 
ATOM   8305  C  CA    . TYR F  5 41  ? 1.443   2.652   -31.713 1.00 35.07  ? 40  TYR D CA    1 
ATOM   8306  C  C     . TYR F  5 41  ? 1.197   2.476   -33.207 1.00 37.10  ? 40  TYR D C     1 
ATOM   8307  O  O     . TYR F  5 41  ? 0.933   1.362   -33.693 1.00 41.43  ? 40  TYR D O     1 
ATOM   8308  C  CB    . TYR F  5 41  ? 0.201   3.208   -31.024 1.00 37.76  ? 40  TYR D CB    1 
ATOM   8309  C  CG    . TYR F  5 41  ? 0.482   3.634   -29.606 1.00 41.13  ? 40  TYR D CG    1 
ATOM   8310  C  CD1   . TYR F  5 41  ? 0.670   2.692   -28.606 1.00 38.91  ? 40  TYR D CD1   1 
ATOM   8311  C  CD2   . TYR F  5 41  ? 0.585   4.978   -29.271 1.00 42.44  ? 40  TYR D CD2   1 
ATOM   8312  C  CE1   . TYR F  5 41  ? 0.941   3.072   -27.311 1.00 44.51  ? 40  TYR D CE1   1 
ATOM   8313  C  CE2   . TYR F  5 41  ? 0.855   5.371   -27.973 1.00 43.35  ? 40  TYR D CE2   1 
ATOM   8314  C  CZ    . TYR F  5 41  ? 1.032   4.410   -26.998 1.00 52.83  ? 40  TYR D CZ    1 
ATOM   8315  O  OH    . TYR F  5 41  ? 1.301   4.783   -25.703 1.00 60.54  ? 40  TYR D OH    1 
ATOM   8316  N  N     . ILE F  5 42  ? 1.283   3.587   -33.930 1.00 36.07  ? 41  ILE D N     1 
ATOM   8317  C  CA    . ILE F  5 42  ? 1.149   3.565   -35.374 1.00 33.41  ? 41  ILE D CA    1 
ATOM   8318  C  C     . ILE F  5 42  ? 2.237   2.683   -35.954 1.00 35.18  ? 41  ILE D C     1 
ATOM   8319  O  O     . ILE F  5 42  ? 1.970   1.862   -36.820 1.00 35.13  ? 41  ILE D O     1 
ATOM   8320  C  CB    . ILE F  5 42  ? 1.239   4.972   -35.988 1.00 36.62  ? 41  ILE D CB    1 
ATOM   8321  C  CG1   . ILE F  5 42  ? 0.103   5.852   -35.465 1.00 35.45  ? 41  ILE D CG1   1 
ATOM   8322  C  CG2   . ILE F  5 42  ? 1.199   4.889   -37.504 1.00 30.48  ? 41  ILE D CG2   1 
ATOM   8323  C  CD1   . ILE F  5 42  ? 0.138   7.258   -35.988 1.00 31.16  ? 41  ILE D CD1   1 
ATOM   8324  N  N     . TYR F  5 43  ? 3.458   2.834   -35.451 1.00 37.29  ? 42  TYR D N     1 
ATOM   8325  C  CA    . TYR F  5 43  ? 4.583   2.060   -35.957 1.00 38.39  ? 42  TYR D CA    1 
ATOM   8326  C  C     . TYR F  5 43  ? 4.381   0.570   -35.679 1.00 37.04  ? 42  TYR D C     1 
ATOM   8327  O  O     . TYR F  5 43  ? 4.661   -0.273  -36.536 1.00 34.18  ? 42  TYR D O     1 
ATOM   8328  C  CB    . TYR F  5 43  ? 5.901   2.541   -35.348 1.00 33.18  ? 42  TYR D CB    1 
ATOM   8329  C  CG    . TYR F  5 43  ? 7.099   2.063   -36.129 1.00 39.90  ? 42  TYR D CG    1 
ATOM   8330  C  CD1   . TYR F  5 43  ? 7.621   2.821   -37.170 1.00 39.70  ? 42  TYR D CD1   1 
ATOM   8331  C  CD2   . TYR F  5 43  ? 7.687   0.835   -35.850 1.00 44.07  ? 42  TYR D CD2   1 
ATOM   8332  C  CE1   . TYR F  5 43  ? 8.708   2.376   -37.904 1.00 53.27  ? 42  TYR D CE1   1 
ATOM   8333  C  CE2   . TYR F  5 43  ? 8.776   0.382   -36.575 1.00 51.03  ? 42  TYR D CE2   1 
ATOM   8334  C  CZ    . TYR F  5 43  ? 9.283   1.153   -37.601 1.00 58.61  ? 42  TYR D CZ    1 
ATOM   8335  O  OH    . TYR F  5 43  ? 10.367  0.699   -38.322 1.00 62.00  ? 42  TYR D OH    1 
ATOM   8336  N  N     . LYS F  5 44  ? 3.888   0.259   -34.483 1.00 31.79  ? 43  LYS D N     1 
ATOM   8337  C  CA    . LYS F  5 44  ? 3.565   -1.115  -34.120 1.00 31.79  ? 43  LYS D CA    1 
ATOM   8338  C  C     . LYS F  5 44  ? 2.599   -1.724  -35.126 1.00 36.31  ? 43  LYS D C     1 
ATOM   8339  O  O     . LYS F  5 44  ? 2.839   -2.816  -35.662 1.00 39.71  ? 43  LYS D O     1 
ATOM   8340  C  CB    . LYS F  5 44  ? 2.969   -1.174  -32.713 1.00 31.50  ? 43  LYS D CB    1 
ATOM   8341  C  CG    . LYS F  5 44  ? 3.991   -0.986  -31.606 1.00 35.65  ? 43  LYS D CG    1 
ATOM   8342  C  CD    . LYS F  5 44  ? 3.338   -0.944  -30.232 1.00 45.56  ? 43  LYS D CD    1 
ATOM   8343  C  CE    . LYS F  5 44  ? 4.389   -1.013  -29.129 1.00 59.24  ? 43  LYS D CE    1 
ATOM   8344  N  NZ    . LYS F  5 44  ? 3.781   -1.027  -27.768 1.00 72.20  ? 43  LYS D NZ    1 
ATOM   8345  N  N     . VAL F  5 45  ? 1.514   -1.009  -35.401 1.00 36.05  ? 44  VAL D N     1 
ATOM   8346  C  CA    . VAL F  5 45  ? 0.526   -1.513  -36.349 1.00 35.81  ? 44  VAL D CA    1 
ATOM   8347  C  C     . VAL F  5 45  ? 1.118   -1.630  -37.762 1.00 35.58  ? 44  VAL D C     1 
ATOM   8348  O  O     . VAL F  5 45  ? 0.809   -2.571  -38.511 1.00 37.61  ? 44  VAL D O     1 
ATOM   8349  C  CB    . VAL F  5 45  ? -0.725  -0.619  -36.365 1.00 32.48  ? 44  VAL D CB    1 
ATOM   8350  C  CG1   . VAL F  5 45  ? -1.681  -1.070  -37.432 1.00 26.81  ? 44  VAL D CG1   1 
ATOM   8351  C  CG2   . VAL F  5 45  ? -1.414  -0.660  -35.004 1.00 25.02  ? 44  VAL D CG2   1 
ATOM   8352  N  N     . LEU F  5 46  ? 1.984   -0.686  -38.111 1.00 36.58  ? 45  LEU D N     1 
ATOM   8353  C  CA    . LEU F  5 46  ? 2.667   -0.711  -39.397 1.00 35.28  ? 45  LEU D CA    1 
ATOM   8354  C  C     . LEU F  5 46  ? 3.443   -2.011  -39.545 1.00 37.66  ? 45  LEU D C     1 
ATOM   8355  O  O     . LEU F  5 46  ? 3.300   -2.709  -40.552 1.00 35.30  ? 45  LEU D O     1 
ATOM   8356  C  CB    . LEU F  5 46  ? 3.600   0.493   -39.544 1.00 29.60  ? 45  LEU D CB    1 
ATOM   8357  C  CG    . LEU F  5 46  ? 4.592   0.474   -40.711 1.00 30.09  ? 45  LEU D CG    1 
ATOM   8358  C  CD1   . LEU F  5 46  ? 3.890   0.406   -42.050 1.00 28.69  ? 45  LEU D CD1   1 
ATOM   8359  C  CD2   . LEU F  5 46  ? 5.501   1.686   -40.645 1.00 37.08  ? 45  LEU D CD2   1 
ATOM   8360  N  N     . LYS F  5 47  ? 4.242   -2.342  -38.531 1.00 38.44  ? 46  LYS D N     1 
ATOM   8361  C  CA    . LYS F  5 47  ? 5.032   -3.574  -38.551 1.00 37.17  ? 46  LYS D CA    1 
ATOM   8362  C  C     . LYS F  5 47  ? 4.126   -4.795  -38.596 1.00 32.36  ? 46  LYS D C     1 
ATOM   8363  O  O     . LYS F  5 47  ? 4.469   -5.805  -39.208 1.00 38.76  ? 46  LYS D O     1 
ATOM   8364  C  CB    . LYS F  5 47  ? 5.963   -3.658  -37.337 1.00 30.56  ? 46  LYS D CB    1 
ATOM   8365  C  CG    . LYS F  5 47  ? 7.006   -2.546  -37.233 1.00 34.15  ? 46  LYS D CG    1 
ATOM   8366  C  CD    . LYS F  5 47  ? 8.167   -2.752  -38.198 1.00 43.65  ? 46  LYS D CD    1 
ATOM   8367  C  CE    . LYS F  5 47  ? 7.971   -1.989  -39.505 1.00 42.06  ? 46  LYS D CE    1 
ATOM   8368  N  NZ    . LYS F  5 47  ? 9.150   -2.097  -40.408 1.00 43.68  ? 46  LYS D NZ    1 
ATOM   8369  N  N     . GLN F  5 48  ? 2.964   -4.698  -37.959 1.00 26.60  ? 47  GLN D N     1 
ATOM   8370  C  CA    . GLN F  5 48  ? 2.003   -5.793  -37.989 1.00 21.24  ? 47  GLN D CA    1 
ATOM   8371  C  C     . GLN F  5 48  ? 1.450   -6.080  -39.384 1.00 25.75  ? 47  GLN D C     1 
ATOM   8372  O  O     . GLN F  5 48  ? 1.355   -7.241  -39.788 1.00 36.51  ? 47  GLN D O     1 
ATOM   8373  C  CB    . GLN F  5 48  ? 0.846   -5.510  -37.039 1.00 23.06  ? 47  GLN D CB    1 
ATOM   8374  C  CG    . GLN F  5 48  ? 1.144   -5.820  -35.594 1.00 26.15  ? 47  GLN D CG    1 
ATOM   8375  C  CD    . GLN F  5 48  ? -0.096  -5.755  -34.737 1.00 37.80  ? 47  GLN D CD    1 
ATOM   8376  O  OE1   . GLN F  5 48  ? -0.997  -4.951  -34.990 1.00 39.73  ? 47  GLN D OE1   1 
ATOM   8377  N  NE2   . GLN F  5 48  ? -0.164  -6.618  -33.730 1.00 33.71  ? 47  GLN D NE2   1 
ATOM   8378  N  N     . VAL F  5 49  ? 1.070   -5.045  -40.123 1.00 28.82  ? 48  VAL D N     1 
ATOM   8379  C  CA    . VAL F  5 49  ? 0.494   -5.277  -41.446 1.00 31.88  ? 48  VAL D CA    1 
ATOM   8380  C  C     . VAL F  5 49  ? 1.548   -5.368  -42.537 1.00 26.60  ? 48  VAL D C     1 
ATOM   8381  O  O     . VAL F  5 49  ? 1.313   -5.958  -43.584 1.00 30.21  ? 48  VAL D O     1 
ATOM   8382  C  CB    . VAL F  5 49  ? -0.523  -4.162  -41.833 1.00 32.73  ? 48  VAL D CB    1 
ATOM   8383  C  CG1   . VAL F  5 49  ? -1.584  -4.007  -40.749 1.00 33.43  ? 48  VAL D CG1   1 
ATOM   8384  C  CG2   . VAL F  5 49  ? 0.190   -2.835  -42.084 1.00 32.22  ? 48  VAL D CG2   1 
ATOM   8385  N  N     . HIS F  5 50  ? 2.719   -4.795  -42.286 1.00 32.19  ? 49  HIS D N     1 
ATOM   8386  C  CA    . HIS F  5 50  ? 3.747   -4.666  -43.325 1.00 37.27  ? 49  HIS D CA    1 
ATOM   8387  C  C     . HIS F  5 50  ? 5.146   -4.685  -42.717 1.00 39.61  ? 49  HIS D C     1 
ATOM   8388  O  O     . HIS F  5 50  ? 5.773   -3.638  -42.590 1.00 40.98  ? 49  HIS D O     1 
ATOM   8389  C  CB    . HIS F  5 50  ? 3.522   -3.358  -44.111 1.00 36.93  ? 49  HIS D CB    1 
ATOM   8390  C  CG    . HIS F  5 50  ? 2.668   -3.515  -45.331 1.00 40.15  ? 49  HIS D CG    1 
ATOM   8391  N  ND1   . HIS F  5 50  ? 1.485   -4.218  -45.322 1.00 51.17  ? 49  HIS D ND1   1 
ATOM   8392  C  CD2   . HIS F  5 50  ? 2.774   -2.959  -46.561 1.00 54.49  ? 49  HIS D CD2   1 
ATOM   8393  C  CE1   . HIS F  5 50  ? 0.950   -4.175  -46.530 1.00 41.35  ? 49  HIS D CE1   1 
ATOM   8394  N  NE2   . HIS F  5 50  ? 1.699   -3.404  -47.292 1.00 40.87  ? 49  HIS D NE2   1 
ATOM   8395  N  N     . PRO F  5 51  ? 5.645   -5.881  -42.378 1.00 45.24  ? 50  PRO D N     1 
ATOM   8396  C  CA    . PRO F  5 51  ? 6.827   -6.043  -41.522 1.00 41.53  ? 50  PRO D CA    1 
ATOM   8397  C  C     . PRO F  5 51  ? 8.102   -5.429  -42.086 1.00 39.58  ? 50  PRO D C     1 
ATOM   8398  O  O     . PRO F  5 51  ? 8.985   -5.080  -41.302 1.00 43.38  ? 50  PRO D O     1 
ATOM   8399  C  CB    . PRO F  5 51  ? 6.976   -7.563  -41.419 1.00 41.11  ? 50  PRO D CB    1 
ATOM   8400  C  CG    . PRO F  5 51  ? 5.609   -8.093  -41.727 1.00 32.84  ? 50  PRO D CG    1 
ATOM   8401  C  CD    . PRO F  5 51  ? 5.069   -7.178  -42.774 1.00 33.09  ? 50  PRO D CD    1 
ATOM   8402  N  N     . ASP F  5 52  ? 8.193   -5.289  -43.404 1.00 38.47  ? 51  ASP D N     1 
ATOM   8403  C  CA    . ASP F  5 52  ? 9.411   -4.787  -44.028 1.00 43.73  ? 51  ASP D CA    1 
ATOM   8404  C  C     . ASP F  5 52  ? 9.220   -3.400  -44.627 1.00 47.48  ? 51  ASP D C     1 
ATOM   8405  O  O     . ASP F  5 52  ? 9.988   -2.984  -45.496 1.00 47.36  ? 51  ASP D O     1 
ATOM   8406  C  CB    . ASP F  5 52  ? 9.891   -5.751  -45.115 1.00 49.11  ? 51  ASP D CB    1 
ATOM   8407  C  CG    . ASP F  5 52  ? 10.316  -7.098  -44.561 1.00 54.48  ? 51  ASP D CG    1 
ATOM   8408  O  OD1   . ASP F  5 52  ? 10.967  -7.127  -43.494 1.00 52.85  ? 51  ASP D OD1   1 
ATOM   8409  O  OD2   . ASP F  5 52  ? 9.989   -8.127  -45.193 1.00 60.47  ? 51  ASP D OD2   1 
ATOM   8410  N  N     . THR F  5 53  ? 8.199   -2.690  -44.155 1.00 44.40  ? 52  THR D N     1 
ATOM   8411  C  CA    . THR F  5 53  ? 7.877   -1.364  -44.665 1.00 35.16  ? 52  THR D CA    1 
ATOM   8412  C  C     . THR F  5 53  ? 8.062   -0.318  -43.572 1.00 38.37  ? 52  THR D C     1 
ATOM   8413  O  O     . THR F  5 53  ? 7.619   -0.504  -42.442 1.00 39.05  ? 52  THR D O     1 
ATOM   8414  C  CB    . THR F  5 53  ? 6.431   -1.304  -45.204 1.00 38.90  ? 52  THR D CB    1 
ATOM   8415  O  OG1   . THR F  5 53  ? 6.291   -2.189  -46.321 1.00 38.59  ? 52  THR D OG1   1 
ATOM   8416  C  CG2   . THR F  5 53  ? 6.071   0.111   -45.645 1.00 39.71  ? 52  THR D CG2   1 
ATOM   8417  N  N     . GLY F  5 54  ? 8.729   0.779   -43.907 1.00 35.41  ? 53  GLY D N     1 
ATOM   8418  C  CA    . GLY F  5 54  ? 8.925   1.853   -42.954 1.00 42.10  ? 53  GLY D CA    1 
ATOM   8419  C  C     . GLY F  5 54  ? 8.047   3.048   -43.271 1.00 41.33  ? 53  GLY D C     1 
ATOM   8420  O  O     . GLY F  5 54  ? 7.323   3.053   -44.264 1.00 40.14  ? 53  GLY D O     1 
ATOM   8421  N  N     . ILE F  5 55  ? 8.108   4.073   -42.434 1.00 35.14  ? 54  ILE D N     1 
ATOM   8422  C  CA    . ILE F  5 55  ? 7.307   5.258   -42.682 1.00 41.54  ? 54  ILE D CA    1 
ATOM   8423  C  C     . ILE F  5 55  ? 8.120   6.521   -42.415 1.00 38.98  ? 54  ILE D C     1 
ATOM   8424  O  O     . ILE F  5 55  ? 8.845   6.614   -41.423 1.00 45.92  ? 54  ILE D O     1 
ATOM   8425  C  CB    . ILE F  5 55  ? 6.007   5.245   -41.834 1.00 40.73  ? 54  ILE D CB    1 
ATOM   8426  C  CG1   . ILE F  5 55  ? 5.078   6.392   -42.242 1.00 32.93  ? 54  ILE D CG1   1 
ATOM   8427  C  CG2   . ILE F  5 55  ? 6.316   5.260   -40.343 1.00 33.98  ? 54  ILE D CG2   1 
ATOM   8428  C  CD1   . ILE F  5 55  ? 3.697   6.318   -41.610 1.00 28.27  ? 54  ILE D CD1   1 
ATOM   8429  N  N     . SER F  5 56  ? 8.025   7.474   -43.335 1.00 35.20  ? 55  SER D N     1 
ATOM   8430  C  CA    . SER F  5 56  ? 8.735   8.739   -43.207 1.00 35.88  ? 55  SER D CA    1 
ATOM   8431  C  C     . SER F  5 56  ? 8.038   9.622   -42.178 1.00 38.10  ? 55  SER D C     1 
ATOM   8432  O  O     . SER F  5 56  ? 6.848   9.449   -41.911 1.00 36.74  ? 55  SER D O     1 
ATOM   8433  C  CB    . SER F  5 56  ? 8.807   9.455   -44.549 1.00 33.85  ? 55  SER D CB    1 
ATOM   8434  O  OG    . SER F  5 56  ? 7.564   10.060  -44.848 1.00 31.44  ? 55  SER D OG    1 
ATOM   8435  N  N     . SER F  5 57  ? 8.775   10.569  -41.610 1.00 31.74  ? 56  SER D N     1 
ATOM   8436  C  CA    . SER F  5 57  ? 8.241   11.390  -40.536 1.00 30.26  ? 56  SER D CA    1 
ATOM   8437  C  C     . SER F  5 57  ? 7.073   12.264  -40.993 1.00 34.57  ? 56  SER D C     1 
ATOM   8438  O  O     . SER F  5 57  ? 6.154   12.526  -40.217 1.00 36.57  ? 56  SER D O     1 
ATOM   8439  C  CB    . SER F  5 57  ? 9.341   12.261  -39.935 1.00 30.18  ? 56  SER D CB    1 
ATOM   8440  O  OG    . SER F  5 57  ? 9.913   13.092  -40.923 1.00 47.13  ? 56  SER D OG    1 
ATOM   8441  N  N     . LYS F  5 58  ? 7.098   12.712  -42.244 1.00 29.52  ? 57  LYS D N     1 
ATOM   8442  C  CA    . LYS F  5 58  ? 5.991   13.504  -42.757 1.00 30.29  ? 57  LYS D CA    1 
ATOM   8443  C  C     . LYS F  5 58  ? 4.734   12.646  -42.825 1.00 31.85  ? 57  LYS D C     1 
ATOM   8444  O  O     . LYS F  5 58  ? 3.635   13.083  -42.449 1.00 35.19  ? 57  LYS D O     1 
ATOM   8445  C  CB    . LYS F  5 58  ? 6.329   14.091  -44.130 1.00 39.83  ? 57  LYS D CB    1 
ATOM   8446  C  CG    . LYS F  5 58  ? 7.413   15.166  -44.095 1.00 47.57  ? 57  LYS D CG    1 
ATOM   8447  C  CD    . LYS F  5 58  ? 7.505   15.945  -45.404 1.00 53.70  ? 57  LYS D CD    1 
ATOM   8448  C  CE    . LYS F  5 58  ? 6.779   17.290  -45.312 1.00 72.79  ? 57  LYS D CE    1 
ATOM   8449  N  NZ    . LYS F  5 58  ? 7.401   18.244  -44.336 1.00 62.13  ? 57  LYS D NZ    1 
ATOM   8450  N  N     . ALA F  5 59  ? 4.912   11.408  -43.281 1.00 35.64  ? 58  ALA D N     1 
ATOM   8451  C  CA    . ALA F  5 59  ? 3.810   10.464  -43.400 1.00 26.35  ? 58  ALA D CA    1 
ATOM   8452  C  C     . ALA F  5 59  ? 3.295   10.057  -42.027 1.00 26.05  ? 58  ALA D C     1 
ATOM   8453  O  O     . ALA F  5 59  ? 2.090   9.896   -41.832 1.00 31.91  ? 58  ALA D O     1 
ATOM   8454  C  CB    . ALA F  5 59  ? 4.238   9.265   -44.184 1.00 25.29  ? 58  ALA D CB    1 
ATOM   8455  N  N     . MET F  5 60  ? 4.204   9.919   -41.068 1.00 28.44  ? 59  MET D N     1 
ATOM   8456  C  CA    . MET F  5 60  ? 3.822   9.595   -39.697 1.00 29.47  ? 59  MET D CA    1 
ATOM   8457  C  C     . MET F  5 60  ? 3.059   10.761  -39.070 1.00 33.37  ? 59  MET D C     1 
ATOM   8458  O  O     . MET F  5 60  ? 2.140   10.561  -38.270 1.00 38.44  ? 59  MET D O     1 
ATOM   8459  C  CB    . MET F  5 60  ? 5.056   9.238   -38.861 1.00 27.72  ? 59  MET D CB    1 
ATOM   8460  C  CG    . MET F  5 60  ? 4.768   8.930   -37.398 1.00 28.24  ? 59  MET D CG    1 
ATOM   8461  S  SD    . MET F  5 60  ? 3.609   7.568   -37.154 1.00 41.88  ? 59  MET D SD    1 
ATOM   8462  C  CE    . MET F  5 60  ? 4.708   6.152   -37.180 1.00 31.68  ? 59  MET D CE    1 
ATOM   8463  N  N     . SER F  5 61  ? 3.435   11.980  -39.446 1.00 32.99  ? 60  SER D N     1 
ATOM   8464  C  CA    . SER F  5 61  ? 2.748   13.173  -38.973 1.00 28.21  ? 60  SER D CA    1 
ATOM   8465  C  C     . SER F  5 61  ? 1.314   13.171  -39.487 1.00 28.76  ? 60  SER D C     1 
ATOM   8466  O  O     . SER F  5 61  ? 0.359   13.325  -38.718 1.00 31.48  ? 60  SER D O     1 
ATOM   8467  C  CB    . SER F  5 61  ? 3.488   14.431  -39.425 1.00 29.29  ? 60  SER D CB    1 
ATOM   8468  O  OG    . SER F  5 61  ? 2.729   15.598  -39.156 1.00 44.53  ? 60  SER D OG    1 
ATOM   8469  N  N     . ILE F  5 62  ? 1.168   12.971  -40.790 1.00 23.81  ? 61  ILE D N     1 
ATOM   8470  C  CA    . ILE F  5 62  ? -0.159  12.789  -41.372 1.00 31.30  ? 61  ILE D CA    1 
ATOM   8471  C  C     . ILE F  5 62  ? -0.986  11.693  -40.669 1.00 35.97  ? 61  ILE D C     1 
ATOM   8472  O  O     . ILE F  5 62  ? -2.180  11.883  -40.404 1.00 32.33  ? 61  ILE D O     1 
ATOM   8473  C  CB    . ILE F  5 62  ? -0.049  12.467  -42.866 1.00 31.57  ? 61  ILE D CB    1 
ATOM   8474  C  CG1   . ILE F  5 62  ? 0.263   13.747  -43.634 1.00 25.40  ? 61  ILE D CG1   1 
ATOM   8475  C  CG2   . ILE F  5 62  ? -1.336  11.840  -43.388 1.00 25.04  ? 61  ILE D CG2   1 
ATOM   8476  C  CD1   . ILE F  5 62  ? 0.679   13.504  -45.040 1.00 29.31  ? 61  ILE D CD1   1 
ATOM   8477  N  N     . MET F  5 63  ? -0.357  10.561  -40.354 1.00 28.64  ? 62  MET D N     1 
ATOM   8478  C  CA    . MET F  5 63  ? -1.055  9.507   -39.618 1.00 33.10  ? 62  MET D CA    1 
ATOM   8479  C  C     . MET F  5 63  ? -1.532  9.994   -38.246 1.00 34.17  ? 62  MET D C     1 
ATOM   8480  O  O     . MET F  5 63  ? -2.653  9.684   -37.814 1.00 35.09  ? 62  MET D O     1 
ATOM   8481  C  CB    . MET F  5 63  ? -0.163  8.276   -39.454 1.00 33.85  ? 62  MET D CB    1 
ATOM   8482  C  CG    . MET F  5 63  ? 0.054   7.493   -40.734 1.00 27.97  ? 62  MET D CG    1 
ATOM   8483  S  SD    . MET F  5 63  ? -1.497  7.103   -41.561 1.00 34.40  ? 62  MET D SD    1 
ATOM   8484  C  CE    . MET F  5 63  ? -2.251  6.024   -40.348 1.00 23.43  ? 62  MET D CE    1 
ATOM   8485  N  N     . ASN F  5 64  ? -0.684  10.759  -37.566 1.00 33.83  ? 63  ASN D N     1 
ATOM   8486  C  CA    . ASN F  5 64  ? -1.052  11.327  -36.273 1.00 38.82  ? 63  ASN D CA    1 
ATOM   8487  C  C     . ASN F  5 64  ? -2.255  12.272  -36.364 1.00 40.81  ? 63  ASN D C     1 
ATOM   8488  O  O     . ASN F  5 64  ? -3.180  12.227  -35.524 1.00 38.15  ? 63  ASN D O     1 
ATOM   8489  C  CB    . ASN F  5 64  ? 0.143   12.051  -35.662 1.00 34.69  ? 63  ASN D CB    1 
ATOM   8490  C  CG    . ASN F  5 64  ? 0.697   11.322  -34.458 1.00 43.17  ? 63  ASN D CG    1 
ATOM   8491  O  OD1   . ASN F  5 64  ? 0.155   11.425  -33.358 1.00 45.54  ? 63  ASN D OD1   1 
ATOM   8492  N  ND2   . ASN F  5 64  ? 1.772   10.567  -34.659 1.00 41.68  ? 63  ASN D ND2   1 
ATOM   8493  N  N     . SER F  5 65  ? -2.244  13.119  -37.390 1.00 29.67  ? 64  SER D N     1 
ATOM   8494  C  CA    . SER F  5 65  ? -3.392  13.971  -37.666 1.00 31.55  ? 64  SER D CA    1 
ATOM   8495  C  C     . SER F  5 65  ? -4.640  13.124  -37.891 1.00 34.75  ? 64  SER D C     1 
ATOM   8496  O  O     . SER F  5 65  ? -5.702  13.437  -37.365 1.00 37.46  ? 64  SER D O     1 
ATOM   8497  C  CB    . SER F  5 65  ? -3.141  14.863  -38.886 1.00 35.79  ? 64  SER D CB    1 
ATOM   8498  O  OG    . SER F  5 65  ? -2.080  15.775  -38.662 1.00 39.94  ? 64  SER D OG    1 
ATOM   8499  N  N     . PHE F  5 66  ? -4.503  12.051  -38.667 1.00 31.40  ? 65  PHE D N     1 
ATOM   8500  C  CA    . PHE F  5 66  ? -5.625  11.164  -38.978 1.00 30.14  ? 65  PHE D CA    1 
ATOM   8501  C  C     . PHE F  5 66  ? -6.256  10.576  -37.723 1.00 29.23  ? 65  PHE D C     1 
ATOM   8502  O  O     . PHE F  5 66  ? -7.483  10.596  -37.555 1.00 33.02  ? 65  PHE D O     1 
ATOM   8503  C  CB    . PHE F  5 66  ? -5.161  10.040  -39.908 1.00 30.78  ? 65  PHE D CB    1 
ATOM   8504  C  CG    . PHE F  5 66  ? -6.155  8.924   -40.072 1.00 26.83  ? 65  PHE D CG    1 
ATOM   8505  C  CD1   . PHE F  5 66  ? -7.349  9.134   -40.745 1.00 22.94  ? 65  PHE D CD1   1 
ATOM   8506  C  CD2   . PHE F  5 66  ? -5.881  7.650   -39.568 1.00 29.74  ? 65  PHE D CD2   1 
ATOM   8507  C  CE1   . PHE F  5 66  ? -8.263  8.098   -40.904 1.00 28.72  ? 65  PHE D CE1   1 
ATOM   8508  C  CE2   . PHE F  5 66  ? -6.786  6.604   -39.721 1.00 20.94  ? 65  PHE D CE2   1 
ATOM   8509  C  CZ    . PHE F  5 66  ? -7.978  6.824   -40.389 1.00 26.34  ? 65  PHE D CZ    1 
ATOM   8510  N  N     . VAL F  5 67  ? -5.413  10.053  -36.840 1.00 33.22  ? 66  VAL D N     1 
ATOM   8511  C  CA    . VAL F  5 67  ? -5.904  9.437   -35.612 1.00 32.03  ? 66  VAL D CA    1 
ATOM   8512  C  C     . VAL F  5 67  ? -6.581  10.482  -34.720 1.00 31.20  ? 66  VAL D C     1 
ATOM   8513  O  O     . VAL F  5 67  ? -7.660  10.226  -34.175 1.00 31.01  ? 66  VAL D O     1 
ATOM   8514  C  CB    . VAL F  5 67  ? -4.760  8.726   -34.840 1.00 29.34  ? 66  VAL D CB    1 
ATOM   8515  C  CG1   . VAL F  5 67  ? -5.252  8.189   -33.516 1.00 28.90  ? 66  VAL D CG1   1 
ATOM   8516  C  CG2   . VAL F  5 67  ? -4.179  7.602   -35.679 1.00 27.47  ? 66  VAL D CG2   1 
ATOM   8517  N  N     . THR F  5 68  ? -5.970  11.661  -34.583 1.00 27.86  ? 67  THR D N     1 
ATOM   8518  C  CA    . THR F  5 68  ? -6.572  12.697  -33.744 1.00 27.97  ? 67  THR D CA    1 
ATOM   8519  C  C     . THR F  5 68  ? -7.911  13.181  -34.323 1.00 29.69  ? 67  THR D C     1 
ATOM   8520  O  O     . THR F  5 68  ? -8.878  13.423  -33.594 1.00 27.06  ? 67  THR D O     1 
ATOM   8521  C  CB    . THR F  5 68  ? -5.629  13.893  -33.564 1.00 29.68  ? 67  THR D CB    1 
ATOM   8522  O  OG1   . THR F  5 68  ? -4.454  13.467  -32.866 1.00 36.18  ? 67  THR D OG1   1 
ATOM   8523  C  CG2   . THR F  5 68  ? -6.306  14.980  -32.753 1.00 27.45  ? 67  THR D CG2   1 
ATOM   8524  N  N     . ASP F  5 69  ? -7.966  13.296  -35.642 1.00 24.35  ? 68  ASP D N     1 
ATOM   8525  C  CA    . ASP F  5 69  ? -9.193  13.670  -36.325 1.00 25.91  ? 68  ASP D CA    1 
ATOM   8526  C  C     . ASP F  5 69  ? -10.319 12.680  -36.036 1.00 31.27  ? 68  ASP D C     1 
ATOM   8527  O  O     . ASP F  5 69  ? -11.360 13.063  -35.490 1.00 31.44  ? 68  ASP D O     1 
ATOM   8528  C  CB    . ASP F  5 69  ? -8.951  13.771  -37.829 1.00 26.30  ? 68  ASP D CB    1 
ATOM   8529  C  CG    . ASP F  5 69  ? -10.184 14.220  -38.592 1.00 32.67  ? 68  ASP D CG    1 
ATOM   8530  O  OD1   . ASP F  5 69  ? -11.200 14.566  -37.946 1.00 30.50  ? 68  ASP D OD1   1 
ATOM   8531  O  OD2   . ASP F  5 69  ? -10.134 14.235  -39.845 1.00 30.10  ? 68  ASP D OD2   1 
ATOM   8532  N  N     . ILE F  5 70  ? -10.114 11.416  -36.409 1.00 30.92  ? 69  ILE D N     1 
ATOM   8533  C  CA    . ILE F  5 70  ? -11.132 10.387  -36.192 1.00 28.55  ? 69  ILE D CA    1 
ATOM   8534  C  C     . ILE F  5 70  ? -11.544 10.302  -34.720 1.00 28.88  ? 69  ILE D C     1 
ATOM   8535  O  O     . ILE F  5 70  ? -12.737 10.158  -34.392 1.00 29.53  ? 69  ILE D O     1 
ATOM   8536  C  CB    . ILE F  5 70  ? -10.640 9.013   -36.660 1.00 24.02  ? 69  ILE D CB    1 
ATOM   8537  C  CG1   . ILE F  5 70  ? -10.258 9.070   -38.136 1.00 21.52  ? 69  ILE D CG1   1 
ATOM   8538  C  CG2   . ILE F  5 70  ? -11.718 7.978   -36.451 1.00 22.08  ? 69  ILE D CG2   1 
ATOM   8539  C  CD1   . ILE F  5 70  ? -11.390 9.516   -39.025 1.00 27.53  ? 69  ILE D CD1   1 
ATOM   8540  N  N     . PHE F  5 71  ? -10.554 10.403  -33.839 1.00 25.23  ? 70  PHE D N     1 
ATOM   8541  C  CA    . PHE F  5 71  ? -10.823 10.501  -32.415 1.00 28.32  ? 70  PHE D CA    1 
ATOM   8542  C  C     . PHE F  5 71  ? -11.843 11.602  -32.138 1.00 34.73  ? 70  PHE D C     1 
ATOM   8543  O  O     . PHE F  5 71  ? -12.850 11.365  -31.474 1.00 35.57  ? 70  PHE D O     1 
ATOM   8544  C  CB    . PHE F  5 71  ? -9.537  10.776  -31.632 1.00 32.44  ? 70  PHE D CB    1 
ATOM   8545  C  CG    . PHE F  5 71  ? -9.751  10.903  -30.150 1.00 36.67  ? 70  PHE D CG    1 
ATOM   8546  C  CD1   . PHE F  5 71  ? -9.568  9.816   -29.317 1.00 37.79  ? 70  PHE D CD1   1 
ATOM   8547  C  CD2   . PHE F  5 71  ? -10.141 12.109  -29.590 1.00 37.03  ? 70  PHE D CD2   1 
ATOM   8548  C  CE1   . PHE F  5 71  ? -9.770  9.930   -27.956 1.00 40.47  ? 70  PHE D CE1   1 
ATOM   8549  C  CE2   . PHE F  5 71  ? -10.351 12.224  -28.231 1.00 37.81  ? 70  PHE D CE2   1 
ATOM   8550  C  CZ    . PHE F  5 71  ? -10.167 11.135  -27.415 1.00 38.37  ? 70  PHE D CZ    1 
ATOM   8551  N  N     . GLU F  5 72  ? -11.578 12.804  -32.650 1.00 36.06  ? 71  GLU D N     1 
ATOM   8552  C  CA    . GLU F  5 72  ? -12.423 13.957  -32.349 1.00 30.70  ? 71  GLU D CA    1 
ATOM   8553  C  C     . GLU F  5 72  ? -13.820 13.816  -32.937 1.00 33.73  ? 71  GLU D C     1 
ATOM   8554  O  O     . GLU F  5 72  ? -14.804 14.135  -32.277 1.00 37.82  ? 71  GLU D O     1 
ATOM   8555  C  CB    . GLU F  5 72  ? -11.771 15.245  -32.849 1.00 38.09  ? 71  GLU D CB    1 
ATOM   8556  C  CG    . GLU F  5 72  ? -10.572 15.682  -32.020 1.00 47.46  ? 71  GLU D CG    1 
ATOM   8557  C  CD    . GLU F  5 72  ? -9.713  16.715  -32.727 1.00 50.56  ? 71  GLU D CD    1 
ATOM   8558  O  OE1   . GLU F  5 72  ? -10.013 17.044  -33.900 1.00 41.43  ? 71  GLU D OE1   1 
ATOM   8559  O  OE2   . GLU F  5 72  ? -8.735  17.188  -32.106 1.00 49.34  ? 71  GLU D OE2   1 
ATOM   8560  N  N     . ARG F  5 73  ? -13.917 13.335  -34.170 1.00 28.65  ? 72  ARG D N     1 
ATOM   8561  C  CA    . ARG F  5 73  ? -15.226 13.130  -34.779 1.00 27.99  ? 72  ARG D CA    1 
ATOM   8562  C  C     . ARG F  5 73  ? -16.063 12.151  -33.959 1.00 36.49  ? 72  ARG D C     1 
ATOM   8563  O  O     . ARG F  5 73  ? -17.224 12.438  -33.631 1.00 44.76  ? 72  ARG D O     1 
ATOM   8564  C  CB    . ARG F  5 73  ? -15.091 12.615  -36.207 1.00 25.70  ? 72  ARG D CB    1 
ATOM   8565  C  CG    . ARG F  5 73  ? -14.238 13.466  -37.123 1.00 22.40  ? 72  ARG D CG    1 
ATOM   8566  C  CD    . ARG F  5 73  ? -14.565 13.132  -38.563 1.00 19.08  ? 72  ARG D CD    1 
ATOM   8567  N  NE    . ARG F  5 73  ? -13.454 13.395  -39.462 1.00 19.52  ? 72  ARG D NE    1 
ATOM   8568  C  CZ    . ARG F  5 73  ? -13.462 13.074  -40.751 1.00 29.77  ? 72  ARG D CZ    1 
ATOM   8569  N  NH1   . ARG F  5 73  ? -14.530 12.489  -41.272 1.00 26.73  ? 72  ARG D NH1   1 
ATOM   8570  N  NH2   . ARG F  5 73  ? -12.411 13.335  -41.519 1.00 32.20  ? 72  ARG D NH2   1 
ATOM   8571  N  N     . ILE F  5 74  ? -15.476 11.002  -33.619 1.00 30.45  ? 73  ILE D N     1 
ATOM   8572  C  CA    . ILE F  5 74  ? -16.218 9.984   -32.877 1.00 31.91  ? 73  ILE D CA    1 
ATOM   8573  C  C     . ILE F  5 74  ? -16.599 10.475  -31.481 1.00 34.66  ? 73  ILE D C     1 
ATOM   8574  O  O     . ILE F  5 74  ? -17.737 10.296  -31.047 1.00 34.64  ? 73  ILE D O     1 
ATOM   8575  C  CB    . ILE F  5 74  ? -15.425 8.667   -32.772 1.00 31.39  ? 73  ILE D CB    1 
ATOM   8576  C  CG1   . ILE F  5 74  ? -15.384 7.977   -34.138 1.00 30.25  ? 73  ILE D CG1   1 
ATOM   8577  C  CG2   . ILE F  5 74  ? -16.066 7.741   -31.756 1.00 25.70  ? 73  ILE D CG2   1 
ATOM   8578  C  CD1   . ILE F  5 74  ? -14.409 6.838   -34.225 1.00 28.48  ? 73  ILE D CD1   1 
ATOM   8579  N  N     . ALA F  5 75  ? -15.663 11.121  -30.793 1.00 32.79  ? 74  ALA D N     1 
ATOM   8580  C  CA    . ALA F  5 75  ? -15.921 11.604  -29.439 1.00 37.91  ? 74  ALA D CA    1 
ATOM   8581  C  C     . ALA F  5 75  ? -16.970 12.719  -29.420 1.00 38.78  ? 74  ALA D C     1 
ATOM   8582  O  O     . ALA F  5 75  ? -17.791 12.797  -28.510 1.00 35.21  ? 74  ALA D O     1 
ATOM   8583  C  CB    . ALA F  5 75  ? -14.629 12.083  -28.795 1.00 32.10  ? 74  ALA D CB    1 
ATOM   8584  N  N     . SER F  5 76  ? -16.934 13.583  -30.426 1.00 36.27  ? 75  SER D N     1 
ATOM   8585  C  CA    . SER F  5 76  ? -17.913 14.654  -30.528 1.00 39.84  ? 75  SER D CA    1 
ATOM   8586  C  C     . SER F  5 76  ? -19.295 14.073  -30.773 1.00 39.49  ? 75  SER D C     1 
ATOM   8587  O  O     . SER F  5 76  ? -20.256 14.436  -30.093 1.00 40.42  ? 75  SER D O     1 
ATOM   8588  C  CB    . SER F  5 76  ? -17.541 15.632  -31.642 1.00 30.39  ? 75  SER D CB    1 
ATOM   8589  O  OG    . SER F  5 76  ? -16.266 16.197  -31.402 1.00 40.15  ? 75  SER D OG    1 
ATOM   8590  N  N     . GLU F  5 77  ? -19.385 13.165  -31.739 1.00 38.37  ? 76  GLU D N     1 
ATOM   8591  C  CA    . GLU F  5 77  ? -20.656 12.524  -32.047 1.00 37.54  ? 76  GLU D CA    1 
ATOM   8592  C  C     . GLU F  5 77  ? -21.206 11.798  -30.823 1.00 41.75  ? 76  GLU D C     1 
ATOM   8593  O  O     . GLU F  5 77  ? -22.412 11.809  -30.570 1.00 46.41  ? 76  GLU D O     1 
ATOM   8594  C  CB    . GLU F  5 77  ? -20.498 11.547  -33.207 1.00 39.01  ? 76  GLU D CB    1 
ATOM   8595  C  CG    . GLU F  5 77  ? -21.806 10.930  -33.661 1.00 42.43  ? 76  GLU D CG    1 
ATOM   8596  C  CD    . GLU F  5 77  ? -22.773 11.962  -34.198 1.00 48.18  ? 76  GLU D CD    1 
ATOM   8597  O  OE1   . GLU F  5 77  ? -22.403 12.687  -35.148 1.00 49.93  ? 76  GLU D OE1   1 
ATOM   8598  O  OE2   . GLU F  5 77  ? -23.902 12.046  -33.670 1.00 50.97  ? 76  GLU D OE2   1 
ATOM   8599  N  N     . ALA F  5 78  ? -20.310 11.174  -30.066 1.00 40.45  ? 77  ALA D N     1 
ATOM   8600  C  CA    . ALA F  5 78  ? -20.692 10.448  -28.863 1.00 39.59  ? 77  ALA D CA    1 
ATOM   8601  C  C     . ALA F  5 78  ? -21.238 11.410  -27.827 1.00 40.31  ? 77  ALA D C     1 
ATOM   8602  O  O     . ALA F  5 78  ? -22.254 11.141  -27.192 1.00 44.03  ? 77  ALA D O     1 
ATOM   8603  C  CB    . ALA F  5 78  ? -19.511 9.680   -28.302 1.00 37.87  ? 77  ALA D CB    1 
ATOM   8604  N  N     . SER F  5 79  ? -20.548 12.534  -27.669 1.00 44.58  ? 78  SER D N     1 
ATOM   8605  C  CA    . SER F  5 79  ? -20.956 13.575  -26.736 1.00 41.04  ? 78  SER D CA    1 
ATOM   8606  C  C     . SER F  5 79  ? -22.369 14.008  -27.058 1.00 38.16  ? 78  SER D C     1 
ATOM   8607  O  O     . SER F  5 79  ? -23.249 14.024  -26.195 1.00 39.73  ? 78  SER D O     1 
ATOM   8608  C  CB    . SER F  5 79  ? -20.002 14.765  -26.812 1.00 35.62  ? 78  SER D CB    1 
ATOM   8609  O  OG    . SER F  5 79  ? -20.435 15.820  -25.975 1.00 47.17  ? 78  SER D OG    1 
ATOM   8610  N  N     . ARG F  5 80  ? -22.566 14.331  -28.330 1.00 42.66  ? 79  ARG D N     1 
ATOM   8611  C  CA    . ARG F  5 80  ? -23.846 14.778  -28.859 1.00 47.54  ? 79  ARG D CA    1 
ATOM   8612  C  C     . ARG F  5 80  ? -24.949 13.767  -28.591 1.00 47.98  ? 79  ARG D C     1 
ATOM   8613  O  O     . ARG F  5 80  ? -26.068 14.125  -28.202 1.00 51.64  ? 79  ARG D O     1 
ATOM   8614  C  CB    . ARG F  5 80  ? -23.723 15.027  -30.361 1.00 46.83  ? 79  ARG D CB    1 
ATOM   8615  C  CG    . ARG F  5 80  ? -24.187 16.392  -30.798 1.00 51.15  ? 79  ARG D CG    1 
ATOM   8616  C  CD    . ARG F  5 80  ? -23.870 16.626  -32.262 1.00 54.54  ? 79  ARG D CD    1 
ATOM   8617  N  NE    . ARG F  5 80  ? -22.474 16.989  -32.464 1.00 56.28  ? 79  ARG D NE    1 
ATOM   8618  C  CZ    . ARG F  5 80  ? -21.631 16.308  -33.229 1.00 52.09  ? 79  ARG D CZ    1 
ATOM   8619  N  NH1   . ARG F  5 80  ? -22.045 15.219  -33.865 1.00 45.34  ? 79  ARG D NH1   1 
ATOM   8620  N  NH2   . ARG F  5 80  ? -20.374 16.718  -33.356 1.00 54.44  ? 79  ARG D NH2   1 
ATOM   8621  N  N     . LEU F  5 81  ? -24.620 12.498  -28.801 1.00 52.07  ? 80  LEU D N     1 
ATOM   8622  C  CA    . LEU F  5 81  ? -25.568 11.410  -28.599 1.00 47.95  ? 80  LEU D CA    1 
ATOM   8623  C  C     . LEU F  5 81  ? -25.949 11.215  -27.129 1.00 45.90  ? 80  LEU D C     1 
ATOM   8624  O  O     . LEU F  5 81  ? -27.115 10.993  -26.813 1.00 44.42  ? 80  LEU D O     1 
ATOM   8625  C  CB    . LEU F  5 81  ? -24.993 10.119  -29.169 1.00 43.35  ? 80  LEU D CB    1 
ATOM   8626  C  CG    . LEU F  5 81  ? -26.001 9.226   -29.881 1.00 50.67  ? 80  LEU D CG    1 
ATOM   8627  C  CD1   . LEU F  5 81  ? -27.147 10.057  -30.415 1.00 49.01  ? 80  LEU D CD1   1 
ATOM   8628  C  CD2   . LEU F  5 81  ? -25.298 8.524   -31.005 1.00 46.14  ? 80  LEU D CD2   1 
ATOM   8629  N  N     . ALA F  5 82  ? -24.972 11.310  -26.233 1.00 40.92  ? 81  ALA D N     1 
ATOM   8630  C  CA    . ALA F  5 82  ? -25.268 11.266  -24.812 1.00 42.81  ? 81  ALA D CA    1 
ATOM   8631  C  C     . ALA F  5 82  ? -26.199 12.416  -24.464 1.00 53.26  ? 81  ALA D C     1 
ATOM   8632  O  O     . ALA F  5 82  ? -27.186 12.231  -23.751 1.00 53.06  ? 81  ALA D O     1 
ATOM   8633  C  CB    . ALA F  5 82  ? -23.995 11.336  -23.993 1.00 41.57  ? 81  ALA D CB    1 
ATOM   8634  N  N     . HIS F  5 83  ? -25.885 13.600  -24.989 1.00 54.39  ? 82  HIS D N     1 
ATOM   8635  C  CA    . HIS F  5 83  ? -26.675 14.794  -24.716 1.00 45.69  ? 82  HIS D CA    1 
ATOM   8636  C  C     . HIS F  5 83  ? -28.133 14.629  -25.134 1.00 46.72  ? 82  HIS D C     1 
ATOM   8637  O  O     . HIS F  5 83  ? -29.035 14.857  -24.333 1.00 51.19  ? 82  HIS D O     1 
ATOM   8638  C  CB    . HIS F  5 83  ? -26.071 16.008  -25.417 1.00 47.37  ? 82  HIS D CB    1 
ATOM   8639  C  CG    . HIS F  5 83  ? -26.645 17.314  -24.960 1.00 61.80  ? 82  HIS D CG    1 
ATOM   8640  N  ND1   . HIS F  5 83  ? -26.447 17.809  -23.689 1.00 64.97  ? 82  HIS D ND1   1 
ATOM   8641  C  CD2   . HIS F  5 83  ? -27.419 18.222  -25.602 1.00 60.86  ? 82  HIS D CD2   1 
ATOM   8642  C  CE1   . HIS F  5 83  ? -27.070 18.969  -23.569 1.00 63.32  ? 82  HIS D CE1   1 
ATOM   8643  N  NE2   . HIS F  5 83  ? -27.667 19.242  -24.715 1.00 61.71  ? 82  HIS D NE2   1 
ATOM   8644  N  N     . TYR F  5 84  ? -28.357 14.230  -26.383 1.00 50.23  ? 83  TYR D N     1 
ATOM   8645  C  CA    . TYR F  5 84  ? -29.716 14.099  -26.924 1.00 52.14  ? 83  TYR D CA    1 
ATOM   8646  C  C     . TYR F  5 84  ? -30.633 13.237  -26.059 1.00 55.48  ? 83  TYR D C     1 
ATOM   8647  O  O     . TYR F  5 84  ? -31.839 13.469  -25.996 1.00 53.78  ? 83  TYR D O     1 
ATOM   8648  C  CB    . TYR F  5 84  ? -29.680 13.509  -28.335 1.00 47.88  ? 83  TYR D CB    1 
ATOM   8649  C  CG    . TYR F  5 84  ? -28.967 14.368  -29.354 1.00 57.85  ? 83  TYR D CG    1 
ATOM   8650  C  CD1   . TYR F  5 84  ? -28.639 15.688  -29.077 1.00 54.01  ? 83  TYR D CD1   1 
ATOM   8651  C  CD2   . TYR F  5 84  ? -28.628 13.857  -30.600 1.00 59.09  ? 83  TYR D CD2   1 
ATOM   8652  C  CE1   . TYR F  5 84  ? -27.986 16.467  -30.005 1.00 55.87  ? 83  TYR D CE1   1 
ATOM   8653  C  CE2   . TYR F  5 84  ? -27.981 14.634  -31.539 1.00 50.87  ? 83  TYR D CE2   1 
ATOM   8654  C  CZ    . TYR F  5 84  ? -27.662 15.936  -31.236 1.00 56.44  ? 83  TYR D CZ    1 
ATOM   8655  O  OH    . TYR F  5 84  ? -27.020 16.709  -32.176 1.00 63.11  ? 83  TYR D OH    1 
ATOM   8656  N  N     . ASN F  5 85  ? -30.056 12.242  -25.396 1.00 56.30  ? 84  ASN D N     1 
ATOM   8657  C  CA    . ASN F  5 85  ? -30.833 11.307  -24.599 1.00 51.81  ? 84  ASN D CA    1 
ATOM   8658  C  C     . ASN F  5 85  ? -30.668 11.545  -23.106 1.00 53.11  ? 84  ASN D C     1 
ATOM   8659  O  O     . ASN F  5 85  ? -30.795 10.619  -22.302 1.00 53.23  ? 84  ASN D O     1 
ATOM   8660  C  CB    . ASN F  5 85  ? -30.442 9.877   -24.957 1.00 48.89  ? 84  ASN D CB    1 
ATOM   8661  C  CG    . ASN F  5 85  ? -30.715 9.558   -26.407 1.00 49.44  ? 84  ASN D CG    1 
ATOM   8662  O  OD1   . ASN F  5 85  ? -31.840 9.226   -26.774 1.00 63.46  ? 84  ASN D OD1   1 
ATOM   8663  N  ND2   . ASN F  5 85  ? -29.693 9.674   -27.245 1.00 45.26  ? 84  ASN D ND2   1 
ATOM   8664  N  N     . LYS F  5 86  ? -30.380 12.794  -22.752 1.00 58.62  ? 85  LYS D N     1 
ATOM   8665  C  CA    . LYS F  5 86  ? -30.274 13.227  -21.361 1.00 56.21  ? 85  LYS D CA    1 
ATOM   8666  C  C     . LYS F  5 86  ? -29.399 12.298  -20.523 1.00 49.34  ? 85  LYS D C     1 
ATOM   8667  O  O     . LYS F  5 86  ? -29.662 12.088  -19.343 1.00 59.60  ? 85  LYS D O     1 
ATOM   8668  C  CB    . LYS F  5 86  ? -31.666 13.334  -20.737 1.00 55.39  ? 85  LYS D CB    1 
ATOM   8669  C  CG    . LYS F  5 86  ? -32.660 14.158  -21.551 1.00 58.55  ? 85  LYS D CG    1 
ATOM   8670  C  CD    . LYS F  5 86  ? -34.090 13.860  -21.115 1.00 72.43  ? 85  LYS D CD    1 
ATOM   8671  C  CE    . LYS F  5 86  ? -35.112 14.628  -21.939 1.00 79.30  ? 85  LYS D CE    1 
ATOM   8672  N  NZ    . LYS F  5 86  ? -36.508 14.320  -21.506 1.00 76.24  ? 85  LYS D NZ    1 
ATOM   8673  N  N     . ARG F  5 87  ? -28.368 11.734  -21.143 1.00 49.46  ? 86  ARG D N     1 
ATOM   8674  C  CA    . ARG F  5 87  ? -27.433 10.867  -20.435 1.00 56.68  ? 86  ARG D CA    1 
ATOM   8675  C  C     . ARG F  5 87  ? -26.152 11.624  -20.104 1.00 51.37  ? 86  ARG D C     1 
ATOM   8676  O  O     . ARG F  5 87  ? -25.742 12.526  -20.833 1.00 55.69  ? 86  ARG D O     1 
ATOM   8677  C  CB    . ARG F  5 87  ? -27.122 9.613   -21.260 1.00 54.11  ? 86  ARG D CB    1 
ATOM   8678  C  CG    . ARG F  5 87  ? -28.281 8.627   -21.349 1.00 63.72  ? 86  ARG D CG    1 
ATOM   8679  C  CD    . ARG F  5 87  ? -27.813 7.253   -21.817 1.00 80.64  ? 86  ARG D CD    1 
ATOM   8680  N  NE    . ARG F  5 87  ? -28.878 6.253   -21.759 1.00 87.48  ? 86  ARG D NE    1 
ATOM   8681  C  CZ    . ARG F  5 87  ? -29.623 5.890   -22.800 1.00 89.71  ? 86  ARG D CZ    1 
ATOM   8682  N  NH1   . ARG F  5 87  ? -29.423 6.443   -23.989 1.00 81.13  ? 86  ARG D NH1   1 
ATOM   8683  N  NH2   . ARG F  5 87  ? -30.571 4.973   -22.655 1.00 95.70  ? 86  ARG D NH2   1 
ATOM   8684  N  N     . SER F  5 88  ? -25.525 11.260  -18.994 1.00 50.45  ? 87  SER D N     1 
ATOM   8685  C  CA    . SER F  5 88  ? -24.334 11.962  -18.543 1.00 52.94  ? 87  SER D CA    1 
ATOM   8686  C  C     . SER F  5 88  ? -23.074 11.122  -18.730 1.00 52.34  ? 87  SER D C     1 
ATOM   8687  O  O     . SER F  5 88  ? -21.966 11.573  -18.432 1.00 50.83  ? 87  SER D O     1 
ATOM   8688  C  CB    . SER F  5 88  ? -24.486 12.368  -17.077 1.00 55.41  ? 87  SER D CB    1 
ATOM   8689  O  OG    . SER F  5 88  ? -25.064 11.320  -16.322 1.00 63.16  ? 87  SER D OG    1 
ATOM   8690  N  N     . THR F  5 89  ? -23.244 9.904   -19.232 1.00 55.27  ? 88  THR D N     1 
ATOM   8691  C  CA    . THR F  5 89  ? -22.118 8.993   -19.403 1.00 56.81  ? 88  THR D CA    1 
ATOM   8692  C  C     . THR F  5 89  ? -21.989 8.496   -20.840 1.00 50.73  ? 88  THR D C     1 
ATOM   8693  O  O     . THR F  5 89  ? -22.964 8.041   -21.444 1.00 48.64  ? 88  THR D O     1 
ATOM   8694  C  CB    . THR F  5 89  ? -22.239 7.776   -18.471 1.00 56.26  ? 88  THR D CB    1 
ATOM   8695  O  OG1   . THR F  5 89  ? -22.768 8.191   -17.207 1.00 57.51  ? 88  THR D OG1   1 
ATOM   8696  C  CG2   . THR F  5 89  ? -20.878 7.122   -18.268 1.00 53.47  ? 88  THR D CG2   1 
ATOM   8697  N  N     . ILE F  5 90  ? -20.780 8.591   -21.383 1.00 41.99  ? 89  ILE D N     1 
ATOM   8698  C  CA    . ILE F  5 90  ? -20.488 8.032   -22.694 1.00 42.39  ? 89  ILE D CA    1 
ATOM   8699  C  C     . ILE F  5 90  ? -20.000 6.597   -22.522 1.00 48.49  ? 89  ILE D C     1 
ATOM   8700  O  O     . ILE F  5 90  ? -18.881 6.353   -22.060 1.00 43.69  ? 89  ILE D O     1 
ATOM   8701  C  CB    . ILE F  5 90  ? -19.432 8.863   -23.456 1.00 37.18  ? 89  ILE D CB    1 
ATOM   8702  C  CG1   . ILE F  5 90  ? -20.009 10.224  -23.849 1.00 44.51  ? 89  ILE D CG1   1 
ATOM   8703  C  CG2   . ILE F  5 90  ? -18.963 8.123   -24.693 1.00 40.76  ? 89  ILE D CG2   1 
ATOM   8704  C  CD1   . ILE F  5 90  ? -19.000 11.173  -24.463 1.00 36.73  ? 89  ILE D CD1   1 
ATOM   8705  N  N     . THR F  5 91  ? -20.855 5.647   -22.874 1.00 41.06  ? 90  THR D N     1 
ATOM   8706  C  CA    . THR F  5 91  ? -20.489 4.246   -22.780 1.00 40.56  ? 90  THR D CA    1 
ATOM   8707  C  C     . THR F  5 91  ? -20.012 3.737   -24.130 1.00 41.96  ? 90  THR D C     1 
ATOM   8708  O  O     . THR F  5 91  ? -19.987 4.482   -25.114 1.00 44.10  ? 90  THR D O     1 
ATOM   8709  C  CB    . THR F  5 91  ? -21.666 3.389   -22.302 1.00 40.02  ? 90  THR D CB    1 
ATOM   8710  O  OG1   . THR F  5 91  ? -22.633 3.275   -23.354 1.00 40.85  ? 90  THR D OG1   1 
ATOM   8711  C  CG2   . THR F  5 91  ? -22.316 4.019   -21.082 1.00 36.02  ? 90  THR D CG2   1 
ATOM   8712  N  N     . SER F  5 92  ? -19.640 2.462   -24.171 1.00 38.87  ? 91  SER D N     1 
ATOM   8713  C  CA    . SER F  5 92  ? -19.222 1.820   -25.409 1.00 36.33  ? 91  SER D CA    1 
ATOM   8714  C  C     . SER F  5 92  ? -20.335 1.869   -26.445 1.00 34.69  ? 91  SER D C     1 
ATOM   8715  O  O     . SER F  5 92  ? -20.071 1.898   -27.646 1.00 39.02  ? 91  SER D O     1 
ATOM   8716  C  CB    . SER F  5 92  ? -18.802 0.368   -25.151 1.00 41.23  ? 91  SER D CB    1 
ATOM   8717  O  OG    . SER F  5 92  ? -19.867 -0.386  -24.596 1.00 40.43  ? 91  SER D OG    1 
ATOM   8718  N  N     . ARG F  5 93  ? -21.579 1.890   -25.972 1.00 36.03  ? 92  ARG D N     1 
ATOM   8719  C  CA    . ARG F  5 93  ? -22.749 1.978   -26.845 1.00 37.25  ? 92  ARG D CA    1 
ATOM   8720  C  C     . ARG F  5 93  ? -22.801 3.302   -27.631 1.00 38.79  ? 92  ARG D C     1 
ATOM   8721  O  O     . ARG F  5 93  ? -23.138 3.329   -28.825 1.00 34.60  ? 92  ARG D O     1 
ATOM   8722  C  CB    . ARG F  5 93  ? -24.019 1.802   -26.014 1.00 34.29  ? 92  ARG D CB    1 
ATOM   8723  C  CG    . ARG F  5 93  ? -25.256 1.532   -26.830 1.00 36.42  ? 92  ARG D CG    1 
ATOM   8724  C  CD    . ARG F  5 93  ? -26.401 1.074   -25.955 1.00 35.35  ? 92  ARG D CD    1 
ATOM   8725  N  NE    . ARG F  5 93  ? -27.600 0.840   -26.752 1.00 52.67  ? 92  ARG D NE    1 
ATOM   8726  C  CZ    . ARG F  5 93  ? -28.542 1.751   -26.971 1.00 56.82  ? 92  ARG D CZ    1 
ATOM   8727  N  NH1   . ARG F  5 93  ? -28.437 2.962   -26.436 1.00 51.94  ? 92  ARG D NH1   1 
ATOM   8728  N  NH2   . ARG F  5 93  ? -29.597 1.445   -27.717 1.00 55.30  ? 92  ARG D NH2   1 
ATOM   8729  N  N     . GLU F  5 94  ? -22.456 4.399   -26.961 1.00 38.45  ? 93  GLU D N     1 
ATOM   8730  C  CA    . GLU F  5 94  ? -22.378 5.690   -27.627 1.00 38.69  ? 93  GLU D CA    1 
ATOM   8731  C  C     . GLU F  5 94  ? -21.289 5.675   -28.692 1.00 37.68  ? 93  GLU D C     1 
ATOM   8732  O  O     . GLU F  5 94  ? -21.522 6.095   -29.825 1.00 39.44  ? 93  GLU D O     1 
ATOM   8733  C  CB    . GLU F  5 94  ? -22.120 6.813   -26.623 1.00 40.71  ? 93  GLU D CB    1 
ATOM   8734  C  CG    . GLU F  5 94  ? -23.384 7.370   -25.983 1.00 46.31  ? 93  GLU D CG    1 
ATOM   8735  C  CD    . GLU F  5 94  ? -24.017 6.406   -25.001 1.00 47.55  ? 93  GLU D CD    1 
ATOM   8736  O  OE1   . GLU F  5 94  ? -23.274 5.842   -24.168 1.00 47.18  ? 93  GLU D OE1   1 
ATOM   8737  O  OE2   . GLU F  5 94  ? -25.250 6.213   -25.062 1.00 45.34  ? 93  GLU D OE2   1 
ATOM   8738  N  N     . ILE F  5 95  ? -20.108 5.188   -28.326 1.00 34.33  ? 94  ILE D N     1 
ATOM   8739  C  CA    . ILE F  5 95  ? -18.998 5.094   -29.265 1.00 31.52  ? 94  ILE D CA    1 
ATOM   8740  C  C     . ILE F  5 95  ? -19.416 4.290   -30.484 1.00 34.72  ? 94  ILE D C     1 
ATOM   8741  O  O     . ILE F  5 95  ? -19.099 4.639   -31.622 1.00 34.59  ? 94  ILE D O     1 
ATOM   8742  C  CB    . ILE F  5 95  ? -17.762 4.436   -28.624 1.00 33.65  ? 94  ILE D CB    1 
ATOM   8743  C  CG1   . ILE F  5 95  ? -17.295 5.241   -27.411 1.00 37.95  ? 94  ILE D CG1   1 
ATOM   8744  C  CG2   . ILE F  5 95  ? -16.637 4.309   -29.640 1.00 29.91  ? 94  ILE D CG2   1 
ATOM   8745  C  CD1   . ILE F  5 95  ? -16.881 6.662   -27.742 1.00 32.82  ? 94  ILE D CD1   1 
ATOM   8746  N  N     . GLN F  5 96  ? -20.152 3.216   -30.234 1.00 35.76  ? 95  GLN D N     1 
ATOM   8747  C  CA    . GLN F  5 96  ? -20.612 2.346   -31.305 1.00 37.90  ? 95  GLN D CA    1 
ATOM   8748  C  C     . GLN F  5 96  ? -21.565 3.064   -32.264 1.00 35.02  ? 95  GLN D C     1 
ATOM   8749  O  O     . GLN F  5 96  ? -21.374 3.022   -33.484 1.00 37.33  ? 95  GLN D O     1 
ATOM   8750  C  CB    . GLN F  5 96  ? -21.286 1.107   -30.718 1.00 38.05  ? 95  GLN D CB    1 
ATOM   8751  C  CG    . GLN F  5 96  ? -21.838 0.159   -31.758 1.00 40.85  ? 95  GLN D CG    1 
ATOM   8752  C  CD    . GLN F  5 96  ? -22.020 -1.234  -31.208 1.00 37.69  ? 95  GLN D CD    1 
ATOM   8753  O  OE1   . GLN F  5 96  ? -21.103 -2.051  -31.248 1.00 39.71  ? 95  GLN D OE1   1 
ATOM   8754  N  NE2   . GLN F  5 96  ? -23.203 -1.511  -30.677 1.00 41.12  ? 95  GLN D NE2   1 
ATOM   8755  N  N     . THR F  5 97  ? -22.587 3.724   -31.725 1.00 33.61  ? 96  THR D N     1 
ATOM   8756  C  CA    . THR F  5 97  ? -23.527 4.419   -32.597 1.00 34.87  ? 96  THR D CA    1 
ATOM   8757  C  C     . THR F  5 97  ? -22.809 5.527   -33.372 1.00 32.71  ? 96  THR D C     1 
ATOM   8758  O  O     . THR F  5 97  ? -23.066 5.740   -34.557 1.00 31.29  ? 96  THR D O     1 
ATOM   8759  C  CB    . THR F  5 97  ? -24.702 5.023   -31.811 1.00 41.17  ? 96  THR D CB    1 
ATOM   8760  O  OG1   . THR F  5 97  ? -25.336 4.002   -31.033 1.00 46.70  ? 96  THR D OG1   1 
ATOM   8761  C  CG2   . THR F  5 97  ? -25.725 5.613   -32.767 1.00 34.04  ? 96  THR D CG2   1 
ATOM   8762  N  N     . ALA F  5 98  ? -21.895 6.217   -32.698 1.00 30.40  ? 97  ALA D N     1 
ATOM   8763  C  CA    . ALA F  5 98  ? -21.110 7.268   -33.330 1.00 31.60  ? 97  ALA D CA    1 
ATOM   8764  C  C     . ALA F  5 98  ? -20.327 6.710   -34.506 1.00 35.62  ? 97  ALA D C     1 
ATOM   8765  O  O     . ALA F  5 98  ? -20.273 7.313   -35.585 1.00 35.85  ? 97  ALA D O     1 
ATOM   8766  C  CB    . ALA F  5 98  ? -20.171 7.906   -32.324 1.00 35.81  ? 97  ALA D CB    1 
ATOM   8767  N  N     . VAL F  5 99  ? -19.722 5.549   -34.286 1.00 34.44  ? 98  VAL D N     1 
ATOM   8768  C  CA    . VAL F  5 99  ? -18.996 4.849   -35.334 1.00 33.08  ? 98  VAL D CA    1 
ATOM   8769  C  C     . VAL F  5 99  ? -19.904 4.525   -36.517 1.00 31.00  ? 98  VAL D C     1 
ATOM   8770  O  O     . VAL F  5 99  ? -19.518 4.718   -37.671 1.00 31.93  ? 98  VAL D O     1 
ATOM   8771  C  CB    . VAL F  5 99  ? -18.362 3.552   -34.802 1.00 33.25  ? 98  VAL D CB    1 
ATOM   8772  C  CG1   . VAL F  5 99  ? -18.038 2.605   -35.942 1.00 35.14  ? 98  VAL D CG1   1 
ATOM   8773  C  CG2   . VAL F  5 99  ? -17.112 3.867   -33.986 1.00 34.62  ? 98  VAL D CG2   1 
ATOM   8774  N  N     . ARG F  5 100 ? -21.114 4.046   -36.238 1.00 34.46  ? 99  ARG D N     1 
ATOM   8775  C  CA    . ARG F  5 100 ? -22.028 3.672   -37.320 1.00 36.76  ? 99  ARG D CA    1 
ATOM   8776  C  C     . ARG F  5 100 ? -22.513 4.894   -38.088 1.00 34.34  ? 99  ARG D C     1 
ATOM   8777  O  O     . ARG F  5 100 ? -22.836 4.795   -39.272 1.00 34.20  ? 99  ARG D O     1 
ATOM   8778  C  CB    . ARG F  5 100 ? -23.224 2.880   -36.784 1.00 37.57  ? 99  ARG D CB    1 
ATOM   8779  C  CG    . ARG F  5 100 ? -22.903 1.430   -36.413 1.00 44.19  ? 99  ARG D CG    1 
ATOM   8780  C  CD    . ARG F  5 100 ? -24.182 0.621   -36.220 1.00 48.56  ? 99  ARG D CD    1 
ATOM   8781  N  NE    . ARG F  5 100 ? -23.937 -0.716  -35.686 1.00 54.14  ? 99  ARG D NE    1 
ATOM   8782  C  CZ    . ARG F  5 100 ? -23.682 -1.787  -36.436 1.00 66.11  ? 99  ARG D CZ    1 
ATOM   8783  N  NH1   . ARG F  5 100 ? -23.625 -1.681  -37.758 1.00 56.87  ? 99  ARG D NH1   1 
ATOM   8784  N  NH2   . ARG F  5 100 ? -23.475 -2.967  -35.865 1.00 65.00  ? 99  ARG D NH2   1 
ATOM   8785  N  N     . LEU F  5 101 ? -22.555 6.043   -37.413 1.00 34.32  ? 100 LEU D N     1 
ATOM   8786  C  CA    . LEU F  5 101 ? -22.951 7.300   -38.051 1.00 35.06  ? 100 LEU D CA    1 
ATOM   8787  C  C     . LEU F  5 101 ? -21.838 7.873   -38.921 1.00 38.42  ? 100 LEU D C     1 
ATOM   8788  O  O     . LEU F  5 101 ? -22.090 8.329   -40.033 1.00 50.02  ? 100 LEU D O     1 
ATOM   8789  C  CB    . LEU F  5 101 ? -23.356 8.342   -37.006 1.00 34.62  ? 100 LEU D CB    1 
ATOM   8790  C  CG    . LEU F  5 101 ? -24.669 8.142   -36.248 1.00 37.04  ? 100 LEU D CG    1 
ATOM   8791  C  CD1   . LEU F  5 101 ? -24.765 9.144   -35.108 1.00 29.82  ? 100 LEU D CD1   1 
ATOM   8792  C  CD2   . LEU F  5 101 ? -25.858 8.273   -37.186 1.00 36.59  ? 100 LEU D CD2   1 
ATOM   8793  N  N     . LEU F  5 102 ? -20.609 7.842   -38.416 1.00 34.41  ? 101 LEU D N     1 
ATOM   8794  C  CA    . LEU F  5 102 ? -19.493 8.499   -39.087 1.00 27.38  ? 101 LEU D CA    1 
ATOM   8795  C  C     . LEU F  5 102 ? -18.860 7.680   -40.205 1.00 36.12  ? 101 LEU D C     1 
ATOM   8796  O  O     . LEU F  5 102 ? -18.515 8.227   -41.251 1.00 43.96  ? 101 LEU D O     1 
ATOM   8797  C  CB    . LEU F  5 102 ? -18.427 8.872   -38.061 1.00 29.35  ? 101 LEU D CB    1 
ATOM   8798  C  CG    . LEU F  5 102 ? -18.844 10.066  -37.197 1.00 44.46  ? 101 LEU D CG    1 
ATOM   8799  C  CD1   . LEU F  5 102 ? -18.210 10.006  -35.823 1.00 36.06  ? 101 LEU D CD1   1 
ATOM   8800  C  CD2   . LEU F  5 102 ? -18.496 11.383  -37.889 1.00 41.28  ? 101 LEU D CD2   1 
ATOM   8801  N  N     . LEU F  5 103 ? -18.704 6.377   -40.001 1.00 35.75  ? 102 LEU D N     1 
ATOM   8802  C  CA    . LEU F  5 103 ? -17.956 5.570   -40.962 1.00 34.34  ? 102 LEU D CA    1 
ATOM   8803  C  C     . LEU F  5 103 ? -18.858 4.972   -42.040 1.00 33.90  ? 102 LEU D C     1 
ATOM   8804  O  O     . LEU F  5 103 ? -19.972 4.546   -41.755 1.00 44.67  ? 102 LEU D O     1 
ATOM   8805  C  CB    . LEU F  5 103 ? -17.194 4.457   -40.243 1.00 35.59  ? 102 LEU D CB    1 
ATOM   8806  C  CG    . LEU F  5 103 ? -16.299 4.847   -39.062 1.00 36.66  ? 102 LEU D CG    1 
ATOM   8807  C  CD1   . LEU F  5 103 ? -15.333 3.715   -38.738 1.00 39.68  ? 102 LEU D CD1   1 
ATOM   8808  C  CD2   . LEU F  5 103 ? -15.536 6.133   -39.330 1.00 38.78  ? 102 LEU D CD2   1 
ATOM   8809  N  N     . PRO F  5 104 ? -18.377 4.946   -43.291 1.00 32.06  ? 103 PRO D N     1 
ATOM   8810  C  CA    . PRO F  5 104 ? -19.127 4.317   -44.385 1.00 37.40  ? 103 PRO D CA    1 
ATOM   8811  C  C     . PRO F  5 104 ? -19.191 2.792   -44.233 1.00 42.44  ? 103 PRO D C     1 
ATOM   8812  O  O     . PRO F  5 104 ? -18.313 2.209   -43.599 1.00 40.21  ? 103 PRO D O     1 
ATOM   8813  C  CB    . PRO F  5 104 ? -18.334 4.718   -45.630 1.00 32.68  ? 103 PRO D CB    1 
ATOM   8814  C  CG    . PRO F  5 104 ? -16.954 4.962   -45.129 1.00 32.94  ? 103 PRO D CG    1 
ATOM   8815  C  CD    . PRO F  5 104 ? -17.118 5.547   -43.760 1.00 34.28  ? 103 PRO D CD    1 
ATOM   8816  N  N     . GLY F  5 105 ? -20.216 2.184   -44.828 1.00 36.25  ? 104 GLY D N     1 
ATOM   8817  C  CA    . GLY F  5 105 ? -20.581 0.788   -44.635 1.00 34.58  ? 104 GLY D CA    1 
ATOM   8818  C  C     . GLY F  5 105 ? -19.579 -0.211  -44.088 1.00 38.91  ? 104 GLY D C     1 
ATOM   8819  O  O     . GLY F  5 105 ? -19.558 -0.499  -42.887 1.00 45.32  ? 104 GLY D O     1 
ATOM   8820  N  N     . GLU F  5 106 ? -18.747 -0.741  -44.975 1.00 40.28  ? 105 GLU D N     1 
ATOM   8821  C  CA    . GLU F  5 106 ? -17.858 -1.848  -44.644 1.00 41.45  ? 105 GLU D CA    1 
ATOM   8822  C  C     . GLU F  5 106 ? -16.884 -1.484  -43.526 1.00 43.19  ? 105 GLU D C     1 
ATOM   8823  O  O     . GLU F  5 106 ? -16.685 -2.254  -42.575 1.00 55.56  ? 105 GLU D O     1 
ATOM   8824  C  CB    . GLU F  5 106 ? -17.097 -2.289  -45.892 1.00 43.52  ? 105 GLU D CB    1 
ATOM   8825  C  CG    . GLU F  5 106 ? -16.623 -3.731  -45.870 1.00 58.55  ? 105 GLU D CG    1 
ATOM   8826  C  CD    . GLU F  5 106 ? -17.758 -4.743  -45.940 1.00 70.38  ? 105 GLU D CD    1 
ATOM   8827  O  OE1   . GLU F  5 106 ? -18.917 -4.347  -46.200 1.00 68.08  ? 105 GLU D OE1   1 
ATOM   8828  O  OE2   . GLU F  5 106 ? -17.483 -5.945  -45.742 1.00 76.66  ? 105 GLU D OE2   1 
ATOM   8829  N  N     . LEU F  5 107 ? -16.289 -0.303  -43.650 1.00 43.02  ? 106 LEU D N     1 
ATOM   8830  C  CA    . LEU F  5 107 ? -15.403 0.245   -42.631 1.00 37.55  ? 106 LEU D CA    1 
ATOM   8831  C  C     . LEU F  5 107 ? -16.089 0.216   -41.275 1.00 39.72  ? 106 LEU D C     1 
ATOM   8832  O  O     . LEU F  5 107 ? -15.505 -0.195  -40.269 1.00 42.88  ? 106 LEU D O     1 
ATOM   8833  C  CB    . LEU F  5 107 ? -15.009 1.676   -42.992 1.00 34.59  ? 106 LEU D CB    1 
ATOM   8834  C  CG    . LEU F  5 107 ? -13.526 2.029   -43.046 1.00 38.28  ? 106 LEU D CG    1 
ATOM   8835  C  CD1   . LEU F  5 107 ? -12.791 1.044   -43.923 1.00 36.69  ? 106 LEU D CD1   1 
ATOM   8836  C  CD2   . LEU F  5 107 ? -13.347 3.445   -43.574 1.00 35.55  ? 106 LEU D CD2   1 
ATOM   8837  N  N     . ALA F  5 108 ? -17.347 0.642   -41.267 1.00 45.81  ? 107 ALA D N     1 
ATOM   8838  C  CA    . ALA F  5 108 ? -18.125 0.710   -40.042 1.00 40.61  ? 107 ALA D CA    1 
ATOM   8839  C  C     . ALA F  5 108 ? -18.304 -0.683  -39.460 1.00 41.76  ? 107 ALA D C     1 
ATOM   8840  O  O     . ALA F  5 108 ? -18.010 -0.903  -38.293 1.00 38.61  ? 107 ALA D O     1 
ATOM   8841  C  CB    . ALA F  5 108 ? -19.468 1.366   -40.299 1.00 29.86  ? 107 ALA D CB    1 
ATOM   8842  N  N     . LYS F  5 109 ? -18.767 -1.617  -40.287 1.00 42.53  ? 108 LYS D N     1 
ATOM   8843  C  CA    . LYS F  5 109 ? -18.987 -3.005  -39.874 1.00 39.61  ? 108 LYS D CA    1 
ATOM   8844  C  C     . LYS F  5 109 ? -17.749 -3.635  -39.209 1.00 41.84  ? 108 LYS D C     1 
ATOM   8845  O  O     . LYS F  5 109 ? -17.826 -4.212  -38.106 1.00 40.34  ? 108 LYS D O     1 
ATOM   8846  C  CB    . LYS F  5 109 ? -19.425 -3.823  -41.090 1.00 38.86  ? 108 LYS D CB    1 
ATOM   8847  C  CG    . LYS F  5 109 ? -19.209 -5.321  -40.987 1.00 60.73  ? 108 LYS D CG    1 
ATOM   8848  C  CD    . LYS F  5 109 ? -19.656 -6.018  -42.272 1.00 65.19  ? 108 LYS D CD    1 
ATOM   8849  C  CE    . LYS F  5 109 ? -18.971 -7.365  -42.456 1.00 61.21  ? 108 LYS D CE    1 
ATOM   8850  N  NZ    . LYS F  5 109 ? -19.371 -8.026  -43.733 1.00 70.20  ? 108 LYS D NZ    1 
ATOM   8851  N  N     . HIS F  5 110 ? -16.601 -3.498  -39.862 1.00 41.11  ? 109 HIS D N     1 
ATOM   8852  C  CA    . HIS F  5 110 ? -15.368 -4.030  -39.288 1.00 43.07  ? 109 HIS D CA    1 
ATOM   8853  C  C     . HIS F  5 110 ? -14.957 -3.289  -37.997 1.00 41.65  ? 109 HIS D C     1 
ATOM   8854  O  O     . HIS F  5 110 ? -14.501 -3.916  -37.028 1.00 41.52  ? 109 HIS D O     1 
ATOM   8855  C  CB    . HIS F  5 110 ? -14.249 -3.986  -40.331 1.00 42.32  ? 109 HIS D CB    1 
ATOM   8856  C  CG    . HIS F  5 110 ? -14.466 -4.925  -41.479 1.00 48.03  ? 109 HIS D CG    1 
ATOM   8857  N  ND1   . HIS F  5 110 ? -13.959 -4.692  -42.745 1.00 54.08  ? 109 HIS D ND1   1 
ATOM   8858  C  CD2   . HIS F  5 110 ? -15.129 -6.103  -41.558 1.00 46.07  ? 109 HIS D CD2   1 
ATOM   8859  C  CE1   . HIS F  5 110 ? -14.308 -5.679  -43.546 1.00 47.67  ? 109 HIS D CE1   1 
ATOM   8860  N  NE2   . HIS F  5 110 ? -15.019 -6.552  -42.850 1.00 49.69  ? 109 HIS D NE2   1 
ATOM   8861  N  N     . ALA F  5 111 ? -15.141 -1.969  -37.970 1.00 41.87  ? 110 ALA D N     1 
ATOM   8862  C  CA    . ALA F  5 111 ? -14.859 -1.185  -36.762 1.00 39.17  ? 110 ALA D CA    1 
ATOM   8863  C  C     . ALA F  5 111 ? -15.700 -1.653  -35.566 1.00 36.52  ? 110 ALA D C     1 
ATOM   8864  O  O     . ALA F  5 111 ? -15.179 -1.839  -34.462 1.00 32.79  ? 110 ALA D O     1 
ATOM   8865  C  CB    . ALA F  5 111 ? -15.093 0.303   -37.027 1.00 36.73  ? 110 ALA D CB    1 
ATOM   8866  N  N     . VAL F  5 112 ? -16.998 -1.838  -35.798 1.00 36.84  ? 111 VAL D N     1 
ATOM   8867  C  CA    . VAL F  5 112 ? -17.918 -2.356  -34.788 1.00 41.30  ? 111 VAL D CA    1 
ATOM   8868  C  C     . VAL F  5 112 ? -17.453 -3.705  -34.276 1.00 40.98  ? 111 VAL D C     1 
ATOM   8869  O  O     . VAL F  5 112 ? -17.433 -3.948  -33.062 1.00 41.74  ? 111 VAL D O     1 
ATOM   8870  C  CB    . VAL F  5 112 ? -19.350 -2.515  -35.334 1.00 42.14  ? 111 VAL D CB    1 
ATOM   8871  C  CG1   . VAL F  5 112 ? -20.242 -3.150  -34.286 1.00 34.51  ? 111 VAL D CG1   1 
ATOM   8872  C  CG2   . VAL F  5 112 ? -19.909 -1.170  -35.760 1.00 50.33  ? 111 VAL D CG2   1 
ATOM   8873  N  N     . SER F  5 113 ? -17.081 -4.581  -35.208 1.00 41.05  ? 112 SER D N     1 
ATOM   8874  C  CA    . SER F  5 113 ? -16.531 -5.883  -34.832 1.00 36.26  ? 112 SER D CA    1 
ATOM   8875  C  C     . SER F  5 113 ? -15.366 -5.743  -33.851 1.00 38.98  ? 112 SER D C     1 
ATOM   8876  O  O     . SER F  5 113 ? -15.413 -6.265  -32.727 1.00 44.21  ? 112 SER D O     1 
ATOM   8877  C  CB    . SER F  5 113 ? -16.076 -6.647  -36.072 1.00 39.96  ? 112 SER D CB    1 
ATOM   8878  O  OG    . SER F  5 113 ? -15.358 -7.812  -35.710 1.00 58.36  ? 112 SER D OG    1 
ATOM   8879  N  N     . GLU F  5 114 ? -14.332 -5.022  -34.281 1.00 44.04  ? 113 GLU D N     1 
ATOM   8880  C  CA    . GLU F  5 114 ? -13.134 -4.816  -33.465 1.00 44.28  ? 113 GLU D CA    1 
ATOM   8881  C  C     . GLU F  5 114 ? -13.444 -4.220  -32.088 1.00 42.06  ? 113 GLU D C     1 
ATOM   8882  O  O     . GLU F  5 114 ? -12.876 -4.636  -31.070 1.00 43.67  ? 113 GLU D O     1 
ATOM   8883  C  CB    . GLU F  5 114 ? -12.149 -3.915  -34.209 1.00 31.93  ? 113 GLU D CB    1 
ATOM   8884  C  CG    . GLU F  5 114 ? -11.594 -4.531  -35.479 1.00 41.57  ? 113 GLU D CG    1 
ATOM   8885  C  CD    . GLU F  5 114 ? -10.328 -5.333  -35.238 1.00 58.17  ? 113 GLU D CD    1 
ATOM   8886  O  OE1   . GLU F  5 114 ? -9.253  -4.709  -35.086 1.00 61.85  ? 113 GLU D OE1   1 
ATOM   8887  O  OE2   . GLU F  5 114 ? -10.406 -6.581  -35.200 1.00 51.71  ? 113 GLU D OE2   1 
ATOM   8888  N  N     . GLY F  5 115 ? -14.349 -3.248  -32.062 1.00 36.25  ? 114 GLY D N     1 
ATOM   8889  C  CA    . GLY F  5 115 ? -14.719 -2.600  -30.820 1.00 40.50  ? 114 GLY D CA    1 
ATOM   8890  C  C     . GLY F  5 115 ? -15.374 -3.561  -29.851 1.00 37.81  ? 114 GLY D C     1 
ATOM   8891  O  O     . GLY F  5 115 ? -14.997 -3.628  -28.677 1.00 39.63  ? 114 GLY D O     1 
ATOM   8892  N  N     . THR F  5 116 ? -16.358 -4.307  -30.346 1.00 39.39  ? 115 THR D N     1 
ATOM   8893  C  CA    . THR F  5 116 ? -17.051 -5.296  -29.526 1.00 41.17  ? 115 THR D CA    1 
ATOM   8894  C  C     . THR F  5 116 ? -16.087 -6.335  -28.964 1.00 36.69  ? 115 THR D C     1 
ATOM   8895  O  O     . THR F  5 116 ? -16.147 -6.671  -27.779 1.00 40.76  ? 115 THR D O     1 
ATOM   8896  C  CB    . THR F  5 116 ? -18.148 -6.027  -30.315 1.00 38.11  ? 115 THR D CB    1 
ATOM   8897  O  OG1   . THR F  5 116 ? -19.068 -5.071  -30.854 1.00 42.96  ? 115 THR D OG1   1 
ATOM   8898  C  CG2   . THR F  5 116 ? -18.898 -6.991  -29.408 1.00 36.22  ? 115 THR D CG2   1 
ATOM   8899  N  N     . LYS F  5 117 ? -15.192 -6.836  -29.810 1.00 35.24  ? 116 LYS D N     1 
ATOM   8900  C  CA    . LYS F  5 117 ? -14.269 -7.873  -29.360 1.00 39.00  ? 116 LYS D CA    1 
ATOM   8901  C  C     . LYS F  5 117 ? -13.321 -7.327  -28.304 1.00 40.59  ? 116 LYS D C     1 
ATOM   8902  O  O     . LYS F  5 117 ? -13.097 -7.967  -27.273 1.00 48.48  ? 116 LYS D O     1 
ATOM   8903  C  CB    . LYS F  5 117 ? -13.479 -8.458  -30.530 1.00 43.49  ? 116 LYS D CB    1 
ATOM   8904  C  CG    . LYS F  5 117 ? -14.345 -9.251  -31.495 1.00 54.23  ? 116 LYS D CG    1 
ATOM   8905  C  CD    . LYS F  5 117 ? -13.515 -10.043 -32.498 1.00 64.78  ? 116 LYS D CD    1 
ATOM   8906  C  CE    . LYS F  5 117 ? -14.383 -10.539 -33.652 1.00 67.95  ? 116 LYS D CE    1 
ATOM   8907  N  NZ    . LYS F  5 117 ? -15.845 -10.384 -33.392 1.00 58.97  ? 116 LYS D NZ    1 
ATOM   8908  N  N     . ALA F  5 118 ? -12.788 -6.134  -28.542 1.00 41.52  ? 117 ALA D N     1 
ATOM   8909  C  CA    . ALA F  5 118 ? -11.908 -5.514  -27.565 1.00 38.84  ? 117 ALA D CA    1 
ATOM   8910  C  C     . ALA F  5 118 ? -12.630 -5.365  -26.231 1.00 42.56  ? 117 ALA D C     1 
ATOM   8911  O  O     . ALA F  5 118 ? -12.060 -5.640  -25.173 1.00 45.43  ? 117 ALA D O     1 
ATOM   8912  C  CB    . ALA F  5 118 ? -11.417 -4.163  -28.066 1.00 35.64  ? 117 ALA D CB    1 
ATOM   8913  N  N     . VAL F  5 119 ? -13.892 -4.949  -26.283 1.00 40.67  ? 118 VAL D N     1 
ATOM   8914  C  CA    . VAL F  5 119 ? -14.640 -4.713  -25.053 1.00 45.37  ? 118 VAL D CA    1 
ATOM   8915  C  C     . VAL F  5 119 ? -14.893 -6.012  -24.285 1.00 42.02  ? 118 VAL D C     1 
ATOM   8916  O  O     . VAL F  5 119 ? -14.583 -6.086  -23.095 1.00 44.06  ? 118 VAL D O     1 
ATOM   8917  C  CB    . VAL F  5 119 ? -15.982 -4.000  -25.328 1.00 41.18  ? 118 VAL D CB    1 
ATOM   8918  C  CG1   . VAL F  5 119 ? -16.854 -3.990  -24.081 1.00 29.75  ? 118 VAL D CG1   1 
ATOM   8919  C  CG2   . VAL F  5 119 ? -15.726 -2.583  -25.797 1.00 37.08  ? 118 VAL D CG2   1 
ATOM   8920  N  N     . THR F  5 120 ? -15.443 -7.029  -24.948 1.00 37.33  ? 119 THR D N     1 
ATOM   8921  C  CA    . THR F  5 120 ? -15.681 -8.311  -24.276 1.00 39.68  ? 119 THR D CA    1 
ATOM   8922  C  C     . THR F  5 120 ? -14.390 -8.901  -23.689 1.00 42.14  ? 119 THR D C     1 
ATOM   8923  O  O     . THR F  5 120 ? -14.362 -9.354  -22.528 1.00 48.43  ? 119 THR D O     1 
ATOM   8924  C  CB    . THR F  5 120 ? -16.314 -9.349  -25.222 1.00 38.29  ? 119 THR D CB    1 
ATOM   8925  O  OG1   . THR F  5 120 ? -15.442 -9.585  -26.333 1.00 50.56  ? 119 THR D OG1   1 
ATOM   8926  C  CG2   . THR F  5 120 ? -17.652 -8.863  -25.737 1.00 41.94  ? 119 THR D CG2   1 
ATOM   8927  N  N     . LYS F  5 121 ? -13.324 -8.883  -24.484 1.00 35.83  ? 120 LYS D N     1 
ATOM   8928  C  CA    . LYS F  5 121 ? -12.039 -9.377  -24.009 1.00 38.29  ? 120 LYS D CA    1 
ATOM   8929  C  C     . LYS F  5 121 ? -11.589 -8.604  -22.778 1.00 42.09  ? 120 LYS D C     1 
ATOM   8930  O  O     . LYS F  5 121 ? -11.055 -9.182  -21.830 1.00 46.14  ? 120 LYS D O     1 
ATOM   8931  C  CB    . LYS F  5 121 ? -10.972 -9.291  -25.103 1.00 35.46  ? 120 LYS D CB    1 
ATOM   8932  C  CG    . LYS F  5 121 ? -9.565  -9.506  -24.574 1.00 42.65  ? 120 LYS D CG    1 
ATOM   8933  C  CD    . LYS F  5 121 ? -8.625  -10.083 -25.615 1.00 47.09  ? 120 LYS D CD    1 
ATOM   8934  C  CE    . LYS F  5 121 ? -7.240  -10.304 -25.019 1.00 46.59  ? 120 LYS D CE    1 
ATOM   8935  N  NZ    . LYS F  5 121 ? -6.626  -11.575 -25.498 1.00 51.62  ? 120 LYS D NZ    1 
ATOM   8936  N  N     . TYR F  5 122 ? -11.824 -7.296  -22.786 1.00 46.27  ? 121 TYR D N     1 
ATOM   8937  C  CA    . TYR F  5 122 ? -11.423 -6.456  -21.664 1.00 45.63  ? 121 TYR D CA    1 
ATOM   8938  C  C     . TYR F  5 122 ? -12.231 -6.764  -20.402 1.00 48.13  ? 121 TYR D C     1 
ATOM   8939  O  O     . TYR F  5 122 ? -11.676 -6.788  -19.302 1.00 44.02  ? 121 TYR D O     1 
ATOM   8940  C  CB    . TYR F  5 122 ? -11.558 -4.974  -22.023 1.00 40.16  ? 121 TYR D CB    1 
ATOM   8941  C  CG    . TYR F  5 122 ? -11.364 -4.044  -20.848 1.00 39.35  ? 121 TYR D CG    1 
ATOM   8942  C  CD1   . TYR F  5 122 ? -10.094 -3.709  -20.406 1.00 44.10  ? 121 TYR D CD1   1 
ATOM   8943  C  CD2   . TYR F  5 122 ? -12.455 -3.504  -20.176 1.00 41.62  ? 121 TYR D CD2   1 
ATOM   8944  C  CE1   . TYR F  5 122 ? -9.912  -2.864  -19.327 1.00 43.68  ? 121 TYR D CE1   1 
ATOM   8945  C  CE2   . TYR F  5 122 ? -12.284 -2.659  -19.101 1.00 41.50  ? 121 TYR D CE2   1 
ATOM   8946  C  CZ    . TYR F  5 122 ? -11.011 -2.344  -18.681 1.00 46.70  ? 121 TYR D CZ    1 
ATOM   8947  O  OH    . TYR F  5 122 ? -10.837 -1.501  -17.609 1.00 63.57  ? 121 TYR D OH    1 
ATOM   8948  N  N     . THR F  5 123 ? -13.533 -6.999  -20.558 1.00 45.17  ? 122 THR D N     1 
ATOM   8949  C  CA    . THR F  5 123 ? -14.391 -7.193  -19.393 1.00 47.43  ? 122 THR D CA    1 
ATOM   8950  C  C     . THR F  5 123 ? -14.212 -8.586  -18.801 1.00 47.92  ? 122 THR D C     1 
ATOM   8951  O  O     . THR F  5 123 ? -14.518 -8.804  -17.631 1.00 52.08  ? 122 THR D O     1 
ATOM   8952  C  CB    . THR F  5 123 ? -15.890 -6.965  -19.717 1.00 41.26  ? 122 THR D CB    1 
ATOM   8953  O  OG1   . THR F  5 123 ? -16.364 -7.984  -20.599 1.00 48.60  ? 122 THR D OG1   1 
ATOM   8954  C  CG2   . THR F  5 123 ? -16.101 -5.611  -20.362 1.00 51.59  ? 122 THR D CG2   1 
ATOM   8955  N  N     . SER F  5 124 ? -13.705 -9.527  -19.592 1.00 49.07  ? 123 SER D N     1 
ATOM   8956  C  CA    . SER F  5 124 ? -13.462 -10.867 -19.054 1.00 47.92  ? 123 SER D CA    1 
ATOM   8957  C  C     . SER F  5 124 ? -12.234 -10.933 -18.136 1.00 51.80  ? 123 SER D C     1 
ATOM   8958  O  O     . SER F  5 124 ? -12.010 -11.943 -17.474 1.00 62.71  ? 123 SER D O     1 
ATOM   8959  C  CB    . SER F  5 124 ? -13.296 -11.876 -20.185 1.00 44.47  ? 123 SER D CB    1 
ATOM   8960  O  OG    . SER F  5 124 ? -12.083 -11.652 -20.879 1.00 49.03  ? 123 SER D OG    1 
ATOM   8961  N  N     . SER F  5 125 ? -11.448 -9.860  -18.092 1.00 56.04  ? 124 SER D N     1 
ATOM   8962  C  CA    . SER F  5 125 ? -10.187 -9.863  -17.345 1.00 57.97  ? 124 SER D CA    1 
ATOM   8963  C  C     . SER F  5 125 ? -10.285 -9.219  -15.962 1.00 69.12  ? 124 SER D C     1 
ATOM   8964  O  O     . SER F  5 125 ? -11.143 -8.371  -15.709 1.00 67.98  ? 124 SER D O     1 
ATOM   8965  C  CB    . SER F  5 125 ? -9.094  -9.158  -18.154 1.00 59.61  ? 124 SER D CB    1 
ATOM   8966  O  OG    . SER F  5 125 ? -8.804  -9.867  -19.350 1.00 61.49  ? 124 SER D OG    1 
ATOM   8967  N  N     . LYS F  5 126 ? -9.383  -9.633  -15.076 1.00 80.56  ? 125 LYS D N     1 
ATOM   8968  C  CA    . LYS F  5 126 ? -9.342  -9.154  -13.698 1.00 84.19  ? 125 LYS D CA    1 
ATOM   8969  C  C     . LYS F  5 126 ? -8.004  -8.495  -13.389 1.00 88.00  ? 125 LYS D C     1 
ATOM   8970  O  O     . LYS F  5 126 ? -7.945  -7.386  -12.850 1.00 99.10  ? 125 LYS D O     1 
ATOM   8971  C  CB    . LYS F  5 126 ? -9.594  -10.310 -12.724 1.00 79.68  ? 125 LYS D CB    1 
ATOM   8972  C  CG    . LYS F  5 126 ? -9.274  -9.991  -11.271 1.00 76.49  ? 125 LYS D CG    1 
ATOM   8973  C  CD    . LYS F  5 126 ? -10.443 -10.339 -10.365 1.00 85.71  ? 125 LYS D CD    1 
ATOM   8974  C  CE    . LYS F  5 126 ? -10.511 -9.393  -9.179  1.00 93.88  ? 125 LYS D CE    1 
ATOM   8975  N  NZ    . LYS F  5 126 ? -11.879 -8.829  -8.995  1.00 94.87  ? 125 LYS D NZ    1 
ATOM   8976  O  OXT   . LYS F  5 126 ? -6.949  -9.062  -13.676 1.00 85.99  ? 125 LYS D OXT   1 
ATOM   8977  N  N     . PRO G  2 38  ? 14.095  21.570  -88.274 1.00 99.85  ? 38  PRO E N     1 
ATOM   8978  C  CA    . PRO G  2 38  ? 13.209  22.239  -87.325 1.00 96.40  ? 38  PRO E CA    1 
ATOM   8979  C  C     . PRO G  2 38  ? 12.106  21.317  -86.817 1.00 96.00  ? 38  PRO E C     1 
ATOM   8980  O  O     . PRO G  2 38  ? 11.256  20.859  -87.596 1.00 98.85  ? 38  PRO E O     1 
ATOM   8981  C  CB    . PRO G  2 38  ? 12.609  23.402  -88.162 1.00 96.45  ? 38  PRO E CB    1 
ATOM   8982  C  CG    . PRO G  2 38  ? 13.218  23.272  -89.562 1.00 108.27 ? 38  PRO E CG    1 
ATOM   8983  C  CD    . PRO G  2 38  ? 14.439  22.467  -89.388 1.00 106.60 ? 38  PRO E CD    1 
ATOM   8984  N  N     . HIS G  2 39  ? 12.100  21.062  -85.516 1.00 90.39  ? 39  HIS E N     1 
ATOM   8985  C  CA    . HIS G  2 39  ? 11.095  20.195  -84.900 1.00 82.70  ? 39  HIS E CA    1 
ATOM   8986  C  C     . HIS G  2 39  ? 10.136  21.002  -84.032 1.00 74.76  ? 39  HIS E C     1 
ATOM   8987  O  O     . HIS G  2 39  ? 10.520  22.012  -83.438 1.00 66.79  ? 39  HIS E O     1 
ATOM   8988  C  CB    . HIS G  2 39  ? 11.766  19.106  -84.064 1.00 81.34  ? 39  HIS E CB    1 
ATOM   8989  C  CG    . HIS G  2 39  ? 10.805  18.143  -83.441 1.00 77.52  ? 39  HIS E CG    1 
ATOM   8990  N  ND1   . HIS G  2 39  ? 10.446  16.955  -84.041 1.00 78.27  ? 39  HIS E ND1   1 
ATOM   8991  C  CD2   . HIS G  2 39  ? 10.123  18.197  -82.273 1.00 70.07  ? 39  HIS E CD2   1 
ATOM   8992  C  CE1   . HIS G  2 39  ? 9.590   16.314  -83.265 1.00 77.41  ? 39  HIS E CE1   1 
ATOM   8993  N  NE2   . HIS G  2 39  ? 9.376   17.047  -82.187 1.00 74.60  ? 39  HIS E NE2   1 
ATOM   8994  N  N     . ARG G  2 40  ? 8.889   20.551  -83.964 1.00 68.37  ? 40  ARG E N     1 
ATOM   8995  C  CA    . ARG G  2 40  ? 7.857   21.297  -83.255 1.00 58.47  ? 40  ARG E CA    1 
ATOM   8996  C  C     . ARG G  2 40  ? 6.640   20.436  -82.925 1.00 53.56  ? 40  ARG E C     1 
ATOM   8997  O  O     . ARG G  2 40  ? 5.916   19.997  -83.822 1.00 53.06  ? 40  ARG E O     1 
ATOM   8998  C  CB    . ARG G  2 40  ? 7.437   22.516  -84.082 1.00 49.98  ? 40  ARG E CB    1 
ATOM   8999  C  CG    . ARG G  2 40  ? 6.413   23.409  -83.425 1.00 53.27  ? 40  ARG E CG    1 
ATOM   9000  C  CD    . ARG G  2 40  ? 6.329   24.743  -84.139 1.00 52.70  ? 40  ARG E CD    1 
ATOM   9001  N  NE    . ARG G  2 40  ? 7.232   25.730  -83.557 1.00 55.35  ? 40  ARG E NE    1 
ATOM   9002  C  CZ    . ARG G  2 40  ? 6.883   26.585  -82.601 1.00 47.73  ? 40  ARG E CZ    1 
ATOM   9003  N  NH1   . ARG G  2 40  ? 5.647   26.576  -82.120 1.00 46.44  ? 40  ARG E NH1   1 
ATOM   9004  N  NH2   . ARG G  2 40  ? 7.766   27.452  -82.130 1.00 51.86  ? 40  ARG E NH2   1 
ATOM   9005  N  N     . TYR G  2 41  ? 6.427   20.201  -81.632 1.00 50.92  ? 41  TYR E N     1 
ATOM   9006  C  CA    . TYR G  2 41  ? 5.255   19.471  -81.159 1.00 49.18  ? 41  TYR E CA    1 
ATOM   9007  C  C     . TYR G  2 41  ? 3.980   20.254  -81.420 1.00 46.69  ? 41  TYR E C     1 
ATOM   9008  O  O     . TYR G  2 41  ? 3.929   21.466  -81.200 1.00 49.32  ? 41  TYR E O     1 
ATOM   9009  C  CB    . TYR G  2 41  ? 5.373   19.162  -79.666 1.00 47.52  ? 41  TYR E CB    1 
ATOM   9010  C  CG    . TYR G  2 41  ? 6.412   18.114  -79.346 1.00 52.81  ? 41  TYR E CG    1 
ATOM   9011  C  CD1   . TYR G  2 41  ? 6.221   16.788  -79.717 1.00 47.39  ? 41  TYR E CD1   1 
ATOM   9012  C  CD2   . TYR G  2 41  ? 7.576   18.444  -78.668 1.00 49.62  ? 41  TYR E CD2   1 
ATOM   9013  C  CE1   . TYR G  2 41  ? 7.162   15.828  -79.433 1.00 48.66  ? 41  TYR E CE1   1 
ATOM   9014  C  CE2   . TYR G  2 41  ? 8.524   17.487  -78.375 1.00 54.03  ? 41  TYR E CE2   1 
ATOM   9015  C  CZ    . TYR G  2 41  ? 8.313   16.180  -78.761 1.00 53.82  ? 41  TYR E CZ    1 
ATOM   9016  O  OH    . TYR G  2 41  ? 9.253   15.218  -78.476 1.00 62.66  ? 41  TYR E OH    1 
ATOM   9017  N  N     . ARG G  2 42  ? 2.951   19.562  -81.893 1.00 46.41  ? 42  ARG E N     1 
ATOM   9018  C  CA    . ARG G  2 42  ? 1.670   20.205  -82.155 1.00 46.61  ? 42  ARG E CA    1 
ATOM   9019  C  C     . ARG G  2 42  ? 1.084   20.734  -80.849 1.00 42.79  ? 42  ARG E C     1 
ATOM   9020  O  O     . ARG G  2 42  ? 1.318   20.162  -79.787 1.00 47.85  ? 42  ARG E O     1 
ATOM   9021  C  CB    . ARG G  2 42  ? 0.709   19.225  -82.824 1.00 49.81  ? 42  ARG E CB    1 
ATOM   9022  C  CG    . ARG G  2 42  ? 1.300   18.501  -84.026 1.00 55.60  ? 42  ARG E CG    1 
ATOM   9023  C  CD    . ARG G  2 42  ? 0.338   17.457  -84.573 1.00 58.42  ? 42  ARG E CD    1 
ATOM   9024  N  NE    . ARG G  2 42  ? -0.939  18.042  -84.974 1.00 71.64  ? 42  ARG E NE    1 
ATOM   9025  C  CZ    . ARG G  2 42  ? -2.021  17.336  -85.289 1.00 78.81  ? 42  ARG E CZ    1 
ATOM   9026  N  NH1   . ARG G  2 42  ? -1.987  16.011  -85.250 1.00 80.06  ? 42  ARG E NH1   1 
ATOM   9027  N  NH2   . ARG G  2 42  ? -3.141  17.955  -85.642 1.00 81.29  ? 42  ARG E NH2   1 
ATOM   9028  N  N     . PRO G  2 43  ? 0.343   21.845  -80.914 1.00 39.30  ? 43  PRO E N     1 
ATOM   9029  C  CA    . PRO G  2 43  ? -0.264  22.357  -79.684 1.00 41.40  ? 43  PRO E CA    1 
ATOM   9030  C  C     . PRO G  2 43  ? -1.176  21.337  -79.008 1.00 40.22  ? 43  PRO E C     1 
ATOM   9031  O  O     . PRO G  2 43  ? -2.063  20.759  -79.638 1.00 42.41  ? 43  PRO E O     1 
ATOM   9032  C  CB    . PRO G  2 43  ? -1.061  23.582  -80.161 1.00 31.91  ? 43  PRO E CB    1 
ATOM   9033  C  CG    . PRO G  2 43  ? -1.104  23.491  -81.636 1.00 37.48  ? 43  PRO E CG    1 
ATOM   9034  C  CD    . PRO G  2 43  ? 0.121   22.749  -82.051 1.00 47.23  ? 43  PRO E CD    1 
ATOM   9035  N  N     . GLY G  2 44  ? -0.930  21.116  -77.723 1.00 37.80  ? 44  GLY E N     1 
ATOM   9036  C  CA    . GLY G  2 44  ? -1.748  20.228  -76.923 1.00 37.80  ? 44  GLY E CA    1 
ATOM   9037  C  C     . GLY G  2 44  ? -0.912  19.090  -76.390 1.00 41.60  ? 44  GLY E C     1 
ATOM   9038  O  O     . GLY G  2 44  ? -1.192  18.530  -75.332 1.00 43.26  ? 44  GLY E O     1 
ATOM   9039  N  N     . THR G  2 45  ? 0.131   18.756  -77.138 1.00 41.92  ? 45  THR E N     1 
ATOM   9040  C  CA    . THR G  2 45  ? 0.982   17.624  -76.820 1.00 36.81  ? 45  THR E CA    1 
ATOM   9041  C  C     . THR G  2 45  ? 1.796   17.905  -75.567 1.00 40.48  ? 45  THR E C     1 
ATOM   9042  O  O     . THR G  2 45  ? 1.844   17.086  -74.639 1.00 41.22  ? 45  THR E O     1 
ATOM   9043  C  CB    . THR G  2 45  ? 1.917   17.302  -78.000 1.00 42.61  ? 45  THR E CB    1 
ATOM   9044  O  OG1   . THR G  2 45  ? 1.134   17.113  -79.187 1.00 42.47  ? 45  THR E OG1   1 
ATOM   9045  C  CG2   . THR G  2 45  ? 2.741   16.058  -77.725 1.00 32.72  ? 45  THR E CG2   1 
ATOM   9046  N  N     . VAL G  2 46  ? 2.429   19.074  -75.536 1.00 40.60  ? 46  VAL E N     1 
ATOM   9047  C  CA    . VAL G  2 46  ? 3.238   19.451  -74.388 1.00 40.03  ? 46  VAL E CA    1 
ATOM   9048  C  C     . VAL G  2 46  ? 2.338   19.725  -73.185 1.00 39.86  ? 46  VAL E C     1 
ATOM   9049  O  O     . VAL G  2 46  ? 2.736   19.494  -72.046 1.00 45.32  ? 46  VAL E O     1 
ATOM   9050  C  CB    . VAL G  2 46  ? 4.112   20.679  -74.683 1.00 40.52  ? 46  VAL E CB    1 
ATOM   9051  C  CG1   . VAL G  2 46  ? 5.139   20.872  -73.579 1.00 41.70  ? 46  VAL E CG1   1 
ATOM   9052  C  CG2   . VAL G  2 46  ? 4.809   20.510  -76.018 1.00 42.63  ? 46  VAL E CG2   1 
ATOM   9053  N  N     . ALA G  2 47  ? 1.121   20.196  -73.443 1.00 34.91  ? 47  ALA E N     1 
ATOM   9054  C  CA    . ALA G  2 47  ? 0.140   20.414  -72.382 1.00 33.02  ? 47  ALA E CA    1 
ATOM   9055  C  C     . ALA G  2 47  ? -0.213  19.109  -71.662 1.00 37.08  ? 47  ALA E C     1 
ATOM   9056  O  O     . ALA G  2 47  ? -0.174  19.041  -70.429 1.00 36.56  ? 47  ALA E O     1 
ATOM   9057  C  CB    . ALA G  2 47  ? -1.108  21.058  -72.948 1.00 30.65  ? 47  ALA E CB    1 
ATOM   9058  N  N     . LEU G  2 48  ? -0.554  18.078  -72.433 1.00 37.46  ? 48  LEU E N     1 
ATOM   9059  C  CA    . LEU G  2 48  ? -0.867  16.762  -71.878 1.00 34.82  ? 48  LEU E CA    1 
ATOM   9060  C  C     . LEU G  2 48  ? 0.355   16.170  -71.187 1.00 33.42  ? 48  LEU E C     1 
ATOM   9061  O  O     . LEU G  2 48  ? 0.249   15.548  -70.121 1.00 32.24  ? 48  LEU E O     1 
ATOM   9062  C  CB    . LEU G  2 48  ? -1.366  15.824  -72.973 1.00 33.44  ? 48  LEU E CB    1 
ATOM   9063  C  CG    . LEU G  2 48  ? -2.738  16.171  -73.551 1.00 38.23  ? 48  LEU E CG    1 
ATOM   9064  C  CD1   . LEU G  2 48  ? -2.834  15.719  -74.997 1.00 36.51  ? 48  LEU E CD1   1 
ATOM   9065  C  CD2   . LEU G  2 48  ? -3.844  15.541  -72.718 1.00 34.33  ? 48  LEU E CD2   1 
ATOM   9066  N  N     . ARG G  2 49  ? 1.519   16.378  -71.795 1.00 35.31  ? 49  ARG E N     1 
ATOM   9067  C  CA    . ARG G  2 49  ? 2.770   15.954  -71.183 1.00 35.85  ? 49  ARG E CA    1 
ATOM   9068  C  C     . ARG G  2 49  ? 2.934   16.584  -69.797 1.00 39.46  ? 49  ARG E C     1 
ATOM   9069  O  O     . ARG G  2 49  ? 3.357   15.929  -68.838 1.00 35.17  ? 49  ARG E O     1 
ATOM   9070  C  CB    . ARG G  2 49  ? 3.953   16.324  -72.077 1.00 35.35  ? 49  ARG E CB    1 
ATOM   9071  C  CG    . ARG G  2 49  ? 5.293   15.907  -71.499 1.00 53.74  ? 49  ARG E CG    1 
ATOM   9072  C  CD    . ARG G  2 49  ? 6.455   16.445  -72.306 1.00 50.75  ? 49  ARG E CD    1 
ATOM   9073  N  NE    . ARG G  2 49  ? 6.344   16.091  -73.714 1.00 52.89  ? 49  ARG E NE    1 
ATOM   9074  C  CZ    . ARG G  2 49  ? 6.956   16.749  -74.690 1.00 53.68  ? 49  ARG E CZ    1 
ATOM   9075  N  NH1   . ARG G  2 49  ? 7.717   17.798  -74.404 1.00 52.95  ? 49  ARG E NH1   1 
ATOM   9076  N  NH2   . ARG G  2 49  ? 6.799   16.364  -75.947 1.00 53.18  ? 49  ARG E NH2   1 
ATOM   9077  N  N     . GLU G  2 50  ? 2.580   17.860  -69.693 1.00 35.98  ? 50  GLU E N     1 
ATOM   9078  C  CA    . GLU G  2 50  ? 2.709   18.580  -68.438 1.00 39.16  ? 50  GLU E CA    1 
ATOM   9079  C  C     . GLU G  2 50  ? 1.682   18.100  -67.416 1.00 34.77  ? 50  GLU E C     1 
ATOM   9080  O  O     . GLU G  2 50  ? 1.991   17.985  -66.225 1.00 31.30  ? 50  GLU E O     1 
ATOM   9081  C  CB    . GLU G  2 50  ? 2.577   20.085  -68.672 1.00 37.92  ? 50  GLU E CB    1 
ATOM   9082  C  CG    . GLU G  2 50  ? 3.860   20.736  -69.144 1.00 38.47  ? 50  GLU E CG    1 
ATOM   9083  C  CD    . GLU G  2 50  ? 3.665   22.172  -69.568 1.00 44.27  ? 50  GLU E CD    1 
ATOM   9084  O  OE1   . GLU G  2 50  ? 2.771   22.842  -69.007 1.00 50.98  ? 50  GLU E OE1   1 
ATOM   9085  O  OE2   . GLU G  2 50  ? 4.411   22.633  -70.458 1.00 47.92  ? 50  GLU E OE2   1 
ATOM   9086  N  N     . ILE G  2 51  ? 0.468   17.819  -67.880 1.00 27.58  ? 51  ILE E N     1 
ATOM   9087  C  CA    . ILE G  2 51  ? -0.544  17.229  -67.011 1.00 32.15  ? 51  ILE E CA    1 
ATOM   9088  C  C     . ILE G  2 51  ? -0.028  15.932  -66.385 1.00 32.98  ? 51  ILE E C     1 
ATOM   9089  O  O     . ILE G  2 51  ? -0.091  15.754  -65.162 1.00 30.52  ? 51  ILE E O     1 
ATOM   9090  C  CB    . ILE G  2 51  ? -1.850  16.944  -67.767 1.00 30.15  ? 51  ILE E CB    1 
ATOM   9091  C  CG1   . ILE G  2 51  ? -2.492  18.258  -68.223 1.00 28.40  ? 51  ILE E CG1   1 
ATOM   9092  C  CG2   . ILE G  2 51  ? -2.799  16.151  -66.887 1.00 23.23  ? 51  ILE E CG2   1 
ATOM   9093  C  CD1   . ILE G  2 51  ? -3.816  18.095  -68.923 1.00 23.03  ? 51  ILE E CD1   1 
ATOM   9094  N  N     . ARG G  2 52  ? 0.505   15.039  -67.217 1.00 29.66  ? 52  ARG E N     1 
ATOM   9095  C  CA    . ARG G  2 52  ? 1.026   13.781  -66.696 1.00 33.76  ? 52  ARG E CA    1 
ATOM   9096  C  C     . ARG G  2 52  ? 2.159   14.058  -65.704 1.00 35.16  ? 52  ARG E C     1 
ATOM   9097  O  O     . ARG G  2 52  ? 2.188   13.503  -64.592 1.00 38.06  ? 52  ARG E O     1 
ATOM   9098  C  CB    . ARG G  2 52  ? 1.492   12.871  -67.839 1.00 29.05  ? 52  ARG E CB    1 
ATOM   9099  C  CG    . ARG G  2 52  ? 0.387   12.547  -68.855 1.00 32.91  ? 52  ARG E CG    1 
ATOM   9100  C  CD    . ARG G  2 52  ? 0.817   11.506  -69.884 1.00 30.06  ? 52  ARG E CD    1 
ATOM   9101  N  NE    . ARG G  2 52  ? 0.370   11.847  -71.239 1.00 32.67  ? 52  ARG E NE    1 
ATOM   9102  C  CZ    . ARG G  2 52  ? -0.791  11.465  -71.771 1.00 46.68  ? 52  ARG E CZ    1 
ATOM   9103  N  NH1   . ARG G  2 52  ? -1.643  10.721  -71.069 1.00 40.28  ? 52  ARG E NH1   1 
ATOM   9104  N  NH2   . ARG G  2 52  ? -1.104  11.826  -73.011 1.00 42.14  ? 52  ARG E NH2   1 
ATOM   9105  N  N     . ARG G  2 53  ? 3.062   14.955  -66.090 1.00 35.67  ? 53  ARG E N     1 
ATOM   9106  C  CA    . ARG G  2 53  ? 4.204   15.287  -65.248 1.00 33.89  ? 53  ARG E CA    1 
ATOM   9107  C  C     . ARG G  2 53  ? 3.805   15.757  -63.855 1.00 34.92  ? 53  ARG E C     1 
ATOM   9108  O  O     . ARG G  2 53  ? 4.299   15.245  -62.852 1.00 42.01  ? 53  ARG E O     1 
ATOM   9109  C  CB    . ARG G  2 53  ? 5.061   16.366  -65.898 1.00 34.93  ? 53  ARG E CB    1 
ATOM   9110  C  CG    . ARG G  2 53  ? 6.200   16.788  -64.998 1.00 36.70  ? 53  ARG E CG    1 
ATOM   9111  C  CD    . ARG G  2 53  ? 6.975   17.982  -65.524 1.00 44.99  ? 53  ARG E CD    1 
ATOM   9112  N  NE    . ARG G  2 53  ? 7.877   18.471  -64.484 1.00 58.99  ? 53  ARG E NE    1 
ATOM   9113  C  CZ    . ARG G  2 53  ? 8.830   19.376  -64.668 1.00 56.14  ? 53  ARG E CZ    1 
ATOM   9114  N  NH1   . ARG G  2 53  ? 9.022   19.913  -65.867 1.00 47.98  ? 53  ARG E NH1   1 
ATOM   9115  N  NH2   . ARG G  2 53  ? 9.594   19.741  -63.646 1.00 54.04  ? 53  ARG E NH2   1 
ATOM   9116  N  N     . TYR G  2 54  ? 2.912   16.734  -63.784 1.00 36.08  ? 54  TYR E N     1 
ATOM   9117  C  CA    . TYR G  2 54  ? 2.596   17.323  -62.492 1.00 35.09  ? 54  TYR E CA    1 
ATOM   9118  C  C     . TYR G  2 54  ? 1.619   16.470  -61.698 1.00 32.63  ? 54  TYR E C     1 
ATOM   9119  O  O     . TYR G  2 54  ? 1.596   16.542  -60.468 1.00 31.19  ? 54  TYR E O     1 
ATOM   9120  C  CB    . TYR G  2 54  ? 2.075   18.751  -62.673 1.00 29.05  ? 54  TYR E CB    1 
ATOM   9121  C  CG    . TYR G  2 54  ? 3.178   19.673  -63.124 1.00 29.71  ? 54  TYR E CG    1 
ATOM   9122  C  CD1   . TYR G  2 54  ? 4.292   19.881  -62.325 1.00 34.08  ? 54  TYR E CD1   1 
ATOM   9123  C  CD2   . TYR G  2 54  ? 3.131   20.305  -64.358 1.00 33.34  ? 54  TYR E CD2   1 
ATOM   9124  C  CE1   . TYR G  2 54  ? 5.319   20.698  -62.734 1.00 34.01  ? 54  TYR E CE1   1 
ATOM   9125  C  CE2   . TYR G  2 54  ? 4.153   21.130  -64.771 1.00 30.08  ? 54  TYR E CE2   1 
ATOM   9126  C  CZ    . TYR G  2 54  ? 5.244   21.320  -63.955 1.00 29.31  ? 54  TYR E CZ    1 
ATOM   9127  O  OH    . TYR G  2 54  ? 6.270   22.137  -64.357 1.00 38.42  ? 54  TYR E OH    1 
ATOM   9128  N  N     . GLN G  2 55  ? 0.833   15.642  -62.381 1.00 30.52  ? 55  GLN E N     1 
ATOM   9129  C  CA    . GLN G  2 55  ? -0.013  14.704  -61.653 1.00 28.61  ? 55  GLN E CA    1 
ATOM   9130  C  C     . GLN G  2 55  ? 0.821   13.549  -61.086 1.00 33.31  ? 55  GLN E C     1 
ATOM   9131  O  O     . GLN G  2 55  ? 0.377   12.859  -60.171 1.00 36.82  ? 55  GLN E O     1 
ATOM   9132  C  CB    . GLN G  2 55  ? -1.146  14.181  -62.539 1.00 27.28  ? 55  GLN E CB    1 
ATOM   9133  C  CG    . GLN G  2 55  ? -2.307  15.167  -62.680 1.00 30.04  ? 55  GLN E CG    1 
ATOM   9134  C  CD    . GLN G  2 55  ? -3.471  14.613  -63.481 1.00 27.70  ? 55  GLN E CD    1 
ATOM   9135  O  OE1   . GLN G  2 55  ? -3.407  13.504  -64.006 1.00 32.08  ? 55  GLN E OE1   1 
ATOM   9136  N  NE2   . GLN G  2 55  ? -4.537  15.396  -63.591 1.00 25.97  ? 55  GLN E NE2   1 
ATOM   9137  N  N     . LYS G  2 56  ? 2.029   13.340  -61.608 1.00 35.93  ? 56  LYS E N     1 
ATOM   9138  C  CA    . LYS G  2 56  ? 2.915   12.333  -61.014 1.00 32.91  ? 56  LYS E CA    1 
ATOM   9139  C  C     . LYS G  2 56  ? 3.617   12.828  -59.750 1.00 35.04  ? 56  LYS E C     1 
ATOM   9140  O  O     . LYS G  2 56  ? 3.945   12.035  -58.865 1.00 36.99  ? 56  LYS E O     1 
ATOM   9141  C  CB    . LYS G  2 56  ? 3.970   11.865  -62.022 1.00 34.52  ? 56  LYS E CB    1 
ATOM   9142  C  CG    . LYS G  2 56  ? 3.429   10.963  -63.111 1.00 48.95  ? 56  LYS E CG    1 
ATOM   9143  C  CD    . LYS G  2 56  ? 4.547   10.400  -63.988 1.00 54.45  ? 56  LYS E CD    1 
ATOM   9144  C  CE    . LYS G  2 56  ? 5.216   11.516  -64.788 1.00 58.04  ? 56  LYS E CE    1 
ATOM   9145  N  NZ    . LYS G  2 56  ? 6.194   11.018  -65.798 1.00 88.79  ? 56  LYS E NZ    1 
ATOM   9146  N  N     . SER G  2 57  ? 3.855   14.132  -59.656 1.00 34.96  ? 57  SER E N     1 
ATOM   9147  C  CA    . SER G  2 57  ? 4.658   14.652  -58.553 1.00 29.02  ? 57  SER E CA    1 
ATOM   9148  C  C     . SER G  2 57  ? 3.796   15.283  -57.482 1.00 26.27  ? 57  SER E C     1 
ATOM   9149  O  O     . SER G  2 57  ? 2.582   15.395  -57.645 1.00 30.51  ? 57  SER E O     1 
ATOM   9150  C  CB    . SER G  2 57  ? 5.672   15.671  -59.059 1.00 31.90  ? 57  SER E CB    1 
ATOM   9151  O  OG    . SER G  2 57  ? 5.015   16.819  -59.568 1.00 35.84  ? 57  SER E OG    1 
ATOM   9152  N  N     . THR G  2 58  ? 4.428   15.698  -56.387 1.00 28.67  ? 58  THR E N     1 
ATOM   9153  C  CA    . THR G  2 58  ? 3.706   16.316  -55.276 1.00 31.07  ? 58  THR E CA    1 
ATOM   9154  C  C     . THR G  2 58  ? 4.295   17.648  -54.792 1.00 31.22  ? 58  THR E C     1 
ATOM   9155  O  O     . THR G  2 58  ? 3.810   18.219  -53.818 1.00 30.85  ? 58  THR E O     1 
ATOM   9156  C  CB    . THR G  2 58  ? 3.656   15.378  -54.057 1.00 29.81  ? 58  THR E CB    1 
ATOM   9157  O  OG1   . THR G  2 58  ? 4.975   15.218  -53.521 1.00 32.53  ? 58  THR E OG1   1 
ATOM   9158  C  CG2   . THR G  2 58  ? 3.112   14.031  -54.446 1.00 31.41  ? 58  THR E CG2   1 
ATOM   9159  N  N     . GLU G  2 59  ? 5.343   18.136  -55.447 1.00 30.16  ? 59  GLU E N     1 
ATOM   9160  C  CA    . GLU G  2 59  ? 6.022   19.335  -54.965 1.00 30.55  ? 59  GLU E CA    1 
ATOM   9161  C  C     . GLU G  2 59  ? 5.097   20.543  -55.103 1.00 33.99  ? 59  GLU E C     1 
ATOM   9162  O  O     . GLU G  2 59  ? 4.197   20.543  -55.945 1.00 29.61  ? 59  GLU E O     1 
ATOM   9163  C  CB    . GLU G  2 59  ? 7.344   19.553  -55.716 1.00 23.37  ? 59  GLU E CB    1 
ATOM   9164  C  CG    . GLU G  2 59  ? 7.248   20.300  -57.045 1.00 26.63  ? 59  GLU E CG    1 
ATOM   9165  C  CD    . GLU G  2 59  ? 6.809   19.427  -58.205 1.00 36.56  ? 59  GLU E CD    1 
ATOM   9166  O  OE1   . GLU G  2 59  ? 7.330   19.609  -59.329 1.00 33.92  ? 59  GLU E OE1   1 
ATOM   9167  O  OE2   . GLU G  2 59  ? 5.929   18.567  -57.998 1.00 42.20  ? 59  GLU E OE2   1 
ATOM   9168  N  N     . LEU G  2 60  ? 5.288   21.546  -54.247 1.00 30.47  ? 60  LEU E N     1 
ATOM   9169  C  CA    . LEU G  2 60  ? 4.520   22.783  -54.352 1.00 30.80  ? 60  LEU E CA    1 
ATOM   9170  C  C     . LEU G  2 60  ? 4.886   23.483  -55.658 1.00 29.26  ? 60  LEU E C     1 
ATOM   9171  O  O     . LEU G  2 60  ? 6.046   23.481  -56.065 1.00 32.75  ? 60  LEU E O     1 
ATOM   9172  C  CB    . LEU G  2 60  ? 4.781   23.695  -53.151 1.00 34.37  ? 60  LEU E CB    1 
ATOM   9173  C  CG    . LEU G  2 60  ? 4.202   23.229  -51.813 1.00 30.24  ? 60  LEU E CG    1 
ATOM   9174  C  CD1   . LEU G  2 60  ? 4.860   23.944  -50.655 1.00 24.19  ? 60  LEU E CD1   1 
ATOM   9175  C  CD2   . LEU G  2 60  ? 2.701   23.453  -51.782 1.00 32.91  ? 60  LEU E CD2   1 
ATOM   9176  N  N     . LEU G  2 61  ? 3.898   24.074  -56.316 1.00 26.42  ? 61  LEU E N     1 
ATOM   9177  C  CA    . LEU G  2 61  ? 4.100   24.603  -57.662 1.00 32.39  ? 61  LEU E CA    1 
ATOM   9178  C  C     . LEU G  2 61  ? 4.249   26.134  -57.719 1.00 34.66  ? 61  LEU E C     1 
ATOM   9179  O  O     . LEU G  2 61  ? 4.680   26.686  -58.730 1.00 31.75  ? 61  LEU E O     1 
ATOM   9180  C  CB    . LEU G  2 61  ? 2.947   24.150  -58.552 1.00 31.36  ? 61  LEU E CB    1 
ATOM   9181  C  CG    . LEU G  2 61  ? 2.776   22.629  -58.567 1.00 31.16  ? 61  LEU E CG    1 
ATOM   9182  C  CD1   . LEU G  2 61  ? 1.586   22.191  -59.412 1.00 26.22  ? 61  LEU E CD1   1 
ATOM   9183  C  CD2   . LEU G  2 61  ? 4.053   21.958  -59.048 1.00 28.47  ? 61  LEU E CD2   1 
ATOM   9184  N  N     . ILE G  2 62  ? 3.880   26.813  -56.638 1.00 31.87  ? 62  ILE E N     1 
ATOM   9185  C  CA    . ILE G  2 62  ? 4.103   28.246  -56.525 1.00 30.07  ? 62  ILE E CA    1 
ATOM   9186  C  C     . ILE G  2 62  ? 5.458   28.442  -55.878 1.00 32.67  ? 62  ILE E C     1 
ATOM   9187  O  O     . ILE G  2 62  ? 5.815   27.679  -54.993 1.00 33.66  ? 62  ILE E O     1 
ATOM   9188  C  CB    . ILE G  2 62  ? 2.997   28.941  -55.698 1.00 33.28  ? 62  ILE E CB    1 
ATOM   9189  C  CG1   . ILE G  2 62  ? 1.685   28.976  -56.487 1.00 32.51  ? 62  ILE E CG1   1 
ATOM   9190  C  CG2   . ILE G  2 62  ? 3.405   30.356  -55.299 1.00 33.70  ? 62  ILE E CG2   1 
ATOM   9191  C  CD1   . ILE G  2 62  ? 0.511   29.523  -55.702 1.00 29.77  ? 62  ILE E CD1   1 
ATOM   9192  N  N     . ARG G  2 63  ? 6.216   29.439  -56.336 1.00 33.82  ? 63  ARG E N     1 
ATOM   9193  C  CA    . ARG G  2 63  ? 7.534   29.740  -55.786 1.00 27.93  ? 63  ARG E CA    1 
ATOM   9194  C  C     . ARG G  2 63  ? 7.397   30.155  -54.314 1.00 29.36  ? 63  ARG E C     1 
ATOM   9195  O  O     . ARG G  2 63  ? 6.454   30.854  -53.955 1.00 31.56  ? 63  ARG E O     1 
ATOM   9196  C  CB    . ARG G  2 63  ? 8.205   30.827  -56.627 1.00 33.02  ? 63  ARG E CB    1 
ATOM   9197  C  CG    . ARG G  2 63  ? 8.965   30.294  -57.843 1.00 35.23  ? 63  ARG E CG    1 
ATOM   9198  C  CD    . ARG G  2 63  ? 9.890   29.139  -57.448 1.00 47.88  ? 63  ARG E CD    1 
ATOM   9199  N  NE    . ARG G  2 63  ? 9.997   28.108  -58.481 1.00 62.28  ? 63  ARG E NE    1 
ATOM   9200  C  CZ    . ARG G  2 63  ? 9.501   26.875  -58.360 1.00 62.88  ? 63  ARG E CZ    1 
ATOM   9201  N  NH1   . ARG G  2 63  ? 8.861   26.520  -57.252 1.00 52.42  ? 63  ARG E NH1   1 
ATOM   9202  N  NH2   . ARG G  2 63  ? 9.637   25.995  -59.347 1.00 64.57  ? 63  ARG E NH2   1 
ATOM   9203  N  N     . LYS G  2 64  ? 8.318   29.707  -53.464 1.00 28.43  ? 64  LYS E N     1 
ATOM   9204  C  CA    . LYS G  2 64  ? 8.165   29.853  -52.014 1.00 27.49  ? 64  LYS E CA    1 
ATOM   9205  C  C     . LYS G  2 64  ? 8.196   31.296  -51.537 1.00 35.00  ? 64  LYS E C     1 
ATOM   9206  O  O     . LYS G  2 64  ? 7.258   31.769  -50.893 1.00 37.54  ? 64  LYS E O     1 
ATOM   9207  C  CB    . LYS G  2 64  ? 9.257   29.080  -51.269 1.00 33.65  ? 64  LYS E CB    1 
ATOM   9208  C  CG    . LYS G  2 64  ? 9.280   27.585  -51.525 1.00 45.45  ? 64  LYS E CG    1 
ATOM   9209  C  CD    . LYS G  2 64  ? 8.005   26.891  -51.071 1.00 48.73  ? 64  LYS E CD    1 
ATOM   9210  C  CE    . LYS G  2 64  ? 8.104   25.381  -51.290 1.00 59.19  ? 64  LYS E CE    1 
ATOM   9211  N  NZ    . LYS G  2 64  ? 9.252   24.755  -50.560 1.00 52.77  ? 64  LYS E NZ    1 
ATOM   9212  N  N     . LEU G  2 65  ? 9.293   31.985  -51.834 1.00 36.10  ? 65  LEU E N     1 
ATOM   9213  C  CA    . LEU G  2 65  ? 9.487   33.349  -51.364 1.00 33.34  ? 65  LEU E CA    1 
ATOM   9214  C  C     . LEU G  2 65  ? 8.361   34.305  -51.791 1.00 37.89  ? 65  LEU E C     1 
ATOM   9215  O  O     . LEU G  2 65  ? 7.866   35.071  -50.951 1.00 39.15  ? 65  LEU E O     1 
ATOM   9216  C  CB    . LEU G  2 65  ? 10.841  33.882  -51.836 1.00 37.16  ? 65  LEU E CB    1 
ATOM   9217  C  CG    . LEU G  2 65  ? 11.187  35.291  -51.365 1.00 30.47  ? 65  LEU E CG    1 
ATOM   9218  C  CD1   . LEU G  2 65  ? 11.214  35.341  -49.849 1.00 26.23  ? 65  LEU E CD1   1 
ATOM   9219  C  CD2   . LEU G  2 65  ? 12.518  35.706  -51.940 1.00 34.41  ? 65  LEU E CD2   1 
ATOM   9220  N  N     . PRO G  2 66  ? 7.951   34.276  -53.079 1.00 29.30  ? 66  PRO E N     1 
ATOM   9221  C  CA    . PRO G  2 66  ? 6.821   35.142  -53.427 1.00 24.30  ? 66  PRO E CA    1 
ATOM   9222  C  C     . PRO G  2 66  ? 5.574   34.866  -52.593 1.00 33.12  ? 66  PRO E C     1 
ATOM   9223  O  O     . PRO G  2 66  ? 4.935   35.822  -52.141 1.00 39.50  ? 66  PRO E O     1 
ATOM   9224  C  CB    . PRO G  2 66  ? 6.573   34.815  -54.899 1.00 29.04  ? 66  PRO E CB    1 
ATOM   9225  C  CG    . PRO G  2 66  ? 7.913   34.434  -55.414 1.00 29.88  ? 66  PRO E CG    1 
ATOM   9226  C  CD    . PRO G  2 66  ? 8.551   33.668  -54.282 1.00 31.06  ? 66  PRO E CD    1 
ATOM   9227  N  N     . PHE G  2 67  ? 5.243   33.595  -52.375 1.00 29.23  ? 67  PHE E N     1 
ATOM   9228  C  CA    . PHE G  2 67  ? 4.058   33.245  -51.591 1.00 28.06  ? 67  PHE E CA    1 
ATOM   9229  C  C     . PHE G  2 67  ? 4.205   33.718  -50.148 1.00 29.85  ? 67  PHE E C     1 
ATOM   9230  O  O     . PHE G  2 67  ? 3.235   34.172  -49.528 1.00 27.72  ? 67  PHE E O     1 
ATOM   9231  C  CB    . PHE G  2 67  ? 3.795   31.733  -51.620 1.00 28.86  ? 67  PHE E CB    1 
ATOM   9232  C  CG    . PHE G  2 67  ? 2.559   31.320  -50.860 1.00 27.77  ? 67  PHE E CG    1 
ATOM   9233  C  CD1   . PHE G  2 67  ? 1.318   31.319  -51.475 1.00 28.32  ? 67  PHE E CD1   1 
ATOM   9234  C  CD2   . PHE G  2 67  ? 2.635   30.958  -49.525 1.00 26.96  ? 67  PHE E CD2   1 
ATOM   9235  C  CE1   . PHE G  2 67  ? 0.182   30.954  -50.779 1.00 23.98  ? 67  PHE E CE1   1 
ATOM   9236  C  CE2   . PHE G  2 67  ? 1.502   30.599  -48.825 1.00 23.71  ? 67  PHE E CE2   1 
ATOM   9237  C  CZ    . PHE G  2 67  ? 0.273   30.595  -49.455 1.00 24.64  ? 67  PHE E CZ    1 
ATOM   9238  N  N     . GLN G  2 68  ? 5.414   33.605  -49.610 1.00 29.87  ? 68  GLN E N     1 
ATOM   9239  C  CA    . GLN G  2 68  ? 5.668   34.091  -48.261 1.00 32.30  ? 68  GLN E CA    1 
ATOM   9240  C  C     . GLN G  2 68  ? 5.431   35.601  -48.180 1.00 33.64  ? 68  GLN E C     1 
ATOM   9241  O  O     . GLN G  2 68  ? 4.859   36.102  -47.202 1.00 30.32  ? 68  GLN E O     1 
ATOM   9242  C  CB    . GLN G  2 68  ? 7.088   33.756  -47.815 1.00 26.68  ? 68  GLN E CB    1 
ATOM   9243  C  CG    . GLN G  2 68  ? 7.248   33.777  -46.309 1.00 41.93  ? 68  GLN E CG    1 
ATOM   9244  C  CD    . GLN G  2 68  ? 8.683   33.617  -45.862 1.00 48.61  ? 68  GLN E CD    1 
ATOM   9245  O  OE1   . GLN G  2 68  ? 9.516   34.494  -46.092 1.00 53.51  ? 68  GLN E OE1   1 
ATOM   9246  N  NE2   . GLN G  2 68  ? 8.979   32.500  -45.208 1.00 44.89  ? 68  GLN E NE2   1 
ATOM   9247  N  N     . ARG G  2 69  ? 5.861   36.322  -49.216 1.00 30.01  ? 69  ARG E N     1 
ATOM   9248  C  CA    . ARG G  2 69  ? 5.648   37.764  -49.260 1.00 27.21  ? 69  ARG E CA    1 
ATOM   9249  C  C     . ARG G  2 69  ? 4.171   38.086  -49.317 1.00 30.22  ? 69  ARG E C     1 
ATOM   9250  O  O     . ARG G  2 69  ? 3.705   38.986  -48.627 1.00 36.24  ? 69  ARG E O     1 
ATOM   9251  C  CB    . ARG G  2 69  ? 6.350   38.391  -50.454 1.00 32.66  ? 69  ARG E CB    1 
ATOM   9252  C  CG    . ARG G  2 69  ? 7.825   38.613  -50.257 1.00 34.09  ? 69  ARG E CG    1 
ATOM   9253  C  CD    . ARG G  2 69  ? 8.349   39.562  -51.314 1.00 35.98  ? 69  ARG E CD    1 
ATOM   9254  N  NE    . ARG G  2 69  ? 9.388   38.953  -52.136 1.00 35.50  ? 69  ARG E NE    1 
ATOM   9255  C  CZ    . ARG G  2 69  ? 9.210   38.563  -53.390 1.00 36.97  ? 69  ARG E CZ    1 
ATOM   9256  N  NH1   . ARG G  2 69  ? 8.028   38.718  -53.979 1.00 32.21  ? 69  ARG E NH1   1 
ATOM   9257  N  NH2   . ARG G  2 69  ? 10.220  38.028  -54.057 1.00 38.57  ? 69  ARG E NH2   1 
ATOM   9258  N  N     . LEU G  2 70  ? 3.436   37.351  -50.143 1.00 29.02  ? 70  LEU E N     1 
ATOM   9259  C  CA    . LEU G  2 70  ? 1.994   37.547  -50.251 1.00 26.32  ? 70  LEU E CA    1 
ATOM   9260  C  C     . LEU G  2 70  ? 1.316   37.356  -48.899 1.00 25.86  ? 70  LEU E C     1 
ATOM   9261  O  O     . LEU G  2 70  ? 0.443   38.142  -48.493 1.00 32.27  ? 70  LEU E O     1 
ATOM   9262  C  CB    . LEU G  2 70  ? 1.403   36.582  -51.276 1.00 26.15  ? 70  LEU E CB    1 
ATOM   9263  C  CG    . LEU G  2 70  ? -0.093  36.749  -51.520 1.00 29.54  ? 70  LEU E CG    1 
ATOM   9264  C  CD1   . LEU G  2 70  ? -0.377  38.155  -52.048 1.00 30.98  ? 70  LEU E CD1   1 
ATOM   9265  C  CD2   . LEU G  2 70  ? -0.601  35.678  -52.480 1.00 23.51  ? 70  LEU E CD2   1 
ATOM   9266  N  N     . VAL G  2 71  ? 1.732   36.312  -48.194 1.00 27.98  ? 71  VAL E N     1 
ATOM   9267  C  CA    . VAL G  2 71  ? 1.159   36.027  -46.889 1.00 29.05  ? 71  VAL E CA    1 
ATOM   9268  C  C     . VAL G  2 71  ? 1.452   37.175  -45.934 1.00 27.54  ? 71  VAL E C     1 
ATOM   9269  O  O     . VAL G  2 71  ? 0.545   37.675  -45.264 1.00 26.77  ? 71  VAL E O     1 
ATOM   9270  C  CB    . VAL G  2 71  ? 1.685   34.695  -46.316 1.00 22.26  ? 71  VAL E CB    1 
ATOM   9271  C  CG1   . VAL G  2 71  ? 1.426   34.603  -44.826 1.00 24.96  ? 71  VAL E CG1   1 
ATOM   9272  C  CG2   . VAL G  2 71  ? 1.023   33.547  -47.026 1.00 27.57  ? 71  VAL E CG2   1 
ATOM   9273  N  N     . ARG G  2 72  ? 2.706   37.616  -45.892 1.00 26.70  ? 72  ARG E N     1 
ATOM   9274  C  CA    . ARG G  2 72  ? 3.067   38.701  -44.986 1.00 31.90  ? 72  ARG E CA    1 
ATOM   9275  C  C     . ARG G  2 72  ? 2.317   40.003  -45.323 1.00 31.94  ? 72  ARG E C     1 
ATOM   9276  O  O     . ARG G  2 72  ? 1.946   40.763  -44.422 1.00 25.21  ? 72  ARG E O     1 
ATOM   9277  C  CB    . ARG G  2 72  ? 4.580   38.908  -44.997 1.00 32.96  ? 72  ARG E CB    1 
ATOM   9278  C  CG    . ARG G  2 72  ? 5.327   37.701  -44.429 1.00 39.17  ? 72  ARG E CG    1 
ATOM   9279  C  CD    . ARG G  2 72  ? 6.808   37.956  -44.233 1.00 44.78  ? 72  ARG E CD    1 
ATOM   9280  N  NE    . ARG G  2 72  ? 7.561   36.707  -44.138 1.00 48.93  ? 72  ARG E NE    1 
ATOM   9281  C  CZ    . ARG G  2 72  ? 7.836   36.072  -43.002 1.00 49.99  ? 72  ARG E CZ    1 
ATOM   9282  N  NH1   . ARG G  2 72  ? 7.419   36.557  -41.837 1.00 37.88  ? 72  ARG E NH1   1 
ATOM   9283  N  NH2   . ARG G  2 72  ? 8.530   34.942  -43.034 1.00 48.66  ? 72  ARG E NH2   1 
ATOM   9284  N  N     . GLU G  2 73  ? 2.058   40.228  -46.609 1.00 22.83  ? 73  GLU E N     1 
ATOM   9285  C  CA    . GLU G  2 73  ? 1.287   41.382  -47.046 1.00 24.32  ? 73  GLU E CA    1 
ATOM   9286  C  C     . GLU G  2 73  ? -0.150  41.337  -46.528 1.00 30.86  ? 73  GLU E C     1 
ATOM   9287  O  O     . GLU G  2 73  ? -0.625  42.277  -45.870 1.00 35.56  ? 73  GLU E O     1 
ATOM   9288  C  CB    . GLU G  2 73  ? 1.283   41.477  -48.569 1.00 26.19  ? 73  GLU E CB    1 
ATOM   9289  C  CG    . GLU G  2 73  ? 0.521   42.678  -49.111 1.00 24.62  ? 73  GLU E CG    1 
ATOM   9290  C  CD    . GLU G  2 73  ? 0.457   42.688  -50.627 1.00 31.66  ? 73  GLU E CD    1 
ATOM   9291  O  OE1   . GLU G  2 73  ? 1.525   42.662  -51.271 1.00 29.81  ? 73  GLU E OE1   1 
ATOM   9292  O  OE2   . GLU G  2 73  ? -0.664  42.711  -51.180 1.00 40.19  ? 73  GLU E OE2   1 
ATOM   9293  N  N     . ILE G  2 74  ? -0.845  40.244  -46.824 1.00 31.94  ? 74  ILE E N     1 
ATOM   9294  C  CA    . ILE G  2 74  ? -2.226  40.103  -46.369 1.00 29.70  ? 74  ILE E CA    1 
ATOM   9295  C  C     . ILE G  2 74  ? -2.329  40.208  -44.841 1.00 27.65  ? 74  ILE E C     1 
ATOM   9296  O  O     . ILE G  2 74  ? -3.111  41.013  -44.304 1.00 33.04  ? 74  ILE E O     1 
ATOM   9297  C  CB    . ILE G  2 74  ? -2.828  38.769  -46.858 1.00 23.60  ? 74  ILE E CB    1 
ATOM   9298  C  CG1   . ILE G  2 74  ? -3.057  38.838  -48.367 1.00 23.31  ? 74  ILE E CG1   1 
ATOM   9299  C  CG2   . ILE G  2 74  ? -4.127  38.466  -46.144 1.00 23.10  ? 74  ILE E CG2   1 
ATOM   9300  C  CD1   . ILE G  2 74  ? -3.428  37.532  -49.000 1.00 29.17  ? 74  ILE E CD1   1 
ATOM   9301  N  N     . ALA G  2 75  ? -1.519  39.412  -44.150 1.00 28.66  ? 75  ALA E N     1 
ATOM   9302  C  CA    . ALA G  2 75  ? -1.534  39.390  -42.695 1.00 29.60  ? 75  ALA E CA    1 
ATOM   9303  C  C     . ALA G  2 75  ? -1.304  40.778  -42.147 1.00 31.80  ? 75  ALA E C     1 
ATOM   9304  O  O     . ALA G  2 75  ? -2.012  41.216  -41.241 1.00 28.62  ? 75  ALA E O     1 
ATOM   9305  C  CB    . ALA G  2 75  ? -0.485  38.432  -42.157 1.00 30.64  ? 75  ALA E CB    1 
ATOM   9306  N  N     . GLN G  2 76  ? -0.320  41.471  -42.716 1.00 35.49  ? 76  GLN E N     1 
ATOM   9307  C  CA    . GLN G  2 76  ? 0.027   42.807  -42.254 1.00 32.70  ? 76  GLN E CA    1 
ATOM   9308  C  C     . GLN G  2 76  ? -1.150  43.744  -42.393 1.00 29.73  ? 76  GLN E C     1 
ATOM   9309  O  O     . GLN G  2 76  ? -1.444  44.513  -41.480 1.00 34.97  ? 76  GLN E O     1 
ATOM   9310  C  CB    . GLN G  2 76  ? 1.212   43.356  -43.025 1.00 36.22  ? 76  GLN E CB    1 
ATOM   9311  C  CG    . GLN G  2 76  ? 1.817   44.583  -42.410 1.00 33.27  ? 76  GLN E CG    1 
ATOM   9312  C  CD    . GLN G  2 76  ? 3.018   45.036  -43.177 1.00 34.05  ? 76  GLN E CD    1 
ATOM   9313  O  OE1   . GLN G  2 76  ? 3.074   44.888  -44.398 1.00 36.98  ? 76  GLN E OE1   1 
ATOM   9314  N  NE2   . GLN G  2 76  ? 3.997   45.587  -42.474 1.00 47.78  ? 76  GLN E NE2   1 
ATOM   9315  N  N     . ASP G  2 77  ? -1.837  43.673  -43.528 1.00 28.79  ? 77  ASP E N     1 
ATOM   9316  C  CA    . ASP G  2 77  ? -3.045  44.472  -43.685 1.00 28.81  ? 77  ASP E CA    1 
ATOM   9317  C  C     . ASP G  2 77  ? -4.097  44.119  -42.631 1.00 36.49  ? 77  ASP E C     1 
ATOM   9318  O  O     . ASP G  2 77  ? -4.905  44.968  -42.258 1.00 44.56  ? 77  ASP E O     1 
ATOM   9319  C  CB    . ASP G  2 77  ? -3.636  44.315  -45.085 1.00 25.34  ? 77  ASP E CB    1 
ATOM   9320  C  CG    . ASP G  2 77  ? -2.821  45.034  -46.141 1.00 34.27  ? 77  ASP E CG    1 
ATOM   9321  O  OD1   . ASP G  2 77  ? -3.076  44.815  -47.344 1.00 35.09  ? 77  ASP E OD1   1 
ATOM   9322  O  OD2   . ASP G  2 77  ? -1.916  45.810  -45.767 1.00 37.14  ? 77  ASP E OD2   1 
ATOM   9323  N  N     . PHE G  2 78  ? -4.102  42.886  -42.134 1.00 34.35  ? 78  PHE E N     1 
ATOM   9324  C  CA    . PHE G  2 78  ? -5.068  42.578  -41.074 1.00 35.26  ? 78  PHE E CA    1 
ATOM   9325  C  C     . PHE G  2 78  ? -4.549  42.956  -39.681 1.00 38.49  ? 78  PHE E C     1 
ATOM   9326  O  O     . PHE G  2 78  ? -5.332  43.295  -38.794 1.00 46.30  ? 78  PHE E O     1 
ATOM   9327  C  CB    . PHE G  2 78  ? -5.463  41.100  -41.095 1.00 35.40  ? 78  PHE E CB    1 
ATOM   9328  C  CG    . PHE G  2 78  ? -6.558  40.755  -40.121 1.00 41.92  ? 78  PHE E CG    1 
ATOM   9329  C  CD1   . PHE G  2 78  ? -7.885  41.019  -40.426 1.00 43.58  ? 78  PHE E CD1   1 
ATOM   9330  C  CD2   . PHE G  2 78  ? -6.261  40.173  -38.893 1.00 42.29  ? 78  PHE E CD2   1 
ATOM   9331  C  CE1   . PHE G  2 78  ? -8.902  40.700  -39.521 1.00 45.98  ? 78  PHE E CE1   1 
ATOM   9332  C  CE2   . PHE G  2 78  ? -7.271  39.853  -37.988 1.00 39.30  ? 78  PHE E CE2   1 
ATOM   9333  C  CZ    . PHE G  2 78  ? -8.591  40.118  -38.304 1.00 38.17  ? 78  PHE E CZ    1 
ATOM   9334  N  N     . LYS G  2 79  ? -3.237  42.904  -39.493 1.00 39.44  ? 79  LYS E N     1 
ATOM   9335  C  CA    . LYS G  2 79  ? -2.636  43.220  -38.200 1.00 37.07  ? 79  LYS E CA    1 
ATOM   9336  C  C     . LYS G  2 79  ? -1.127  43.390  -38.340 1.00 40.37  ? 79  LYS E C     1 
ATOM   9337  O  O     . LYS G  2 79  ? -0.455  42.572  -38.969 1.00 44.01  ? 79  LYS E O     1 
ATOM   9338  C  CB    . LYS G  2 79  ? -2.951  42.125  -37.181 1.00 41.38  ? 79  LYS E CB    1 
ATOM   9339  C  CG    . LYS G  2 79  ? -2.508  42.434  -35.766 1.00 44.41  ? 79  LYS E CG    1 
ATOM   9340  C  CD    . LYS G  2 79  ? -3.704  42.678  -34.862 1.00 48.38  ? 79  LYS E CD    1 
ATOM   9341  C  CE    . LYS G  2 79  ? -3.301  42.604  -33.400 1.00 55.39  ? 79  LYS E CE    1 
ATOM   9342  N  NZ    . LYS G  2 79  ? -2.022  43.330  -33.163 1.00 55.33  ? 79  LYS E NZ    1 
ATOM   9343  N  N     . THR G  2 80  ? -0.592  44.453  -37.754 1.00 45.04  ? 80  THR E N     1 
ATOM   9344  C  CA    . THR G  2 80  ? 0.830   44.741  -37.892 1.00 47.04  ? 80  THR E CA    1 
ATOM   9345  C  C     . THR G  2 80  ? 1.662   43.971  -36.877 1.00 47.38  ? 80  THR E C     1 
ATOM   9346  O  O     . THR G  2 80  ? 1.120   43.265  -36.025 1.00 51.27  ? 80  THR E O     1 
ATOM   9347  C  CB    . THR G  2 80  ? 1.113   46.238  -37.737 1.00 47.98  ? 80  THR E CB    1 
ATOM   9348  O  OG1   . THR G  2 80  ? 0.630   46.683  -36.464 1.00 46.67  ? 80  THR E OG1   1 
ATOM   9349  C  CG2   . THR G  2 80  ? 0.423   47.021  -38.845 1.00 40.56  ? 80  THR E CG2   1 
ATOM   9350  N  N     . ASP G  2 81  ? 2.980   44.104  -36.993 1.00 44.43  ? 81  ASP E N     1 
ATOM   9351  C  CA    . ASP G  2 81  ? 3.927   43.500  -36.059 1.00 51.01  ? 81  ASP E CA    1 
ATOM   9352  C  C     . ASP G  2 81  ? 3.762   41.984  -35.928 1.00 52.57  ? 81  ASP E C     1 
ATOM   9353  O  O     . ASP G  2 81  ? 4.097   41.408  -34.893 1.00 53.30  ? 81  ASP E O     1 
ATOM   9354  C  CB    . ASP G  2 81  ? 3.794   44.148  -34.676 1.00 56.68  ? 81  ASP E CB    1 
ATOM   9355  C  CG    . ASP G  2 81  ? 3.635   45.657  -34.748 1.00 71.97  ? 81  ASP E CG    1 
ATOM   9356  O  OD1   . ASP G  2 81  ? 3.946   46.243  -35.810 1.00 76.46  ? 81  ASP E OD1   1 
ATOM   9357  O  OD2   . ASP G  2 81  ? 3.193   46.255  -33.743 1.00 72.68  ? 81  ASP E OD2   1 
ATOM   9358  N  N     . LEU G  2 82  ? 3.250   41.338  -36.971 1.00 52.61  ? 82  LEU E N     1 
ATOM   9359  C  CA    . LEU G  2 82  ? 3.004   39.899  -36.913 1.00 52.06  ? 82  LEU E CA    1 
ATOM   9360  C  C     . LEU G  2 82  ? 4.237   39.088  -37.307 1.00 49.79  ? 82  LEU E C     1 
ATOM   9361  O  O     . LEU G  2 82  ? 4.981   39.459  -38.218 1.00 45.23  ? 82  LEU E O     1 
ATOM   9362  C  CB    . LEU G  2 82  ? 1.820   39.515  -37.808 1.00 44.56  ? 82  LEU E CB    1 
ATOM   9363  C  CG    . LEU G  2 82  ? 0.420   39.647  -37.200 1.00 41.58  ? 82  LEU E CG    1 
ATOM   9364  C  CD1   . LEU G  2 82  ? -0.659  39.319  -38.226 1.00 30.27  ? 82  LEU E CD1   1 
ATOM   9365  C  CD2   . LEU G  2 82  ? 0.286   38.760  -35.974 1.00 35.63  ? 82  LEU E CD2   1 
ATOM   9366  N  N     . ARG G  2 83  ? 4.440   37.979  -36.603 1.00 45.48  ? 83  ARG E N     1 
ATOM   9367  C  CA    . ARG G  2 83  ? 5.494   37.030  -36.933 1.00 46.21  ? 83  ARG E CA    1 
ATOM   9368  C  C     . ARG G  2 83  ? 4.907   35.690  -37.377 1.00 47.15  ? 83  ARG E C     1 
ATOM   9369  O  O     . ARG G  2 83  ? 3.827   35.293  -36.933 1.00 45.15  ? 83  ARG E O     1 
ATOM   9370  C  CB    . ARG G  2 83  ? 6.420   36.823  -35.736 1.00 51.57  ? 83  ARG E CB    1 
ATOM   9371  C  CG    . ARG G  2 83  ? 7.070   38.090  -35.239 1.00 53.23  ? 83  ARG E CG    1 
ATOM   9372  C  CD    . ARG G  2 83  ? 8.189   37.794  -34.260 1.00 53.58  ? 83  ARG E CD    1 
ATOM   9373  N  NE    . ARG G  2 83  ? 9.175   38.869  -34.270 1.00 71.05  ? 83  ARG E NE    1 
ATOM   9374  C  CZ    . ARG G  2 83  ? 10.487  38.680  -34.184 1.00 76.04  ? 83  ARG E CZ    1 
ATOM   9375  N  NH1   . ARG G  2 83  ? 10.972  37.449  -34.071 1.00 63.16  ? 83  ARG E NH1   1 
ATOM   9376  N  NH2   . ARG G  2 83  ? 11.313  39.720  -34.209 1.00 75.93  ? 83  ARG E NH2   1 
ATOM   9377  N  N     . PHE G  2 84  ? 5.629   34.988  -38.243 1.00 44.66  ? 84  PHE E N     1 
ATOM   9378  C  CA    . PHE G  2 84  ? 5.172   33.697  -38.741 1.00 37.64  ? 84  PHE E CA    1 
ATOM   9379  C  C     . PHE G  2 84  ? 6.175   32.577  -38.503 1.00 35.98  ? 84  PHE E C     1 
ATOM   9380  O  O     . PHE G  2 84  ? 7.347   32.700  -38.850 1.00 45.94  ? 84  PHE E O     1 
ATOM   9381  C  CB    . PHE G  2 84  ? 4.874   33.784  -40.236 1.00 34.50  ? 84  PHE E CB    1 
ATOM   9382  C  CG    . PHE G  2 84  ? 3.523   34.348  -40.554 1.00 42.13  ? 84  PHE E CG    1 
ATOM   9383  C  CD1   . PHE G  2 84  ? 3.339   35.715  -40.665 1.00 38.58  ? 84  PHE E CD1   1 
ATOM   9384  C  CD2   . PHE G  2 84  ? 2.438   33.509  -40.761 1.00 42.66  ? 84  PHE E CD2   1 
ATOM   9385  C  CE1   . PHE G  2 84  ? 2.096   36.236  -40.968 1.00 38.29  ? 84  PHE E CE1   1 
ATOM   9386  C  CE2   . PHE G  2 84  ? 1.189   34.024  -41.063 1.00 37.41  ? 84  PHE E CE2   1 
ATOM   9387  C  CZ    . PHE G  2 84  ? 1.017   35.388  -41.167 1.00 40.03  ? 84  PHE E CZ    1 
ATOM   9388  N  N     . GLN G  2 85  ? 5.709   31.482  -37.913 1.00 38.39  ? 85  GLN E N     1 
ATOM   9389  C  CA    . GLN G  2 85  ? 6.440   30.222  -37.979 1.00 38.41  ? 85  GLN E CA    1 
ATOM   9390  C  C     . GLN G  2 85  ? 6.534   29.805  -39.443 1.00 37.89  ? 85  GLN E C     1 
ATOM   9391  O  O     . GLN G  2 85  ? 5.557   29.912  -40.185 1.00 36.40  ? 85  GLN E O     1 
ATOM   9392  C  CB    . GLN G  2 85  ? 5.742   29.132  -37.163 1.00 40.54  ? 85  GLN E CB    1 
ATOM   9393  C  CG    . GLN G  2 85  ? 5.650   29.408  -35.672 1.00 40.16  ? 85  GLN E CG    1 
ATOM   9394  C  CD    . GLN G  2 85  ? 5.071   28.231  -34.910 1.00 42.33  ? 85  GLN E CD    1 
ATOM   9395  O  OE1   . GLN G  2 85  ? 4.479   27.329  -35.503 1.00 39.27  ? 85  GLN E OE1   1 
ATOM   9396  N  NE2   . GLN G  2 85  ? 5.231   28.237  -33.590 1.00 42.77  ? 85  GLN E NE2   1 
ATOM   9397  N  N     . SER G  2 86  ? 7.700   29.338  -39.865 1.00 38.97  ? 86  SER E N     1 
ATOM   9398  C  CA    . SER G  2 86  ? 7.880   28.937  -41.256 1.00 41.41  ? 86  SER E CA    1 
ATOM   9399  C  C     . SER G  2 86  ? 6.924   27.801  -41.646 1.00 39.88  ? 86  SER E C     1 
ATOM   9400  O  O     . SER G  2 86  ? 6.444   27.737  -42.784 1.00 43.32  ? 86  SER E O     1 
ATOM   9401  C  CB    . SER G  2 86  ? 9.331   28.531  -41.497 1.00 34.34  ? 86  SER E CB    1 
ATOM   9402  O  OG    . SER G  2 86  ? 9.786   27.685  -40.459 1.00 50.71  ? 86  SER E OG    1 
ATOM   9403  N  N     . SER G  2 87  ? 6.631   26.921  -40.693 1.00 33.76  ? 87  SER E N     1 
ATOM   9404  C  CA    . SER G  2 87  ? 5.716   25.817  -40.940 1.00 30.04  ? 87  SER E CA    1 
ATOM   9405  C  C     . SER G  2 87  ? 4.287   26.309  -41.107 1.00 33.88  ? 87  SER E C     1 
ATOM   9406  O  O     . SER G  2 87  ? 3.466   25.635  -41.716 1.00 37.87  ? 87  SER E O     1 
ATOM   9407  C  CB    . SER G  2 87  ? 5.779   24.800  -39.806 1.00 31.43  ? 87  SER E CB    1 
ATOM   9408  O  OG    . SER G  2 87  ? 5.278   25.360  -38.608 1.00 41.38  ? 87  SER E OG    1 
ATOM   9409  N  N     . ALA G  2 88  ? 3.984   27.479  -40.560 1.00 34.00  ? 88  ALA E N     1 
ATOM   9410  C  CA    . ALA G  2 88  ? 2.660   28.064  -40.735 1.00 32.30  ? 88  ALA E CA    1 
ATOM   9411  C  C     . ALA G  2 88  ? 2.503   28.614  -42.154 1.00 32.39  ? 88  ALA E C     1 
ATOM   9412  O  O     . ALA G  2 88  ? 1.449   28.459  -42.784 1.00 32.48  ? 88  ALA E O     1 
ATOM   9413  C  CB    . ALA G  2 88  ? 2.417   29.154  -39.705 1.00 36.11  ? 88  ALA E CB    1 
ATOM   9414  N  N     . VAL G  2 89  ? 3.552   29.258  -42.657 1.00 33.47  ? 89  VAL E N     1 
ATOM   9415  C  CA    . VAL G  2 89  ? 3.560   29.707  -44.044 1.00 33.74  ? 89  VAL E CA    1 
ATOM   9416  C  C     . VAL G  2 89  ? 3.416   28.492  -44.953 1.00 33.64  ? 89  VAL E C     1 
ATOM   9417  O  O     . VAL G  2 89  ? 2.638   28.502  -45.912 1.00 31.85  ? 89  VAL E O     1 
ATOM   9418  C  CB    . VAL G  2 89  ? 4.853   30.474  -44.407 1.00 32.26  ? 89  VAL E CB    1 
ATOM   9419  C  CG1   . VAL G  2 89  ? 4.767   31.032  -45.820 1.00 25.65  ? 89  VAL E CG1   1 
ATOM   9420  C  CG2   . VAL G  2 89  ? 5.109   31.586  -43.414 1.00 36.46  ? 89  VAL E CG2   1 
ATOM   9421  N  N     . MET G  2 90  ? 4.160   27.436  -44.630 1.00 35.90  ? 90  MET E N     1 
ATOM   9422  C  CA    . MET G  2 90  ? 4.113   26.211  -45.417 1.00 33.46  ? 90  MET E CA    1 
ATOM   9423  C  C     . MET G  2 90  ? 2.722   25.574  -45.412 1.00 32.69  ? 90  MET E C     1 
ATOM   9424  O  O     . MET G  2 90  ? 2.223   25.164  -46.462 1.00 30.40  ? 90  MET E O     1 
ATOM   9425  C  CB    . MET G  2 90  ? 5.156   25.221  -44.912 1.00 37.98  ? 90  MET E CB    1 
ATOM   9426  C  CG    . MET G  2 90  ? 6.568   25.558  -45.363 1.00 38.90  ? 90  MET E CG    1 
ATOM   9427  S  SD    . MET G  2 90  ? 6.679   25.727  -47.158 1.00 51.84  ? 90  MET E SD    1 
ATOM   9428  C  CE    . MET G  2 90  ? 6.982   27.484  -47.306 1.00 48.86  ? 90  MET E CE    1 
ATOM   9429  N  N     . ALA G  2 91  ? 2.090   25.507  -44.243 1.00 28.23  ? 91  ALA E N     1 
ATOM   9430  C  CA    . ALA G  2 91  ? 0.712   25.029  -44.161 1.00 26.02  ? 91  ALA E CA    1 
ATOM   9431  C  C     . ALA G  2 91  ? -0.199  25.873  -45.053 1.00 30.66  ? 91  ALA E C     1 
ATOM   9432  O  O     . ALA G  2 91  ? -0.977  25.330  -45.839 1.00 33.05  ? 91  ALA E O     1 
ATOM   9433  C  CB    . ALA G  2 91  ? 0.219   25.043  -42.724 1.00 17.20  ? 91  ALA E CB    1 
ATOM   9434  N  N     . LEU G  2 92  ? -0.086  27.197  -44.948 1.00 31.21  ? 92  LEU E N     1 
ATOM   9435  C  CA    . LEU G  2 92  ? -0.874  28.090  -45.799 1.00 27.99  ? 92  LEU E CA    1 
ATOM   9436  C  C     . LEU G  2 92  ? -0.687  27.768  -47.284 1.00 29.59  ? 92  LEU E C     1 
ATOM   9437  O  O     . LEU G  2 92  ? -1.653  27.750  -48.047 1.00 30.78  ? 92  LEU E O     1 
ATOM   9438  C  CB    . LEU G  2 92  ? -0.507  29.552  -45.527 1.00 32.26  ? 92  LEU E CB    1 
ATOM   9439  C  CG    . LEU G  2 92  ? -1.047  30.154  -44.226 1.00 28.83  ? 92  LEU E CG    1 
ATOM   9440  C  CD1   . LEU G  2 92  ? -0.400  31.499  -43.969 1.00 24.78  ? 92  LEU E CD1   1 
ATOM   9441  C  CD2   . LEU G  2 92  ? -2.560  30.290  -44.274 1.00 17.37  ? 92  LEU E CD2   1 
ATOM   9442  N  N     . GLN G  2 93  ? 0.546   27.487  -47.694 1.00 30.73  ? 93  GLN E N     1 
ATOM   9443  C  CA    . GLN G  2 93  ? 0.790   27.194  -49.101 1.00 26.69  ? 93  GLN E CA    1 
ATOM   9444  C  C     . GLN G  2 93  ? 0.206   25.842  -49.508 1.00 28.56  ? 93  GLN E C     1 
ATOM   9445  O  O     . GLN G  2 93  ? -0.363  25.718  -50.590 1.00 28.96  ? 93  GLN E O     1 
ATOM   9446  C  CB    . GLN G  2 93  ? 2.285   27.240  -49.422 1.00 25.28  ? 93  GLN E CB    1 
ATOM   9447  C  CG    . GLN G  2 93  ? 2.549   27.378  -50.914 1.00 22.57  ? 93  GLN E CG    1 
ATOM   9448  C  CD    . GLN G  2 93  ? 4.007   27.587  -51.246 1.00 29.44  ? 93  GLN E CD    1 
ATOM   9449  O  OE1   . GLN G  2 93  ? 4.845   27.787  -50.361 1.00 31.01  ? 93  GLN E OE1   1 
ATOM   9450  N  NE2   . GLN G  2 93  ? 4.324   27.537  -52.534 1.00 29.58  ? 93  GLN E NE2   1 
ATOM   9451  N  N     . GLU G  2 94  ? 0.350   24.836  -48.646 1.00 27.06  ? 94  GLU E N     1 
ATOM   9452  C  CA    . GLU G  2 94  ? -0.258  23.529  -48.883 1.00 24.74  ? 94  GLU E CA    1 
ATOM   9453  C  C     . GLU G  2 94  ? -1.768  23.654  -49.082 1.00 26.81  ? 94  GLU E C     1 
ATOM   9454  O  O     . GLU G  2 94  ? -2.336  23.111  -50.034 1.00 28.29  ? 94  GLU E O     1 
ATOM   9455  C  CB    . GLU G  2 94  ? 0.033   22.578  -47.721 1.00 26.97  ? 94  GLU E CB    1 
ATOM   9456  C  CG    . GLU G  2 94  ? 1.445   22.001  -47.700 1.00 28.24  ? 94  GLU E CG    1 
ATOM   9457  C  CD    . GLU G  2 94  ? 1.698   20.990  -48.810 1.00 36.19  ? 94  GLU E CD    1 
ATOM   9458  O  OE1   . GLU G  2 94  ? 0.727   20.581  -49.486 1.00 37.51  ? 94  GLU E OE1   1 
ATOM   9459  O  OE2   . GLU G  2 94  ? 2.872   20.597  -49.001 1.00 37.00  ? 94  GLU E OE2   1 
ATOM   9460  N  N     . ALA G  2 95  ? -2.412  24.388  -48.184 1.00 26.70  ? 95  ALA E N     1 
ATOM   9461  C  CA    . ALA G  2 95  ? -3.843  24.617  -48.282 1.00 22.74  ? 95  ALA E CA    1 
ATOM   9462  C  C     . ALA G  2 95  ? -4.203  25.346  -49.573 1.00 28.52  ? 95  ALA E C     1 
ATOM   9463  O  O     . ALA G  2 95  ? -5.135  24.948  -50.268 1.00 30.32  ? 95  ALA E O     1 
ATOM   9464  C  CB    . ALA G  2 95  ? -4.331  25.398  -47.079 1.00 22.06  ? 95  ALA E CB    1 
ATOM   9465  N  N     . CYS G  2 96  ? -3.459  26.405  -49.895 1.00 27.05  ? 96  CYS E N     1 
ATOM   9466  C  CA    . CYS G  2 96  ? -3.765  27.235  -51.064 1.00 23.98  ? 96  CYS E CA    1 
ATOM   9467  C  C     . CYS G  2 96  ? -3.631  26.461  -52.366 1.00 26.70  ? 96  CYS E C     1 
ATOM   9468  O  O     . CYS G  2 96  ? -4.467  26.581  -53.267 1.00 24.73  ? 96  CYS E O     1 
ATOM   9469  C  CB    . CYS G  2 96  ? -2.856  28.467  -51.109 1.00 31.25  ? 96  CYS E CB    1 
ATOM   9470  S  SG    . CYS G  2 96  ? -3.358  29.825  -50.013 1.00 37.16  ? 96  CYS E SG    1 
ATOM   9471  N  N     . GLU G  2 97  ? -2.575  25.663  -52.467 1.00 32.62  ? 97  GLU E N     1 
ATOM   9472  C  CA    . GLU G  2 97  ? -2.338  24.911  -53.687 1.00 28.19  ? 97  GLU E CA    1 
ATOM   9473  C  C     . GLU G  2 97  ? -3.322  23.755  -53.800 1.00 24.63  ? 97  GLU E C     1 
ATOM   9474  O  O     . GLU G  2 97  ? -3.822  23.481  -54.889 1.00 26.29  ? 97  GLU E O     1 
ATOM   9475  C  CB    . GLU G  2 97  ? -0.894  24.419  -53.748 1.00 28.68  ? 97  GLU E CB    1 
ATOM   9476  C  CG    . GLU G  2 97  ? 0.114   25.558  -53.752 1.00 32.21  ? 97  GLU E CG    1 
ATOM   9477  C  CD    . GLU G  2 97  ? 1.417   25.196  -54.436 1.00 35.28  ? 97  GLU E CD    1 
ATOM   9478  O  OE1   . GLU G  2 97  ? 1.547   24.056  -54.928 1.00 39.95  ? 97  GLU E OE1   1 
ATOM   9479  O  OE2   . GLU G  2 97  ? 2.320   26.055  -54.479 1.00 39.82  ? 97  GLU E OE2   1 
ATOM   9480  N  N     . ALA G  2 98  ? -3.626  23.094  -52.686 1.00 25.45  ? 98  ALA E N     1 
ATOM   9481  C  CA    . ALA G  2 98  ? -4.626  22.025  -52.727 1.00 20.86  ? 98  ALA E CA    1 
ATOM   9482  C  C     . ALA G  2 98  ? -5.963  22.593  -53.163 1.00 24.75  ? 98  ALA E C     1 
ATOM   9483  O  O     . ALA G  2 98  ? -6.639  22.018  -54.023 1.00 31.89  ? 98  ALA E O     1 
ATOM   9484  C  CB    . ALA G  2 98  ? -4.756  21.342  -51.387 1.00 19.08  ? 98  ALA E CB    1 
ATOM   9485  N  N     . TYR G  2 99  ? -6.336  23.733  -52.585 1.00 22.06  ? 99  TYR E N     1 
ATOM   9486  C  CA    . TYR G  2 99  ? -7.589  24.386  -52.947 1.00 24.35  ? 99  TYR E CA    1 
ATOM   9487  C  C     . TYR G  2 99  ? -7.608  24.787  -54.424 1.00 23.81  ? 99  TYR E C     1 
ATOM   9488  O  O     . TYR G  2 99  ? -8.610  24.599  -55.105 1.00 22.96  ? 99  TYR E O     1 
ATOM   9489  C  CB    . TYR G  2 99  ? -7.848  25.614  -52.065 1.00 28.85  ? 99  TYR E CB    1 
ATOM   9490  C  CG    . TYR G  2 99  ? -8.950  26.516  -52.593 1.00 27.48  ? 99  TYR E CG    1 
ATOM   9491  C  CD1   . TYR G  2 99  ? -10.293 26.172  -52.451 1.00 26.55  ? 99  TYR E CD1   1 
ATOM   9492  C  CD2   . TYR G  2 99  ? -8.644  27.699  -53.256 1.00 22.06  ? 99  TYR E CD2   1 
ATOM   9493  C  CE1   . TYR G  2 99  ? -11.301 26.991  -52.948 1.00 25.60  ? 99  TYR E CE1   1 
ATOM   9494  C  CE2   . TYR G  2 99  ? -9.638  28.520  -53.759 1.00 26.03  ? 99  TYR E CE2   1 
ATOM   9495  C  CZ    . TYR G  2 99  ? -10.963 28.166  -53.603 1.00 30.52  ? 99  TYR E CZ    1 
ATOM   9496  O  OH    . TYR G  2 99  ? -11.945 28.994  -54.107 1.00 27.44  ? 99  TYR E OH    1 
ATOM   9497  N  N     . LEU G  2 100 ? -6.508  25.333  -54.929 1.00 25.87  ? 100 LEU E N     1 
ATOM   9498  C  CA    . LEU G  2 100 ? -6.515  25.808  -56.309 1.00 26.04  ? 100 LEU E CA    1 
ATOM   9499  C  C     . LEU G  2 100 ? -6.519  24.644  -57.310 1.00 26.43  ? 100 LEU E C     1 
ATOM   9500  O  O     . LEU G  2 100 ? -7.193  24.718  -58.338 1.00 29.01  ? 100 LEU E O     1 
ATOM   9501  C  CB    . LEU G  2 100 ? -5.335  26.757  -56.552 1.00 29.34  ? 100 LEU E CB    1 
ATOM   9502  C  CG    . LEU G  2 100 ? -5.519  28.170  -55.960 1.00 31.48  ? 100 LEU E CG    1 
ATOM   9503  C  CD1   . LEU G  2 100 ? -4.251  29.005  -56.050 1.00 25.94  ? 100 LEU E CD1   1 
ATOM   9504  C  CD2   . LEU G  2 100 ? -6.668  28.913  -56.626 1.00 26.15  ? 100 LEU E CD2   1 
ATOM   9505  N  N     . VAL G  2 101 ? -5.803  23.562  -57.006 1.00 26.04  ? 101 VAL E N     1 
ATOM   9506  C  CA    . VAL G  2 101 ? -5.825  22.371  -57.864 1.00 24.76  ? 101 VAL E CA    1 
ATOM   9507  C  C     . VAL G  2 101 ? -7.229  21.764  -57.889 1.00 25.39  ? 101 VAL E C     1 
ATOM   9508  O  O     . VAL G  2 101 ? -7.779  21.416  -58.961 1.00 25.61  ? 101 VAL E O     1 
ATOM   9509  C  CB    . VAL G  2 101 ? -4.797  21.309  -57.395 1.00 31.11  ? 101 VAL E CB    1 
ATOM   9510  C  CG1   . VAL G  2 101 ? -5.047  19.971  -58.077 1.00 29.36  ? 101 VAL E CG1   1 
ATOM   9511  C  CG2   . VAL G  2 101 ? -3.359  21.788  -57.650 1.00 21.26  ? 101 VAL E CG2   1 
ATOM   9512  N  N     . GLY G  2 102 ? -7.816  21.669  -56.697 1.00 25.55  ? 102 GLY E N     1 
ATOM   9513  C  CA    . GLY G  2 102 ? -9.191  21.225  -56.550 1.00 23.73  ? 102 GLY E CA    1 
ATOM   9514  C  C     . GLY G  2 102 ? -10.174 22.062  -57.342 1.00 29.40  ? 102 GLY E C     1 
ATOM   9515  O  O     . GLY G  2 102 ? -11.073 21.527  -57.983 1.00 32.72  ? 102 GLY E O     1 
ATOM   9516  N  N     . LEU G  2 103 ? -9.997  23.381  -57.309 1.00 33.74  ? 103 LEU E N     1 
ATOM   9517  C  CA    . LEU G  2 103 ? -10.884 24.294  -58.024 1.00 28.55  ? 103 LEU E CA    1 
ATOM   9518  C  C     . LEU G  2 103 ? -10.728 24.157  -59.533 1.00 30.52  ? 103 LEU E C     1 
ATOM   9519  O  O     . LEU G  2 103 ? -11.717 24.190  -60.272 1.00 32.49  ? 103 LEU E O     1 
ATOM   9520  C  CB    . LEU G  2 103 ? -10.625 25.738  -57.604 1.00 31.77  ? 103 LEU E CB    1 
ATOM   9521  C  CG    . LEU G  2 103 ? -11.570 26.769  -58.226 1.00 30.53  ? 103 LEU E CG    1 
ATOM   9522  C  CD1   . LEU G  2 103 ? -13.001 26.566  -57.742 1.00 29.22  ? 103 LEU E CD1   1 
ATOM   9523  C  CD2   . LEU G  2 103 ? -11.094 28.176  -57.935 1.00 28.67  ? 103 LEU E CD2   1 
ATOM   9524  N  N     . PHE G  2 104 ? -9.485  24.003  -59.985 1.00 31.18  ? 104 PHE E N     1 
ATOM   9525  C  CA    . PHE G  2 104 ? -9.198  23.806  -61.408 1.00 30.05  ? 104 PHE E CA    1 
ATOM   9526  C  C     . PHE G  2 104 ? -9.803  22.504  -61.975 1.00 35.13  ? 104 PHE E C     1 
ATOM   9527  O  O     . PHE G  2 104 ? -10.182 22.465  -63.145 1.00 30.26  ? 104 PHE E O     1 
ATOM   9528  C  CB    . PHE G  2 104 ? -7.691  23.824  -61.645 1.00 26.01  ? 104 PHE E CB    1 
ATOM   9529  C  CG    . PHE G  2 104 ? -7.114  25.201  -61.764 1.00 32.66  ? 104 PHE E CG    1 
ATOM   9530  C  CD1   . PHE G  2 104 ? -7.717  26.153  -62.573 1.00 36.29  ? 104 PHE E CD1   1 
ATOM   9531  C  CD2   . PHE G  2 104 ? -5.963  25.546  -61.075 1.00 30.98  ? 104 PHE E CD2   1 
ATOM   9532  C  CE1   . PHE G  2 104 ? -7.185  27.425  -62.692 1.00 30.59  ? 104 PHE E CE1   1 
ATOM   9533  C  CE2   . PHE G  2 104 ? -5.425  26.816  -61.187 1.00 30.48  ? 104 PHE E CE2   1 
ATOM   9534  C  CZ    . PHE G  2 104 ? -6.037  27.758  -61.995 1.00 31.24  ? 104 PHE E CZ    1 
ATOM   9535  N  N     . GLU G  2 105 ? -9.891  21.442  -61.170 1.00 33.47  ? 105 GLU E N     1 
ATOM   9536  C  CA    . GLU G  2 105 ? -10.610 20.242  -61.634 1.00 28.94  ? 105 GLU E CA    1 
ATOM   9537  C  C     . GLU G  2 105 ? -12.085 20.542  -61.959 1.00 34.44  ? 105 GLU E C     1 
ATOM   9538  O  O     . GLU G  2 105 ? -12.594 20.167  -63.031 1.00 34.33  ? 105 GLU E O     1 
ATOM   9539  C  CB    . GLU G  2 105 ? -10.532 19.127  -60.592 1.00 27.04  ? 105 GLU E CB    1 
ATOM   9540  C  CG    . GLU G  2 105 ? -9.148  18.523  -60.434 1.00 33.94  ? 105 GLU E CG    1 
ATOM   9541  C  CD    . GLU G  2 105 ? -8.970  17.810  -59.105 1.00 39.51  ? 105 GLU E CD    1 
ATOM   9542  O  OE1   . GLU G  2 105 ? -9.979  17.650  -58.380 1.00 41.48  ? 105 GLU E OE1   1 
ATOM   9543  O  OE2   . GLU G  2 105 ? -7.817  17.430  -58.782 1.00 40.22  ? 105 GLU E OE2   1 
ATOM   9544  N  N     . ASP G  2 106 ? -12.769 21.218  -61.037 1.00 34.90  ? 106 ASP E N     1 
ATOM   9545  C  CA    . ASP G  2 106 ? -14.181 21.555  -61.225 1.00 30.06  ? 106 ASP E CA    1 
ATOM   9546  C  C     . ASP G  2 106 ? -14.356 22.511  -62.406 1.00 33.20  ? 106 ASP E C     1 
ATOM   9547  O  O     . ASP G  2 106 ? -15.331 22.430  -63.168 1.00 29.61  ? 106 ASP E O     1 
ATOM   9548  C  CB    . ASP G  2 106 ? -14.761 22.174  -59.954 1.00 26.30  ? 106 ASP E CB    1 
ATOM   9549  C  CG    . ASP G  2 106 ? -14.639 21.258  -58.744 1.00 36.06  ? 106 ASP E CG    1 
ATOM   9550  O  OD1   . ASP G  2 106 ? -14.364 20.053  -58.926 1.00 35.34  ? 106 ASP E OD1   1 
ATOM   9551  O  OD2   . ASP G  2 106 ? -14.834 21.745  -57.605 1.00 38.23  ? 106 ASP E OD2   1 
ATOM   9552  N  N     . THR G  2 107 ? -13.396 23.419  -62.550 1.00 35.95  ? 107 THR E N     1 
ATOM   9553  C  CA    . THR G  2 107 ? -13.401 24.382  -63.643 1.00 29.07  ? 107 THR E CA    1 
ATOM   9554  C  C     . THR G  2 107 ? -13.296 23.647  -64.967 1.00 27.39  ? 107 THR E C     1 
ATOM   9555  O  O     . THR G  2 107 ? -14.048 23.909  -65.908 1.00 31.61  ? 107 THR E O     1 
ATOM   9556  C  CB    . THR G  2 107 ? -12.246 25.391  -63.501 1.00 27.51  ? 107 THR E CB    1 
ATOM   9557  O  OG1   . THR G  2 107 ? -12.376 26.078  -62.252 1.00 33.62  ? 107 THR E OG1   1 
ATOM   9558  C  CG2   . THR G  2 107 ? -12.263 26.401  -64.623 1.00 25.25  ? 107 THR E CG2   1 
ATOM   9559  N  N     . ASN G  2 108 ? -12.357 22.712  -65.025 1.00 27.99  ? 108 ASN E N     1 
ATOM   9560  C  CA    . ASN G  2 108 ? -12.178 21.876  -66.197 1.00 28.49  ? 108 ASN E CA    1 
ATOM   9561  C  C     . ASN G  2 108 ? -13.467 21.134  -66.549 1.00 34.61  ? 108 ASN E C     1 
ATOM   9562  O  O     . ASN G  2 108 ? -13.855 21.060  -67.723 1.00 31.80  ? 108 ASN E O     1 
ATOM   9563  C  CB    . ASN G  2 108 ? -11.040 20.888  -65.960 1.00 28.19  ? 108 ASN E CB    1 
ATOM   9564  C  CG    . ASN G  2 108 ? -10.411 20.409  -67.242 1.00 28.12  ? 108 ASN E CG    1 
ATOM   9565  O  OD1   . ASN G  2 108 ? -10.469 21.090  -68.266 1.00 33.78  ? 108 ASN E OD1   1 
ATOM   9566  N  ND2   . ASN G  2 108 ? -9.794  19.238  -67.194 1.00 30.06  ? 108 ASN E ND2   1 
ATOM   9567  N  N     . LEU G  2 109 ? -14.140 20.596  -65.531 1.00 29.28  ? 109 LEU E N     1 
ATOM   9568  C  CA    . LEU G  2 109 ? -15.416 19.934  -65.777 1.00 29.25  ? 109 LEU E CA    1 
ATOM   9569  C  C     . LEU G  2 109 ? -16.473 20.908  -66.325 1.00 30.73  ? 109 LEU E C     1 
ATOM   9570  O  O     . LEU G  2 109 ? -17.287 20.533  -67.171 1.00 32.87  ? 109 LEU E O     1 
ATOM   9571  C  CB    . LEU G  2 109 ? -15.924 19.251  -64.503 1.00 34.38  ? 109 LEU E CB    1 
ATOM   9572  C  CG    . LEU G  2 109 ? -15.268 17.916  -64.117 1.00 30.39  ? 109 LEU E CG    1 
ATOM   9573  C  CD1   . LEU G  2 109 ? -16.006 17.257  -62.961 1.00 22.57  ? 109 LEU E CD1   1 
ATOM   9574  C  CD2   . LEU G  2 109 ? -15.190 16.974  -65.306 1.00 19.77  ? 109 LEU E CD2   1 
ATOM   9575  N  N     . CYS G  2 110 ? -16.457 22.159  -65.868 1.00 29.67  ? 110 CYS E N     1 
ATOM   9576  C  CA    . CYS G  2 110 ? -17.418 23.144  -66.379 1.00 34.79  ? 110 CYS E CA    1 
ATOM   9577  C  C     . CYS G  2 110 ? -17.135 23.563  -67.828 1.00 35.15  ? 110 CYS E C     1 
ATOM   9578  O  O     . CYS G  2 110 ? -18.061 23.837  -68.596 1.00 32.22  ? 110 CYS E O     1 
ATOM   9579  C  CB    . CYS G  2 110 ? -17.444 24.384  -65.488 1.00 30.73  ? 110 CYS E CB    1 
ATOM   9580  S  SG    . CYS G  2 110 ? -18.107 24.083  -63.843 1.00 31.27  ? 110 CYS E SG    1 
ATOM   9581  N  N     . ALA G  2 111 ? -15.861 23.625  -68.200 1.00 31.16  ? 111 ALA E N     1 
ATOM   9582  C  CA    . ALA G  2 111 ? -15.514 23.932  -69.582 1.00 28.98  ? 111 ALA E CA    1 
ATOM   9583  C  C     . ALA G  2 111 ? -15.883 22.767  -70.492 1.00 35.69  ? 111 ALA E C     1 
ATOM   9584  O  O     . ALA G  2 111 ? -16.401 22.965  -71.590 1.00 37.45  ? 111 ALA E O     1 
ATOM   9585  C  CB    . ALA G  2 111 ? -14.040 24.255  -69.708 1.00 30.09  ? 111 ALA E CB    1 
ATOM   9586  N  N     . ILE G  2 112 ? -15.619 21.549  -70.033 1.00 33.86  ? 112 ILE E N     1 
ATOM   9587  C  CA    . ILE G  2 112 ? -15.937 20.368  -70.827 1.00 35.12  ? 112 ILE E CA    1 
ATOM   9588  C  C     . ILE G  2 112 ? -17.454 20.195  -70.950 1.00 36.56  ? 112 ILE E C     1 
ATOM   9589  O  O     . ILE G  2 112 ? -17.955 19.663  -71.940 1.00 41.85  ? 112 ILE E O     1 
ATOM   9590  C  CB    . ILE G  2 112 ? -15.289 19.110  -70.221 1.00 32.82  ? 112 ILE E CB    1 
ATOM   9591  C  CG1   . ILE G  2 112 ? -13.768 19.230  -70.297 1.00 35.90  ? 112 ILE E CG1   1 
ATOM   9592  C  CG2   . ILE G  2 112 ? -15.719 17.870  -70.955 1.00 28.04  ? 112 ILE E CG2   1 
ATOM   9593  C  CD1   . ILE G  2 112 ? -13.029 18.208  -69.465 1.00 36.68  ? 112 ILE E CD1   1 
ATOM   9594  N  N     . HIS G  2 113 ? -18.190 20.670  -69.953 1.00 40.27  ? 113 HIS E N     1 
ATOM   9595  C  CA    . HIS G  2 113 ? -19.647 20.645  -70.024 1.00 36.48  ? 113 HIS E CA    1 
ATOM   9596  C  C     . HIS G  2 113 ? -20.165 21.555  -71.135 1.00 39.44  ? 113 HIS E C     1 
ATOM   9597  O  O     . HIS G  2 113 ? -21.197 21.280  -71.749 1.00 39.49  ? 113 HIS E O     1 
ATOM   9598  C  CB    . HIS G  2 113 ? -20.247 21.068  -68.691 1.00 37.44  ? 113 HIS E CB    1 
ATOM   9599  C  CG    . HIS G  2 113 ? -21.735 20.927  -68.628 1.00 42.33  ? 113 HIS E CG    1 
ATOM   9600  N  ND1   . HIS G  2 113 ? -22.365 19.704  -68.569 1.00 42.04  ? 113 HIS E ND1   1 
ATOM   9601  C  CD2   . HIS G  2 113 ? -22.716 21.860  -68.601 1.00 39.39  ? 113 HIS E CD2   1 
ATOM   9602  C  CE1   . HIS G  2 113 ? -23.673 19.888  -68.511 1.00 38.54  ? 113 HIS E CE1   1 
ATOM   9603  N  NE2   . HIS G  2 113 ? -23.912 21.186  -68.529 1.00 41.55  ? 113 HIS E NE2   1 
ATOM   9604  N  N     . ALA G  2 114 ? -19.437 22.644  -71.375 1.00 39.98  ? 114 ALA E N     1 
ATOM   9605  C  CA    . ALA G  2 114 ? -19.776 23.612  -72.416 1.00 34.84  ? 114 ALA E CA    1 
ATOM   9606  C  C     . ALA G  2 114 ? -19.179 23.210  -73.759 1.00 38.93  ? 114 ALA E C     1 
ATOM   9607  O  O     . ALA G  2 114 ? -19.081 24.030  -74.676 1.00 34.46  ? 114 ALA E O     1 
ATOM   9608  C  CB    . ALA G  2 114 ? -19.293 24.991  -72.025 1.00 32.27  ? 114 ALA E CB    1 
ATOM   9609  N  N     . LYS G  2 115 ? -18.771 21.947  -73.856 1.00 39.66  ? 115 LYS E N     1 
ATOM   9610  C  CA    . LYS G  2 115 ? -18.169 21.402  -75.067 1.00 36.96  ? 115 LYS E CA    1 
ATOM   9611  C  C     . LYS G  2 115 ? -16.914 22.187  -75.465 1.00 35.31  ? 115 LYS E C     1 
ATOM   9612  O  O     . LYS G  2 115 ? -16.615 22.356  -76.643 1.00 36.35  ? 115 LYS E O     1 
ATOM   9613  C  CB    . LYS G  2 115 ? -19.188 21.390  -76.208 1.00 37.99  ? 115 LYS E CB    1 
ATOM   9614  C  CG    . LYS G  2 115 ? -20.467 20.615  -75.893 1.00 38.61  ? 115 LYS E CG    1 
ATOM   9615  C  CD    . LYS G  2 115 ? -21.493 20.776  -77.007 1.00 47.82  ? 115 LYS E CD    1 
ATOM   9616  C  CE    . LYS G  2 115 ? -22.652 19.803  -76.855 1.00 56.07  ? 115 LYS E CE    1 
ATOM   9617  N  NZ    . LYS G  2 115 ? -23.650 19.967  -77.954 1.00 61.19  ? 115 LYS E NZ    1 
ATOM   9618  N  N     . ARG G  2 116 ? -16.180 22.657  -74.465 1.00 36.82  ? 116 ARG E N     1 
ATOM   9619  C  CA    . ARG G  2 116 ? -14.921 23.352  -74.697 1.00 34.49  ? 116 ARG E CA    1 
ATOM   9620  C  C     . ARG G  2 116 ? -13.746 22.592  -74.091 1.00 33.24  ? 116 ARG E C     1 
ATOM   9621  O  O     . ARG G  2 116 ? -13.915 21.630  -73.341 1.00 39.90  ? 116 ARG E O     1 
ATOM   9622  C  CB    . ARG G  2 116 ? -14.971 24.769  -74.119 1.00 36.07  ? 116 ARG E CB    1 
ATOM   9623  C  CG    . ARG G  2 116 ? -15.926 25.703  -74.839 1.00 37.19  ? 116 ARG E CG    1 
ATOM   9624  C  CD    . ARG G  2 116 ? -15.854 27.116  -74.269 1.00 38.37  ? 116 ARG E CD    1 
ATOM   9625  N  NE    . ARG G  2 116 ? -16.627 27.269  -73.038 1.00 36.75  ? 116 ARG E NE    1 
ATOM   9626  C  CZ    . ARG G  2 116 ? -16.100 27.331  -71.820 1.00 33.22  ? 116 ARG E CZ    1 
ATOM   9627  N  NH1   . ARG G  2 116 ? -14.789 27.247  -71.658 1.00 35.11  ? 116 ARG E NH1   1 
ATOM   9628  N  NH2   . ARG G  2 116 ? -16.886 27.475  -70.760 1.00 29.21  ? 116 ARG E NH2   1 
ATOM   9629  N  N     . VAL G  2 117 ? -12.549 23.045  -74.420 1.00 34.53  ? 117 VAL E N     1 
ATOM   9630  C  CA    . VAL G  2 117 ? -11.324 22.433  -73.941 1.00 34.02  ? 117 VAL E CA    1 
ATOM   9631  C  C     . VAL G  2 117 ? -10.543 23.507  -73.172 1.00 33.41  ? 117 VAL E C     1 
ATOM   9632  O  O     . VAL G  2 117 ? -9.695  23.215  -72.329 1.00 36.13  ? 117 VAL E O     1 
ATOM   9633  C  CB    . VAL G  2 117 ? -10.532 21.830  -75.134 1.00 31.17  ? 117 VAL E CB    1 
ATOM   9634  C  CG1   . VAL G  2 117 ? -9.030  21.950  -74.959 1.00 36.97  ? 117 VAL E CG1   1 
ATOM   9635  C  CG2   . VAL G  2 117 ? -10.954 20.383  -75.363 1.00 28.61  ? 117 VAL E CG2   1 
ATOM   9636  N  N     . THR G  2 118 ? -10.901 24.759  -73.438 1.00 33.59  ? 118 THR E N     1 
ATOM   9637  C  CA    . THR G  2 118 ? -10.289 25.919  -72.809 1.00 31.38  ? 118 THR E CA    1 
ATOM   9638  C  C     . THR G  2 118 ? -11.048 26.368  -71.567 1.00 27.33  ? 118 THR E C     1 
ATOM   9639  O  O     . THR G  2 118 ? -12.207 26.750  -71.668 1.00 34.69  ? 118 THR E O     1 
ATOM   9640  C  CB    . THR G  2 118 ? -10.242 27.107  -73.787 1.00 37.62  ? 118 THR E CB    1 
ATOM   9641  O  OG1   . THR G  2 118 ? -9.796  26.660  -75.076 1.00 36.71  ? 118 THR E OG1   1 
ATOM   9642  C  CG2   . THR G  2 118 ? -9.322  28.199  -73.262 1.00 34.47  ? 118 THR E CG2   1 
ATOM   9643  N  N     . ILE G  2 119 ? -10.414 26.345  -70.402 1.00 23.06  ? 119 ILE E N     1 
ATOM   9644  C  CA    . ILE G  2 119 ? -11.071 26.880  -69.214 1.00 29.56  ? 119 ILE E CA    1 
ATOM   9645  C  C     . ILE G  2 119 ? -11.161 28.410  -69.294 1.00 34.43  ? 119 ILE E C     1 
ATOM   9646  O  O     . ILE G  2 119 ? -10.262 29.068  -69.823 1.00 28.97  ? 119 ILE E O     1 
ATOM   9647  C  CB    . ILE G  2 119 ? -10.349 26.475  -67.913 1.00 27.31  ? 119 ILE E CB    1 
ATOM   9648  C  CG1   . ILE G  2 119 ? -8.903  26.975  -67.912 1.00 30.14  ? 119 ILE E CG1   1 
ATOM   9649  C  CG2   . ILE G  2 119 ? -10.395 24.969  -67.734 1.00 32.15  ? 119 ILE E CG2   1 
ATOM   9650  C  CD1   . ILE G  2 119 ? -8.236  26.929  -66.547 1.00 24.88  ? 119 ILE E CD1   1 
ATOM   9651  N  N     . MET G  2 120 ? -12.258 28.961  -68.775 1.00 32.83  ? 120 MET E N     1 
ATOM   9652  C  CA    . MET G  2 120 ? -12.515 30.402  -68.817 1.00 33.43  ? 120 MET E CA    1 
ATOM   9653  C  C     . MET G  2 120 ? -13.030 30.911  -67.478 1.00 31.92  ? 120 MET E C     1 
ATOM   9654  O  O     . MET G  2 120 ? -13.591 30.138  -66.708 1.00 32.75  ? 120 MET E O     1 
ATOM   9655  C  CB    . MET G  2 120 ? -13.529 30.726  -69.910 1.00 31.68  ? 120 MET E CB    1 
ATOM   9656  C  CG    . MET G  2 120 ? -13.072 30.351  -71.290 1.00 32.21  ? 120 MET E CG    1 
ATOM   9657  S  SD    . MET G  2 120 ? -14.252 30.836  -72.553 1.00 42.25  ? 120 MET E SD    1 
ATOM   9658  C  CE    . MET G  2 120 ? -13.523 29.987  -73.955 1.00 41.20  ? 120 MET E CE    1 
ATOM   9659  N  N     . PRO G  2 121 ? -12.851 32.218  -67.198 1.00 40.27  ? 121 PRO E N     1 
ATOM   9660  C  CA    . PRO G  2 121 ? -13.342 32.807  -65.944 1.00 35.39  ? 121 PRO E CA    1 
ATOM   9661  C  C     . PRO G  2 121 ? -14.800 32.445  -65.664 1.00 36.43  ? 121 PRO E C     1 
ATOM   9662  O  O     . PRO G  2 121 ? -15.166 32.126  -64.534 1.00 35.55  ? 121 PRO E O     1 
ATOM   9663  C  CB    . PRO G  2 121 ? -13.180 34.303  -66.187 1.00 27.54  ? 121 PRO E CB    1 
ATOM   9664  C  CG    . PRO G  2 121 ? -11.988 34.388  -67.078 1.00 28.77  ? 121 PRO E CG    1 
ATOM   9665  C  CD    . PRO G  2 121 ? -12.137 33.216  -68.017 1.00 37.39  ? 121 PRO E CD    1 
ATOM   9666  N  N     . LYS G  2 122 ? -15.610 32.490  -66.710 1.00 30.92  ? 122 LYS E N     1 
ATOM   9667  C  CA    . LYS G  2 122 ? -16.957 31.939  -66.699 1.00 37.00  ? 122 LYS E CA    1 
ATOM   9668  C  C     . LYS G  2 122 ? -17.051 30.570  -65.981 1.00 35.03  ? 122 LYS E C     1 
ATOM   9669  O  O     . LYS G  2 122 ? -17.931 30.350  -65.134 1.00 35.58  ? 122 LYS E O     1 
ATOM   9670  C  CB    . LYS G  2 122 ? -17.433 31.823  -68.149 1.00 33.64  ? 122 LYS E CB    1 
ATOM   9671  C  CG    . LYS G  2 122 ? -18.827 31.311  -68.347 1.00 33.00  ? 122 LYS E CG    1 
ATOM   9672  C  CD    . LYS G  2 122 ? -19.003 30.858  -69.784 1.00 36.28  ? 122 LYS E CD    1 
ATOM   9673  C  CE    . LYS G  2 122 ? -18.459 31.882  -70.760 1.00 39.45  ? 122 LYS E CE    1 
ATOM   9674  N  NZ    . LYS G  2 122 ? -18.312 31.283  -72.116 1.00 51.58  ? 122 LYS E NZ    1 
ATOM   9675  N  N     . ASP G  2 123 ? -16.131 29.664  -66.306 1.00 27.83  ? 123 ASP E N     1 
ATOM   9676  C  CA    . ASP G  2 123 ? -16.150 28.326  -65.722 1.00 32.10  ? 123 ASP E CA    1 
ATOM   9677  C  C     . ASP G  2 123 ? -15.836 28.375  -64.227 1.00 33.74  ? 123 ASP E C     1 
ATOM   9678  O  O     . ASP G  2 123 ? -16.584 27.825  -63.415 1.00 36.02  ? 123 ASP E O     1 
ATOM   9679  C  CB    . ASP G  2 123 ? -15.166 27.396  -66.443 1.00 26.52  ? 123 ASP E CB    1 
ATOM   9680  C  CG    . ASP G  2 123 ? -15.489 27.229  -67.919 1.00 30.07  ? 123 ASP E CG    1 
ATOM   9681  O  OD1   . ASP G  2 123 ? -16.675 27.031  -68.249 1.00 35.41  ? 123 ASP E OD1   1 
ATOM   9682  O  OD2   . ASP G  2 123 ? -14.565 27.307  -68.758 1.00 29.15  ? 123 ASP E OD2   1 
ATOM   9683  N  N     . ILE G  2 124 ? -14.732 29.029  -63.869 1.00 33.29  ? 124 ILE E N     1 
ATOM   9684  C  CA    . ILE G  2 124 ? -14.359 29.205  -62.467 1.00 28.74  ? 124 ILE E CA    1 
ATOM   9685  C  C     . ILE G  2 124 ? -15.538 29.736  -61.667 1.00 30.18  ? 124 ILE E C     1 
ATOM   9686  O  O     . ILE G  2 124 ? -15.893 29.189  -60.627 1.00 33.30  ? 124 ILE E O     1 
ATOM   9687  C  CB    . ILE G  2 124 ? -13.169 30.176  -62.305 1.00 34.08  ? 124 ILE E CB    1 
ATOM   9688  C  CG1   . ILE G  2 124 ? -11.929 29.636  -63.021 1.00 35.59  ? 124 ILE E CG1   1 
ATOM   9689  C  CG2   . ILE G  2 124 ? -12.868 30.408  -60.834 1.00 30.43  ? 124 ILE E CG2   1 
ATOM   9690  C  CD1   . ILE G  2 124 ? -10.664 30.435  -62.750 1.00 30.25  ? 124 ILE E CD1   1 
ATOM   9691  N  N     . GLN G  2 125 ? -16.152 30.795  -62.182 1.00 36.12  ? 125 GLN E N     1 
ATOM   9692  C  CA    . GLN G  2 125 ? -17.303 31.417  -61.546 1.00 32.28  ? 125 GLN E CA    1 
ATOM   9693  C  C     . GLN G  2 125 ? -18.439 30.413  -61.336 1.00 28.98  ? 125 GLN E C     1 
ATOM   9694  O  O     . GLN G  2 125 ? -19.022 30.362  -60.252 1.00 31.37  ? 125 GLN E O     1 
ATOM   9695  C  CB    . GLN G  2 125 ? -17.780 32.611  -62.375 1.00 33.17  ? 125 GLN E CB    1 
ATOM   9696  C  CG    . GLN G  2 125 ? -16.830 33.803  -62.349 1.00 36.92  ? 125 GLN E CG    1 
ATOM   9697  C  CD    . GLN G  2 125 ? -17.020 34.734  -63.537 1.00 41.11  ? 125 GLN E CD    1 
ATOM   9698  O  OE1   . GLN G  2 125 ? -18.022 34.659  -64.247 1.00 45.42  ? 125 GLN E OE1   1 
ATOM   9699  N  NE2   . GLN G  2 125 ? -16.048 35.608  -63.765 1.00 36.40  ? 125 GLN E NE2   1 
ATOM   9700  N  N     . LEU G  2 126 ? -18.743 29.604  -62.352 1.00 28.91  ? 126 LEU E N     1 
ATOM   9701  C  CA    . LEU G  2 126 ? -19.807 28.603  -62.204 1.00 26.54  ? 126 LEU E CA    1 
ATOM   9702  C  C     . LEU G  2 126 ? -19.481 27.600  -61.102 1.00 29.83  ? 126 LEU E C     1 
ATOM   9703  O  O     . LEU G  2 126 ? -20.319 27.299  -60.237 1.00 30.00  ? 126 LEU E O     1 
ATOM   9704  C  CB    . LEU G  2 126 ? -20.055 27.856  -63.516 1.00 25.15  ? 126 LEU E CB    1 
ATOM   9705  C  CG    . LEU G  2 126 ? -21.182 26.824  -63.425 1.00 30.41  ? 126 LEU E CG    1 
ATOM   9706  C  CD1   . LEU G  2 126 ? -22.480 27.466  -62.947 1.00 32.68  ? 126 LEU E CD1   1 
ATOM   9707  C  CD2   . LEU G  2 126 ? -21.400 26.131  -64.746 1.00 29.99  ? 126 LEU E CD2   1 
ATOM   9708  N  N     . ALA G  2 127 ? -18.256 27.088  -61.137 1.00 29.45  ? 127 ALA E N     1 
ATOM   9709  C  CA    . ALA G  2 127 ? -17.816 26.109  -60.156 1.00 27.88  ? 127 ALA E CA    1 
ATOM   9710  C  C     . ALA G  2 127 ? -17.938 26.667  -58.744 1.00 35.51  ? 127 ALA E C     1 
ATOM   9711  O  O     . ALA G  2 127 ? -18.395 25.972  -57.834 1.00 36.87  ? 127 ALA E O     1 
ATOM   9712  C  CB    . ALA G  2 127 ? -16.384 25.674  -60.436 1.00 28.82  ? 127 ALA E CB    1 
ATOM   9713  N  N     . ARG G  2 128 ? -17.541 27.924  -58.562 1.00 31.09  ? 128 ARG E N     1 
ATOM   9714  C  CA    . ARG G  2 128 ? -17.547 28.502  -57.227 1.00 29.28  ? 128 ARG E CA    1 
ATOM   9715  C  C     . ARG G  2 128 ? -18.973 28.811  -56.791 1.00 35.94  ? 128 ARG E C     1 
ATOM   9716  O  O     . ARG G  2 128 ? -19.277 28.792  -55.596 1.00 33.09  ? 128 ARG E O     1 
ATOM   9717  C  CB    . ARG G  2 128 ? -16.676 29.758  -57.171 1.00 26.94  ? 128 ARG E CB    1 
ATOM   9718  C  CG    . ARG G  2 128 ? -15.247 29.513  -57.611 1.00 29.43  ? 128 ARG E CG    1 
ATOM   9719  C  CD    . ARG G  2 128 ? -14.260 30.351  -56.829 1.00 31.35  ? 128 ARG E CD    1 
ATOM   9720  N  NE    . ARG G  2 128 ? -14.671 31.745  -56.777 1.00 38.63  ? 128 ARG E NE    1 
ATOM   9721  C  CZ    . ARG G  2 128 ? -14.880 32.421  -55.655 1.00 40.20  ? 128 ARG E CZ    1 
ATOM   9722  N  NH1   . ARG G  2 128 ? -14.710 31.835  -54.478 1.00 36.90  ? 128 ARG E NH1   1 
ATOM   9723  N  NH2   . ARG G  2 128 ? -15.258 33.687  -55.716 1.00 42.21  ? 128 ARG E NH2   1 
ATOM   9724  N  N     . ARG G  2 129 ? -19.851 29.083  -57.754 1.00 33.55  ? 129 ARG E N     1 
ATOM   9725  C  CA    . ARG G  2 129 ? -21.246 29.335  -57.418 1.00 34.10  ? 129 ARG E CA    1 
ATOM   9726  C  C     . ARG G  2 129 ? -21.887 28.048  -56.915 1.00 38.02  ? 129 ARG E C     1 
ATOM   9727  O  O     . ARG G  2 129 ? -22.555 28.042  -55.883 1.00 37.48  ? 129 ARG E O     1 
ATOM   9728  C  CB    . ARG G  2 129 ? -22.026 29.898  -58.612 1.00 28.72  ? 129 ARG E CB    1 
ATOM   9729  C  CG    . ARG G  2 129 ? -23.452 30.313  -58.252 1.00 43.38  ? 129 ARG E CG    1 
ATOM   9730  C  CD    . ARG G  2 129 ? -24.026 31.373  -59.201 1.00 65.96  ? 129 ARG E CD    1 
ATOM   9731  N  NE    . ARG G  2 129 ? -25.368 31.804  -58.794 1.00 66.44  ? 129 ARG E NE    1 
ATOM   9732  C  CZ    . ARG G  2 129 ? -26.233 32.440  -59.584 1.00 58.43  ? 129 ARG E CZ    1 
ATOM   9733  N  NH1   . ARG G  2 129 ? -25.909 32.724  -60.838 1.00 53.98  ? 129 ARG E NH1   1 
ATOM   9734  N  NH2   . ARG G  2 129 ? -27.430 32.785  -59.120 1.00 57.00  ? 129 ARG E NH2   1 
ATOM   9735  N  N     . ILE G  2 130 ? -21.663 26.948  -57.623 1.00 36.95  ? 130 ILE E N     1 
ATOM   9736  C  CA    . ILE G  2 130 ? -22.271 25.690  -57.210 1.00 37.55  ? 130 ILE E CA    1 
ATOM   9737  C  C     . ILE G  2 130 ? -21.680 25.190  -55.889 1.00 40.34  ? 130 ILE E C     1 
ATOM   9738  O  O     . ILE G  2 130 ? -22.405 24.659  -55.042 1.00 45.53  ? 130 ILE E O     1 
ATOM   9739  C  CB    . ILE G  2 130 ? -22.123 24.621  -58.300 1.00 40.05  ? 130 ILE E CB    1 
ATOM   9740  C  CG1   . ILE G  2 130 ? -22.965 25.013  -59.512 1.00 43.20  ? 130 ILE E CG1   1 
ATOM   9741  C  CG2   . ILE G  2 130 ? -22.562 23.262  -57.788 1.00 32.82  ? 130 ILE E CG2   1 
ATOM   9742  C  CD1   . ILE G  2 130 ? -23.016 23.956  -60.579 1.00 37.50  ? 130 ILE E CD1   1 
ATOM   9743  N  N     . ARG G  2 131 ? -20.375 25.384  -55.708 1.00 37.64  ? 131 ARG E N     1 
ATOM   9744  C  CA    . ARG G  2 131 ? -19.697 25.037  -54.457 1.00 32.36  ? 131 ARG E CA    1 
ATOM   9745  C  C     . ARG G  2 131 ? -20.228 25.800  -53.250 1.00 34.82  ? 131 ARG E C     1 
ATOM   9746  O  O     . ARG G  2 131 ? -19.988 25.406  -52.113 1.00 41.89  ? 131 ARG E O     1 
ATOM   9747  C  CB    . ARG G  2 131 ? -18.205 25.317  -54.551 1.00 34.45  ? 131 ARG E CB    1 
ATOM   9748  C  CG    . ARG G  2 131 ? -17.372 24.348  -55.335 1.00 27.82  ? 131 ARG E CG    1 
ATOM   9749  C  CD    . ARG G  2 131 ? -15.948 24.856  -55.298 1.00 24.74  ? 131 ARG E CD    1 
ATOM   9750  N  NE    . ARG G  2 131 ? -14.987 23.914  -55.845 1.00 23.90  ? 131 ARG E NE    1 
ATOM   9751  C  CZ    . ARG G  2 131 ? -13.755 23.777  -55.375 1.00 29.21  ? 131 ARG E CZ    1 
ATOM   9752  N  NH1   . ARG G  2 131 ? -13.359 24.511  -54.340 1.00 24.27  ? 131 ARG E NH1   1 
ATOM   9753  N  NH2   . ARG G  2 131 ? -12.922 22.902  -55.926 1.00 31.43  ? 131 ARG E NH2   1 
ATOM   9754  N  N     . GLY G  2 132 ? -20.906 26.916  -53.494 1.00 36.68  ? 132 GLY E N     1 
ATOM   9755  C  CA    . GLY G  2 132 ? -21.427 27.729  -52.410 1.00 34.99  ? 132 GLY E CA    1 
ATOM   9756  C  C     . GLY G  2 132 ? -20.449 28.783  -51.933 1.00 38.44  ? 132 GLY E C     1 
ATOM   9757  O  O     . GLY G  2 132 ? -20.614 29.349  -50.856 1.00 46.32  ? 132 GLY E O     1 
ATOM   9758  N  N     . GLU G  2 133 ? -19.415 29.030  -52.733 1.00 47.30  ? 133 GLU E N     1 
ATOM   9759  C  CA    . GLU G  2 133 ? -18.477 30.122  -52.495 1.00 40.65  ? 133 GLU E CA    1 
ATOM   9760  C  C     . GLU G  2 133 ? -19.048 31.393  -53.139 1.00 58.89  ? 133 GLU E C     1 
ATOM   9761  O  O     . GLU G  2 133 ? -19.880 31.304  -54.047 1.00 60.46  ? 133 GLU E O     1 
ATOM   9762  C  CB    . GLU G  2 133 ? -17.093 29.776  -53.060 1.00 37.12  ? 133 GLU E CB    1 
ATOM   9763  C  CG    . GLU G  2 133 ? -16.437 28.552  -52.413 1.00 31.74  ? 133 GLU E CG    1 
ATOM   9764  C  CD    . GLU G  2 133 ? -15.118 28.135  -53.075 1.00 35.26  ? 133 GLU E CD    1 
ATOM   9765  O  OE1   . GLU G  2 133 ? -14.423 28.992  -53.667 1.00 28.38  ? 133 GLU E OE1   1 
ATOM   9766  O  OE2   . GLU G  2 133 ? -14.775 26.932  -53.005 1.00 36.33  ? 133 GLU E OE2   1 
ATOM   9767  N  N     . ARG G  2 134 ? -18.631 32.571  -52.679 1.00 60.66  ? 134 ARG E N     1 
ATOM   9768  C  CA    . ARG G  2 134 ? -19.289 33.798  -53.137 1.00 74.76  ? 134 ARG E CA    1 
ATOM   9769  C  C     . ARG G  2 134 ? -18.349 34.970  -53.442 1.00 82.19  ? 134 ARG E C     1 
ATOM   9770  O  O     . ARG G  2 134 ? -17.753 35.556  -52.532 1.00 77.58  ? 134 ARG E O     1 
ATOM   9771  C  CB    . ARG G  2 134 ? -20.329 34.248  -52.103 1.00 81.57  ? 134 ARG E CB    1 
ATOM   9772  C  CG    . ARG G  2 134 ? -21.501 35.034  -52.699 1.00 87.70  ? 134 ARG E CG    1 
ATOM   9773  C  CD    . ARG G  2 134 ? -22.462 34.110  -53.444 1.00 82.86  ? 134 ARG E CD    1 
ATOM   9774  N  NE    . ARG G  2 134 ? -22.750 34.580  -54.797 1.00 83.81  ? 134 ARG E NE    1 
ATOM   9775  C  CZ    . ARG G  2 134 ? -23.569 33.964  -55.646 1.00 78.66  ? 134 ARG E CZ    1 
ATOM   9776  N  NH1   . ARG G  2 134 ? -24.190 32.848  -55.283 1.00 82.78  ? 134 ARG E NH1   1 
ATOM   9777  N  NH2   . ARG G  2 134 ? -23.766 34.462  -56.859 1.00 70.34  ? 134 ARG E NH2   1 
ATOM   9778  N  N     . ALA G  2 135 ? -18.247 35.301  -54.732 1.00 81.53  ? 135 ALA E N     1 
ATOM   9779  C  CA    . ALA G  2 135 ? -17.531 36.482  -55.240 1.00 69.91  ? 135 ALA E CA    1 
ATOM   9780  C  C     . ALA G  2 135 ? -16.030 36.507  -54.926 1.00 74.46  ? 135 ALA E C     1 
ATOM   9781  O  O     . ALA G  2 135 ? -15.268 37.166  -55.643 1.00 82.82  ? 135 ALA E O     1 
ATOM   9782  C  CB    . ALA G  2 135 ? -18.192 37.756  -54.718 1.00 66.12  ? 135 ALA E CB    1 
ATOM   9783  O  OXT   . ALA G  2 135 ? -15.528 35.885  -53.983 1.00 61.02  ? 135 ALA E OXT   1 
ATOM   9784  N  N     . LYS H  3 16  ? 15.018  49.219  -34.995 1.00 97.04  ? 16  LYS F N     1 
ATOM   9785  C  CA    . LYS H  3 16  ? 15.197  50.632  -35.315 1.00 96.48  ? 16  LYS F CA    1 
ATOM   9786  C  C     . LYS H  3 16  ? 14.836  50.902  -36.772 1.00 96.57  ? 16  LYS F C     1 
ATOM   9787  O  O     . LYS H  3 16  ? 14.516  52.032  -37.149 1.00 91.16  ? 16  LYS F O     1 
ATOM   9788  C  CB    . LYS H  3 16  ? 16.637  51.070  -35.042 1.00 91.27  ? 16  LYS F CB    1 
ATOM   9789  C  CG    . LYS H  3 16  ? 17.300  50.351  -33.877 1.00 97.14  ? 16  LYS F CG    1 
ATOM   9790  C  CD    . LYS H  3 16  ? 18.782  50.684  -33.812 1.00 98.36  ? 16  LYS F CD    1 
ATOM   9791  C  CE    . LYS H  3 16  ? 19.622  49.425  -33.688 1.00 95.30  ? 16  LYS F CE    1 
ATOM   9792  N  NZ    . LYS H  3 16  ? 20.989  49.624  -34.241 1.00 101.91 ? 16  LYS F NZ    1 
ATOM   9793  N  N     . ARG H  3 17  ? 14.899  49.856  -37.589 1.00 90.28  ? 17  ARG F N     1 
ATOM   9794  C  CA    . ARG H  3 17  ? 14.526  49.960  -38.993 1.00 83.10  ? 17  ARG F CA    1 
ATOM   9795  C  C     . ARG H  3 17  ? 13.283  49.128  -39.278 1.00 80.64  ? 17  ARG F C     1 
ATOM   9796  O  O     . ARG H  3 17  ? 13.080  48.070  -38.681 1.00 86.70  ? 17  ARG F O     1 
ATOM   9797  C  CB    . ARG H  3 17  ? 15.675  49.509  -39.894 1.00 78.37  ? 17  ARG F CB    1 
ATOM   9798  C  CG    . ARG H  3 17  ? 17.036  50.007  -39.453 1.00 87.49  ? 17  ARG F CG    1 
ATOM   9799  C  CD    . ARG H  3 17  ? 18.090  49.730  -40.510 1.00 84.67  ? 17  ARG F CD    1 
ATOM   9800  N  NE    . ARG H  3 17  ? 18.157  48.315  -40.858 1.00 84.23  ? 17  ARG F NE    1 
ATOM   9801  C  CZ    . ARG H  3 17  ? 19.216  47.734  -41.412 1.00 93.84  ? 17  ARG F CZ    1 
ATOM   9802  N  NH1   . ARG H  3 17  ? 20.302  48.448  -41.679 1.00 92.99  ? 17  ARG F NH1   1 
ATOM   9803  N  NH2   . ARG H  3 17  ? 19.191  46.439  -41.697 1.00 96.05  ? 17  ARG F NH2   1 
ATOM   9804  N  N     . HIS H  3 18  ? 12.449  49.614  -40.187 1.00 74.88  ? 18  HIS F N     1 
ATOM   9805  C  CA    . HIS H  3 18  ? 11.264  48.875  -40.586 1.00 67.60  ? 18  HIS F CA    1 
ATOM   9806  C  C     . HIS H  3 18  ? 11.508  48.221  -41.935 1.00 65.15  ? 18  HIS F C     1 
ATOM   9807  O  O     . HIS H  3 18  ? 12.345  48.674  -42.716 1.00 63.66  ? 18  HIS F O     1 
ATOM   9808  C  CB    . HIS H  3 18  ? 10.036  49.789  -40.642 1.00 72.73  ? 18  HIS F CB    1 
ATOM   9809  C  CG    . HIS H  3 18  ? 10.263  51.065  -41.394 1.00 66.66  ? 18  HIS F CG    1 
ATOM   9810  N  ND1   . HIS H  3 18  ? 10.932  52.141  -40.849 1.00 67.04  ? 18  HIS F ND1   1 
ATOM   9811  C  CD2   . HIS H  3 18  ? 9.908   51.437  -42.646 1.00 61.93  ? 18  HIS F CD2   1 
ATOM   9812  C  CE1   . HIS H  3 18  ? 10.983  53.118  -41.736 1.00 67.88  ? 18  HIS F CE1   1 
ATOM   9813  N  NE2   . HIS H  3 18  ? 10.368  52.718  -42.835 1.00 67.59  ? 18  HIS F NE2   1 
ATOM   9814  N  N     . ARG H  3 19  ? 10.780  47.143  -42.190 1.00 66.42  ? 19  ARG F N     1 
ATOM   9815  C  CA    . ARG H  3 19  ? 10.898  46.398  -43.433 1.00 70.62  ? 19  ARG F CA    1 
ATOM   9816  C  C     . ARG H  3 19  ? 10.460  47.275  -44.601 1.00 60.11  ? 19  ARG F C     1 
ATOM   9817  O  O     . ARG H  3 19  ? 9.730   48.245  -44.408 1.00 63.62  ? 19  ARG F O     1 
ATOM   9818  C  CB    . ARG H  3 19  ? 10.051  45.127  -43.353 1.00 75.22  ? 19  ARG F CB    1 
ATOM   9819  C  CG    . ARG H  3 19  ? 8.940   45.233  -42.310 1.00 87.75  ? 19  ARG F CG    1 
ATOM   9820  C  CD    . ARG H  3 19  ? 8.363   43.880  -41.923 1.00 89.44  ? 19  ARG F CD    1 
ATOM   9821  N  NE    . ARG H  3 19  ? 8.007   43.081  -43.091 1.00 93.92  ? 19  ARG F NE    1 
ATOM   9822  C  CZ    . ARG H  3 19  ? 7.499   41.855  -43.032 1.00 86.23  ? 19  ARG F CZ    1 
ATOM   9823  N  NH1   . ARG H  3 19  ? 7.274   41.282  -41.856 1.00 85.62  ? 19  ARG F NH1   1 
ATOM   9824  N  NH2   . ARG H  3 19  ? 7.208   41.203  -44.148 1.00 75.61  ? 19  ARG F NH2   1 
ATOM   9825  N  N     . LYS H  3 20  ? 10.928  46.958  -45.804 1.00 48.22  ? 20  LYS F N     1 
ATOM   9826  C  CA    . LYS H  3 20  ? 10.455  47.644  -46.997 1.00 42.90  ? 20  LYS F CA    1 
ATOM   9827  C  C     . LYS H  3 20  ? 8.944   47.442  -47.127 1.00 46.63  ? 20  LYS F C     1 
ATOM   9828  O  O     . LYS H  3 20  ? 8.394   46.453  -46.645 1.00 48.63  ? 20  LYS F O     1 
ATOM   9829  C  CB    . LYS H  3 20  ? 11.190  47.134  -48.244 1.00 44.61  ? 20  LYS F CB    1 
ATOM   9830  C  CG    . LYS H  3 20  ? 10.675  47.690  -49.576 1.00 39.36  ? 20  LYS F CG    1 
ATOM   9831  C  CD    . LYS H  3 20  ? 11.686  47.476  -50.697 1.00 44.54  ? 20  LYS F CD    1 
ATOM   9832  C  CE    . LYS H  3 20  ? 11.016  47.417  -52.068 1.00 51.71  ? 20  LYS F CE    1 
ATOM   9833  N  NZ    . LYS H  3 20  ? 10.338  46.103  -52.308 1.00 57.78  ? 20  LYS F NZ    1 
ATOM   9834  N  N     . VAL H  3 21  ? 8.276   48.409  -47.741 1.00 42.87  ? 21  VAL F N     1 
ATOM   9835  C  CA    . VAL H  3 21  ? 6.856   48.315  -48.007 1.00 30.32  ? 21  VAL F CA    1 
ATOM   9836  C  C     . VAL H  3 21  ? 6.549   47.041  -48.784 1.00 41.33  ? 21  VAL F C     1 
ATOM   9837  O  O     . VAL H  3 21  ? 7.254   46.704  -49.736 1.00 41.18  ? 21  VAL F O     1 
ATOM   9838  C  CB    . VAL H  3 21  ? 6.360   49.522  -48.816 1.00 31.44  ? 21  VAL F CB    1 
ATOM   9839  C  CG1   . VAL H  3 21  ? 4.851   49.631  -48.747 1.00 35.85  ? 21  VAL F CG1   1 
ATOM   9840  C  CG2   . VAL H  3 21  ? 7.000   50.787  -48.310 1.00 39.65  ? 21  VAL F CG2   1 
ATOM   9841  N  N     . LEU H  3 22  ? 5.510   46.331  -48.357 1.00 40.43  ? 22  LEU F N     1 
ATOM   9842  C  CA    . LEU H  3 22  ? 4.985   45.193  -49.097 1.00 29.34  ? 22  LEU F CA    1 
ATOM   9843  C  C     . LEU H  3 22  ? 3.809   45.647  -49.942 1.00 31.53  ? 22  LEU F C     1 
ATOM   9844  O  O     . LEU H  3 22  ? 2.857   46.226  -49.422 1.00 36.83  ? 22  LEU F O     1 
ATOM   9845  C  CB    . LEU H  3 22  ? 4.551   44.072  -48.148 1.00 28.85  ? 22  LEU F CB    1 
ATOM   9846  C  CG    . LEU H  3 22  ? 5.652   43.238  -47.496 1.00 32.34  ? 22  LEU F CG    1 
ATOM   9847  C  CD1   . LEU H  3 22  ? 5.097   42.383  -46.376 1.00 30.32  ? 22  LEU F CD1   1 
ATOM   9848  C  CD2   . LEU H  3 22  ? 6.323   42.373  -48.544 1.00 32.57  ? 22  LEU F CD2   1 
ATOM   9849  N  N     . ARG H  3 23  ? 3.876   45.401  -51.246 1.00 32.11  ? 23  ARG F N     1 
ATOM   9850  C  CA    . ARG H  3 23  ? 2.758   45.726  -52.121 1.00 31.18  ? 23  ARG F CA    1 
ATOM   9851  C  C     . ARG H  3 23  ? 2.859   44.961  -53.433 1.00 27.13  ? 23  ARG F C     1 
ATOM   9852  O  O     . ARG H  3 23  ? 3.957   44.664  -53.890 1.00 32.02  ? 23  ARG F O     1 
ATOM   9853  C  CB    . ARG H  3 23  ? 2.690   47.241  -52.377 1.00 30.97  ? 23  ARG F CB    1 
ATOM   9854  C  CG    . ARG H  3 23  ? 3.852   47.796  -53.170 1.00 35.33  ? 23  ARG F CG    1 
ATOM   9855  C  CD    . ARG H  3 23  ? 3.896   49.327  -53.160 1.00 35.54  ? 23  ARG F CD    1 
ATOM   9856  N  NE    . ARG H  3 23  ? 5.121   49.793  -53.808 1.00 36.78  ? 23  ARG F NE    1 
ATOM   9857  C  CZ    . ARG H  3 23  ? 5.175   50.340  -55.018 1.00 29.98  ? 23  ARG F CZ    1 
ATOM   9858  N  NH1   . ARG H  3 23  ? 4.067   50.538  -55.716 1.00 22.69  ? 23  ARG F NH1   1 
ATOM   9859  N  NH2   . ARG H  3 23  ? 6.344   50.710  -55.522 1.00 39.05  ? 23  ARG F NH2   1 
ATOM   9860  N  N     . ASP H  3 24  ? 1.701   44.632  -54.009 1.00 34.50  ? 24  ASP F N     1 
ATOM   9861  C  CA    . ASP H  3 24  ? 1.588   43.979  -55.322 1.00 33.52  ? 24  ASP F CA    1 
ATOM   9862  C  C     . ASP H  3 24  ? 2.129   42.540  -55.355 1.00 36.90  ? 24  ASP F C     1 
ATOM   9863  O  O     . ASP H  3 24  ? 2.403   41.998  -56.424 1.00 38.60  ? 24  ASP F O     1 
ATOM   9864  C  CB    . ASP H  3 24  ? 2.298   44.815  -56.391 1.00 32.53  ? 24  ASP F CB    1 
ATOM   9865  C  CG    . ASP H  3 24  ? 1.756   44.565  -57.785 1.00 44.84  ? 24  ASP F CG    1 
ATOM   9866  O  OD1   . ASP H  3 24  ? 0.528   44.367  -57.906 1.00 45.68  ? 24  ASP F OD1   1 
ATOM   9867  O  OD2   . ASP H  3 24  ? 2.552   44.574  -58.755 1.00 40.41  ? 24  ASP F OD2   1 
ATOM   9868  N  N     . ASN H  3 25  ? 2.263   41.910  -54.195 1.00 35.52  ? 25  ASN F N     1 
ATOM   9869  C  CA    . ASN H  3 25  ? 2.868   40.584  -54.142 1.00 37.16  ? 25  ASN F CA    1 
ATOM   9870  C  C     . ASN H  3 25  ? 1.998   39.456  -54.720 1.00 36.53  ? 25  ASN F C     1 
ATOM   9871  O  O     . ASN H  3 25  ? 2.480   38.341  -54.908 1.00 37.59  ? 25  ASN F O     1 
ATOM   9872  C  CB    . ASN H  3 25  ? 3.259   40.254  -52.705 1.00 30.63  ? 25  ASN F CB    1 
ATOM   9873  C  CG    . ASN H  3 25  ? 4.515   40.977  -52.270 1.00 34.33  ? 25  ASN F CG    1 
ATOM   9874  O  OD1   . ASN H  3 25  ? 5.625   40.614  -52.665 1.00 39.87  ? 25  ASN F OD1   1 
ATOM   9875  N  ND2   . ASN H  3 25  ? 4.349   42.011  -51.454 1.00 37.96  ? 25  ASN F ND2   1 
ATOM   9876  N  N     . ILE H  3 26  ? 0.734   39.751  -55.015 1.00 34.29  ? 26  ILE F N     1 
ATOM   9877  C  CA    . ILE H  3 26  ? -0.153  38.778  -55.648 1.00 33.60  ? 26  ILE F CA    1 
ATOM   9878  C  C     . ILE H  3 26  ? 0.332   38.492  -57.062 1.00 42.15  ? 26  ILE F C     1 
ATOM   9879  O  O     . ILE H  3 26  ? 0.037   37.439  -57.629 1.00 45.45  ? 26  ILE F O     1 
ATOM   9880  C  CB    . ILE H  3 26  ? -1.630  39.264  -55.701 1.00 34.72  ? 26  ILE F CB    1 
ATOM   9881  C  CG1   . ILE H  3 26  ? -2.572  38.125  -56.096 1.00 39.41  ? 26  ILE F CG1   1 
ATOM   9882  C  CG2   . ILE H  3 26  ? -1.798  40.400  -56.688 1.00 26.05  ? 26  ILE F CG2   1 
ATOM   9883  C  CD1   . ILE H  3 26  ? -2.768  37.078  -55.027 1.00 34.15  ? 26  ILE F CD1   1 
ATOM   9884  N  N     . GLN H  3 27  ? 1.085   39.431  -57.628 1.00 40.50  ? 27  GLN F N     1 
ATOM   9885  C  CA    . GLN H  3 27  ? 1.640   39.251  -58.963 1.00 40.56  ? 27  GLN F CA    1 
ATOM   9886  C  C     . GLN H  3 27  ? 2.820   38.295  -58.902 1.00 38.04  ? 27  GLN F C     1 
ATOM   9887  O  O     . GLN H  3 27  ? 3.339   37.863  -59.933 1.00 41.40  ? 27  GLN F O     1 
ATOM   9888  C  CB    . GLN H  3 27  ? 2.060   40.594  -59.564 1.00 39.60  ? 27  GLN F CB    1 
ATOM   9889  C  CG    . GLN H  3 27  ? 0.885   41.474  -59.948 1.00 40.13  ? 27  GLN F CG    1 
ATOM   9890  C  CD    . GLN H  3 27  ? 0.017   40.844  -61.027 1.00 45.43  ? 27  GLN F CD    1 
ATOM   9891  O  OE1   . GLN H  3 27  ? 0.517   40.142  -61.909 1.00 54.15  ? 27  GLN F OE1   1 
ATOM   9892  N  NE2   . GLN H  3 27  ? -1.289  41.088  -60.957 1.00 37.01  ? 27  GLN F NE2   1 
ATOM   9893  N  N     . GLY H  3 28  ? 3.235   37.970  -57.681 1.00 32.77  ? 28  GLY F N     1 
ATOM   9894  C  CA    . GLY H  3 28  ? 4.279   36.992  -57.462 1.00 35.58  ? 28  GLY F CA    1 
ATOM   9895  C  C     . GLY H  3 28  ? 3.732   35.624  -57.794 1.00 42.45  ? 28  GLY F C     1 
ATOM   9896  O  O     . GLY H  3 28  ? 4.484   34.692  -58.083 1.00 50.56  ? 28  GLY F O     1 
ATOM   9897  N  N     . ILE H  3 29  ? 2.409   35.500  -57.739 1.00 39.43  ? 29  ILE F N     1 
ATOM   9898  C  CA    . ILE H  3 29  ? 1.742   34.306  -58.233 1.00 36.93  ? 29  ILE F CA    1 
ATOM   9899  C  C     . ILE H  3 29  ? 1.798   34.359  -59.750 1.00 34.47  ? 29  ILE F C     1 
ATOM   9900  O  O     . ILE H  3 29  ? 0.882   34.859  -60.407 1.00 33.90  ? 29  ILE F O     1 
ATOM   9901  C  CB    . ILE H  3 29  ? 0.288   34.211  -57.745 1.00 39.66  ? 29  ILE F CB    1 
ATOM   9902  C  CG1   . ILE H  3 29  ? 0.230   34.373  -56.224 1.00 37.46  ? 29  ILE F CG1   1 
ATOM   9903  C  CG2   . ILE H  3 29  ? -0.336  32.897  -58.177 1.00 33.49  ? 29  ILE F CG2   1 
ATOM   9904  C  CD1   . ILE H  3 29  ? 1.055   33.357  -55.466 1.00 34.69  ? 29  ILE F CD1   1 
ATOM   9905  N  N     . THR H  3 30  ? 2.897   33.853  -60.293 1.00 33.79  ? 30  THR F N     1 
ATOM   9906  C  CA    . THR H  3 30  ? 3.218   34.027  -61.700 1.00 35.45  ? 30  THR F CA    1 
ATOM   9907  C  C     . THR H  3 30  ? 2.304   33.222  -62.623 1.00 35.59  ? 30  THR F C     1 
ATOM   9908  O  O     . THR H  3 30  ? 1.653   32.267  -62.201 1.00 33.60  ? 30  THR F O     1 
ATOM   9909  C  CB    . THR H  3 30  ? 4.684   33.639  -61.968 1.00 39.63  ? 30  THR F CB    1 
ATOM   9910  O  OG1   . THR H  3 30  ? 4.879   32.252  -61.669 1.00 41.61  ? 30  THR F OG1   1 
ATOM   9911  C  CG2   . THR H  3 30  ? 5.616   34.466  -61.089 1.00 40.13  ? 30  THR F CG2   1 
ATOM   9912  N  N     . LYS H  3 31  ? 2.249   33.638  -63.884 1.00 37.06  ? 31  LYS F N     1 
ATOM   9913  C  CA    . LYS H  3 31  ? 1.509   32.920  -64.915 1.00 30.32  ? 31  LYS F CA    1 
ATOM   9914  C  C     . LYS H  3 31  ? 1.923   31.443  -65.036 1.00 37.08  ? 31  LYS F C     1 
ATOM   9915  O  O     . LYS H  3 31  ? 1.056   30.570  -65.043 1.00 35.24  ? 31  LYS F O     1 
ATOM   9916  C  CB    . LYS H  3 31  ? 1.674   33.628  -66.264 1.00 27.32  ? 31  LYS F CB    1 
ATOM   9917  C  CG    . LYS H  3 31  ? 1.070   32.892  -67.439 1.00 35.02  ? 31  LYS F CG    1 
ATOM   9918  C  CD    . LYS H  3 31  ? 1.477   33.528  -68.759 1.00 36.43  ? 31  LYS F CD    1 
ATOM   9919  C  CE    . LYS H  3 31  ? 0.887   32.765  -69.939 1.00 43.69  ? 31  LYS F CE    1 
ATOM   9920  N  NZ    . LYS H  3 31  ? 1.276   33.350  -71.256 1.00 48.32  ? 31  LYS F NZ    1 
ATOM   9921  N  N     . PRO H  3 32  ? 3.240   31.149  -65.124 1.00 40.54  ? 32  PRO F N     1 
ATOM   9922  C  CA    . PRO H  3 32  ? 3.598   29.728  -65.224 1.00 34.93  ? 32  PRO F CA    1 
ATOM   9923  C  C     . PRO H  3 32  ? 3.215   28.891  -63.994 1.00 37.33  ? 32  PRO F C     1 
ATOM   9924  O  O     . PRO H  3 32  ? 2.953   27.699  -64.141 1.00 36.41  ? 32  PRO F O     1 
ATOM   9925  C  CB    . PRO H  3 32  ? 5.121   29.766  -65.394 1.00 35.56  ? 32  PRO F CB    1 
ATOM   9926  C  CG    . PRO H  3 32  ? 5.536   31.064  -64.818 1.00 39.21  ? 32  PRO F CG    1 
ATOM   9927  C  CD    . PRO H  3 32  ? 4.441   32.005  -65.182 1.00 36.75  ? 32  PRO F CD    1 
ATOM   9928  N  N     . ALA H  3 33  ? 3.183   29.495  -62.810 1.00 32.87  ? 33  ALA F N     1 
ATOM   9929  C  CA    . ALA H  3 33  ? 2.795   28.774  -61.601 1.00 29.91  ? 33  ALA F CA    1 
ATOM   9930  C  C     . ALA H  3 33  ? 1.302   28.400  -61.616 1.00 34.25  ? 33  ALA F C     1 
ATOM   9931  O  O     . ALA H  3 33  ? 0.921   27.272  -61.265 1.00 36.80  ? 33  ALA F O     1 
ATOM   9932  C  CB    . ALA H  3 33  ? 3.125   29.600  -60.373 1.00 25.03  ? 33  ALA F CB    1 
ATOM   9933  N  N     . ILE H  3 34  ? 0.467   29.352  -62.021 1.00 30.47  ? 34  ILE F N     1 
ATOM   9934  C  CA    . ILE H  3 34  ? -0.965  29.122  -62.197 1.00 28.51  ? 34  ILE F CA    1 
ATOM   9935  C  C     . ILE H  3 34  ? -1.190  28.055  -63.260 1.00 30.92  ? 34  ILE F C     1 
ATOM   9936  O  O     . ILE H  3 34  ? -2.041  27.175  -63.119 1.00 35.04  ? 34  ILE F O     1 
ATOM   9937  C  CB    . ILE H  3 34  ? -1.694  30.427  -62.600 1.00 30.00  ? 34  ILE F CB    1 
ATOM   9938  C  CG1   . ILE H  3 34  ? -1.662  31.435  -61.449 1.00 28.76  ? 34  ILE F CG1   1 
ATOM   9939  C  CG2   . ILE H  3 34  ? -3.117  30.146  -63.040 1.00 26.97  ? 34  ILE F CG2   1 
ATOM   9940  C  CD1   . ILE H  3 34  ? -2.266  32.776  -61.803 1.00 28.15  ? 34  ILE F CD1   1 
ATOM   9941  N  N     . ARG H  3 35  ? -0.401  28.147  -64.322 1.00 33.20  ? 35  ARG F N     1 
ATOM   9942  C  CA    . ARG H  3 35  ? -0.385  27.159  -65.392 1.00 32.05  ? 35  ARG F CA    1 
ATOM   9943  C  C     . ARG H  3 35  ? -0.103  25.749  -64.849 1.00 33.20  ? 35  ARG F C     1 
ATOM   9944  O  O     . ARG H  3 35  ? -0.805  24.792  -65.181 1.00 33.59  ? 35  ARG F O     1 
ATOM   9945  C  CB    . ARG H  3 35  ? 0.664   27.562  -66.424 1.00 33.26  ? 35  ARG F CB    1 
ATOM   9946  C  CG    . ARG H  3 35  ? 0.653   26.783  -67.712 1.00 45.97  ? 35  ARG F CG    1 
ATOM   9947  C  CD    . ARG H  3 35  ? 1.512   27.495  -68.749 1.00 43.64  ? 35  ARG F CD    1 
ATOM   9948  N  NE    . ARG H  3 35  ? 1.022   27.281  -70.104 1.00 55.40  ? 35  ARG F NE    1 
ATOM   9949  C  CZ    . ARG H  3 35  ? -0.083  27.839  -70.591 1.00 54.79  ? 35  ARG F CZ    1 
ATOM   9950  N  NH1   . ARG H  3 35  ? -0.816  28.642  -69.827 1.00 45.03  ? 35  ARG F NH1   1 
ATOM   9951  N  NH2   . ARG H  3 35  ? -0.457  27.593  -71.840 1.00 48.87  ? 35  ARG F NH2   1 
ATOM   9952  N  N     . ARG H  3 36  ? 0.916   25.638  -64.003 1.00 28.82  ? 36  ARG F N     1 
ATOM   9953  C  CA    . ARG H  3 36  ? 1.275   24.370  -63.380 1.00 28.84  ? 36  ARG F CA    1 
ATOM   9954  C  C     . ARG H  3 36  ? 0.127   23.821  -62.538 1.00 33.04  ? 36  ARG F C     1 
ATOM   9955  O  O     . ARG H  3 36  ? -0.211  22.630  -62.629 1.00 34.81  ? 36  ARG F O     1 
ATOM   9956  C  CB    . ARG H  3 36  ? 2.527   24.524  -62.505 1.00 31.86  ? 36  ARG F CB    1 
ATOM   9957  C  CG    . ARG H  3 36  ? 3.811   24.791  -63.272 1.00 32.11  ? 36  ARG F CG    1 
ATOM   9958  C  CD    . ARG H  3 36  ? 5.049   24.555  -62.412 1.00 31.49  ? 36  ARG F CD    1 
ATOM   9959  N  NE    . ARG H  3 36  ? 5.246   25.588  -61.402 1.00 38.61  ? 36  ARG F NE    1 
ATOM   9960  C  CZ    . ARG H  3 36  ? 5.869   26.742  -61.629 1.00 43.07  ? 36  ARG F CZ    1 
ATOM   9961  N  NH1   . ARG H  3 36  ? 6.349   27.009  -62.838 1.00 40.14  ? 36  ARG F NH1   1 
ATOM   9962  N  NH2   . ARG H  3 36  ? 6.009   27.633  -60.653 1.00 37.26  ? 36  ARG F NH2   1 
ATOM   9963  N  N     . LEU H  3 37  ? -0.460  24.687  -61.710 1.00 30.28  ? 37  LEU F N     1 
ATOM   9964  C  CA    . LEU H  3 37  ? -1.570  24.280  -60.852 1.00 26.17  ? 37  LEU F CA    1 
ATOM   9965  C  C     . LEU H  3 37  ? -2.739  23.750  -61.687 1.00 34.74  ? 37  LEU F C     1 
ATOM   9966  O  O     . LEU H  3 37  ? -3.351  22.720  -61.356 1.00 28.08  ? 37  LEU F O     1 
ATOM   9967  C  CB    . LEU H  3 37  ? -2.028  25.443  -59.977 1.00 24.48  ? 37  LEU F CB    1 
ATOM   9968  C  CG    . LEU H  3 37  ? -1.075  25.848  -58.854 1.00 32.70  ? 37  LEU F CG    1 
ATOM   9969  C  CD1   . LEU H  3 37  ? -1.427  27.225  -58.281 1.00 24.92  ? 37  LEU F CD1   1 
ATOM   9970  C  CD2   . LEU H  3 37  ? -1.090  24.793  -57.766 1.00 28.54  ? 37  LEU F CD2   1 
ATOM   9971  N  N     . ALA H  3 38  ? -3.040  24.451  -62.778 1.00 31.45  ? 38  ALA F N     1 
ATOM   9972  C  CA    . ALA H  3 38  ? -4.058  23.980  -63.701 1.00 31.45  ? 38  ALA F CA    1 
ATOM   9973  C  C     . ALA H  3 38  ? -3.680  22.600  -64.251 1.00 31.08  ? 38  ALA F C     1 
ATOM   9974  O  O     . ALA H  3 38  ? -4.540  21.730  -64.388 1.00 27.88  ? 38  ALA F O     1 
ATOM   9975  C  CB    . ALA H  3 38  ? -4.255  24.968  -64.827 1.00 29.97  ? 38  ALA F CB    1 
ATOM   9976  N  N     . ARG H  3 39  ? -2.397  22.402  -64.552 1.00 29.39  ? 39  ARG F N     1 
ATOM   9977  C  CA    . ARG H  3 39  ? -1.937  21.118  -65.086 1.00 30.07  ? 39  ARG F CA    1 
ATOM   9978  C  C     . ARG H  3 39  ? -2.195  19.984  -64.109 1.00 28.96  ? 39  ARG F C     1 
ATOM   9979  O  O     . ARG H  3 39  ? -2.672  18.919  -64.501 1.00 30.56  ? 39  ARG F O     1 
ATOM   9980  C  CB    . ARG H  3 39  ? -0.449  21.159  -65.436 1.00 27.71  ? 39  ARG F CB    1 
ATOM   9981  C  CG    . ARG H  3 39  ? -0.108  22.036  -66.618 1.00 29.44  ? 39  ARG F CG    1 
ATOM   9982  C  CD    . ARG H  3 39  ? -0.682  21.524  -67.920 1.00 25.81  ? 39  ARG F CD    1 
ATOM   9983  N  NE    . ARG H  3 39  ? -0.148  22.295  -69.037 1.00 35.07  ? 39  ARG F NE    1 
ATOM   9984  C  CZ    . ARG H  3 39  ? -0.862  23.129  -69.786 1.00 39.82  ? 39  ARG F CZ    1 
ATOM   9985  N  NH1   . ARG H  3 39  ? -2.159  23.284  -69.560 1.00 38.51  ? 39  ARG F NH1   1 
ATOM   9986  N  NH2   . ARG H  3 39  ? -0.282  23.798  -70.772 1.00 41.62  ? 39  ARG F NH2   1 
ATOM   9987  N  N     . ARG H  3 40  ? -1.881  20.206  -62.837 1.00 26.78  ? 40  ARG F N     1 
ATOM   9988  C  CA    . ARG H  3 40  ? -2.207  19.205  -61.830 1.00 25.64  ? 40  ARG F CA    1 
ATOM   9989  C  C     . ARG H  3 40  ? -3.726  19.031  -61.729 1.00 25.13  ? 40  ARG F C     1 
ATOM   9990  O  O     . ARG H  3 40  ? -4.211  17.976  -61.343 1.00 34.75  ? 40  ARG F O     1 
ATOM   9991  C  CB    . ARG H  3 40  ? -1.615  19.580  -60.472 1.00 22.73  ? 40  ARG F CB    1 
ATOM   9992  C  CG    . ARG H  3 40  ? -1.752  18.497  -59.417 1.00 21.15  ? 40  ARG F CG    1 
ATOM   9993  C  CD    . ARG H  3 40  ? -0.912  18.806  -58.193 1.00 19.37  ? 40  ARG F CD    1 
ATOM   9994  N  NE    . ARG H  3 40  ? 0.512   18.581  -58.431 1.00 22.02  ? 40  ARG F NE    1 
ATOM   9995  C  CZ    . ARG H  3 40  ? 1.479   19.055  -57.651 1.00 27.92  ? 40  ARG F CZ    1 
ATOM   9996  N  NH1   . ARG H  3 40  ? 1.176   19.804  -56.600 1.00 37.60  ? 40  ARG F NH1   1 
ATOM   9997  N  NH2   . ARG H  3 40  ? 2.749   18.800  -57.929 1.00 26.01  ? 40  ARG F NH2   1 
ATOM   9998  N  N     . GLY H  3 41  ? -4.478  20.061  -62.098 1.00 26.23  ? 41  GLY F N     1 
ATOM   9999  C  CA    . GLY H  3 41  ? -5.923  19.944  -62.133 1.00 23.87  ? 41  GLY F CA    1 
ATOM   10000 C  C     . GLY H  3 41  ? -6.385  19.214  -63.378 1.00 23.67  ? 41  GLY F C     1 
ATOM   10001 O  O     . GLY H  3 41  ? -7.581  18.990  -63.583 1.00 27.87  ? 41  GLY F O     1 
ATOM   10002 N  N     . GLY H  3 42  ? -5.431  18.844  -64.220 1.00 23.16  ? 42  GLY F N     1 
ATOM   10003 C  CA    . GLY H  3 42  ? -5.734  18.133  -65.448 1.00 26.97  ? 42  GLY F CA    1 
ATOM   10004 C  C     . GLY H  3 42  ? -6.297  19.020  -66.541 1.00 29.83  ? 42  GLY F C     1 
ATOM   10005 O  O     . GLY H  3 42  ? -6.992  18.538  -67.439 1.00 33.94  ? 42  GLY F O     1 
ATOM   10006 N  N     . VAL H  3 43  ? -5.999  20.315  -66.468 1.00 27.53  ? 43  VAL F N     1 
ATOM   10007 C  CA    . VAL H  3 43  ? -6.458  21.275  -67.468 1.00 27.99  ? 43  VAL F CA    1 
ATOM   10008 C  C     . VAL H  3 43  ? -5.482  21.360  -68.640 1.00 25.53  ? 43  VAL F C     1 
ATOM   10009 O  O     . VAL H  3 43  ? -4.280  21.531  -68.447 1.00 25.35  ? 43  VAL F O     1 
ATOM   10010 C  CB    . VAL H  3 43  ? -6.647  22.676  -66.857 1.00 29.45  ? 43  VAL F CB    1 
ATOM   10011 C  CG1   . VAL H  3 43  ? -6.879  23.698  -67.949 1.00 28.28  ? 43  VAL F CG1   1 
ATOM   10012 C  CG2   . VAL H  3 43  ? -7.801  22.670  -65.864 1.00 26.28  ? 43  VAL F CG2   1 
ATOM   10013 N  N     . LYS H  3 44  ? -6.014  21.248  -69.854 1.00 34.70  ? 44  LYS F N     1 
ATOM   10014 C  CA    . LYS H  3 44  ? -5.200  21.167  -71.068 1.00 33.21  ? 44  LYS F CA    1 
ATOM   10015 C  C     . LYS H  3 44  ? -5.014  22.523  -71.754 1.00 34.14  ? 44  LYS F C     1 
ATOM   10016 O  O     . LYS H  3 44  ? -3.935  22.816  -72.259 1.00 37.56  ? 44  LYS F O     1 
ATOM   10017 C  CB    . LYS H  3 44  ? -5.827  20.163  -72.044 1.00 34.91  ? 44  LYS F CB    1 
ATOM   10018 C  CG    . LYS H  3 44  ? -5.174  20.080  -73.417 1.00 37.73  ? 44  LYS F CG    1 
ATOM   10019 C  CD    . LYS H  3 44  ? -5.699  18.867  -74.185 1.00 39.05  ? 44  LYS F CD    1 
ATOM   10020 C  CE    . LYS H  3 44  ? -5.203  18.822  -75.621 1.00 33.96  ? 44  LYS F CE    1 
ATOM   10021 N  NZ    . LYS H  3 44  ? -6.242  19.316  -76.574 1.00 47.04  ? 44  LYS F NZ    1 
ATOM   10022 N  N     . ARG H  3 45  ? -6.058  23.349  -71.765 1.00 33.73  ? 45  ARG F N     1 
ATOM   10023 C  CA    . ARG H  3 45  ? -5.997  24.648  -72.435 1.00 31.65  ? 45  ARG F CA    1 
ATOM   10024 C  C     . ARG H  3 45  ? -6.542  25.775  -71.551 1.00 36.62  ? 45  ARG F C     1 
ATOM   10025 O  O     . ARG H  3 45  ? -7.529  25.591  -70.837 1.00 34.87  ? 45  ARG F O     1 
ATOM   10026 C  CB    . ARG H  3 45  ? -6.770  24.593  -73.749 1.00 34.47  ? 45  ARG F CB    1 
ATOM   10027 C  CG    . ARG H  3 45  ? -6.323  25.601  -74.780 1.00 34.05  ? 45  ARG F CG    1 
ATOM   10028 C  CD    . ARG H  3 45  ? -6.919  25.275  -76.130 1.00 32.31  ? 45  ARG F CD    1 
ATOM   10029 N  NE    . ARG H  3 45  ? -6.401  26.156  -77.168 1.00 45.13  ? 45  ARG F NE    1 
ATOM   10030 C  CZ    . ARG H  3 45  ? -6.991  27.280  -77.558 1.00 39.92  ? 45  ARG F CZ    1 
ATOM   10031 N  NH1   . ARG H  3 45  ? -8.133  27.658  -77.003 1.00 34.32  ? 45  ARG F NH1   1 
ATOM   10032 N  NH2   . ARG H  3 45  ? -6.441  28.019  -78.513 1.00 41.95  ? 45  ARG F NH2   1 
ATOM   10033 N  N     . ILE H  3 46  ? -5.901  26.942  -71.609 1.00 34.60  ? 46  ILE F N     1 
ATOM   10034 C  CA    . ILE H  3 46  ? -6.187  28.025  -70.670 1.00 34.38  ? 46  ILE F CA    1 
ATOM   10035 C  C     . ILE H  3 46  ? -6.411  29.386  -71.333 1.00 38.00  ? 46  ILE F C     1 
ATOM   10036 O  O     . ILE H  3 46  ? -5.535  29.901  -72.023 1.00 39.91  ? 46  ILE F O     1 
ATOM   10037 C  CB    . ILE H  3 46  ? -5.044  28.192  -69.654 1.00 34.88  ? 46  ILE F CB    1 
ATOM   10038 C  CG1   . ILE H  3 46  ? -4.764  26.881  -68.924 1.00 29.60  ? 46  ILE F CG1   1 
ATOM   10039 C  CG2   . ILE H  3 46  ? -5.370  29.304  -68.671 1.00 38.22  ? 46  ILE F CG2   1 
ATOM   10040 C  CD1   . ILE H  3 46  ? -3.562  26.941  -68.029 1.00 28.15  ? 46  ILE F CD1   1 
ATOM   10041 N  N     . SER H  3 47  ? -7.580  29.975  -71.099 1.00 38.94  ? 47  SER F N     1 
ATOM   10042 C  CA    . SER