data_3ZFM
# 
_entry.id   3ZFM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ZFM         
PDBE  EBI-55098    
WWPDB D_1290055098 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 3ZEW unspecified 'CRYSTAL STRUCTURE OF EPHB4 IN COMPLEX WITH STAUROSPORINE' 
PDB 3ZFX unspecified 'CRYSTAL STRUCTURE OF EPHB1'                               
PDB 3ZFY unspecified 'CRYSTAL STRUCTURE OF EPHB3'                               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ZFM 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-12-12 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Debreczeni, J.E.' 1 
'Overman, R.'      2 
'Truman, C.'       3 
'McAlister, M.'    4 
'Attwood, T.K.'    5 
# 
_citation.id                        primary 
_citation.title                     'Completing the Structural Family Portrait of the Human Ephb Tyrosine Kinase Domains' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            23 
_citation.page_first                627 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24677421 
_citation.pdbx_database_id_DOI      10.1002/PRO.2445 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Overman, R.C.'    1 
primary 'Debreczeni, J.E.' 2 
primary 'Truman, C.M.'     3 
primary 'Mcalister, M.S.'  4 
primary 'Attwood, T.K.'    5 
# 
_cell.entry_id           3ZFM 
_cell.length_a           34.590 
_cell.length_b           41.190 
_cell.length_c           54.470 
_cell.angle_alpha        92.65 
_cell.angle_beta         97.15 
_cell.angle_gamma        114.79 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3ZFM 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'EPHRIN TYPE-B RECEPTOR 2' 33603.387 1  2.7.10.1 ? 'KINASE DOMAIN, RESIDUES 604-898' ? 
2 water   nat water                      18.015    83 ?        ? ?                                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;DEVELOPMENTALLY-REGULATED EPH-RELATED TYROSINE KINASE, ELK-RELATED TYROSINE KINASE, EPH TYROSINE KINASE 3, EPH-LIKE KINASE 5, EK5, HEK5, RENAL CARCINOMA ANTIGEN NY-REN-47, TYROSINE-PROTEIN KINASE TYRO5, TYROSINE-PROTEIN KINASE RECEPTOR EPH-3, EPHB2, EPHHB2
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHP
NVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVC
KVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIE
QDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHP
NVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVC
KVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIE
QDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   ASP n 
1 5   PRO n 
1 6   ASN n 
1 7   GLU n 
1 8   ALA n 
1 9   VAL n 
1 10  ARG n 
1 11  GLU n 
1 12  PHE n 
1 13  ALA n 
1 14  LYS n 
1 15  GLU n 
1 16  ILE n 
1 17  ASP n 
1 18  ILE n 
1 19  SER n 
1 20  CYS n 
1 21  VAL n 
1 22  LYS n 
1 23  ILE n 
1 24  GLU n 
1 25  GLN n 
1 26  VAL n 
1 27  ILE n 
1 28  GLY n 
1 29  ALA n 
1 30  GLY n 
1 31  GLU n 
1 32  PHE n 
1 33  GLY n 
1 34  GLU n 
1 35  VAL n 
1 36  CYS n 
1 37  SER n 
1 38  GLY n 
1 39  HIS n 
1 40  LEU n 
1 41  LYS n 
1 42  LEU n 
1 43  PRO n 
1 44  GLY n 
1 45  LYS n 
1 46  ARG n 
1 47  GLU n 
1 48  ILE n 
1 49  PHE n 
1 50  VAL n 
1 51  ALA n 
1 52  ILE n 
1 53  LYS n 
1 54  THR n 
1 55  LEU n 
1 56  LYS n 
1 57  SER n 
1 58  GLY n 
1 59  TYR n 
1 60  THR n 
1 61  GLU n 
1 62  LYS n 
1 63  GLN n 
1 64  ARG n 
1 65  ARG n 
1 66  ASP n 
1 67  PHE n 
1 68  LEU n 
1 69  SER n 
1 70  GLU n 
1 71  ALA n 
1 72  SER n 
1 73  ILE n 
1 74  MET n 
1 75  GLY n 
1 76  GLN n 
1 77  PHE n 
1 78  ASP n 
1 79  HIS n 
1 80  PRO n 
1 81  ASN n 
1 82  VAL n 
1 83  ILE n 
1 84  HIS n 
1 85  LEU n 
1 86  GLU n 
1 87  GLY n 
1 88  VAL n 
1 89  VAL n 
1 90  THR n 
1 91  LYS n 
1 92  SER n 
1 93  THR n 
1 94  PRO n 
1 95  VAL n 
1 96  MET n 
1 97  ILE n 
1 98  ILE n 
1 99  THR n 
1 100 GLU n 
1 101 PHE n 
1 102 MET n 
1 103 GLU n 
1 104 ASN n 
1 105 GLY n 
1 106 SER n 
1 107 LEU n 
1 108 ASP n 
1 109 SER n 
1 110 PHE n 
1 111 LEU n 
1 112 ARG n 
1 113 GLN n 
1 114 ASN n 
1 115 ASP n 
1 116 GLY n 
1 117 GLN n 
1 118 PHE n 
1 119 THR n 
1 120 VAL n 
1 121 ILE n 
1 122 GLN n 
1 123 LEU n 
1 124 VAL n 
1 125 GLY n 
1 126 MET n 
1 127 LEU n 
1 128 ARG n 
1 129 GLY n 
1 130 ILE n 
1 131 ALA n 
1 132 ALA n 
1 133 GLY n 
1 134 MET n 
1 135 LYS n 
1 136 TYR n 
1 137 LEU n 
1 138 ALA n 
1 139 ASP n 
1 140 MET n 
1 141 ASN n 
1 142 TYR n 
1 143 VAL n 
1 144 HIS n 
1 145 ARG n 
1 146 ASP n 
1 147 LEU n 
1 148 ALA n 
1 149 ALA n 
1 150 ARG n 
1 151 ASN n 
1 152 ILE n 
1 153 LEU n 
1 154 VAL n 
1 155 ASN n 
1 156 SER n 
1 157 ASN n 
1 158 LEU n 
1 159 VAL n 
1 160 CYS n 
1 161 LYS n 
1 162 VAL n 
1 163 SER n 
1 164 ASP n 
1 165 PHE n 
1 166 GLY n 
1 167 LEU n 
1 168 SER n 
1 169 ARG n 
1 170 PHE n 
1 171 LEU n 
1 172 GLU n 
1 173 ASP n 
1 174 ASP n 
1 175 THR n 
1 176 SER n 
1 177 ASP n 
1 178 PRO n 
1 179 THR n 
1 180 TYR n 
1 181 THR n 
1 182 SER n 
1 183 ALA n 
1 184 LEU n 
1 185 GLY n 
1 186 GLY n 
1 187 LYS n 
1 188 ILE n 
1 189 PRO n 
1 190 ILE n 
1 191 ARG n 
1 192 TRP n 
1 193 THR n 
1 194 ALA n 
1 195 PRO n 
1 196 GLU n 
1 197 ALA n 
1 198 ILE n 
1 199 GLN n 
1 200 TYR n 
1 201 ARG n 
1 202 LYS n 
1 203 PHE n 
1 204 THR n 
1 205 SER n 
1 206 ALA n 
1 207 SER n 
1 208 ASP n 
1 209 VAL n 
1 210 TRP n 
1 211 SER n 
1 212 TYR n 
1 213 GLY n 
1 214 ILE n 
1 215 VAL n 
1 216 MET n 
1 217 TRP n 
1 218 GLU n 
1 219 VAL n 
1 220 MET n 
1 221 SER n 
1 222 TYR n 
1 223 GLY n 
1 224 GLU n 
1 225 ARG n 
1 226 PRO n 
1 227 TYR n 
1 228 TRP n 
1 229 ASP n 
1 230 MET n 
1 231 THR n 
1 232 ASN n 
1 233 GLN n 
1 234 ASP n 
1 235 VAL n 
1 236 ILE n 
1 237 ASN n 
1 238 ALA n 
1 239 ILE n 
1 240 GLU n 
1 241 GLN n 
1 242 ASP n 
1 243 TYR n 
1 244 ARG n 
1 245 LEU n 
1 246 PRO n 
1 247 PRO n 
1 248 PRO n 
1 249 MET n 
1 250 ASP n 
1 251 CYS n 
1 252 PRO n 
1 253 SER n 
1 254 ALA n 
1 255 LEU n 
1 256 HIS n 
1 257 GLN n 
1 258 LEU n 
1 259 MET n 
1 260 LEU n 
1 261 ASP n 
1 262 CYS n 
1 263 TRP n 
1 264 GLN n 
1 265 LYS n 
1 266 ASP n 
1 267 ARG n 
1 268 ASN n 
1 269 HIS n 
1 270 ARG n 
1 271 PRO n 
1 272 LYS n 
1 273 PHE n 
1 274 GLY n 
1 275 GLN n 
1 276 ILE n 
1 277 VAL n 
1 278 ASN n 
1 279 THR n 
1 280 LEU n 
1 281 ASP n 
1 282 LYS n 
1 283 MET n 
1 284 ILE n 
1 285 ARG n 
1 286 ASN n 
1 287 PRO n 
1 288 ASN n 
1 289 SER n 
1 290 LEU n 
1 291 LYS n 
1 292 ALA n 
1 293 MET n 
1 294 ALA n 
1 295 PRO n 
1 296 LEU n 
1 297 SER n 
1 298 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              STAR 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    EPHB2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P29323 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3ZFM 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 298 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P29323 
_struct_ref_seq.db_align_beg                  604 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  898 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       604 
_struct_ref_seq.pdbx_auth_seq_align_end       898 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ZFM GLY A 1 ? UNP P29323 ? ? 'expression tag' 601 1 
1 3ZFM SER A 2 ? UNP P29323 ? ? 'expression tag' 602 2 
1 3ZFM SER A 3 ? UNP P29323 ? ? 'expression tag' 603 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3ZFM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.99 
_exptl_crystal.density_percent_sol   38 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RIGAKU SATURN' 
_diffrn_detector.pdbx_collection_date   2009-07-29 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3ZFM 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             37.17 
_reflns.d_resolution_high            2.27 
_reflns.number_obs                   45906 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.1 
_reflns.pdbx_Rmerge_I_obs            0.04 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.70 
_reflns.B_iso_Wilson_estimate        28.66 
_reflns.pdbx_redundancy              3.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.27 
_reflns_shell.d_res_low              2.39 
_reflns_shell.percent_possible_all   92.6 
_reflns_shell.Rmerge_I_obs           0.12 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    10.30 
_reflns_shell.pdbx_redundancy        3.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3ZFM 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     11689 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             21.11 
_refine.ls_d_res_high                            2.27 
_refine.ls_percent_reflns_obs                    94.10 
_refine.ls_R_factor_obs                          0.2362 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2349 
_refine.ls_R_factor_R_free                       0.2634 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.79 
_refine.ls_number_reflns_R_free                  560 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.8430 
_refine.correlation_coeff_Fo_to_Fc_free          0.8074 
_refine.B_iso_mean                               26.86 
_refine.aniso_B[1][1]                            1.7258 
_refine.aniso_B[2][2]                            5.1799 
_refine.aniso_B[3][3]                            -6.9057 
_refine.aniso_B[1][2]                            0.4573 
_refine.aniso_B[1][3]                            -0.4221 
_refine.aniso_B[2][3]                            0.9727 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'IDEAL-DIST CONTACT TERM CONTACT SETUP. ALL ATOMS HAVE CCP4 ATOM TYPE FROM LIBRARY' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.404 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.252 
_refine.pdbx_overall_SU_R_Blow_DPI               0.387 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.246 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3ZFM 
_refine_analyze.Luzzati_coordinate_error_obs    0.336 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1933 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             83 
_refine_hist.number_atoms_total               2016 
_refine_hist.d_res_high                       2.27 
_refine_hist.d_res_low                        21.11 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  1974 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.05  ? 2.00  2679 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  669  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  49   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  284  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 1974 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           2.45  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           18.29 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  265  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  2354 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.27 
_refine_ls_shell.d_res_low                        2.49 
_refine_ls_shell.number_reflns_R_work             2502 
_refine_ls_shell.R_factor_R_work                  0.2737 
_refine_ls_shell.percent_reflns_obs               94.10 
_refine_ls_shell.R_factor_R_free                  0.2728 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.83 
_refine_ls_shell.number_reflns_R_free             155 
_refine_ls_shell.number_reflns_all                2657 
_refine_ls_shell.R_factor_all                     0.2736 
# 
_struct.entry_id                  3ZFM 
_struct.title                     'Crystal structure of EphB2' 
_struct.pdbx_descriptor           'EPHRIN TYPE-B RECEPTOR 2 (E.C.2.7.10.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ZFM 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 17  ? SER A 19  ? ASP A 617 SER A 619 5 ? 3  
HELX_P HELX_P2  2  THR A 60  ? GLY A 75  ? THR A 660 GLY A 675 1 ? 16 
HELX_P HELX_P3  3  SER A 106 ? GLN A 113 ? SER A 706 GLN A 713 1 ? 8  
HELX_P HELX_P4  4  THR A 119 ? MET A 140 ? THR A 719 MET A 740 1 ? 22 
HELX_P HELX_P5  5  ALA A 148 ? ARG A 150 ? ALA A 748 ARG A 750 5 ? 3  
HELX_P HELX_P6  6  PRO A 189 ? THR A 193 ? PRO A 789 THR A 793 5 ? 5  
HELX_P HELX_P7  7  ALA A 194 ? ARG A 201 ? ALA A 794 ARG A 801 1 ? 8  
HELX_P HELX_P8  8  THR A 204 ? SER A 221 ? THR A 804 SER A 821 1 ? 18 
HELX_P HELX_P9  9  THR A 231 ? GLN A 241 ? THR A 831 GLN A 841 1 ? 11 
HELX_P HELX_P10 10 PRO A 252 ? TRP A 263 ? PRO A 852 TRP A 863 1 ? 12 
HELX_P HELX_P11 11 LYS A 272 ? ASN A 286 ? LYS A 872 ASN A 886 1 ? 15 
HELX_P HELX_P12 12 PRO A 287 ? LYS A 291 ? PRO A 887 LYS A 891 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          THR 
_struct_mon_prot_cis.label_seq_id           93 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           THR 
_struct_mon_prot_cis.auth_seq_id            693 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    94 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     694 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.66 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 21  ? VAL A 26  ? VAL A 621 VAL A 626 
AA 2 VAL A 35  ? LEU A 40  ? VAL A 635 LEU A 640 
AA 3 ILE A 48  ? LEU A 55  ? ILE A 648 LEU A 655 
AA 4 VAL A 95  ? GLU A 100 ? VAL A 695 GLU A 700 
AA 5 LEU A 85  ? VAL A 89  ? LEU A 685 VAL A 689 
AB 1 ILE A 152 ? VAL A 154 ? ILE A 752 VAL A 754 
AB 2 CYS A 160 ? VAL A 162 ? CYS A 760 VAL A 762 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 24  ? N GLU A 624 O SER A 37  ? O SER A 637 
AA 2 3 N LEU A 40  ? N LEU A 640 O ILE A 48  ? O ILE A 648 
AA 3 4 N LEU A 55  ? N LEU A 655 O VAL A 95  ? O VAL A 695 
AA 4 5 O ILE A 98  ? O ILE A 698 N GLU A 86  ? N GLU A 686 
AB 1 2 N LEU A 153 ? N LEU A 753 O LYS A 161 ? O LYS A 761 
# 
_database_PDB_matrix.entry_id          3ZFM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ZFM 
_atom_sites.fract_transf_matrix[1][1]   0.028910 
_atom_sites.fract_transf_matrix[1][2]   0.013352 
_atom_sites.fract_transf_matrix[1][3]   0.005116 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026742 
_atom_sites.fract_transf_matrix[2][3]   0.002940 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018614 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 15  ? -9.507  18.716  -18.607 1.00 50.80  ? 615  GLU A N   1 
ATOM   2    C CA  . GLU A 1 15  ? -9.768  19.630  -17.493 1.00 50.53  ? 615  GLU A CA  1 
ATOM   3    C C   . GLU A 1 15  ? -9.108  20.992  -17.716 1.00 54.43  ? 615  GLU A C   1 
ATOM   4    O O   . GLU A 1 15  ? -9.797  22.012  -17.664 1.00 53.93  ? 615  GLU A O   1 
ATOM   5    C CB  . GLU A 1 15  ? -9.298  19.032  -16.145 1.00 51.69  ? 615  GLU A CB  1 
ATOM   6    C CG  . GLU A 1 15  ? -10.069 17.809  -15.669 1.00 59.51  ? 615  GLU A CG  1 
ATOM   7    C CD  . GLU A 1 15  ? -11.410 18.053  -15.001 1.00 69.77  ? 615  GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 15  ? -11.721 19.220  -14.670 1.00 62.25  ? 615  GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 15  ? -12.141 17.061  -14.781 1.00 55.64  ? 615  GLU A OE2 1 
ATOM   10   N N   . ILE A 1 16  ? -7.773  21.007  -17.944 1.00 51.08  ? 616  ILE A N   1 
ATOM   11   C CA  . ILE A 1 16  ? -6.984  22.230  -18.130 1.00 51.10  ? 616  ILE A CA  1 
ATOM   12   C C   . ILE A 1 16  ? -6.417  22.329  -19.551 1.00 55.62  ? 616  ILE A C   1 
ATOM   13   O O   . ILE A 1 16  ? -5.913  21.338  -20.084 1.00 55.08  ? 616  ILE A O   1 
ATOM   14   C CB  . ILE A 1 16  ? -5.858  22.375  -17.043 1.00 54.07  ? 616  ILE A CB  1 
ATOM   15   C CG1 . ILE A 1 16  ? -6.417  22.279  -15.594 1.00 54.32  ? 616  ILE A CG1 1 
ATOM   16   C CG2 . ILE A 1 16  ? -5.031  23.667  -17.235 1.00 54.52  ? 616  ILE A CG2 1 
ATOM   17   C CD1 . ILE A 1 16  ? -5.334  22.195  -14.461 1.00 57.62  ? 616  ILE A CD1 1 
ATOM   18   N N   . ASP A 1 17  ? -6.484  23.546  -20.140 1.00 52.36  ? 617  ASP A N   1 
ATOM   19   C CA  . ASP A 1 17  ? -5.928  23.876  -21.450 1.00 52.17  ? 617  ASP A CA  1 
ATOM   20   C C   . ASP A 1 17  ? -4.418  24.116  -21.258 1.00 55.75  ? 617  ASP A C   1 
ATOM   21   O O   . ASP A 1 17  ? -4.025  24.805  -20.311 1.00 54.99  ? 617  ASP A O   1 
ATOM   22   C CB  . ASP A 1 17  ? -6.630  25.125  -22.021 1.00 54.08  ? 617  ASP A CB  1 
ATOM   23   C CG  . ASP A 1 17  ? -6.387  25.397  -23.495 1.00 63.47  ? 617  ASP A CG  1 
ATOM   24   O OD1 . ASP A 1 17  ? -6.527  24.453  -24.308 1.00 63.49  ? 617  ASP A OD1 1 
ATOM   25   O OD2 . ASP A 1 17  ? -6.127  26.568  -23.844 1.00 69.60  ? 617  ASP A OD2 1 
ATOM   26   N N   . ILE A 1 18  ? -3.579  23.523  -22.139 1.00 52.21  ? 618  ILE A N   1 
ATOM   27   C CA  . ILE A 1 18  ? -2.106  23.571  -22.103 1.00 51.86  ? 618  ILE A CA  1 
ATOM   28   C C   . ILE A 1 18  ? -1.523  25.013  -21.993 1.00 55.31  ? 618  ILE A C   1 
ATOM   29   O O   . ILE A 1 18  ? -0.452  25.183  -21.402 1.00 54.76  ? 618  ILE A O   1 
ATOM   30   C CB  . ILE A 1 18  ? -1.490  22.770  -23.288 1.00 54.95  ? 618  ILE A CB  1 
ATOM   31   C CG1 . ILE A 1 18  ? 0.004   22.453  -23.034 1.00 55.60  ? 618  ILE A CG1 1 
ATOM   32   C CG2 . ILE A 1 18  ? -1.733  23.444  -24.658 1.00 55.47  ? 618  ILE A CG2 1 
ATOM   33   C CD1 . ILE A 1 18  ? 0.524   21.152  -23.627 1.00 66.23  ? 618  ILE A CD1 1 
ATOM   34   N N   . SER A 1 19  ? -2.237  26.032  -22.526 1.00 51.49  ? 619  SER A N   1 
ATOM   35   C CA  . SER A 1 19  ? -1.829  27.444  -22.485 1.00 50.82  ? 619  SER A CA  1 
ATOM   36   C C   . SER A 1 19  ? -1.761  28.007  -21.053 1.00 54.37  ? 619  SER A C   1 
ATOM   37   O O   . SER A 1 19  ? -1.017  28.959  -20.805 1.00 53.73  ? 619  SER A O   1 
ATOM   38   C CB  . SER A 1 19  ? -2.750  28.293  -23.354 1.00 53.61  ? 619  SER A CB  1 
ATOM   39   O OG  . SER A 1 19  ? -4.100  28.197  -22.933 1.00 61.85  ? 619  SER A OG  1 
ATOM   40   N N   . CYS A 1 20  ? -2.518  27.404  -20.117 1.00 51.20  ? 620  CYS A N   1 
ATOM   41   C CA  . CYS A 1 20  ? -2.562  27.786  -18.701 1.00 51.17  ? 620  CYS A CA  1 
ATOM   42   C C   . CYS A 1 20  ? -1.378  27.206  -17.919 1.00 55.36  ? 620  CYS A C   1 
ATOM   43   O O   . CYS A 1 20  ? -1.071  27.703  -16.836 1.00 54.94  ? 620  CYS A O   1 
ATOM   44   C CB  . CYS A 1 20  ? -3.893  27.381  -18.071 1.00 51.44  ? 620  CYS A CB  1 
ATOM   45   S SG  . CYS A 1 20  ? -5.355  27.957  -18.975 1.00 55.25  ? 620  CYS A SG  1 
ATOM   46   N N   . VAL A 1 21  ? -0.718  26.164  -18.468 1.00 52.40  ? 621  VAL A N   1 
ATOM   47   C CA  . VAL A 1 21  ? 0.417   25.456  -17.854 1.00 52.34  ? 621  VAL A CA  1 
ATOM   48   C C   . VAL A 1 21  ? 1.768   25.976  -18.387 1.00 57.85  ? 621  VAL A C   1 
ATOM   49   O O   . VAL A 1 21  ? 1.909   26.220  -19.589 1.00 57.48  ? 621  VAL A O   1 
ATOM   50   C CB  . VAL A 1 21  ? 0.283   23.910  -18.015 1.00 55.60  ? 621  VAL A CB  1 
ATOM   51   C CG1 . VAL A 1 21  ? 1.353   23.164  -17.221 1.00 55.29  ? 621  VAL A CG1 1 
ATOM   52   C CG2 . VAL A 1 21  ? -1.108  23.422  -17.614 1.00 55.24  ? 621  VAL A CG2 1 
ATOM   53   N N   . LYS A 1 22  ? 2.757   26.131  -17.482 1.00 55.51  ? 622  LYS A N   1 
ATOM   54   C CA  . LYS A 1 22  ? 4.114   26.577  -17.806 1.00 55.86  ? 622  LYS A CA  1 
ATOM   55   C C   . LYS A 1 22  ? 5.160   25.864  -16.924 1.00 60.55  ? 622  LYS A C   1 
ATOM   56   O O   . LYS A 1 22  ? 5.340   26.224  -15.758 1.00 59.82  ? 622  LYS A O   1 
ATOM   57   C CB  . LYS A 1 22  ? 4.228   28.109  -17.717 1.00 58.50  ? 622  LYS A CB  1 
ATOM   58   N N   . ILE A 1 23  ? 5.832   24.837  -17.491 1.00 58.05  ? 623  ILE A N   1 
ATOM   59   C CA  . ILE A 1 23  ? 6.852   24.019  -16.815 1.00 58.41  ? 623  ILE A CA  1 
ATOM   60   C C   . ILE A 1 23  ? 8.129   24.841  -16.553 1.00 64.61  ? 623  ILE A C   1 
ATOM   61   O O   . ILE A 1 23  ? 8.686   25.431  -17.483 1.00 64.34  ? 623  ILE A O   1 
ATOM   62   C CB  . ILE A 1 23  ? 7.139   22.687  -17.574 1.00 61.12  ? 623  ILE A CB  1 
ATOM   63   C CG1 . ILE A 1 23  ? 5.839   21.991  -18.030 1.00 61.24  ? 623  ILE A CG1 1 
ATOM   64   C CG2 . ILE A 1 23  ? 7.995   21.739  -16.728 1.00 61.68  ? 623  ILE A CG2 1 
ATOM   65   C CD1 . ILE A 1 23  ? 5.803   21.660  -19.492 1.00 67.52  ? 623  ILE A CD1 1 
ATOM   66   N N   . GLU A 1 24  ? 8.582   24.871  -15.283 1.00 62.43  ? 624  GLU A N   1 
ATOM   67   C CA  . GLU A 1 24  ? 9.755   25.634  -14.856 1.00 62.67  ? 624  GLU A CA  1 
ATOM   68   C C   . GLU A 1 24  ? 10.990  24.777  -14.563 1.00 67.52  ? 624  GLU A C   1 
ATOM   69   O O   . GLU A 1 24  ? 12.065  25.080  -15.085 1.00 67.28  ? 624  GLU A O   1 
ATOM   70   C CB  . GLU A 1 24  ? 9.411   26.527  -13.652 1.00 64.00  ? 624  GLU A CB  1 
ATOM   71   N N   . GLN A 1 25  ? 10.849  23.730  -13.721 1.00 64.58  ? 625  GLN A N   1 
ATOM   72   C CA  . GLN A 1 25  ? 11.963  22.861  -13.319 1.00 64.74  ? 625  GLN A CA  1 
ATOM   73   C C   . GLN A 1 25  ? 11.518  21.421  -12.994 1.00 69.01  ? 625  GLN A C   1 
ATOM   74   O O   . GLN A 1 25  ? 10.323  21.138  -12.941 1.00 68.55  ? 625  GLN A O   1 
ATOM   75   C CB  . GLN A 1 25  ? 12.690  23.484  -12.106 1.00 66.12  ? 625  GLN A CB  1 
ATOM   76   C CG  . GLN A 1 25  ? 14.207  23.340  -12.144 1.00 83.44  ? 625  GLN A CG  1 
ATOM   77   C CD  . GLN A 1 25  ? 14.848  23.901  -10.901 1.00 103.86 ? 625  GLN A CD  1 
ATOM   78   N N   . VAL A 1 26  ? 12.493  20.519  -12.785 1.00 66.01  ? 626  VAL A N   1 
ATOM   79   C CA  . VAL A 1 26  ? 12.291  19.116  -12.411 1.00 65.93  ? 626  VAL A CA  1 
ATOM   80   C C   . VAL A 1 26  ? 12.982  18.865  -11.055 1.00 70.09  ? 626  VAL A C   1 
ATOM   81   O O   . VAL A 1 26  ? 14.130  19.277  -10.868 1.00 70.02  ? 626  VAL A O   1 
ATOM   82   C CB  . VAL A 1 26  ? 12.719  18.125  -13.538 1.00 69.90  ? 626  VAL A CB  1 
ATOM   83   C CG1 . VAL A 1 26  ? 14.192  18.279  -13.924 1.00 69.81  ? 626  VAL A CG1 1 
ATOM   84   C CG2 . VAL A 1 26  ? 12.391  16.678  -13.177 1.00 69.65  ? 626  VAL A CG2 1 
ATOM   85   N N   . ILE A 1 27  ? 12.263  18.245  -10.099 1.00 66.34  ? 627  ILE A N   1 
ATOM   86   C CA  . ILE A 1 27  ? 12.780  17.947  -8.756  1.00 91.44  ? 627  ILE A CA  1 
ATOM   87   C C   . ILE A 1 27  ? 12.215  16.625  -8.220  1.00 106.37 ? 627  ILE A C   1 
ATOM   88   O O   . ILE A 1 27  ? 11.107  16.232  -8.578  1.00 63.57  ? 627  ILE A O   1 
ATOM   89   C CB  . ILE A 1 27  ? 12.587  19.146  -7.769  1.00 94.58  ? 627  ILE A CB  1 
ATOM   90   C CG1 . ILE A 1 27  ? 13.320  18.925  -6.423  1.00 94.94  ? 627  ILE A CG1 1 
ATOM   91   C CG2 . ILE A 1 27  ? 11.111  19.510  -7.555  1.00 95.48  ? 627  ILE A CG2 1 
ATOM   92   C CD1 . ILE A 1 27  ? 14.733  19.485  -6.364  1.00 101.60 ? 627  ILE A CD1 1 
ATOM   93   N N   . PHE A 1 32  ? 5.798   6.330   -12.914 1.00 76.96  ? 632  PHE A N   1 
ATOM   94   C CA  . PHE A 1 32  ? 5.445   6.230   -14.329 1.00 76.60  ? 632  PHE A CA  1 
ATOM   95   C C   . PHE A 1 32  ? 6.338   7.104   -15.214 1.00 79.33  ? 632  PHE A C   1 
ATOM   96   O O   . PHE A 1 32  ? 6.953   6.594   -16.151 1.00 78.95  ? 632  PHE A O   1 
ATOM   97   C CB  . PHE A 1 32  ? 3.956   6.552   -14.555 1.00 78.56  ? 632  PHE A CB  1 
ATOM   98   C CG  . PHE A 1 32  ? 2.993   5.557   -13.951 1.00 80.32  ? 632  PHE A CG  1 
ATOM   99   C CD1 . PHE A 1 32  ? 2.669   4.382   -14.621 1.00 83.54  ? 632  PHE A CD1 1 
ATOM   100  C CD2 . PHE A 1 32  ? 2.392   5.805   -12.722 1.00 82.55  ? 632  PHE A CD2 1 
ATOM   101  C CE1 . PHE A 1 32  ? 1.778   3.462   -14.062 1.00 84.51  ? 632  PHE A CE1 1 
ATOM   102  C CE2 . PHE A 1 32  ? 1.496   4.887   -12.166 1.00 85.44  ? 632  PHE A CE2 1 
ATOM   103  C CZ  . PHE A 1 32  ? 1.198   3.721   -12.838 1.00 83.61  ? 632  PHE A CZ  1 
ATOM   104  N N   . GLY A 1 33  ? 6.404   8.398   -14.906 1.00 74.87  ? 633  GLY A N   1 
ATOM   105  C CA  . GLY A 1 33  ? 7.209   9.359   -15.651 1.00 74.20  ? 633  GLY A CA  1 
ATOM   106  C C   . GLY A 1 33  ? 8.000   10.309  -14.776 1.00 76.78  ? 633  GLY A C   1 
ATOM   107  O O   . GLY A 1 33  ? 8.553   9.897   -13.751 1.00 76.41  ? 633  GLY A O   1 
ATOM   108  N N   . GLU A 1 34  ? 8.058   11.593  -15.182 1.00 72.24  ? 634  GLU A N   1 
ATOM   109  C CA  . GLU A 1 34  ? 8.801   12.645  -14.481 1.00 71.67  ? 634  GLU A CA  1 
ATOM   110  C C   . GLU A 1 34  ? 7.917   13.571  -13.645 1.00 74.02  ? 634  GLU A C   1 
ATOM   111  O O   . GLU A 1 34  ? 6.844   13.969  -14.096 1.00 73.59  ? 634  GLU A O   1 
ATOM   112  C CB  . GLU A 1 34  ? 9.631   13.468  -15.479 1.00 73.11  ? 634  GLU A CB  1 
ATOM   113  N N   . VAL A 1 35  ? 8.388   13.927  -12.434 1.00 69.18  ? 635  VAL A N   1 
ATOM   114  C CA  . VAL A 1 35  ? 7.713   14.848  -11.511 1.00 68.17  ? 635  VAL A CA  1 
ATOM   115  C C   . VAL A 1 35  ? 8.320   16.238  -11.673 1.00 69.35  ? 635  VAL A C   1 
ATOM   116  O O   . VAL A 1 35  ? 9.526   16.405  -11.493 1.00 68.96  ? 635  VAL A O   1 
ATOM   117  C CB  . VAL A 1 35  ? 7.678   14.362  -10.037 1.00 72.42  ? 635  VAL A CB  1 
ATOM   118  C CG1 . VAL A 1 35  ? 6.539   13.374  -9.817  1.00 72.35  ? 635  VAL A CG1 1 
ATOM   119  C CG2 . VAL A 1 35  ? 9.013   13.760  -9.596  1.00 72.37  ? 635  VAL A CG2 1 
ATOM   120  N N   . CYS A 1 36  ? 7.502   17.220  -12.082 1.00 63.89  ? 636  CYS A N   1 
ATOM   121  C CA  . CYS A 1 36  ? 7.981   18.572  -12.367 1.00 62.72  ? 636  CYS A CA  1 
ATOM   122  C C   . CYS A 1 36  ? 7.292   19.675  -11.552 1.00 63.90  ? 636  CYS A C   1 
ATOM   123  O O   . CYS A 1 36  ? 6.261   19.457  -10.912 1.00 63.12  ? 636  CYS A O   1 
ATOM   124  C CB  . CYS A 1 36  ? 7.898   18.860  -13.865 1.00 63.07  ? 636  CYS A CB  1 
ATOM   125  S SG  . CYS A 1 36  ? 8.767   17.658  -14.908 1.00 66.94  ? 636  CYS A SG  1 
ATOM   126  N N   . SER A 1 37  ? 7.896   20.868  -11.601 1.00 58.89  ? 637  SER A N   1 
ATOM   127  C CA  . SER A 1 37  ? 7.481   22.108  -10.959 1.00 58.12  ? 637  SER A CA  1 
ATOM   128  C C   . SER A 1 37  ? 7.003   23.070  -12.056 1.00 61.87  ? 637  SER A C   1 
ATOM   129  O O   . SER A 1 37  ? 7.515   23.009  -13.180 1.00 61.21  ? 637  SER A O   1 
ATOM   130  C CB  . SER A 1 37  ? 8.674   22.714  -10.225 1.00 60.58  ? 637  SER A CB  1 
ATOM   131  O OG  . SER A 1 37  ? 8.307   23.815  -9.416  1.00 66.73  ? 637  SER A OG  1 
ATOM   132  N N   . GLY A 1 38  ? 6.035   23.932  -11.732 1.00 58.49  ? 638  GLY A N   1 
ATOM   133  C CA  . GLY A 1 38  ? 5.504   24.899  -12.689 1.00 58.32  ? 638  GLY A CA  1 
ATOM   134  C C   . GLY A 1 38  ? 4.481   25.892  -12.175 1.00 62.47  ? 638  GLY A C   1 
ATOM   135  O O   . GLY A 1 38  ? 4.184   25.933  -10.978 1.00 61.82  ? 638  GLY A O   1 
ATOM   136  N N   . HIS A 1 39  ? 3.941   26.710  -13.105 1.00 59.70  ? 639  HIS A N   1 
ATOM   137  C CA  . HIS A 1 39  ? 2.942   27.757  -12.855 1.00 59.72  ? 639  HIS A CA  1 
ATOM   138  C C   . HIS A 1 39  ? 1.621   27.451  -13.569 1.00 63.41  ? 639  HIS A C   1 
ATOM   139  O O   . HIS A 1 39  ? 1.633   26.883  -14.663 1.00 62.71  ? 639  HIS A O   1 
ATOM   140  C CB  . HIS A 1 39  ? 3.467   29.123  -13.326 1.00 60.59  ? 639  HIS A CB  1 
ATOM   141  C CG  . HIS A 1 39  ? 4.750   29.541  -12.684 1.00 64.18  ? 639  HIS A CG  1 
ATOM   142  N ND1 . HIS A 1 39  ? 4.765   30.371  -11.578 1.00 66.05  ? 639  HIS A ND1 1 
ATOM   143  C CD2 . HIS A 1 39  ? 6.026   29.241  -13.025 1.00 66.12  ? 639  HIS A CD2 1 
ATOM   144  C CE1 . HIS A 1 39  ? 6.043   30.550  -11.281 1.00 65.58  ? 639  HIS A CE1 1 
ATOM   145  N NE2 . HIS A 1 39  ? 6.839   29.883  -12.119 1.00 65.93  ? 639  HIS A NE2 1 
ATOM   146  N N   . LEU A 1 40  ? 0.489   27.851  -12.959 1.00 60.19  ? 640  LEU A N   1 
ATOM   147  C CA  . LEU A 1 40  ? -0.849  27.650  -13.515 1.00 60.32  ? 640  LEU A CA  1 
ATOM   148  C C   . LEU A 1 40  ? -1.688  28.927  -13.444 1.00 66.01  ? 640  LEU A C   1 
ATOM   149  O O   . LEU A 1 40  ? -2.047  29.373  -12.351 1.00 65.82  ? 640  LEU A O   1 
ATOM   150  C CB  . LEU A 1 40  ? -1.565  26.474  -12.820 1.00 60.21  ? 640  LEU A CB  1 
ATOM   151  C CG  . LEU A 1 40  ? -2.920  26.037  -13.386 1.00 64.43  ? 640  LEU A CG  1 
ATOM   152  C CD1 . LEU A 1 40  ? -2.754  25.122  -14.585 1.00 64.40  ? 640  LEU A CD1 1 
ATOM   153  C CD2 . LEU A 1 40  ? -3.738  25.339  -12.327 1.00 66.38  ? 640  LEU A CD2 1 
ATOM   154  N N   . LYS A 1 41  ? -2.002  29.504  -14.617 1.00 63.64  ? 641  LYS A N   1 
ATOM   155  C CA  . LYS A 1 41  ? -2.814  30.713  -14.731 1.00 64.01  ? 641  LYS A CA  1 
ATOM   156  C C   . LYS A 1 41  ? -4.014  30.465  -15.644 1.00 69.02  ? 641  LYS A C   1 
ATOM   157  O O   . LYS A 1 41  ? -3.896  30.544  -16.870 1.00 68.83  ? 641  LYS A O   1 
ATOM   158  C CB  . LYS A 1 41  ? -1.973  31.904  -15.215 1.00 66.73  ? 641  LYS A CB  1 
ATOM   159  N N   . LEU A 1 42  ? -5.163  30.135  -15.038 1.00 66.33  ? 642  LEU A N   1 
ATOM   160  C CA  . LEU A 1 42  ? -6.416  29.865  -15.750 1.00 66.45  ? 642  LEU A CA  1 
ATOM   161  C C   . LEU A 1 42  ? -7.138  31.184  -16.094 1.00 71.15  ? 642  LEU A C   1 
ATOM   162  O O   . LEU A 1 42  ? -7.018  32.137  -15.316 1.00 70.69  ? 642  LEU A O   1 
ATOM   163  C CB  . LEU A 1 42  ? -7.334  28.957  -14.900 1.00 66.40  ? 642  LEU A CB  1 
ATOM   164  C CG  . LEU A 1 42  ? -6.839  27.531  -14.610 1.00 70.76  ? 642  LEU A CG  1 
ATOM   165  C CD1 . LEU A 1 42  ? -7.517  26.967  -13.382 1.00 70.82  ? 642  LEU A CD1 1 
ATOM   166  C CD2 . LEU A 1 42  ? -7.059  26.603  -15.800 1.00 72.99  ? 642  LEU A CD2 1 
ATOM   167  N N   . PRO A 1 43  ? -7.884  31.282  -17.232 1.00 68.35  ? 643  PRO A N   1 
ATOM   168  C CA  . PRO A 1 43  ? -8.580  32.546  -17.542 1.00 68.35  ? 643  PRO A CA  1 
ATOM   169  C C   . PRO A 1 43  ? -9.607  32.914  -16.469 1.00 72.59  ? 643  PRO A C   1 
ATOM   170  O O   . PRO A 1 43  ? -10.419 32.079  -16.062 1.00 72.26  ? 643  PRO A O   1 
ATOM   171  C CB  . PRO A 1 43  ? -9.221  32.283  -18.910 1.00 70.10  ? 643  PRO A CB  1 
ATOM   172  C CG  . PRO A 1 43  ? -9.319  30.804  -19.014 1.00 74.51  ? 643  PRO A CG  1 
ATOM   173  C CD  . PRO A 1 43  ? -8.139  30.262  -18.272 1.00 70.02  ? 643  PRO A CD  1 
ATOM   174  N N   . GLY A 1 44  ? -9.507  34.145  -15.980 1.00 69.11  ? 644  GLY A N   1 
ATOM   175  C CA  . GLY A 1 44  ? -10.360 34.646  -14.910 1.00 68.80  ? 644  GLY A CA  1 
ATOM   176  C C   . GLY A 1 44  ? -9.932  34.114  -13.556 1.00 71.96  ? 644  GLY A C   1 
ATOM   177  O O   . GLY A 1 44  ? -10.780 33.820  -12.707 1.00 71.60  ? 644  GLY A O   1 
ATOM   178  N N   . LYS A 1 45  ? -8.595  33.973  -13.361 1.00 67.59  ? 645  LYS A N   1 
ATOM   179  C CA  . LYS A 1 45  ? -7.942  33.484  -12.138 1.00 66.73  ? 645  LYS A CA  1 
ATOM   180  C C   . LYS A 1 45  ? -6.460  33.897  -12.071 1.00 68.70  ? 645  LYS A C   1 
ATOM   181  O O   . LYS A 1 45  ? -5.822  34.104  -13.108 1.00 68.09  ? 645  LYS A O   1 
ATOM   182  C CB  . LYS A 1 45  ? -8.072  31.954  -12.018 1.00 69.24  ? 645  LYS A CB  1 
ATOM   183  N N   . ARG A 1 46  ? -5.923  33.997  -10.839 1.00 63.83  ? 646  ARG A N   1 
ATOM   184  C CA  . ARG A 1 46  ? -4.530  34.355  -10.526 1.00 62.83  ? 646  ARG A CA  1 
ATOM   185  C C   . ARG A 1 46  ? -3.537  33.230  -10.883 1.00 64.33  ? 646  ARG A C   1 
ATOM   186  O O   . ARG A 1 46  ? -3.913  32.053  -10.856 1.00 64.01  ? 646  ARG A O   1 
ATOM   187  C CB  . ARG A 1 46  ? -4.398  34.721  -9.028  1.00 63.31  ? 646  ARG A CB  1 
ATOM   188  C CG  . ARG A 1 46  ? -4.861  33.612  -8.074  1.00 74.85  ? 646  ARG A CG  1 
ATOM   189  C CD  . ARG A 1 46  ? -4.601  33.917  -6.615  1.00 85.75  ? 646  ARG A CD  1 
ATOM   190  N NE  . ARG A 1 46  ? -4.725  32.709  -5.797  1.00 94.45  ? 646  ARG A NE  1 
ATOM   191  C CZ  . ARG A 1 46  ? -5.245  32.673  -4.573  1.00 109.75 ? 646  ARG A CZ  1 
ATOM   192  N NH1 . ARG A 1 46  ? -5.706  33.782  -4.007  1.00 97.11  ? 646  ARG A NH1 1 
ATOM   193  N NH2 . ARG A 1 46  ? -5.313  31.528  -3.909  1.00 97.53  ? 646  ARG A NH2 1 
ATOM   194  N N   . GLU A 1 47  ? -2.269  33.587  -11.186 1.00 58.85  ? 647  GLU A N   1 
ATOM   195  C CA  . GLU A 1 47  ? -1.231  32.596  -11.487 1.00 57.68  ? 647  GLU A CA  1 
ATOM   196  C C   . GLU A 1 47  ? -0.748  31.982  -10.172 1.00 58.68  ? 647  GLU A C   1 
ATOM   197  O O   . GLU A 1 47  ? -0.285  32.703  -9.279  1.00 57.92  ? 647  GLU A O   1 
ATOM   198  C CB  . GLU A 1 47  ? -0.060  33.201  -12.290 1.00 59.14  ? 647  GLU A CB  1 
ATOM   199  C CG  . GLU A 1 47  ? 0.912   32.148  -12.807 1.00 69.62  ? 647  GLU A CG  1 
ATOM   200  C CD  . GLU A 1 47  ? 2.138   32.644  -13.548 1.00 89.56  ? 647  GLU A CD  1 
ATOM   201  O OE1 . GLU A 1 47  ? 2.881   33.480  -12.984 1.00 79.82  ? 647  GLU A OE1 1 
ATOM   202  O OE2 . GLU A 1 47  ? 2.400   32.133  -14.661 1.00 85.49  ? 647  GLU A OE2 1 
ATOM   203  N N   . ILE A 1 48  ? -0.894  30.654  -10.046 1.00 53.21  ? 648  ILE A N   1 
ATOM   204  C CA  . ILE A 1 48  ? -0.515  29.920  -8.834  1.00 51.88  ? 648  ILE A CA  1 
ATOM   205  C C   . ILE A 1 48  ? 0.529   28.832  -9.123  1.00 52.68  ? 648  ILE A C   1 
ATOM   206  O O   . ILE A 1 48  ? 0.463   28.167  -10.162 1.00 52.27  ? 648  ILE A O   1 
ATOM   207  C CB  . ILE A 1 48  ? -1.748  29.377  -8.050  1.00 54.84  ? 648  ILE A CB  1 
ATOM   208  C CG1 . ILE A 1 48  ? -2.661  28.488  -8.923  1.00 55.26  ? 648  ILE A CG1 1 
ATOM   209  C CG2 . ILE A 1 48  ? -2.535  30.517  -7.394  1.00 55.22  ? 648  ILE A CG2 1 
ATOM   210  C CD1 . ILE A 1 48  ? -2.924  27.151  -8.329  1.00 63.44  ? 648  ILE A CD1 1 
ATOM   211  N N   . PHE A 1 49  ? 1.492   28.666  -8.196  1.00 46.69  ? 649  PHE A N   1 
ATOM   212  C CA  . PHE A 1 49  ? 2.580   27.692  -8.288  1.00 45.46  ? 649  PHE A CA  1 
ATOM   213  C C   . PHE A 1 49  ? 2.053   26.282  -8.030  1.00 47.55  ? 649  PHE A C   1 
ATOM   214  O O   . PHE A 1 49  ? 1.425   26.047  -6.995  1.00 47.73  ? 649  PHE A O   1 
ATOM   215  C CB  . PHE A 1 49  ? 3.693   28.053  -7.297  1.00 47.04  ? 649  PHE A CB  1 
ATOM   216  C CG  . PHE A 1 49  ? 5.075   27.672  -7.759  1.00 48.33  ? 649  PHE A CG  1 
ATOM   217  C CD1 . PHE A 1 49  ? 5.569   26.392  -7.543  1.00 49.95  ? 649  PHE A CD1 1 
ATOM   218  C CD2 . PHE A 1 49  ? 5.889   28.595  -8.402  1.00 51.40  ? 649  PHE A CD2 1 
ATOM   219  C CE1 . PHE A 1 49  ? 6.852   26.046  -7.960  1.00 52.82  ? 649  PHE A CE1 1 
ATOM   220  C CE2 . PHE A 1 49  ? 7.172   28.245  -8.826  1.00 52.10  ? 649  PHE A CE2 1 
ATOM   221  C CZ  . PHE A 1 49  ? 7.645   26.972  -8.604  1.00 51.03  ? 649  PHE A CZ  1 
ATOM   222  N N   . VAL A 1 50  ? 2.292   25.352  -8.978  1.00 42.12  ? 650  VAL A N   1 
ATOM   223  C CA  . VAL A 1 50  ? 1.790   23.970  -8.928  1.00 41.17  ? 650  VAL A CA  1 
ATOM   224  C C   . VAL A 1 50  ? 2.854   22.880  -9.129  1.00 43.46  ? 650  VAL A C   1 
ATOM   225  O O   . VAL A 1 50  ? 3.971   23.161  -9.569  1.00 42.63  ? 650  VAL A O   1 
ATOM   226  C CB  . VAL A 1 50  ? 0.623   23.749  -9.930  1.00 45.18  ? 650  VAL A CB  1 
ATOM   227  C CG1 . VAL A 1 50  ? -0.683  24.336  -9.414  1.00 44.96  ? 650  VAL A CG1 1 
ATOM   228  C CG2 . VAL A 1 50  ? 0.963   24.277  -11.324 1.00 45.23  ? 650  VAL A CG2 1 
ATOM   229  N N   . ALA A 1 51  ? 2.458   21.621  -8.835  1.00 39.31  ? 651  ALA A N   1 
ATOM   230  C CA  . ALA A 1 51  ? 3.234   20.395  -9.010  1.00 38.67  ? 651  ALA A CA  1 
ATOM   231  C C   . ALA A 1 51  ? 2.637   19.670  -10.222 1.00 41.92  ? 651  ALA A C   1 
ATOM   232  O O   . ALA A 1 51  ? 1.431   19.396  -10.248 1.00 40.21  ? 651  ALA A O   1 
ATOM   233  C CB  . ALA A 1 51  ? 3.131   19.523  -7.763  1.00 39.19  ? 651  ALA A CB  1 
ATOM   234  N N   . ILE A 1 52  ? 3.467   19.420  -11.251 1.00 39.76  ? 652  ILE A N   1 
ATOM   235  C CA  . ILE A 1 52  ? 3.025   18.782  -12.499 1.00 39.98  ? 652  ILE A CA  1 
ATOM   236  C C   . ILE A 1 52  ? 3.732   17.454  -12.769 1.00 44.43  ? 652  ILE A C   1 
ATOM   237  O O   . ILE A 1 52  ? 4.920   17.451  -13.085 1.00 44.76  ? 652  ILE A O   1 
ATOM   238  C CB  . ILE A 1 52  ? 3.124   19.732  -13.735 1.00 43.13  ? 652  ILE A CB  1 
ATOM   239  C CG1 . ILE A 1 52  ? 2.710   21.181  -13.411 1.00 43.62  ? 652  ILE A CG1 1 
ATOM   240  C CG2 . ILE A 1 52  ? 2.318   19.170  -14.914 1.00 44.01  ? 652  ILE A CG2 1 
ATOM   241  C CD1 . ILE A 1 52  ? 3.483   22.228  -14.169 1.00 52.06  ? 652  ILE A CD1 1 
ATOM   242  N N   . LYS A 1 53  ? 2.993   16.338  -12.699 1.00 40.71  ? 653  LYS A N   1 
ATOM   243  C CA  . LYS A 1 53  ? 3.534   15.012  -13.006 1.00 40.55  ? 653  LYS A CA  1 
ATOM   244  C C   . LYS A 1 53  ? 3.292   14.737  -14.490 1.00 45.39  ? 653  LYS A C   1 
ATOM   245  O O   . LYS A 1 53  ? 2.223   15.071  -15.010 1.00 44.78  ? 653  LYS A O   1 
ATOM   246  C CB  . LYS A 1 53  ? 2.881   13.928  -12.135 1.00 42.90  ? 653  LYS A CB  1 
ATOM   247  N N   . THR A 1 54  ? 4.292   14.152  -15.174 1.00 42.50  ? 654  THR A N   1 
ATOM   248  C CA  . THR A 1 54  ? 4.234   13.834  -16.607 1.00 42.29  ? 654  THR A CA  1 
ATOM   249  C C   . THR A 1 54  ? 4.433   12.337  -16.897 1.00 45.79  ? 654  THR A C   1 
ATOM   250  O O   . THR A 1 54  ? 4.848   11.586  -16.015 1.00 45.18  ? 654  THR A O   1 
ATOM   251  C CB  . THR A 1 54  ? 5.219   14.721  -17.409 1.00 49.78  ? 654  THR A CB  1 
ATOM   252  O OG1 . THR A 1 54  ? 6.496   14.756  -16.763 1.00 48.74  ? 654  THR A OG1 1 
ATOM   253  C CG2 . THR A 1 54  ? 4.695   16.134  -17.621 1.00 47.52  ? 654  THR A CG2 1 
ATOM   254  N N   . LEU A 1 55  ? 4.106   11.912  -18.135 1.00 42.54  ? 655  LEU A N   1 
ATOM   255  C CA  . LEU A 1 55  ? 4.264   10.545  -18.639 1.00 72.85  ? 655  LEU A CA  1 
ATOM   256  C C   . LEU A 1 55  ? 4.389   10.558  -20.164 1.00 104.93 ? 655  LEU A C   1 
ATOM   257  O O   . LEU A 1 55  ? 3.775   11.390  -20.829 1.00 69.19  ? 655  LEU A O   1 
ATOM   258  C CB  . LEU A 1 55  ? 3.112   9.625   -18.177 1.00 72.93  ? 655  LEU A CB  1 
ATOM   259  C CG  . LEU A 1 55  ? 3.087   8.184   -18.723 1.00 77.71  ? 655  LEU A CG  1 
ATOM   260  C CD1 . LEU A 1 55  ? 4.267   7.356   -18.216 1.00 77.81  ? 655  LEU A CD1 1 
ATOM   261  C CD2 . LEU A 1 55  ? 1.787   7.497   -18.377 1.00 80.31  ? 655  LEU A CD2 1 
ATOM   262  N N   . THR A 1 60  ? 2.146   2.863   -23.946 1.00 83.02  ? 660  THR A N   1 
ATOM   263  C CA  . THR A 1 60  ? 1.504   1.894   -23.058 1.00 82.82  ? 660  THR A CA  1 
ATOM   264  C C   . THR A 1 60  ? 0.071   2.317   -22.731 1.00 86.95  ? 660  THR A C   1 
ATOM   265  O O   . THR A 1 60  ? -0.144  3.408   -22.196 1.00 86.62  ? 660  THR A O   1 
ATOM   266  C CB  . THR A 1 60  ? 2.363   1.626   -21.807 1.00 89.29  ? 660  THR A CB  1 
ATOM   267  O OG1 . THR A 1 60  ? 2.793   2.869   -21.249 1.00 87.78  ? 660  THR A OG1 1 
ATOM   268  C CG2 . THR A 1 60  ? 3.572   0.755   -22.105 1.00 87.89  ? 660  THR A CG2 1 
ATOM   269  N N   . GLU A 1 61  ? -0.907  1.461   -23.083 1.00 83.46  ? 661  GLU A N   1 
ATOM   270  C CA  . GLU A 1 61  ? -2.334  1.709   -22.859 1.00 83.14  ? 661  GLU A CA  1 
ATOM   271  C C   . GLU A 1 61  ? -2.745  1.459   -21.406 1.00 86.65  ? 661  GLU A C   1 
ATOM   272  O O   . GLU A 1 61  ? -3.491  2.263   -20.844 1.00 86.25  ? 661  GLU A O   1 
ATOM   273  C CB  . GLU A 1 61  ? -3.195  0.876   -23.823 1.00 84.48  ? 661  GLU A CB  1 
ATOM   274  N N   . LYS A 1 62  ? -2.261  0.349   -20.805 1.00 82.95  ? 662  LYS A N   1 
ATOM   275  C CA  . LYS A 1 62  ? -2.554  -0.035  -19.417 1.00 82.65  ? 662  LYS A CA  1 
ATOM   276  C C   . LYS A 1 62  ? -1.911  0.912   -18.383 1.00 86.17  ? 662  LYS A C   1 
ATOM   277  O O   . LYS A 1 62  ? -2.508  1.150   -17.333 1.00 85.82  ? 662  LYS A O   1 
ATOM   278  C CB  . LYS A 1 62  ? -2.201  -1.515  -19.139 1.00 85.11  ? 662  LYS A CB  1 
ATOM   279  C CG  . LYS A 1 62  ? -0.758  -1.920  -19.441 1.00 99.24  ? 662  LYS A CG  1 
ATOM   280  N N   . GLN A 1 63  ? -0.715  1.460   -18.692 1.00 82.13  ? 663  GLN A N   1 
ATOM   281  C CA  . GLN A 1 63  ? 0.011   2.394   -17.825 1.00 81.65  ? 663  GLN A CA  1 
ATOM   282  C C   . GLN A 1 63  ? -0.577  3.812   -17.875 1.00 84.40  ? 663  GLN A C   1 
ATOM   283  O O   . GLN A 1 63  ? -0.471  4.548   -16.892 1.00 84.06  ? 663  GLN A O   1 
ATOM   284  C CB  . GLN A 1 63  ? 1.506   2.411   -18.167 1.00 83.07  ? 663  GLN A CB  1 
ATOM   285  N N   . ARG A 1 64  ? -1.190  4.190   -19.019 1.00 79.89  ? 664  ARG A N   1 
ATOM   286  C CA  . ARG A 1 64  ? -1.852  5.484   -19.215 1.00 79.12  ? 664  ARG A CA  1 
ATOM   287  C C   . ARG A 1 64  ? -3.169  5.483   -18.432 1.00 81.48  ? 664  ARG A C   1 
ATOM   288  O O   . ARG A 1 64  ? -3.579  6.525   -17.918 1.00 80.95  ? 664  ARG A O   1 
ATOM   289  C CB  . ARG A 1 64  ? -2.117  5.744   -20.711 1.00 79.23  ? 664  ARG A CB  1 
ATOM   290  C CG  . ARG A 1 64  ? -2.446  7.199   -21.038 1.00 88.05  ? 664  ARG A CG  1 
ATOM   291  C CD  . ARG A 1 64  ? -2.927  7.366   -22.465 1.00 95.07  ? 664  ARG A CD  1 
ATOM   292  N NE  . ARG A 1 64  ? -3.213  8.767   -22.783 1.00 100.52 ? 664  ARG A NE  1 
ATOM   293  C CZ  . ARG A 1 64  ? -4.406  9.342   -22.655 1.00 112.52 ? 664  ARG A CZ  1 
ATOM   294  N NH1 . ARG A 1 64  ? -5.444  8.642   -22.213 1.00 99.30  ? 664  ARG A NH1 1 
ATOM   295  N NH2 . ARG A 1 64  ? -4.569  10.620  -22.970 1.00 97.36  ? 664  ARG A NH2 1 
ATOM   296  N N   . ARG A 1 65  ? -3.818  4.302   -18.346 1.00 76.98  ? 665  ARG A N   1 
ATOM   297  C CA  . ARG A 1 65  ? -5.064  4.075   -17.615 1.00 76.15  ? 665  ARG A CA  1 
ATOM   298  C C   . ARG A 1 65  ? -4.816  4.124   -16.107 1.00 78.55  ? 665  ARG A C   1 
ATOM   299  O O   . ARG A 1 65  ? -5.696  4.565   -15.370 1.00 78.22  ? 665  ARG A O   1 
ATOM   300  C CB  . ARG A 1 65  ? -5.683  2.727   -18.009 1.00 76.31  ? 665  ARG A CB  1 
ATOM   301  N N   . ASP A 1 66  ? -3.620  3.677   -15.656 1.00 73.77  ? 666  ASP A N   1 
ATOM   302  C CA  . ASP A 1 66  ? -3.205  3.659   -14.248 1.00 72.94  ? 666  ASP A CA  1 
ATOM   303  C C   . ASP A 1 66  ? -2.750  5.033   -13.756 1.00 74.52  ? 666  ASP A C   1 
ATOM   304  O O   . ASP A 1 66  ? -2.972  5.365   -12.590 1.00 74.05  ? 666  ASP A O   1 
ATOM   305  C CB  . ASP A 1 66  ? -2.079  2.633   -14.022 1.00 74.93  ? 666  ASP A CB  1 
ATOM   306  C CG  . ASP A 1 66  ? -2.477  1.179   -14.178 1.00 86.92  ? 666  ASP A CG  1 
ATOM   307  O OD1 . ASP A 1 66  ? -3.640  0.841   -13.861 1.00 88.08  ? 666  ASP A OD1 1 
ATOM   308  O OD2 . ASP A 1 66  ? -1.612  0.368   -14.575 1.00 93.44  ? 666  ASP A OD2 1 
ATOM   309  N N   . PHE A 1 67  ? -2.079  5.808   -14.633 1.00 69.19  ? 667  PHE A N   1 
ATOM   310  C CA  . PHE A 1 67  ? -1.569  7.150   -14.345 1.00 68.08  ? 667  PHE A CA  1 
ATOM   311  C C   . PHE A 1 67  ? -2.732  8.106   -14.091 1.00 70.06  ? 667  PHE A C   1 
ATOM   312  O O   . PHE A 1 67  ? -2.773  8.745   -13.040 1.00 69.89  ? 667  PHE A O   1 
ATOM   313  C CB  . PHE A 1 67  ? -0.680  7.635   -15.510 1.00 69.81  ? 667  PHE A CB  1 
ATOM   314  C CG  . PHE A 1 67  ? 0.011   8.974   -15.362 1.00 71.23  ? 667  PHE A CG  1 
ATOM   315  C CD1 . PHE A 1 67  ? 1.122   9.115   -14.539 1.00 74.15  ? 667  PHE A CD1 1 
ATOM   316  C CD2 . PHE A 1 67  ? -0.390  10.070  -16.121 1.00 73.20  ? 667  PHE A CD2 1 
ATOM   317  C CE1 . PHE A 1 67  ? 1.781   10.346  -14.429 1.00 74.97  ? 667  PHE A CE1 1 
ATOM   318  C CE2 . PHE A 1 67  ? 0.273   11.298  -16.014 1.00 75.85  ? 667  PHE A CE2 1 
ATOM   319  C CZ  . PHE A 1 67  ? 1.352   11.428  -15.167 1.00 73.92  ? 667  PHE A CZ  1 
ATOM   320  N N   . LEU A 1 68  ? -3.708  8.142   -15.018 1.00 64.97  ? 668  LEU A N   1 
ATOM   321  C CA  . LEU A 1 68  ? -4.891  9.005   -14.952 1.00 63.87  ? 668  LEU A CA  1 
ATOM   322  C C   . LEU A 1 68  ? -5.922  8.588   -13.893 1.00 65.56  ? 668  LEU A C   1 
ATOM   323  O O   . LEU A 1 68  ? -6.717  9.433   -13.472 1.00 64.90  ? 668  LEU A O   1 
ATOM   324  C CB  . LEU A 1 68  ? -5.555  9.131   -16.338 1.00 63.84  ? 668  LEU A CB  1 
ATOM   325  C CG  . LEU A 1 68  ? -4.713  9.779   -17.448 1.00 68.56  ? 668  LEU A CG  1 
ATOM   326  C CD1 . LEU A 1 68  ? -5.291  9.476   -18.807 1.00 68.84  ? 668  LEU A CD1 1 
ATOM   327  C CD2 . LEU A 1 68  ? -4.583  11.288  -17.255 1.00 70.72  ? 668  LEU A CD2 1 
ATOM   328  N N   . SER A 1 69  ? -5.911  7.302   -13.462 1.00 60.61  ? 669  SER A N   1 
ATOM   329  C CA  . SER A 1 69  ? -6.835  6.768   -12.449 1.00 59.61  ? 669  SER A CA  1 
ATOM   330  C C   . SER A 1 69  ? -6.590  7.361   -11.065 1.00 61.35  ? 669  SER A C   1 
ATOM   331  O O   . SER A 1 69  ? -7.537  7.466   -10.284 1.00 61.29  ? 669  SER A O   1 
ATOM   332  C CB  . SER A 1 69  ? -6.766  5.244   -12.382 1.00 63.19  ? 669  SER A CB  1 
ATOM   333  O OG  . SER A 1 69  ? -5.520  4.783   -11.884 1.00 71.31  ? 669  SER A OG  1 
ATOM   334  N N   . GLU A 1 70  ? -5.322  7.737   -10.764 1.00 55.65  ? 670  GLU A N   1 
ATOM   335  C CA  . GLU A 1 70  ? -4.918  8.356   -9.497  1.00 54.54  ? 670  GLU A CA  1 
ATOM   336  C C   . GLU A 1 70  ? -5.651  9.685   -9.336  1.00 55.27  ? 670  GLU A C   1 
ATOM   337  O O   . GLU A 1 70  ? -6.217  9.939   -8.275  1.00 54.29  ? 670  GLU A O   1 
ATOM   338  C CB  . GLU A 1 70  ? -3.391  8.574   -9.447  1.00 56.11  ? 670  GLU A CB  1 
ATOM   339  C CG  . GLU A 1 70  ? -2.857  8.850   -8.046  1.00 67.12  ? 670  GLU A CG  1 
ATOM   340  C CD  . GLU A 1 70  ? -1.668  9.788   -7.926  1.00 87.16  ? 670  GLU A CD  1 
ATOM   341  O OE1 . GLU A 1 70  ? -1.426  10.586  -8.861  1.00 79.21  ? 670  GLU A OE1 1 
ATOM   342  O OE2 . GLU A 1 70  ? -1.006  9.755   -6.863  1.00 80.36  ? 670  GLU A OE2 1 
ATOM   343  N N   . ALA A 1 71  ? -5.687  10.496  -10.416 1.00 50.23  ? 671  ALA A N   1 
ATOM   344  C CA  . ALA A 1 71  ? -6.361  11.796  -10.472 1.00 49.02  ? 671  ALA A CA  1 
ATOM   345  C C   . ALA A 1 71  ? -7.894  11.669  -10.457 1.00 50.17  ? 671  ALA A C   1 
ATOM   346  O O   . ALA A 1 71  ? -8.574  12.617  -10.062 1.00 49.73  ? 671  ALA A O   1 
ATOM   347  C CB  . ALA A 1 71  ? -5.902  12.567  -11.698 1.00 49.71  ? 671  ALA A CB  1 
ATOM   348  N N   . SER A 1 72  ? -8.432  10.505  -10.879 1.00 44.82  ? 672  SER A N   1 
ATOM   349  C CA  . SER A 1 72  ? -9.872  10.227  -10.888 1.00 43.74  ? 672  SER A CA  1 
ATOM   350  C C   . SER A 1 72  ? -10.380 10.052  -9.454  1.00 44.48  ? 672  SER A C   1 
ATOM   351  O O   . SER A 1 72  ? -11.453 10.547  -9.120  1.00 44.13  ? 672  SER A O   1 
ATOM   352  C CB  . SER A 1 72  ? -10.178 8.986   -11.723 1.00 47.85  ? 672  SER A CB  1 
ATOM   353  O OG  . SER A 1 72  ? -11.575 8.749   -11.809 1.00 57.53  ? 672  SER A OG  1 
ATOM   354  N N   . ILE A 1 73  ? -9.593  9.356   -8.616  1.00 38.82  ? 673  ILE A N   1 
ATOM   355  C CA  . ILE A 1 73  ? -9.856  9.116   -7.194  1.00 37.69  ? 673  ILE A CA  1 
ATOM   356  C C   . ILE A 1 73  ? -9.635  10.451  -6.445  1.00 38.97  ? 673  ILE A C   1 
ATOM   357  O O   . ILE A 1 73  ? -10.490 10.872  -5.667  1.00 37.62  ? 673  ILE A O   1 
ATOM   358  C CB  . ILE A 1 73  ? -8.927  7.964   -6.666  1.00 40.70  ? 673  ILE A CB  1 
ATOM   359  C CG1 . ILE A 1 73  ? -9.238  6.613   -7.371  1.00 41.02  ? 673  ILE A CG1 1 
ATOM   360  C CG2 . ILE A 1 73  ? -9.000  7.827   -5.138  1.00 41.04  ? 673  ILE A CG2 1 
ATOM   361  C CD1 . ILE A 1 73  ? -8.048  5.633   -7.500  1.00 48.53  ? 673  ILE A CD1 1 
ATOM   362  N N   . MET A 1 74  ? -8.487  11.110  -6.720  1.00 34.63  ? 674  MET A N   1 
ATOM   363  C CA  . MET A 1 74  ? -8.045  12.392  -6.158  1.00 33.81  ? 674  MET A CA  1 
ATOM   364  C C   . MET A 1 74  ? -9.022  13.538  -6.416  1.00 34.40  ? 674  MET A C   1 
ATOM   365  O O   . MET A 1 74  ? -9.169  14.415  -5.564  1.00 34.01  ? 674  MET A O   1 
ATOM   366  C CB  . MET A 1 74  ? -6.698  12.775  -6.770  1.00 36.38  ? 674  MET A CB  1 
ATOM   367  C CG  . MET A 1 74  ? -5.550  12.655  -5.831  1.00 40.41  ? 674  MET A CG  1 
ATOM   368  S SD  . MET A 1 74  ? -4.099  13.501  -6.491  1.00 45.06  ? 674  MET A SD  1 
ATOM   369  C CE  . MET A 1 74  ? -4.583  15.126  -6.276  1.00 41.77  ? 674  MET A CE  1 
ATOM   370  N N   . GLY A 1 75  ? -9.633  13.538  -7.602  1.00 28.42  ? 675  GLY A N   1 
ATOM   371  C CA  . GLY A 1 75  ? -10.582 14.555  -8.048  1.00 26.82  ? 675  GLY A CA  1 
ATOM   372  C C   . GLY A 1 75  ? -11.900 14.526  -7.308  1.00 27.27  ? 675  GLY A C   1 
ATOM   373  O O   . GLY A 1 75  ? -12.646 15.506  -7.338  1.00 26.79  ? 675  GLY A O   1 
ATOM   374  N N   . GLN A 1 76  ? -12.179 13.406  -6.616  1.00 22.08  ? 676  GLN A N   1 
ATOM   375  C CA  . GLN A 1 76  ? -13.388 13.195  -5.816  1.00 20.95  ? 676  GLN A CA  1 
ATOM   376  C C   . GLN A 1 76  ? -13.237 13.784  -4.408  1.00 22.35  ? 676  GLN A C   1 
ATOM   377  O O   . GLN A 1 76  ? -14.214 13.816  -3.655  1.00 21.39  ? 676  GLN A O   1 
ATOM   378  C CB  . GLN A 1 76  ? -13.726 11.692  -5.740  1.00 22.17  ? 676  GLN A CB  1 
ATOM   379  C CG  . GLN A 1 76  ? -14.141 11.076  -7.086  1.00 31.11  ? 676  GLN A CG  1 
ATOM   380  C CD  . GLN A 1 76  ? -14.472 9.604   -7.010  1.00 49.28  ? 676  GLN A CD  1 
ATOM   381  O OE1 . GLN A 1 76  ? -14.768 9.048   -5.944  1.00 43.79  ? 676  GLN A OE1 1 
ATOM   382  N NE2 . GLN A 1 76  ? -14.471 8.944   -8.158  1.00 41.75  ? 676  GLN A NE2 1 
ATOM   383  N N   . PHE A 1 77  ? -12.025 14.274  -4.061  1.00 18.03  ? 677  PHE A N   1 
ATOM   384  C CA  . PHE A 1 77  ? -11.734 14.820  -2.731  1.00 17.52  ? 677  PHE A CA  1 
ATOM   385  C C   . PHE A 1 77  ? -11.498 16.333  -2.711  1.00 20.87  ? 677  PHE A C   1 
ATOM   386  O O   . PHE A 1 77  ? -10.845 16.878  -3.599  1.00 21.27  ? 677  PHE A O   1 
ATOM   387  C CB  . PHE A 1 77  ? -10.568 14.057  -2.081  1.00 19.08  ? 677  PHE A CB  1 
ATOM   388  C CG  . PHE A 1 77  ? -10.750 12.551  -2.018  1.00 20.63  ? 677  PHE A CG  1 
ATOM   389  C CD1 . PHE A 1 77  ? -11.897 11.990  -1.455  1.00 24.23  ? 677  PHE A CD1 1 
ATOM   390  C CD2 . PHE A 1 77  ? -9.759  11.694  -2.485  1.00 23.11  ? 677  PHE A CD2 1 
ATOM   391  C CE1 . PHE A 1 77  ? -12.063 10.600  -1.398  1.00 25.35  ? 677  PHE A CE1 1 
ATOM   392  C CE2 . PHE A 1 77  ? -9.920  10.301  -2.418  1.00 26.07  ? 677  PHE A CE2 1 
ATOM   393  C CZ  . PHE A 1 77  ? -11.069 9.764   -1.876  1.00 24.46  ? 677  PHE A CZ  1 
ATOM   394  N N   . ASP A 1 78  ? -12.063 17.002  -1.692  1.00 17.02  ? 678  ASP A N   1 
ATOM   395  C CA  . ASP A 1 78  ? -11.980 18.447  -1.445  1.00 16.17  ? 678  ASP A CA  1 
ATOM   396  C C   . ASP A 1 78  ? -11.741 18.684  0.059   1.00 16.50  ? 678  ASP A C   1 
ATOM   397  O O   . ASP A 1 78  ? -12.679 18.979  0.806   1.00 16.32  ? 678  ASP A O   1 
ATOM   398  C CB  . ASP A 1 78  ? -13.264 19.157  -1.961  1.00 18.43  ? 678  ASP A CB  1 
ATOM   399  C CG  . ASP A 1 78  ? -13.376 20.667  -1.758  1.00 27.74  ? 678  ASP A CG  1 
ATOM   400  O OD1 . ASP A 1 78  ? -12.335 21.318  -1.478  1.00 27.68  ? 678  ASP A OD1 1 
ATOM   401  O OD2 . ASP A 1 78  ? -14.504 21.198  -1.881  1.00 33.98  ? 678  ASP A OD2 1 
ATOM   402  N N   . HIS A 1 79  ? -10.478 18.528  0.507   1.00 10.80  ? 679  HIS A N   1 
ATOM   403  C CA  . HIS A 1 79  ? -10.135 18.716  1.921   1.00 9.85   ? 679  HIS A CA  1 
ATOM   404  C C   . HIS A 1 79  ? -8.769  19.382  2.118   1.00 13.18  ? 679  HIS A C   1 
ATOM   405  O O   . HIS A 1 79  ? -7.829  19.030  1.407   1.00 12.20  ? 679  HIS A O   1 
ATOM   406  C CB  . HIS A 1 79  ? -10.218 17.383  2.685   1.00 9.87   ? 679  HIS A CB  1 
ATOM   407  C CG  . HIS A 1 79  ? -10.133 17.512  4.175   1.00 12.76  ? 679  HIS A CG  1 
ATOM   408  N ND1 . HIS A 1 79  ? -8.912  17.552  4.828   1.00 14.11  ? 679  HIS A ND1 1 
ATOM   409  C CD2 . HIS A 1 79  ? -11.124 17.574  5.097   1.00 13.50  ? 679  HIS A CD2 1 
ATOM   410  C CE1 . HIS A 1 79  ? -9.201  17.650  6.117   1.00 12.93  ? 679  HIS A CE1 1 
ATOM   411  N NE2 . HIS A 1 79  ? -10.520 17.654  6.325   1.00 12.95  ? 679  HIS A NE2 1 
ATOM   412  N N   . PRO A 1 80  ? -8.613  20.284  3.121   1.00 10.25  ? 680  PRO A N   1 
ATOM   413  C CA  . PRO A 1 80  ? -7.295  20.918  3.345   1.00 10.19  ? 680  PRO A CA  1 
ATOM   414  C C   . PRO A 1 80  ? -6.128  19.965  3.666   1.00 13.04  ? 680  PRO A C   1 
ATOM   415  O O   . PRO A 1 80  ? -4.977  20.388  3.579   1.00 11.51  ? 680  PRO A O   1 
ATOM   416  C CB  . PRO A 1 80  ? -7.562  21.905  4.493   1.00 12.03  ? 680  PRO A CB  1 
ATOM   417  C CG  . PRO A 1 80  ? -8.806  21.401  5.159   1.00 16.80  ? 680  PRO A CG  1 
ATOM   418  C CD  . PRO A 1 80  ? -9.631  20.842  4.038   1.00 12.36  ? 680  PRO A CD  1 
ATOM   419  N N   . ASN A 1 81  ? -6.406  18.683  4.011   1.00 9.51   ? 681  ASN A N   1 
ATOM   420  C CA  . ASN A 1 81  ? -5.341  17.710  4.322   1.00 7.94   ? 681  ASN A CA  1 
ATOM   421  C C   . ASN A 1 81  ? -5.273  16.534  3.357   1.00 6.58   ? 681  ASN A C   1 
ATOM   422  O O   . ASN A 1 81  ? -4.754  15.470  3.685   1.00 3.00   ? 681  ASN A O   1 
ATOM   423  C CB  . ASN A 1 81  ? -5.414  17.232  5.755   1.00 8.04   ? 681  ASN A CB  1 
ATOM   424  C CG  . ASN A 1 81  ? -5.363  18.337  6.755   1.00 19.89  ? 681  ASN A CG  1 
ATOM   425  O OD1 . ASN A 1 81  ? -6.394  18.750  7.276   1.00 14.59  ? 681  ASN A OD1 1 
ATOM   426  N ND2 . ASN A 1 81  ? -4.168  18.816  7.063   1.00 13.52  ? 681  ASN A ND2 1 
ATOM   427  N N   . VAL A 1 82  ? -5.798  16.736  2.162   1.00 5.51   ? 682  VAL A N   1 
ATOM   428  C CA  . VAL A 1 82  ? -5.761  15.773  1.061   1.00 6.15   ? 682  VAL A CA  1 
ATOM   429  C C   . VAL A 1 82  ? -5.260  16.624  -0.099  1.00 10.06  ? 682  VAL A C   1 
ATOM   430  O O   . VAL A 1 82  ? -5.765  17.734  -0.278  1.00 9.33   ? 682  VAL A O   1 
ATOM   431  C CB  . VAL A 1 82  ? -7.149  15.129  0.766   1.00 11.32  ? 682  VAL A CB  1 
ATOM   432  C CG1 . VAL A 1 82  ? -7.059  14.131  -0.381  1.00 11.64  ? 682  VAL A CG1 1 
ATOM   433  C CG2 . VAL A 1 82  ? -7.748  14.457  2.004   1.00 11.12  ? 682  VAL A CG2 1 
ATOM   434  N N   . ILE A 1 83  ? -4.229  16.157  -0.832  1.00 8.68   ? 683  ILE A N   1 
ATOM   435  C CA  . ILE A 1 83  ? -3.663  16.892  -1.979  1.00 9.14   ? 683  ILE A CA  1 
ATOM   436  C C   . ILE A 1 83  ? -4.765  17.230  -2.988  1.00 15.50  ? 683  ILE A C   1 
ATOM   437  O O   . ILE A 1 83  ? -5.543  16.358  -3.380  1.00 14.95  ? 683  ILE A O   1 
ATOM   438  C CB  . ILE A 1 83  ? -2.406  16.193  -2.609  1.00 11.78  ? 683  ILE A CB  1 
ATOM   439  C CG1 . ILE A 1 83  ? -1.147  16.574  -1.811  1.00 11.95  ? 683  ILE A CG1 1 
ATOM   440  C CG2 . ILE A 1 83  ? -2.171  16.601  -4.078  1.00 11.29  ? 683  ILE A CG2 1 
ATOM   441  C CD1 . ILE A 1 83  ? -0.819  15.703  -0.726  1.00 20.73  ? 683  ILE A CD1 1 
ATOM   442  N N   . HIS A 1 84  ? -4.880  18.529  -3.306  1.00 15.40  ? 684  HIS A N   1 
ATOM   443  C CA  . HIS A 1 84  ? -5.873  19.081  -4.220  1.00 16.91  ? 684  HIS A CA  1 
ATOM   444  C C   . HIS A 1 84  ? -5.420  18.905  -5.644  1.00 23.49  ? 684  HIS A C   1 
ATOM   445  O O   . HIS A 1 84  ? -4.265  19.189  -5.973  1.00 23.20  ? 684  HIS A O   1 
ATOM   446  C CB  . HIS A 1 84  ? -6.129  20.568  -3.928  1.00 17.89  ? 684  HIS A CB  1 
ATOM   447  C CG  . HIS A 1 84  ? -7.296  21.142  -4.680  1.00 21.69  ? 684  HIS A CG  1 
ATOM   448  N ND1 . HIS A 1 84  ? -7.121  21.841  -5.864  1.00 23.87  ? 684  HIS A ND1 1 
ATOM   449  C CD2 . HIS A 1 84  ? -8.616  21.111  -4.384  1.00 23.72  ? 684  HIS A CD2 1 
ATOM   450  C CE1 . HIS A 1 84  ? -8.334  22.193  -6.258  1.00 23.36  ? 684  HIS A CE1 1 
ATOM   451  N NE2 . HIS A 1 84  ? -9.265  21.789  -5.391  1.00 23.75  ? 684  HIS A NE2 1 
ATOM   452  N N   . LEU A 1 85  ? -6.330  18.420  -6.488  1.00 22.46  ? 685  LEU A N   1 
ATOM   453  C CA  . LEU A 1 85  ? -6.073  18.251  -7.911  1.00 23.04  ? 685  LEU A CA  1 
ATOM   454  C C   . LEU A 1 85  ? -6.618  19.486  -8.617  1.00 28.30  ? 685  LEU A C   1 
ATOM   455  O O   . LEU A 1 85  ? -7.832  19.719  -8.601  1.00 26.94  ? 685  LEU A O   1 
ATOM   456  C CB  . LEU A 1 85  ? -6.748  16.971  -8.456  1.00 23.15  ? 685  LEU A CB  1 
ATOM   457  C CG  . LEU A 1 85  ? -6.533  16.657  -9.946  1.00 27.52  ? 685  LEU A CG  1 
ATOM   458  C CD1 . LEU A 1 85  ? -5.195  15.994  -10.191 1.00 27.28  ? 685  LEU A CD1 1 
ATOM   459  C CD2 . LEU A 1 85  ? -7.647  15.791  -10.476 1.00 30.65  ? 685  LEU A CD2 1 
ATOM   460  N N   . GLU A 1 86  ? -5.715  20.293  -9.205  1.00 27.21  ? 686  GLU A N   1 
ATOM   461  C CA  . GLU A 1 86  ? -6.087  21.476  -9.982  1.00 28.22  ? 686  GLU A CA  1 
ATOM   462  C C   . GLU A 1 86  ? -6.738  21.015  -11.296 1.00 34.84  ? 686  GLU A C   1 
ATOM   463  O O   . GLU A 1 86  ? -7.691  21.645  -11.768 1.00 34.76  ? 686  GLU A O   1 
ATOM   464  C CB  . GLU A 1 86  ? -4.871  22.373  -10.258 1.00 29.59  ? 686  GLU A CB  1 
ATOM   465  C CG  . GLU A 1 86  ? -4.232  22.987  -9.020  1.00 39.27  ? 686  GLU A CG  1 
ATOM   466  C CD  . GLU A 1 86  ? -5.103  23.913  -8.191  1.00 63.23  ? 686  GLU A CD  1 
ATOM   467  O OE1 . GLU A 1 86  ? -5.849  24.728  -8.780  1.00 61.47  ? 686  GLU A OE1 1 
ATOM   468  O OE2 . GLU A 1 86  ? -5.022  23.835  -6.944  1.00 61.37  ? 686  GLU A OE2 1 
ATOM   469  N N   . GLY A 1 87  ? -6.249  19.892  -11.832 1.00 32.82  ? 687  GLY A N   1 
ATOM   470  C CA  . GLY A 1 87  ? -6.776  19.285  -13.047 1.00 33.48  ? 687  GLY A CA  1 
ATOM   471  C C   . GLY A 1 87  ? -5.875  18.282  -13.733 1.00 39.94  ? 687  GLY A C   1 
ATOM   472  O O   . GLY A 1 87  ? -4.881  17.814  -13.165 1.00 38.87  ? 687  GLY A O   1 
ATOM   473  N N   . VAL A 1 88  ? -6.246  17.947  -14.982 1.00 38.93  ? 688  VAL A N   1 
ATOM   474  C CA  . VAL A 1 88  ? -5.585  16.971  -15.844 1.00 39.63  ? 688  VAL A CA  1 
ATOM   475  C C   . VAL A 1 88  ? -5.582  17.439  -17.324 1.00 45.25  ? 688  VAL A C   1 
ATOM   476  O O   . VAL A 1 88  ? -6.560  18.041  -17.785 1.00 44.17  ? 688  VAL A O   1 
ATOM   477  C CB  . VAL A 1 88  ? -6.234  15.567  -15.613 1.00 43.57  ? 688  VAL A CB  1 
ATOM   478  C CG1 . VAL A 1 88  ? -6.566  14.830  -16.911 1.00 43.52  ? 688  VAL A CG1 1 
ATOM   479  C CG2 . VAL A 1 88  ? -5.375  14.707  -14.698 1.00 43.44  ? 688  VAL A CG2 1 
ATOM   480  N N   . VAL A 1 89  ? -4.468  17.182  -18.047 1.00 43.59  ? 689  VAL A N   1 
ATOM   481  C CA  . VAL A 1 89  ? -4.324  17.506  -19.475 1.00 44.15  ? 689  VAL A CA  1 
ATOM   482  C C   . VAL A 1 89  ? -4.174  16.187  -20.251 1.00 49.64  ? 689  VAL A C   1 
ATOM   483  O O   . VAL A 1 89  ? -3.168  15.486  -20.102 1.00 48.41  ? 689  VAL A O   1 
ATOM   484  C CB  . VAL A 1 89  ? -3.198  18.533  -19.799 1.00 47.98  ? 689  VAL A CB  1 
ATOM   485  C CG1 . VAL A 1 89  ? -3.307  19.022  -21.241 1.00 47.75  ? 689  VAL A CG1 1 
ATOM   486  C CG2 . VAL A 1 89  ? -3.232  19.719  -18.842 1.00 47.67  ? 689  VAL A CG2 1 
ATOM   487  N N   . THR A 1 90  ? -5.204  15.848  -21.054 1.00 48.55  ? 690  THR A N   1 
ATOM   488  C CA  . THR A 1 90  ? -5.297  14.607  -21.843 1.00 49.26  ? 690  THR A CA  1 
ATOM   489  C C   . THR A 1 90  ? -5.271  14.801  -23.372 1.00 54.59  ? 690  THR A C   1 
ATOM   490  O O   . THR A 1 90  ? -4.688  13.972  -24.080 1.00 53.67  ? 690  THR A O   1 
ATOM   491  C CB  . THR A 1 90  ? -6.546  13.813  -21.427 1.00 57.69  ? 690  THR A CB  1 
ATOM   492  O OG1 . THR A 1 90  ? -7.633  14.716  -21.183 1.00 55.09  ? 690  THR A OG1 1 
ATOM   493  C CG2 . THR A 1 90  ? -6.301  12.937  -20.207 1.00 57.07  ? 690  THR A CG2 1 
ATOM   494  N N   . LYS A 1 91  ? -5.923  15.877  -23.873 1.00 52.53  ? 691  LYS A N   1 
ATOM   495  C CA  . LYS A 1 91  ? -6.041  16.212  -25.300 1.00 52.62  ? 691  LYS A CA  1 
ATOM   496  C C   . LYS A 1 91  ? -4.707  16.537  -25.991 1.00 56.39  ? 691  LYS A C   1 
ATOM   497  O O   . LYS A 1 91  ? -4.649  16.538  -27.225 1.00 56.07  ? 691  LYS A O   1 
ATOM   498  C CB  . LYS A 1 91  ? -7.055  17.351  -25.508 1.00 55.30  ? 691  LYS A CB  1 
ATOM   499  N N   . SER A 1 92  ? -3.644  16.798  -25.204 1.00 52.78  ? 692  SER A N   1 
ATOM   500  C CA  . SER A 1 92  ? -2.310  17.118  -25.712 1.00 52.64  ? 692  SER A CA  1 
ATOM   501  C C   . SER A 1 92  ? -1.230  16.176  -25.157 1.00 56.32  ? 692  SER A C   1 
ATOM   502  O O   . SER A 1 92  ? -1.488  15.421  -24.215 1.00 55.24  ? 692  SER A O   1 
ATOM   503  C CB  . SER A 1 92  ? -1.959  18.571  -25.397 1.00 56.49  ? 692  SER A CB  1 
ATOM   504  O OG  . SER A 1 92  ? -1.632  18.742  -24.028 1.00 65.70  ? 692  SER A OG  1 
ATOM   505  N N   . THR A 1 93  ? -0.018  16.239  -25.742 1.00 53.54  ? 693  THR A N   1 
ATOM   506  C CA  . THR A 1 93  ? 1.137   15.450  -25.312 1.00 53.52  ? 693  THR A CA  1 
ATOM   507  C C   . THR A 1 93  ? 2.212   16.361  -24.670 1.00 57.19  ? 693  THR A C   1 
ATOM   508  O O   . THR A 1 93  ? 2.524   17.411  -25.239 1.00 56.51  ? 693  THR A O   1 
ATOM   509  C CB  . THR A 1 93  ? 1.672   14.537  -26.442 1.00 62.65  ? 693  THR A CB  1 
ATOM   510  O OG1 . THR A 1 93  ? 2.715   13.715  -25.917 1.00 61.70  ? 693  THR A OG1 1 
ATOM   511  C CG2 . THR A 1 93  ? 2.180   15.311  -27.671 1.00 62.34  ? 693  THR A CG2 1 
ATOM   512  N N   . PRO A 1 94  ? 2.780   16.004  -23.487 1.00 54.01  ? 694  PRO A N   1 
ATOM   513  C CA  . PRO A 1 94  ? 2.521   14.798  -22.676 1.00 53.43  ? 694  PRO A CA  1 
ATOM   514  C C   . PRO A 1 94  ? 1.313   14.918  -21.740 1.00 55.56  ? 694  PRO A C   1 
ATOM   515  O O   . PRO A 1 94  ? 0.817   16.027  -21.516 1.00 54.92  ? 694  PRO A O   1 
ATOM   516  C CB  . PRO A 1 94  ? 3.838   14.628  -21.905 1.00 55.22  ? 694  PRO A CB  1 
ATOM   517  C CG  . PRO A 1 94  ? 4.324   16.037  -21.685 1.00 59.88  ? 694  PRO A CG  1 
ATOM   518  C CD  . PRO A 1 94  ? 3.818   16.857  -22.861 1.00 55.61  ? 694  PRO A CD  1 
ATOM   519  N N   . VAL A 1 95  ? 0.843   13.770  -21.191 1.00 50.78  ? 695  VAL A N   1 
ATOM   520  C CA  . VAL A 1 95  ? -0.262  13.743  -20.219 1.00 49.81  ? 695  VAL A CA  1 
ATOM   521  C C   . VAL A 1 95  ? 0.216   14.366  -18.902 1.00 50.58  ? 695  VAL A C   1 
ATOM   522  O O   . VAL A 1 95  ? 1.331   14.080  -18.452 1.00 50.21  ? 695  VAL A O   1 
ATOM   523  C CB  . VAL A 1 95  ? -0.948  12.362  -20.020 1.00 53.91  ? 695  VAL A CB  1 
ATOM   524  C CG1 . VAL A 1 95  ? -1.862  12.026  -21.194 1.00 53.80  ? 695  VAL A CG1 1 
ATOM   525  C CG2 . VAL A 1 95  ? 0.064   11.243  -19.767 1.00 53.69  ? 695  VAL A CG2 1 
ATOM   526  N N   . MET A 1 96  ? -0.590  15.272  -18.332 1.00 44.24  ? 696  MET A N   1 
ATOM   527  C CA  . MET A 1 96  ? -0.207  15.987  -17.120 1.00 42.34  ? 696  MET A CA  1 
ATOM   528  C C   . MET A 1 96  ? -1.203  15.873  -15.975 1.00 42.62  ? 696  MET A C   1 
ATOM   529  O O   . MET A 1 96  ? -2.413  15.953  -16.182 1.00 41.79  ? 696  MET A O   1 
ATOM   530  C CB  . MET A 1 96  ? 0.065   17.469  -17.431 1.00 44.61  ? 696  MET A CB  1 
ATOM   531  C CG  . MET A 1 96  ? 1.281   17.705  -18.311 1.00 48.17  ? 696  MET A CG  1 
ATOM   532  S SD  . MET A 1 96  ? 1.677   19.454  -18.538 1.00 52.17  ? 696  MET A SD  1 
ATOM   533  C CE  . MET A 1 96  ? 0.459   19.918  -19.746 1.00 48.85  ? 696  MET A CE  1 
ATOM   534  N N   . ILE A 1 97  ? -0.676  15.710  -14.759 1.00 37.16  ? 697  ILE A N   1 
ATOM   535  C CA  . ILE A 1 97  ? -1.445  15.693  -13.516 1.00 35.83  ? 697  ILE A CA  1 
ATOM   536  C C   . ILE A 1 97  ? -1.002  16.955  -12.770 1.00 36.85  ? 697  ILE A C   1 
ATOM   537  O O   . ILE A 1 97  ? 0.162   17.062  -12.372 1.00 36.80  ? 697  ILE A O   1 
ATOM   538  C CB  . ILE A 1 97  ? -1.247  14.383  -12.696 1.00 39.07  ? 697  ILE A CB  1 
ATOM   539  C CG1 . ILE A 1 97  ? -1.834  13.162  -13.449 1.00 39.27  ? 697  ILE A CG1 1 
ATOM   540  C CG2 . ILE A 1 97  ? -1.852  14.517  -11.282 1.00 40.06  ? 697  ILE A CG2 1 
ATOM   541  C CD1 . ILE A 1 97  ? -1.518  11.797  -12.827 1.00 45.03  ? 697  ILE A CD1 1 
ATOM   542  N N   . ILE A 1 98  ? -1.896  17.941  -12.673 1.00 31.19  ? 698  ILE A N   1 
ATOM   543  C CA  . ILE A 1 98  ? -1.585  19.208  -12.023 1.00 30.08  ? 698  ILE A CA  1 
ATOM   544  C C   . ILE A 1 98  ? -2.202  19.228  -10.639 1.00 32.07  ? 698  ILE A C   1 
ATOM   545  O O   . ILE A 1 98  ? -3.416  19.340  -10.491 1.00 32.18  ? 698  ILE A O   1 
ATOM   546  C CB  . ILE A 1 98  ? -1.948  20.446  -12.896 1.00 33.13  ? 698  ILE A CB  1 
ATOM   547  C CG1 . ILE A 1 98  ? -1.172  20.445  -14.222 1.00 33.54  ? 698  ILE A CG1 1 
ATOM   548  C CG2 . ILE A 1 98  ? -1.708  21.755  -12.155 1.00 33.95  ? 698  ILE A CG2 1 
ATOM   549  C CD1 . ILE A 1 98  ? -2.034  20.294  -15.390 1.00 41.07  ? 698  ILE A CD1 1 
ATOM   550  N N   . THR A 1 99  ? -1.350  19.084  -9.630  1.00 26.83  ? 699  THR A N   1 
ATOM   551  C CA  . THR A 1 99  ? -1.721  19.097  -8.220  1.00 25.16  ? 699  THR A CA  1 
ATOM   552  C C   . THR A 1 99  ? -1.101  20.332  -7.593  1.00 26.68  ? 699  THR A C   1 
ATOM   553  O O   . THR A 1 99  ? -0.191  20.919  -8.181  1.00 26.23  ? 699  THR A O   1 
ATOM   554  C CB  . THR A 1 99  ? -1.232  17.818  -7.526  1.00 28.78  ? 699  THR A CB  1 
ATOM   555  O OG1 . THR A 1 99  ? 0.187   17.727  -7.642  1.00 29.02  ? 699  THR A OG1 1 
ATOM   556  C CG2 . THR A 1 99  ? -1.877  16.569  -8.080  1.00 25.06  ? 699  THR A CG2 1 
ATOM   557  N N   . GLU A 1 100 ? -1.578  20.721  -6.401  1.00 21.39  ? 700  GLU A N   1 
ATOM   558  C CA  . GLU A 1 100 ? -1.062  21.860  -5.641  1.00 20.01  ? 700  GLU A CA  1 
ATOM   559  C C   . GLU A 1 100 ? 0.412   21.631  -5.293  1.00 23.08  ? 700  GLU A C   1 
ATOM   560  O O   . GLU A 1 100 ? 0.840   20.478  -5.154  1.00 22.50  ? 700  GLU A O   1 
ATOM   561  C CB  . GLU A 1 100 ? -1.895  22.082  -4.366  1.00 20.98  ? 700  GLU A CB  1 
ATOM   562  C CG  . GLU A 1 100 ? -1.894  20.901  -3.402  1.00 24.77  ? 700  GLU A CG  1 
ATOM   563  C CD  . GLU A 1 100 ? -2.618  21.130  -2.095  1.00 28.63  ? 700  GLU A CD  1 
ATOM   564  O OE1 . GLU A 1 100 ? -2.287  22.110  -1.392  1.00 26.53  ? 700  GLU A OE1 1 
ATOM   565  O OE2 . GLU A 1 100 ? -3.493  20.305  -1.751  1.00 18.71  ? 700  GLU A OE2 1 
ATOM   566  N N   . PHE A 1 101 ? 1.187   22.722  -5.167  1.00 18.75  ? 701  PHE A N   1 
ATOM   567  C CA  . PHE A 1 101 ? 2.602   22.611  -4.847  1.00 17.57  ? 701  PHE A CA  1 
ATOM   568  C C   . PHE A 1 101 ? 2.855   22.496  -3.342  1.00 20.15  ? 701  PHE A C   1 
ATOM   569  O O   . PHE A 1 101 ? 2.194   23.158  -2.534  1.00 19.71  ? 701  PHE A O   1 
ATOM   570  C CB  . PHE A 1 101 ? 3.440   23.722  -5.492  1.00 18.95  ? 701  PHE A CB  1 
ATOM   571  C CG  . PHE A 1 101 ? 4.893   23.328  -5.609  1.00 20.00  ? 701  PHE A CG  1 
ATOM   572  C CD1 . PHE A 1 101 ? 5.285   22.291  -6.448  1.00 22.04  ? 701  PHE A CD1 1 
ATOM   573  C CD2 . PHE A 1 101 ? 5.865   23.960  -4.840  1.00 22.25  ? 701  PHE A CD2 1 
ATOM   574  C CE1 . PHE A 1 101 ? 6.624   21.906  -6.533  1.00 23.05  ? 701  PHE A CE1 1 
ATOM   575  C CE2 . PHE A 1 101 ? 7.207   23.578  -4.930  1.00 24.64  ? 701  PHE A CE2 1 
ATOM   576  C CZ  . PHE A 1 101 ? 7.579   22.564  -5.785  1.00 22.50  ? 701  PHE A CZ  1 
ATOM   577  N N   . MET A 1 102 ? 3.789   21.594  -2.983  1.00 14.75  ? 702  MET A N   1 
ATOM   578  C CA  . MET A 1 102 ? 4.172   21.265  -1.612  1.00 13.18  ? 702  MET A CA  1 
ATOM   579  C C   . MET A 1 102 ? 5.687   21.416  -1.466  1.00 16.78  ? 702  MET A C   1 
ATOM   580  O O   . MET A 1 102 ? 6.438   20.450  -1.608  1.00 15.53  ? 702  MET A O   1 
ATOM   581  C CB  . MET A 1 102 ? 3.690   19.841  -1.242  1.00 14.68  ? 702  MET A CB  1 
ATOM   582  C CG  . MET A 1 102 ? 2.187   19.621  -1.405  1.00 17.13  ? 702  MET A CG  1 
ATOM   583  S SD  . MET A 1 102 ? 1.126   20.632  -0.339  1.00 19.94  ? 702  MET A SD  1 
ATOM   584  C CE  . MET A 1 102 ? 1.210   19.690  1.141   1.00 15.91  ? 702  MET A CE  1 
ATOM   585  N N   . GLU A 1 103 ? 6.116   22.662  -1.194  1.00 14.96  ? 703  GLU A N   1 
ATOM   586  C CA  . GLU A 1 103 ? 7.506   23.130  -1.055  1.00 15.03  ? 703  GLU A CA  1 
ATOM   587  C C   . GLU A 1 103 ? 8.427   22.212  -0.275  1.00 17.90  ? 703  GLU A C   1 
ATOM   588  O O   . GLU A 1 103 ? 9.607   22.119  -0.610  1.00 18.50  ? 703  GLU A O   1 
ATOM   589  C CB  . GLU A 1 103 ? 7.557   24.523  -0.386  1.00 16.52  ? 703  GLU A CB  1 
ATOM   590  C CG  . GLU A 1 103 ? 6.735   25.604  -1.063  1.00 28.29  ? 703  GLU A CG  1 
ATOM   591  C CD  . GLU A 1 103 ? 5.342   25.827  -0.507  1.00 41.70  ? 703  GLU A CD  1 
ATOM   592  O OE1 . GLU A 1 103 ? 4.654   24.836  -0.174  1.00 34.36  ? 703  GLU A OE1 1 
ATOM   593  O OE2 . GLU A 1 103 ? 4.916   27.002  -0.460  1.00 26.86  ? 703  GLU A OE2 1 
ATOM   594  N N   . ASN A 1 104 ? 7.909   21.580  0.793   1.00 13.05  ? 704  ASN A N   1 
ATOM   595  C CA  . ASN A 1 104 ? 8.702   20.767  1.714   1.00 11.10  ? 704  ASN A CA  1 
ATOM   596  C C   . ASN A 1 104 ? 8.697   19.250  1.442   1.00 13.92  ? 704  ASN A C   1 
ATOM   597  O O   . ASN A 1 104 ? 9.340   18.506  2.189   1.00 14.22  ? 704  ASN A O   1 
ATOM   598  C CB  . ASN A 1 104 ? 8.284   21.090  3.146   1.00 5.37   ? 704  ASN A CB  1 
ATOM   599  C CG  . ASN A 1 104 ? 8.793   22.462  3.529   1.00 24.00  ? 704  ASN A CG  1 
ATOM   600  O OD1 . ASN A 1 104 ? 10.002  22.739  3.481   1.00 15.69  ? 704  ASN A OD1 1 
ATOM   601  N ND2 . ASN A 1 104 ? 7.890   23.394  3.778   1.00 13.50  ? 704  ASN A ND2 1 
ATOM   602  N N   . GLY A 1 105 ? 8.081   18.826  0.336   1.00 10.06  ? 705  GLY A N   1 
ATOM   603  C CA  . GLY A 1 105 ? 8.033   17.425  -0.093  1.00 9.55   ? 705  GLY A CA  1 
ATOM   604  C C   . GLY A 1 105 ? 7.448   16.439  0.898   1.00 12.62  ? 705  GLY A C   1 
ATOM   605  O O   . GLY A 1 105 ? 6.555   16.791  1.679   1.00 12.34  ? 705  GLY A O   1 
ATOM   606  N N   . SER A 1 106 ? 7.956   15.188  0.870   1.00 9.12   ? 706  SER A N   1 
ATOM   607  C CA  . SER A 1 106 ? 7.507   14.088  1.739   1.00 8.66   ? 706  SER A CA  1 
ATOM   608  C C   . SER A 1 106 ? 7.821   14.347  3.203   1.00 10.58  ? 706  SER A C   1 
ATOM   609  O O   . SER A 1 106 ? 8.860   14.906  3.512   1.00 8.09   ? 706  SER A O   1 
ATOM   610  C CB  . SER A 1 106 ? 8.081   12.750  1.285   1.00 12.25  ? 706  SER A CB  1 
ATOM   611  O OG  . SER A 1 106 ? 7.496   12.348  0.057   1.00 21.02  ? 706  SER A OG  1 
ATOM   612  N N   . LEU A 1 107 ? 6.898   13.973  4.094   1.00 9.17   ? 707  LEU A N   1 
ATOM   613  C CA  . LEU A 1 107 ? 7.006   14.228  5.538   1.00 8.88   ? 707  LEU A CA  1 
ATOM   614  C C   . LEU A 1 107 ? 8.145   13.450  6.225   1.00 13.29  ? 707  LEU A C   1 
ATOM   615  O O   . LEU A 1 107 ? 8.788   13.998  7.110   1.00 12.14  ? 707  LEU A O   1 
ATOM   616  C CB  . LEU A 1 107 ? 5.642   13.985  6.220   1.00 8.09   ? 707  LEU A CB  1 
ATOM   617  C CG  . LEU A 1 107 ? 5.520   14.126  7.741   1.00 11.33  ? 707  LEU A CG  1 
ATOM   618  C CD1 . LEU A 1 107 ? 5.730   15.534  8.204   1.00 11.46  ? 707  LEU A CD1 1 
ATOM   619  C CD2 . LEU A 1 107 ? 4.191   13.632  8.218   1.00 11.75  ? 707  LEU A CD2 1 
ATOM   620  N N   . ASP A 1 108 ? 8.397   12.200  5.815   1.00 10.79  ? 708  ASP A N   1 
ATOM   621  C CA  . ASP A 1 108 ? 9.448   11.373  6.403   1.00 10.59  ? 708  ASP A CA  1 
ATOM   622  C C   . ASP A 1 108 ? 10.872  11.967  6.202   1.00 13.92  ? 708  ASP A C   1 
ATOM   623  O O   . ASP A 1 108 ? 11.643  12.028  7.157   1.00 13.04  ? 708  ASP A O   1 
ATOM   624  C CB  . ASP A 1 108 ? 9.353   9.915   5.885   1.00 11.90  ? 708  ASP A CB  1 
ATOM   625  C CG  . ASP A 1 108 ? 9.691   9.717   4.416   1.00 14.17  ? 708  ASP A CG  1 
ATOM   626  O OD1 . ASP A 1 108 ? 9.455   10.650  3.617   1.00 11.18  ? 708  ASP A OD1 1 
ATOM   627  O OD2 . ASP A 1 108 ? 10.220  8.646   4.074   1.00 22.40  ? 708  ASP A OD2 1 
ATOM   628  N N   . SER A 1 109 ? 11.199  12.394  4.972   1.00 9.63   ? 709  SER A N   1 
ATOM   629  C CA  . SER A 1 109 ? 12.496  12.979  4.632   1.00 9.12   ? 709  SER A CA  1 
ATOM   630  C C   . SER A 1 109 ? 12.594  14.395  5.184   1.00 12.53  ? 709  SER A C   1 
ATOM   631  O O   . SER A 1 109 ? 13.670  14.783  5.655   1.00 12.28  ? 709  SER A O   1 
ATOM   632  C CB  . SER A 1 109 ? 12.703  12.992  3.121   1.00 11.34  ? 709  SER A CB  1 
ATOM   633  O OG  . SER A 1 109 ? 11.550  13.512  2.483   1.00 23.70  ? 709  SER A OG  1 
ATOM   634  N N   . PHE A 1 110 ? 11.467  15.158  5.147   1.00 8.40   ? 710  PHE A N   1 
ATOM   635  C CA  . PHE A 1 110 ? 11.389  16.525  5.669   1.00 8.16   ? 710  PHE A CA  1 
ATOM   636  C C   . PHE A 1 110 ? 11.723  16.543  7.137   1.00 13.53  ? 710  PHE A C   1 
ATOM   637  O O   . PHE A 1 110 ? 12.470  17.425  7.559   1.00 15.32  ? 710  PHE A O   1 
ATOM   638  C CB  . PHE A 1 110 ? 10.006  17.158  5.426   1.00 9.73   ? 710  PHE A CB  1 
ATOM   639  C CG  . PHE A 1 110 ? 9.725   18.404  6.238   1.00 10.63  ? 710  PHE A CG  1 
ATOM   640  C CD1 . PHE A 1 110 ? 10.387  19.599  5.961   1.00 13.07  ? 710  PHE A CD1 1 
ATOM   641  C CD2 . PHE A 1 110 ? 8.820   18.376  7.298   1.00 11.43  ? 710  PHE A CD2 1 
ATOM   642  C CE1 . PHE A 1 110 ? 10.145  20.747  6.723   1.00 13.52  ? 710  PHE A CE1 1 
ATOM   643  C CE2 . PHE A 1 110 ? 8.578   19.527  8.058   1.00 14.28  ? 710  PHE A CE2 1 
ATOM   644  C CZ  . PHE A 1 110 ? 9.225   20.712  7.748   1.00 12.16  ? 710  PHE A CZ  1 
ATOM   645  N N   . LEU A 1 111 ? 11.186  15.570  7.915   1.00 9.08   ? 711  LEU A N   1 
ATOM   646  C CA  . LEU A 1 111 ? 11.429  15.478  9.358   1.00 8.30   ? 711  LEU A CA  1 
ATOM   647  C C   . LEU A 1 111 ? 12.850  15.010  9.636   1.00 14.42  ? 711  LEU A C   1 
ATOM   648  O O   . LEU A 1 111 ? 13.458  15.505  10.580  1.00 13.61  ? 711  LEU A O   1 
ATOM   649  C CB  . LEU A 1 111 ? 10.438  14.550  10.062  1.00 7.70   ? 711  LEU A CB  1 
ATOM   650  C CG  . LEU A 1 111 ? 8.973   14.967  10.197  1.00 11.49  ? 711  LEU A CG  1 
ATOM   651  C CD1 . LEU A 1 111 ? 8.153   13.799  10.670  1.00 9.73   ? 711  LEU A CD1 1 
ATOM   652  C CD2 . LEU A 1 111 ? 8.791   16.184  11.140  1.00 14.05  ? 711  LEU A CD2 1 
ATOM   653  N N   . ARG A 1 112 ? 13.377  14.055  8.817   1.00 11.33  ? 712  ARG A N   1 
ATOM   654  C CA  . ARG A 1 112 ? 14.744  13.531  8.940   1.00 11.14  ? 712  ARG A CA  1 
ATOM   655  C C   . ARG A 1 112 ? 15.772  14.668  8.819   1.00 16.17  ? 712  ARG A C   1 
ATOM   656  O O   . ARG A 1 112 ? 16.735  14.698  9.585   1.00 16.79  ? 712  ARG A O   1 
ATOM   657  C CB  . ARG A 1 112 ? 15.022  12.423  7.904   1.00 8.77   ? 712  ARG A CB  1 
ATOM   658  C CG  . ARG A 1 112 ? 14.374  11.079  8.254   1.00 16.33  ? 712  ARG A CG  1 
ATOM   659  C CD  . ARG A 1 112 ? 14.876  9.904   7.432   1.00 17.95  ? 712  ARG A CD  1 
ATOM   660  N NE  . ARG A 1 112 ? 14.570  10.032  6.006   1.00 28.09  ? 712  ARG A NE  1 
ATOM   661  C CZ  . ARG A 1 112 ? 13.566  9.418   5.386   1.00 35.84  ? 712  ARG A CZ  1 
ATOM   662  N NH1 . ARG A 1 112 ? 12.736  8.631   6.065   1.00 18.68  ? 712  ARG A NH1 1 
ATOM   663  N NH2 . ARG A 1 112 ? 13.376  9.596   4.086   1.00 15.84  ? 712  ARG A NH2 1 
ATOM   664  N N   . GLN A 1 113 ? 15.519  15.629  7.898   1.00 11.59  ? 713  GLN A N   1 
ATOM   665  C CA  . GLN A 1 113 ? 16.363  16.797  7.643   1.00 10.82  ? 713  GLN A CA  1 
ATOM   666  C C   . GLN A 1 113 ? 16.250  17.860  8.740   1.00 14.50  ? 713  GLN A C   1 
ATOM   667  O O   . GLN A 1 113 ? 17.096  18.751  8.820   1.00 14.33  ? 713  GLN A O   1 
ATOM   668  C CB  . GLN A 1 113 ? 16.073  17.393  6.249   1.00 12.04  ? 713  GLN A CB  1 
ATOM   669  C CG  . GLN A 1 113 ? 16.440  16.454  5.086   1.00 18.33  ? 713  GLN A CG  1 
ATOM   670  C CD  . GLN A 1 113 ? 15.847  16.877  3.759   1.00 31.99  ? 713  GLN A CD  1 
ATOM   671  O OE1 . GLN A 1 113 ? 14.632  17.005  3.594   1.00 33.46  ? 713  GLN A OE1 1 
ATOM   672  N NE2 . GLN A 1 113 ? 16.690  17.073  2.769   1.00 20.62  ? 713  GLN A NE2 1 
ATOM   673  N N   . ASN A 1 114 ? 15.219  17.748  9.593   1.00 11.14  ? 714  ASN A N   1 
ATOM   674  C CA  . ASN A 1 114 ? 14.929  18.656  10.700  1.00 10.32  ? 714  ASN A CA  1 
ATOM   675  C C   . ASN A 1 114 ? 14.808  17.926  12.046  1.00 14.97  ? 714  ASN A C   1 
ATOM   676  O O   . ASN A 1 114 ? 13.971  18.324  12.867  1.00 15.17  ? 714  ASN A O   1 
ATOM   677  C CB  . ASN A 1 114 ? 13.638  19.442  10.406  1.00 7.73   ? 714  ASN A CB  1 
ATOM   678  C CG  . ASN A 1 114 ? 13.780  20.449  9.309   1.00 13.03  ? 714  ASN A CG  1 
ATOM   679  O OD1 . ASN A 1 114 ? 14.359  21.511  9.496   1.00 8.09   ? 714  ASN A OD1 1 
ATOM   680  N ND2 . ASN A 1 114 ? 13.283  20.123  8.137   1.00 3.00   ? 714  ASN A ND2 1 
ATOM   681  N N   . ASP A 1 115 ? 15.638  16.875  12.280  1.00 11.17  ? 715  ASP A N   1 
ATOM   682  C CA  . ASP A 1 115 ? 15.642  16.100  13.534  1.00 12.27  ? 715  ASP A CA  1 
ATOM   683  C C   . ASP A 1 115 ? 15.814  16.980  14.795  1.00 16.01  ? 715  ASP A C   1 
ATOM   684  O O   . ASP A 1 115 ? 16.853  17.601  14.978  1.00 16.12  ? 715  ASP A O   1 
ATOM   685  C CB  . ASP A 1 115 ? 16.685  14.951  13.489  1.00 14.45  ? 715  ASP A CB  1 
ATOM   686  C CG  . ASP A 1 115 ? 16.772  14.070  14.731  1.00 22.41  ? 715  ASP A CG  1 
ATOM   687  O OD1 . ASP A 1 115 ? 15.725  13.834  15.370  1.00 21.13  ? 715  ASP A OD1 1 
ATOM   688  O OD2 . ASP A 1 115 ? 17.891  13.596  15.049  1.00 32.00  ? 715  ASP A OD2 1 
ATOM   689  N N   . GLY A 1 116 ? 14.766  17.031  15.617  1.00 12.70  ? 716  GLY A N   1 
ATOM   690  C CA  . GLY A 1 116 ? 14.696  17.811  16.853  1.00 11.22  ? 716  GLY A CA  1 
ATOM   691  C C   . GLY A 1 116 ? 14.440  19.295  16.670  1.00 13.19  ? 716  GLY A C   1 
ATOM   692  O O   . GLY A 1 116 ? 14.674  20.074  17.601  1.00 12.80  ? 716  GLY A O   1 
ATOM   693  N N   . GLN A 1 117 ? 13.962  19.713  15.481  1.00 9.53   ? 717  GLN A N   1 
ATOM   694  C CA  . GLN A 1 117 ? 13.776  21.145  15.182  1.00 9.80   ? 717  GLN A CA  1 
ATOM   695  C C   . GLN A 1 117 ? 12.423  21.742  15.553  1.00 14.13  ? 717  GLN A C   1 
ATOM   696  O O   . GLN A 1 117 ? 12.357  22.951  15.778  1.00 12.66  ? 717  GLN A O   1 
ATOM   697  C CB  . GLN A 1 117 ? 14.087  21.473  13.703  1.00 11.01  ? 717  GLN A CB  1 
ATOM   698  C CG  . GLN A 1 117 ? 15.564  21.321  13.308  1.00 13.95  ? 717  GLN A CG  1 
ATOM   699  C CD  . GLN A 1 117 ? 16.513  21.760  14.391  1.00 29.42  ? 717  GLN A CD  1 
ATOM   700  O OE1 . GLN A 1 117 ? 17.243  20.944  14.973  1.00 30.12  ? 717  GLN A OE1 1 
ATOM   701  N NE2 . GLN A 1 117 ? 16.445  23.030  14.760  1.00 11.88  ? 717  GLN A NE2 1 
ATOM   702  N N   . PHE A 1 118 ? 11.354  20.918  15.606  1.00 12.60  ? 718  PHE A N   1 
ATOM   703  C CA  . PHE A 1 118 ? 10.003  21.372  15.954  1.00 12.06  ? 718  PHE A CA  1 
ATOM   704  C C   . PHE A 1 118 ? 9.616   21.019  17.384  1.00 16.27  ? 718  PHE A C   1 
ATOM   705  O O   . PHE A 1 118 ? 10.141  20.068  17.957  1.00 16.52  ? 718  PHE A O   1 
ATOM   706  C CB  . PHE A 1 118 ? 8.961   20.837  14.963  1.00 13.42  ? 718  PHE A CB  1 
ATOM   707  C CG  . PHE A 1 118 ? 9.392   20.964  13.525  1.00 14.52  ? 718  PHE A CG  1 
ATOM   708  C CD1 . PHE A 1 118 ? 9.539   22.213  12.935  1.00 17.06  ? 718  PHE A CD1 1 
ATOM   709  C CD2 . PHE A 1 118 ? 9.691   19.836  12.773  1.00 16.11  ? 718  PHE A CD2 1 
ATOM   710  C CE1 . PHE A 1 118 ? 9.980   22.330  11.622  1.00 18.20  ? 718  PHE A CE1 1 
ATOM   711  C CE2 . PHE A 1 118 ? 10.122  19.955  11.454  1.00 18.63  ? 718  PHE A CE2 1 
ATOM   712  C CZ  . PHE A 1 118 ? 10.270  21.199  10.892  1.00 17.12  ? 718  PHE A CZ  1 
ATOM   713  N N   . THR A 1 119 ? 8.700   21.796  17.959  1.00 12.50  ? 719  THR A N   1 
ATOM   714  C CA  . THR A 1 119 ? 8.194   21.569  19.314  1.00 11.70  ? 719  THR A CA  1 
ATOM   715  C C   . THR A 1 119 ? 7.204   20.393  19.298  1.00 14.63  ? 719  THR A C   1 
ATOM   716  O O   . THR A 1 119 ? 6.770   19.975  18.219  1.00 13.19  ? 719  THR A O   1 
ATOM   717  C CB  . THR A 1 119 ? 7.542   22.855  19.855  1.00 16.80  ? 719  THR A CB  1 
ATOM   718  O OG1 . THR A 1 119 ? 6.353   23.112  19.111  1.00 17.04  ? 719  THR A OG1 1 
ATOM   719  C CG2 . THR A 1 119 ? 8.479   24.081  19.780  1.00 14.77  ? 719  THR A CG2 1 
ATOM   720  N N   . VAL A 1 120 ? 6.821   19.885  20.486  1.00 11.82  ? 720  VAL A N   1 
ATOM   721  C CA  . VAL A 1 120 ? 5.821   18.811  20.610  1.00 12.12  ? 720  VAL A CA  1 
ATOM   722  C C   . VAL A 1 120 ? 4.472   19.289  19.978  1.00 14.43  ? 720  VAL A C   1 
ATOM   723  O O   . VAL A 1 120 ? 3.881   18.554  19.186  1.00 13.89  ? 720  VAL A O   1 
ATOM   724  C CB  . VAL A 1 120 ? 5.654   18.335  22.078  1.00 16.62  ? 720  VAL A CB  1 
ATOM   725  C CG1 . VAL A 1 120 ? 4.725   17.131  22.169  1.00 16.11  ? 720  VAL A CG1 1 
ATOM   726  C CG2 . VAL A 1 120 ? 7.005   18.011  22.711  1.00 17.31  ? 720  VAL A CG2 1 
ATOM   727  N N   . ILE A 1 121 ? 4.035   20.539  20.292  1.00 10.16  ? 721  ILE A N   1 
ATOM   728  C CA  . ILE A 1 121 ? 2.814   21.172  19.759  1.00 9.93   ? 721  ILE A CA  1 
ATOM   729  C C   . ILE A 1 121 ? 2.840   21.183  18.215  1.00 9.52   ? 721  ILE A C   1 
ATOM   730  O O   . ILE A 1 121 ? 1.829   20.857  17.582  1.00 8.10   ? 721  ILE A O   1 
ATOM   731  C CB  . ILE A 1 121 ? 2.623   22.596  20.383  1.00 14.25  ? 721  ILE A CB  1 
ATOM   732  C CG1 . ILE A 1 121 ? 2.266   22.514  21.906  1.00 16.21  ? 721  ILE A CG1 1 
ATOM   733  C CG2 . ILE A 1 121 ? 1.617   23.483  19.600  1.00 14.69  ? 721  ILE A CG2 1 
ATOM   734  C CD1 . ILE A 1 121 ? 0.840   21.851  22.297  1.00 29.89  ? 721  ILE A CD1 1 
ATOM   735  N N   . GLN A 1 122 ? 4.006   21.537  17.624  1.00 3.89   ? 722  GLN A N   1 
ATOM   736  C CA  . GLN A 1 122 ? 4.185   21.567  16.171  1.00 3.17   ? 722  GLN A CA  1 
ATOM   737  C C   . GLN A 1 122 ? 4.078   20.180  15.542  1.00 8.90   ? 722  GLN A C   1 
ATOM   738  O O   . GLN A 1 122 ? 3.545   20.058  14.439  1.00 8.34   ? 722  GLN A O   1 
ATOM   739  C CB  . GLN A 1 122 ? 5.482   22.258  15.778  1.00 3.00   ? 722  GLN A CB  1 
ATOM   740  C CG  . GLN A 1 122 ? 5.325   23.765  15.677  1.00 3.00   ? 722  GLN A CG  1 
ATOM   741  C CD  . GLN A 1 122 ? 6.568   24.430  15.135  1.00 12.82  ? 722  GLN A CD  1 
ATOM   742  O OE1 . GLN A 1 122 ? 7.695   24.050  15.461  1.00 3.01   ? 722  GLN A OE1 1 
ATOM   743  N NE2 . GLN A 1 122 ? 6.398   25.431  14.278  1.00 5.57   ? 722  GLN A NE2 1 
ATOM   744  N N   . LEU A 1 123 ? 4.553   19.137  16.258  1.00 5.99   ? 723  LEU A N   1 
ATOM   745  C CA  . LEU A 1 123 ? 4.462   17.755  15.788  1.00 5.55   ? 723  LEU A CA  1 
ATOM   746  C C   . LEU A 1 123 ? 3.020   17.222  15.926  1.00 7.75   ? 723  LEU A C   1 
ATOM   747  O O   . LEU A 1 123 ? 2.545   16.542  15.033  1.00 4.99   ? 723  LEU A O   1 
ATOM   748  C CB  . LEU A 1 123 ? 5.496   16.857  16.510  1.00 5.61   ? 723  LEU A CB  1 
ATOM   749  C CG  . LEU A 1 123 ? 6.992   17.234  16.330  1.00 9.52   ? 723  LEU A CG  1 
ATOM   750  C CD1 . LEU A 1 123 ? 7.895   16.270  17.072  1.00 9.71   ? 723  LEU A CD1 1 
ATOM   751  C CD2 . LEU A 1 123 ? 7.395   17.296  14.861  1.00 10.40  ? 723  LEU A CD2 1 
ATOM   752  N N   . VAL A 1 124 ? 2.309   17.587  17.024  1.00 6.31   ? 724  VAL A N   1 
ATOM   753  C CA  . VAL A 1 124 ? 0.901   17.219  17.290  1.00 5.68   ? 724  VAL A CA  1 
ATOM   754  C C   . VAL A 1 124 ? -0.025  17.913  16.281  1.00 11.37  ? 724  VAL A C   1 
ATOM   755  O O   . VAL A 1 124 ? -1.085  17.367  15.934  1.00 12.29  ? 724  VAL A O   1 
ATOM   756  C CB  . VAL A 1 124 ? 0.496   17.480  18.775  1.00 9.40   ? 724  VAL A CB  1 
ATOM   757  C CG1 . VAL A 1 124 ? -0.987  17.205  19.028  1.00 9.66   ? 724  VAL A CG1 1 
ATOM   758  C CG2 . VAL A 1 124 ? 1.348   16.650  19.726  1.00 8.83   ? 724  VAL A CG2 1 
ATOM   759  N N   . GLY A 1 125 ? 0.384   19.097  15.818  1.00 7.05   ? 725  GLY A N   1 
ATOM   760  C CA  . GLY A 1 125 ? -0.344  19.847  14.803  1.00 7.03   ? 725  GLY A CA  1 
ATOM   761  C C   . GLY A 1 125 ? -0.346  19.114  13.472  1.00 11.56  ? 725  GLY A C   1 
ATOM   762  O O   . GLY A 1 125 ? -1.378  19.022  12.803  1.00 10.81  ? 725  GLY A O   1 
ATOM   763  N N   . MET A 1 126 ? 0.821   18.577  13.094  1.00 9.04   ? 726  MET A N   1 
ATOM   764  C CA  . MET A 1 126 ? 1.045   17.795  11.875  1.00 8.38   ? 726  MET A CA  1 
ATOM   765  C C   . MET A 1 126 ? 0.163   16.538  11.884  1.00 10.52  ? 726  MET A C   1 
ATOM   766  O O   . MET A 1 126 ? -0.497  16.232  10.895  1.00 10.16  ? 726  MET A O   1 
ATOM   767  C CB  . MET A 1 126 ? 2.521   17.388  11.780  1.00 10.45  ? 726  MET A CB  1 
ATOM   768  C CG  . MET A 1 126 ? 3.467   18.536  11.522  1.00 14.87  ? 726  MET A CG  1 
ATOM   769  S SD  . MET A 1 126 ? 5.183   17.953  11.437  1.00 19.76  ? 726  MET A SD  1 
ATOM   770  C CE  . MET A 1 126 ? 6.041   19.420  11.812  1.00 16.04  ? 726  MET A CE  1 
ATOM   771  N N   . LEU A 1 127 ? 0.130   15.844  13.028  1.00 6.05   ? 727  LEU A N   1 
ATOM   772  C CA  . LEU A 1 127 ? -0.647  14.631  13.253  1.00 4.75   ? 727  LEU A CA  1 
ATOM   773  C C   . LEU A 1 127 ? -2.143  14.882  13.229  1.00 6.75   ? 727  LEU A C   1 
ATOM   774  O O   . LEU A 1 127 ? -2.898  14.024  12.770  1.00 5.60   ? 727  LEU A O   1 
ATOM   775  C CB  . LEU A 1 127 ? -0.218  13.972  14.564  1.00 4.77   ? 727  LEU A CB  1 
ATOM   776  C CG  . LEU A 1 127 ? 1.142   13.280  14.519  1.00 9.30   ? 727  LEU A CG  1 
ATOM   777  C CD1 . LEU A 1 127 ? 1.650   12.959  15.929  1.00 8.89   ? 727  LEU A CD1 1 
ATOM   778  C CD2 . LEU A 1 127 ? 1.071   12.016  13.651  1.00 9.70   ? 727  LEU A CD2 1 
ATOM   779  N N   . ARG A 1 128 ? -2.577  16.044  13.742  1.00 3.99   ? 728  ARG A N   1 
ATOM   780  C CA  . ARG A 1 128 ? -3.981  16.451  13.761  1.00 3.49   ? 728  ARG A CA  1 
ATOM   781  C C   . ARG A 1 128 ? -4.433  16.712  12.309  1.00 6.87   ? 728  ARG A C   1 
ATOM   782  O O   . ARG A 1 128 ? -5.548  16.356  11.935  1.00 4.55   ? 728  ARG A O   1 
ATOM   783  C CB  . ARG A 1 128 ? -4.164  17.680  14.669  1.00 3.00   ? 728  ARG A CB  1 
ATOM   784  C CG  . ARG A 1 128 ? -5.609  17.969  15.069  1.00 6.97   ? 728  ARG A CG  1 
ATOM   785  C CD  . ARG A 1 128 ? -6.206  19.066  14.204  1.00 17.54  ? 728  ARG A CD  1 
ATOM   786  N NE  . ARG A 1 128 ? -7.571  19.378  14.614  1.00 19.50  ? 728  ARG A NE  1 
ATOM   787  C CZ  . ARG A 1 128 ? -8.611  19.449  13.795  1.00 18.24  ? 728  ARG A CZ  1 
ATOM   788  N NH1 . ARG A 1 128 ? -8.454  19.251  12.495  1.00 7.76   ? 728  ARG A NH1 1 
ATOM   789  N NH2 . ARG A 1 128 ? -9.820  19.706  14.272  1.00 4.71   ? 728  ARG A NH2 1 
ATOM   790  N N   . GLY A 1 129 ? -3.528  17.270  11.506  1.00 4.89   ? 729  GLY A N   1 
ATOM   791  C CA  . GLY A 1 129 ? -3.727  17.504  10.082  1.00 4.56   ? 729  GLY A CA  1 
ATOM   792  C C   . GLY A 1 129 ? -3.878  16.203  9.317   1.00 7.30   ? 729  GLY A C   1 
ATOM   793  O O   . GLY A 1 129 ? -4.846  16.041  8.573   1.00 5.63   ? 729  GLY A O   1 
ATOM   794  N N   . ILE A 1 130 ? -2.948  15.243  9.531   1.00 6.29   ? 730  ILE A N   1 
ATOM   795  C CA  . ILE A 1 130 ? -2.998  13.915  8.883   1.00 6.81   ? 730  ILE A CA  1 
ATOM   796  C C   . ILE A 1 130 ? -4.308  13.190  9.244   1.00 11.06  ? 730  ILE A C   1 
ATOM   797  O O   . ILE A 1 130 ? -5.011  12.739  8.342   1.00 11.58  ? 730  ILE A O   1 
ATOM   798  C CB  . ILE A 1 130 ? -1.741  13.035  9.181   1.00 9.50   ? 730  ILE A CB  1 
ATOM   799  C CG1 . ILE A 1 130 ? -0.429  13.737  8.766   1.00 9.54   ? 730  ILE A CG1 1 
ATOM   800  C CG2 . ILE A 1 130 ? -1.851  11.623  8.523   1.00 9.11   ? 730  ILE A CG2 1 
ATOM   801  C CD1 . ILE A 1 130 ? 0.794   13.391  9.698   1.00 13.31  ? 730  ILE A CD1 1 
ATOM   802  N N   . ALA A 1 131 ? -4.650  13.125  10.553  1.00 6.79   ? 731  ALA A N   1 
ATOM   803  C CA  . ALA A 1 131 ? -5.865  12.469  11.054  1.00 6.01   ? 731  ALA A CA  1 
ATOM   804  C C   . ALA A 1 131 ? -7.160  13.103  10.515  1.00 9.46   ? 731  ALA A C   1 
ATOM   805  O O   . ALA A 1 131 ? -8.147  12.388  10.321  1.00 8.81   ? 731  ALA A O   1 
ATOM   806  C CB  . ALA A 1 131 ? -5.872  12.445  12.582  1.00 6.44   ? 731  ALA A CB  1 
ATOM   807  N N   . ALA A 1 132 ? -7.152  14.432  10.264  1.00 5.75   ? 732  ALA A N   1 
ATOM   808  C CA  . ALA A 1 132 ? -8.313  15.148  9.728   1.00 4.94   ? 732  ALA A CA  1 
ATOM   809  C C   . ALA A 1 132 ? -8.566  14.820  8.249   1.00 6.64   ? 732  ALA A C   1 
ATOM   810  O O   . ALA A 1 132 ? -9.720  14.731  7.841   1.00 5.53   ? 732  ALA A O   1 
ATOM   811  C CB  . ALA A 1 132 ? -8.155  16.646  9.930   1.00 5.75   ? 732  ALA A CB  1 
ATOM   812  N N   . GLY A 1 133 ? -7.497  14.658  7.468   1.00 3.14   ? 733  GLY A N   1 
ATOM   813  C CA  . GLY A 1 133 ? -7.573  14.297  6.051   1.00 3.00   ? 733  GLY A CA  1 
ATOM   814  C C   . GLY A 1 133 ? -7.999  12.848  5.942   1.00 7.51   ? 733  GLY A C   1 
ATOM   815  O O   . GLY A 1 133 ? -8.859  12.497  5.135   1.00 5.98   ? 733  GLY A O   1 
ATOM   816  N N   . MET A 1 134 ? -7.438  12.007  6.830   1.00 5.28   ? 734  MET A N   1 
ATOM   817  C CA  . MET A 1 134 ? -7.780  10.600  6.952   1.00 4.01   ? 734  MET A CA  1 
ATOM   818  C C   . MET A 1 134 ? -9.228  10.455  7.396   1.00 8.40   ? 734  MET A C   1 
ATOM   819  O O   . MET A 1 134 ? -9.893  9.545   6.902   1.00 8.46   ? 734  MET A O   1 
ATOM   820  C CB  . MET A 1 134 ? -6.835  9.890   7.923   1.00 5.85   ? 734  MET A CB  1 
ATOM   821  C CG  . MET A 1 134 ? -5.464  9.522   7.333   1.00 8.82   ? 734  MET A CG  1 
ATOM   822  S SD  . MET A 1 134 ? -5.462  8.843   5.652   1.00 12.60  ? 734  MET A SD  1 
ATOM   823  C CE  . MET A 1 134 ? -6.342  7.272   5.904   1.00 8.67   ? 734  MET A CE  1 
ATOM   824  N N   . LYS A 1 135 ? -9.730  11.366  8.283   1.00 5.56   ? 735  LYS A N   1 
ATOM   825  C CA  . LYS A 1 135 ? -11.133 11.389  8.749   1.00 6.06   ? 735  LYS A CA  1 
ATOM   826  C C   . LYS A 1 135 ? -12.067 11.583  7.563   1.00 12.05  ? 735  LYS A C   1 
ATOM   827  O O   . LYS A 1 135 ? -12.973 10.775  7.371   1.00 13.36  ? 735  LYS A O   1 
ATOM   828  C CB  . LYS A 1 135 ? -11.404 12.484  9.813   1.00 7.49   ? 735  LYS A CB  1 
ATOM   829  C CG  . LYS A 1 135 ? -12.762 12.266  10.512  1.00 6.79   ? 735  LYS A CG  1 
ATOM   830  C CD  . LYS A 1 135 ? -13.283 13.456  11.291  1.00 6.41   ? 735  LYS A CD  1 
ATOM   831  C CE  . LYS A 1 135 ? -14.662 13.198  11.889  1.00 8.89   ? 735  LYS A CE  1 
ATOM   832  N NZ  . LYS A 1 135 ? -15.776 13.337  10.911  1.00 7.45   ? 735  LYS A NZ  1 
ATOM   833  N N   . TYR A 1 136 ? -11.809 12.633  6.751   1.00 8.11   ? 736  TYR A N   1 
ATOM   834  C CA  . TYR A 1 136 ? -12.536 12.971  5.536   1.00 6.99   ? 736  TYR A CA  1 
ATOM   835  C C   . TYR A 1 136 ? -12.592 11.772  4.584   1.00 11.17  ? 736  TYR A C   1 
ATOM   836  O O   . TYR A 1 136 ? -13.683 11.435  4.138   1.00 11.51  ? 736  TYR A O   1 
ATOM   837  C CB  . TYR A 1 136 ? -11.883 14.185  4.863   1.00 7.65   ? 736  TYR A CB  1 
ATOM   838  C CG  . TYR A 1 136 ? -12.469 14.573  3.521   1.00 9.17   ? 736  TYR A CG  1 
ATOM   839  C CD1 . TYR A 1 136 ? -13.597 15.381  3.438   1.00 11.46  ? 736  TYR A CD1 1 
ATOM   840  C CD2 . TYR A 1 136 ? -11.854 14.189  2.333   1.00 9.99   ? 736  TYR A CD2 1 
ATOM   841  C CE1 . TYR A 1 136 ? -14.135 15.750  2.207   1.00 11.51  ? 736  TYR A CE1 1 
ATOM   842  C CE2 . TYR A 1 136 ? -12.389 14.542  1.094   1.00 11.11  ? 736  TYR A CE2 1 
ATOM   843  C CZ  . TYR A 1 136 ? -13.526 15.332  1.037   1.00 17.72  ? 736  TYR A CZ  1 
ATOM   844  O OH  . TYR A 1 136 ? -14.053 15.713  -0.172  1.00 19.83  ? 736  TYR A OH  1 
ATOM   845  N N   . LEU A 1 137 ? -11.427 11.133  4.274   1.00 7.16   ? 737  LEU A N   1 
ATOM   846  C CA  . LEU A 1 137 ? -11.328 9.957   3.393   1.00 6.68   ? 737  LEU A CA  1 
ATOM   847  C C   . LEU A 1 137 ? -12.159 8.777   3.889   1.00 11.14  ? 737  LEU A C   1 
ATOM   848  O O   . LEU A 1 137 ? -12.866 8.154   3.092   1.00 10.90  ? 737  LEU A O   1 
ATOM   849  C CB  . LEU A 1 137 ? -9.879  9.493   3.182   1.00 6.66   ? 737  LEU A CB  1 
ATOM   850  C CG  . LEU A 1 137 ? -8.877  10.475  2.555   1.00 11.31  ? 737  LEU A CG  1 
ATOM   851  C CD1 . LEU A 1 137 ? -7.478  9.901   2.593   1.00 11.15  ? 737  LEU A CD1 1 
ATOM   852  C CD2 . LEU A 1 137 ? -9.263  10.858  1.141   1.00 13.36  ? 737  LEU A CD2 1 
ATOM   853  N N   . ALA A 1 138 ? -12.077 8.472   5.198   1.00 8.79   ? 738  ALA A N   1 
ATOM   854  C CA  . ALA A 1 138 ? -12.820 7.377   5.845   1.00 8.59   ? 738  ALA A CA  1 
ATOM   855  C C   . ALA A 1 138 ? -14.335 7.612   5.716   1.00 10.73  ? 738  ALA A C   1 
ATOM   856  O O   . ALA A 1 138 ? -15.078 6.695   5.361   1.00 8.90   ? 738  ALA A O   1 
ATOM   857  C CB  . ALA A 1 138 ? -12.423 7.287   7.317   1.00 9.59   ? 738  ALA A CB  1 
ATOM   858  N N   . ASP A 1 139 ? -14.760 8.882   5.950   1.00 7.43   ? 739  ASP A N   1 
ATOM   859  C CA  . ASP A 1 139 ? -16.131 9.383   5.873   1.00 6.92   ? 739  ASP A CA  1 
ATOM   860  C C   . ASP A 1 139 ? -16.722 9.251   4.484   1.00 13.35  ? 739  ASP A C   1 
ATOM   861  O O   . ASP A 1 139 ? -17.942 9.106   4.367   1.00 12.06  ? 739  ASP A O   1 
ATOM   862  C CB  . ASP A 1 139 ? -16.195 10.841  6.360   1.00 7.68   ? 739  ASP A CB  1 
ATOM   863  C CG  . ASP A 1 139 ? -16.066 10.976  7.865   1.00 12.36  ? 739  ASP A CG  1 
ATOM   864  O OD1 . ASP A 1 139 ? -16.558 10.094  8.583   1.00 15.56  ? 739  ASP A OD1 1 
ATOM   865  O OD2 . ASP A 1 139 ? -15.505 11.973  8.318   1.00 15.95  ? 739  ASP A OD2 1 
ATOM   866  N N   . MET A 1 140 ? -15.841 9.282   3.441   1.00 10.77  ? 740  MET A N   1 
ATOM   867  C CA  . MET A 1 140 ? -16.138 9.117   2.015   1.00 11.13  ? 740  MET A CA  1 
ATOM   868  C C   . MET A 1 140 ? -16.055 7.630   1.596   1.00 16.34  ? 740  MET A C   1 
ATOM   869  O O   . MET A 1 140 ? -15.969 7.349   0.406   1.00 14.71  ? 740  MET A O   1 
ATOM   870  C CB  . MET A 1 140 ? -15.163 9.951   1.153   1.00 13.50  ? 740  MET A CB  1 
ATOM   871  C CG  . MET A 1 140 ? -15.264 11.445  1.361   1.00 17.32  ? 740  MET A CG  1 
ATOM   872  S SD  . MET A 1 140 ? -16.675 12.221  0.546   1.00 22.25  ? 740  MET A SD  1 
ATOM   873  C CE  . MET A 1 140 ? -16.900 13.603  1.604   1.00 19.01  ? 740  MET A CE  1 
ATOM   874  N N   . ASN A 1 141 ? -16.095 6.685   2.580   1.00 15.42  ? 741  ASN A N   1 
ATOM   875  C CA  . ASN A 1 141 ? -16.034 5.218   2.414   1.00 15.50  ? 741  ASN A CA  1 
ATOM   876  C C   . ASN A 1 141 ? -14.737 4.717   1.733   1.00 18.55  ? 741  ASN A C   1 
ATOM   877  O O   . ASN A 1 141 ? -14.732 3.624   1.159   1.00 17.56  ? 741  ASN A O   1 
ATOM   878  C CB  . ASN A 1 141 ? -17.281 4.676   1.691   1.00 18.23  ? 741  ASN A CB  1 
ATOM   879  C CG  . ASN A 1 141 ? -18.557 4.750   2.479   1.00 50.74  ? 741  ASN A CG  1 
ATOM   880  O OD1 . ASN A 1 141 ? -19.080 5.836   2.769   1.00 50.82  ? 741  ASN A OD1 1 
ATOM   881  N ND2 . ASN A 1 141 ? -19.140 3.588   2.757   1.00 41.93  ? 741  ASN A ND2 1 
ATOM   882  N N   . TYR A 1 142 ? -13.649 5.518   1.814   1.00 15.45  ? 742  TYR A N   1 
ATOM   883  C CA  . TYR A 1 142 ? -12.341 5.243   1.212   1.00 15.81  ? 742  TYR A CA  1 
ATOM   884  C C   . TYR A 1 142 ? -11.339 4.635   2.202   1.00 17.21  ? 742  TYR A C   1 
ATOM   885  O O   . TYR A 1 142 ? -11.176 5.159   3.305   1.00 17.54  ? 742  TYR A O   1 
ATOM   886  C CB  . TYR A 1 142 ? -11.752 6.530   0.584   1.00 18.05  ? 742  TYR A CB  1 
ATOM   887  C CG  . TYR A 1 142 ? -10.480 6.308   -0.204  1.00 21.89  ? 742  TYR A CG  1 
ATOM   888  C CD1 . TYR A 1 142 ? -10.509 5.708   -1.464  1.00 24.26  ? 742  TYR A CD1 1 
ATOM   889  C CD2 . TYR A 1 142 ? -9.244  6.692   0.306   1.00 23.01  ? 742  TYR A CD2 1 
ATOM   890  C CE1 . TYR A 1 142 ? -9.337  5.481   -2.186  1.00 25.02  ? 742  TYR A CE1 1 
ATOM   891  C CE2 . TYR A 1 142 ? -8.066  6.481   -0.411  1.00 24.18  ? 742  TYR A CE2 1 
ATOM   892  C CZ  . TYR A 1 142 ? -8.116  5.872   -1.657  1.00 31.15  ? 742  TYR A CZ  1 
ATOM   893  O OH  . TYR A 1 142 ? -6.948  5.642   -2.353  1.00 29.35  ? 742  TYR A OH  1 
ATOM   894  N N   . VAL A 1 143 ? -10.657 3.546   1.783   1.00 10.02  ? 743  VAL A N   1 
ATOM   895  C CA  . VAL A 1 143 ? -9.589  2.888   2.544   1.00 9.63   ? 743  VAL A CA  1 
ATOM   896  C C   . VAL A 1 143 ? -8.296  3.163   1.778   1.00 13.05  ? 743  VAL A C   1 
ATOM   897  O O   . VAL A 1 143 ? -8.159  2.727   0.636   1.00 13.51  ? 743  VAL A O   1 
ATOM   898  C CB  . VAL A 1 143 ? -9.809  1.364   2.778   1.00 13.72  ? 743  VAL A CB  1 
ATOM   899  C CG1 . VAL A 1 143 ? -8.736  0.798   3.699   1.00 13.65  ? 743  VAL A CG1 1 
ATOM   900  C CG2 . VAL A 1 143 ? -11.204 1.074   3.338   1.00 13.62  ? 743  VAL A CG2 1 
ATOM   901  N N   . HIS A 1 144 ? -7.385  3.940   2.378   1.00 9.90   ? 744  HIS A N   1 
ATOM   902  C CA  . HIS A 1 144 ? -6.122  4.331   1.760   1.00 9.58   ? 744  HIS A CA  1 
ATOM   903  C C   . HIS A 1 144 ? -5.158  3.137   1.508   1.00 14.70  ? 744  HIS A C   1 
ATOM   904  O O   . HIS A 1 144 ? -4.599  3.041   0.414   1.00 14.67  ? 744  HIS A O   1 
ATOM   905  C CB  . HIS A 1 144 ? -5.461  5.453   2.562   1.00 9.94   ? 744  HIS A CB  1 
ATOM   906  C CG  . HIS A 1 144 ? -4.318  6.103   1.851   1.00 13.18  ? 744  HIS A CG  1 
ATOM   907  N ND1 . HIS A 1 144 ? -3.051  5.560   1.880   1.00 14.81  ? 744  HIS A ND1 1 
ATOM   908  C CD2 . HIS A 1 144 ? -4.293  7.223   1.097   1.00 14.56  ? 744  HIS A CD2 1 
ATOM   909  C CE1 . HIS A 1 144 ? -2.299  6.358   1.138   1.00 13.88  ? 744  HIS A CE1 1 
ATOM   910  N NE2 . HIS A 1 144 ? -2.998  7.374   0.652   1.00 14.02  ? 744  HIS A NE2 1 
ATOM   911  N N   . ARG A 1 145 ? -4.964  2.249   2.512   1.00 11.44  ? 745  ARG A N   1 
ATOM   912  C CA  . ARG A 1 145 ? -4.102  1.033   2.484   1.00 11.79  ? 745  ARG A CA  1 
ATOM   913  C C   . ARG A 1 145 ? -2.578  1.288   2.378   1.00 14.41  ? 745  ARG A C   1 
ATOM   914  O O   . ARG A 1 145 ? -1.791  0.359   2.581   1.00 13.03  ? 745  ARG A O   1 
ATOM   915  C CB  . ARG A 1 145 ? -4.516  0.034   1.385   1.00 13.42  ? 745  ARG A CB  1 
ATOM   916  C CG  . ARG A 1 145 ? -5.951  -0.472  1.431   1.00 23.32  ? 745  ARG A CG  1 
ATOM   917  C CD  . ARG A 1 145 ? -6.297  -1.038  0.073   1.00 30.63  ? 745  ARG A CD  1 
ATOM   918  N NE  . ARG A 1 145 ? -7.204  -2.179  0.139   1.00 41.56  ? 745  ARG A NE  1 
ATOM   919  C CZ  . ARG A 1 145 ? -6.973  -3.347  -0.448  1.00 56.74  ? 745  ARG A CZ  1 
ATOM   920  N NH1 . ARG A 1 145 ? -5.853  -3.543  -1.135  1.00 41.44  ? 745  ARG A NH1 1 
ATOM   921  N NH2 . ARG A 1 145 ? -7.859  -4.330  -0.354  1.00 45.67  ? 745  ARG A NH2 1 
ATOM   922  N N   . ASP A 1 146 ? -2.170  2.523   2.056   1.00 10.61  ? 746  ASP A N   1 
ATOM   923  C CA  . ASP A 1 146 ? -0.764  2.887   1.896   1.00 10.71  ? 746  ASP A CA  1 
ATOM   924  C C   . ASP A 1 146 ? -0.443  4.115   2.760   1.00 14.32  ? 746  ASP A C   1 
ATOM   925  O O   . ASP A 1 146 ? 0.301   4.985   2.316   1.00 14.54  ? 746  ASP A O   1 
ATOM   926  C CB  . ASP A 1 146 ? -0.486  3.186   0.398   1.00 13.24  ? 746  ASP A CB  1 
ATOM   927  C CG  . ASP A 1 146 ? 0.897   2.842   -0.127  1.00 29.08  ? 746  ASP A CG  1 
ATOM   928  O OD1 . ASP A 1 146 ? 1.806   2.577   0.698   1.00 30.77  ? 746  ASP A OD1 1 
ATOM   929  O OD2 . ASP A 1 146 ? 1.071   2.828   -1.360  1.00 38.32  ? 746  ASP A OD2 1 
ATOM   930  N N   . LEU A 1 147 ? -1.053  4.233   3.962   1.00 9.33   ? 747  LEU A N   1 
ATOM   931  C CA  . LEU A 1 147 ? -0.803  5.400   4.803   1.00 8.05   ? 747  LEU A CA  1 
ATOM   932  C C   . LEU A 1 147 ? 0.528   5.257   5.541   1.00 10.16  ? 747  LEU A C   1 
ATOM   933  O O   . LEU A 1 147 ? 0.743   4.287   6.277   1.00 9.70   ? 747  LEU A O   1 
ATOM   934  C CB  . LEU A 1 147 ? -1.991  5.700   5.731   1.00 7.98   ? 747  LEU A CB  1 
ATOM   935  C CG  . LEU A 1 147 ? -1.828  6.807   6.778   1.00 12.26  ? 747  LEU A CG  1 
ATOM   936  C CD1 . LEU A 1 147 ? -1.772  8.182   6.148   1.00 11.86  ? 747  LEU A CD1 1 
ATOM   937  C CD2 . LEU A 1 147 ? -2.938  6.751   7.764   1.00 14.11  ? 747  LEU A CD2 1 
ATOM   938  N N   . ALA A 1 148 ? 1.437   6.216   5.275   1.00 4.86   ? 748  ALA A N   1 
ATOM   939  C CA  . ALA A 1 148 ? 2.807   6.321   5.784   1.00 3.02   ? 748  ALA A CA  1 
ATOM   940  C C   . ALA A 1 148 ? 3.308   7.760   5.573   1.00 8.28   ? 748  ALA A C   1 
ATOM   941  O O   . ALA A 1 148 ? 2.747   8.501   4.758   1.00 7.22   ? 748  ALA A O   1 
ATOM   942  C CB  . ALA A 1 148 ? 3.706   5.345   5.049   1.00 3.21   ? 748  ALA A CB  1 
ATOM   943  N N   . ALA A 1 149 ? 4.362   8.158   6.311   1.00 7.52   ? 749  ALA A N   1 
ATOM   944  C CA  . ALA A 1 149 ? 4.949   9.505   6.260   1.00 7.29   ? 749  ALA A CA  1 
ATOM   945  C C   . ALA A 1 149 ? 5.519   9.892   4.891   1.00 12.83  ? 749  ALA A C   1 
ATOM   946  O O   . ALA A 1 149 ? 5.510   11.071  4.543   1.00 13.73  ? 749  ALA A O   1 
ATOM   947  C CB  . ALA A 1 149 ? 5.994   9.665   7.348   1.00 7.95   ? 749  ALA A CB  1 
ATOM   948  N N   . ARG A 1 150 ? 5.955   8.900   4.096   1.00 10.15  ? 750  ARG A N   1 
ATOM   949  C CA  . ARG A 1 150 ? 6.492   9.100   2.747   1.00 10.06  ? 750  ARG A CA  1 
ATOM   950  C C   . ARG A 1 150 ? 5.358   9.427   1.763   1.00 14.75  ? 750  ARG A C   1 
ATOM   951  O O   . ARG A 1 150 ? 5.612   9.927   0.667   1.00 14.66  ? 750  ARG A O   1 
ATOM   952  C CB  . ARG A 1 150 ? 7.308   7.863   2.294   1.00 11.77  ? 750  ARG A CB  1 
ATOM   953  C CG  . ARG A 1 150 ? 6.463   6.610   2.041   1.00 23.75  ? 750  ARG A CG  1 
ATOM   954  C CD  . ARG A 1 150 ? 7.254   5.371   1.638   1.00 24.32  ? 750  ARG A CD  1 
ATOM   955  N NE  . ARG A 1 150 ? 6.369   4.369   1.033   1.00 34.21  ? 750  ARG A NE  1 
ATOM   956  C CZ  . ARG A 1 150 ? 5.631   3.492   1.711   1.00 47.02  ? 750  ARG A CZ  1 
ATOM   957  N NH1 . ARG A 1 150 ? 5.684   3.452   3.035   1.00 37.11  ? 750  ARG A NH1 1 
ATOM   958  N NH2 . ARG A 1 150 ? 4.840   2.644   1.069   1.00 30.65  ? 750  ARG A NH2 1 
ATOM   959  N N   . ASN A 1 151 ? 4.108   9.134   2.177   1.00 11.04  ? 751  ASN A N   1 
ATOM   960  C CA  . ASN A 1 151 ? 2.871   9.347   1.430   1.00 9.92   ? 751  ASN A CA  1 
ATOM   961  C C   . ASN A 1 151 ? 2.142   10.614  1.885   1.00 11.23  ? 751  ASN A C   1 
ATOM   962  O O   . ASN A 1 151 ? 1.109   10.962  1.312   1.00 10.04  ? 751  ASN A O   1 
ATOM   963  C CB  . ASN A 1 151 ? 1.976   8.101   1.517   1.00 10.18  ? 751  ASN A CB  1 
ATOM   964  C CG  . ASN A 1 151 ? 2.585   6.903   0.839   1.00 24.19  ? 751  ASN A CG  1 
ATOM   965  O OD1 . ASN A 1 151 ? 3.010   6.962   -0.310  1.00 15.26  ? 751  ASN A OD1 1 
ATOM   966  N ND2 . ASN A 1 151 ? 2.741   5.817   1.563   1.00 21.56  ? 751  ASN A ND2 1 
ATOM   967  N N   . ILE A 1 152 ? 2.696   11.308  2.905   1.00 6.48   ? 752  ILE A N   1 
ATOM   968  C CA  . ILE A 1 152 ? 2.204   12.594  3.401   1.00 5.71   ? 752  ILE A CA  1 
ATOM   969  C C   . ILE A 1 152 ? 3.109   13.708  2.858   1.00 10.06  ? 752  ILE A C   1 
ATOM   970  O O   . ILE A 1 152 ? 4.339   13.587  2.905   1.00 10.49  ? 752  ILE A O   1 
ATOM   971  C CB  . ILE A 1 152 ? 2.021   12.654  4.948   1.00 8.39   ? 752  ILE A CB  1 
ATOM   972  C CG1 . ILE A 1 152 ? 1.238   11.421  5.508   1.00 8.71   ? 752  ILE A CG1 1 
ATOM   973  C CG2 . ILE A 1 152 ? 1.364   13.981  5.389   1.00 6.50   ? 752  ILE A CG2 1 
ATOM   974  C CD1 . ILE A 1 152 ? -0.159  11.136  4.885   1.00 10.96  ? 752  ILE A CD1 1 
ATOM   975  N N   . LEU A 1 153 ? 2.498   14.757  2.282   1.00 5.89   ? 753  LEU A N   1 
ATOM   976  C CA  . LEU A 1 153 ? 3.230   15.886  1.722   1.00 4.65   ? 753  LEU A CA  1 
ATOM   977  C C   . LEU A 1 153 ? 3.109   17.079  2.655   1.00 7.81   ? 753  LEU A C   1 
ATOM   978  O O   . LEU A 1 153 ? 2.134   17.174  3.398   1.00 5.67   ? 753  LEU A O   1 
ATOM   979  C CB  . LEU A 1 153 ? 2.762   16.231  0.290   1.00 4.48   ? 753  LEU A CB  1 
ATOM   980  C CG  . LEU A 1 153 ? 2.898   15.166  -0.823  1.00 9.34   ? 753  LEU A CG  1 
ATOM   981  C CD1 . LEU A 1 153 ? 2.568   15.770  -2.188  1.00 9.12   ? 753  LEU A CD1 1 
ATOM   982  C CD2 . LEU A 1 153 ? 4.303   14.547  -0.876  1.00 12.03  ? 753  LEU A CD2 1 
ATOM   983  N N   . VAL A 1 154 ? 4.125   17.968  2.645   1.00 7.20   ? 754  VAL A N   1 
ATOM   984  C CA  . VAL A 1 154 ? 4.196   19.155  3.522   1.00 7.35   ? 754  VAL A CA  1 
ATOM   985  C C   . VAL A 1 154 ? 4.466   20.428  2.740   1.00 11.23  ? 754  VAL A C   1 
ATOM   986  O O   . VAL A 1 154 ? 5.232   20.404  1.777   1.00 11.21  ? 754  VAL A O   1 
ATOM   987  C CB  . VAL A 1 154 ? 5.220   18.997  4.687   1.00 10.93  ? 754  VAL A CB  1 
ATOM   988  C CG1 . VAL A 1 154 ? 4.914   19.976  5.827   1.00 10.34  ? 754  VAL A CG1 1 
ATOM   989  C CG2 . VAL A 1 154 ? 5.262   17.568  5.215   1.00 10.43  ? 754  VAL A CG2 1 
ATOM   990  N N   . ASN A 1 155 ? 3.856   21.541  3.173   1.00 8.84   ? 755  ASN A N   1 
ATOM   991  C CA  . ASN A 1 155 ? 4.047   22.862  2.565   1.00 9.06   ? 755  ASN A CA  1 
ATOM   992  C C   . ASN A 1 155 ? 4.782   23.845  3.515   1.00 14.24  ? 755  ASN A C   1 
ATOM   993  O O   . ASN A 1 155 ? 5.216   23.448  4.601   1.00 13.89  ? 755  ASN A O   1 
ATOM   994  C CB  . ASN A 1 155 ? 2.710   23.433  2.028   1.00 5.16   ? 755  ASN A CB  1 
ATOM   995  C CG  . ASN A 1 155 ? 1.601   23.613  3.034   1.00 15.59  ? 755  ASN A CG  1 
ATOM   996  O OD1 . ASN A 1 155 ? 1.813   23.707  4.241   1.00 11.71  ? 755  ASN A OD1 1 
ATOM   997  N ND2 . ASN A 1 155 ? 0.375   23.710  2.544   1.00 7.51   ? 755  ASN A ND2 1 
ATOM   998  N N   . SER A 1 156 ? 4.934   25.117  3.104   1.00 12.68  ? 756  SER A N   1 
ATOM   999  C CA  . SER A 1 156 ? 5.591   26.152  3.919   1.00 12.66  ? 756  SER A CA  1 
ATOM   1000 C C   . SER A 1 156 ? 4.802   26.508  5.179   1.00 16.77  ? 756  SER A C   1 
ATOM   1001 O O   . SER A 1 156 ? 5.372   27.071  6.121   1.00 17.20  ? 756  SER A O   1 
ATOM   1002 C CB  . SER A 1 156 ? 5.932   27.393  3.098   1.00 15.23  ? 756  SER A CB  1 
ATOM   1003 O OG  . SER A 1 156 ? 4.920   27.716  2.162   1.00 24.57  ? 756  SER A OG  1 
ATOM   1004 N N   . ASN A 1 157 ? 3.504   26.142  5.225   1.00 11.92  ? 757  ASN A N   1 
ATOM   1005 C CA  . ASN A 1 157 ? 2.696   26.387  6.414   1.00 11.63  ? 757  ASN A CA  1 
ATOM   1006 C C   . ASN A 1 157 ? 2.781   25.239  7.442   1.00 16.22  ? 757  ASN A C   1 
ATOM   1007 O O   . ASN A 1 157 ? 2.127   25.304  8.487   1.00 17.50  ? 757  ASN A O   1 
ATOM   1008 C CB  . ASN A 1 157 ? 1.254   26.703  6.028   1.00 12.77  ? 757  ASN A CB  1 
ATOM   1009 C CG  . ASN A 1 157 ? 0.998   28.171  5.820   1.00 26.30  ? 757  ASN A CG  1 
ATOM   1010 O OD1 . ASN A 1 157 ? 1.575   29.024  6.494   1.00 25.18  ? 757  ASN A OD1 1 
ATOM   1011 N ND2 . ASN A 1 157 ? 0.098   28.501  4.914   1.00 9.37   ? 757  ASN A ND2 1 
ATOM   1012 N N   . LEU A 1 158 ? 3.615   24.209  7.162   1.00 11.14  ? 758  LEU A N   1 
ATOM   1013 C CA  . LEU A 1 158 ? 3.773   22.993  7.969   1.00 10.40  ? 758  LEU A CA  1 
ATOM   1014 C C   . LEU A 1 158 ? 2.506   22.124  7.893   1.00 13.20  ? 758  LEU A C   1 
ATOM   1015 O O   . LEU A 1 158 ? 2.311   21.257  8.740   1.00 12.27  ? 758  LEU A O   1 
ATOM   1016 C CB  . LEU A 1 158 ? 4.116   23.301  9.442   1.00 10.41  ? 758  LEU A CB  1 
ATOM   1017 C CG  . LEU A 1 158 ? 5.569   23.459  9.849   1.00 15.15  ? 758  LEU A CG  1 
ATOM   1018 C CD1 . LEU A 1 158 ? 5.675   23.613  11.369  1.00 15.29  ? 758  LEU A CD1 1 
ATOM   1019 C CD2 . LEU A 1 158 ? 6.404   22.271  9.404   1.00 18.07  ? 758  LEU A CD2 1 
ATOM   1020 N N   . VAL A 1 159 ? 1.646   22.364  6.876   1.00 9.68   ? 759  VAL A N   1 
ATOM   1021 C CA  . VAL A 1 159 ? 0.387   21.646  6.684   1.00 9.34   ? 759  VAL A CA  1 
ATOM   1022 C C   . VAL A 1 159 ? 0.639   20.313  5.984   1.00 12.44  ? 759  VAL A C   1 
ATOM   1023 O O   . VAL A 1 159 ? 1.251   20.257  4.911   1.00 11.86  ? 759  VAL A O   1 
ATOM   1024 C CB  . VAL A 1 159 ? -0.725  22.503  6.008   1.00 12.83  ? 759  VAL A CB  1 
ATOM   1025 C CG1 . VAL A 1 159 ? -2.030  21.719  5.871   1.00 13.03  ? 759  VAL A CG1 1 
ATOM   1026 C CG2 . VAL A 1 159 ? -0.967  23.790  6.787   1.00 12.05  ? 759  VAL A CG2 1 
ATOM   1027 N N   . CYS A 1 160 ? 0.167   19.246  6.626   1.00 7.80   ? 760  CYS A N   1 
ATOM   1028 C CA  . CYS A 1 160 ? 0.331   17.862  6.195   1.00 6.90   ? 760  CYS A CA  1 
ATOM   1029 C C   . CYS A 1 160 ? -0.878  17.355  5.434   1.00 10.71  ? 760  CYS A C   1 
ATOM   1030 O O   . CYS A 1 160 ? -2.016  17.468  5.904   1.00 10.86  ? 760  CYS A O   1 
ATOM   1031 C CB  . CYS A 1 160 ? 0.685   16.972  7.384   1.00 6.12   ? 760  CYS A CB  1 
ATOM   1032 S SG  . CYS A 1 160 ? 2.367   17.219  8.007   1.00 9.51   ? 760  CYS A SG  1 
ATOM   1033 N N   . LYS A 1 161 ? -0.629  16.855  4.215   1.00 6.37   ? 761  LYS A N   1 
ATOM   1034 C CA  . LYS A 1 161 ? -1.684  16.363  3.329   1.00 4.84   ? 761  LYS A CA  1 
ATOM   1035 C C   . LYS A 1 161 ? -1.419  14.968  2.821   1.00 9.23   ? 761  LYS A C   1 
ATOM   1036 O O   . LYS A 1 161 ? -0.290  14.648  2.438   1.00 9.74   ? 761  LYS A O   1 
ATOM   1037 C CB  . LYS A 1 161 ? -1.957  17.334  2.167   1.00 6.09   ? 761  LYS A CB  1 
ATOM   1038 C CG  . LYS A 1 161 ? -2.168  18.790  2.597   1.00 8.99   ? 761  LYS A CG  1 
ATOM   1039 C CD  . LYS A 1 161 ? -2.548  19.679  1.426   1.00 19.97  ? 761  LYS A CD  1 
ATOM   1040 C CE  . LYS A 1 161 ? -2.240  21.129  1.721   1.00 23.63  ? 761  LYS A CE  1 
ATOM   1041 N NZ  . LYS A 1 161 ? -3.460  21.958  1.802   1.00 19.77  ? 761  LYS A NZ  1 
ATOM   1042 N N   . VAL A 1 162 ? -2.464  14.129  2.850   1.00 6.06   ? 762  VAL A N   1 
ATOM   1043 C CA  . VAL A 1 162 ? -2.456  12.751  2.384   1.00 6.51   ? 762  VAL A CA  1 
ATOM   1044 C C   . VAL A 1 162 ? -2.312  12.730  0.857   1.00 14.08  ? 762  VAL A C   1 
ATOM   1045 O O   . VAL A 1 162 ? -3.016  13.458  0.154   1.00 13.06  ? 762  VAL A O   1 
ATOM   1046 C CB  . VAL A 1 162 ? -3.721  11.956  2.858   1.00 9.80   ? 762  VAL A CB  1 
ATOM   1047 C CG1 . VAL A 1 162 ? -3.707  10.519  2.351   1.00 9.13   ? 762  VAL A CG1 1 
ATOM   1048 C CG2 . VAL A 1 162 ? -3.857  11.971  4.374   1.00 9.68   ? 762  VAL A CG2 1 
ATOM   1049 N N   . SER A 1 163 ? -1.379  11.900  0.359   1.00 13.86  ? 763  SER A N   1 
ATOM   1050 C CA  . SER A 1 163 ? -1.145  11.697  -1.075  1.00 14.86  ? 763  SER A CA  1 
ATOM   1051 C C   . SER A 1 163 ? -1.161  10.189  -1.390  1.00 20.68  ? 763  SER A C   1 
ATOM   1052 O O   . SER A 1 163 ? -1.418  9.384   -0.488  1.00 19.82  ? 763  SER A O   1 
ATOM   1053 C CB  . SER A 1 163 ? 0.180   12.318  -1.512  1.00 17.38  ? 763  SER A CB  1 
ATOM   1054 O OG  . SER A 1 163 ? 0.205   12.407  -2.928  1.00 24.87  ? 763  SER A OG  1 
ATOM   1055 N N   . ASP A 1 164 ? -0.877  9.829   -2.667  1.00 18.93  ? 764  ASP A N   1 
ATOM   1056 C CA  . ASP A 1 164 ? -0.814  8.480   -3.233  1.00 20.25  ? 764  ASP A CA  1 
ATOM   1057 C C   . ASP A 1 164 ? -2.163  7.734   -3.145  1.00 26.24  ? 764  ASP A C   1 
ATOM   1058 O O   . ASP A 1 164 ? -2.394  6.935   -2.232  1.00 26.64  ? 764  ASP A O   1 
ATOM   1059 C CB  . ASP A 1 164 ? 0.354   7.661   -2.639  1.00 22.79  ? 764  ASP A CB  1 
ATOM   1060 C CG  . ASP A 1 164 ? 0.593   6.345   -3.352  1.00 40.00  ? 764  ASP A CG  1 
ATOM   1061 O OD1 . ASP A 1 164 ? 0.816   6.367   -4.589  1.00 42.50  ? 764  ASP A OD1 1 
ATOM   1062 O OD2 . ASP A 1 164 ? 0.536   5.293   -2.685  1.00 46.02  ? 764  ASP A OD2 1 
ATOM   1063 N N   . PHE A 1 165 ? -3.036  7.981   -4.129  1.00 23.65  ? 765  PHE A N   1 
ATOM   1064 C CA  . PHE A 1 165 ? -4.371  7.377   -4.203  1.00 50.19  ? 765  PHE A CA  1 
ATOM   1065 C C   . PHE A 1 165 ? -4.525  6.382   -5.353  1.00 90.13  ? 765  PHE A C   1 
ATOM   1066 O O   . PHE A 1 165 ? -3.549  5.776   -5.792  1.00 56.78  ? 765  PHE A O   1 
ATOM   1067 C CB  . PHE A 1 165 ? -5.441  8.477   -4.291  1.00 51.73  ? 765  PHE A CB  1 
ATOM   1068 C CG  . PHE A 1 165 ? -5.456  9.404   -3.099  1.00 52.94  ? 765  PHE A CG  1 
ATOM   1069 C CD1 . PHE A 1 165 ? -6.193  9.090   -1.965  1.00 55.59  ? 765  PHE A CD1 1 
ATOM   1070 C CD2 . PHE A 1 165 ? -4.719  10.581  -3.105  1.00 55.02  ? 765  PHE A CD2 1 
ATOM   1071 C CE1 . PHE A 1 165 ? -6.198  9.940   -0.860  1.00 56.43  ? 765  PHE A CE1 1 
ATOM   1072 C CE2 . PHE A 1 165 ? -4.731  11.436  -2.002  1.00 57.76  ? 765  PHE A CE2 1 
ATOM   1073 C CZ  . PHE A 1 165 ? -5.461  11.103  -0.883  1.00 55.77  ? 765  PHE A CZ  1 
ATOM   1074 N N   . PRO A 1 189 ? 3.144   -2.620  1.969   1.00 16.47  ? 789  PRO A N   1 
ATOM   1075 C CA  . PRO A 1 189 ? 3.828   -1.835  3.013   1.00 15.57  ? 789  PRO A CA  1 
ATOM   1076 C C   . PRO A 1 189 ? 3.604   -2.476  4.380   1.00 16.49  ? 789  PRO A C   1 
ATOM   1077 O O   . PRO A 1 189 ? 3.020   -1.883  5.281   1.00 15.35  ? 789  PRO A O   1 
ATOM   1078 C CB  . PRO A 1 189 ? 3.210   -0.431  2.880   1.00 17.65  ? 789  PRO A CB  1 
ATOM   1079 C CG  . PRO A 1 189 ? 1.928   -0.637  2.087   1.00 22.69  ? 789  PRO A CG  1 
ATOM   1080 C CD  . PRO A 1 189 ? 2.231   -1.786  1.167   1.00 18.27  ? 789  PRO A CD  1 
ATOM   1081 N N   . ILE A 1 190 ? 4.102   -3.717  4.505   1.00 13.30  ? 790  ILE A N   1 
ATOM   1082 C CA  . ILE A 1 190 ? 4.025   -4.646  5.643   1.00 11.34  ? 790  ILE A CA  1 
ATOM   1083 C C   . ILE A 1 190 ? 4.221   -3.963  6.997   1.00 13.65  ? 790  ILE A C   1 
ATOM   1084 O O   . ILE A 1 190 ? 3.401   -4.188  7.887   1.00 12.82  ? 790  ILE A O   1 
ATOM   1085 C CB  . ILE A 1 190 ? 5.027   -5.834  5.417   1.00 13.71  ? 790  ILE A CB  1 
ATOM   1086 C CG1 . ILE A 1 190 ? 4.559   -6.786  4.258   1.00 13.96  ? 790  ILE A CG1 1 
ATOM   1087 C CG2 . ILE A 1 190 ? 5.379   -6.622  6.702   1.00 12.80  ? 790  ILE A CG2 1 
ATOM   1088 C CD1 . ILE A 1 190 ? 3.398   -7.791  4.527   1.00 23.98  ? 790  ILE A CD1 1 
ATOM   1089 N N   . ARG A 1 191 ? 5.303   -3.153  7.169   1.00 10.55  ? 791  ARG A N   1 
ATOM   1090 C CA  . ARG A 1 191 ? 5.600   -2.560  8.471   1.00 9.78   ? 791  ARG A CA  1 
ATOM   1091 C C   . ARG A 1 191 ? 4.671   -1.395  8.843   1.00 12.07  ? 791  ARG A C   1 
ATOM   1092 O O   . ARG A 1 191 ? 4.792   -0.871  9.952   1.00 10.13  ? 791  ARG A O   1 
ATOM   1093 C CB  . ARG A 1 191 ? 7.080   -2.204  8.672   1.00 9.30   ? 791  ARG A CB  1 
ATOM   1094 C CG  . ARG A 1 191 ? 7.792   -1.519  7.551   1.00 18.64  ? 791  ARG A CG  1 
ATOM   1095 C CD  . ARG A 1 191 ? 9.234   -1.262  7.929   1.00 21.29  ? 791  ARG A CD  1 
ATOM   1096 N NE  . ARG A 1 191 ? 10.144  -2.226  7.311   1.00 27.28  ? 791  ARG A NE  1 
ATOM   1097 C CZ  . ARG A 1 191 ? 10.978  -3.027  7.972   1.00 34.98  ? 791  ARG A CZ  1 
ATOM   1098 N NH1 . ARG A 1 191 ? 11.031  -2.997  9.296   1.00 13.97  ? 791  ARG A NH1 1 
ATOM   1099 N NH2 . ARG A 1 191 ? 11.764  -3.863  7.311   1.00 26.29  ? 791  ARG A NH2 1 
ATOM   1100 N N   . TRP A 1 192 ? 3.692   -1.071  7.961   1.00 8.64   ? 792  TRP A N   1 
ATOM   1101 C CA  . TRP A 1 192 ? 2.642   -0.079  8.184   1.00 8.12   ? 792  TRP A CA  1 
ATOM   1102 C C   . TRP A 1 192 ? 1.288   -0.750  8.172   1.00 11.74  ? 792  TRP A C   1 
ATOM   1103 O O   . TRP A 1 192 ? 0.309   -0.102  8.504   1.00 11.38  ? 792  TRP A O   1 
ATOM   1104 C CB  . TRP A 1 192 ? 2.661   1.001   7.096   1.00 6.86   ? 792  TRP A CB  1 
ATOM   1105 C CG  . TRP A 1 192 ? 3.740   2.025   7.274   1.00 7.71   ? 792  TRP A CG  1 
ATOM   1106 C CD1 . TRP A 1 192 ? 3.644   3.214   7.935   1.00 10.32  ? 792  TRP A CD1 1 
ATOM   1107 C CD2 . TRP A 1 192 ? 5.077   1.956   6.759   1.00 7.63   ? 792  TRP A CD2 1 
ATOM   1108 N NE1 . TRP A 1 192 ? 4.855   3.864   7.915   1.00 9.51   ? 792  TRP A NE1 1 
ATOM   1109 C CE2 . TRP A 1 192 ? 5.750   3.124   7.181   1.00 11.08  ? 792  TRP A CE2 1 
ATOM   1110 C CE3 . TRP A 1 192 ? 5.783   1.005   5.994   1.00 9.02   ? 792  TRP A CE3 1 
ATOM   1111 C CZ2 . TRP A 1 192 ? 7.088   3.382   6.847   1.00 10.17  ? 792  TRP A CZ2 1 
ATOM   1112 C CZ3 . TRP A 1 192 ? 7.101   1.274   5.642   1.00 10.20  ? 792  TRP A CZ3 1 
ATOM   1113 C CH2 . TRP A 1 192 ? 7.740   2.448   6.070   1.00 10.63  ? 792  TRP A CH2 1 
ATOM   1114 N N   . THR A 1 193 ? 1.214   -2.040  7.766   1.00 8.37   ? 793  THR A N   1 
ATOM   1115 C CA  . THR A 1 193 ? -0.060  -2.746  7.606   1.00 7.80   ? 793  THR A CA  1 
ATOM   1116 C C   . THR A 1 193 ? -0.496  -3.462  8.883   1.00 12.21  ? 793  THR A C   1 
ATOM   1117 O O   . THR A 1 193 ? 0.312   -4.100  9.568   1.00 11.65  ? 793  THR A O   1 
ATOM   1118 C CB  . THR A 1 193 ? -0.010  -3.671  6.366   1.00 11.52  ? 793  THR A CB  1 
ATOM   1119 O OG1 . THR A 1 193 ? 0.306   -2.886  5.217   1.00 9.71   ? 793  THR A OG1 1 
ATOM   1120 C CG2 . THR A 1 193 ? -1.335  -4.349  6.080   1.00 7.26   ? 793  THR A CG2 1 
ATOM   1121 N N   . ALA A 1 194 ? -1.803  -3.362  9.180   1.00 9.78   ? 794  ALA A N   1 
ATOM   1122 C CA  . ALA A 1 194 ? -2.442  -3.997  10.324  1.00 9.60   ? 794  ALA A CA  1 
ATOM   1123 C C   . ALA A 1 194 ? -2.308  -5.537  10.237  1.00 13.86  ? 794  ALA A C   1 
ATOM   1124 O O   . ALA A 1 194 ? -2.210  -6.066  9.119   1.00 13.33  ? 794  ALA A O   1 
ATOM   1125 C CB  . ALA A 1 194 ? -3.902  -3.592  10.377  1.00 10.37  ? 794  ALA A CB  1 
ATOM   1126 N N   . PRO A 1 195 ? -2.249  -6.268  11.384  1.00 9.91   ? 795  PRO A N   1 
ATOM   1127 C CA  . PRO A 1 195 ? -2.114  -7.737  11.314  1.00 9.47   ? 795  PRO A CA  1 
ATOM   1128 C C   . PRO A 1 195 ? -3.205  -8.424  10.497  1.00 11.35  ? 795  PRO A C   1 
ATOM   1129 O O   . PRO A 1 195 ? -2.853  -9.109  9.541   1.00 11.06  ? 795  PRO A O   1 
ATOM   1130 C CB  . PRO A 1 195 ? -2.102  -8.186  12.787  1.00 11.39  ? 795  PRO A CB  1 
ATOM   1131 C CG  . PRO A 1 195 ? -2.693  -7.049  13.546  1.00 16.28  ? 795  PRO A CG  1 
ATOM   1132 C CD  . PRO A 1 195 ? -2.330  -5.805  12.781  1.00 11.62  ? 795  PRO A CD  1 
ATOM   1133 N N   . GLU A 1 196 ? -4.514  -8.182  10.814  1.00 5.90   ? 796  GLU A N   1 
ATOM   1134 C CA  . GLU A 1 196 ? -5.680  -8.758  10.111  1.00 4.43   ? 796  GLU A CA  1 
ATOM   1135 C C   . GLU A 1 196 ? -5.634  -8.578  8.579   1.00 6.04   ? 796  GLU A C   1 
ATOM   1136 O O   . GLU A 1 196 ? -6.090  -9.462  7.849   1.00 5.07   ? 796  GLU A O   1 
ATOM   1137 C CB  . GLU A 1 196 ? -7.015  -8.235  10.694  1.00 5.65   ? 796  GLU A CB  1 
ATOM   1138 C CG  . GLU A 1 196 ? -7.383  -6.788  10.364  1.00 11.88  ? 796  GLU A CG  1 
ATOM   1139 C CD  . GLU A 1 196 ? -6.770  -5.679  11.207  1.00 20.52  ? 796  GLU A CD  1 
ATOM   1140 O OE1 . GLU A 1 196 ? -5.780  -5.937  11.924  1.00 4.27   ? 796  GLU A OE1 1 
ATOM   1141 O OE2 . GLU A 1 196 ? -7.274  -4.537  11.135  1.00 10.76  ? 796  GLU A OE2 1 
ATOM   1142 N N   . ALA A 1 197 ? -5.055  -7.459  8.106   1.00 3.00   ? 797  ALA A N   1 
ATOM   1143 C CA  . ALA A 1 197 ? -4.894  -7.152  6.676   1.00 3.47   ? 797  ALA A CA  1 
ATOM   1144 C C   . ALA A 1 197 ? -3.772  -8.003  6.027   1.00 7.69   ? 797  ALA A C   1 
ATOM   1145 O O   . ALA A 1 197 ? -3.870  -8.359  4.852   1.00 6.86   ? 797  ALA A O   1 
ATOM   1146 C CB  . ALA A 1 197 ? -4.618  -5.670  6.493   1.00 4.19   ? 797  ALA A CB  1 
ATOM   1147 N N   . ILE A 1 198 ? -2.727  -8.342  6.803   1.00 4.86   ? 798  ILE A N   1 
ATOM   1148 C CA  . ILE A 1 198 ? -1.627  -9.210  6.351   1.00 5.33   ? 798  ILE A CA  1 
ATOM   1149 C C   . ILE A 1 198 ? -2.138  -10.672 6.307   1.00 9.65   ? 798  ILE A C   1 
ATOM   1150 O O   . ILE A 1 198 ? -1.913  -11.359 5.317   1.00 9.07   ? 798  ILE A O   1 
ATOM   1151 C CB  . ILE A 1 198 ? -0.346  -9.037  7.256   1.00 8.01   ? 798  ILE A CB  1 
ATOM   1152 C CG1 . ILE A 1 198 ? 0.306   -7.643  7.045   1.00 8.77   ? 798  ILE A CG1 1 
ATOM   1153 C CG2 . ILE A 1 198 ? 0.697   -10.184 7.048   1.00 7.61   ? 798  ILE A CG2 1 
ATOM   1154 C CD1 . ILE A 1 198 ? 1.262   -7.196  8.217   1.00 18.17  ? 798  ILE A CD1 1 
ATOM   1155 N N   . GLN A 1 199 ? -2.837  -11.111 7.379   1.00 7.74   ? 799  GLN A N   1 
ATOM   1156 C CA  . GLN A 1 199 ? -3.364  -12.467 7.617   1.00 8.19   ? 799  GLN A CA  1 
ATOM   1157 C C   . GLN A 1 199 ? -4.539  -12.876 6.752   1.00 15.41  ? 799  GLN A C   1 
ATOM   1158 O O   . GLN A 1 199 ? -4.538  -13.998 6.230   1.00 15.99  ? 799  GLN A O   1 
ATOM   1159 C CB  . GLN A 1 199 ? -3.782  -12.640 9.088   1.00 9.00   ? 799  GLN A CB  1 
ATOM   1160 C CG  . GLN A 1 199 ? -2.688  -12.365 10.101  1.00 15.26  ? 799  GLN A CG  1 
ATOM   1161 C CD  . GLN A 1 199 ? -3.238  -12.224 11.494  1.00 36.16  ? 799  GLN A CD  1 
ATOM   1162 O OE1 . GLN A 1 199 ? -4.265  -11.577 11.737  1.00 34.28  ? 799  GLN A OE1 1 
ATOM   1163 N NE2 . GLN A 1 199 ? -2.534  -12.792 12.451  1.00 28.07  ? 799  GLN A NE2 1 
ATOM   1164 N N   . TYR A 1 200 ? -5.600  -12.030 6.672   1.00 12.32  ? 800  TYR A N   1 
ATOM   1165 C CA  . TYR A 1 200 ? -6.762  -12.427 5.881   1.00 10.60  ? 800  TYR A CA  1 
ATOM   1166 C C   . TYR A 1 200 ? -7.274  -11.302 4.957   1.00 11.57  ? 800  TYR A C   1 
ATOM   1167 O O   . TYR A 1 200 ? -8.454  -11.288 4.574   1.00 9.42   ? 800  TYR A O   1 
ATOM   1168 C CB  . TYR A 1 200 ? -7.868  -13.041 6.766   1.00 11.20  ? 800  TYR A CB  1 
ATOM   1169 C CG  . TYR A 1 200 ? -8.302  -12.248 7.981   1.00 12.85  ? 800  TYR A CG  1 
ATOM   1170 C CD1 . TYR A 1 200 ? -7.636  -12.381 9.201   1.00 14.73  ? 800  TYR A CD1 1 
ATOM   1171 C CD2 . TYR A 1 200 ? -9.483  -11.509 7.965   1.00 13.61  ? 800  TYR A CD2 1 
ATOM   1172 C CE1 . TYR A 1 200 ? -8.087  -11.726 10.351  1.00 13.92  ? 800  TYR A CE1 1 
ATOM   1173 C CE2 . TYR A 1 200 ? -9.932  -10.835 9.100   1.00 14.76  ? 800  TYR A CE2 1 
ATOM   1174 C CZ  . TYR A 1 200 ? -9.238  -10.957 10.294  1.00 23.17  ? 800  TYR A CZ  1 
ATOM   1175 O OH  . TYR A 1 200 ? -9.678  -10.268 11.399  1.00 27.42  ? 800  TYR A OH  1 
ATOM   1176 N N   . ARG A 1 201 ? -6.344  -10.418 4.528   1.00 7.73   ? 801  ARG A N   1 
ATOM   1177 C CA  . ARG A 1 201 ? -6.565  -9.297  3.598   1.00 7.84   ? 801  ARG A CA  1 
ATOM   1178 C C   . ARG A 1 201 ? -7.785  -8.421  3.962   1.00 10.23  ? 801  ARG A C   1 
ATOM   1179 O O   . ARG A 1 201 ? -8.546  -8.006  3.083   1.00 7.64   ? 801  ARG A O   1 
ATOM   1180 C CB  . ARG A 1 201 ? -6.635  -9.799  2.137   1.00 9.45   ? 801  ARG A CB  1 
ATOM   1181 N N   . LYS A 1 202 ? -7.974  -8.167  5.268   1.00 8.84   ? 802  LYS A N   1 
ATOM   1182 C CA  . LYS A 1 202 ? -9.088  -7.358  5.751   1.00 9.17   ? 802  LYS A CA  1 
ATOM   1183 C C   . LYS A 1 202 ? -8.642  -5.899  5.864   1.00 13.44  ? 802  LYS A C   1 
ATOM   1184 O O   . LYS A 1 202 ? -7.867  -5.560  6.755   1.00 14.15  ? 802  LYS A O   1 
ATOM   1185 C CB  . LYS A 1 202 ? -9.641  -7.934  7.075   1.00 11.16  ? 802  LYS A CB  1 
ATOM   1186 C CG  . LYS A 1 202 ? -10.814 -7.185  7.714   1.00 14.65  ? 802  LYS A CG  1 
ATOM   1187 C CD  . LYS A 1 202 ? -12.037 -7.031  6.799   1.00 15.99  ? 802  LYS A CD  1 
ATOM   1188 C CE  . LYS A 1 202 ? -13.233 -6.639  7.620   1.00 23.97  ? 802  LYS A CE  1 
ATOM   1189 N NZ  . LYS A 1 202 ? -14.314 -6.037  6.789   1.00 25.79  ? 802  LYS A NZ  1 
ATOM   1190 N N   . PHE A 1 203 ? -9.112  -5.055  4.938   1.00 9.44   ? 803  PHE A N   1 
ATOM   1191 C CA  . PHE A 1 203 ? -8.781  -3.632  4.875   1.00 9.76   ? 803  PHE A CA  1 
ATOM   1192 C C   . PHE A 1 203 ? -10.003 -2.776  5.119   1.00 14.54  ? 803  PHE A C   1 
ATOM   1193 O O   . PHE A 1 203 ? -11.009 -2.893  4.422   1.00 13.91  ? 803  PHE A O   1 
ATOM   1194 C CB  . PHE A 1 203 ? -8.121  -3.261  3.534   1.00 11.18  ? 803  PHE A CB  1 
ATOM   1195 C CG  . PHE A 1 203 ? -6.756  -3.860  3.294   1.00 12.01  ? 803  PHE A CG  1 
ATOM   1196 C CD1 . PHE A 1 203 ? -6.622  -5.099  2.675   1.00 13.16  ? 803  PHE A CD1 1 
ATOM   1197 C CD2 . PHE A 1 203 ? -5.602  -3.174  3.665   1.00 14.06  ? 803  PHE A CD2 1 
ATOM   1198 C CE1 . PHE A 1 203 ? -5.356  -5.647  2.442   1.00 15.57  ? 803  PHE A CE1 1 
ATOM   1199 C CE2 . PHE A 1 203 ? -4.337  -3.714  3.417   1.00 14.56  ? 803  PHE A CE2 1 
ATOM   1200 C CZ  . PHE A 1 203 ? -4.223  -4.948  2.809   1.00 13.58  ? 803  PHE A CZ  1 
ATOM   1201 N N   . THR A 1 204 ? -9.912  -1.941  6.151   1.00 11.65  ? 804  THR A N   1 
ATOM   1202 C CA  . THR A 1 204 ? -10.941 -1.020  6.626   1.00 10.45  ? 804  THR A CA  1 
ATOM   1203 C C   . THR A 1 204 ? -10.234 0.250   7.092   1.00 13.04  ? 804  THR A C   1 
ATOM   1204 O O   . THR A 1 204 ? -9.000  0.319   7.072   1.00 10.16  ? 804  THR A O   1 
ATOM   1205 C CB  . THR A 1 204 ? -11.689 -1.630  7.831   1.00 16.12  ? 804  THR A CB  1 
ATOM   1206 O OG1 . THR A 1 204 ? -10.743 -2.058  8.808   1.00 15.66  ? 804  THR A OG1 1 
ATOM   1207 C CG2 . THR A 1 204 ? -12.601 -2.783  7.455   1.00 17.82  ? 804  THR A CG2 1 
ATOM   1208 N N   . SER A 1 205 ? -11.013 1.231   7.575   1.00 10.73  ? 805  SER A N   1 
ATOM   1209 C CA  . SER A 1 205 ? -10.468 2.466   8.124   1.00 10.99  ? 805  SER A CA  1 
ATOM   1210 C C   . SER A 1 205 ? -9.818  2.223   9.515   1.00 13.38  ? 805  SER A C   1 
ATOM   1211 O O   . SER A 1 205 ? -9.070  3.071   9.987   1.00 12.62  ? 805  SER A O   1 
ATOM   1212 C CB  . SER A 1 205 ? -11.525 3.568   8.132   1.00 15.65  ? 805  SER A CB  1 
ATOM   1213 O OG  . SER A 1 205 ? -11.974 3.815   6.805   1.00 22.07  ? 805  SER A OG  1 
ATOM   1214 N N   . ALA A 1 206 ? -10.064 1.034   10.129  1.00 9.32   ? 806  ALA A N   1 
ATOM   1215 C CA  . ALA A 1 206 ? -9.446  0.605   11.394  1.00 8.15   ? 806  ALA A CA  1 
ATOM   1216 C C   . ALA A 1 206 ? -8.030  0.038   11.089  1.00 9.02   ? 806  ALA A C   1 
ATOM   1217 O O   . ALA A 1 206 ? -7.144  0.127   11.932  1.00 8.10   ? 806  ALA A O   1 
ATOM   1218 C CB  . ALA A 1 206 ? -10.311 -0.432  12.090  1.00 8.70   ? 806  ALA A CB  1 
ATOM   1219 N N   . SER A 1 207 ? -7.817  -0.501  9.867   1.00 4.24   ? 807  SER A N   1 
ATOM   1220 C CA  . SER A 1 207 ? -6.489  -0.935  9.428   1.00 3.08   ? 807  SER A CA  1 
ATOM   1221 C C   . SER A 1 207 ? -5.664  0.316   8.986   1.00 7.33   ? 807  SER A C   1 
ATOM   1222 O O   . SER A 1 207 ? -4.443  0.324   9.088   1.00 7.94   ? 807  SER A O   1 
ATOM   1223 C CB  . SER A 1 207 ? -6.558  -2.044  8.378   1.00 3.31   ? 807  SER A CB  1 
ATOM   1224 O OG  . SER A 1 207 ? -7.286  -1.758  7.198   1.00 7.81   ? 807  SER A OG  1 
ATOM   1225 N N   . ASP A 1 208 ? -6.359  1.404   8.616   1.00 3.62   ? 808  ASP A N   1 
ATOM   1226 C CA  . ASP A 1 208 ? -5.755  2.696   8.271   1.00 3.13   ? 808  ASP A CA  1 
ATOM   1227 C C   . ASP A 1 208 ? -5.371  3.431   9.547   1.00 7.08   ? 808  ASP A C   1 
ATOM   1228 O O   . ASP A 1 208 ? -4.398  4.182   9.550   1.00 7.10   ? 808  ASP A O   1 
ATOM   1229 C CB  . ASP A 1 208 ? -6.718  3.548   7.451   1.00 3.95   ? 808  ASP A CB  1 
ATOM   1230 C CG  . ASP A 1 208 ? -6.594  3.415   5.953   1.00 5.12   ? 808  ASP A CG  1 
ATOM   1231 O OD1 . ASP A 1 208 ? -5.696  2.658   5.485   1.00 4.47   ? 808  ASP A OD1 1 
ATOM   1232 O OD2 . ASP A 1 208 ? -7.383  4.065   5.242   1.00 5.68   ? 808  ASP A OD2 1 
ATOM   1233 N N   . VAL A 1 209 ? -6.128  3.187   10.636  1.00 3.46   ? 809  VAL A N   1 
ATOM   1234 C CA  . VAL A 1 209 ? -5.876  3.721   11.982  1.00 3.21   ? 809  VAL A CA  1 
ATOM   1235 C C   . VAL A 1 209 ? -4.563  3.099   12.513  1.00 6.38   ? 809  VAL A C   1 
ATOM   1236 O O   . VAL A 1 209 ? -3.753  3.817   13.104  1.00 5.58   ? 809  VAL A O   1 
ATOM   1237 C CB  . VAL A 1 209 ? -7.117  3.551   12.926  1.00 5.74   ? 809  VAL A CB  1 
ATOM   1238 C CG1 . VAL A 1 209 ? -6.725  3.503   14.397  1.00 4.73   ? 809  VAL A CG1 1 
ATOM   1239 C CG2 . VAL A 1 209 ? -8.132  4.660   12.686  1.00 5.59   ? 809  VAL A CG2 1 
ATOM   1240 N N   . TRP A 1 210 ? -4.327  1.798   12.232  1.00 3.68   ? 810  TRP A N   1 
ATOM   1241 C CA  . TRP A 1 210 ? -3.074  1.101   12.588  1.00 4.38   ? 810  TRP A CA  1 
ATOM   1242 C C   . TRP A 1 210 ? -1.914  1.801   11.872  1.00 9.64   ? 810  TRP A C   1 
ATOM   1243 O O   . TRP A 1 210 ? -0.890  2.093   12.489  1.00 9.27   ? 810  TRP A O   1 
ATOM   1244 C CB  . TRP A 1 210 ? -3.105  -0.395  12.195  1.00 3.00   ? 810  TRP A CB  1 
ATOM   1245 C CG  . TRP A 1 210 ? -1.822  -1.131  12.499  1.00 3.81   ? 810  TRP A CG  1 
ATOM   1246 C CD1 . TRP A 1 210 ? -0.633  -1.033  11.827  1.00 6.51   ? 810  TRP A CD1 1 
ATOM   1247 C CD2 . TRP A 1 210 ? -1.615  -2.098  13.538  1.00 3.47   ? 810  TRP A CD2 1 
ATOM   1248 N NE1 . TRP A 1 210 ? 0.312   -1.840  12.415  1.00 5.22   ? 810  TRP A NE1 1 
ATOM   1249 C CE2 . TRP A 1 210 ? -0.258  -2.494  13.477  1.00 6.69   ? 810  TRP A CE2 1 
ATOM   1250 C CE3 . TRP A 1 210 ? -2.443  -2.655  14.532  1.00 4.58   ? 810  TRP A CE3 1 
ATOM   1251 C CZ2 . TRP A 1 210 ? 0.288   -3.424  14.367  1.00 5.88   ? 810  TRP A CZ2 1 
ATOM   1252 C CZ3 . TRP A 1 210 ? -1.898  -3.577  15.413  1.00 5.91   ? 810  TRP A CZ3 1 
ATOM   1253 C CH2 . TRP A 1 210 ? -0.546  -3.936  15.339  1.00 6.70   ? 810  TRP A CH2 1 
ATOM   1254 N N   . SER A 1 211 ? -2.090  2.066   10.563  1.00 6.70   ? 811  SER A N   1 
ATOM   1255 C CA  . SER A 1 211 ? -1.100  2.727   9.710   1.00 4.99   ? 811  SER A CA  1 
ATOM   1256 C C   . SER A 1 211 ? -0.823  4.138   10.232  1.00 6.06   ? 811  SER A C   1 
ATOM   1257 O O   . SER A 1 211 ? 0.328   4.565   10.279  1.00 5.52   ? 811  SER A O   1 
ATOM   1258 C CB  . SER A 1 211 ? -1.600  2.774   8.272   1.00 6.89   ? 811  SER A CB  1 
ATOM   1259 O OG  . SER A 1 211 ? -1.451  1.515   7.640   1.00 8.09   ? 811  SER A OG  1 
ATOM   1260 N N   . TYR A 1 212 ? -1.876  4.825   10.673  1.00 3.00   ? 812  TYR A N   1 
ATOM   1261 C CA  . TYR A 1 212 ? -1.799  6.156   11.260  1.00 3.00   ? 812  TYR A CA  1 
ATOM   1262 C C   . TYR A 1 212 ? -0.933  6.133   12.532  1.00 5.64   ? 812  TYR A C   1 
ATOM   1263 O O   . TYR A 1 212 ? -0.156  7.061   12.756  1.00 4.58   ? 812  TYR A O   1 
ATOM   1264 C CB  . TYR A 1 212 ? -3.199  6.746   11.504  1.00 3.00   ? 812  TYR A CB  1 
ATOM   1265 C CG  . TYR A 1 212 ? -3.133  8.079   12.207  1.00 3.00   ? 812  TYR A CG  1 
ATOM   1266 C CD1 . TYR A 1 212 ? -2.921  9.258   11.491  1.00 3.85   ? 812  TYR A CD1 1 
ATOM   1267 C CD2 . TYR A 1 212 ? -3.169  8.156   13.599  1.00 3.56   ? 812  TYR A CD2 1 
ATOM   1268 C CE1 . TYR A 1 212 ? -2.760  10.481  12.144  1.00 3.00   ? 812  TYR A CE1 1 
ATOM   1269 C CE2 . TYR A 1 212 ? -2.996  9.368   14.260  1.00 4.09   ? 812  TYR A CE2 1 
ATOM   1270 C CZ  . TYR A 1 212 ? -2.804  10.527  13.530  1.00 6.57   ? 812  TYR A CZ  1 
ATOM   1271 O OH  . TYR A 1 212 ? -2.660  11.704  14.209  1.00 5.37   ? 812  TYR A OH  1 
ATOM   1272 N N   . GLY A 1 213 ? -1.063  5.062   13.317  1.00 3.00   ? 813  GLY A N   1 
ATOM   1273 C CA  . GLY A 1 213 ? -0.275  4.829   14.521  1.00 3.00   ? 813  GLY A CA  1 
ATOM   1274 C C   . GLY A 1 213 ? 1.213   4.706   14.238  1.00 6.35   ? 813  GLY A C   1 
ATOM   1275 O O   . GLY A 1 213 ? 2.024   5.167   15.036  1.00 5.40   ? 813  GLY A O   1 
ATOM   1276 N N   . ILE A 1 214 ? 1.577   4.120   13.070  1.00 3.99   ? 814  ILE A N   1 
ATOM   1277 C CA  . ILE A 1 214 ? 2.967   3.957   12.601  1.00 4.17   ? 814  ILE A CA  1 
ATOM   1278 C C   . ILE A 1 214 ? 3.521   5.331   12.147  1.00 10.13  ? 814  ILE A C   1 
ATOM   1279 O O   . ILE A 1 214 ? 4.687   5.643   12.427  1.00 11.11  ? 814  ILE A O   1 
ATOM   1280 C CB  . ILE A 1 214 ? 3.095   2.821   11.522  1.00 7.24   ? 814  ILE A CB  1 
ATOM   1281 C CG1 . ILE A 1 214 ? 2.434   1.475   11.975  1.00 6.62   ? 814  ILE A CG1 1 
ATOM   1282 C CG2 . ILE A 1 214 ? 4.556   2.605   11.086  1.00 9.19   ? 814  ILE A CG2 1 
ATOM   1283 C CD1 . ILE A 1 214 ? 3.210   0.645   13.029  1.00 15.33  ? 814  ILE A CD1 1 
ATOM   1284 N N   . VAL A 1 215 ? 2.656   6.160   11.495  1.00 6.36   ? 815  VAL A N   1 
ATOM   1285 C CA  . VAL A 1 215 ? 2.919   7.548   11.072  1.00 5.36   ? 815  VAL A CA  1 
ATOM   1286 C C   . VAL A 1 215 ? 3.157   8.376   12.346  1.00 8.20   ? 815  VAL A C   1 
ATOM   1287 O O   . VAL A 1 215 ? 4.066   9.190   12.360  1.00 8.61   ? 815  VAL A O   1 
ATOM   1288 C CB  . VAL A 1 215 ? 1.748   8.169   10.247  1.00 8.03   ? 815  VAL A CB  1 
ATOM   1289 C CG1 . VAL A 1 215 ? 2.023   9.630   9.899   1.00 7.43   ? 815  VAL A CG1 1 
ATOM   1290 C CG2 . VAL A 1 215 ? 1.454   7.373   8.989   1.00 7.76   ? 815  VAL A CG2 1 
ATOM   1291 N N   . MET A 1 216 ? 2.335   8.175   13.405  1.00 4.02   ? 816  MET A N   1 
ATOM   1292 C CA  . MET A 1 216 ? 2.487   8.863   14.704  1.00 3.24   ? 816  MET A CA  1 
ATOM   1293 C C   . MET A 1 216 ? 3.865   8.620   15.270  1.00 8.91   ? 816  MET A C   1 
ATOM   1294 O O   . MET A 1 216 ? 4.517   9.559   15.733  1.00 9.62   ? 816  MET A O   1 
ATOM   1295 C CB  . MET A 1 216 ? 1.461   8.365   15.724  1.00 4.58   ? 816  MET A CB  1 
ATOM   1296 C CG  . MET A 1 216 ? 0.179   9.096   15.687  1.00 6.45   ? 816  MET A CG  1 
ATOM   1297 S SD  . MET A 1 216 ? -0.853  8.598   17.059  1.00 9.65   ? 816  MET A SD  1 
ATOM   1298 C CE  . MET A 1 216 ? -0.126  9.588   18.403  1.00 5.60   ? 816  MET A CE  1 
ATOM   1299 N N   . TRP A 1 217 ? 4.303   7.349   15.216  1.00 5.16   ? 817  TRP A N   1 
ATOM   1300 C CA  . TRP A 1 217 ? 5.613   6.935   15.669  1.00 5.63   ? 817  TRP A CA  1 
ATOM   1301 C C   . TRP A 1 217 ? 6.677   7.565   14.767  1.00 10.39  ? 817  TRP A C   1 
ATOM   1302 O O   . TRP A 1 217 ? 7.716   7.973   15.272  1.00 10.47  ? 817  TRP A O   1 
ATOM   1303 C CB  . TRP A 1 217 ? 5.715   5.393   15.671  1.00 4.09   ? 817  TRP A CB  1 
ATOM   1304 C CG  . TRP A 1 217 ? 6.999   4.894   16.263  1.00 4.71   ? 817  TRP A CG  1 
ATOM   1305 C CD1 . TRP A 1 217 ? 7.242   4.605   17.575  1.00 7.83   ? 817  TRP A CD1 1 
ATOM   1306 C CD2 . TRP A 1 217 ? 8.243   4.714   15.572  1.00 4.60   ? 817  TRP A CD2 1 
ATOM   1307 N NE1 . TRP A 1 217 ? 8.559   4.232   17.742  1.00 7.68   ? 817  TRP A NE1 1 
ATOM   1308 C CE2 . TRP A 1 217 ? 9.194   4.285   16.526  1.00 8.58   ? 817  TRP A CE2 1 
ATOM   1309 C CE3 . TRP A 1 217 ? 8.649   4.874   14.235  1.00 5.93   ? 817  TRP A CE3 1 
ATOM   1310 C CZ2 . TRP A 1 217 ? 10.513  3.984   16.181  1.00 7.61   ? 817  TRP A CZ2 1 
ATOM   1311 C CZ3 . TRP A 1 217 ? 9.963   4.586   13.899  1.00 7.57   ? 817  TRP A CZ3 1 
ATOM   1312 C CH2 . TRP A 1 217 ? 10.865  4.104   14.857  1.00 7.99   ? 817  TRP A CH2 1 
ATOM   1313 N N   . GLU A 1 218 ? 6.422   7.623   13.433  1.00 7.19   ? 818  GLU A N   1 
ATOM   1314 C CA  . GLU A 1 218 ? 7.339   8.208   12.449  1.00 6.22   ? 818  GLU A CA  1 
ATOM   1315 C C   . GLU A 1 218 ? 7.561   9.692   12.711  1.00 7.82   ? 818  GLU A C   1 
ATOM   1316 O O   . GLU A 1 218 ? 8.697   10.134  12.702  1.00 8.12   ? 818  GLU A O   1 
ATOM   1317 C CB  . GLU A 1 218 ? 6.834   7.996   11.023  1.00 7.67   ? 818  GLU A CB  1 
ATOM   1318 C CG  . GLU A 1 218 ? 7.150   6.637   10.428  1.00 14.31  ? 818  GLU A CG  1 
ATOM   1319 C CD  . GLU A 1 218 ? 6.637   6.500   9.010   1.00 19.51  ? 818  GLU A CD  1 
ATOM   1320 O OE1 . GLU A 1 218 ? 5.400   6.462   8.828   1.00 3.00   ? 818  GLU A OE1 1 
ATOM   1321 O OE2 . GLU A 1 218 ? 7.469   6.496   8.075   1.00 14.02  ? 818  GLU A OE2 1 
ATOM   1322 N N   . VAL A 1 219 ? 6.493   10.437  12.990  1.00 3.00   ? 819  VAL A N   1 
ATOM   1323 C CA  . VAL A 1 219 ? 6.521   11.872  13.287  1.00 3.00   ? 819  VAL A CA  1 
ATOM   1324 C C   . VAL A 1 219 ? 7.332   12.181  14.556  1.00 7.17   ? 819  VAL A C   1 
ATOM   1325 O O   . VAL A 1 219 ? 8.278   12.974  14.499  1.00 6.05   ? 819  VAL A O   1 
ATOM   1326 C CB  . VAL A 1 219 ? 5.077   12.445  13.324  1.00 6.49   ? 819  VAL A CB  1 
ATOM   1327 C CG1 . VAL A 1 219 ? 5.033   13.857  13.916  1.00 5.96   ? 819  VAL A CG1 1 
ATOM   1328 C CG2 . VAL A 1 219 ? 4.450   12.413  11.929  1.00 6.30   ? 819  VAL A CG2 1 
ATOM   1329 N N   . MET A 1 220 ? 7.019   11.479  15.660  1.00 5.93   ? 820  MET A N   1 
ATOM   1330 C CA  . MET A 1 220 ? 7.659   11.646  16.972  1.00 6.62   ? 820  MET A CA  1 
ATOM   1331 C C   . MET A 1 220 ? 9.103   11.164  17.019  1.00 14.64  ? 820  MET A C   1 
ATOM   1332 O O   . MET A 1 220 ? 9.817   11.460  17.981  1.00 15.04  ? 820  MET A O   1 
ATOM   1333 C CB  . MET A 1 220 ? 6.821   11.002  18.091  1.00 8.26   ? 820  MET A CB  1 
ATOM   1334 C CG  . MET A 1 220 ? 5.404   11.572  18.235  1.00 10.78  ? 820  MET A CG  1 
ATOM   1335 S SD  . MET A 1 220 ? 5.193   13.369  18.035  1.00 14.40  ? 820  MET A SD  1 
ATOM   1336 C CE  . MET A 1 220 ? 6.102   13.996  19.506  1.00 10.67  ? 820  MET A CE  1 
ATOM   1337 N N   . SER A 1 221 ? 9.535   10.431  15.983  1.00 13.44  ? 821  SER A N   1 
ATOM   1338 C CA  . SER A 1 221 ? 10.903  9.923   15.860  1.00 12.95  ? 821  SER A CA  1 
ATOM   1339 C C   . SER A 1 221 ? 11.623  10.624  14.708  1.00 15.00  ? 821  SER A C   1 
ATOM   1340 O O   . SER A 1 221 ? 12.709  10.198  14.319  1.00 16.03  ? 821  SER A O   1 
ATOM   1341 C CB  . SER A 1 221 ? 10.911  8.404   15.688  1.00 15.57  ? 821  SER A CB  1 
ATOM   1342 O OG  . SER A 1 221 ? 10.325  8.010   14.459  1.00 23.45  ? 821  SER A OG  1 
ATOM   1343 N N   . TYR A 1 222 ? 11.034  11.723  14.197  1.00 9.79   ? 822  TYR A N   1 
ATOM   1344 C CA  . TYR A 1 222 ? 11.564  12.564  13.109  1.00 10.11  ? 822  TYR A CA  1 
ATOM   1345 C C   . TYR A 1 222 ? 11.879  11.788  11.822  1.00 15.67  ? 822  TYR A C   1 
ATOM   1346 O O   . TYR A 1 222 ? 12.935  11.971  11.218  1.00 14.95  ? 822  TYR A O   1 
ATOM   1347 C CB  . TYR A 1 222 ? 12.785  13.409  13.572  1.00 11.05  ? 822  TYR A CB  1 
ATOM   1348 C CG  . TYR A 1 222 ? 12.382  14.610  14.387  1.00 11.40  ? 822  TYR A CG  1 
ATOM   1349 C CD1 . TYR A 1 222 ? 12.040  15.811  13.768  1.00 13.89  ? 822  TYR A CD1 1 
ATOM   1350 C CD2 . TYR A 1 222 ? 12.230  14.520  15.765  1.00 12.21  ? 822  TYR A CD2 1 
ATOM   1351 C CE1 . TYR A 1 222 ? 11.611  16.912  14.510  1.00 14.30  ? 822  TYR A CE1 1 
ATOM   1352 C CE2 . TYR A 1 222 ? 11.815  15.620  16.521  1.00 13.53  ? 822  TYR A CE2 1 
ATOM   1353 C CZ  . TYR A 1 222 ? 11.508  16.815  15.887  1.00 17.98  ? 822  TYR A CZ  1 
ATOM   1354 O OH  . TYR A 1 222 ? 11.109  17.907  16.618  1.00 15.66  ? 822  TYR A OH  1 
ATOM   1355 N N   . GLY A 1 223 ? 10.953  10.915  11.446  1.00 13.63  ? 823  GLY A N   1 
ATOM   1356 C CA  . GLY A 1 223 ? 10.982  10.143  10.215  1.00 14.18  ? 823  GLY A CA  1 
ATOM   1357 C C   . GLY A 1 223 ? 11.889  8.941   10.162  1.00 18.12  ? 823  GLY A C   1 
ATOM   1358 O O   . GLY A 1 223 ? 12.276  8.523   9.070   1.00 18.56  ? 823  GLY A O   1 
ATOM   1359 N N   . GLU A 1 224 ? 12.204  8.342   11.306  1.00 13.79  ? 824  GLU A N   1 
ATOM   1360 C CA  . GLU A 1 224 ? 13.062  7.173   11.232  1.00 12.52  ? 824  GLU A CA  1 
ATOM   1361 C C   . GLU A 1 224 ? 12.243  5.917   10.809  1.00 14.72  ? 824  GLU A C   1 
ATOM   1362 O O   . GLU A 1 224 ? 11.003  5.966   10.774  1.00 12.65  ? 824  GLU A O   1 
ATOM   1363 C CB  . GLU A 1 224 ? 13.916  7.000   12.497  1.00 13.40  ? 824  GLU A CB  1 
ATOM   1364 C CG  . GLU A 1 224 ? 13.270  6.326   13.682  1.00 21.83  ? 824  GLU A CG  1 
ATOM   1365 C CD  . GLU A 1 224 ? 14.246  6.073   14.816  1.00 40.92  ? 824  GLU A CD  1 
ATOM   1366 O OE1 . GLU A 1 224 ? 15.211  5.302   14.607  1.00 22.98  ? 824  GLU A OE1 1 
ATOM   1367 O OE2 . GLU A 1 224 ? 14.063  6.662   15.906  1.00 37.94  ? 824  GLU A OE2 1 
ATOM   1368 N N   . ARG A 1 225 ? 12.957  4.858   10.375  1.00 10.73  ? 825  ARG A N   1 
ATOM   1369 C CA  . ARG A 1 225 ? 12.401  3.599   9.906   1.00 10.70  ? 825  ARG A CA  1 
ATOM   1370 C C   . ARG A 1 225 ? 11.719  2.828   11.020  1.00 13.84  ? 825  ARG A C   1 
ATOM   1371 O O   . ARG A 1 225 ? 12.375  2.460   12.008  1.00 13.63  ? 825  ARG A O   1 
ATOM   1372 C CB  . ARG A 1 225 ? 13.485  2.731   9.205   1.00 13.78  ? 825  ARG A CB  1 
ATOM   1373 C CG  . ARG A 1 225 ? 13.078  1.262   8.908   1.00 22.74  ? 825  ARG A CG  1 
ATOM   1374 C CD  . ARG A 1 225 ? 12.272  1.049   7.637   1.00 23.32  ? 825  ARG A CD  1 
ATOM   1375 N NE  . ARG A 1 225 ? 12.674  -0.188  6.962   1.00 32.99  ? 825  ARG A NE  1 
ATOM   1376 C CZ  . ARG A 1 225 ? 12.547  -0.414  5.655   1.00 45.66  ? 825  ARG A CZ  1 
ATOM   1377 N NH1 . ARG A 1 225 ? 12.015  0.511   4.861   1.00 33.72  ? 825  ARG A NH1 1 
ATOM   1378 N NH2 . ARG A 1 225 ? 12.961  -1.563  5.130   1.00 19.56  ? 825  ARG A NH2 1 
ATOM   1379 N N   . PRO A 1 226 ? 10.407  2.532   10.859  1.00 11.11  ? 826  PRO A N   1 
ATOM   1380 C CA  . PRO A 1 226 ? 9.724   1.711   11.869  1.00 11.64  ? 826  PRO A CA  1 
ATOM   1381 C C   . PRO A 1 226 ? 10.362  0.325   11.859  1.00 17.84  ? 826  PRO A C   1 
ATOM   1382 O O   . PRO A 1 226 ? 10.637  -0.214  10.790  1.00 18.31  ? 826  PRO A O   1 
ATOM   1383 C CB  . PRO A 1 226 ? 8.261   1.673   11.388  1.00 13.34  ? 826  PRO A CB  1 
ATOM   1384 C CG  . PRO A 1 226 ? 8.151   2.698   10.297  1.00 16.62  ? 826  PRO A CG  1 
ATOM   1385 C CD  . PRO A 1 226 ? 9.514   2.848   9.720   1.00 12.17  ? 826  PRO A CD  1 
ATOM   1386 N N   . TYR A 1 227 ? 10.655  -0.213  13.041  1.00 16.54  ? 827  TYR A N   1 
ATOM   1387 C CA  . TYR A 1 227 ? 11.281  -1.527  13.263  1.00 17.98  ? 827  TYR A CA  1 
ATOM   1388 C C   . TYR A 1 227 ? 12.728  -1.597  12.726  1.00 26.85  ? 827  TYR A C   1 
ATOM   1389 O O   . TYR A 1 227 ? 13.289  -2.680  12.616  1.00 27.11  ? 827  TYR A O   1 
ATOM   1390 C CB  . TYR A 1 227 ? 10.414  -2.693  12.742  1.00 18.64  ? 827  TYR A CB  1 
ATOM   1391 C CG  . TYR A 1 227 ? 8.933   -2.579  13.046  1.00 18.47  ? 827  TYR A CG  1 
ATOM   1392 C CD1 . TYR A 1 227 ? 8.395   -3.124  14.209  1.00 19.43  ? 827  TYR A CD1 1 
ATOM   1393 C CD2 . TYR A 1 227 ? 8.058   -1.995  12.135  1.00 18.41  ? 827  TYR A CD2 1 
ATOM   1394 C CE1 . TYR A 1 227 ? 7.036   -3.017  14.493  1.00 19.13  ? 827  TYR A CE1 1 
ATOM   1395 C CE2 . TYR A 1 227 ? 6.698   -1.887  12.406  1.00 19.04  ? 827  TYR A CE2 1 
ATOM   1396 C CZ  . TYR A 1 227 ? 6.187   -2.414  13.577  1.00 22.69  ? 827  TYR A CZ  1 
ATOM   1397 O OH  . TYR A 1 227 ? 4.841   -2.307  13.818  1.00 21.03  ? 827  TYR A OH  1 
ATOM   1398 N N   . TRP A 1 228 ? 13.332  -0.428  12.436  1.00 27.78  ? 828  TRP A N   1 
ATOM   1399 C CA  . TRP A 1 228 ? 14.713  -0.215  11.991  1.00 29.58  ? 828  TRP A CA  1 
ATOM   1400 C C   . TRP A 1 228 ? 15.225  -1.262  10.969  1.00 34.45  ? 828  TRP A C   1 
ATOM   1401 O O   . TRP A 1 228 ? 14.858  -1.191  9.785   1.00 35.88  ? 828  TRP A O   1 
ATOM   1402 C CB  . TRP A 1 228 ? 15.650  -0.108  13.212  1.00 29.54  ? 828  TRP A CB  1 
ATOM   1403 C CG  . TRP A 1 228 ? 15.166  0.843   14.266  1.00 31.69  ? 828  TRP A CG  1 
ATOM   1404 C CD1 . TRP A 1 228 ? 15.398  2.183   14.323  1.00 34.88  ? 828  TRP A CD1 1 
ATOM   1405 C CD2 . TRP A 1 228 ? 14.326  0.533   15.391  1.00 32.10  ? 828  TRP A CD2 1 
ATOM   1406 N NE1 . TRP A 1 228 ? 14.785  2.724   15.430  1.00 34.69  ? 828  TRP A NE1 1 
ATOM   1407 C CE2 . TRP A 1 228 ? 14.109  1.737   16.096  1.00 36.28  ? 828  TRP A CE2 1 
ATOM   1408 C CE3 . TRP A 1 228 ? 13.732  -0.646  15.871  1.00 33.62  ? 828  TRP A CE3 1 
ATOM   1409 C CZ2 . TRP A 1 228 ? 13.316  1.800   17.248  1.00 35.93  ? 828  TRP A CZ2 1 
ATOM   1410 C CZ3 . TRP A 1 228 ? 12.956  -0.585  17.018  1.00 35.40  ? 828  TRP A CZ3 1 
ATOM   1411 C CH2 . TRP A 1 228 ? 12.759  0.624   17.696  1.00 36.15  ? 828  TRP A CH2 1 
ATOM   1412 N N   . ASP A 1 229 ? 16.052  -2.231  11.423  1.00 28.66  ? 829  ASP A N   1 
ATOM   1413 C CA  . ASP A 1 229 ? 16.642  -3.247  10.549  1.00 28.29  ? 829  ASP A CA  1 
ATOM   1414 C C   . ASP A 1 229 ? 16.013  -4.656  10.719  1.00 30.96  ? 829  ASP A C   1 
ATOM   1415 O O   . ASP A 1 229 ? 16.653  -5.663  10.395  1.00 29.81  ? 829  ASP A O   1 
ATOM   1416 C CB  . ASP A 1 229 ? 18.176  -3.268  10.711  1.00 30.04  ? 829  ASP A CB  1 
ATOM   1417 C CG  . ASP A 1 229 ? 18.948  -3.814  9.519   1.00 40.37  ? 829  ASP A CG  1 
ATOM   1418 O OD1 . ASP A 1 229 ? 18.813  -3.243  8.405   1.00 40.68  ? 829  ASP A OD1 1 
ATOM   1419 O OD2 . ASP A 1 229 ? 19.720  -4.780  9.707   1.00 45.56  ? 829  ASP A OD2 1 
ATOM   1420 N N   . MET A 1 230 ? 14.746  -4.720  11.190  1.00 26.45  ? 830  MET A N   1 
ATOM   1421 C CA  . MET A 1 230 ? 14.026  -5.989  11.295  1.00 25.52  ? 830  MET A CA  1 
ATOM   1422 C C   . MET A 1 230 ? 13.568  -6.300  9.891   1.00 28.79  ? 830  MET A C   1 
ATOM   1423 O O   . MET A 1 230 ? 13.224  -5.373  9.144   1.00 29.26  ? 830  MET A O   1 
ATOM   1424 C CB  . MET A 1 230 ? 12.777  -5.874  12.189  1.00 27.83  ? 830  MET A CB  1 
ATOM   1425 C CG  . MET A 1 230 ? 13.062  -5.876  13.663  1.00 31.58  ? 830  MET A CG  1 
ATOM   1426 S SD  . MET A 1 230 ? 11.530  -5.771  14.619  1.00 36.18  ? 830  MET A SD  1 
ATOM   1427 C CE  . MET A 1 230 ? 11.299  -7.467  15.015  1.00 32.83  ? 830  MET A CE  1 
ATOM   1428 N N   . THR A 1 231 ? 13.555  -7.589  9.517   1.00 23.45  ? 831  THR A N   1 
ATOM   1429 C CA  . THR A 1 231 ? 13.062  -7.991  8.192   1.00 21.80  ? 831  THR A CA  1 
ATOM   1430 C C   . THR A 1 231 ? 11.515  -7.878  8.218   1.00 21.76  ? 831  THR A C   1 
ATOM   1431 O O   . THR A 1 231 ? 10.940  -7.783  9.304   1.00 19.79  ? 831  THR A O   1 
ATOM   1432 C CB  . THR A 1 231 ? 13.594  -9.389  7.804   1.00 28.58  ? 831  THR A CB  1 
ATOM   1433 O OG1 . THR A 1 231 ? 13.053  -10.382 8.676   1.00 30.53  ? 831  THR A OG1 1 
ATOM   1434 C CG2 . THR A 1 231 ? 15.125  -9.469  7.830   1.00 27.07  ? 831  THR A CG2 1 
ATOM   1435 N N   . ASN A 1 232 ? 10.851  -7.870  7.044   1.00 17.36  ? 832  ASN A N   1 
ATOM   1436 C CA  . ASN A 1 232 ? 9.385   -7.790  6.949   1.00 17.11  ? 832  ASN A CA  1 
ATOM   1437 C C   . ASN A 1 232 ? 8.698   -8.948  7.709   1.00 19.96  ? 832  ASN A C   1 
ATOM   1438 O O   . ASN A 1 232 ? 7.626   -8.755  8.275   1.00 18.69  ? 832  ASN A O   1 
ATOM   1439 C CB  . ASN A 1 232 ? 8.940   -7.767  5.483   1.00 19.27  ? 832  ASN A CB  1 
ATOM   1440 C CG  . ASN A 1 232 ? 8.696   -6.388  4.900   1.00 43.92  ? 832  ASN A CG  1 
ATOM   1441 O OD1 . ASN A 1 232 ? 9.000   -5.345  5.502   1.00 34.71  ? 832  ASN A OD1 1 
ATOM   1442 N ND2 . ASN A 1 232 ? 8.125   -6.356  3.700   1.00 38.36  ? 832  ASN A ND2 1 
ATOM   1443 N N   . GLN A 1 233 ? 9.357   -10.127 7.753   1.00 16.19  ? 833  GLN A N   1 
ATOM   1444 C CA  . GLN A 1 233 ? 8.875   -11.320 8.437   1.00 15.78  ? 833  GLN A CA  1 
ATOM   1445 C C   . GLN A 1 233 ? 9.072   -11.248 9.948   1.00 18.19  ? 833  GLN A C   1 
ATOM   1446 O O   . GLN A 1 233 ? 8.207   -11.710 10.695  1.00 16.32  ? 833  GLN A O   1 
ATOM   1447 C CB  . GLN A 1 233 ? 9.487   -12.591 7.833   1.00 16.90  ? 833  GLN A CB  1 
ATOM   1448 C CG  . GLN A 1 233 ? 8.701   -13.862 8.180   1.00 33.58  ? 833  GLN A CG  1 
ATOM   1449 C CD  . GLN A 1 233 ? 7.212   -13.815 7.881   1.00 44.15  ? 833  GLN A CD  1 
ATOM   1450 O OE1 . GLN A 1 233 ? 6.761   -13.371 6.811   1.00 38.50  ? 833  GLN A OE1 1 
ATOM   1451 N NE2 . GLN A 1 233 ? 6.416   -14.291 8.833   1.00 31.53  ? 833  GLN A NE2 1 
ATOM   1452 N N   . ASP A 1 234 ? 10.189  -10.628 10.397  1.00 14.70  ? 834  ASP A N   1 
ATOM   1453 C CA  . ASP A 1 234 ? 10.483  -10.406 11.813  1.00 13.35  ? 834  ASP A CA  1 
ATOM   1454 C C   . ASP A 1 234 ? 9.451   -9.460  12.400  1.00 13.95  ? 834  ASP A C   1 
ATOM   1455 O O   . ASP A 1 234 ? 9.059   -9.659  13.548  1.00 13.29  ? 834  ASP A O   1 
ATOM   1456 C CB  . ASP A 1 234 ? 11.897  -9.824  12.016  1.00 15.56  ? 834  ASP A CB  1 
ATOM   1457 C CG  . ASP A 1 234 ? 13.045  -10.800 11.823  1.00 28.94  ? 834  ASP A CG  1 
ATOM   1458 O OD1 . ASP A 1 234 ? 12.788  -11.955 11.395  1.00 30.01  ? 834  ASP A OD1 1 
ATOM   1459 O OD2 . ASP A 1 234 ? 14.201  -10.404 12.064  1.00 34.44  ? 834  ASP A OD2 1 
ATOM   1460 N N   . VAL A 1 235 ? 8.989   -8.453  11.612  1.00 9.48   ? 835  VAL A N   1 
ATOM   1461 C CA  . VAL A 1 235 ? 7.962   -7.476  12.035  1.00 9.03   ? 835  VAL A CA  1 
ATOM   1462 C C   . VAL A 1 235 ? 6.622   -8.204  12.207  1.00 12.70  ? 835  VAL A C   1 
ATOM   1463 O O   . VAL A 1 235 ? 5.994   -8.086  13.258  1.00 11.47  ? 835  VAL A O   1 
ATOM   1464 C CB  . VAL A 1 235 ? 7.859   -6.271  11.059  1.00 12.56  ? 835  VAL A CB  1 
ATOM   1465 C CG1 . VAL A 1 235 ? 6.665   -5.370  11.381  1.00 11.99  ? 835  VAL A CG1 1 
ATOM   1466 C CG2 . VAL A 1 235 ? 9.150   -5.473  11.037  1.00 12.15  ? 835  VAL A CG2 1 
ATOM   1467 N N   . ILE A 1 236 ? 6.218   -8.995  11.192  1.00 11.01  ? 836  ILE A N   1 
ATOM   1468 C CA  . ILE A 1 236 ? 4.982   -9.788  11.222  1.00 10.72  ? 836  ILE A CA  1 
ATOM   1469 C C   . ILE A 1 236 ? 4.921   -10.652 12.492  1.00 14.65  ? 836  ILE A C   1 
ATOM   1470 O O   . ILE A 1 236 ? 3.934   -10.564 13.224  1.00 15.05  ? 836  ILE A O   1 
ATOM   1471 C CB  . ILE A 1 236 ? 4.769   -10.590 9.896   1.00 13.49  ? 836  ILE A CB  1 
ATOM   1472 C CG1 . ILE A 1 236 ? 4.252   -9.647  8.780   1.00 13.44  ? 836  ILE A CG1 1 
ATOM   1473 C CG2 . ILE A 1 236 ? 3.793   -11.786 10.079  1.00 13.56  ? 836  ILE A CG2 1 
ATOM   1474 C CD1 . ILE A 1 236 ? 4.485   -10.145 7.359   1.00 16.20  ? 836  ILE A CD1 1 
ATOM   1475 N N   . ASN A 1 237 ? 6.001   -11.399 12.799  1.00 10.14  ? 837  ASN A N   1 
ATOM   1476 C CA  . ASN A 1 237 ? 6.031   -12.288 13.963  1.00 9.29   ? 837  ASN A CA  1 
ATOM   1477 C C   . ASN A 1 237 ? 6.114   -11.563 15.291  1.00 13.60  ? 837  ASN A C   1 
ATOM   1478 O O   . ASN A 1 237 ? 5.588   -12.063 16.291  1.00 12.78  ? 837  ASN A O   1 
ATOM   1479 C CB  . ASN A 1 237 ? 7.131   -13.323 13.844  1.00 8.27   ? 837  ASN A CB  1 
ATOM   1480 C CG  . ASN A 1 237 ? 6.955   -14.268 12.693  1.00 22.95  ? 837  ASN A CG  1 
ATOM   1481 O OD1 . ASN A 1 237 ? 5.885   -14.858 12.482  1.00 19.83  ? 837  ASN A OD1 1 
ATOM   1482 N ND2 . ASN A 1 237 ? 8.035   -14.482 11.965  1.00 14.63  ? 837  ASN A ND2 1 
ATOM   1483 N N   . ALA A 1 238 ? 6.778   -10.397 15.314  1.00 11.12  ? 838  ALA A N   1 
ATOM   1484 C CA  . ALA A 1 238 ? 6.868   -9.566  16.517  1.00 10.81  ? 838  ALA A CA  1 
ATOM   1485 C C   . ALA A 1 238 ? 5.476   -9.008  16.839  1.00 15.35  ? 838  ALA A C   1 
ATOM   1486 O O   . ALA A 1 238 ? 5.015   -9.137  17.968  1.00 15.53  ? 838  ALA A O   1 
ATOM   1487 C CB  . ALA A 1 238 ? 7.848   -8.428  16.294  1.00 11.38  ? 838  ALA A CB  1 
ATOM   1488 N N   . ILE A 1 239 ? 4.793   -8.453  15.820  1.00 13.19  ? 839  ILE A N   1 
ATOM   1489 C CA  . ILE A 1 239 ? 3.446   -7.862  15.889  1.00 13.57  ? 839  ILE A CA  1 
ATOM   1490 C C   . ILE A 1 239 ? 2.382   -8.893  16.339  1.00 17.99  ? 839  ILE A C   1 
ATOM   1491 O O   . ILE A 1 239 ? 1.484   -8.552  17.111  1.00 16.90  ? 839  ILE A O   1 
ATOM   1492 C CB  . ILE A 1 239 ? 3.141   -7.163  14.516  1.00 16.27  ? 839  ILE A CB  1 
ATOM   1493 C CG1 . ILE A 1 239 ? 3.274   -5.634  14.616  1.00 16.58  ? 839  ILE A CG1 1 
ATOM   1494 C CG2 . ILE A 1 239 ? 1.809   -7.563  13.871  1.00 16.71  ? 839  ILE A CG2 1 
ATOM   1495 C CD1 . ILE A 1 239 ? 4.464   -5.148  15.388  1.00 25.42  ? 839  ILE A CD1 1 
ATOM   1496 N N   . GLU A 1 240 ? 2.533   -10.151 15.889  1.00 15.37  ? 840  GLU A N   1 
ATOM   1497 C CA  . GLU A 1 240 ? 1.650   -11.272 16.203  1.00 14.86  ? 840  GLU A CA  1 
ATOM   1498 C C   . GLU A 1 240 ? 1.900   -11.814 17.611  1.00 20.77  ? 840  GLU A C   1 
ATOM   1499 O O   . GLU A 1 240 ? 1.022   -12.474 18.170  1.00 20.94  ? 840  GLU A O   1 
ATOM   1500 C CB  . GLU A 1 240 ? 1.802   -12.380 15.143  1.00 15.65  ? 840  GLU A CB  1 
ATOM   1501 C CG  . GLU A 1 240 ? 1.138   -12.029 13.819  1.00 20.97  ? 840  GLU A CG  1 
ATOM   1502 C CD  . GLU A 1 240 ? 1.505   -12.864 12.607  1.00 35.10  ? 840  GLU A CD  1 
ATOM   1503 O OE1 . GLU A 1 240 ? 2.474   -13.652 12.683  1.00 34.48  ? 840  GLU A OE1 1 
ATOM   1504 O OE2 . GLU A 1 240 ? 0.843   -12.699 11.558  1.00 28.04  ? 840  GLU A OE2 1 
ATOM   1505 N N   . GLN A 1 241 ? 3.083   -11.525 18.186  1.00 18.74  ? 841  GLN A N   1 
ATOM   1506 C CA  . GLN A 1 241 ? 3.477   -11.973 19.525  1.00 19.43  ? 841  GLN A CA  1 
ATOM   1507 C C   . GLN A 1 241 ? 3.506   -10.810 20.553  1.00 24.99  ? 841  GLN A C   1 
ATOM   1508 O O   . GLN A 1 241 ? 4.321   -10.802 21.481  1.00 25.00  ? 841  GLN A O   1 
ATOM   1509 C CB  . GLN A 1 241 ? 4.802   -12.760 19.467  1.00 21.02  ? 841  GLN A CB  1 
ATOM   1510 N N   . ASP A 1 242 ? 2.574   -9.842  20.370  1.00 21.92  ? 842  ASP A N   1 
ATOM   1511 C CA  . ASP A 1 242 ? 2.285   -8.647  21.175  1.00 21.40  ? 842  ASP A CA  1 
ATOM   1512 C C   . ASP A 1 242 ? 3.411   -7.585  21.231  1.00 22.73  ? 842  ASP A C   1 
ATOM   1513 O O   . ASP A 1 242 ? 3.361   -6.708  22.099  1.00 21.53  ? 842  ASP A O   1 
ATOM   1514 C CB  . ASP A 1 242 ? 1.824   -9.028  22.599  1.00 23.79  ? 842  ASP A CB  1 
ATOM   1515 C CG  . ASP A 1 242 ? 0.625   -9.960  22.648  1.00 33.06  ? 842  ASP A CG  1 
ATOM   1516 O OD1 . ASP A 1 242 ? -0.336  -9.738  21.874  1.00 32.89  ? 842  ASP A OD1 1 
ATOM   1517 O OD2 . ASP A 1 242 ? 0.630   -10.885 23.490  1.00 39.94  ? 842  ASP A OD2 1 
ATOM   1518 N N   . TYR A 1 243 ? 4.386   -7.620  20.302  1.00 18.66  ? 843  TYR A N   1 
ATOM   1519 C CA  . TYR A 1 243 ? 5.434   -6.582  20.284  1.00 17.71  ? 843  TYR A CA  1 
ATOM   1520 C C   . TYR A 1 243 ? 4.856   -5.317  19.646  1.00 18.11  ? 843  TYR A C   1 
ATOM   1521 O O   . TYR A 1 243 ? 4.096   -5.407  18.680  1.00 16.30  ? 843  TYR A O   1 
ATOM   1522 C CB  . TYR A 1 243 ? 6.730   -7.043  19.561  1.00 18.71  ? 843  TYR A CB  1 
ATOM   1523 C CG  . TYR A 1 243 ? 7.751   -5.949  19.305  1.00 19.34  ? 843  TYR A CG  1 
ATOM   1524 C CD1 . TYR A 1 243 ? 8.693   -5.607  20.271  1.00 20.68  ? 843  TYR A CD1 1 
ATOM   1525 C CD2 . TYR A 1 243 ? 7.781   -5.263  18.094  1.00 19.94  ? 843  TYR A CD2 1 
ATOM   1526 C CE1 . TYR A 1 243 ? 9.616   -4.585  20.051  1.00 20.70  ? 843  TYR A CE1 1 
ATOM   1527 C CE2 . TYR A 1 243 ? 8.698   -4.239  17.863  1.00 20.50  ? 843  TYR A CE2 1 
ATOM   1528 C CZ  . TYR A 1 243 ? 9.623   -3.911  18.841  1.00 26.67  ? 843  TYR A CZ  1 
ATOM   1529 O OH  . TYR A 1 243 ? 10.549  -2.921  18.608  1.00 25.85  ? 843  TYR A OH  1 
ATOM   1530 N N   . ARG A 1 244 ? 5.193   -4.148  20.226  1.00 13.43  ? 844  ARG A N   1 
ATOM   1531 C CA  . ARG A 1 244 ? 4.758   -2.828  19.766  1.00 13.09  ? 844  ARG A CA  1 
ATOM   1532 C C   . ARG A 1 244 ? 5.929   -1.855  19.862  1.00 15.96  ? 844  ARG A C   1 
ATOM   1533 O O   . ARG A 1 244 ? 6.607   -1.845  20.889  1.00 16.53  ? 844  ARG A O   1 
ATOM   1534 C CB  . ARG A 1 244 ? 3.577   -2.311  20.603  1.00 11.32  ? 844  ARG A CB  1 
ATOM   1535 C CG  . ARG A 1 244 ? 2.294   -3.115  20.484  1.00 15.38  ? 844  ARG A CG  1 
ATOM   1536 C CD  . ARG A 1 244 ? 1.671   -3.047  19.099  1.00 18.82  ? 844  ARG A CD  1 
ATOM   1537 N NE  . ARG A 1 244 ? 0.399   -3.764  19.067  1.00 20.58  ? 844  ARG A NE  1 
ATOM   1538 C CZ  . ARG A 1 244 ? 0.261   -5.032  18.693  1.00 27.70  ? 844  ARG A CZ  1 
ATOM   1539 N NH1 . ARG A 1 244 ? 1.310   -5.725  18.275  1.00 7.89   ? 844  ARG A NH1 1 
ATOM   1540 N NH2 . ARG A 1 244 ? -0.932  -5.607  18.708  1.00 14.96  ? 844  ARG A NH2 1 
ATOM   1541 N N   . LEU A 1 245 ? 6.181   -1.060  18.789  1.00 10.53  ? 845  LEU A N   1 
ATOM   1542 C CA  . LEU A 1 245 ? 7.271   -0.073  18.713  1.00 10.19  ? 845  LEU A CA  1 
ATOM   1543 C C   . LEU A 1 245 ? 7.440   0.731   20.012  1.00 16.80  ? 845  LEU A C   1 
ATOM   1544 O O   . LEU A 1 245 ? 6.436   1.191   20.585  1.00 16.90  ? 845  LEU A O   1 
ATOM   1545 C CB  . LEU A 1 245 ? 7.093   0.885   17.517  1.00 9.33   ? 845  LEU A CB  1 
ATOM   1546 C CG  . LEU A 1 245 ? 7.511   0.364   16.132  1.00 10.98  ? 845  LEU A CG  1 
ATOM   1547 C CD1 . LEU A 1 245 ? 6.861   1.166   15.031  1.00 9.57   ? 845  LEU A CD1 1 
ATOM   1548 C CD2 . LEU A 1 245 ? 8.998   0.385   15.963  1.00 9.96   ? 845  LEU A CD2 1 
ATOM   1549 N N   . PRO A 1 246 ? 8.688   0.843   20.536  1.00 14.33  ? 846  PRO A N   1 
ATOM   1550 C CA  . PRO A 1 246 ? 8.889   1.584   21.791  1.00 14.03  ? 846  PRO A CA  1 
ATOM   1551 C C   . PRO A 1 246 ? 8.636   3.076   21.609  1.00 17.44  ? 846  PRO A C   1 
ATOM   1552 O O   . PRO A 1 246 ? 8.802   3.557   20.486  1.00 16.83  ? 846  PRO A O   1 
ATOM   1553 C CB  . PRO A 1 246 ? 10.355  1.303   22.130  1.00 15.54  ? 846  PRO A CB  1 
ATOM   1554 C CG  . PRO A 1 246 ? 11.000  1.035   20.833  1.00 19.54  ? 846  PRO A CG  1 
ATOM   1555 C CD  . PRO A 1 246 ? 9.971   0.330   20.008  1.00 15.69  ? 846  PRO A CD  1 
ATOM   1556 N N   . PRO A 1 247 ? 8.245   3.834   22.667  1.00 14.87  ? 847  PRO A N   1 
ATOM   1557 C CA  . PRO A 1 247 ? 8.021   5.279   22.475  1.00 14.82  ? 847  PRO A CA  1 
ATOM   1558 C C   . PRO A 1 247 ? 9.310   5.997   22.041  1.00 20.85  ? 847  PRO A C   1 
ATOM   1559 O O   . PRO A 1 247 ? 10.371  5.698   22.609  1.00 21.56  ? 847  PRO A O   1 
ATOM   1560 C CB  . PRO A 1 247 ? 7.530   5.747   23.846  1.00 16.39  ? 847  PRO A CB  1 
ATOM   1561 C CG  . PRO A 1 247 ? 8.031   4.732   24.804  1.00 20.59  ? 847  PRO A CG  1 
ATOM   1562 C CD  . PRO A 1 247 ? 8.011   3.434   24.070  1.00 15.92  ? 847  PRO A CD  1 
ATOM   1563 N N   . PRO A 1 248 ? 9.275   6.905   21.026  1.00 16.91  ? 848  PRO A N   1 
ATOM   1564 C CA  . PRO A 1 248 ? 10.517  7.597   20.616  1.00 16.95  ? 848  PRO A CA  1 
ATOM   1565 C C   . PRO A 1 248 ? 11.070  8.478   21.741  1.00 24.31  ? 848  PRO A C   1 
ATOM   1566 O O   . PRO A 1 248 ? 10.327  8.778   22.677  1.00 24.18  ? 848  PRO A O   1 
ATOM   1567 C CB  . PRO A 1 248 ? 10.076  8.427   19.404  1.00 18.00  ? 848  PRO A CB  1 
ATOM   1568 C CG  . PRO A 1 248 ? 8.761   7.848   18.975  1.00 21.55  ? 848  PRO A CG  1 
ATOM   1569 C CD  . PRO A 1 248 ? 8.122   7.361   20.223  1.00 17.48  ? 848  PRO A CD  1 
ATOM   1570 N N   . MET A 1 249 ? 12.367  8.863   21.693  1.00 23.38  ? 849  MET A N   1 
ATOM   1571 C CA  . MET A 1 249 ? 12.927  9.690   22.775  1.00 23.42  ? 849  MET A CA  1 
ATOM   1572 C C   . MET A 1 249 ? 12.246  11.072  22.833  1.00 24.71  ? 849  MET A C   1 
ATOM   1573 O O   . MET A 1 249 ? 11.991  11.678  21.792  1.00 23.66  ? 849  MET A O   1 
ATOM   1574 C CB  . MET A 1 249 ? 14.475  9.767   22.753  1.00 26.13  ? 849  MET A CB  1 
ATOM   1575 C CG  . MET A 1 249 ? 15.073  10.611  21.650  1.00 30.48  ? 849  MET A CG  1 
ATOM   1576 S SD  . MET A 1 249 ? 16.703  11.246  22.129  1.00 35.48  ? 849  MET A SD  1 
ATOM   1577 C CE  . MET A 1 249 ? 16.814  12.677  21.067  1.00 31.91  ? 849  MET A CE  1 
ATOM   1578 N N   . ASP A 1 250 ? 11.887  11.512  24.060  1.00 20.83  ? 850  ASP A N   1 
ATOM   1579 C CA  . ASP A 1 250 ? 11.207  12.782  24.398  1.00 20.58  ? 850  ASP A CA  1 
ATOM   1580 C C   . ASP A 1 250 ? 9.680   12.752  24.144  1.00 24.06  ? 850  ASP A C   1 
ATOM   1581 O O   . ASP A 1 250 ? 9.005   13.731  24.462  1.00 23.24  ? 850  ASP A O   1 
ATOM   1582 C CB  . ASP A 1 250 ? 11.854  14.023  23.718  1.00 22.35  ? 850  ASP A CB  1 
ATOM   1583 C CG  . ASP A 1 250 ? 13.374  14.085  23.744  1.00 33.61  ? 850  ASP A CG  1 
ATOM   1584 O OD1 . ASP A 1 250 ? 13.958  14.019  24.858  1.00 33.49  ? 850  ASP A OD1 1 
ATOM   1585 O OD2 . ASP A 1 250 ? 13.982  14.225  22.653  1.00 39.35  ? 850  ASP A OD2 1 
ATOM   1586 N N   . CYS A 1 251 ? 9.137   11.621  23.616  1.00 21.25  ? 851  CYS A N   1 
ATOM   1587 C CA  . CYS A 1 251 ? 7.714   11.435  23.300  1.00 20.84  ? 851  CYS A CA  1 
ATOM   1588 C C   . CYS A 1 251 ? 6.812   11.419  24.547  1.00 25.42  ? 851  CYS A C   1 
ATOM   1589 O O   . CYS A 1 251 ? 7.060   10.627  25.460  1.00 25.47  ? 851  CYS A O   1 
ATOM   1590 C CB  . CYS A 1 251 ? 7.504   10.191  22.437  1.00 21.06  ? 851  CYS A CB  1 
ATOM   1591 S SG  . CYS A 1 251 ? 5.798   9.943   21.853  1.00 24.76  ? 851  CYS A SG  1 
ATOM   1592 N N   . PRO A 1 252 ? 5.748   12.267  24.588  1.00 22.09  ? 852  PRO A N   1 
ATOM   1593 C CA  . PRO A 1 252 ? 4.836   12.267  25.753  1.00 21.67  ? 852  PRO A CA  1 
ATOM   1594 C C   . PRO A 1 252 ? 4.036   10.976  25.907  1.00 26.09  ? 852  PRO A C   1 
ATOM   1595 O O   . PRO A 1 252 ? 3.817   10.256  24.927  1.00 26.18  ? 852  PRO A O   1 
ATOM   1596 C CB  . PRO A 1 252 ? 3.896   13.446  25.483  1.00 23.15  ? 852  PRO A CB  1 
ATOM   1597 C CG  . PRO A 1 252 ? 4.546   14.243  24.409  1.00 27.76  ? 852  PRO A CG  1 
ATOM   1598 C CD  . PRO A 1 252 ? 5.343   13.284  23.596  1.00 23.54  ? 852  PRO A CD  1 
ATOM   1599 N N   . SER A 1 253 ? 3.590   10.702  27.146  1.00 22.20  ? 853  SER A N   1 
ATOM   1600 C CA  . SER A 1 253 ? 2.818   9.520   27.544  1.00 21.28  ? 853  SER A CA  1 
ATOM   1601 C C   . SER A 1 253 ? 1.456   9.465   26.859  1.00 22.67  ? 853  SER A C   1 
ATOM   1602 O O   . SER A 1 253 ? 0.986   8.382   26.511  1.00 22.28  ? 853  SER A O   1 
ATOM   1603 C CB  . SER A 1 253 ? 2.635   9.499   29.059  1.00 24.39  ? 853  SER A CB  1 
ATOM   1604 O OG  . SER A 1 253 ? 1.930   8.337   29.463  1.00 35.05  ? 853  SER A OG  1 
ATOM   1605 N N   . ALA A 1 254 ? 0.822   10.636  26.682  1.00 17.07  ? 854  ALA A N   1 
ATOM   1606 C CA  . ALA A 1 254 ? -0.478  10.771  26.035  1.00 15.62  ? 854  ALA A CA  1 
ATOM   1607 C C   . ALA A 1 254 ? -0.377  10.470  24.528  1.00 17.19  ? 854  ALA A C   1 
ATOM   1608 O O   . ALA A 1 254 ? -1.332  9.947   23.950  1.00 16.87  ? 854  ALA A O   1 
ATOM   1609 C CB  . ALA A 1 254 ? -1.035  12.160  26.275  1.00 16.24  ? 854  ALA A CB  1 
ATOM   1610 N N   . LEU A 1 255 ? 0.782   10.774  23.907  1.00 11.76  ? 855  LEU A N   1 
ATOM   1611 C CA  . LEU A 1 255 ? 1.034   10.465  22.498  1.00 10.95  ? 855  LEU A CA  1 
ATOM   1612 C C   . LEU A 1 255 ? 1.355   8.987   22.293  1.00 14.67  ? 855  LEU A C   1 
ATOM   1613 O O   . LEU A 1 255 ? 0.815   8.382   21.372  1.00 13.16  ? 855  LEU A O   1 
ATOM   1614 C CB  . LEU A 1 255 ? 2.123   11.348  21.888  1.00 10.60  ? 855  LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 255 ? 1.710   12.769  21.517  1.00 15.08  ? 855  LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 255 ? 2.885   13.523  21.009  1.00 15.14  ? 855  LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 255 ? 0.607   12.785  20.442  1.00 16.85  ? 855  LEU A CD2 1 
ATOM   1618 N N   . HIS A 1 256 ? 2.189   8.391   23.171  1.00 12.74  ? 856  HIS A N   1 
ATOM   1619 C CA  . HIS A 1 256 ? 2.511   6.968   23.069  1.00 12.94  ? 856  HIS A CA  1 
ATOM   1620 C C   . HIS A 1 256 ? 1.286   6.072   23.282  1.00 17.46  ? 856  HIS A C   1 
ATOM   1621 O O   . HIS A 1 256 ? 1.133   5.073   22.579  1.00 17.85  ? 856  HIS A O   1 
ATOM   1622 C CB  . HIS A 1 256 ? 3.665   6.564   23.995  1.00 13.86  ? 856  HIS A CB  1 
ATOM   1623 C CG  . HIS A 1 256 ? 4.026   5.120   23.841  1.00 17.36  ? 856  HIS A CG  1 
ATOM   1624 N ND1 . HIS A 1 256 ? 4.520   4.626   22.647  1.00 19.30  ? 856  HIS A ND1 1 
ATOM   1625 C CD2 . HIS A 1 256 ? 3.877   4.095   24.709  1.00 19.00  ? 856  HIS A CD2 1 
ATOM   1626 C CE1 . HIS A 1 256 ? 4.679   3.331   22.834  1.00 18.63  ? 856  HIS A CE1 1 
ATOM   1627 N NE2 . HIS A 1 256 ? 4.310   2.966   24.060  1.00 18.82  ? 856  HIS A NE2 1 
ATOM   1628 N N   . GLN A 1 257 ? 0.411   6.439   24.229  1.00 13.87  ? 857  GLN A N   1 
ATOM   1629 C CA  . GLN A 1 257 ? -0.816  5.697   24.511  1.00 13.06  ? 857  GLN A CA  1 
ATOM   1630 C C   . GLN A 1 257 ? -1.766  5.741   23.323  1.00 14.86  ? 857  GLN A C   1 
ATOM   1631 O O   . GLN A 1 257 ? -2.381  4.719   23.024  1.00 14.35  ? 857  GLN A O   1 
ATOM   1632 C CB  . GLN A 1 257 ? -1.495  6.191   25.805  1.00 14.41  ? 857  GLN A CB  1 
ATOM   1633 C CG  . GLN A 1 257 ? -2.717  5.361   26.252  1.00 27.58  ? 857  GLN A CG  1 
ATOM   1634 C CD  . GLN A 1 257 ? -2.415  3.904   26.528  1.00 40.91  ? 857  GLN A CD  1 
ATOM   1635 O OE1 . GLN A 1 257 ? -1.489  3.565   27.277  1.00 41.48  ? 857  GLN A OE1 1 
ATOM   1636 N NE2 . GLN A 1 257 ? -3.190  3.010   25.918  1.00 21.66  ? 857  GLN A NE2 1 
ATOM   1637 N N   . LEU A 1 258 ? -1.867  6.899   22.623  1.00 10.67  ? 858  LEU A N   1 
ATOM   1638 C CA  . LEU A 1 258 ? -2.729  6.996   21.436  1.00 9.71   ? 858  LEU A CA  1 
ATOM   1639 C C   . LEU A 1 258 ? -2.242  6.043   20.322  1.00 12.03  ? 858  LEU A C   1 
ATOM   1640 O O   . LEU A 1 258 ? -3.071  5.352   19.715  1.00 11.88  ? 858  LEU A O   1 
ATOM   1641 C CB  . LEU A 1 258 ? -2.926  8.444   20.953  1.00 9.51   ? 858  LEU A CB  1 
ATOM   1642 C CG  . LEU A 1 258 ? -3.760  8.657   19.660  1.00 13.63  ? 858  LEU A CG  1 
ATOM   1643 C CD1 . LEU A 1 258 ? -5.176  8.083   19.782  1.00 13.19  ? 858  LEU A CD1 1 
ATOM   1644 C CD2 . LEU A 1 258 ? -3.816  10.128  19.290  1.00 15.52  ? 858  LEU A CD2 1 
ATOM   1645 N N   . MET A 1 259 ? -0.899  5.935   20.125  1.00 6.55   ? 859  MET A N   1 
ATOM   1646 C CA  . MET A 1 259 ? -0.302  4.984   19.164  1.00 4.55   ? 859  MET A CA  1 
ATOM   1647 C C   . MET A 1 259 ? -0.712  3.553   19.561  1.00 7.95   ? 859  MET A C   1 
ATOM   1648 O O   . MET A 1 259 ? -1.024  2.749   18.699  1.00 8.13   ? 859  MET A O   1 
ATOM   1649 C CB  . MET A 1 259 ? 1.232   5.033   19.208  1.00 6.24   ? 859  MET A CB  1 
ATOM   1650 C CG  . MET A 1 259 ? 1.853   6.358   18.902  1.00 8.33   ? 859  MET A CG  1 
ATOM   1651 S SD  . MET A 1 259 ? 3.648   6.216   19.086  1.00 10.47  ? 859  MET A SD  1 
ATOM   1652 C CE  . MET A 1 259 ? 4.088   7.954   19.186  1.00 6.25   ? 859  MET A CE  1 
ATOM   1653 N N   . LEU A 1 260 ? -0.684  3.242   20.871  1.00 5.90   ? 860  LEU A N   1 
ATOM   1654 C CA  . LEU A 1 260 ? -1.029  1.940   21.437  1.00 6.17   ? 860  LEU A CA  1 
ATOM   1655 C C   . LEU A 1 260 ? -2.472  1.557   21.170  1.00 8.37   ? 860  LEU A C   1 
ATOM   1656 O O   . LEU A 1 260 ? -2.741  0.417   20.831  1.00 6.58   ? 860  LEU A O   1 
ATOM   1657 C CB  . LEU A 1 260 ? -0.668  1.858   22.938  1.00 6.97   ? 860  LEU A CB  1 
ATOM   1658 C CG  . LEU A 1 260 ? 0.838   1.673   23.253  1.00 12.46  ? 860  LEU A CG  1 
ATOM   1659 C CD1 . LEU A 1 260 ? 1.093   1.688   24.748  1.00 12.64  ? 860  LEU A CD1 1 
ATOM   1660 C CD2 . LEU A 1 260 ? 1.384   0.354   22.676  1.00 16.41  ? 860  LEU A CD2 1 
ATOM   1661 N N   . ASP A 1 261 ? -3.388  2.528   21.269  1.00 5.80   ? 861  ASP A N   1 
ATOM   1662 C CA  . ASP A 1 261 ? -4.805  2.385   20.955  1.00 4.65   ? 861  ASP A CA  1 
ATOM   1663 C C   . ASP A 1 261 ? -4.938  2.099   19.433  1.00 8.25   ? 861  ASP A C   1 
ATOM   1664 O O   . ASP A 1 261 ? -5.726  1.232   19.039  1.00 7.50   ? 861  ASP A O   1 
ATOM   1665 C CB  . ASP A 1 261 ? -5.556  3.685   21.322  1.00 6.04   ? 861  ASP A CB  1 
ATOM   1666 C CG  . ASP A 1 261 ? -5.450  4.152   22.778  1.00 12.96  ? 861  ASP A CG  1 
ATOM   1667 O OD1 . ASP A 1 261 ? -5.036  3.345   23.641  1.00 10.41  ? 861  ASP A OD1 1 
ATOM   1668 O OD2 . ASP A 1 261 ? -5.817  5.311   23.056  1.00 15.72  ? 861  ASP A OD2 1 
ATOM   1669 N N   . CYS A 1 262 ? -4.160  2.829   18.583  1.00 3.38   ? 862  CYS A N   1 
ATOM   1670 C CA  . CYS A 1 262 ? -4.155  2.629   17.127  1.00 3.05   ? 862  CYS A CA  1 
ATOM   1671 C C   . CYS A 1 262 ? -3.710  1.207   16.791  1.00 7.39   ? 862  CYS A C   1 
ATOM   1672 O O   . CYS A 1 262 ? -4.162  0.658   15.796  1.00 6.29   ? 862  CYS A O   1 
ATOM   1673 C CB  . CYS A 1 262 ? -3.272  3.650   16.419  1.00 3.07   ? 862  CYS A CB  1 
ATOM   1674 S SG  . CYS A 1 262 ? -3.874  5.348   16.507  1.00 7.44   ? 862  CYS A SG  1 
ATOM   1675 N N   . TRP A 1 263 ? -2.821  0.627   17.628  1.00 4.10   ? 863  TRP A N   1 
ATOM   1676 C CA  . TRP A 1 263 ? -2.271  -0.717  17.467  1.00 4.31   ? 863  TRP A CA  1 
ATOM   1677 C C   . TRP A 1 263 ? -3.003  -1.833  18.273  1.00 8.66   ? 863  TRP A C   1 
ATOM   1678 O O   . TRP A 1 263 ? -2.460  -2.934  18.401  1.00 7.75   ? 863  TRP A O   1 
ATOM   1679 C CB  . TRP A 1 263 ? -0.757  -0.731  17.771  1.00 3.00   ? 863  TRP A CB  1 
ATOM   1680 C CG  . TRP A 1 263 ? 0.073   0.254   16.996  1.00 3.46   ? 863  TRP A CG  1 
ATOM   1681 C CD1 . TRP A 1 263 ? -0.105  0.647   15.703  1.00 5.90   ? 863  TRP A CD1 1 
ATOM   1682 C CD2 . TRP A 1 263 ? 1.256   0.926   17.461  1.00 3.20   ? 863  TRP A CD2 1 
ATOM   1683 N NE1 . TRP A 1 263 ? 0.860   1.562   15.348  1.00 4.83   ? 863  TRP A NE1 1 
ATOM   1684 C CE2 . TRP A 1 263 ? 1.716   1.744   16.407  1.00 6.61   ? 863  TRP A CE2 1 
ATOM   1685 C CE3 . TRP A 1 263 ? 1.970   0.922   18.676  1.00 4.06   ? 863  TRP A CE3 1 
ATOM   1686 C CZ2 . TRP A 1 263 ? 2.861   2.547   16.526  1.00 5.31   ? 863  TRP A CZ2 1 
ATOM   1687 C CZ3 . TRP A 1 263 ? 3.097   1.723   18.791  1.00 4.98   ? 863  TRP A CZ3 1 
ATOM   1688 C CH2 . TRP A 1 263 ? 3.532   2.519   17.725  1.00 5.10   ? 863  TRP A CH2 1 
ATOM   1689 N N   . GLN A 1 264 ? -4.232  -1.581  18.777  1.00 7.49   ? 864  GLN A N   1 
ATOM   1690 C CA  . GLN A 1 264 ? -4.985  -2.622  19.502  1.00 8.61   ? 864  GLN A CA  1 
ATOM   1691 C C   . GLN A 1 264 ? -5.194  -3.813  18.569  1.00 16.85  ? 864  GLN A C   1 
ATOM   1692 O O   . GLN A 1 264 ? -5.618  -3.604  17.429  1.00 17.34  ? 864  GLN A O   1 
ATOM   1693 C CB  . GLN A 1 264 ? -6.358  -2.116  20.003  1.00 9.60   ? 864  GLN A CB  1 
ATOM   1694 C CG  . GLN A 1 264 ? -6.324  -1.135  21.173  1.00 27.51  ? 864  GLN A CG  1 
ATOM   1695 C CD  . GLN A 1 264 ? -5.604  -1.633  22.407  1.00 46.61  ? 864  GLN A CD  1 
ATOM   1696 O OE1 . GLN A 1 264 ? -6.042  -2.568  23.083  1.00 45.34  ? 864  GLN A OE1 1 
ATOM   1697 N NE2 . GLN A 1 264 ? -4.505  -0.980  22.753  1.00 34.87  ? 864  GLN A NE2 1 
ATOM   1698 N N   . LYS A 1 265 ? -4.849  -5.049  19.028  1.00 15.13  ? 865  LYS A N   1 
ATOM   1699 C CA  . LYS A 1 265 ? -4.999  -6.295  18.258  1.00 15.18  ? 865  LYS A CA  1 
ATOM   1700 C C   . LYS A 1 265 ? -6.384  -6.372  17.621  1.00 18.69  ? 865  LYS A C   1 
ATOM   1701 O O   . LYS A 1 265 ? -6.471  -6.584  16.414  1.00 18.64  ? 865  LYS A O   1 
ATOM   1702 C CB  . LYS A 1 265 ? -4.728  -7.529  19.125  1.00 17.75  ? 865  LYS A CB  1 
ATOM   1703 C CG  . LYS A 1 265 ? -4.298  -8.751  18.310  1.00 34.27  ? 865  LYS A CG  1 
ATOM   1704 C CD  . LYS A 1 265 ? -4.215  -9.991  19.184  1.00 46.05  ? 865  LYS A CD  1 
ATOM   1705 C CE  . LYS A 1 265 ? -3.180  -10.981 18.720  1.00 57.17  ? 865  LYS A CE  1 
ATOM   1706 N NZ  . LYS A 1 265 ? -2.862  -11.963 19.792  1.00 67.54  ? 865  LYS A NZ  1 
ATOM   1707 N N   . ASP A 1 266 ? -7.456  -6.121  18.410  1.00 15.01  ? 866  ASP A N   1 
ATOM   1708 C CA  . ASP A 1 266 ? -8.834  -6.092  17.905  1.00 14.55  ? 866  ASP A CA  1 
ATOM   1709 C C   . ASP A 1 266 ? -9.090  -4.708  17.281  1.00 19.18  ? 866  ASP A C   1 
ATOM   1710 O O   . ASP A 1 266 ? -9.038  -3.696  17.989  1.00 18.87  ? 866  ASP A O   1 
ATOM   1711 C CB  . ASP A 1 266 ? -9.843  -6.404  19.034  1.00 15.76  ? 866  ASP A CB  1 
ATOM   1712 C CG  . ASP A 1 266 ? -11.323 -6.392  18.672  1.00 22.02  ? 866  ASP A CG  1 
ATOM   1713 O OD1 . ASP A 1 266 ? -11.676 -5.857  17.599  1.00 23.47  ? 866  ASP A OD1 1 
ATOM   1714 O OD2 . ASP A 1 266 ? -12.132 -6.851  19.493  1.00 26.52  ? 866  ASP A OD2 1 
ATOM   1715 N N   . ARG A 1 267 ? -9.395  -4.686  15.959  1.00 15.61  ? 867  ARG A N   1 
ATOM   1716 C CA  . ARG A 1 267 ? -9.655  -3.486  15.147  1.00 14.94  ? 867  ARG A CA  1 
ATOM   1717 C C   . ARG A 1 267 ? -10.854 -2.635  15.613  1.00 20.31  ? 867  ARG A C   1 
ATOM   1718 O O   . ARG A 1 267 ? -10.881 -1.433  15.339  1.00 20.88  ? 867  ARG A O   1 
ATOM   1719 C CB  . ARG A 1 267 ? -9.791  -3.852  13.653  1.00 12.90  ? 867  ARG A CB  1 
ATOM   1720 C CG  . ARG A 1 267 ? -11.052 -4.636  13.263  1.00 12.09  ? 867  ARG A CG  1 
ATOM   1721 C CD  . ARG A 1 267 ? -11.145 -4.828  11.759  1.00 5.65   ? 867  ARG A CD  1 
ATOM   1722 N NE  . ARG A 1 267 ? -12.267 -5.691  11.382  1.00 14.90  ? 867  ARG A NE  1 
ATOM   1723 C CZ  . ARG A 1 267 ? -12.225 -7.022  11.338  1.00 30.90  ? 867  ARG A CZ  1 
ATOM   1724 N NH1 . ARG A 1 267 ? -11.105 -7.672  11.643  1.00 17.56  ? 867  ARG A NH1 1 
ATOM   1725 N NH2 . ARG A 1 267 ? -13.298 -7.712  10.986  1.00 20.41  ? 867  ARG A NH2 1 
ATOM   1726 N N   . ASN A 1 268 ? -11.847 -3.252  16.285  1.00 17.05  ? 868  ASN A N   1 
ATOM   1727 C CA  . ASN A 1 268 ? -13.049 -2.562  16.774  1.00 16.37  ? 868  ASN A CA  1 
ATOM   1728 C C   . ASN A 1 268 ? -12.753 -1.763  18.047  1.00 20.10  ? 868  ASN A C   1 
ATOM   1729 O O   . ASN A 1 268 ? -13.525 -0.865  18.409  1.00 19.21  ? 868  ASN A O   1 
ATOM   1730 C CB  . ASN A 1 268 ? -14.195 -3.565  17.019  1.00 15.94  ? 868  ASN A CB  1 
ATOM   1731 C CG  . ASN A 1 268 ? -14.615 -4.367  15.804  1.00 35.39  ? 868  ASN A CG  1 
ATOM   1732 O OD1 . ASN A 1 268 ? -14.665 -3.859  14.678  1.00 37.60  ? 868  ASN A OD1 1 
ATOM   1733 N ND2 . ASN A 1 268 ? -14.948 -5.638  16.011  1.00 21.09  ? 868  ASN A ND2 1 
ATOM   1734 N N   . HIS A 1 269 ? -11.623 -2.088  18.712  1.00 17.22  ? 869  HIS A N   1 
ATOM   1735 C CA  . HIS A 1 269 ? -11.184 -1.442  19.945  1.00 17.28  ? 869  HIS A CA  1 
ATOM   1736 C C   . HIS A 1 269 ? -10.234 -0.272  19.678  1.00 18.08  ? 869  HIS A C   1 
ATOM   1737 O O   . HIS A 1 269 ? -9.930  0.513   20.585  1.00 16.62  ? 869  HIS A O   1 
ATOM   1738 C CB  . HIS A 1 269 ? -10.609 -2.479  20.918  1.00 18.79  ? 869  HIS A CB  1 
ATOM   1739 C CG  . HIS A 1 269 ? -11.678 -3.345  21.520  1.00 23.08  ? 869  HIS A CG  1 
ATOM   1740 N ND1 . HIS A 1 269 ? -11.850 -3.427  22.888  1.00 25.40  ? 869  HIS A ND1 1 
ATOM   1741 C CD2 . HIS A 1 269 ? -12.631 -4.097  20.914  1.00 25.25  ? 869  HIS A CD2 1 
ATOM   1742 C CE1 . HIS A 1 269 ? -12.877 -4.245  23.070  1.00 24.95  ? 869  HIS A CE1 1 
ATOM   1743 N NE2 . HIS A 1 269 ? -13.383 -4.666  21.911  1.00 25.15  ? 869  HIS A NE2 1 
ATOM   1744 N N   . ARG A 1 270 ? -9.823  -0.127  18.410  1.00 12.27  ? 870  ARG A N   1 
ATOM   1745 C CA  . ARG A 1 270 ? -8.974  0.971   17.968  1.00 10.99  ? 870  ARG A CA  1 
ATOM   1746 C C   . ARG A 1 270 ? -9.843  2.234   17.878  1.00 13.34  ? 870  ARG A C   1 
ATOM   1747 O O   . ARG A 1 270 ? -11.035 2.121   17.555  1.00 12.25  ? 870  ARG A O   1 
ATOM   1748 C CB  . ARG A 1 270 ? -8.366  0.664   16.590  1.00 7.40   ? 870  ARG A CB  1 
ATOM   1749 C CG  . ARG A 1 270 ? -7.361  -0.475  16.605  1.00 7.87   ? 870  ARG A CG  1 
ATOM   1750 C CD  . ARG A 1 270 ? -6.911  -0.825  15.208  1.00 8.57   ? 870  ARG A CD  1 
ATOM   1751 N NE  . ARG A 1 270 ? -6.379  -2.186  15.178  1.00 13.91  ? 870  ARG A NE  1 
ATOM   1752 C CZ  . ARG A 1 270 ? -6.283  -2.933  14.088  1.00 17.32  ? 870  ARG A CZ  1 
ATOM   1753 N NH1 . ARG A 1 270 ? -6.680  -2.461  12.913  1.00 3.00   ? 870  ARG A NH1 1 
ATOM   1754 N NH2 . ARG A 1 270 ? -5.806  -4.165  14.166  1.00 7.84   ? 870  ARG A NH2 1 
ATOM   1755 N N   . PRO A 1 271 ? -9.292  3.447   18.132  1.00 8.98   ? 871  PRO A N   1 
ATOM   1756 C CA  . PRO A 1 271 ? -10.130 4.648   17.990  1.00 8.55   ? 871  PRO A CA  1 
ATOM   1757 C C   . PRO A 1 271 ? -10.478 4.901   16.527  1.00 11.83  ? 871  PRO A C   1 
ATOM   1758 O O   . PRO A 1 271 ? -9.751  4.475   15.643  1.00 11.20  ? 871  PRO A O   1 
ATOM   1759 C CB  . PRO A 1 271 ? -9.240  5.772   18.540  1.00 9.47   ? 871  PRO A CB  1 
ATOM   1760 C CG  . PRO A 1 271 ? -7.845  5.284   18.352  1.00 13.53  ? 871  PRO A CG  1 
ATOM   1761 C CD  . PRO A 1 271 ? -7.905  3.796   18.512  1.00 9.45   ? 871  PRO A CD  1 
ATOM   1762 N N   . LYS A 1 272 ? -11.570 5.616   16.276  1.00 10.07  ? 872  LYS A N   1 
ATOM   1763 C CA  . LYS A 1 272 ? -11.923 6.013   14.920  1.00 9.96   ? 872  LYS A CA  1 
ATOM   1764 C C   . LYS A 1 272 ? -11.162 7.330   14.667  1.00 10.56  ? 872  LYS A C   1 
ATOM   1765 O O   . LYS A 1 272 ? -10.644 7.925   15.615  1.00 10.49  ? 872  LYS A O   1 
ATOM   1766 C CB  . LYS A 1 272 ? -13.451 6.169   14.775  1.00 13.59  ? 872  LYS A CB  1 
ATOM   1767 C CG  . LYS A 1 272 ? -14.194 4.827   14.683  1.00 13.30  ? 872  LYS A CG  1 
ATOM   1768 C CD  . LYS A 1 272 ? -15.392 4.808   15.629  1.00 22.34  ? 872  LYS A CD  1 
ATOM   1769 C CE  . LYS A 1 272 ? -16.063 3.454   15.742  1.00 27.28  ? 872  LYS A CE  1 
ATOM   1770 N NZ  . LYS A 1 272 ? -17.094 3.438   16.824  1.00 32.05  ? 872  LYS A NZ  1 
ATOM   1771 N N   . PHE A 1 273 ? -11.039 7.752   13.409  1.00 5.26   ? 873  PHE A N   1 
ATOM   1772 C CA  . PHE A 1 273 ? -10.306 8.973   13.061  1.00 4.67   ? 873  PHE A CA  1 
ATOM   1773 C C   . PHE A 1 273 ? -10.902 10.245  13.705  1.00 8.77   ? 873  PHE A C   1 
ATOM   1774 O O   . PHE A 1 273 ? -10.152 11.117  14.134  1.00 7.66   ? 873  PHE A O   1 
ATOM   1775 C CB  . PHE A 1 273 ? -10.132 9.097   11.539  1.00 5.97   ? 873  PHE A CB  1 
ATOM   1776 C CG  . PHE A 1 273 ? -8.984  8.283   10.973  1.00 6.68   ? 873  PHE A CG  1 
ATOM   1777 C CD1 . PHE A 1 273 ? -7.663  8.583   11.304  1.00 9.90   ? 873  PHE A CD1 1 
ATOM   1778 C CD2 . PHE A 1 273 ? -9.218  7.260   10.060  1.00 8.26   ? 873  PHE A CD2 1 
ATOM   1779 C CE1 . PHE A 1 273 ? -6.597  7.838   10.770  1.00 10.23  ? 873  PHE A CE1 1 
ATOM   1780 C CE2 . PHE A 1 273 ? -8.154  6.541   9.494   1.00 10.59  ? 873  PHE A CE2 1 
ATOM   1781 C CZ  . PHE A 1 273 ? -6.850  6.825   9.866   1.00 8.89   ? 873  PHE A CZ  1 
ATOM   1782 N N   . GLY A 1 274 ? -12.224 10.292  13.864  1.00 8.44   ? 874  GLY A N   1 
ATOM   1783 C CA  . GLY A 1 274 ? -12.911 11.382  14.556  1.00 8.83   ? 874  GLY A CA  1 
ATOM   1784 C C   . GLY A 1 274 ? -12.454 11.468  16.000  1.00 14.67  ? 874  GLY A C   1 
ATOM   1785 O O   . GLY A 1 274 ? -12.147 12.561  16.484  1.00 15.00  ? 874  GLY A O   1 
ATOM   1786 N N   . GLN A 1 275 ? -12.339 10.301  16.684  1.00 11.88  ? 875  GLN A N   1 
ATOM   1787 C CA  . GLN A 1 275 ? -11.852 10.232  18.081  1.00 11.68  ? 875  GLN A CA  1 
ATOM   1788 C C   . GLN A 1 275 ? -10.383 10.660  18.180  1.00 15.14  ? 875  GLN A C   1 
ATOM   1789 O O   . GLN A 1 275 ? -10.023 11.318  19.156  1.00 15.31  ? 875  GLN A O   1 
ATOM   1790 C CB  . GLN A 1 275 ? -12.058 8.829   18.712  1.00 12.63  ? 875  GLN A CB  1 
ATOM   1791 C CG  . GLN A 1 275 ? -13.524 8.383   18.803  1.00 17.51  ? 875  GLN A CG  1 
ATOM   1792 C CD  . GLN A 1 275 ? -13.693 6.927   19.214  1.00 25.67  ? 875  GLN A CD  1 
ATOM   1793 O OE1 . GLN A 1 275 ? -13.303 5.986   18.507  1.00 8.84   ? 875  GLN A OE1 1 
ATOM   1794 N NE2 . GLN A 1 275 ? -14.340 6.710   20.349  1.00 26.08  ? 875  GLN A NE2 1 
ATOM   1795 N N   . ILE A 1 276 ? -9.531  10.281  17.181  1.00 10.15  ? 876  ILE A N   1 
ATOM   1796 C CA  . ILE A 1 276 ? -8.108  10.656  17.161  1.00 9.14   ? 876  ILE A CA  1 
ATOM   1797 C C   . ILE A 1 276 ? -7.979  12.197  17.138  1.00 15.99  ? 876  ILE A C   1 
ATOM   1798 O O   . ILE A 1 276 ? -7.278  12.759  17.979  1.00 17.09  ? 876  ILE A O   1 
ATOM   1799 C CB  . ILE A 1 276 ? -7.319  9.968   15.995  1.00 10.89  ? 876  ILE A CB  1 
ATOM   1800 C CG1 . ILE A 1 276 ? -7.171  8.438   16.224  1.00 10.12  ? 876  ILE A CG1 1 
ATOM   1801 C CG2 . ILE A 1 276 ? -5.943  10.619  15.802  1.00 9.18   ? 876  ILE A CG2 1 
ATOM   1802 C CD1 . ILE A 1 276 ? -6.880  7.616   14.967  1.00 10.88  ? 876  ILE A CD1 1 
ATOM   1803 N N   . VAL A 1 277 ? -8.687  12.867  16.199  1.00 12.26  ? 877  VAL A N   1 
ATOM   1804 C CA  . VAL A 1 277 ? -8.699  14.329  16.048  1.00 12.08  ? 877  VAL A CA  1 
ATOM   1805 C C   . VAL A 1 277 ? -9.110  15.016  17.377  1.00 15.17  ? 877  VAL A C   1 
ATOM   1806 O O   . VAL A 1 277 ? -8.461  15.973  17.803  1.00 13.83  ? 877  VAL A O   1 
ATOM   1807 C CB  . VAL A 1 277 ? -9.568  14.760  14.836  1.00 16.70  ? 877  VAL A CB  1 
ATOM   1808 C CG1 . VAL A 1 277 ? -9.765  16.274  14.786  1.00 16.98  ? 877  VAL A CG1 1 
ATOM   1809 C CG2 . VAL A 1 277 ? -8.974  14.253  13.528  1.00 16.71  ? 877  VAL A CG2 1 
ATOM   1810 N N   . ASN A 1 278 ? -10.162 14.490  18.034  1.00 12.96  ? 878  ASN A N   1 
ATOM   1811 C CA  . ASN A 1 278 ? -10.660 14.957  19.326  1.00 12.96  ? 878  ASN A CA  1 
ATOM   1812 C C   . ASN A 1 278 ? -9.583  14.870  20.408  1.00 15.02  ? 878  ASN A C   1 
ATOM   1813 O O   . ASN A 1 278 ? -9.421  15.814  21.174  1.00 14.87  ? 878  ASN A O   1 
ATOM   1814 C CB  . ASN A 1 278 ? -11.903 14.157  19.740  1.00 15.01  ? 878  ASN A CB  1 
ATOM   1815 C CG  . ASN A 1 278 ? -13.202 14.861  19.458  1.00 49.03  ? 878  ASN A CG  1 
ATOM   1816 O OD1 . ASN A 1 278 ? -13.385 16.045  19.781  1.00 51.47  ? 878  ASN A OD1 1 
ATOM   1817 N ND2 . ASN A 1 278 ? -14.152 14.135  18.885  1.00 39.88  ? 878  ASN A ND2 1 
ATOM   1818 N N   . THR A 1 279 ? -8.843  13.742  20.445  1.00 10.74  ? 879  THR A N   1 
ATOM   1819 C CA  . THR A 1 279 ? -7.743  13.444  21.378  1.00 9.78   ? 879  THR A CA  1 
ATOM   1820 C C   . THR A 1 279 ? -6.573  14.439  21.190  1.00 11.53  ? 879  THR A C   1 
ATOM   1821 O O   . THR A 1 279 ? -6.104  15.010  22.166  1.00 11.38  ? 879  THR A O   1 
ATOM   1822 C CB  . THR A 1 279 ? -7.349  11.952  21.250  1.00 14.67  ? 879  THR A CB  1 
ATOM   1823 O OG1 . THR A 1 279 ? -8.473  11.148  21.620  1.00 12.15  ? 879  THR A OG1 1 
ATOM   1824 C CG2 . THR A 1 279 ? -6.114  11.560  22.096  1.00 13.07  ? 879  THR A CG2 1 
ATOM   1825 N N   . LEU A 1 280 ? -6.138  14.664  19.940  1.00 6.40   ? 880  LEU A N   1 
ATOM   1826 C CA  . LEU A 1 280 ? -5.050  15.585  19.617  1.00 5.63   ? 880  LEU A CA  1 
ATOM   1827 C C   . LEU A 1 280 ? -5.454  17.043  19.853  1.00 11.46  ? 880  LEU A C   1 
ATOM   1828 O O   . LEU A 1 280 ? -4.613  17.829  20.265  1.00 10.13  ? 880  LEU A O   1 
ATOM   1829 C CB  . LEU A 1 280 ? -4.542  15.378  18.184  1.00 5.21   ? 880  LEU A CB  1 
ATOM   1830 C CG  . LEU A 1 280 ? -4.064  13.966  17.805  1.00 8.80   ? 880  LEU A CG  1 
ATOM   1831 C CD1 . LEU A 1 280 ? -4.073  13.794  16.315  1.00 8.09   ? 880  LEU A CD1 1 
ATOM   1832 C CD2 . LEU A 1 280 ? -2.651  13.667  18.367  1.00 11.53  ? 880  LEU A CD2 1 
ATOM   1833 N N   . ASP A 1 281 ? -6.743  17.397  19.616  1.00 10.46  ? 881  ASP A N   1 
ATOM   1834 C CA  . ASP A 1 281 ? -7.267  18.742  19.889  1.00 10.67  ? 881  ASP A CA  1 
ATOM   1835 C C   . ASP A 1 281 ? -7.273  19.008  21.383  1.00 16.11  ? 881  ASP A C   1 
ATOM   1836 O O   . ASP A 1 281 ? -6.860  20.090  21.793  1.00 16.64  ? 881  ASP A O   1 
ATOM   1837 C CB  . ASP A 1 281 ? -8.666  18.948  19.278  1.00 11.97  ? 881  ASP A CB  1 
ATOM   1838 C CG  . ASP A 1 281 ? -8.597  19.249  17.800  1.00 19.30  ? 881  ASP A CG  1 
ATOM   1839 O OD1 . ASP A 1 281 ? -7.509  19.643  17.326  1.00 20.74  ? 881  ASP A OD1 1 
ATOM   1840 O OD2 . ASP A 1 281 ? -9.630  19.103  17.116  1.00 23.68  ? 881  ASP A OD2 1 
ATOM   1841 N N   . LYS A 1 282 ? -7.674  18.006  22.202  1.00 12.95  ? 882  LYS A N   1 
ATOM   1842 C CA  . LYS A 1 282 ? -7.669  18.108  23.666  1.00 13.58  ? 882  LYS A CA  1 
ATOM   1843 C C   . LYS A 1 282 ? -6.238  18.315  24.229  1.00 18.45  ? 882  LYS A C   1 
ATOM   1844 O O   . LYS A 1 282 ? -6.093  18.917  25.288  1.00 17.87  ? 882  LYS A O   1 
ATOM   1845 C CB  . LYS A 1 282 ? -8.318  16.871  24.302  1.00 16.02  ? 882  LYS A CB  1 
ATOM   1846 C CG  . LYS A 1 282 ? -9.820  16.987  24.486  1.00 25.04  ? 882  LYS A CG  1 
ATOM   1847 N N   . MET A 1 283 ? -5.198  17.834  23.498  1.00 15.52  ? 883  MET A N   1 
ATOM   1848 C CA  . MET A 1 283 ? -3.775  17.954  23.825  1.00 15.14  ? 883  MET A CA  1 
ATOM   1849 C C   . MET A 1 283 ? -3.235  19.331  23.467  1.00 21.07  ? 883  MET A C   1 
ATOM   1850 O O   . MET A 1 283 ? -2.428  19.860  24.226  1.00 20.97  ? 883  MET A O   1 
ATOM   1851 C CB  . MET A 1 283 ? -2.940  16.899  23.088  1.00 17.11  ? 883  MET A CB  1 
ATOM   1852 C CG  . MET A 1 283 ? -3.014  15.522  23.672  1.00 19.75  ? 883  MET A CG  1 
ATOM   1853 S SD  . MET A 1 283 ? -2.004  14.424  22.654  1.00 22.65  ? 883  MET A SD  1 
ATOM   1854 C CE  . MET A 1 283 ? -2.702  12.904  23.059  1.00 19.58  ? 883  MET A CE  1 
ATOM   1855 N N   . ILE A 1 284 ? -3.629  19.893  22.293  1.00 19.49  ? 884  ILE A N   1 
ATOM   1856 C CA  . ILE A 1 284 ? -3.206  21.230  21.848  1.00 20.23  ? 884  ILE A CA  1 
ATOM   1857 C C   . ILE A 1 284 ? -3.846  22.261  22.779  1.00 26.01  ? 884  ILE A C   1 
ATOM   1858 O O   . ILE A 1 284 ? -3.173  23.206  23.197  1.00 26.58  ? 884  ILE A O   1 
ATOM   1859 C CB  . ILE A 1 284 ? -3.529  21.516  20.347  1.00 23.76  ? 884  ILE A CB  1 
ATOM   1860 C CG1 . ILE A 1 284 ? -2.866  20.486  19.397  1.00 24.17  ? 884  ILE A CG1 1 
ATOM   1861 C CG2 . ILE A 1 284 ? -3.122  22.943  19.955  1.00 24.76  ? 884  ILE A CG2 1 
ATOM   1862 C CD1 . ILE A 1 284 ? -3.609  20.287  18.043  1.00 26.75  ? 884  ILE A CD1 1 
ATOM   1863 N N   . ARG A 1 285 ? -5.130  22.048  23.134  1.00 23.56  ? 885  ARG A N   1 
ATOM   1864 C CA  . ARG A 1 285 ? -5.878  22.908  24.059  1.00 23.86  ? 885  ARG A CA  1 
ATOM   1865 C C   . ARG A 1 285 ? -5.250  22.908  25.450  1.00 28.42  ? 885  ARG A C   1 
ATOM   1866 O O   . ARG A 1 285 ? -5.126  23.974  26.048  1.00 28.94  ? 885  ARG A O   1 
ATOM   1867 C CB  . ARG A 1 285 ? -7.369  22.532  24.113  1.00 22.50  ? 885  ARG A CB  1 
ATOM   1868 C CG  . ARG A 1 285 ? -8.147  23.028  22.897  1.00 31.75  ? 885  ARG A CG  1 
ATOM   1869 C CD  . ARG A 1 285 ? -9.650  22.972  23.097  1.00 40.78  ? 885  ARG A CD  1 
ATOM   1870 N NE  . ARG A 1 285 ? -10.158 21.598  23.125  1.00 48.44  ? 885  ARG A NE  1 
ATOM   1871 C CZ  . ARG A 1 285 ? -10.722 20.976  22.094  1.00 57.20  ? 885  ARG A CZ  1 
ATOM   1872 N NH1 . ARG A 1 285 ? -10.870 21.602  20.930  1.00 32.53  ? 885  ARG A NH1 1 
ATOM   1873 N NH2 . ARG A 1 285 ? -11.148 19.727  22.218  1.00 48.48  ? 885  ARG A NH2 1 
ATOM   1874 N N   . ASN A 1 286 ? -4.802  21.730  25.936  1.00 24.41  ? 886  ASN A N   1 
ATOM   1875 C CA  . ASN A 1 286 ? -4.146  21.591  27.235  1.00 24.19  ? 886  ASN A CA  1 
ATOM   1876 C C   . ASN A 1 286 ? -2.702  21.063  27.055  1.00 29.06  ? 886  ASN A C   1 
ATOM   1877 O O   . ASN A 1 286 ? -2.468  19.859  27.184  1.00 27.58  ? 886  ASN A O   1 
ATOM   1878 C CB  . ASN A 1 286 ? -4.976  20.712  28.188  1.00 25.59  ? 886  ASN A CB  1 
ATOM   1879 C CG  . ASN A 1 286 ? -4.602  20.838  29.653  1.00 59.74  ? 886  ASN A CG  1 
ATOM   1880 O OD1 . ASN A 1 286 ? -4.022  21.838  30.106  1.00 58.19  ? 886  ASN A OD1 1 
ATOM   1881 N ND2 . ASN A 1 286 ? -4.966  19.836  30.440  1.00 53.24  ? 886  ASN A ND2 1 
ATOM   1882 N N   . PRO A 1 287 ? -1.717  21.952  26.752  1.00 27.89  ? 887  PRO A N   1 
ATOM   1883 C CA  . PRO A 1 287 ? -0.335  21.477  26.519  1.00 28.44  ? 887  PRO A CA  1 
ATOM   1884 C C   . PRO A 1 287 ? 0.395   20.877  27.733  1.00 33.49  ? 887  PRO A C   1 
ATOM   1885 O O   . PRO A 1 287 ? 1.514   20.375  27.576  1.00 32.26  ? 887  PRO A O   1 
ATOM   1886 C CB  . PRO A 1 287 ? 0.382   22.715  25.971  1.00 30.08  ? 887  PRO A CB  1 
ATOM   1887 C CG  . PRO A 1 287 ? -0.397  23.861  26.474  1.00 34.51  ? 887  PRO A CG  1 
ATOM   1888 C CD  . PRO A 1 287 ? -1.826  23.410  26.532  1.00 29.77  ? 887  PRO A CD  1 
ATOM   1889 N N   . ASN A 1 288 ? -0.249  20.885  28.921  1.00 31.45  ? 888  ASN A N   1 
ATOM   1890 C CA  . ASN A 1 288 ? 0.278   20.302  30.156  1.00 31.74  ? 888  ASN A CA  1 
ATOM   1891 C C   . ASN A 1 288 ? 0.250   18.763  30.071  1.00 36.39  ? 888  ASN A C   1 
ATOM   1892 O O   . ASN A 1 288 ? 1.126   18.099  30.632  1.00 35.80  ? 888  ASN A O   1 
ATOM   1893 C CB  . ASN A 1 288 ? -0.516  20.812  31.372  1.00 33.06  ? 888  ASN A CB  1 
ATOM   1894 C CG  . ASN A 1 288 ? -0.169  20.140  32.685  1.00 43.73  ? 888  ASN A CG  1 
ATOM   1895 O OD1 . ASN A 1 288 ? 0.834   20.454  33.329  1.00 32.28  ? 888  ASN A OD1 1 
ATOM   1896 N ND2 . ASN A 1 288 ? -0.990  19.181  33.093  1.00 33.65  ? 888  ASN A ND2 1 
ATOM   1897 N N   . SER A 1 289 ? -0.745  18.207  29.346  1.00 33.70  ? 889  SER A N   1 
ATOM   1898 C CA  . SER A 1 289 ? -0.924  16.762  29.133  1.00 33.93  ? 889  SER A CA  1 
ATOM   1899 C C   . SER A 1 289 ? 0.223   16.118  28.314  1.00 39.44  ? 889  SER A C   1 
ATOM   1900 O O   . SER A 1 289 ? 0.328   14.892  28.261  1.00 39.06  ? 889  SER A O   1 
ATOM   1901 C CB  . SER A 1 289 ? -2.278  16.486  28.482  1.00 36.75  ? 889  SER A CB  1 
ATOM   1902 O OG  . SER A 1 289 ? -2.391  17.138  27.228  1.00 42.77  ? 889  SER A OG  1 
ATOM   1903 N N   . LEU A 1 290 ? 1.089   16.950  27.708  1.00 37.48  ? 890  LEU A N   1 
ATOM   1904 C CA  . LEU A 1 290 ? 2.239   16.520  26.908  1.00 37.98  ? 890  LEU A CA  1 
ATOM   1905 C C   . LEU A 1 290 ? 3.582   16.652  27.670  1.00 43.22  ? 890  LEU A C   1 
ATOM   1906 O O   . LEU A 1 290 ? 4.640   16.367  27.101  1.00 42.81  ? 890  LEU A O   1 
ATOM   1907 C CB  . LEU A 1 290 ? 2.277   17.301  25.577  1.00 38.07  ? 890  LEU A CB  1 
ATOM   1908 C CG  . LEU A 1 290 ? 1.042   17.173  24.676  1.00 42.63  ? 890  LEU A CG  1 
ATOM   1909 C CD1 . LEU A 1 290 ? 0.634   18.515  24.122  1.00 42.78  ? 890  LEU A CD1 1 
ATOM   1910 C CD2 . LEU A 1 290 ? 1.270   16.174  23.559  1.00 45.22  ? 890  LEU A CD2 1 
ATOM   1911 N N   . LYS A 1 291 ? 3.535   17.063  28.958  1.00 40.93  ? 891  LYS A N   1 
ATOM   1912 C CA  . LYS A 1 291 ? 4.721   17.239  29.811  1.00 41.17  ? 891  LYS A CA  1 
ATOM   1913 C C   . LYS A 1 291 ? 5.250   15.913  30.372  1.00 46.96  ? 891  LYS A C   1 
ATOM   1914 O O   . LYS A 1 291 ? 6.464   15.759  30.496  1.00 46.93  ? 891  LYS A O   1 
ATOM   1915 C CB  . LYS A 1 291 ? 4.458   18.240  30.955  1.00 43.25  ? 891  LYS A CB  1 
ATOM   1916 C CG  . LYS A 1 291 ? 4.052   19.643  30.502  1.00 53.79  ? 891  LYS A CG  1 
ATOM   1917 C CD  . LYS A 1 291 ? 5.238   20.525  30.113  1.00 64.03  ? 891  LYS A CD  1 
ATOM   1918 C CE  . LYS A 1 291 ? 4.806   21.807  29.436  1.00 71.58  ? 891  LYS A CE  1 
ATOM   1919 N NZ  . LYS A 1 291 ? 4.210   22.779  30.391  1.00 78.06  ? 891  LYS A NZ  1 
ATOM   1920 N N   . ALA A 1 292 ? 4.350   14.964  30.708  1.00 44.35  ? 892  ALA A N   1 
ATOM   1921 C CA  . ALA A 1 292 ? 4.733   13.654  31.242  1.00 44.51  ? 892  ALA A CA  1 
ATOM   1922 C C   . ALA A 1 292 ? 5.219   12.716  30.129  1.00 48.29  ? 892  ALA A C   1 
ATOM   1923 O O   . ALA A 1 292 ? 4.519   12.530  29.129  1.00 47.38  ? 892  ALA A O   1 
ATOM   1924 C CB  . ALA A 1 292 ? 3.570   13.029  32.000  1.00 45.31  ? 892  ALA A CB  1 
ATOM   1925 N N   . MET A 1 293 ? 6.431   12.151  30.304  1.00 45.34  ? 893  MET A N   1 
ATOM   1926 C CA  . MET A 1 293 ? 7.075   11.223  29.364  1.00 49.71  ? 893  MET A CA  1 
ATOM   1927 C C   . MET A 1 293 ? 6.985   9.772   29.850  1.00 62.03  ? 893  MET A C   1 
ATOM   1928 O O   . MET A 1 293 ? 7.165   9.527   31.064  1.00 63.84  ? 893  MET A O   1 
ATOM   1929 C CB  . MET A 1 293 ? 8.546   11.615  29.116  1.00 52.19  ? 893  MET A CB  1 
ATOM   1930 C CG  . MET A 1 293 ? 8.758   12.465  27.869  1.00 55.99  ? 893  MET A CG  1 
ATOM   1931 S SD  . MET A 1 293 ? 8.249   14.200  28.024  1.00 60.31  ? 893  MET A SD  1 
ATOM   1932 C CE  . MET A 1 293 ? 9.629   14.870  28.965  1.00 56.98  ? 893  MET A CE  1 
ATOM   1933 N N   . ALA A 1 294 ? 6.746   8.879   29.008  1.00 82.80  ? 894  ALA A N   1 
HETATM 1934 O O   . HOH B 2 .   ? 9.064   27.642  17.701  1.00 24.18  ? 2001 HOH A O   1 
HETATM 1935 O O   . HOH B 2 .   ? -13.560 2.354   -2.559  1.00 22.31  ? 2002 HOH A O   1 
HETATM 1936 O O   . HOH B 2 .   ? -2.485  1.077   -2.489  1.00 32.50  ? 2003 HOH A O   1 
HETATM 1937 O O   . HOH B 2 .   ? 12.542  3.914   19.840  1.00 36.98  ? 2004 HOH A O   1 
HETATM 1938 O O   . HOH B 2 .   ? 7.736   -0.381  24.543  1.00 23.09  ? 2005 HOH A O   1 
HETATM 1939 O O   . HOH B 2 .   ? 4.836   34.100  -14.983 1.00 30.11  ? 2006 HOH A O   1 
HETATM 1940 O O   . HOH B 2 .   ? -9.248  17.741  -5.647  1.00 18.23  ? 2007 HOH A O   1 
HETATM 1941 O O   . HOH B 2 .   ? -8.308  17.924  -1.266  1.00 3.98   ? 2008 HOH A O   1 
HETATM 1942 O O   . HOH B 2 .   ? -10.727 22.013  1.049   1.00 15.76  ? 2009 HOH A O   1 
HETATM 1943 O O   . HOH B 2 .   ? -13.471 20.850  3.035   1.00 11.80  ? 2010 HOH A O   1 
HETATM 1944 O O   . HOH B 2 .   ? -6.125  20.609  -0.324  1.00 16.37  ? 2011 HOH A O   1 
HETATM 1945 O O   . HOH B 2 .   ? -11.640 16.432  8.592   1.00 17.30  ? 2012 HOH A O   1 
HETATM 1946 O O   . HOH B 2 .   ? -7.461  20.627  8.696   1.00 20.04  ? 2013 HOH A O   1 
HETATM 1947 O O   . HOH B 2 .   ? -3.639  21.056  8.975   1.00 7.70   ? 2014 HOH A O   1 
HETATM 1948 O O   . HOH B 2 .   ? -6.230  27.713  -8.514  1.00 23.92  ? 2015 HOH A O   1 
HETATM 1949 O O   . HOH B 2 .   ? -0.675  24.132  -0.732  1.00 27.23  ? 2016 HOH A O   1 
HETATM 1950 O O   . HOH B 2 .   ? 11.253  16.226  1.909   1.00 14.73  ? 2017 HOH A O   1 
HETATM 1951 O O   . HOH B 2 .   ? 9.836   16.247  -2.915  1.00 32.50  ? 2018 HOH A O   1 
HETATM 1952 O O   . HOH B 2 .   ? 10.714  6.614   1.372   1.00 17.56  ? 2019 HOH A O   1 
HETATM 1953 O O   . HOH B 2 .   ? 15.833  11.859  3.805   1.00 28.83  ? 2020 HOH A O   1 
HETATM 1954 O O   . HOH B 2 .   ? 16.572  22.151  8.162   1.00 10.33  ? 2021 HOH A O   1 
HETATM 1955 O O   . HOH B 2 .   ? 15.823  16.127  0.303   1.00 13.21  ? 2022 HOH A O   1 
HETATM 1956 O O   . HOH B 2 .   ? 18.691  18.512  13.185  1.00 10.01  ? 2023 HOH A O   1 
HETATM 1957 O O   . HOH B 2 .   ? 9.816   25.341  16.449  1.00 5.85   ? 2024 HOH A O   1 
HETATM 1958 O O   . HOH B 2 .   ? 5.601   25.648  18.548  1.00 22.11  ? 2025 HOH A O   1 
HETATM 1959 O O   . HOH B 2 .   ? 1.884   21.762  12.965  1.00 3.10   ? 2026 HOH A O   1 
HETATM 1960 O O   . HOH B 2 .   ? 3.978   26.289  13.229  1.00 19.77  ? 2027 HOH A O   1 
HETATM 1961 O O   . HOH B 2 .   ? 0.468   21.152  10.664  1.00 11.53  ? 2028 HOH A O   1 
HETATM 1962 O O   . HOH B 2 .   ? -3.559  20.649  12.721  1.00 31.42  ? 2029 HOH A O   1 
HETATM 1963 O O   . HOH B 2 .   ? -17.512 5.518   5.764   1.00 14.52  ? 2030 HOH A O   1 
HETATM 1964 O O   . HOH B 2 .   ? -15.690 6.727   8.907   1.00 8.41   ? 2031 HOH A O   1 
HETATM 1965 O O   . HOH B 2 .   ? -15.753 14.278  7.062   1.00 6.62   ? 2032 HOH A O   1 
HETATM 1966 O O   . HOH B 2 .   ? -18.279 9.175   11.049  1.00 23.95  ? 2033 HOH A O   1 
HETATM 1967 O O   . HOH B 2 .   ? -17.322 4.716   -1.772  1.00 10.23  ? 2034 HOH A O   1 
HETATM 1968 O O   . HOH B 2 .   ? -11.857 2.051   -0.384  1.00 9.53   ? 2035 HOH A O   1 
HETATM 1969 O O   . HOH B 2 .   ? -21.772 4.899   2.366   1.00 50.01  ? 2036 HOH A O   1 
HETATM 1970 O O   . HOH B 2 .   ? -9.846  5.291   5.665   1.00 17.31  ? 2037 HOH A O   1 
HETATM 1971 O O   . HOH B 2 .   ? -3.972  4.781   -1.581  1.00 4.06   ? 2038 HOH A O   1 
HETATM 1972 O O   . HOH B 2 .   ? -8.743  2.006   -2.121  1.00 30.65  ? 2039 HOH A O   1 
HETATM 1973 O O   . HOH B 2 .   ? -5.644  1.401   -2.533  1.00 13.60  ? 2040 HOH A O   1 
HETATM 1974 O O   . HOH B 2 .   ? -2.977  2.625   5.211   1.00 4.17   ? 2041 HOH A O   1 
HETATM 1975 O O   . HOH B 2 .   ? -1.322  -0.745  5.075   1.00 8.76   ? 2042 HOH A O   1 
HETATM 1976 O O   . HOH B 2 .   ? -1.451  -3.366  0.039   1.00 12.62  ? 2043 HOH A O   1 
HETATM 1977 O O   . HOH B 2 .   ? 6.977   6.493   5.418   1.00 3.12   ? 2044 HOH A O   1 
HETATM 1978 O O   . HOH B 2 .   ? 4.089   4.888   -1.674  1.00 27.60  ? 2045 HOH A O   1 
HETATM 1979 O O   . HOH B 2 .   ? -1.053  19.431  9.117   1.00 8.98   ? 2046 HOH A O   1 
HETATM 1980 O O   . HOH B 2 .   ? 7.550   -3.017  4.691   1.00 9.79   ? 2047 HOH A O   1 
HETATM 1981 O O   . HOH B 2 .   ? 2.732   -4.653  10.645  1.00 12.56  ? 2048 HOH A O   1 
HETATM 1982 O O   . HOH B 2 .   ? 3.116   -2.236  11.710  1.00 8.57   ? 2049 HOH A O   1 
HETATM 1983 O O   . HOH B 2 .   ? -3.142  -1.089  7.106   1.00 6.80   ? 2050 HOH A O   1 
HETATM 1984 O O   . HOH B 2 .   ? -9.084  -4.137  9.210   1.00 11.25  ? 2051 HOH A O   1 
HETATM 1985 O O   . HOH B 2 .   ? -13.743 -3.549  4.520   1.00 14.63  ? 2052 HOH A O   1 
HETATM 1986 O O   . HOH B 2 .   ? -14.310 0.950   6.761   1.00 18.51  ? 2053 HOH A O   1 
HETATM 1987 O O   . HOH B 2 .   ? -5.276  -0.121  5.414   1.00 6.84   ? 2054 HOH A O   1 
HETATM 1988 O O   . HOH B 2 .   ? 14.865  9.462   15.714  1.00 14.20  ? 2055 HOH A O   1 
HETATM 1989 O O   . HOH B 2 .   ? 15.601  11.552  12.290  1.00 19.07  ? 2056 HOH A O   1 
HETATM 1990 O O   . HOH B 2 .   ? 12.368  5.993   17.957  1.00 5.28   ? 2057 HOH A O   1 
HETATM 1991 O O   . HOH B 2 .   ? 14.879  -3.602  15.735  1.00 25.78  ? 2058 HOH A O   1 
HETATM 1992 O O   . HOH B 2 .   ? 3.854   -1.108  16.658  1.00 11.47  ? 2059 HOH A O   1 
HETATM 1993 O O   . HOH B 2 .   ? 18.913  -5.937  12.555  1.00 23.11  ? 2060 HOH A O   1 
HETATM 1994 O O   . HOH B 2 .   ? 13.200  -12.913 6.088   1.00 11.52  ? 2061 HOH A O   1 
HETATM 1995 O O   . HOH B 2 .   ? 11.714  -10.894 5.112   1.00 6.73   ? 2062 HOH A O   1 
HETATM 1996 O O   . HOH B 2 .   ? 6.617   -11.129 4.939   1.00 6.63   ? 2063 HOH A O   1 
HETATM 1997 O O   . HOH B 2 .   ? 10.175  -11.734 14.896  1.00 14.81  ? 2064 HOH A O   1 
HETATM 1998 O O   . HOH B 2 .   ? -0.984  -8.375  19.027  1.00 23.73  ? 2065 HOH A O   1 
HETATM 1999 O O   . HOH B 2 .   ? 1.227   -13.782 9.017   1.00 14.84  ? 2066 HOH A O   1 
HETATM 2000 O O   . HOH B 2 .   ? 5.372   0.334   23.255  1.00 18.68  ? 2067 HOH A O   1 
HETATM 2001 O O   . HOH B 2 .   ? 8.722   -2.423  22.712  1.00 21.26  ? 2068 HOH A O   1 
HETATM 2002 O O   . HOH B 2 .   ? -1.118  -1.722  21.040  1.00 8.35   ? 2069 HOH A O   1 
HETATM 2003 O O   . HOH B 2 .   ? -6.221  7.981   23.503  1.00 21.28  ? 2070 HOH A O   1 
HETATM 2004 O O   . HOH B 2 .   ? -3.929  -5.160  21.615  1.00 29.67  ? 2071 HOH A O   1 
HETATM 2005 O O   . HOH B 2 .   ? -9.237  -7.545  14.383  1.00 8.26   ? 2072 HOH A O   1 
HETATM 2006 O O   . HOH B 2 .   ? -11.986 -7.891  15.822  1.00 22.05  ? 2073 HOH A O   1 
HETATM 2007 O O   . HOH B 2 .   ? -12.626 0.937   15.666  1.00 8.87   ? 2074 HOH A O   1 
HETATM 2008 O O   . HOH B 2 .   ? -14.463 2.229   20.824  1.00 25.63  ? 2075 HOH A O   1 
HETATM 2009 O O   . HOH B 2 .   ? -16.906 -4.160  18.961  1.00 26.08  ? 2076 HOH A O   1 
HETATM 2010 O O   . HOH B 2 .   ? -14.432 9.078   12.801  1.00 10.05  ? 2077 HOH A O   1 
HETATM 2011 O O   . HOH B 2 .   ? -12.634 17.696  16.993  1.00 17.40  ? 2078 HOH A O   1 
HETATM 2012 O O   . HOH B 2 .   ? -5.926  14.017  24.986  1.00 11.99  ? 2079 HOH A O   1 
HETATM 2013 O O   . HOH B 2 .   ? -8.342  22.320  16.738  1.00 21.18  ? 2080 HOH A O   1 
HETATM 2014 O O   . HOH B 2 .   ? -8.228  20.464  27.150  1.00 40.27  ? 2081 HOH A O   1 
HETATM 2015 O O   . HOH B 2 .   ? -14.330 16.158  8.271   1.00 9.96   ? 2082 HOH A O   1 
HETATM 2016 O O   . HOH B 2 .   ? 5.666   6.679   27.141  1.00 22.95  ? 2083 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   601 ?   ?   ?   A . n 
A 1 2   SER 2   602 ?   ?   ?   A . n 
A 1 3   SER 3   603 ?   ?   ?   A . n 
A 1 4   ASP 4   604 ?   ?   ?   A . n 
A 1 5   PRO 5   605 ?   ?   ?   A . n 
A 1 6   ASN 6   606 ?   ?   ?   A . n 
A 1 7   GLU 7   607 ?   ?   ?   A . n 
A 1 8   ALA 8   608 ?   ?   ?   A . n 
A 1 9   VAL 9   609 ?   ?   ?   A . n 
A 1 10  ARG 10  610 ?   ?   ?   A . n 
A 1 11  GLU 11  611 ?   ?   ?   A . n 
A 1 12  PHE 12  612 ?   ?   ?   A . n 
A 1 13  ALA 13  613 ?   ?   ?   A . n 
A 1 14  LYS 14  614 ?   ?   ?   A . n 
A 1 15  GLU 15  615 615 GLU GLU A . n 
A 1 16  ILE 16  616 616 ILE ILE A . n 
A 1 17  ASP 17  617 617 ASP ASP A . n 
A 1 18  ILE 18  618 618 ILE ILE A . n 
A 1 19  SER 19  619 619 SER SER A . n 
A 1 20  CYS 20  620 620 CYS CYS A . n 
A 1 21  VAL 21  621 621 VAL VAL A . n 
A 1 22  LYS 22  622 622 LYS LYS A . n 
A 1 23  ILE 23  623 623 ILE ILE A . n 
A 1 24  GLU 24  624 624 GLU GLU A . n 
A 1 25  GLN 25  625 625 GLN GLN A . n 
A 1 26  VAL 26  626 626 VAL VAL A . n 
A 1 27  ILE 27  627 627 ILE ILE A . n 
A 1 28  GLY 28  628 ?   ?   ?   A . n 
A 1 29  ALA 29  629 ?   ?   ?   A . n 
A 1 30  GLY 30  630 ?   ?   ?   A . n 
A 1 31  GLU 31  631 ?   ?   ?   A . n 
A 1 32  PHE 32  632 632 PHE PHE A . n 
A 1 33  GLY 33  633 633 GLY GLY A . n 
A 1 34  GLU 34  634 634 GLU GLU A . n 
A 1 35  VAL 35  635 635 VAL VAL A . n 
A 1 36  CYS 36  636 636 CYS CYS A . n 
A 1 37  SER 37  637 637 SER SER A . n 
A 1 38  GLY 38  638 638 GLY GLY A . n 
A 1 39  HIS 39  639 639 HIS HIS A . n 
A 1 40  LEU 40  640 640 LEU LEU A . n 
A 1 41  LYS 41  641 641 LYS LYS A . n 
A 1 42  LEU 42  642 642 LEU LEU A . n 
A 1 43  PRO 43  643 643 PRO PRO A . n 
A 1 44  GLY 44  644 644 GLY GLY A . n 
A 1 45  LYS 45  645 645 LYS LYS A . n 
A 1 46  ARG 46  646 646 ARG ARG A . n 
A 1 47  GLU 47  647 647 GLU GLU A . n 
A 1 48  ILE 48  648 648 ILE ILE A . n 
A 1 49  PHE 49  649 649 PHE PHE A . n 
A 1 50  VAL 50  650 650 VAL VAL A . n 
A 1 51  ALA 51  651 651 ALA ALA A . n 
A 1 52  ILE 52  652 652 ILE ILE A . n 
A 1 53  LYS 53  653 653 LYS LYS A . n 
A 1 54  THR 54  654 654 THR THR A . n 
A 1 55  LEU 55  655 655 LEU LEU A . n 
A 1 56  LYS 56  656 ?   ?   ?   A . n 
A 1 57  SER 57  657 ?   ?   ?   A . n 
A 1 58  GLY 58  658 ?   ?   ?   A . n 
A 1 59  TYR 59  659 ?   ?   ?   A . n 
A 1 60  THR 60  660 660 THR THR A . n 
A 1 61  GLU 61  661 661 GLU GLU A . n 
A 1 62  LYS 62  662 662 LYS LYS A . n 
A 1 63  GLN 63  663 663 GLN GLN A . n 
A 1 64  ARG 64  664 664 ARG ARG A . n 
A 1 65  ARG 65  665 665 ARG ARG A . n 
A 1 66  ASP 66  666 666 ASP ASP A . n 
A 1 67  PHE 67  667 667 PHE PHE A . n 
A 1 68  LEU 68  668 668 LEU LEU A . n 
A 1 69  SER 69  669 669 SER SER A . n 
A 1 70  GLU 70  670 670 GLU GLU A . n 
A 1 71  ALA 71  671 671 ALA ALA A . n 
A 1 72  SER 72  672 672 SER SER A . n 
A 1 73  ILE 73  673 673 ILE ILE A . n 
A 1 74  MET 74  674 674 MET MET A . n 
A 1 75  GLY 75  675 675 GLY GLY A . n 
A 1 76  GLN 76  676 676 GLN GLN A . n 
A 1 77  PHE 77  677 677 PHE PHE A . n 
A 1 78  ASP 78  678 678 ASP ASP A . n 
A 1 79  HIS 79  679 679 HIS HIS A . n 
A 1 80  PRO 80  680 680 PRO PRO A . n 
A 1 81  ASN 81  681 681 ASN ASN A . n 
A 1 82  VAL 82  682 682 VAL VAL A . n 
A 1 83  ILE 83  683 683 ILE ILE A . n 
A 1 84  HIS 84  684 684 HIS HIS A . n 
A 1 85  LEU 85  685 685 LEU LEU A . n 
A 1 86  GLU 86  686 686 GLU GLU A . n 
A 1 87  GLY 87  687 687 GLY GLY A . n 
A 1 88  VAL 88  688 688 VAL VAL A . n 
A 1 89  VAL 89  689 689 VAL VAL A . n 
A 1 90  THR 90  690 690 THR THR A . n 
A 1 91  LYS 91  691 691 LYS LYS A . n 
A 1 92  SER 92  692 692 SER SER A . n 
A 1 93  THR 93  693 693 THR THR A . n 
A 1 94  PRO 94  694 694 PRO PRO A . n 
A 1 95  VAL 95  695 695 VAL VAL A . n 
A 1 96  MET 96  696 696 MET MET A . n 
A 1 97  ILE 97  697 697 ILE ILE A . n 
A 1 98  ILE 98  698 698 ILE ILE A . n 
A 1 99  THR 99  699 699 THR THR A . n 
A 1 100 GLU 100 700 700 GLU GLU A . n 
A 1 101 PHE 101 701 701 PHE PHE A . n 
A 1 102 MET 102 702 702 MET MET A . n 
A 1 103 GLU 103 703 703 GLU GLU A . n 
A 1 104 ASN 104 704 704 ASN ASN A . n 
A 1 105 GLY 105 705 705 GLY GLY A . n 
A 1 106 SER 106 706 706 SER SER A . n 
A 1 107 LEU 107 707 707 LEU LEU A . n 
A 1 108 ASP 108 708 708 ASP ASP A . n 
A 1 109 SER 109 709 709 SER SER A . n 
A 1 110 PHE 110 710 710 PHE PHE A . n 
A 1 111 LEU 111 711 711 LEU LEU A . n 
A 1 112 ARG 112 712 712 ARG ARG A . n 
A 1 113 GLN 113 713 713 GLN GLN A . n 
A 1 114 ASN 114 714 714 ASN ASN A . n 
A 1 115 ASP 115 715 715 ASP ASP A . n 
A 1 116 GLY 116 716 716 GLY GLY A . n 
A 1 117 GLN 117 717 717 GLN GLN A . n 
A 1 118 PHE 118 718 718 PHE PHE A . n 
A 1 119 THR 119 719 719 THR THR A . n 
A 1 120 VAL 120 720 720 VAL VAL A . n 
A 1 121 ILE 121 721 721 ILE ILE A . n 
A 1 122 GLN 122 722 722 GLN GLN A . n 
A 1 123 LEU 123 723 723 LEU LEU A . n 
A 1 124 VAL 124 724 724 VAL VAL A . n 
A 1 125 GLY 125 725 725 GLY GLY A . n 
A 1 126 MET 126 726 726 MET MET A . n 
A 1 127 LEU 127 727 727 LEU LEU A . n 
A 1 128 ARG 128 728 728 ARG ARG A . n 
A 1 129 GLY 129 729 729 GLY GLY A . n 
A 1 130 ILE 130 730 730 ILE ILE A . n 
A 1 131 ALA 131 731 731 ALA ALA A . n 
A 1 132 ALA 132 732 732 ALA ALA A . n 
A 1 133 GLY 133 733 733 GLY GLY A . n 
A 1 134 MET 134 734 734 MET MET A . n 
A 1 135 LYS 135 735 735 LYS LYS A . n 
A 1 136 TYR 136 736 736 TYR TYR A . n 
A 1 137 LEU 137 737 737 LEU LEU A . n 
A 1 138 ALA 138 738 738 ALA ALA A . n 
A 1 139 ASP 139 739 739 ASP ASP A . n 
A 1 140 MET 140 740 740 MET MET A . n 
A 1 141 ASN 141 741 741 ASN ASN A . n 
A 1 142 TYR 142 742 742 TYR TYR A . n 
A 1 143 VAL 143 743 743 VAL VAL A . n 
A 1 144 HIS 144 744 744 HIS HIS A . n 
A 1 145 ARG 145 745 745 ARG ARG A . n 
A 1 146 ASP 146 746 746 ASP ASP A . n 
A 1 147 LEU 147 747 747 LEU LEU A . n 
A 1 148 ALA 148 748 748 ALA ALA A . n 
A 1 149 ALA 149 749 749 ALA ALA A . n 
A 1 150 ARG 150 750 750 ARG ARG A . n 
A 1 151 ASN 151 751 751 ASN ASN A . n 
A 1 152 ILE 152 752 752 ILE ILE A . n 
A 1 153 LEU 153 753 753 LEU LEU A . n 
A 1 154 VAL 154 754 754 VAL VAL A . n 
A 1 155 ASN 155 755 755 ASN ASN A . n 
A 1 156 SER 156 756 756 SER SER A . n 
A 1 157 ASN 157 757 757 ASN ASN A . n 
A 1 158 LEU 158 758 758 LEU LEU A . n 
A 1 159 VAL 159 759 759 VAL VAL A . n 
A 1 160 CYS 160 760 760 CYS CYS A . n 
A 1 161 LYS 161 761 761 LYS LYS A . n 
A 1 162 VAL 162 762 762 VAL VAL A . n 
A 1 163 SER 163 763 763 SER SER A . n 
A 1 164 ASP 164 764 764 ASP ASP A . n 
A 1 165 PHE 165 765 765 PHE PHE A . n 
A 1 166 GLY 166 766 ?   ?   ?   A . n 
A 1 167 LEU 167 767 ?   ?   ?   A . n 
A 1 168 SER 168 768 ?   ?   ?   A . n 
A 1 169 ARG 169 769 ?   ?   ?   A . n 
A 1 170 PHE 170 770 ?   ?   ?   A . n 
A 1 171 LEU 171 771 ?   ?   ?   A . n 
A 1 172 GLU 172 772 ?   ?   ?   A . n 
A 1 173 ASP 173 773 ?   ?   ?   A . n 
A 1 174 ASP 174 774 ?   ?   ?   A . n 
A 1 175 THR 175 775 ?   ?   ?   A . n 
A 1 176 SER 176 776 ?   ?   ?   A . n 
A 1 177 ASP 177 777 ?   ?   ?   A . n 
A 1 178 PRO 178 778 ?   ?   ?   A . n 
A 1 179 THR 179 779 ?   ?   ?   A . n 
A 1 180 TYR 180 780 ?   ?   ?   A . n 
A 1 181 THR 181 781 ?   ?   ?   A . n 
A 1 182 SER 182 782 ?   ?   ?   A . n 
A 1 183 ALA 183 783 ?   ?   ?   A . n 
A 1 184 LEU 184 784 ?   ?   ?   A . n 
A 1 185 GLY 185 785 ?   ?   ?   A . n 
A 1 186 GLY 186 786 ?   ?   ?   A . n 
A 1 187 LYS 187 787 ?   ?   ?   A . n 
A 1 188 ILE 188 788 ?   ?   ?   A . n 
A 1 189 PRO 189 789 789 PRO PRO A . n 
A 1 190 ILE 190 790 790 ILE ILE A . n 
A 1 191 ARG 191 791 791 ARG ARG A . n 
A 1 192 TRP 192 792 792 TRP TRP A . n 
A 1 193 THR 193 793 793 THR THR A . n 
A 1 194 ALA 194 794 794 ALA ALA A . n 
A 1 195 PRO 195 795 795 PRO PRO A . n 
A 1 196 GLU 196 796 796 GLU GLU A . n 
A 1 197 ALA 197 797 797 ALA ALA A . n 
A 1 198 ILE 198 798 798 ILE ILE A . n 
A 1 199 GLN 199 799 799 GLN GLN A . n 
A 1 200 TYR 200 800 800 TYR TYR A . n 
A 1 201 ARG 201 801 801 ARG ARG A . n 
A 1 202 LYS 202 802 802 LYS LYS A . n 
A 1 203 PHE 203 803 803 PHE PHE A . n 
A 1 204 THR 204 804 804 THR THR A . n 
A 1 205 SER 205 805 805 SER SER A . n 
A 1 206 ALA 206 806 806 ALA ALA A . n 
A 1 207 SER 207 807 807 SER SER A . n 
A 1 208 ASP 208 808 808 ASP ASP A . n 
A 1 209 VAL 209 809 809 VAL VAL A . n 
A 1 210 TRP 210 810 810 TRP TRP A . n 
A 1 211 SER 211 811 811 SER SER A . n 
A 1 212 TYR 212 812 812 TYR TYR A . n 
A 1 213 GLY 213 813 813 GLY GLY A . n 
A 1 214 ILE 214 814 814 ILE ILE A . n 
A 1 215 VAL 215 815 815 VAL VAL A . n 
A 1 216 MET 216 816 816 MET MET A . n 
A 1 217 TRP 217 817 817 TRP TRP A . n 
A 1 218 GLU 218 818 818 GLU GLU A . n 
A 1 219 VAL 219 819 819 VAL VAL A . n 
A 1 220 MET 220 820 820 MET MET A . n 
A 1 221 SER 221 821 821 SER SER A . n 
A 1 222 TYR 222 822 822 TYR TYR A . n 
A 1 223 GLY 223 823 823 GLY GLY A . n 
A 1 224 GLU 224 824 824 GLU GLU A . n 
A 1 225 ARG 225 825 825 ARG ARG A . n 
A 1 226 PRO 226 826 826 PRO PRO A . n 
A 1 227 TYR 227 827 827 TYR TYR A . n 
A 1 228 TRP 228 828 828 TRP TRP A . n 
A 1 229 ASP 229 829 829 ASP ASP A . n 
A 1 230 MET 230 830 830 MET MET A . n 
A 1 231 THR 231 831 831 THR THR A . n 
A 1 232 ASN 232 832 832 ASN ASN A . n 
A 1 233 GLN 233 833 833 GLN GLN A . n 
A 1 234 ASP 234 834 834 ASP ASP A . n 
A 1 235 VAL 235 835 835 VAL VAL A . n 
A 1 236 ILE 236 836 836 ILE ILE A . n 
A 1 237 ASN 237 837 837 ASN ASN A . n 
A 1 238 ALA 238 838 838 ALA ALA A . n 
A 1 239 ILE 239 839 839 ILE ILE A . n 
A 1 240 GLU 240 840 840 GLU GLU A . n 
A 1 241 GLN 241 841 841 GLN GLN A . n 
A 1 242 ASP 242 842 842 ASP ASP A . n 
A 1 243 TYR 243 843 843 TYR TYR A . n 
A 1 244 ARG 244 844 844 ARG ARG A . n 
A 1 245 LEU 245 845 845 LEU LEU A . n 
A 1 246 PRO 246 846 846 PRO PRO A . n 
A 1 247 PRO 247 847 847 PRO PRO A . n 
A 1 248 PRO 248 848 848 PRO PRO A . n 
A 1 249 MET 249 849 849 MET MET A . n 
A 1 250 ASP 250 850 850 ASP ASP A . n 
A 1 251 CYS 251 851 851 CYS CYS A . n 
A 1 252 PRO 252 852 852 PRO PRO A . n 
A 1 253 SER 253 853 853 SER SER A . n 
A 1 254 ALA 254 854 854 ALA ALA A . n 
A 1 255 LEU 255 855 855 LEU LEU A . n 
A 1 256 HIS 256 856 856 HIS HIS A . n 
A 1 257 GLN 257 857 857 GLN GLN A . n 
A 1 258 LEU 258 858 858 LEU LEU A . n 
A 1 259 MET 259 859 859 MET MET A . n 
A 1 260 LEU 260 860 860 LEU LEU A . n 
A 1 261 ASP 261 861 861 ASP ASP A . n 
A 1 262 CYS 262 862 862 CYS CYS A . n 
A 1 263 TRP 263 863 863 TRP TRP A . n 
A 1 264 GLN 264 864 864 GLN GLN A . n 
A 1 265 LYS 265 865 865 LYS LYS A . n 
A 1 266 ASP 266 866 866 ASP ASP A . n 
A 1 267 ARG 267 867 867 ARG ARG A . n 
A 1 268 ASN 268 868 868 ASN ASN A . n 
A 1 269 HIS 269 869 869 HIS HIS A . n 
A 1 270 ARG 270 870 870 ARG ARG A . n 
A 1 271 PRO 271 871 871 PRO PRO A . n 
A 1 272 LYS 272 872 872 LYS LYS A . n 
A 1 273 PHE 273 873 873 PHE PHE A . n 
A 1 274 GLY 274 874 874 GLY GLY A . n 
A 1 275 GLN 275 875 875 GLN GLN A . n 
A 1 276 ILE 276 876 876 ILE ILE A . n 
A 1 277 VAL 277 877 877 VAL VAL A . n 
A 1 278 ASN 278 878 878 ASN ASN A . n 
A 1 279 THR 279 879 879 THR THR A . n 
A 1 280 LEU 280 880 880 LEU LEU A . n 
A 1 281 ASP 281 881 881 ASP ASP A . n 
A 1 282 LYS 282 882 882 LYS LYS A . n 
A 1 283 MET 283 883 883 MET MET A . n 
A 1 284 ILE 284 884 884 ILE ILE A . n 
A 1 285 ARG 285 885 885 ARG ARG A . n 
A 1 286 ASN 286 886 886 ASN ASN A . n 
A 1 287 PRO 287 887 887 PRO PRO A . n 
A 1 288 ASN 288 888 888 ASN ASN A . n 
A 1 289 SER 289 889 889 SER SER A . n 
A 1 290 LEU 290 890 890 LEU LEU A . n 
A 1 291 LYS 291 891 891 LYS LYS A . n 
A 1 292 ALA 292 892 892 ALA ALA A . n 
A 1 293 MET 293 893 893 MET MET A . n 
A 1 294 ALA 294 894 894 ALA ALA A . n 
A 1 295 PRO 295 895 ?   ?   ?   A . n 
A 1 296 LEU 296 896 ?   ?   ?   A . n 
A 1 297 SER 297 897 ?   ?   ?   A . n 
A 1 298 SER 298 898 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  2001 2001 HOH HOH A . 
B 2 HOH 2  2002 2002 HOH HOH A . 
B 2 HOH 3  2003 2003 HOH HOH A . 
B 2 HOH 4  2004 2004 HOH HOH A . 
B 2 HOH 5  2005 2005 HOH HOH A . 
B 2 HOH 6  2006 2006 HOH HOH A . 
B 2 HOH 7  2007 2007 HOH HOH A . 
B 2 HOH 8  2008 2008 HOH HOH A . 
B 2 HOH 9  2009 2009 HOH HOH A . 
B 2 HOH 10 2010 2010 HOH HOH A . 
B 2 HOH 11 2011 2011 HOH HOH A . 
B 2 HOH 12 2012 2012 HOH HOH A . 
B 2 HOH 13 2013 2013 HOH HOH A . 
B 2 HOH 14 2014 2014 HOH HOH A . 
B 2 HOH 15 2015 2015 HOH HOH A . 
B 2 HOH 16 2016 2016 HOH HOH A . 
B 2 HOH 17 2017 2017 HOH HOH A . 
B 2 HOH 18 2018 2018 HOH HOH A . 
B 2 HOH 19 2019 2019 HOH HOH A . 
B 2 HOH 20 2020 2020 HOH HOH A . 
B 2 HOH 21 2021 2021 HOH HOH A . 
B 2 HOH 22 2022 2022 HOH HOH A . 
B 2 HOH 23 2023 2023 HOH HOH A . 
B 2 HOH 24 2024 2024 HOH HOH A . 
B 2 HOH 25 2025 2025 HOH HOH A . 
B 2 HOH 26 2026 2026 HOH HOH A . 
B 2 HOH 27 2027 2027 HOH HOH A . 
B 2 HOH 28 2028 2028 HOH HOH A . 
B 2 HOH 29 2029 2029 HOH HOH A . 
B 2 HOH 30 2030 2030 HOH HOH A . 
B 2 HOH 31 2031 2031 HOH HOH A . 
B 2 HOH 32 2032 2032 HOH HOH A . 
B 2 HOH 33 2033 2033 HOH HOH A . 
B 2 HOH 34 2034 2034 HOH HOH A . 
B 2 HOH 35 2035 2035 HOH HOH A . 
B 2 HOH 36 2036 2036 HOH HOH A . 
B 2 HOH 37 2037 2037 HOH HOH A . 
B 2 HOH 38 2038 2038 HOH HOH A . 
B 2 HOH 39 2039 2039 HOH HOH A . 
B 2 HOH 40 2040 2040 HOH HOH A . 
B 2 HOH 41 2041 2041 HOH HOH A . 
B 2 HOH 42 2042 2042 HOH HOH A . 
B 2 HOH 43 2043 2043 HOH HOH A . 
B 2 HOH 44 2044 2044 HOH HOH A . 
B 2 HOH 45 2045 2045 HOH HOH A . 
B 2 HOH 46 2046 2046 HOH HOH A . 
B 2 HOH 47 2047 2047 HOH HOH A . 
B 2 HOH 48 2048 2048 HOH HOH A . 
B 2 HOH 49 2049 2049 HOH HOH A . 
B 2 HOH 50 2050 2050 HOH HOH A . 
B 2 HOH 51 2051 2051 HOH HOH A . 
B 2 HOH 52 2052 2052 HOH HOH A . 
B 2 HOH 53 2053 2053 HOH HOH A . 
B 2 HOH 54 2054 2054 HOH HOH A . 
B 2 HOH 55 2055 2055 HOH HOH A . 
B 2 HOH 56 2056 2056 HOH HOH A . 
B 2 HOH 57 2057 2057 HOH HOH A . 
B 2 HOH 58 2058 2058 HOH HOH A . 
B 2 HOH 59 2059 2059 HOH HOH A . 
B 2 HOH 60 2060 2060 HOH HOH A . 
B 2 HOH 61 2061 2061 HOH HOH A . 
B 2 HOH 62 2062 2062 HOH HOH A . 
B 2 HOH 63 2063 2063 HOH HOH A . 
B 2 HOH 64 2064 2064 HOH HOH A . 
B 2 HOH 65 2065 2065 HOH HOH A . 
B 2 HOH 66 2066 2066 HOH HOH A . 
B 2 HOH 67 2067 2067 HOH HOH A . 
B 2 HOH 68 2068 2068 HOH HOH A . 
B 2 HOH 69 2069 2069 HOH HOH A . 
B 2 HOH 70 2070 2070 HOH HOH A . 
B 2 HOH 71 2071 2071 HOH HOH A . 
B 2 HOH 72 2072 2072 HOH HOH A . 
B 2 HOH 73 2073 2073 HOH HOH A . 
B 2 HOH 74 2074 2074 HOH HOH A . 
B 2 HOH 75 2075 2075 HOH HOH A . 
B 2 HOH 76 2076 2076 HOH HOH A . 
B 2 HOH 77 2077 2077 HOH HOH A . 
B 2 HOH 78 2078 2078 HOH HOH A . 
B 2 HOH 79 2079 2079 HOH HOH A . 
B 2 HOH 80 2080 2080 HOH HOH A . 
B 2 HOH 81 2081 2081 HOH HOH A . 
B 2 HOH 82 2082 2082 HOH HOH A . 
B 2 HOH 83 2083 2083 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-01-08 
2 'Structure model' 1 1 2014-03-05 
3 'Structure model' 1 2 2014-04-09 
4 'Structure model' 1 3 2014-05-07 
5 'Structure model' 1 4 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 4 'Structure model' 'Database references' 
4 5 'Structure model' 'Data collection'     
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    5 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    5 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER refinement       2.11.5 ? 1 
XDS    'data reduction' .      ? 2 
SCALA  'data scaling'   .      ? 3 
PHASER phasing          .      ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 745 ? ? 66.95 -12.96  
2 1 ASP A 764 ? ? 61.51 84.25   
3 1 TRP A 828 ? ? 40.19 -102.75 
4 1 ASP A 850 ? ? 79.21 -1.96   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 622 ? CG  ? A LYS 22  CG  
2  1 Y 1 A LYS 622 ? CD  ? A LYS 22  CD  
3  1 Y 1 A LYS 622 ? CE  ? A LYS 22  CE  
4  1 Y 1 A LYS 622 ? NZ  ? A LYS 22  NZ  
5  1 Y 1 A GLU 624 ? CG  ? A GLU 24  CG  
6  1 Y 1 A GLU 624 ? CD  ? A GLU 24  CD  
7  1 Y 1 A GLU 624 ? OE1 ? A GLU 24  OE1 
8  1 Y 1 A GLU 624 ? OE2 ? A GLU 24  OE2 
9  1 Y 1 A GLN 625 ? OE1 ? A GLN 25  OE1 
10 1 Y 1 A GLN 625 ? NE2 ? A GLN 25  NE2 
11 1 Y 1 A GLU 634 ? CG  ? A GLU 34  CG  
12 1 Y 1 A GLU 634 ? CD  ? A GLU 34  CD  
13 1 Y 1 A GLU 634 ? OE1 ? A GLU 34  OE1 
14 1 Y 1 A GLU 634 ? OE2 ? A GLU 34  OE2 
15 1 Y 1 A LYS 641 ? CG  ? A LYS 41  CG  
16 1 Y 1 A LYS 641 ? CD  ? A LYS 41  CD  
17 1 Y 1 A LYS 641 ? CE  ? A LYS 41  CE  
18 1 Y 1 A LYS 641 ? NZ  ? A LYS 41  NZ  
19 1 Y 1 A LYS 645 ? CG  ? A LYS 45  CG  
20 1 Y 1 A LYS 645 ? CD  ? A LYS 45  CD  
21 1 Y 1 A LYS 645 ? CE  ? A LYS 45  CE  
22 1 Y 1 A LYS 645 ? NZ  ? A LYS 45  NZ  
23 1 Y 1 A LYS 653 ? CG  ? A LYS 53  CG  
24 1 Y 1 A LYS 653 ? CD  ? A LYS 53  CD  
25 1 Y 1 A LYS 653 ? CE  ? A LYS 53  CE  
26 1 Y 1 A LYS 653 ? NZ  ? A LYS 53  NZ  
27 1 Y 1 A GLU 661 ? CG  ? A GLU 61  CG  
28 1 Y 1 A GLU 661 ? CD  ? A GLU 61  CD  
29 1 Y 1 A GLU 661 ? OE1 ? A GLU 61  OE1 
30 1 Y 1 A GLU 661 ? OE2 ? A GLU 61  OE2 
31 1 Y 1 A LYS 662 ? CD  ? A LYS 62  CD  
32 1 Y 1 A LYS 662 ? CE  ? A LYS 62  CE  
33 1 Y 1 A LYS 662 ? NZ  ? A LYS 62  NZ  
34 1 Y 1 A GLN 663 ? CG  ? A GLN 63  CG  
35 1 Y 1 A GLN 663 ? CD  ? A GLN 63  CD  
36 1 Y 1 A GLN 663 ? OE1 ? A GLN 63  OE1 
37 1 Y 1 A GLN 663 ? NE2 ? A GLN 63  NE2 
38 1 Y 1 A ARG 665 ? CG  ? A ARG 65  CG  
39 1 Y 1 A ARG 665 ? CD  ? A ARG 65  CD  
40 1 Y 1 A ARG 665 ? NE  ? A ARG 65  NE  
41 1 Y 1 A ARG 665 ? CZ  ? A ARG 65  CZ  
42 1 Y 1 A ARG 665 ? NH1 ? A ARG 65  NH1 
43 1 Y 1 A ARG 665 ? NH2 ? A ARG 65  NH2 
44 1 Y 1 A LYS 691 ? CG  ? A LYS 91  CG  
45 1 Y 1 A LYS 691 ? CD  ? A LYS 91  CD  
46 1 Y 1 A LYS 691 ? CE  ? A LYS 91  CE  
47 1 Y 1 A LYS 691 ? NZ  ? A LYS 91  NZ  
48 1 Y 1 A ARG 801 ? CG  ? A ARG 201 CG  
49 1 Y 1 A ARG 801 ? CD  ? A ARG 201 CD  
50 1 Y 1 A ARG 801 ? NE  ? A ARG 201 NE  
51 1 Y 1 A ARG 801 ? CZ  ? A ARG 201 CZ  
52 1 Y 1 A ARG 801 ? NH1 ? A ARG 201 NH1 
53 1 Y 1 A ARG 801 ? NH2 ? A ARG 201 NH2 
54 1 Y 1 A GLN 841 ? CG  ? A GLN 241 CG  
55 1 Y 1 A GLN 841 ? CD  ? A GLN 241 CD  
56 1 Y 1 A GLN 841 ? OE1 ? A GLN 241 OE1 
57 1 Y 1 A GLN 841 ? NE2 ? A GLN 241 NE2 
58 1 Y 1 A LYS 882 ? CD  ? A LYS 282 CD  
59 1 Y 1 A LYS 882 ? CE  ? A LYS 282 CE  
60 1 Y 1 A LYS 882 ? NZ  ? A LYS 282 NZ  
61 1 Y 1 A ALA 894 ? CA  ? A ALA 294 CA  
62 1 Y 1 A ALA 894 ? C   ? A ALA 294 C   
63 1 Y 1 A ALA 894 ? O   ? A ALA 294 O   
64 1 Y 1 A ALA 894 ? CB  ? A ALA 294 CB  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 601 ? A GLY 1   
2  1 Y 1 A SER 602 ? A SER 2   
3  1 Y 1 A SER 603 ? A SER 3   
4  1 Y 1 A ASP 604 ? A ASP 4   
5  1 Y 1 A PRO 605 ? A PRO 5   
6  1 Y 1 A ASN 606 ? A ASN 6   
7  1 Y 1 A GLU 607 ? A GLU 7   
8  1 Y 1 A ALA 608 ? A ALA 8   
9  1 Y 1 A VAL 609 ? A VAL 9   
10 1 Y 1 A ARG 610 ? A ARG 10  
11 1 Y 1 A GLU 611 ? A GLU 11  
12 1 Y 1 A PHE 612 ? A PHE 12  
13 1 Y 1 A ALA 613 ? A ALA 13  
14 1 Y 1 A LYS 614 ? A LYS 14  
15 1 Y 1 A GLY 628 ? A GLY 28  
16 1 Y 1 A ALA 629 ? A ALA 29  
17 1 Y 1 A GLY 630 ? A GLY 30  
18 1 Y 1 A GLU 631 ? A GLU 31  
19 1 Y 1 A LYS 656 ? A LYS 56  
20 1 Y 1 A SER 657 ? A SER 57  
21 1 Y 1 A GLY 658 ? A GLY 58  
22 1 Y 1 A TYR 659 ? A TYR 59  
23 1 Y 1 A GLY 766 ? A GLY 166 
24 1 Y 1 A LEU 767 ? A LEU 167 
25 1 Y 1 A SER 768 ? A SER 168 
26 1 Y 1 A ARG 769 ? A ARG 169 
27 1 Y 1 A PHE 770 ? A PHE 170 
28 1 Y 1 A LEU 771 ? A LEU 171 
29 1 Y 1 A GLU 772 ? A GLU 172 
30 1 Y 1 A ASP 773 ? A ASP 173 
31 1 Y 1 A ASP 774 ? A ASP 174 
32 1 Y 1 A THR 775 ? A THR 175 
33 1 Y 1 A SER 776 ? A SER 176 
34 1 Y 1 A ASP 777 ? A ASP 177 
35 1 Y 1 A PRO 778 ? A PRO 178 
36 1 Y 1 A THR 779 ? A THR 179 
37 1 Y 1 A TYR 780 ? A TYR 180 
38 1 Y 1 A THR 781 ? A THR 181 
39 1 Y 1 A SER 782 ? A SER 182 
40 1 Y 1 A ALA 783 ? A ALA 183 
41 1 Y 1 A LEU 784 ? A LEU 184 
42 1 Y 1 A GLY 785 ? A GLY 185 
43 1 Y 1 A GLY 786 ? A GLY 186 
44 1 Y 1 A LYS 787 ? A LYS 187 
45 1 Y 1 A ILE 788 ? A ILE 188 
46 1 Y 1 A PRO 895 ? A PRO 295 
47 1 Y 1 A LEU 896 ? A LEU 296 
48 1 Y 1 A SER 897 ? A SER 297 
49 1 Y 1 A SER 898 ? A SER 298 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#