data_3ZFW
# 
_entry.id   3ZFW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ZFW         
PDBE  EBI-55103    
WWPDB D_1290055103 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ZFW 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-12-12 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pernigo, S.'   1 
'Lamprecht, A.' 2 
'Steiner, R.A.' 3 
'Dodding, M.P.' 4 
# 
_citation.id                        primary 
_citation.title                     'Structural Basis for Kinesin-1:Cargo Recognition.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            340 
_citation.page_first                356 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23519214 
_citation.pdbx_database_id_DOI      10.1126/SCIENCE.1234264 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pernigo, S.'   1 
primary 'Lamprecht, A.' 2 
primary 'Steiner, R.A.' 3 
primary 'Dodding, M.P.' 4 
# 
_cell.entry_id           3ZFW 
_cell.length_a           87.810 
_cell.length_b           90.860 
_cell.length_c           94.040 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3ZFW 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'KINESIN LIGHT CHAIN 2'                                   29861.936 2 ? ? 'TPR DOMAIN, RESIDUES 218-477' ? 
2 polymer man 'PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING FAMILY M MEMBER 2' 4716.028  2 ? ? ?                              
'MOL ID 1 AND MOL ID 2 ARE EXPRESSED AS A SINGLE ENTITY. IT IS UNCLEAR WHICH OF CHAIN A OR B ARE JOINED TO CHAINS X OR Y.' 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'KLC 2' 
2 
;PH DOMAIN-CONTAINING FAMILY M MEMBER 2, SALMONELLA-INDUCED FILAMENTS A AND KINESIN-INTERACTING PROTEIN, SIFA AND KINESIN-INTERACTING PROTEIN
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;VPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGK
YKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYL
KQGKYQDAETLYKEILTRAHEKEFGSVNGENKPIWMHAEEREESKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGA
LYRRQGKLEAAHTLEDCASRSRK
;
;VPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGK
YKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYL
KQGKYQDAETLYKEILTRAHEKEFGSVNGENKPIWMHAEEREESKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGA
LYRRQGKLEAAHTLEDCASRSRK
;
A,B ? 
2 'polypeptide(L)' no no MGSSHHHHHHSSGLVPRGSHMTNLEWDDSAITGSTGSTGSTGSHM MGSSHHHHHHSSGLVPRGSHMTNLEWDDSAITGSTGSTGSTGSHM X,Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   PRO n 
1 3   LEU n 
1 4   CYS n 
1 5   LYS n 
1 6   GLN n 
1 7   ALA n 
1 8   LEU n 
1 9   GLU n 
1 10  ASP n 
1 11  LEU n 
1 12  GLU n 
1 13  LYS n 
1 14  THR n 
1 15  SER n 
1 16  GLY n 
1 17  HIS n 
1 18  ASP n 
1 19  HIS n 
1 20  PRO n 
1 21  ASP n 
1 22  VAL n 
1 23  ALA n 
1 24  THR n 
1 25  MET n 
1 26  LEU n 
1 27  ASN n 
1 28  ILE n 
1 29  LEU n 
1 30  ALA n 
1 31  LEU n 
1 32  VAL n 
1 33  TYR n 
1 34  ARG n 
1 35  ASP n 
1 36  GLN n 
1 37  ASN n 
1 38  LYS n 
1 39  TYR n 
1 40  LYS n 
1 41  ASP n 
1 42  ALA n 
1 43  ALA n 
1 44  HIS n 
1 45  LEU n 
1 46  LEU n 
1 47  ASN n 
1 48  ASP n 
1 49  ALA n 
1 50  LEU n 
1 51  ALA n 
1 52  ILE n 
1 53  ARG n 
1 54  GLU n 
1 55  LYS n 
1 56  THR n 
1 57  LEU n 
1 58  GLY n 
1 59  LYS n 
1 60  ASP n 
1 61  HIS n 
1 62  PRO n 
1 63  ALA n 
1 64  VAL n 
1 65  ALA n 
1 66  ALA n 
1 67  THR n 
1 68  LEU n 
1 69  ASN n 
1 70  ASN n 
1 71  LEU n 
1 72  ALA n 
1 73  VAL n 
1 74  LEU n 
1 75  TYR n 
1 76  GLY n 
1 77  LYS n 
1 78  ARG n 
1 79  GLY n 
1 80  LYS n 
1 81  TYR n 
1 82  LYS n 
1 83  GLU n 
1 84  ALA n 
1 85  GLU n 
1 86  PRO n 
1 87  LEU n 
1 88  CYS n 
1 89  LYS n 
1 90  ARG n 
1 91  ALA n 
1 92  LEU n 
1 93  GLU n 
1 94  ILE n 
1 95  ARG n 
1 96  GLU n 
1 97  LYS n 
1 98  VAL n 
1 99  LEU n 
1 100 GLY n 
1 101 LYS n 
1 102 PHE n 
1 103 HIS n 
1 104 PRO n 
1 105 ASP n 
1 106 VAL n 
1 107 ALA n 
1 108 LYS n 
1 109 GLN n 
1 110 LEU n 
1 111 SER n 
1 112 ASN n 
1 113 LEU n 
1 114 ALA n 
1 115 LEU n 
1 116 LEU n 
1 117 CYS n 
1 118 GLN n 
1 119 ASN n 
1 120 GLN n 
1 121 GLY n 
1 122 LYS n 
1 123 ALA n 
1 124 GLU n 
1 125 GLU n 
1 126 VAL n 
1 127 GLU n 
1 128 TYR n 
1 129 TYR n 
1 130 TYR n 
1 131 ARG n 
1 132 ARG n 
1 133 ALA n 
1 134 LEU n 
1 135 GLU n 
1 136 ILE n 
1 137 TYR n 
1 138 ALA n 
1 139 THR n 
1 140 ARG n 
1 141 LEU n 
1 142 GLY n 
1 143 PRO n 
1 144 ASP n 
1 145 ASP n 
1 146 PRO n 
1 147 ASN n 
1 148 VAL n 
1 149 ALA n 
1 150 LYS n 
1 151 THR n 
1 152 LYS n 
1 153 ASN n 
1 154 ASN n 
1 155 LEU n 
1 156 ALA n 
1 157 SER n 
1 158 CYS n 
1 159 TYR n 
1 160 LEU n 
1 161 LYS n 
1 162 GLN n 
1 163 GLY n 
1 164 LYS n 
1 165 TYR n 
1 166 GLN n 
1 167 ASP n 
1 168 ALA n 
1 169 GLU n 
1 170 THR n 
1 171 LEU n 
1 172 TYR n 
1 173 LYS n 
1 174 GLU n 
1 175 ILE n 
1 176 LEU n 
1 177 THR n 
1 178 ARG n 
1 179 ALA n 
1 180 HIS n 
1 181 GLU n 
1 182 LYS n 
1 183 GLU n 
1 184 PHE n 
1 185 GLY n 
1 186 SER n 
1 187 VAL n 
1 188 ASN n 
1 189 GLY n 
1 190 GLU n 
1 191 ASN n 
1 192 LYS n 
1 193 PRO n 
1 194 ILE n 
1 195 TRP n 
1 196 MET n 
1 197 HIS n 
1 198 ALA n 
1 199 GLU n 
1 200 GLU n 
1 201 ARG n 
1 202 GLU n 
1 203 GLU n 
1 204 SER n 
1 205 LYS n 
1 206 ASP n 
1 207 LYS n 
1 208 ARG n 
1 209 ARG n 
1 210 ASP n 
1 211 SER n 
1 212 ALA n 
1 213 PRO n 
1 214 TYR n 
1 215 GLY n 
1 216 GLU n 
1 217 TYR n 
1 218 GLY n 
1 219 SER n 
1 220 TRP n 
1 221 TYR n 
1 222 LYS n 
1 223 ALA n 
1 224 CYS n 
1 225 LYS n 
1 226 VAL n 
1 227 ASP n 
1 228 SER n 
1 229 PRO n 
1 230 THR n 
1 231 VAL n 
1 232 ASN n 
1 233 THR n 
1 234 THR n 
1 235 LEU n 
1 236 ARG n 
1 237 SER n 
1 238 LEU n 
1 239 GLY n 
1 240 ALA n 
1 241 LEU n 
1 242 TYR n 
1 243 ARG n 
1 244 ARG n 
1 245 GLN n 
1 246 GLY n 
1 247 LYS n 
1 248 LEU n 
1 249 GLU n 
1 250 ALA n 
1 251 ALA n 
1 252 HIS n 
1 253 THR n 
1 254 LEU n 
1 255 GLU n 
1 256 ASP n 
1 257 CYS n 
1 258 ALA n 
1 259 SER n 
1 260 ARG n 
1 261 SER n 
1 262 ARG n 
1 263 LYS n 
2 1   MET n 
2 2   GLY n 
2 3   SER n 
2 4   SER n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  SER n 
2 12  SER n 
2 13  GLY n 
2 14  LEU n 
2 15  VAL n 
2 16  PRO n 
2 17  ARG n 
2 18  GLY n 
2 19  SER n 
2 20  HIS n 
2 21  MET n 
2 22  THR n 
2 23  ASN n 
2 24  LEU n 
2 25  GLU n 
2 26  TRP n 
2 27  ASP n 
2 28  ASP n 
2 29  SER n 
2 30  ALA n 
2 31  ILE n 
2 32  THR n 
2 33  GLY n 
2 34  SER n 
2 35  THR n 
2 36  GLY n 
2 37  SER n 
2 38  THR n 
2 39  GLY n 
2 40  SER n 
2 41  THR n 
2 42  GLY n 
2 43  SER n 
2 44  HIS n 
2 45  MET n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'HOUSE MOUSE' ? ? ? ? ? ? ? ? 'MUS MUSCULUS' 10090 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 
'BL21(DE3)' ? ? ? ? ? ? ? PLASMID PET28 ? ? ? ? ? 
2 1 sample ? ? ? HUMAN         ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606  ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 
'BL21(DE3)' ? ? ? ? ? ? ? PLASMID PET28 ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP Q91YS4_MOUSE 1 ? ? Q91YS4 ? 
2 UNP PKHM2_HUMAN  2 ? ? Q8IWE5 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ZFW A 1  ? 263 ? Q91YS4 218 ? 480 ? 218 480 
2 1 3ZFW B 1  ? 263 ? Q91YS4 218 ? 480 ? 218 480 
3 2 3ZFW X 22 ? 31  ? Q8IWE5 203 ? 212 ? 203 212 
4 2 3ZFW Y 22 ? 31  ? Q8IWE5 203 ? 212 ? 203 212 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 3ZFW MET X 1  ? UNP Q81WE5 ? ? 'expression tag' 182 1  
3 3ZFW GLY X 2  ? UNP Q81WE5 ? ? 'expression tag' 183 2  
3 3ZFW SER X 3  ? UNP Q81WE5 ? ? 'expression tag' 184 3  
3 3ZFW SER X 4  ? UNP Q81WE5 ? ? 'expression tag' 185 4  
3 3ZFW HIS X 5  ? UNP Q81WE5 ? ? 'expression tag' 186 5  
3 3ZFW HIS X 6  ? UNP Q81WE5 ? ? 'expression tag' 187 6  
3 3ZFW HIS X 7  ? UNP Q81WE5 ? ? 'expression tag' 188 7  
3 3ZFW HIS X 8  ? UNP Q81WE5 ? ? 'expression tag' 189 8  
3 3ZFW HIS X 9  ? UNP Q81WE5 ? ? 'expression tag' 190 9  
3 3ZFW HIS X 10 ? UNP Q81WE5 ? ? 'expression tag' 191 10 
3 3ZFW SER X 11 ? UNP Q81WE5 ? ? 'expression tag' 192 11 
3 3ZFW SER X 12 ? UNP Q81WE5 ? ? 'expression tag' 193 12 
3 3ZFW GLY X 13 ? UNP Q81WE5 ? ? 'expression tag' 194 13 
3 3ZFW LEU X 14 ? UNP Q81WE5 ? ? 'expression tag' 195 14 
3 3ZFW VAL X 15 ? UNP Q81WE5 ? ? 'expression tag' 196 15 
3 3ZFW PRO X 16 ? UNP Q81WE5 ? ? 'expression tag' 197 16 
3 3ZFW ARG X 17 ? UNP Q81WE5 ? ? 'expression tag' 198 17 
3 3ZFW GLY X 18 ? UNP Q81WE5 ? ? 'expression tag' 199 18 
3 3ZFW SER X 19 ? UNP Q81WE5 ? ? 'expression tag' 200 19 
3 3ZFW HIS X 20 ? UNP Q81WE5 ? ? 'expression tag' 201 20 
3 3ZFW MET X 21 ? UNP Q81WE5 ? ? 'expression tag' 202 21 
3 3ZFW THR X 32 ? UNP Q81WE5 ? ? 'expression tag' 213 22 
3 3ZFW GLY X 33 ? UNP Q81WE5 ? ? 'expression tag' 214 23 
3 3ZFW SER X 34 ? UNP Q81WE5 ? ? 'expression tag' 215 24 
3 3ZFW THR X 35 ? UNP Q81WE5 ? ? 'expression tag' 216 25 
3 3ZFW GLY X 36 ? UNP Q81WE5 ? ? 'expression tag' 217 26 
3 3ZFW SER X 37 ? UNP Q81WE5 ? ? 'expression tag' 218 27 
3 3ZFW THR X 38 ? UNP Q81WE5 ? ? 'expression tag' 219 28 
3 3ZFW GLY X 39 ? UNP Q81WE5 ? ? 'expression tag' 220 29 
3 3ZFW SER X 40 ? UNP Q81WE5 ? ? 'expression tag' 221 30 
3 3ZFW THR X 41 ? UNP Q81WE5 ? ? 'expression tag' 222 31 
3 3ZFW GLY X 42 ? UNP Q81WE5 ? ? 'expression tag' 223 32 
3 3ZFW SER X 43 ? UNP Q81WE5 ? ? 'expression tag' 224 33 
3 3ZFW HIS X 44 ? UNP Q81WE5 ? ? 'expression tag' 225 34 
3 3ZFW MET X 45 ? UNP Q81WE5 ? ? 'expression tag' 226 35 
4 3ZFW MET Y 1  ? UNP Q81WE5 ? ? 'expression tag' 182 36 
4 3ZFW GLY Y 2  ? UNP Q81WE5 ? ? 'expression tag' 183 37 
4 3ZFW SER Y 3  ? UNP Q81WE5 ? ? 'expression tag' 184 38 
4 3ZFW SER Y 4  ? UNP Q81WE5 ? ? 'expression tag' 185 39 
4 3ZFW HIS Y 5  ? UNP Q81WE5 ? ? 'expression tag' 186 40 
4 3ZFW HIS Y 6  ? UNP Q81WE5 ? ? 'expression tag' 187 41 
4 3ZFW HIS Y 7  ? UNP Q81WE5 ? ? 'expression tag' 188 42 
4 3ZFW HIS Y 8  ? UNP Q81WE5 ? ? 'expression tag' 189 43 
4 3ZFW HIS Y 9  ? UNP Q81WE5 ? ? 'expression tag' 190 44 
4 3ZFW HIS Y 10 ? UNP Q81WE5 ? ? 'expression tag' 191 45 
4 3ZFW SER Y 11 ? UNP Q81WE5 ? ? 'expression tag' 192 46 
4 3ZFW SER Y 12 ? UNP Q81WE5 ? ? 'expression tag' 193 47 
4 3ZFW GLY Y 13 ? UNP Q81WE5 ? ? 'expression tag' 194 48 
4 3ZFW LEU Y 14 ? UNP Q81WE5 ? ? 'expression tag' 195 49 
4 3ZFW VAL Y 15 ? UNP Q81WE5 ? ? 'expression tag' 196 50 
4 3ZFW PRO Y 16 ? UNP Q81WE5 ? ? 'expression tag' 197 51 
4 3ZFW ARG Y 17 ? UNP Q81WE5 ? ? 'expression tag' 198 52 
4 3ZFW GLY Y 18 ? UNP Q81WE5 ? ? 'expression tag' 199 53 
4 3ZFW SER Y 19 ? UNP Q81WE5 ? ? 'expression tag' 200 54 
4 3ZFW HIS Y 20 ? UNP Q81WE5 ? ? 'expression tag' 201 55 
4 3ZFW MET Y 21 ? UNP Q81WE5 ? ? 'expression tag' 202 56 
4 3ZFW THR Y 32 ? UNP Q81WE5 ? ? 'expression tag' 213 57 
4 3ZFW GLY Y 33 ? UNP Q81WE5 ? ? 'expression tag' 214 58 
4 3ZFW SER Y 34 ? UNP Q81WE5 ? ? 'expression tag' 215 59 
4 3ZFW THR Y 35 ? UNP Q81WE5 ? ? 'expression tag' 216 60 
4 3ZFW GLY Y 36 ? UNP Q81WE5 ? ? 'expression tag' 217 61 
4 3ZFW SER Y 37 ? UNP Q81WE5 ? ? 'expression tag' 218 62 
4 3ZFW THR Y 38 ? UNP Q81WE5 ? ? 'expression tag' 219 63 
4 3ZFW GLY Y 39 ? UNP Q81WE5 ? ? 'expression tag' 220 64 
4 3ZFW SER Y 40 ? UNP Q81WE5 ? ? 'expression tag' 221 65 
4 3ZFW THR Y 41 ? UNP Q81WE5 ? ? 'expression tag' 222 66 
4 3ZFW GLY Y 42 ? UNP Q81WE5 ? ? 'expression tag' 223 67 
4 3ZFW SER Y 43 ? UNP Q81WE5 ? ? 'expression tag' 224 68 
4 3ZFW HIS Y 44 ? UNP Q81WE5 ? ? 'expression tag' 225 69 
4 3ZFW MET Y 45 ? UNP Q81WE5 ? ? 'expression tag' 226 70 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3ZFW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   52.7 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.10 M MES PH 6.5, 0.2 L-PROLINE, 7% PGA' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2012-10-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9686 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_wavelength             0.9686 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3ZFW 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             54.42 
_reflns.d_resolution_high            2.90 
_reflns.number_obs                   17034 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.50 
_reflns.B_iso_Wilson_estimate        95.38 
_reflns.pdbx_redundancy              5.60 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              2.98 
_reflns_shell.percent_possible_all   98.2 
_reflns_shell.Rmerge_I_obs           0.70 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.40 
_reflns_shell.pdbx_redundancy        5.04 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3ZFW 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     17030 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             52.42 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    98.67 
_refine.ls_R_factor_obs                          0.2042 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2022 
_refine.ls_R_factor_R_free                       0.2445 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_number_reflns_R_free                  854 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9416 
_refine.correlation_coeff_Fo_to_Fc_free          0.9264 
_refine.B_iso_mean                               108.70 
_refine.aniso_B[1][1]                            0.0082 
_refine.aniso_B[2][2]                            -9.0697 
_refine.aniso_B[3][3]                            9.0615 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3CEQ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.800 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.334 
_refine.pdbx_overall_SU_R_Blow_DPI               0.784 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.327 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3ZFW 
_refine_analyze.Luzzati_coordinate_error_obs    0.578 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3749 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3749 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        52.42 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.009 ? 2.00  3813 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.03  ? 2.00  5144 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  1382 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  111  'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  541  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 3813 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           2.11  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           21.36 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  487  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  4211 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   9 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.08 
_refine_ls_shell.number_reflns_R_work             2519 
_refine_ls_shell.R_factor_R_work                  0.2750 
_refine_ls_shell.percent_reflns_obs               98.67 
_refine_ls_shell.R_factor_R_free                  0.3128 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            6.11 
_refine_ls_shell.number_reflns_R_free             164 
_refine_ls_shell.number_reflns_all                2683 
_refine_ls_shell.R_factor_all                     0.2772 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.177700 0.984100 -0.000756 0.984100 -0.177700 0.000105 0.000000 0.000000  -1.000000 -40.50000 48.13000 93.09000 
2 given ? 0.199700 0.979800 -0.014070 0.979800 -0.199400 0.016500 0.013360 -0.017080 -0.999800 -39.26000 48.07000 93.69000 
# 
_struct.entry_id                  3ZFW 
_struct.title                     
'Crystal structure of the TPR domain of kinesin light chain 2 in complex with a tryptophan-acidic cargo peptide' 
_struct.pdbx_descriptor           'KINESIN LIGHT CHAIN 2, PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING FAMILY M MEMBER 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ZFW 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, KINESIN-CARGO RECOGNITION, MOTOR PROTEIN, TPR DOMAIN, SALMONELLA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 19  ? GLN A 36  ? HIS A 236 GLN A 253 1 ? 18 
HELX_P HELX_P2  2  LYS A 38  ? LEU A 57  ? LYS A 255 LEU A 274 1 ? 20 
HELX_P HELX_P3  3  HIS A 61  ? ARG A 78  ? HIS A 278 ARG A 295 1 ? 18 
HELX_P HELX_P4  4  LYS A 80  ? LEU A 99  ? LYS A 297 LEU A 316 1 ? 20 
HELX_P HELX_P5  5  HIS A 103 ? ASN A 119 ? HIS A 320 ASN A 336 1 ? 17 
HELX_P HELX_P6  6  LYS A 122 ? LEU A 141 ? LYS A 339 LEU A 358 1 ? 20 
HELX_P HELX_P7  7  ASP A 145 ? GLN A 162 ? ASP A 362 GLN A 379 1 ? 18 
HELX_P HELX_P8  8  LYS A 164 ? GLY A 185 ? LYS A 381 GLY A 402 1 ? 22 
HELX_P HELX_P9  9  PRO A 193 ? GLU A 203 ? PRO A 410 GLU A 420 1 ? 11 
HELX_P HELX_P10 10 SER A 228 ? GLN A 245 ? SER A 445 GLN A 462 1 ? 18 
HELX_P HELX_P11 11 LYS A 247 ? ARG A 262 ? LYS A 464 ARG A 479 1 ? 16 
HELX_P HELX_P12 12 HIS B 19  ? GLN B 36  ? HIS B 236 GLN B 253 1 ? 18 
HELX_P HELX_P13 13 LYS B 38  ? LEU B 57  ? LYS B 255 LEU B 274 1 ? 20 
HELX_P HELX_P14 14 HIS B 61  ? ARG B 78  ? HIS B 278 ARG B 295 1 ? 18 
HELX_P HELX_P15 15 LYS B 80  ? LEU B 99  ? LYS B 297 LEU B 316 1 ? 20 
HELX_P HELX_P16 16 HIS B 103 ? ASN B 119 ? HIS B 320 ASN B 336 1 ? 17 
HELX_P HELX_P17 17 LYS B 122 ? LEU B 141 ? LYS B 339 LEU B 358 1 ? 20 
HELX_P HELX_P18 18 ASP B 145 ? GLN B 162 ? ASP B 362 GLN B 379 1 ? 18 
HELX_P HELX_P19 19 LYS B 164 ? GLY B 185 ? LYS B 381 GLY B 402 1 ? 22 
HELX_P HELX_P20 20 PRO B 193 ? GLU B 203 ? PRO B 410 GLU B 420 1 ? 11 
HELX_P HELX_P21 21 SER B 228 ? GLN B 245 ? SER B 445 GLN B 462 1 ? 18 
HELX_P HELX_P22 22 LYS B 247 ? SER B 259 ? LYS B 464 SER B 476 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 224 SG ? ? ? 1_555 A CYS 257 SG ? ? A CYS 441 A CYS 474 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf2 disulf ? ? B CYS 224 SG ? ? ? 1_555 B CYS 257 SG ? ? B CYS 441 B CYS 474 1_555 ? ? ? ? ? ? ? 2.044 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          3ZFW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ZFW 
_atom_sites.fract_transf_matrix[1][1]   0.011388 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011006 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010634 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . HIS A 1 19  ? -43.421 23.321  47.160  1.00 142.69 ? 236 HIS A N   1 
ATOM 2    C CA  . HIS A 1 19  ? -44.387 22.379  47.728  1.00 143.41 ? 236 HIS A CA  1 
ATOM 3    C C   . HIS A 1 19  ? -43.801 21.522  48.888  1.00 146.29 ? 236 HIS A C   1 
ATOM 4    O O   . HIS A 1 19  ? -42.666 21.059  48.762  1.00 145.45 ? 236 HIS A O   1 
ATOM 5    C CB  . HIS A 1 19  ? -44.977 21.487  46.617  1.00 145.08 ? 236 HIS A CB  1 
ATOM 6    C CG  . HIS A 1 19  ? -45.813 20.345  47.119  1.00 149.44 ? 236 HIS A CG  1 
ATOM 7    N ND1 . HIS A 1 19  ? -47.095 20.545  47.606  1.00 152.47 ? 236 HIS A ND1 1 
ATOM 8    C CD2 . HIS A 1 19  ? -45.518 19.027  47.199  1.00 151.16 ? 236 HIS A CD2 1 
ATOM 9    C CE1 . HIS A 1 19  ? -47.526 19.352  47.986  1.00 152.20 ? 236 HIS A CE1 1 
ATOM 10   N NE2 . HIS A 1 19  ? -46.616 18.407  47.753  1.00 151.77 ? 236 HIS A NE2 1 
ATOM 11   N N   . PRO A 1 20  ? -44.574 21.249  49.981  1.00 142.44 ? 237 PRO A N   1 
ATOM 12   C CA  . PRO A 1 20  ? -44.038 20.449  51.105  1.00 141.25 ? 237 PRO A CA  1 
ATOM 13   C C   . PRO A 1 20  ? -43.521 19.023  50.853  1.00 142.90 ? 237 PRO A C   1 
ATOM 14   O O   . PRO A 1 20  ? -42.638 18.588  51.597  1.00 142.28 ? 237 PRO A O   1 
ATOM 15   C CB  . PRO A 1 20  ? -45.182 20.461  52.129  1.00 143.60 ? 237 PRO A CB  1 
ATOM 16   C CG  . PRO A 1 20  ? -46.396 20.782  51.344  1.00 149.12 ? 237 PRO A CG  1 
ATOM 17   C CD  . PRO A 1 20  ? -45.924 21.748  50.308  1.00 144.84 ? 237 PRO A CD  1 
ATOM 18   N N   . ASP A 1 21  ? -44.050 18.287  49.853  1.00 137.92 ? 238 ASP A N   1 
ATOM 19   C CA  . ASP A 1 21  ? -43.564 16.920  49.585  1.00 136.57 ? 238 ASP A CA  1 
ATOM 20   C C   . ASP A 1 21  ? -42.158 16.874  48.975  1.00 135.72 ? 238 ASP A C   1 
ATOM 21   O O   . ASP A 1 21  ? -41.477 15.853  49.098  1.00 134.62 ? 238 ASP A O   1 
ATOM 22   C CB  . ASP A 1 21  ? -44.564 16.082  48.771  1.00 139.40 ? 238 ASP A CB  1 
ATOM 23   C CG  . ASP A 1 21  ? -45.816 15.697  49.537  1.00 149.51 ? 238 ASP A CG  1 
ATOM 24   O OD1 . ASP A 1 21  ? -45.683 15.094  50.637  1.00 149.07 ? 238 ASP A OD1 1 
ATOM 25   O OD2 . ASP A 1 21  ? -46.929 15.963  49.024  1.00 155.06 ? 238 ASP A OD2 1 
ATOM 26   N N   . VAL A 1 22  ? -41.724 17.993  48.349  1.00 129.34 ? 239 VAL A N   1 
ATOM 27   C CA  . VAL A 1 22  ? -40.389 18.183  47.768  1.00 127.33 ? 239 VAL A CA  1 
ATOM 28   C C   . VAL A 1 22  ? -39.359 18.145  48.923  1.00 129.18 ? 239 VAL A C   1 
ATOM 29   O O   . VAL A 1 22  ? -38.331 17.472  48.796  1.00 128.73 ? 239 VAL A O   1 
ATOM 30   C CB  . VAL A 1 22  ? -40.293 19.494  46.933  1.00 130.40 ? 239 VAL A CB  1 
ATOM 31   C CG1 . VAL A 1 22  ? -38.918 19.651  46.293  1.00 129.27 ? 239 VAL A CG1 1 
ATOM 32   C CG2 . VAL A 1 22  ? -41.387 19.563  45.871  1.00 130.83 ? 239 VAL A CG2 1 
ATOM 33   N N   . ALA A 1 23  ? -39.675 18.824  50.061  1.00 123.71 ? 240 ALA A N   1 
ATOM 34   C CA  . ALA A 1 23  ? -38.858 18.870  51.280  1.00 122.41 ? 240 ALA A CA  1 
ATOM 35   C C   . ALA A 1 23  ? -38.630 17.465  51.839  1.00 125.00 ? 240 ALA A C   1 
ATOM 36   O O   . ALA A 1 23  ? -37.520 17.172  52.283  1.00 123.91 ? 240 ALA A O   1 
ATOM 37   C CB  . ALA A 1 23  ? -39.516 19.755  52.335  1.00 123.13 ? 240 ALA A CB  1 
ATOM 38   N N   . THR A 1 24  ? -39.675 16.594  51.773  1.00 121.30 ? 241 THR A N   1 
ATOM 39   C CA  . THR A 1 24  ? -39.665 15.195  52.226  1.00 120.84 ? 241 THR A CA  1 
ATOM 40   C C   . THR A 1 24  ? -38.708 14.358  51.368  1.00 122.94 ? 241 THR A C   1 
ATOM 41   O O   . THR A 1 24  ? -37.985 13.527  51.909  1.00 122.93 ? 241 THR A O   1 
ATOM 42   C CB  . THR A 1 24  ? -41.096 14.623  52.279  1.00 130.56 ? 241 THR A CB  1 
ATOM 43   O OG1 . THR A 1 24  ? -41.963 15.554  52.929  1.00 132.41 ? 241 THR A OG1 1 
ATOM 44   C CG2 . THR A 1 24  ? -41.166 13.289  53.004  1.00 128.79 ? 241 THR A CG2 1 
ATOM 45   N N   . MET A 1 25  ? -38.685 14.606  50.047  1.00 118.11 ? 242 MET A N   1 
ATOM 46   C CA  . MET A 1 25  ? -37.794 13.946  49.087  1.00 117.29 ? 242 MET A CA  1 
ATOM 47   C C   . MET A 1 25  ? -36.347 14.351  49.393  1.00 117.46 ? 242 MET A C   1 
ATOM 48   O O   . MET A 1 25  ? -35.481 13.482  49.508  1.00 117.02 ? 242 MET A O   1 
ATOM 49   C CB  . MET A 1 25  ? -38.154 14.338  47.638  1.00 119.99 ? 242 MET A CB  1 
ATOM 50   C CG  . MET A 1 25  ? -39.541 13.917  47.201  1.00 124.75 ? 242 MET A CG  1 
ATOM 51   S SD  . MET A 1 25  ? -39.787 14.191  45.429  1.00 129.80 ? 242 MET A SD  1 
ATOM 52   C CE  . MET A 1 25  ? -41.138 15.358  45.458  1.00 126.63 ? 242 MET A CE  1 
ATOM 53   N N   . LEU A 1 26  ? -36.105 15.677  49.552  1.00 111.53 ? 243 LEU A N   1 
ATOM 54   C CA  . LEU A 1 26  ? -34.811 16.271  49.900  1.00 110.21 ? 243 LEU A CA  1 
ATOM 55   C C   . LEU A 1 26  ? -34.352 15.736  51.257  1.00 114.36 ? 243 LEU A C   1 
ATOM 56   O O   . LEU A 1 26  ? -33.161 15.471  51.428  1.00 114.24 ? 243 LEU A O   1 
ATOM 57   C CB  . LEU A 1 26  ? -34.915 17.804  49.972  1.00 109.45 ? 243 LEU A CB  1 
ATOM 58   C CG  . LEU A 1 26  ? -35.061 18.569  48.666  1.00 112.34 ? 243 LEU A CG  1 
ATOM 59   C CD1 . LEU A 1 26  ? -35.984 19.728  48.838  1.00 111.74 ? 243 LEU A CD1 1 
ATOM 60   C CD2 . LEU A 1 26  ? -33.743 19.108  48.214  1.00 114.46 ? 243 LEU A CD2 1 
ATOM 61   N N   . ASN A 1 27  ? -35.310 15.560  52.206  1.00 111.16 ? 244 ASN A N   1 
ATOM 62   C CA  . ASN A 1 27  ? -35.095 15.011  53.554  1.00 111.50 ? 244 ASN A CA  1 
ATOM 63   C C   . ASN A 1 27  ? -34.684 13.528  53.496  1.00 115.25 ? 244 ASN A C   1 
ATOM 64   O O   . ASN A 1 27  ? -33.763 13.125  54.207  1.00 115.46 ? 244 ASN A O   1 
ATOM 65   C CB  . ASN A 1 27  ? -36.349 15.177  54.412  1.00 112.23 ? 244 ASN A CB  1 
ATOM 66   C CG  . ASN A 1 27  ? -36.068 15.134  55.877  1.00 142.94 ? 244 ASN A CG  1 
ATOM 67   O OD1 . ASN A 1 27  ? -35.985 14.067  56.490  1.00 143.49 ? 244 ASN A OD1 1 
ATOM 68   N ND2 . ASN A 1 27  ? -35.908 16.297  56.468  1.00 136.77 ? 244 ASN A ND2 1 
ATOM 69   N N   . ILE A 1 28  ? -35.357 12.732  52.635  1.00 106.94 ? 245 ILE A N   1 
ATOM 70   C CA  . ILE A 1 28  ? -35.087 11.313  52.387  1.00 107.54 ? 245 ILE A CA  1 
ATOM 71   C C   . ILE A 1 28  ? -33.699 11.154  51.775  1.00 109.42 ? 245 ILE A C   1 
ATOM 72   O O   . ILE A 1 28  ? -32.962 10.250  52.167  1.00 108.82 ? 245 ILE A O   1 
ATOM 73   C CB  . ILE A 1 28  ? -36.238 10.702  51.530  1.00 112.93 ? 245 ILE A CB  1 
ATOM 74   C CG1 . ILE A 1 28  ? -37.343 10.170  52.450  1.00 115.03 ? 245 ILE A CG1 1 
ATOM 75   C CG2 . ILE A 1 28  ? -35.779 9.628   50.513  1.00 115.16 ? 245 ILE A CG2 1 
ATOM 76   C CD1 . ILE A 1 28  ? -38.761 10.308  51.914  1.00 128.32 ? 245 ILE A CD1 1 
ATOM 77   N N   . LEU A 1 29  ? -33.331 12.055  50.846  1.00 106.49 ? 246 LEU A N   1 
ATOM 78   C CA  . LEU A 1 29  ? -32.015 12.027  50.212  1.00 107.64 ? 246 LEU A CA  1 
ATOM 79   C C   . LEU A 1 29  ? -30.890 12.563  51.111  1.00 113.26 ? 246 LEU A C   1 
ATOM 80   O O   . LEU A 1 29  ? -29.727 12.190  50.919  1.00 115.12 ? 246 LEU A O   1 
ATOM 81   C CB  . LEU A 1 29  ? -32.012 12.668  48.815  1.00 108.15 ? 246 LEU A CB  1 
ATOM 82   C CG  . LEU A 1 29  ? -30.889 12.184  47.895  1.00 114.70 ? 246 LEU A CG  1 
ATOM 83   C CD1 . LEU A 1 29  ? -30.978 10.685  47.628  1.00 117.30 ? 246 LEU A CD1 1 
ATOM 84   C CD2 . LEU A 1 29  ? -30.872 12.943  46.615  1.00 118.21 ? 246 LEU A CD2 1 
ATOM 85   N N   . ALA A 1 30  ? -31.240 13.392  52.122  1.00 107.96 ? 247 ALA A N   1 
ATOM 86   C CA  . ALA A 1 30  ? -30.288 13.920  53.095  1.00 106.00 ? 247 ALA A CA  1 
ATOM 87   C C   . ALA A 1 30  ? -29.793 12.781  53.970  1.00 109.59 ? 247 ALA A C   1 
ATOM 88   O O   . ALA A 1 30  ? -28.619 12.765  54.324  1.00 110.46 ? 247 ALA A O   1 
ATOM 89   C CB  . ALA A 1 30  ? -30.948 14.985  53.948  1.00 105.47 ? 247 ALA A CB  1 
ATOM 90   N N   . LEU A 1 31  ? -30.677 11.810  54.284  1.00 106.21 ? 248 LEU A N   1 
ATOM 91   C CA  . LEU A 1 31  ? -30.359 10.631  55.099  1.00 107.63 ? 248 LEU A CA  1 
ATOM 92   C C   . LEU A 1 31  ? -29.386 9.722   54.362  1.00 114.43 ? 248 LEU A C   1 
ATOM 93   O O   . LEU A 1 31  ? -28.536 9.101   54.992  1.00 115.64 ? 248 LEU A O   1 
ATOM 94   C CB  . LEU A 1 31  ? -31.628 9.855   55.466  1.00 108.33 ? 248 LEU A CB  1 
ATOM 95   C CG  . LEU A 1 31  ? -32.632 10.590  56.345  1.00 111.34 ? 248 LEU A CG  1 
ATOM 96   C CD1 . LEU A 1 31  ? -34.040 10.231  55.953  1.00 112.59 ? 248 LEU A CD1 1 
ATOM 97   C CD2 . LEU A 1 31  ? -32.404 10.305  57.813  1.00 113.09 ? 248 LEU A CD2 1 
ATOM 98   N N   . VAL A 1 32  ? -29.500 9.669   53.026  1.00 112.05 ? 249 VAL A N   1 
ATOM 99   C CA  . VAL A 1 32  ? -28.619 8.903   52.145  1.00 115.06 ? 249 VAL A CA  1 
ATOM 100  C C   . VAL A 1 32  ? -27.185 9.461   52.266  1.00 119.31 ? 249 VAL A C   1 
ATOM 101  O O   . VAL A 1 32  ? -26.248 8.687   52.478  1.00 121.84 ? 249 VAL A O   1 
ATOM 102  C CB  . VAL A 1 32  ? -29.150 8.923   50.681  1.00 119.54 ? 249 VAL A CB  1 
ATOM 103  C CG1 . VAL A 1 32  ? -28.076 8.525   49.679  1.00 122.09 ? 249 VAL A CG1 1 
ATOM 104  C CG2 . VAL A 1 32  ? -30.385 8.042   50.530  1.00 120.20 ? 249 VAL A CG2 1 
ATOM 105  N N   . TYR A 1 33  ? -27.034 10.799  52.161  1.00 113.32 ? 250 TYR A N   1 
ATOM 106  C CA  . TYR A 1 33  ? -25.749 11.484  52.261  1.00 113.84 ? 250 TYR A CA  1 
ATOM 107  C C   . TYR A 1 33  ? -25.169 11.400  53.677  1.00 118.59 ? 250 TYR A C   1 
ATOM 108  O O   . TYR A 1 33  ? -23.965 11.169  53.835  1.00 120.53 ? 250 TYR A O   1 
ATOM 109  C CB  . TYR A 1 33  ? -25.875 12.939  51.796  1.00 113.50 ? 250 TYR A CB  1 
ATOM 110  C CG  . TYR A 1 33  ? -25.770 13.116  50.295  1.00 117.83 ? 250 TYR A CG  1 
ATOM 111  C CD1 . TYR A 1 33  ? -24.530 13.172  49.664  1.00 122.21 ? 250 TYR A CD1 1 
ATOM 112  C CD2 . TYR A 1 33  ? -26.908 13.261  49.507  1.00 118.49 ? 250 TYR A CD2 1 
ATOM 113  C CE1 . TYR A 1 33  ? -24.425 13.344  48.282  1.00 124.98 ? 250 TYR A CE1 1 
ATOM 114  C CE2 . TYR A 1 33  ? -26.816 13.440  48.125  1.00 121.08 ? 250 TYR A CE2 1 
ATOM 115  C CZ  . TYR A 1 33  ? -25.572 13.472  47.515  1.00 130.91 ? 250 TYR A CZ  1 
ATOM 116  O OH  . TYR A 1 33  ? -25.470 13.649  46.156  1.00 132.84 ? 250 TYR A OH  1 
ATOM 117  N N   . ARG A 1 34  ? -26.036 11.564  54.701  1.00 113.74 ? 251 ARG A N   1 
ATOM 118  C CA  . ARG A 1 34  ? -25.694 11.488  56.125  1.00 113.74 ? 251 ARG A CA  1 
ATOM 119  C C   . ARG A 1 34  ? -25.045 10.131  56.419  1.00 121.36 ? 251 ARG A C   1 
ATOM 120  O O   . ARG A 1 34  ? -23.967 10.083  57.012  1.00 122.88 ? 251 ARG A O   1 
ATOM 121  C CB  . ARG A 1 34  ? -26.964 11.686  56.993  1.00 111.30 ? 251 ARG A CB  1 
ATOM 122  C CG  . ARG A 1 34  ? -26.749 11.550  58.513  1.00 115.32 ? 251 ARG A CG  1 
ATOM 123  C CD  . ARG A 1 34  ? -28.032 11.240  59.281  1.00 110.81 ? 251 ARG A CD  1 
ATOM 124  N NE  . ARG A 1 34  ? -28.605 9.938   58.926  1.00 112.62 ? 251 ARG A NE  1 
ATOM 125  C CZ  . ARG A 1 34  ? -29.566 9.321   59.610  1.00 128.65 ? 251 ARG A CZ  1 
ATOM 126  N NH1 . ARG A 1 34  ? -30.079 9.881   60.703  1.00 116.35 ? 251 ARG A NH1 1 
ATOM 127  N NH2 . ARG A 1 34  ? -30.028 8.145   59.204  1.00 114.05 ? 251 ARG A NH2 1 
ATOM 128  N N   . ASP A 1 35  ? -25.690 9.044   55.957  1.00 119.63 ? 252 ASP A N   1 
ATOM 129  C CA  . ASP A 1 35  ? -25.240 7.667   56.139  1.00 123.79 ? 252 ASP A CA  1 
ATOM 130  C C   . ASP A 1 35  ? -23.913 7.355   55.445  1.00 130.93 ? 252 ASP A C   1 
ATOM 131  O O   . ASP A 1 35  ? -23.188 6.467   55.891  1.00 134.73 ? 252 ASP A O   1 
ATOM 132  C CB  . ASP A 1 35  ? -26.359 6.670   55.777  1.00 127.05 ? 252 ASP A CB  1 
ATOM 133  C CG  . ASP A 1 35  ? -27.524 6.625   56.766  1.00 139.61 ? 252 ASP A CG  1 
ATOM 134  O OD1 . ASP A 1 35  ? -27.766 7.649   57.461  1.00 138.16 ? 252 ASP A OD1 1 
ATOM 135  O OD2 . ASP A 1 35  ? -28.210 5.580   56.827  1.00 148.64 ? 252 ASP A OD2 1 
ATOM 136  N N   . GLN A 1 36  ? -23.572 8.111   54.394  1.00 126.53 ? 253 GLN A N   1 
ATOM 137  C CA  . GLN A 1 36  ? -22.304 7.950   53.687  1.00 129.74 ? 253 GLN A CA  1 
ATOM 138  C C   . GLN A 1 36  ? -21.256 8.925   54.243  1.00 132.26 ? 253 GLN A C   1 
ATOM 139  O O   . GLN A 1 36  ? -20.167 9.053   53.680  1.00 134.79 ? 253 GLN A O   1 
ATOM 140  C CB  . GLN A 1 36  ? -22.495 8.121   52.171  1.00 130.95 ? 253 GLN A CB  1 
ATOM 141  C CG  . GLN A 1 36  ? -22.652 6.800   51.446  1.00 151.00 ? 253 GLN A CG  1 
ATOM 142  C CD  . GLN A 1 36  ? -21.782 6.746   50.222  1.00 178.42 ? 253 GLN A CD  1 
ATOM 143  O OE1 . GLN A 1 36  ? -22.114 7.301   49.165  1.00 175.22 ? 253 GLN A OE1 1 
ATOM 144  N NE2 . GLN A 1 36  ? -20.649 6.067   50.339  1.00 174.74 ? 253 GLN A NE2 1 
ATOM 145  N N   . ASN A 1 37  ? -21.590 9.590   55.367  1.00 125.26 ? 254 ASN A N   1 
ATOM 146  C CA  . ASN A 1 37  ? -20.767 10.579  56.070  1.00 124.30 ? 254 ASN A CA  1 
ATOM 147  C C   . ASN A 1 37  ? -20.466 11.850  55.256  1.00 125.49 ? 254 ASN A C   1 
ATOM 148  O O   . ASN A 1 37  ? -19.531 12.582  55.586  1.00 126.10 ? 254 ASN A O   1 
ATOM 149  C CB  . ASN A 1 37  ? -19.511 9.949   56.702  1.00 130.50 ? 254 ASN A CB  1 
ATOM 150  C CG  . ASN A 1 37  ? -19.799 8.894   57.759  1.00 160.61 ? 254 ASN A CG  1 
ATOM 151  O OD1 . ASN A 1 37  ? -20.637 9.068   58.658  1.00 149.30 ? 254 ASN A OD1 1 
ATOM 152  N ND2 . ASN A 1 37  ? -19.072 7.784   57.700  1.00 158.72 ? 254 ASN A ND2 1 
ATOM 153  N N   . LYS A 1 38  ? -21.284 12.131  54.222  1.00 119.11 ? 255 LYS A N   1 
ATOM 154  C CA  . LYS A 1 38  ? -21.150 13.328  53.380  1.00 117.73 ? 255 LYS A CA  1 
ATOM 155  C C   . LYS A 1 38  ? -22.016 14.439  54.009  1.00 118.16 ? 255 LYS A C   1 
ATOM 156  O O   . LYS A 1 38  ? -23.066 14.811  53.464  1.00 116.41 ? 255 LYS A O   1 
ATOM 157  C CB  . LYS A 1 38  ? -21.572 13.043  51.918  1.00 119.98 ? 255 LYS A CB  1 
ATOM 158  C CG  . LYS A 1 38  ? -20.684 12.064  51.153  1.00 131.24 ? 255 LYS A CG  1 
ATOM 159  C CD  . LYS A 1 38  ? -21.254 11.813  49.762  1.00 136.38 ? 255 LYS A CD  1 
ATOM 160  C CE  . LYS A 1 38  ? -20.622 10.671  49.008  1.00 145.62 ? 255 LYS A CE  1 
ATOM 161  N NZ  . LYS A 1 38  ? -21.415 10.316  47.793  1.00 151.02 ? 255 LYS A NZ  1 
ATOM 162  N N   . TYR A 1 39  ? -21.574 14.942  55.178  1.00 113.03 ? 256 TYR A N   1 
ATOM 163  C CA  . TYR A 1 39  ? -22.273 15.957  55.972  1.00 109.96 ? 256 TYR A CA  1 
ATOM 164  C C   . TYR A 1 39  ? -22.557 17.269  55.248  1.00 114.60 ? 256 TYR A C   1 
ATOM 165  O O   . TYR A 1 39  ? -23.703 17.719  55.266  1.00 112.68 ? 256 TYR A O   1 
ATOM 166  C CB  . TYR A 1 39  ? -21.583 16.192  57.332  1.00 111.01 ? 256 TYR A CB  1 
ATOM 167  C CG  . TYR A 1 39  ? -21.210 14.919  58.067  1.00 113.34 ? 256 TYR A CG  1 
ATOM 168  C CD1 . TYR A 1 39  ? -22.177 13.979  58.412  1.00 114.25 ? 256 TYR A CD1 1 
ATOM 169  C CD2 . TYR A 1 39  ? -19.890 14.654  58.416  1.00 116.98 ? 256 TYR A CD2 1 
ATOM 170  C CE1 . TYR A 1 39  ? -21.837 12.794  59.059  1.00 117.26 ? 256 TYR A CE1 1 
ATOM 171  C CE2 . TYR A 1 39  ? -19.538 13.479  59.080  1.00 120.41 ? 256 TYR A CE2 1 
ATOM 172  C CZ  . TYR A 1 39  ? -20.517 12.553  59.406  1.00 128.16 ? 256 TYR A CZ  1 
ATOM 173  O OH  . TYR A 1 39  ? -20.180 11.400  60.084  1.00 133.18 ? 256 TYR A OH  1 
ATOM 174  N N   . LYS A 1 40  ? -21.535 17.869  54.601  1.00 113.82 ? 257 LYS A N   1 
ATOM 175  C CA  . LYS A 1 40  ? -21.649 19.131  53.858  1.00 114.29 ? 257 LYS A CA  1 
ATOM 176  C C   . LYS A 1 40  ? -22.789 19.105  52.826  1.00 115.32 ? 257 LYS A C   1 
ATOM 177  O O   . LYS A 1 40  ? -23.534 20.085  52.723  1.00 113.52 ? 257 LYS A O   1 
ATOM 178  C CB  . LYS A 1 40  ? -20.305 19.492  53.193  1.00 121.55 ? 257 LYS A CB  1 
ATOM 179  C CG  . LYS A 1 40  ? -19.938 20.970  53.300  1.00 147.19 ? 257 LYS A CG  1 
ATOM 180  C CD  . LYS A 1 40  ? -18.822 21.346  52.320  1.00 164.79 ? 257 LYS A CD  1 
ATOM 181  C CE  . LYS A 1 40  ? -18.444 22.810  52.400  1.00 180.51 ? 257 LYS A CE  1 
ATOM 182  N NZ  . LYS A 1 40  ? -17.604 23.235  51.245  1.00 190.88 ? 257 LYS A NZ  1 
ATOM 183  N N   . ASP A 1 41  ? -22.952 17.975  52.101  1.00 111.50 ? 258 ASP A N   1 
ATOM 184  C CA  . ASP A 1 41  ? -24.005 17.795  51.096  1.00 110.06 ? 258 ASP A CA  1 
ATOM 185  C C   . ASP A 1 41  ? -25.347 17.591  51.758  1.00 112.25 ? 258 ASP A C   1 
ATOM 186  O O   . ASP A 1 41  ? -26.310 18.250  51.368  1.00 111.63 ? 258 ASP A O   1 
ATOM 187  C CB  . ASP A 1 41  ? -23.697 16.615  50.160  1.00 112.99 ? 258 ASP A CB  1 
ATOM 188  C CG  . ASP A 1 41  ? -22.420 16.738  49.353  1.00 122.37 ? 258 ASP A CG  1 
ATOM 189  O OD1 . ASP A 1 41  ? -22.082 17.875  48.937  1.00 123.59 ? 258 ASP A OD1 1 
ATOM 190  O OD2 . ASP A 1 41  ? -21.777 15.695  49.100  1.00 128.72 ? 258 ASP A OD2 1 
ATOM 191  N N   . ALA A 1 42  ? -25.409 16.687  52.772  1.00 108.40 ? 259 ALA A N   1 
ATOM 192  C CA  . ALA A 1 42  ? -26.615 16.390  53.546  1.00 106.79 ? 259 ALA A CA  1 
ATOM 193  C C   . ALA A 1 42  ? -27.186 17.694  54.098  1.00 111.64 ? 259 ALA A C   1 
ATOM 194  O O   . ALA A 1 42  ? -28.392 17.912  53.994  1.00 111.16 ? 259 ALA A O   1 
ATOM 195  C CB  . ALA A 1 42  ? -26.292 15.430  54.683  1.00 107.41 ? 259 ALA A CB  1 
ATOM 196  N N   . ALA A 1 43  ? -26.303 18.590  54.600  1.00 109.59 ? 260 ALA A N   1 
ATOM 197  C CA  . ALA A 1 43  ? -26.665 19.903  55.127  1.00 109.98 ? 260 ALA A CA  1 
ATOM 198  C C   . ALA A 1 43  ? -27.278 20.793  54.037  1.00 118.15 ? 260 ALA A C   1 
ATOM 199  O O   . ALA A 1 43  ? -28.327 21.389  54.279  1.00 118.28 ? 260 ALA A O   1 
ATOM 200  C CB  . ALA A 1 43  ? -25.450 20.571  55.736  1.00 111.54 ? 260 ALA A CB  1 
ATOM 201  N N   . HIS A 1 44  ? -26.666 20.834  52.826  1.00 118.09 ? 261 HIS A N   1 
ATOM 202  C CA  . HIS A 1 44  ? -27.164 21.614  51.687  1.00 120.55 ? 261 HIS A CA  1 
ATOM 203  C C   . HIS A 1 44  ? -28.585 21.196  51.302  1.00 122.34 ? 261 HIS A C   1 
ATOM 204  O O   . HIS A 1 44  ? -29.407 22.069  51.034  1.00 123.20 ? 261 HIS A O   1 
ATOM 205  C CB  . HIS A 1 44  ? -26.214 21.519  50.477  1.00 124.19 ? 261 HIS A CB  1 
ATOM 206  C CG  . HIS A 1 44  ? -26.617 22.373  49.307  1.00 131.31 ? 261 HIS A CG  1 
ATOM 207  N ND1 . HIS A 1 44  ? -27.416 21.872  48.283  1.00 134.08 ? 261 HIS A ND1 1 
ATOM 208  C CD2 . HIS A 1 44  ? -26.306 23.662  49.021  1.00 136.46 ? 261 HIS A CD2 1 
ATOM 209  C CE1 . HIS A 1 44  ? -27.569 22.868  47.419  1.00 136.38 ? 261 HIS A CE1 1 
ATOM 210  N NE2 . HIS A 1 44  ? -26.912 23.963  47.812  1.00 138.37 ? 261 HIS A NE2 1 
ATOM 211  N N   . LEU A 1 45  ? -28.879 19.875  51.303  1.00 116.47 ? 262 LEU A N   1 
ATOM 212  C CA  . LEU A 1 45  ? -30.204 19.334  50.977  1.00 115.28 ? 262 LEU A CA  1 
ATOM 213  C C   . LEU A 1 45  ? -31.247 19.623  52.051  1.00 117.00 ? 262 LEU A C   1 
ATOM 214  O O   . LEU A 1 45  ? -32.434 19.671  51.737  1.00 117.49 ? 262 LEU A O   1 
ATOM 215  C CB  . LEU A 1 45  ? -30.157 17.825  50.678  1.00 114.65 ? 262 LEU A CB  1 
ATOM 216  C CG  . LEU A 1 45  ? -29.487 17.380  49.376  1.00 120.66 ? 262 LEU A CG  1 
ATOM 217  C CD1 . LEU A 1 45  ? -29.509 15.882  49.261  1.00 120.93 ? 262 LEU A CD1 1 
ATOM 218  C CD2 . LEU A 1 45  ? -30.177 17.957  48.166  1.00 124.56 ? 262 LEU A CD2 1 
ATOM 219  N N   . LEU A 1 46  ? -30.817 19.795  53.312  1.00 111.82 ? 263 LEU A N   1 
ATOM 220  C CA  . LEU A 1 46  ? -31.719 20.103  54.423  1.00 110.72 ? 263 LEU A CA  1 
ATOM 221  C C   . LEU A 1 46  ? -32.046 21.574  54.504  1.00 116.41 ? 263 LEU A C   1 
ATOM 222  O O   . LEU A 1 46  ? -33.169 21.900  54.874  1.00 116.64 ? 263 LEU A O   1 
ATOM 223  C CB  . LEU A 1 46  ? -31.206 19.582  55.765  1.00 109.03 ? 263 LEU A CB  1 
ATOM 224  C CG  . LEU A 1 46  ? -31.425 18.098  56.012  1.00 112.92 ? 263 LEU A CG  1 
ATOM 225  C CD1 . LEU A 1 46  ? -30.993 17.713  57.406  1.00 112.71 ? 263 LEU A CD1 1 
ATOM 226  C CD2 . LEU A 1 46  ? -32.885 17.694  55.806  1.00 116.11 ? 263 LEU A CD2 1 
ATOM 227  N N   . ASN A 1 47  ? -31.079 22.462  54.154  1.00 114.67 ? 264 ASN A N   1 
ATOM 228  C CA  . ASN A 1 47  ? -31.267 23.921  54.123  1.00 118.01 ? 264 ASN A CA  1 
ATOM 229  C C   . ASN A 1 47  ? -32.295 24.251  53.040  1.00 124.82 ? 264 ASN A C   1 
ATOM 230  O O   . ASN A 1 47  ? -33.103 25.173  53.199  1.00 126.16 ? 264 ASN A O   1 
ATOM 231  C CB  . ASN A 1 47  ? -29.947 24.652  53.828  1.00 121.54 ? 264 ASN A CB  1 
ATOM 232  C CG  . ASN A 1 47  ? -28.987 24.731  54.994  1.00 153.52 ? 264 ASN A CG  1 
ATOM 233  O OD1 . ASN A 1 47  ? -27.870 24.208  54.944  1.00 150.08 ? 264 ASN A OD1 1 
ATOM 234  N ND2 . ASN A 1 47  ? -29.372 25.425  56.060  1.00 148.17 ? 264 ASN A ND2 1 
ATOM 235  N N   . ASP A 1 48  ? -32.267 23.452  51.949  1.00 122.08 ? 265 ASP A N   1 
ATOM 236  C CA  . ASP A 1 48  ? -33.186 23.531  50.822  1.00 124.55 ? 265 ASP A CA  1 
ATOM 237  C C   . ASP A 1 48  ? -34.578 23.101  51.266  1.00 127.46 ? 265 ASP A C   1 
ATOM 238  O O   . ASP A 1 48  ? -35.547 23.782  50.940  1.00 131.69 ? 265 ASP A O   1 
ATOM 239  C CB  . ASP A 1 48  ? -32.678 22.711  49.624  1.00 126.32 ? 265 ASP A CB  1 
ATOM 240  C CG  . ASP A 1 48  ? -31.860 23.545  48.653  1.00 145.64 ? 265 ASP A CG  1 
ATOM 241  O OD1 . ASP A 1 48  ? -30.643 23.719  48.896  1.00 146.17 ? 265 ASP A OD1 1 
ATOM 242  O OD2 . ASP A 1 48  ? -32.444 24.047  47.659  1.00 157.30 ? 265 ASP A OD2 1 
ATOM 243  N N   . ALA A 1 49  ? -34.671 22.026  52.065  1.00 118.64 ? 266 ALA A N   1 
ATOM 244  C CA  . ALA A 1 49  ? -35.935 21.547  52.619  1.00 117.65 ? 266 ALA A CA  1 
ATOM 245  C C   . ALA A 1 49  ? -36.433 22.514  53.711  1.00 121.23 ? 266 ALA A C   1 
ATOM 246  O O   . ALA A 1 49  ? -37.645 22.633  53.910  1.00 123.34 ? 266 ALA A O   1 
ATOM 247  C CB  . ALA A 1 49  ? -35.759 20.148  53.189  1.00 115.63 ? 266 ALA A CB  1 
ATOM 248  N N   . LEU A 1 50  ? -35.498 23.217  54.395  1.00 115.25 ? 267 LEU A N   1 
ATOM 249  C CA  . LEU A 1 50  ? -35.813 24.184  55.450  1.00 116.13 ? 267 LEU A CA  1 
ATOM 250  C C   . LEU A 1 50  ? -36.525 25.395  54.855  1.00 123.24 ? 267 LEU A C   1 
ATOM 251  O O   . LEU A 1 50  ? -37.641 25.705  55.275  1.00 126.06 ? 267 LEU A O   1 
ATOM 252  C CB  . LEU A 1 50  ? -34.553 24.600  56.268  1.00 114.64 ? 267 LEU A CB  1 
ATOM 253  C CG  . LEU A 1 50  ? -34.776 25.557  57.474  1.00 120.75 ? 267 LEU A CG  1 
ATOM 254  C CD1 . LEU A 1 50  ? -35.412 24.842  58.662  1.00 119.47 ? 267 LEU A CD1 1 
ATOM 255  C CD2 . LEU A 1 50  ? -33.481 26.211  57.902  1.00 121.95 ? 267 LEU A CD2 1 
ATOM 256  N N   . ALA A 1 51  ? -35.908 26.039  53.847  1.00 119.33 ? 268 ALA A N   1 
ATOM 257  C CA  . ALA A 1 51  ? -36.476 27.195  53.161  1.00 123.29 ? 268 ALA A CA  1 
ATOM 258  C C   . ALA A 1 51  ? -37.888 26.900  52.628  1.00 127.82 ? 268 ALA A C   1 
ATOM 259  O O   . ALA A 1 51  ? -38.733 27.796  52.631  1.00 132.21 ? 268 ALA A O   1 
ATOM 260  C CB  . ALA A 1 51  ? -35.559 27.624  52.034  1.00 124.69 ? 268 ALA A CB  1 
ATOM 261  N N   . ILE A 1 52  ? -38.145 25.632  52.223  1.00 120.40 ? 269 ILE A N   1 
ATOM 262  C CA  . ILE A 1 52  ? -39.442 25.145  51.732  1.00 121.81 ? 269 ILE A CA  1 
ATOM 263  C C   . ILE A 1 52  ? -40.455 25.096  52.874  1.00 126.63 ? 269 ILE A C   1 
ATOM 264  O O   . ILE A 1 52  ? -41.526 25.689  52.756  1.00 130.92 ? 269 ILE A O   1 
ATOM 265  C CB  . ILE A 1 52  ? -39.315 23.789  50.962  1.00 121.39 ? 269 ILE A CB  1 
ATOM 266  C CG1 . ILE A 1 52  ? -38.635 24.017  49.595  1.00 122.17 ? 269 ILE A CG1 1 
ATOM 267  C CG2 . ILE A 1 52  ? -40.685 23.082  50.785  1.00 123.43 ? 269 ILE A CG2 1 
ATOM 268  C CD1 . ILE A 1 52  ? -38.034 22.794  48.921  1.00 125.31 ? 269 ILE A CD1 1 
ATOM 269  N N   . ARG A 1 53  ? -40.105 24.405  53.970  1.00 119.89 ? 270 ARG A N   1 
ATOM 270  C CA  . ARG A 1 53  ? -40.948 24.250  55.158  1.00 121.35 ? 270 ARG A CA  1 
ATOM 271  C C   . ARG A 1 53  ? -41.226 25.585  55.877  1.00 131.00 ? 270 ARG A C   1 
ATOM 272  O O   . ARG A 1 53  ? -42.331 25.768  56.389  1.00 133.73 ? 270 ARG A O   1 
ATOM 273  C CB  . ARG A 1 53  ? -40.399 23.153  56.092  1.00 115.80 ? 270 ARG A CB  1 
ATOM 274  C CG  . ARG A 1 53  ? -40.604 21.747  55.528  1.00 119.72 ? 270 ARG A CG  1 
ATOM 275  C CD  . ARG A 1 53  ? -39.877 20.662  56.295  1.00 124.08 ? 270 ARG A CD  1 
ATOM 276  N NE  . ARG A 1 53  ? -40.258 19.338  55.797  1.00 137.31 ? 270 ARG A NE  1 
ATOM 277  C CZ  . ARG A 1 53  ? -39.446 18.285  55.735  1.00 147.30 ? 270 ARG A CZ  1 
ATOM 278  N NH1 . ARG A 1 53  ? -38.182 18.386  56.137  1.00 126.15 ? 270 ARG A NH1 1 
ATOM 279  N NH2 . ARG A 1 53  ? -39.888 17.124  55.261  1.00 130.48 ? 270 ARG A NH2 1 
ATOM 280  N N   . GLU A 1 54  ? -40.244 26.528  55.862  1.00 129.62 ? 271 GLU A N   1 
ATOM 281  C CA  . GLU A 1 54  ? -40.356 27.889  56.405  1.00 135.30 ? 271 GLU A CA  1 
ATOM 282  C C   . GLU A 1 54  ? -41.400 28.697  55.616  1.00 147.99 ? 271 GLU A C   1 
ATOM 283  O O   . GLU A 1 54  ? -42.028 29.598  56.176  1.00 153.55 ? 271 GLU A O   1 
ATOM 284  C CB  . GLU A 1 54  ? -39.004 28.619  56.309  1.00 135.94 ? 271 GLU A CB  1 
ATOM 285  C CG  . GLU A 1 54  ? -38.124 28.515  57.546  1.00 144.28 ? 271 GLU A CG  1 
ATOM 286  C CD  . GLU A 1 54  ? -36.739 29.127  57.417  1.00 164.92 ? 271 GLU A CD  1 
ATOM 287  O OE1 . GLU A 1 54  ? -36.144 29.039  56.317  1.00 164.19 ? 271 GLU A OE1 1 
ATOM 288  O OE2 . GLU A 1 54  ? -36.242 29.688  58.422  1.00 142.70 ? 271 GLU A OE2 1 
ATOM 289  N N   . LYS A 1 55  ? -41.558 28.393  54.313  1.00 145.71 ? 272 LYS A N   1 
ATOM 290  C CA  . LYS A 1 55  ? -42.488 29.089  53.425  1.00 152.20 ? 272 LYS A CA  1 
ATOM 291  C C   . LYS A 1 55  ? -43.890 28.469  53.425  1.00 159.60 ? 272 LYS A C   1 
ATOM 292  O O   . LYS A 1 55  ? -44.861 29.180  53.692  1.00 165.87 ? 272 LYS A O   1 
ATOM 293  C CB  . LYS A 1 55  ? -41.918 29.190  52.002  1.00 154.14 ? 272 LYS A CB  1 
ATOM 294  C CG  . LYS A 1 55  ? -40.788 30.209  51.850  1.00 168.86 ? 272 LYS A CG  1 
ATOM 295  C CD  . LYS A 1 55  ? -40.261 30.286  50.398  1.00 178.67 ? 272 LYS A CD  1 
ATOM 296  C CE  . LYS A 1 55  ? -41.032 31.240  49.504  1.00 196.01 ? 272 LYS A CE  1 
ATOM 297  N NZ  . LYS A 1 55  ? -40.505 31.256  48.109  1.00 204.78 ? 272 LYS A NZ  1 
ATOM 298  N N   . THR A 1 56  ? -43.999 27.155  53.135  1.00 132.86 ? 273 THR A N   1 
ATOM 299  C CA  . THR A 1 56  ? -45.280 26.443  53.067  1.00 135.35 ? 273 THR A CA  1 
ATOM 300  C C   . THR A 1 56  ? -45.933 26.259  54.429  1.00 140.65 ? 273 THR A C   1 
ATOM 301  O O   . THR A 1 56  ? -47.043 26.749  54.637  1.00 144.10 ? 273 THR A O   1 
ATOM 302  C CB  . THR A 1 56  ? -45.166 25.112  52.297  1.00 143.82 ? 273 THR A CB  1 
ATOM 303  O OG1 . THR A 1 56  ? -44.219 24.266  52.954  1.00 144.85 ? 273 THR A OG1 1 
ATOM 304  C CG2 . THR A 1 56  ? -44.804 25.301  50.826  1.00 140.29 ? 273 THR A CG2 1 
ATOM 305  N N   . LEU A 1 57  ? -45.249 25.560  55.351  1.00 134.68 ? 274 LEU A N   1 
ATOM 306  C CA  . LEU A 1 57  ? -45.761 25.271  56.699  1.00 135.49 ? 274 LEU A CA  1 
ATOM 307  C C   . LEU A 1 57  ? -45.597 26.444  57.684  1.00 139.38 ? 274 LEU A C   1 
ATOM 308  O O   . LEU A 1 57  ? -46.218 26.441  58.749  1.00 139.74 ? 274 LEU A O   1 
ATOM 309  C CB  . LEU A 1 57  ? -45.137 23.973  57.263  1.00 133.06 ? 274 LEU A CB  1 
ATOM 310  C CG  . LEU A 1 57  ? -45.231 22.714  56.383  1.00 137.50 ? 274 LEU A CG  1 
ATOM 311  C CD1 . LEU A 1 57  ? -44.153 21.728  56.744  1.00 134.43 ? 274 LEU A CD1 1 
ATOM 312  C CD2 . LEU A 1 57  ? -46.615 22.062  56.463  1.00 143.16 ? 274 LEU A CD2 1 
ATOM 313  N N   . GLY A 1 58  ? -44.773 27.426  57.305  1.00 135.72 ? 275 GLY A N   1 
ATOM 314  C CA  . GLY A 1 58  ? -44.491 28.623  58.092  1.00 136.32 ? 275 GLY A CA  1 
ATOM 315  C C   . GLY A 1 58  ? -43.504 28.410  59.220  1.00 139.45 ? 275 GLY A C   1 
ATOM 316  O O   . GLY A 1 58  ? -43.298 27.274  59.659  1.00 138.48 ? 275 GLY A O   1 
ATOM 317  N N   . LYS A 1 59  ? -42.885 29.508  59.713  1.00 136.20 ? 276 LYS A N   1 
ATOM 318  C CA  . LYS A 1 59  ? -41.952 29.445  60.849  1.00 133.86 ? 276 LYS A CA  1 
ATOM 319  C C   . LYS A 1 59  ? -42.744 29.090  62.111  1.00 139.44 ? 276 LYS A C   1 
ATOM 320  O O   . LYS A 1 59  ? -43.954 29.337  62.157  1.00 142.76 ? 276 LYS A O   1 
ATOM 321  C CB  . LYS A 1 59  ? -41.214 30.775  61.042  1.00 136.98 ? 276 LYS A CB  1 
ATOM 322  C CG  . LYS A 1 59  ? -39.912 30.879  60.260  1.00 157.36 ? 276 LYS A CG  1 
ATOM 323  C CD  . LYS A 1 59  ? -39.000 31.950  60.866  1.00 171.48 ? 276 LYS A CD  1 
ATOM 324  C CE  . LYS A 1 59  ? -37.751 32.205  60.049  1.00 181.80 ? 276 LYS A CE  1 
ATOM 325  N NZ  . LYS A 1 59  ? -36.672 32.832  60.865  1.00 188.46 ? 276 LYS A NZ  1 
ATOM 326  N N   . ASP A 1 60  ? -42.078 28.504  63.122  1.00 133.47 ? 277 ASP A N   1 
ATOM 327  C CA  . ASP A 1 60  ? -42.706 28.064  64.376  1.00 134.68 ? 277 ASP A CA  1 
ATOM 328  C C   . ASP A 1 60  ? -43.607 26.832  64.166  1.00 138.71 ? 277 ASP A C   1 
ATOM 329  O O   . ASP A 1 60  ? -44.667 26.696  64.785  1.00 140.61 ? 277 ASP A O   1 
ATOM 330  C CB  . ASP A 1 60  ? -43.425 29.210  65.133  1.00 140.48 ? 277 ASP A CB  1 
ATOM 331  C CG  . ASP A 1 60  ? -42.523 30.370  65.504  1.00 153.63 ? 277 ASP A CG  1 
ATOM 332  O OD1 . ASP A 1 60  ? -41.825 30.273  66.541  1.00 153.44 ? 277 ASP A OD1 1 
ATOM 333  O OD2 . ASP A 1 60  ? -42.533 31.384  64.773  1.00 161.51 ? 277 ASP A OD2 1 
ATOM 334  N N   . HIS A 1 61  ? -43.152 25.925  63.295  1.00 133.60 ? 278 HIS A N   1 
ATOM 335  C CA  . HIS A 1 61  ? -43.824 24.666  62.996  1.00 134.82 ? 278 HIS A CA  1 
ATOM 336  C C   . HIS A 1 61  ? -42.907 23.502  63.419  1.00 135.59 ? 278 HIS A C   1 
ATOM 337  O O   . HIS A 1 61  ? -41.689 23.584  63.203  1.00 131.80 ? 278 HIS A O   1 
ATOM 338  C CB  . HIS A 1 61  ? -44.166 24.568  61.501  1.00 136.49 ? 278 HIS A CB  1 
ATOM 339  C CG  . HIS A 1 61  ? -45.016 23.383  61.158  1.00 142.54 ? 278 HIS A CG  1 
ATOM 340  N ND1 . HIS A 1 61  ? -44.467 22.123  60.997  1.00 142.73 ? 278 HIS A ND1 1 
ATOM 341  C CD2 . HIS A 1 61  ? -46.354 23.301  60.980  1.00 148.91 ? 278 HIS A CD2 1 
ATOM 342  C CE1 . HIS A 1 61  ? -45.481 21.320  60.722  1.00 145.70 ? 278 HIS A CE1 1 
ATOM 343  N NE2 . HIS A 1 61  ? -46.635 21.984  60.694  1.00 149.88 ? 278 HIS A NE2 1 
ATOM 344  N N   . PRO A 1 62  ? -43.470 22.403  63.991  1.00 133.22 ? 279 PRO A N   1 
ATOM 345  C CA  . PRO A 1 62  ? -42.623 21.265  64.414  1.00 130.09 ? 279 PRO A CA  1 
ATOM 346  C C   . PRO A 1 62  ? -41.639 20.717  63.376  1.00 127.50 ? 279 PRO A C   1 
ATOM 347  O O   . PRO A 1 62  ? -40.540 20.309  63.747  1.00 123.49 ? 279 PRO A O   1 
ATOM 348  C CB  . PRO A 1 62  ? -43.648 20.212  64.840  1.00 135.96 ? 279 PRO A CB  1 
ATOM 349  C CG  . PRO A 1 62  ? -44.816 21.017  65.314  1.00 144.75 ? 279 PRO A CG  1 
ATOM 350  C CD  . PRO A 1 62  ? -44.887 22.167  64.346  1.00 139.72 ? 279 PRO A CD  1 
ATOM 351  N N   . ALA A 1 63  ? -42.024 20.720  62.085  1.00 123.35 ? 280 ALA A N   1 
ATOM 352  C CA  . ALA A 1 63  ? -41.174 20.258  60.988  1.00 120.17 ? 280 ALA A CA  1 
ATOM 353  C C   . ALA A 1 63  ? -39.945 21.165  60.813  1.00 118.71 ? 280 ALA A C   1 
ATOM 354  O O   . ALA A 1 63  ? -38.862 20.661  60.505  1.00 116.21 ? 280 ALA A O   1 
ATOM 355  C CB  . ALA A 1 63  ? -41.973 20.186  59.697  1.00 123.21 ? 280 ALA A CB  1 
ATOM 356  N N   . VAL A 1 64  ? -40.109 22.490  61.036  1.00 113.76 ? 281 VAL A N   1 
ATOM 357  C CA  . VAL A 1 64  ? -39.029 23.484  60.962  1.00 110.86 ? 281 VAL A CA  1 
ATOM 358  C C   . VAL A 1 64  ? -38.047 23.166  62.093  1.00 112.03 ? 281 VAL A C   1 
ATOM 359  O O   . VAL A 1 64  ? -36.841 23.108  61.860  1.00 109.06 ? 281 VAL A O   1 
ATOM 360  C CB  . VAL A 1 64  ? -39.558 24.941  61.065  1.00 115.90 ? 281 VAL A CB  1 
ATOM 361  C CG1 . VAL A 1 64  ? -38.431 25.959  60.936  1.00 114.26 ? 281 VAL A CG1 1 
ATOM 362  C CG2 . VAL A 1 64  ? -40.645 25.214  60.037  1.00 118.20 ? 281 VAL A CG2 1 
ATOM 363  N N   . ALA A 1 65  ? -38.583 22.911  63.300  1.00 110.09 ? 282 ALA A N   1 
ATOM 364  C CA  . ALA A 1 65  ? -37.803 22.554  64.485  1.00 108.85 ? 282 ALA A CA  1 
ATOM 365  C C   . ALA A 1 65  ? -36.980 21.285  64.239  1.00 111.26 ? 282 ALA A C   1 
ATOM 366  O O   . ALA A 1 65  ? -35.766 21.314  64.457  1.00 109.62 ? 282 ALA A O   1 
ATOM 367  C CB  . ALA A 1 65  ? -38.713 22.379  65.697  1.00 111.09 ? 282 ALA A CB  1 
ATOM 368  N N   . ALA A 1 66  ? -37.624 20.203  63.733  1.00 108.11 ? 283 ALA A N   1 
ATOM 369  C CA  . ALA A 1 66  ? -36.976 18.923  63.425  1.00 106.94 ? 283 ALA A CA  1 
ATOM 370  C C   . ALA A 1 66  ? -35.823 19.108  62.408  1.00 110.79 ? 283 ALA A C   1 
ATOM 371  O O   . ALA A 1 66  ? -34.738 18.541  62.598  1.00 109.38 ? 283 ALA A O   1 
ATOM 372  C CB  . ALA A 1 66  ? -38.000 17.925  62.902  1.00 109.81 ? 283 ALA A CB  1 
ATOM 373  N N   . THR A 1 67  ? -36.046 19.954  61.370  1.00 107.45 ? 284 THR A N   1 
ATOM 374  C CA  . THR A 1 67  ? -35.056 20.255  60.327  1.00 106.05 ? 284 THR A CA  1 
ATOM 375  C C   . THR A 1 67  ? -33.880 21.087  60.879  1.00 107.86 ? 284 THR A C   1 
ATOM 376  O O   . THR A 1 67  ? -32.719 20.803  60.554  1.00 107.01 ? 284 THR A O   1 
ATOM 377  C CB  . THR A 1 67  ? -35.750 20.799  59.067  1.00 108.40 ? 284 THR A CB  1 
ATOM 378  O OG1 . THR A 1 67  ? -36.686 19.817  58.625  1.00 107.87 ? 284 THR A OG1 1 
ATOM 379  C CG2 . THR A 1 67  ? -34.780 21.096  57.943  1.00 104.16 ? 284 THR A CG2 1 
ATOM 380  N N   . LEU A 1 68  ? -34.179 22.070  61.746  1.00 103.30 ? 285 LEU A N   1 
ATOM 381  C CA  . LEU A 1 68  ? -33.153 22.902  62.380  1.00 102.10 ? 285 LEU A CA  1 
ATOM 382  C C   . LEU A 1 68  ? -32.223 22.057  63.270  1.00 103.49 ? 285 LEU A C   1 
ATOM 383  O O   . LEU A 1 68  ? -31.006 22.252  63.232  1.00 102.57 ? 285 LEU A O   1 
ATOM 384  C CB  . LEU A 1 68  ? -33.781 24.049  63.192  1.00 102.68 ? 285 LEU A CB  1 
ATOM 385  C CG  . LEU A 1 68  ? -34.408 25.190  62.396  1.00 107.77 ? 285 LEU A CG  1 
ATOM 386  C CD1 . LEU A 1 68  ? -35.402 25.927  63.230  1.00 108.52 ? 285 LEU A CD1 1 
ATOM 387  C CD2 . LEU A 1 68  ? -33.369 26.154  61.900  1.00 110.28 ? 285 LEU A CD2 1 
ATOM 388  N N   . ASN A 1 69  ? -32.802 21.095  64.028  1.00 98.80  ? 286 ASN A N   1 
ATOM 389  C CA  . ASN A 1 69  ? -32.075 20.165  64.901  1.00 97.76  ? 286 ASN A CA  1 
ATOM 390  C C   . ASN A 1 69  ? -31.148 19.289  64.071  1.00 100.98 ? 286 ASN A C   1 
ATOM 391  O O   . ASN A 1 69  ? -29.983 19.125  64.421  1.00 99.17  ? 286 ASN A O   1 
ATOM 392  C CB  . ASN A 1 69  ? -33.054 19.273  65.685  1.00 99.15  ? 286 ASN A CB  1 
ATOM 393  C CG  . ASN A 1 69  ? -32.392 18.103  66.384  1.00 109.12 ? 286 ASN A CG  1 
ATOM 394  O OD1 . ASN A 1 69  ? -31.777 18.249  67.447  1.00 100.88 ? 286 ASN A OD1 1 
ATOM 395  N ND2 . ASN A 1 69  ? -32.501 16.918  65.793  1.00 94.89  ? 286 ASN A ND2 1 
ATOM 396  N N   . ASN A 1 70  ? -31.687 18.711  62.982  1.00 98.88  ? 287 ASN A N   1 
ATOM 397  C CA  . ASN A 1 70  ? -30.958 17.838  62.080  1.00 98.97  ? 287 ASN A CA  1 
ATOM 398  C C   . ASN A 1 70  ? -29.834 18.584  61.403  1.00 104.08 ? 287 ASN A C   1 
ATOM 399  O O   . ASN A 1 70  ? -28.726 18.048  61.316  1.00 104.90 ? 287 ASN A O   1 
ATOM 400  C CB  . ASN A 1 70  ? -31.903 17.162  61.114  1.00 100.62 ? 287 ASN A CB  1 
ATOM 401  C CG  . ASN A 1 70  ? -32.769 16.124  61.793  1.00 127.96 ? 287 ASN A CG  1 
ATOM 402  O OD1 . ASN A 1 70  ? -32.425 15.563  62.846  1.00 114.81 ? 287 ASN A OD1 1 
ATOM 403  N ND2 . ASN A 1 70  ? -33.919 15.842  61.204  1.00 128.83 ? 287 ASN A ND2 1 
ATOM 404  N N   . LEU A 1 71  ? -30.074 19.860  61.036  1.00 100.39 ? 288 LEU A N   1 
ATOM 405  C CA  . LEU A 1 71  ? -29.021 20.720  60.500  1.00 100.97 ? 288 LEU A CA  1 
ATOM 406  C C   . LEU A 1 71  ? -27.932 20.936  61.570  1.00 105.24 ? 288 LEU A C   1 
ATOM 407  O O   . LEU A 1 71  ? -26.753 20.851  61.236  1.00 107.17 ? 288 LEU A O   1 
ATOM 408  C CB  . LEU A 1 71  ? -29.579 22.065  60.021  1.00 101.77 ? 288 LEU A CB  1 
ATOM 409  C CG  . LEU A 1 71  ? -30.148 22.084  58.608  1.00 106.39 ? 288 LEU A CG  1 
ATOM 410  C CD1 . LEU A 1 71  ? -31.107 23.220  58.447  1.00 106.82 ? 288 LEU A CD1 1 
ATOM 411  C CD2 . LEU A 1 71  ? -29.054 22.191  57.576  1.00 109.17 ? 288 LEU A CD2 1 
ATOM 412  N N   . ALA A 1 72  ? -28.324 21.130  62.861  1.00 99.63  ? 289 ALA A N   1 
ATOM 413  C CA  . ALA A 1 72  ? -27.391 21.287  63.986  1.00 98.33  ? 289 ALA A CA  1 
ATOM 414  C C   . ALA A 1 72  ? -26.595 19.998  64.221  1.00 101.92 ? 289 ALA A C   1 
ATOM 415  O O   . ALA A 1 72  ? -25.398 20.076  64.515  1.00 102.47 ? 289 ALA A O   1 
ATOM 416  C CB  . ALA A 1 72  ? -28.134 21.697  65.247  1.00 97.76  ? 289 ALA A CB  1 
ATOM 417  N N   . VAL A 1 73  ? -27.248 18.816  64.037  1.00 97.76  ? 290 VAL A N   1 
ATOM 418  C CA  . VAL A 1 73  ? -26.618 17.491  64.172  1.00 97.62  ? 290 VAL A CA  1 
ATOM 419  C C   . VAL A 1 73  ? -25.461 17.410  63.172  1.00 104.14 ? 290 VAL A C   1 
ATOM 420  O O   . VAL A 1 73  ? -24.350 17.051  63.553  1.00 103.73 ? 290 VAL A O   1 
ATOM 421  C CB  . VAL A 1 73  ? -27.621 16.311  63.989  1.00 100.70 ? 290 VAL A CB  1 
ATOM 422  C CG1 . VAL A 1 73  ? -26.891 14.976  63.889  1.00 100.93 ? 290 VAL A CG1 1 
ATOM 423  C CG2 . VAL A 1 73  ? -28.643 16.262  65.116  1.00 99.70  ? 290 VAL A CG2 1 
ATOM 424  N N   . LEU A 1 74  ? -25.724 17.802  61.910  1.00 103.64 ? 291 LEU A N   1 
ATOM 425  C CA  . LEU A 1 74  ? -24.747 17.792  60.827  1.00 106.37 ? 291 LEU A CA  1 
ATOM 426  C C   . LEU A 1 74  ? -23.637 18.809  61.012  1.00 115.92 ? 291 LEU A C   1 
ATOM 427  O O   . LEU A 1 74  ? -22.481 18.465  60.752  1.00 118.55 ? 291 LEU A O   1 
ATOM 428  C CB  . LEU A 1 74  ? -25.417 17.940  59.462  1.00 106.85 ? 291 LEU A CB  1 
ATOM 429  C CG  . LEU A 1 74  ? -26.392 16.825  59.062  1.00 110.69 ? 291 LEU A CG  1 
ATOM 430  C CD1 . LEU A 1 74  ? -27.192 17.239  57.847  1.00 111.05 ? 291 LEU A CD1 1 
ATOM 431  C CD2 . LEU A 1 74  ? -25.668 15.493  58.816  1.00 114.38 ? 291 LEU A CD2 1 
ATOM 432  N N   . TYR A 1 75  ? -23.959 20.039  61.497  1.00 114.07 ? 292 TYR A N   1 
ATOM 433  C CA  . TYR A 1 75  ? -22.942 21.068  61.771  1.00 116.78 ? 292 TYR A CA  1 
ATOM 434  C C   . TYR A 1 75  ? -21.986 20.574  62.849  1.00 119.91 ? 292 TYR A C   1 
ATOM 435  O O   . TYR A 1 75  ? -20.782 20.795  62.733  1.00 122.55 ? 292 TYR A O   1 
ATOM 436  C CB  . TYR A 1 75  ? -23.555 22.433  62.154  1.00 118.94 ? 292 TYR A CB  1 
ATOM 437  C CG  . TYR A 1 75  ? -23.822 23.355  60.977  1.00 124.51 ? 292 TYR A CG  1 
ATOM 438  C CD1 . TYR A 1 75  ? -25.020 23.290  60.273  1.00 125.01 ? 292 TYR A CD1 1 
ATOM 439  C CD2 . TYR A 1 75  ? -22.888 24.313  60.586  1.00 129.80 ? 292 TYR A CD2 1 
ATOM 440  C CE1 . TYR A 1 75  ? -25.280 24.143  59.202  1.00 127.97 ? 292 TYR A CE1 1 
ATOM 441  C CE2 . TYR A 1 75  ? -23.129 25.163  59.503  1.00 133.36 ? 292 TYR A CE2 1 
ATOM 442  C CZ  . TYR A 1 75  ? -24.333 25.082  58.819  1.00 141.59 ? 292 TYR A CZ  1 
ATOM 443  O OH  . TYR A 1 75  ? -24.584 25.903  57.738  1.00 146.57 ? 292 TYR A OH  1 
ATOM 444  N N   . GLY A 1 76  ? -22.529 19.862  63.841  1.00 113.35 ? 293 GLY A N   1 
ATOM 445  C CA  . GLY A 1 76  ? -21.773 19.263  64.937  1.00 112.71 ? 293 GLY A CA  1 
ATOM 446  C C   . GLY A 1 76  ? -20.856 18.138  64.491  1.00 117.35 ? 293 GLY A C   1 
ATOM 447  O O   . GLY A 1 76  ? -19.761 17.982  65.032  1.00 118.32 ? 293 GLY A O   1 
ATOM 448  N N   . LYS A 1 77  ? -21.293 17.353  63.484  1.00 113.92 ? 294 LYS A N   1 
ATOM 449  C CA  . LYS A 1 77  ? -20.528 16.247  62.887  1.00 115.32 ? 294 LYS A CA  1 
ATOM 450  C C   . LYS A 1 77  ? -19.252 16.786  62.224  1.00 122.53 ? 294 LYS A C   1 
ATOM 451  O O   . LYS A 1 77  ? -18.244 16.081  62.158  1.00 124.71 ? 294 LYS A O   1 
ATOM 452  C CB  . LYS A 1 77  ? -21.377 15.511  61.827  1.00 116.88 ? 294 LYS A CB  1 
ATOM 453  C CG  . LYS A 1 77  ? -22.409 14.529  62.373  1.00 128.91 ? 294 LYS A CG  1 
ATOM 454  C CD  . LYS A 1 77  ? -21.781 13.193  62.742  1.00 141.99 ? 294 LYS A CD  1 
ATOM 455  C CE  . LYS A 1 77  ? -22.808 12.165  63.131  1.00 155.73 ? 294 LYS A CE  1 
ATOM 456  N NZ  . LYS A 1 77  ? -22.181 10.839  63.354  1.00 171.33 ? 294 LYS A NZ  1 
ATOM 457  N N   . ARG A 1 78  ? -19.314 18.037  61.728  1.00 119.68 ? 295 ARG A N   1 
ATOM 458  C CA  . ARG A 1 78  ? -18.226 18.762  61.067  1.00 123.58 ? 295 ARG A CA  1 
ATOM 459  C C   . ARG A 1 78  ? -17.349 19.559  62.060  1.00 130.15 ? 295 ARG A C   1 
ATOM 460  O O   . ARG A 1 78  ? -16.383 20.204  61.639  1.00 134.58 ? 295 ARG A O   1 
ATOM 461  C CB  . ARG A 1 78  ? -18.798 19.706  59.988  1.00 123.67 ? 295 ARG A CB  1 
ATOM 462  C CG  . ARG A 1 78  ? -19.220 19.012  58.701  1.00 130.77 ? 295 ARG A CG  1 
ATOM 463  C CD  . ARG A 1 78  ? -18.895 19.857  57.488  1.00 144.60 ? 295 ARG A CD  1 
ATOM 464  N NE  . ARG A 1 78  ? -19.736 21.054  57.411  1.00 158.48 ? 295 ARG A NE  1 
ATOM 465  C CZ  . ARG A 1 78  ? -19.341 22.218  56.905  1.00 179.18 ? 295 ARG A CZ  1 
ATOM 466  N NH1 . ARG A 1 78  ? -18.108 22.361  56.433  1.00 170.66 ? 295 ARG A NH1 1 
ATOM 467  N NH2 . ARG A 1 78  ? -20.174 23.250  56.872  1.00 168.11 ? 295 ARG A NH2 1 
ATOM 468  N N   . GLY A 1 79  ? -17.701 19.512  63.347  1.00 123.85 ? 296 GLY A N   1 
ATOM 469  C CA  . GLY A 1 79  ? -16.995 20.213  64.419  1.00 125.02 ? 296 GLY A CA  1 
ATOM 470  C C   . GLY A 1 79  ? -17.321 21.693  64.522  1.00 128.01 ? 296 GLY A C   1 
ATOM 471  O O   . GLY A 1 79  ? -16.654 22.427  65.260  1.00 130.07 ? 296 GLY A O   1 
ATOM 472  N N   . LYS A 1 80  ? -18.363 22.136  63.794  1.00 121.49 ? 297 LYS A N   1 
ATOM 473  C CA  . LYS A 1 80  ? -18.820 23.524  63.724  1.00 122.28 ? 297 LYS A CA  1 
ATOM 474  C C   . LYS A 1 80  ? -19.862 23.824  64.821  1.00 122.31 ? 297 LYS A C   1 
ATOM 475  O O   . LYS A 1 80  ? -20.993 24.219  64.529  1.00 119.52 ? 297 LYS A O   1 
ATOM 476  C CB  . LYS A 1 80  ? -19.361 23.821  62.304  1.00 125.73 ? 297 LYS A CB  1 
ATOM 477  C CG  . LYS A 1 80  ? -18.281 24.016  61.244  1.00 145.32 ? 297 LYS A CG  1 
ATOM 478  C CD  . LYS A 1 80  ? -18.875 24.348  59.877  1.00 157.72 ? 297 LYS A CD  1 
ATOM 479  C CE  . LYS A 1 80  ? -18.855 25.826  59.553  1.00 173.50 ? 297 LYS A CE  1 
ATOM 480  N NZ  . LYS A 1 80  ? -19.421 26.110  58.209  1.00 182.79 ? 297 LYS A NZ  1 
ATOM 481  N N   . TYR A 1 81  ? -19.455 23.643  66.088  1.00 119.52 ? 298 TYR A N   1 
ATOM 482  C CA  . TYR A 1 81  ? -20.293 23.804  67.278  1.00 117.24 ? 298 TYR A CA  1 
ATOM 483  C C   . TYR A 1 81  ? -20.850 25.206  67.530  1.00 122.65 ? 298 TYR A C   1 
ATOM 484  O O   . TYR A 1 81  ? -22.032 25.321  67.865  1.00 120.35 ? 298 TYR A O   1 
ATOM 485  C CB  . TYR A 1 81  ? -19.602 23.246  68.532  1.00 118.82 ? 298 TYR A CB  1 
ATOM 486  C CG  . TYR A 1 81  ? -19.011 21.864  68.354  1.00 120.81 ? 298 TYR A CG  1 
ATOM 487  C CD1 . TYR A 1 81  ? -19.820 20.769  68.073  1.00 119.86 ? 298 TYR A CD1 1 
ATOM 488  C CD2 . TYR A 1 81  ? -17.644 21.646  68.495  1.00 125.10 ? 298 TYR A CD2 1 
ATOM 489  C CE1 . TYR A 1 81  ? -19.280 19.495  67.898  1.00 121.09 ? 298 TYR A CE1 1 
ATOM 490  C CE2 . TYR A 1 81  ? -17.092 20.373  68.337  1.00 126.10 ? 298 TYR A CE2 1 
ATOM 491  C CZ  . TYR A 1 81  ? -17.913 19.301  68.025  1.00 130.39 ? 298 TYR A CZ  1 
ATOM 492  O OH  . TYR A 1 81  ? -17.376 18.044  67.854  1.00 130.99 ? 298 TYR A OH  1 
ATOM 493  N N   . LYS A 1 82  ? -20.019 26.262  67.377  1.00 132.51 ? 299 LYS A N   1 
ATOM 494  C CA  . LYS A 1 82  ? -20.426 27.660  67.587  1.00 130.83 ? 299 LYS A CA  1 
ATOM 495  C C   . LYS A 1 82  ? -21.585 28.085  66.676  1.00 134.13 ? 299 LYS A C   1 
ATOM 496  O O   . LYS A 1 82  ? -22.422 28.886  67.092  1.00 131.41 ? 299 LYS A O   1 
ATOM 497  C CB  . LYS A 1 82  ? -19.233 28.623  67.440  1.00 136.48 ? 299 LYS A CB  1 
ATOM 498  C CG  . LYS A 1 82  ? -18.346 28.703  68.679  1.00 148.23 ? 299 LYS A CG  1 
ATOM 499  C CD  . LYS A 1 82  ? -17.329 29.843  68.590  1.00 159.28 ? 299 LYS A CD  1 
ATOM 500  C CE  . LYS A 1 82  ? -16.498 29.972  69.848  1.00 165.10 ? 299 LYS A CE  1 
ATOM 501  N NZ  . LYS A 1 82  ? -15.610 31.167  69.804  1.00 170.88 ? 299 LYS A NZ  1 
ATOM 502  N N   . GLU A 1 83  ? -21.638 27.531  65.452  1.00 133.04 ? 300 GLU A N   1 
ATOM 503  C CA  . GLU A 1 83  ? -22.689 27.809  64.468  1.00 132.30 ? 300 GLU A CA  1 
ATOM 504  C C   . GLU A 1 83  ? -23.839 26.794  64.491  1.00 132.32 ? 300 GLU A C   1 
ATOM 505  O O   . GLU A 1 83  ? -24.866 27.017  63.850  1.00 131.41 ? 300 GLU A O   1 
ATOM 506  C CB  . GLU A 1 83  ? -22.130 28.038  63.046  1.00 137.91 ? 300 GLU A CB  1 
ATOM 507  C CG  . GLU A 1 83  ? -21.095 27.032  62.573  1.00 157.38 ? 300 GLU A CG  1 
ATOM 508  C CD  . GLU A 1 83  ? -19.665 27.343  62.975  1.00 191.78 ? 300 GLU A CD  1 
ATOM 509  O OE1 . GLU A 1 83  ? -19.277 27.000  64.117  1.00 186.39 ? 300 GLU A OE1 1 
ATOM 510  O OE2 . GLU A 1 83  ? -18.928 27.922  62.143  1.00 195.00 ? 300 GLU A OE2 1 
ATOM 511  N N   . ALA A 1 84  ? -23.679 25.703  65.243  1.00 126.68 ? 301 ALA A N   1 
ATOM 512  C CA  . ALA A 1 84  ? -24.703 24.677  65.411  1.00 123.74 ? 301 ALA A CA  1 
ATOM 513  C C   . ALA A 1 84  ? -25.628 25.075  66.563  1.00 123.81 ? 301 ALA A C   1 
ATOM 514  O O   . ALA A 1 84  ? -26.802 24.702  66.570  1.00 121.28 ? 301 ALA A O   1 
ATOM 515  C CB  . ALA A 1 84  ? -24.053 23.336  65.699  1.00 125.78 ? 301 ALA A CB  1 
ATOM 516  N N   . GLU A 1 85  ? -25.078 25.832  67.540  1.00 119.90 ? 302 GLU A N   1 
ATOM 517  C CA  . GLU A 1 85  ? -25.774 26.352  68.718  1.00 116.78 ? 302 GLU A CA  1 
ATOM 518  C C   . GLU A 1 85  ? -26.989 27.258  68.354  1.00 117.93 ? 302 GLU A C   1 
ATOM 519  O O   . GLU A 1 85  ? -28.060 26.989  68.882  1.00 115.70 ? 302 GLU A O   1 
ATOM 520  C CB  . GLU A 1 85  ? -24.784 27.049  69.685  1.00 118.97 ? 302 GLU A CB  1 
ATOM 521  C CG  . GLU A 1 85  ? -25.221 27.018  71.147  1.00 129.22 ? 302 GLU A CG  1 
ATOM 522  C CD  . GLU A 1 85  ? -24.189 27.336  72.218  1.00 152.73 ? 302 GLU A CD  1 
ATOM 523  O OE1 . GLU A 1 85  ? -22.974 27.196  71.947  1.00 150.78 ? 302 GLU A OE1 1 
ATOM 524  O OE2 . GLU A 1 85  ? -24.603 27.671  73.353  1.00 146.26 ? 302 GLU A OE2 1 
ATOM 525  N N   . PRO A 1 86  ? -26.906 28.272  67.443  1.00 115.49 ? 303 PRO A N   1 
ATOM 526  C CA  . PRO A 1 86  ? -28.103 29.081  67.143  1.00 114.23 ? 303 PRO A CA  1 
ATOM 527  C C   . PRO A 1 86  ? -29.263 28.285  66.560  1.00 117.01 ? 303 PRO A C   1 
ATOM 528  O O   . PRO A 1 86  ? -30.413 28.603  66.850  1.00 115.84 ? 303 PRO A O   1 
ATOM 529  C CB  . PRO A 1 86  ? -27.598 30.112  66.126  1.00 117.79 ? 303 PRO A CB  1 
ATOM 530  C CG  . PRO A 1 86  ? -26.135 30.134  66.283  1.00 124.08 ? 303 PRO A CG  1 
ATOM 531  C CD  . PRO A 1 86  ? -25.746 28.752  66.663  1.00 119.48 ? 303 PRO A CD  1 
ATOM 532  N N   . LEU A 1 87  ? -28.956 27.254  65.748  1.00 113.72 ? 304 LEU A N   1 
ATOM 533  C CA  . LEU A 1 87  ? -29.934 26.379  65.104  1.00 112.52 ? 304 LEU A CA  1 
ATOM 534  C C   . LEU A 1 87  ? -30.701 25.590  66.139  1.00 115.11 ? 304 LEU A C   1 
ATOM 535  O O   . LEU A 1 87  ? -31.928 25.544  66.092  1.00 113.81 ? 304 LEU A O   1 
ATOM 536  C CB  . LEU A 1 87  ? -29.240 25.420  64.125  1.00 113.92 ? 304 LEU A CB  1 
ATOM 537  C CG  . LEU A 1 87  ? -28.867 26.001  62.770  1.00 119.75 ? 304 LEU A CG  1 
ATOM 538  C CD1 . LEU A 1 87  ? -27.464 25.641  62.414  1.00 122.30 ? 304 LEU A CD1 1 
ATOM 539  C CD2 . LEU A 1 87  ? -29.782 25.489  61.699  1.00 121.12 ? 304 LEU A CD2 1 
ATOM 540  N N   . CYS A 1 88  ? -29.975 24.996  67.092  1.00 112.85 ? 305 CYS A N   1 
ATOM 541  C CA  . CYS A 1 88  ? -30.537 24.193  68.168  1.00 111.95 ? 305 CYS A CA  1 
ATOM 542  C C   . CYS A 1 88  ? -31.355 25.038  69.138  1.00 113.65 ? 305 CYS A C   1 
ATOM 543  O O   . CYS A 1 88  ? -32.429 24.609  69.564  1.00 112.20 ? 305 CYS A O   1 
ATOM 544  C CB  . CYS A 1 88  ? -29.435 23.421  68.876  1.00 113.29 ? 305 CYS A CB  1 
ATOM 545  S SG  . CYS A 1 88  ? -29.754 21.647  68.999  1.00 117.99 ? 305 CYS A SG  1 
ATOM 546  N N   . LYS A 1 89  ? -30.866 26.259  69.439  1.00 110.31 ? 306 LYS A N   1 
ATOM 547  C CA  . LYS A 1 89  ? -31.525 27.226  70.314  1.00 110.19 ? 306 LYS A CA  1 
ATOM 548  C C   . LYS A 1 89  ? -32.831 27.709  69.689  1.00 116.07 ? 306 LYS A C   1 
ATOM 549  O O   . LYS A 1 89  ? -33.811 27.900  70.412  1.00 117.79 ? 306 LYS A O   1 
ATOM 550  C CB  . LYS A 1 89  ? -30.603 28.415  70.641  1.00 112.69 ? 306 LYS A CB  1 
ATOM 551  C CG  . LYS A 1 89  ? -29.612 28.134  71.775  1.00 118.26 ? 306 LYS A CG  1 
ATOM 552  C CD  . LYS A 1 89  ? -28.725 29.330  72.095  1.00 125.73 ? 306 LYS A CD  1 
ATOM 553  C CE  . LYS A 1 89  ? -27.834 29.043  73.279  1.00 142.59 ? 306 LYS A CE  1 
ATOM 554  N NZ  . LYS A 1 89  ? -26.946 30.187  73.606  1.00 154.33 ? 306 LYS A NZ  1 
ATOM 555  N N   . ARG A 1 90  ? -32.854 27.881  68.350  1.00 111.66 ? 307 ARG A N   1 
ATOM 556  C CA  . ARG A 1 90  ? -34.045 28.308  67.623  1.00 111.19 ? 307 ARG A CA  1 
ATOM 557  C C   . ARG A 1 90  ? -35.100 27.206  67.611  1.00 113.50 ? 307 ARG A C   1 
ATOM 558  O O   . ARG A 1 90  ? -36.279 27.514  67.752  1.00 114.31 ? 307 ARG A O   1 
ATOM 559  C CB  . ARG A 1 90  ? -33.705 28.723  66.190  1.00 112.66 ? 307 ARG A CB  1 
ATOM 560  C CG  . ARG A 1 90  ? -34.714 29.701  65.606  1.00 124.17 ? 307 ARG A CG  1 
ATOM 561  C CD  . ARG A 1 90  ? -34.538 29.869  64.116  1.00 136.05 ? 307 ARG A CD  1 
ATOM 562  N NE  . ARG A 1 90  ? -35.760 29.500  63.404  1.00 142.56 ? 307 ARG A NE  1 
ATOM 563  C CZ  . ARG A 1 90  ? -35.913 29.557  62.087  1.00 147.33 ? 307 ARG A CZ  1 
ATOM 564  N NH1 . ARG A 1 90  ? -34.915 29.973  61.314  1.00 125.66 ? 307 ARG A NH1 1 
ATOM 565  N NH2 . ARG A 1 90  ? -37.057 29.190  61.531  1.00 133.41 ? 307 ARG A NH2 1 
ATOM 566  N N   . ALA A 1 91  ? -34.676 25.931  67.448  1.00 108.06 ? 308 ALA A N   1 
ATOM 567  C CA  . ALA A 1 91  ? -35.564 24.764  67.420  1.00 107.23 ? 308 ALA A CA  1 
ATOM 568  C C   . ALA A 1 91  ? -36.211 24.559  68.776  1.00 110.87 ? 308 ALA A C   1 
ATOM 569  O O   . ALA A 1 91  ? -37.384 24.201  68.850  1.00 111.30 ? 308 ALA A O   1 
ATOM 570  C CB  . ALA A 1 91  ? -34.789 23.521  67.019  1.00 107.72 ? 308 ALA A CB  1 
ATOM 571  N N   . LEU A 1 92  ? -35.457 24.817  69.848  1.00 106.85 ? 309 LEU A N   1 
ATOM 572  C CA  . LEU A 1 92  ? -35.953 24.707  71.212  1.00 107.33 ? 309 LEU A CA  1 
ATOM 573  C C   . LEU A 1 92  ? -37.056 25.754  71.453  1.00 114.84 ? 309 LEU A C   1 
ATOM 574  O O   . LEU A 1 92  ? -38.116 25.415  71.984  1.00 116.68 ? 309 LEU A O   1 
ATOM 575  C CB  . LEU A 1 92  ? -34.789 24.889  72.200  1.00 106.34 ? 309 LEU A CB  1 
ATOM 576  C CG  . LEU A 1 92  ? -35.145 24.944  73.671  1.00 111.52 ? 309 LEU A CG  1 
ATOM 577  C CD1 . LEU A 1 92  ? -35.336 23.564  74.238  1.00 111.80 ? 309 LEU A CD1 1 
ATOM 578  C CD2 . LEU A 1 92  ? -34.079 25.661  74.449  1.00 114.71 ? 309 LEU A CD2 1 
ATOM 579  N N   . GLU A 1 93  ? -36.808 27.011  71.029  1.00 111.71 ? 310 GLU A N   1 
ATOM 580  C CA  . GLU A 1 93  ? -37.726 28.137  71.189  1.00 113.27 ? 310 GLU A CA  1 
ATOM 581  C C   . GLU A 1 93  ? -39.067 27.896  70.508  1.00 117.50 ? 310 GLU A C   1 
ATOM 582  O O   . GLU A 1 93  ? -40.109 28.225  71.075  1.00 119.56 ? 310 GLU A O   1 
ATOM 583  C CB  . GLU A 1 93  ? -37.061 29.458  70.756  1.00 114.86 ? 310 GLU A CB  1 
ATOM 584  C CG  . GLU A 1 93  ? -36.840 30.450  71.899  1.00 132.49 ? 310 GLU A CG  1 
ATOM 585  C CD  . GLU A 1 93  ? -36.144 29.985  73.175  1.00 161.46 ? 310 GLU A CD  1 
ATOM 586  O OE1 . GLU A 1 93  ? -35.137 29.243  73.085  1.00 154.08 ? 310 GLU A OE1 1 
ATOM 587  O OE2 . GLU A 1 93  ? -36.589 30.399  74.271  1.00 159.95 ? 310 GLU A OE2 1 
ATOM 588  N N   . ILE A 1 94  ? -39.034 27.255  69.331  1.00 112.55 ? 311 ILE A N   1 
ATOM 589  C CA  . ILE A 1 94  ? -40.202 26.856  68.543  1.00 112.65 ? 311 ILE A CA  1 
ATOM 590  C C   . ILE A 1 94  ? -40.981 25.807  69.345  1.00 116.55 ? 311 ILE A C   1 
ATOM 591  O O   . ILE A 1 94  ? -42.180 25.981  69.568  1.00 118.54 ? 311 ILE A O   1 
ATOM 592  C CB  . ILE A 1 94  ? -39.744 26.327  67.151  1.00 114.08 ? 311 ILE A CB  1 
ATOM 593  C CG1 . ILE A 1 94  ? -39.267 27.491  66.266  1.00 114.61 ? 311 ILE A CG1 1 
ATOM 594  C CG2 . ILE A 1 94  ? -40.840 25.501  66.460  1.00 115.23 ? 311 ILE A CG2 1 
ATOM 595  C CD1 . ILE A 1 94  ? -38.351 27.122  65.119  1.00 126.20 ? 311 ILE A CD1 1 
ATOM 596  N N   . ARG A 1 95  ? -40.278 24.747  69.799  1.00 111.16 ? 312 ARG A N   1 
ATOM 597  C CA  . ARG A 1 95  ? -40.830 23.637  70.574  1.00 112.41 ? 312 ARG A CA  1 
ATOM 598  C C   . ARG A 1 95  ? -41.517 24.094  71.878  1.00 119.39 ? 312 ARG A C   1 
ATOM 599  O O   . ARG A 1 95  ? -42.596 23.596  72.203  1.00 120.64 ? 312 ARG A O   1 
ATOM 600  C CB  . ARG A 1 95  ? -39.746 22.582  70.845  1.00 110.13 ? 312 ARG A CB  1 
ATOM 601  C CG  . ARG A 1 95  ? -39.412 21.737  69.634  1.00 113.66 ? 312 ARG A CG  1 
ATOM 602  C CD  . ARG A 1 95  ? -38.565 20.539  69.995  1.00 123.13 ? 312 ARG A CD  1 
ATOM 603  N NE  . ARG A 1 95  ? -38.732 19.471  69.010  1.00 134.81 ? 312 ARG A NE  1 
ATOM 604  C CZ  . ARG A 1 95  ? -37.894 19.228  68.007  1.00 143.59 ? 312 ARG A CZ  1 
ATOM 605  N NH1 . ARG A 1 95  ? -36.792 19.951  67.863  1.00 132.53 ? 312 ARG A NH1 1 
ATOM 606  N NH2 . ARG A 1 95  ? -38.150 18.257  67.143  1.00 123.31 ? 312 ARG A NH2 1 
ATOM 607  N N   . GLU A 1 96  ? -40.906 25.061  72.593  1.00 116.92 ? 313 GLU A N   1 
ATOM 608  C CA  . GLU A 1 96  ? -41.453 25.634  73.825  1.00 120.24 ? 313 GLU A CA  1 
ATOM 609  C C   . GLU A 1 96  ? -42.733 26.449  73.535  1.00 127.77 ? 313 GLU A C   1 
ATOM 610  O O   . GLU A 1 96  ? -43.670 26.414  74.342  1.00 131.47 ? 313 GLU A O   1 
ATOM 611  C CB  . GLU A 1 96  ? -40.408 26.518  74.541  1.00 120.90 ? 313 GLU A CB  1 
ATOM 612  C CG  . GLU A 1 96  ? -39.364 25.758  75.350  1.00 128.75 ? 313 GLU A CG  1 
ATOM 613  C CD  . GLU A 1 96  ? -38.133 26.541  75.785  1.00 141.49 ? 313 GLU A CD  1 
ATOM 614  O OE1 . GLU A 1 96  ? -37.842 27.592  75.168  1.00 133.89 ? 313 GLU A OE1 1 
ATOM 615  O OE2 . GLU A 1 96  ? -37.433 26.080  76.715  1.00 125.40 ? 313 GLU A OE2 1 
ATOM 616  N N   . LYS A 1 97  ? -42.763 27.178  72.391  1.00 122.12 ? 314 LYS A N   1 
ATOM 617  C CA  . LYS A 1 97  ? -43.901 28.000  71.957  1.00 123.88 ? 314 LYS A CA  1 
ATOM 618  C C   . LYS A 1 97  ? -45.122 27.121  71.626  1.00 127.61 ? 314 LYS A C   1 
ATOM 619  O O   . LYS A 1 97  ? -46.219 27.384  72.113  1.00 131.11 ? 314 LYS A O   1 
ATOM 620  C CB  . LYS A 1 97  ? -43.498 28.868  70.746  1.00 125.06 ? 314 LYS A CB  1 
ATOM 621  C CG  . LYS A 1 97  ? -44.611 29.765  70.217  1.00 150.43 ? 314 LYS A CG  1 
ATOM 622  C CD  . LYS A 1 97  ? -44.290 30.385  68.858  1.00 160.34 ? 314 LYS A CD  1 
ATOM 623  C CE  . LYS A 1 97  ? -45.456 31.192  68.329  1.00 174.47 ? 314 LYS A CE  1 
ATOM 624  N NZ  . LYS A 1 97  ? -45.251 31.627  66.920  1.00 182.45 ? 314 LYS A NZ  1 
ATOM 625  N N   . VAL A 1 98  ? -44.907 26.070  70.826  1.00 120.50 ? 315 VAL A N   1 
ATOM 626  C CA  . VAL A 1 98  ? -45.923 25.129  70.345  1.00 121.17 ? 315 VAL A CA  1 
ATOM 627  C C   . VAL A 1 98  ? -46.368 24.087  71.394  1.00 125.28 ? 315 VAL A C   1 
ATOM 628  O O   . VAL A 1 98  ? -47.549 24.034  71.733  1.00 127.93 ? 315 VAL A O   1 
ATOM 629  C CB  . VAL A 1 98  ? -45.433 24.456  69.025  1.00 122.07 ? 315 VAL A CB  1 
ATOM 630  C CG1 . VAL A 1 98  ? -46.379 23.355  68.554  1.00 123.59 ? 315 VAL A CG1 1 
ATOM 631  C CG2 . VAL A 1 98  ? -45.207 25.488  67.924  1.00 120.69 ? 315 VAL A CG2 1 
ATOM 632  N N   . LEU A 1 99  ? -45.434 23.233  71.851  1.00 129.52 ? 316 LEU A N   1 
ATOM 633  C CA  . LEU A 1 99  ? -45.700 22.121  72.764  1.00 127.14 ? 316 LEU A CA  1 
ATOM 634  C C   . LEU A 1 99  ? -45.792 22.490  74.235  1.00 126.44 ? 316 LEU A C   1 
ATOM 635  O O   . LEU A 1 99  ? -46.568 21.874  74.964  1.00 127.53 ? 316 LEU A O   1 
ATOM 636  C CB  . LEU A 1 99  ? -44.656 21.000  72.582  1.00 123.36 ? 316 LEU A CB  1 
ATOM 637  C CG  . LEU A 1 99  ? -44.489 20.417  71.183  1.00 131.56 ? 316 LEU A CG  1 
ATOM 638  C CD1 . LEU A 1 99  ? -43.067 19.952  70.969  1.00 126.96 ? 316 LEU A CD1 1 
ATOM 639  C CD2 . LEU A 1 99  ? -45.476 19.288  70.929  1.00 139.28 ? 316 LEU A CD2 1 
ATOM 640  N N   . GLY A 1 100 ? -44.974 23.440  74.669  1.00 118.21 ? 317 GLY A N   1 
ATOM 641  C CA  . GLY A 1 100 ? -44.912 23.853  76.064  1.00 114.90 ? 317 GLY A CA  1 
ATOM 642  C C   . GLY A 1 100 ? -43.522 23.684  76.641  1.00 113.04 ? 317 GLY A C   1 
ATOM 643  O O   . GLY A 1 100 ? -42.737 22.865  76.158  1.00 111.24 ? 317 GLY A O   1 
ATOM 644  N N   . LYS A 1 101 ? -43.215 24.447  77.693  1.00 106.06 ? 318 LYS A N   1 
ATOM 645  C CA  . LYS A 1 101 ? -41.913 24.473  78.361  1.00 99.42  ? 318 LYS A CA  1 
ATOM 646  C C   . LYS A 1 101 ? -41.508 23.116  78.954  1.00 97.66  ? 318 LYS A C   1 
ATOM 647  O O   . LYS A 1 101 ? -40.309 22.852  79.093  1.00 94.30  ? 318 LYS A O   1 
ATOM 648  C CB  . LYS A 1 101 ? -41.951 25.554  79.451  1.00 101.43 ? 318 LYS A CB  1 
ATOM 649  C CG  . LYS A 1 101 ? -40.632 26.244  79.770  1.00 114.32 ? 318 LYS A CG  1 
ATOM 650  C CD  . LYS A 1 101 ? -40.731 26.938  81.151  1.00 126.06 ? 318 LYS A CD  1 
ATOM 651  C CE  . LYS A 1 101 ? -39.416 27.463  81.689  1.00 136.41 ? 318 LYS A CE  1 
ATOM 652  N NZ  . LYS A 1 101 ? -38.454 26.374  82.023  1.00 135.38 ? 318 LYS A NZ  1 
ATOM 653  N N   . PHE A 1 102 ? -42.493 22.262  79.303  1.00 94.56  ? 319 PHE A N   1 
ATOM 654  C CA  . PHE A 1 102 ? -42.227 20.970  79.944  1.00 91.94  ? 319 PHE A CA  1 
ATOM 655  C C   . PHE A 1 102 ? -42.685 19.768  79.141  1.00 99.69  ? 319 PHE A C   1 
ATOM 656  O O   . PHE A 1 102 ? -43.250 18.839  79.707  1.00 100.37 ? 319 PHE A O   1 
ATOM 657  C CB  . PHE A 1 102 ? -42.847 20.918  81.345  1.00 93.25  ? 319 PHE A CB  1 
ATOM 658  C CG  . PHE A 1 102 ? -42.404 21.990  82.301  1.00 92.70  ? 319 PHE A CG  1 
ATOM 659  C CD1 . PHE A 1 102 ? -41.238 21.847  83.035  1.00 93.39  ? 319 PHE A CD1 1 
ATOM 660  C CD2 . PHE A 1 102 ? -43.186 23.109  82.521  1.00 97.47  ? 319 PHE A CD2 1 
ATOM 661  C CE1 . PHE A 1 102 ? -40.856 22.820  83.964  1.00 93.73  ? 319 PHE A CE1 1 
ATOM 662  C CE2 . PHE A 1 102 ? -42.799 24.083  83.439  1.00 99.66  ? 319 PHE A CE2 1 
ATOM 663  C CZ  . PHE A 1 102 ? -41.640 23.935  84.156  1.00 94.27  ? 319 PHE A CZ  1 
ATOM 664  N N   . HIS A 1 103 ? -42.429 19.761  77.839  1.00 98.97  ? 320 HIS A N   1 
ATOM 665  C CA  . HIS A 1 103 ? -42.820 18.636  77.004  1.00 102.90 ? 320 HIS A CA  1 
ATOM 666  C C   . HIS A 1 103 ? -41.607 17.728  76.755  1.00 105.90 ? 320 HIS A C   1 
ATOM 667  O O   . HIS A 1 103 ? -40.511 18.241  76.510  1.00 103.06 ? 320 HIS A O   1 
ATOM 668  C CB  . HIS A 1 103 ? -43.401 19.143  75.684  1.00 108.51 ? 320 HIS A CB  1 
ATOM 669  C CG  . HIS A 1 103 ? -44.082 18.084  74.877  1.00 117.41 ? 320 HIS A CG  1 
ATOM 670  N ND1 . HIS A 1 103 ? -43.369 17.244  74.040  1.00 119.07 ? 320 HIS A ND1 1 
ATOM 671  C CD2 . HIS A 1 103 ? -45.395 17.762  74.808  1.00 125.49 ? 320 HIS A CD2 1 
ATOM 672  C CE1 . HIS A 1 103 ? -44.265 16.438  73.497  1.00 124.74 ? 320 HIS A CE1 1 
ATOM 673  N NE2 . HIS A 1 103 ? -45.499 16.715  73.925  1.00 129.17 ? 320 HIS A NE2 1 
ATOM 674  N N   . PRO A 1 104 ? -41.768 16.383  76.773  1.00 104.27 ? 321 PRO A N   1 
ATOM 675  C CA  . PRO A 1 104 ? -40.615 15.495  76.522  1.00 101.31 ? 321 PRO A CA  1 
ATOM 676  C C   . PRO A 1 104 ? -39.773 15.798  75.269  1.00 105.40 ? 321 PRO A C   1 
ATOM 677  O O   . PRO A 1 104 ? -38.576 15.485  75.254  1.00 102.58 ? 321 PRO A O   1 
ATOM 678  C CB  . PRO A 1 104 ? -41.253 14.111  76.477  1.00 107.35 ? 321 PRO A CB  1 
ATOM 679  C CG  . PRO A 1 104 ? -42.430 14.235  77.366  1.00 114.63 ? 321 PRO A CG  1 
ATOM 680  C CD  . PRO A 1 104 ? -42.982 15.597  77.074  1.00 110.81 ? 321 PRO A CD  1 
ATOM 681  N N   . ASP A 1 105 ? -40.374 16.436  74.242  1.00 104.81 ? 322 ASP A N   1 
ATOM 682  C CA  . ASP A 1 105 ? -39.658 16.824  73.023  1.00 104.59 ? 322 ASP A CA  1 
ATOM 683  C C   . ASP A 1 105 ? -38.696 17.990  73.303  1.00 101.92 ? 322 ASP A C   1 
ATOM 684  O O   . ASP A 1 105 ? -37.619 18.052  72.713  1.00 100.67 ? 322 ASP A O   1 
ATOM 685  C CB  . ASP A 1 105 ? -40.634 17.160  71.868  1.00 112.58 ? 322 ASP A CB  1 
ATOM 686  C CG  . ASP A 1 105 ? -41.349 15.973  71.229  1.00 128.84 ? 322 ASP A CG  1 
ATOM 687  O OD1 . ASP A 1 105 ? -41.300 14.857  71.807  1.00 128.17 ? 322 ASP A OD1 1 
ATOM 688  O OD2 . ASP A 1 105 ? -41.973 16.164  70.160  1.00 142.71 ? 322 ASP A OD2 1 
ATOM 689  N N   . VAL A 1 106 ? -39.079 18.891  74.219  1.00 95.44  ? 323 VAL A N   1 
ATOM 690  C CA  . VAL A 1 106 ? -38.272 20.042  74.642  1.00 91.99  ? 323 VAL A CA  1 
ATOM 691  C C   . VAL A 1 106 ? -37.027 19.513  75.386  1.00 93.31  ? 323 VAL A C   1 
ATOM 692  O O   . VAL A 1 106 ? -35.925 20.049  75.210  1.00 91.83  ? 323 VAL A O   1 
ATOM 693  C CB  . VAL A 1 106 ? -39.120 21.020  75.500  1.00 95.68  ? 323 VAL A CB  1 
ATOM 694  C CG1 . VAL A 1 106 ? -38.293 22.185  76.021  1.00 93.22  ? 323 VAL A CG1 1 
ATOM 695  C CG2 . VAL A 1 106 ? -40.319 21.529  74.715  1.00 100.52 ? 323 VAL A CG2 1 
ATOM 696  N N   . ALA A 1 107 ? -37.203 18.421  76.164  1.00 87.86  ? 324 ALA A N   1 
ATOM 697  C CA  . ALA A 1 107 ? -36.118 17.763  76.887  1.00 83.43  ? 324 ALA A CA  1 
ATOM 698  C C   . ALA A 1 107 ? -35.131 17.120  75.923  1.00 83.01  ? 324 ALA A C   1 
ATOM 699  O O   . ALA A 1 107 ? -33.939 17.129  76.216  1.00 80.21  ? 324 ALA A O   1 
ATOM 700  C CB  . ALA A 1 107 ? -36.675 16.718  77.839  1.00 84.41  ? 324 ALA A CB  1 
ATOM 701  N N   . LYS A 1 108 ? -35.611 16.573  74.779  1.00 80.40  ? 325 LYS A N   1 
ATOM 702  C CA  . LYS A 1 108 ? -34.717 15.976  73.778  1.00 80.32  ? 325 LYS A CA  1 
ATOM 703  C C   . LYS A 1 108 ? -33.830 17.073  73.137  1.00 82.96  ? 325 LYS A C   1 
ATOM 704  O O   . LYS A 1 108 ? -32.630 16.837  72.926  1.00 81.44  ? 325 LYS A O   1 
ATOM 705  C CB  . LYS A 1 108 ? -35.488 15.133  72.750  1.00 86.77  ? 325 LYS A CB  1 
ATOM 706  C CG  . LYS A 1 108 ? -34.675 14.704  71.512  1.00 114.29 ? 325 LYS A CG  1 
ATOM 707  C CD  . LYS A 1 108 ? -35.070 15.529  70.216  1.00 126.59 ? 325 LYS A CD  1 
ATOM 708  C CE  . LYS A 1 108 ? -34.332 15.140  68.944  1.00 119.14 ? 325 LYS A CE  1 
ATOM 709  N NZ  . LYS A 1 108 ? -34.656 13.755  68.491  1.00 119.04 ? 325 LYS A NZ  1 
ATOM 710  N N   . GLN A 1 109 ? -34.406 18.279  72.890  1.00 79.54  ? 326 GLN A N   1 
ATOM 711  C CA  . GLN A 1 109 ? -33.651 19.417  72.361  1.00 80.09  ? 326 GLN A CA  1 
ATOM 712  C C   . GLN A 1 109 ? -32.609 19.852  73.383  1.00 84.49  ? 326 GLN A C   1 
ATOM 713  O O   . GLN A 1 109 ? -31.449 20.033  73.012  1.00 86.53  ? 326 GLN A O   1 
ATOM 714  C CB  . GLN A 1 109 ? -34.555 20.615  72.015  1.00 83.70  ? 326 GLN A CB  1 
ATOM 715  C CG  . GLN A 1 109 ? -34.986 20.738  70.550  1.00 96.30  ? 326 GLN A CG  1 
ATOM 716  C CD  . GLN A 1 109 ? -33.918 20.412  69.542  1.00 110.56 ? 326 GLN A CD  1 
ATOM 717  O OE1 . GLN A 1 109 ? -33.952 19.358  68.899  1.00 106.29 ? 326 GLN A OE1 1 
ATOM 718  N NE2 . GLN A 1 109 ? -32.937 21.290  69.407  1.00 97.53  ? 326 GLN A NE2 1 
ATOM 719  N N   . LEU A 1 110 ? -33.014 19.988  74.675  1.00 78.17  ? 327 LEU A N   1 
ATOM 720  C CA  . LEU A 1 110 ? -32.134 20.381  75.772  1.00 75.03  ? 327 LEU A CA  1 
ATOM 721  C C   . LEU A 1 110 ? -30.912 19.456  75.891  1.00 79.14  ? 327 LEU A C   1 
ATOM 722  O O   . LEU A 1 110 ? -29.783 19.946  76.012  1.00 80.34  ? 327 LEU A O   1 
ATOM 723  C CB  . LEU A 1 110 ? -32.910 20.447  77.079  1.00 72.98  ? 327 LEU A CB  1 
ATOM 724  C CG  . LEU A 1 110 ? -33.883 21.608  77.215  1.00 78.29  ? 327 LEU A CG  1 
ATOM 725  C CD1 . LEU A 1 110 ? -34.856 21.368  78.376  1.00 77.56  ? 327 LEU A CD1 1 
ATOM 726  C CD2 . LEU A 1 110 ? -33.156 22.930  77.373  1.00 78.22  ? 327 LEU A CD2 1 
ATOM 727  N N   . SER A 1 111 ? -31.133 18.136  75.774  1.00 74.32  ? 328 SER A N   1 
ATOM 728  C CA  . SER A 1 111 ? -30.095 17.117  75.793  1.00 74.30  ? 328 SER A CA  1 
ATOM 729  C C   . SER A 1 111 ? -29.096 17.323  74.634  1.00 83.01  ? 328 SER A C   1 
ATOM 730  O O   . SER A 1 111 ? -27.880 17.189  74.826  1.00 83.85  ? 328 SER A O   1 
ATOM 731  C CB  . SER A 1 111 ? -30.737 15.744  75.682  1.00 81.01  ? 328 SER A CB  1 
ATOM 732  O OG  . SER A 1 111 ? -31.616 15.496  76.770  1.00 96.06  ? 328 SER A OG  1 
ATOM 733  N N   . ASN A 1 112 ? -29.617 17.684  73.439  1.00 80.96  ? 329 ASN A N   1 
ATOM 734  C CA  . ASN A 1 112 ? -28.819 17.936  72.245  1.00 81.87  ? 329 ASN A CA  1 
ATOM 735  C C   . ASN A 1 112 ? -28.040 19.238  72.387  1.00 84.44  ? 329 ASN A C   1 
ATOM 736  O O   . ASN A 1 112 ? -26.888 19.333  71.944  1.00 86.70  ? 329 ASN A O   1 
ATOM 737  C CB  . ASN A 1 112 ? -29.716 17.959  71.007  1.00 86.67  ? 329 ASN A CB  1 
ATOM 738  C CG  . ASN A 1 112 ? -29.918 16.615  70.329  1.00 108.64 ? 329 ASN A CG  1 
ATOM 739  O OD1 . ASN A 1 112 ? -29.211 15.632  70.580  1.00 102.84 ? 329 ASN A OD1 1 
ATOM 740  N ND2 . ASN A 1 112 ? -30.881 16.556  69.423  1.00 101.58 ? 329 ASN A ND2 1 
ATOM 741  N N   . LEU A 1 113 ? -28.657 20.225  73.040  1.00 77.85  ? 330 LEU A N   1 
ATOM 742  C CA  . LEU A 1 113 ? -28.064 21.530  73.291  1.00 78.31  ? 330 LEU A CA  1 
ATOM 743  C C   . LEU A 1 113 ? -26.936 21.386  74.295  1.00 82.55  ? 330 LEU A C   1 
ATOM 744  O O   . LEU A 1 113 ? -25.906 22.030  74.130  1.00 85.14  ? 330 LEU A O   1 
ATOM 745  C CB  . LEU A 1 113 ? -29.138 22.491  73.800  1.00 78.01  ? 330 LEU A CB  1 
ATOM 746  C CG  . LEU A 1 113 ? -28.933 23.982  73.602  1.00 85.22  ? 330 LEU A CG  1 
ATOM 747  C CD1 . LEU A 1 113 ? -28.373 24.312  72.232  1.00 88.74  ? 330 LEU A CD1 1 
ATOM 748  C CD2 . LEU A 1 113 ? -30.241 24.703  73.754  1.00 88.91  ? 330 LEU A CD2 1 
ATOM 749  N N   . ALA A 1 114 ? -27.110 20.490  75.298  1.00 76.63  ? 331 ALA A N   1 
ATOM 750  C CA  . ALA A 1 114 ? -26.114 20.170  76.322  1.00 75.80  ? 331 ALA A CA  1 
ATOM 751  C C   . ALA A 1 114 ? -24.876 19.568  75.675  1.00 83.05  ? 331 ALA A C   1 
ATOM 752  O O   . ALA A 1 114 ? -23.760 19.968  76.015  1.00 85.53  ? 331 ALA A O   1 
ATOM 753  C CB  . ALA A 1 114 ? -26.696 19.193  77.322  1.00 73.74  ? 331 ALA A CB  1 
ATOM 754  N N   . LEU A 1 115 ? -25.073 18.636  74.715  1.00 80.35  ? 332 LEU A N   1 
ATOM 755  C CA  . LEU A 1 115 ? -23.993 17.985  73.965  1.00 83.01  ? 332 LEU A CA  1 
ATOM 756  C C   . LEU A 1 115 ? -23.115 18.977  73.187  1.00 89.99  ? 332 LEU A C   1 
ATOM 757  O O   . LEU A 1 115 ? -21.887 18.805  73.164  1.00 91.73  ? 332 LEU A O   1 
ATOM 758  C CB  . LEU A 1 115 ? -24.559 16.937  72.997  1.00 84.12  ? 332 LEU A CB  1 
ATOM 759  C CG  . LEU A 1 115 ? -24.822 15.536  73.541  1.00 87.54  ? 332 LEU A CG  1 
ATOM 760  C CD1 . LEU A 1 115 ? -25.481 14.676  72.474  1.00 89.41  ? 332 LEU A CD1 1 
ATOM 761  C CD2 . LEU A 1 115 ? -23.541 14.872  73.985  1.00 89.86  ? 332 LEU A CD2 1 
ATOM 762  N N   . LEU A 1 116 ? -23.746 20.005  72.550  1.00 86.68  ? 333 LEU A N   1 
ATOM 763  C CA  . LEU A 1 116 ? -23.044 21.053  71.808  1.00 90.72  ? 333 LEU A CA  1 
ATOM 764  C C   . LEU A 1 116 ? -22.138 21.878  72.727  1.00 98.17  ? 333 LEU A C   1 
ATOM 765  O O   . LEU A 1 116 ? -21.038 22.254  72.314  1.00 101.68 ? 333 LEU A O   1 
ATOM 766  C CB  . LEU A 1 116 ? -24.033 21.974  71.088  1.00 92.28  ? 333 LEU A CB  1 
ATOM 767  C CG  . LEU A 1 116 ? -24.670 21.460  69.797  1.00 96.98  ? 333 LEU A CG  1 
ATOM 768  C CD1 . LEU A 1 116 ? -25.756 22.419  69.327  1.00 98.27  ? 333 LEU A CD1 1 
ATOM 769  C CD2 . LEU A 1 116 ? -23.627 21.247  68.704  1.00 101.50 ? 333 LEU A CD2 1 
ATOM 770  N N   . CYS A 1 117 ? -22.596 22.137  73.974  1.00 93.92  ? 334 CYS A N   1 
ATOM 771  C CA  . CYS A 1 117 ? -21.853 22.870  74.997  1.00 96.93  ? 334 CYS A CA  1 
ATOM 772  C C   . CYS A 1 117 ? -20.671 22.058  75.514  1.00 102.28 ? 334 CYS A C   1 
ATOM 773  O O   . CYS A 1 117 ? -19.578 22.596  75.679  1.00 106.14 ? 334 CYS A O   1 
ATOM 774  C CB  . CYS A 1 117 ? -22.780 23.282  76.129  1.00 95.43  ? 334 CYS A CB  1 
ATOM 775  S SG  . CYS A 1 117 ? -23.986 24.548  75.666  1.00 101.53 ? 334 CYS A SG  1 
ATOM 776  N N   . GLN A 1 118 ? -20.903 20.758  75.755  1.00 96.20  ? 335 GLN A N   1 
ATOM 777  C CA  . GLN A 1 118 ? -19.923 19.772  76.213  1.00 96.75  ? 335 GLN A CA  1 
ATOM 778  C C   . GLN A 1 118 ? -18.745 19.735  75.244  1.00 103.80 ? 335 GLN A C   1 
ATOM 779  O O   . GLN A 1 118 ? -17.591 19.697  75.678  1.00 106.22 ? 335 GLN A O   1 
ATOM 780  C CB  . GLN A 1 118 ? -20.607 18.397  76.281  1.00 94.78  ? 335 GLN A CB  1 
ATOM 781  C CG  . GLN A 1 118 ? -19.913 17.333  77.124  1.00 108.81 ? 335 GLN A CG  1 
ATOM 782  C CD  . GLN A 1 118 ? -20.697 16.035  77.054  1.00 131.29 ? 335 GLN A CD  1 
ATOM 783  O OE1 . GLN A 1 118 ? -20.487 15.208  76.157  1.00 125.47 ? 335 GLN A OE1 1 
ATOM 784  N NE2 . GLN A 1 118 ? -21.645 15.839  77.975  1.00 123.59 ? 335 GLN A NE2 1 
ATOM 785  N N   . ASN A 1 119 ? -19.049 19.804  73.932  1.00 100.80 ? 336 ASN A N   1 
ATOM 786  C CA  . ASN A 1 119 ? -18.067 19.782  72.844  1.00 105.03 ? 336 ASN A CA  1 
ATOM 787  C C   . ASN A 1 119 ? -17.428 21.163  72.591  1.00 113.88 ? 336 ASN A C   1 
ATOM 788  O O   . ASN A 1 119 ? -16.738 21.363  71.591  1.00 119.02 ? 336 ASN A O   1 
ATOM 789  C CB  . ASN A 1 119 ? -18.685 19.172  71.570  1.00 104.36 ? 336 ASN A CB  1 
ATOM 790  C CG  . ASN A 1 119 ? -19.167 17.741  71.717  1.00 125.54 ? 336 ASN A CG  1 
ATOM 791  O OD1 . ASN A 1 119 ? -19.087 17.108  72.783  1.00 121.53 ? 336 ASN A OD1 1 
ATOM 792  N ND2 . ASN A 1 119 ? -19.701 17.205  70.644  1.00 116.14 ? 336 ASN A ND2 1 
ATOM 793  N N   . GLN A 1 120 ? -17.653 22.100  73.518  1.00 108.67 ? 337 GLN A N   1 
ATOM 794  C CA  . GLN A 1 120 ? -17.102 23.452  73.538  1.00 112.96 ? 337 GLN A CA  1 
ATOM 795  C C   . GLN A 1 120 ? -16.545 23.673  74.947  1.00 117.29 ? 337 GLN A C   1 
ATOM 796  O O   . GLN A 1 120 ? -15.976 24.727  75.230  1.00 122.98 ? 337 GLN A O   1 
ATOM 797  C CB  . GLN A 1 120 ? -18.199 24.487  73.248  1.00 113.65 ? 337 GLN A CB  1 
ATOM 798  C CG  . GLN A 1 120 ? -18.648 24.565  71.803  1.00 115.80 ? 337 GLN A CG  1 
ATOM 799  C CD  . GLN A 1 120 ? -19.648 25.681  71.606  1.00 131.45 ? 337 GLN A CD  1 
ATOM 800  O OE1 . GLN A 1 120 ? -19.301 26.808  71.220  1.00 133.41 ? 337 GLN A OE1 1 
ATOM 801  N NE2 . GLN A 1 120 ? -20.909 25.409  71.904  1.00 114.44 ? 337 GLN A NE2 1 
ATOM 802  N N   . GLY A 1 121 ? -16.732 22.670  75.808  1.00 108.48 ? 338 GLY A N   1 
ATOM 803  C CA  . GLY A 1 121 ? -16.292 22.666  77.196  1.00 109.12 ? 338 GLY A CA  1 
ATOM 804  C C   . GLY A 1 121 ? -16.950 23.713  78.077  1.00 113.91 ? 338 GLY A C   1 
ATOM 805  O O   . GLY A 1 121 ? -16.285 24.298  78.944  1.00 118.36 ? 338 GLY A O   1 
ATOM 806  N N   . LYS A 1 122 ? -18.263 23.952  77.872  1.00 105.73 ? 339 LYS A N   1 
ATOM 807  C CA  . LYS A 1 122 ? -19.042 24.941  78.627  1.00 105.05 ? 339 LYS A CA  1 
ATOM 808  C C   . LYS A 1 122 ? -19.836 24.234  79.744  1.00 102.74 ? 339 LYS A C   1 
ATOM 809  O O   . LYS A 1 122 ? -21.071 24.275  79.762  1.00 100.22 ? 339 LYS A O   1 
ATOM 810  C CB  . LYS A 1 122 ? -19.961 25.742  77.673  1.00 107.64 ? 339 LYS A CB  1 
ATOM 811  C CG  . LYS A 1 122 ? -19.247 26.391  76.482  1.00 120.93 ? 339 LYS A CG  1 
ATOM 812  C CD  . LYS A 1 122 ? -20.223 26.708  75.363  1.00 125.34 ? 339 LYS A CD  1 
ATOM 813  C CE  . LYS A 1 122 ? -20.424 28.185  75.169  1.00 143.03 ? 339 LYS A CE  1 
ATOM 814  N NZ  . LYS A 1 122 ? -21.438 28.463  74.120  1.00 154.30 ? 339 LYS A NZ  1 
ATOM 815  N N   . ALA A 1 123 ? -19.103 23.571  80.670  1.00 97.24  ? 340 ALA A N   1 
ATOM 816  C CA  . ALA A 1 123 ? -19.608 22.768  81.800  1.00 91.57  ? 340 ALA A CA  1 
ATOM 817  C C   . ALA A 1 123 ? -20.833 23.320  82.517  1.00 90.59  ? 340 ALA A C   1 
ATOM 818  O O   . ALA A 1 123 ? -21.782 22.575  82.738  1.00 83.14  ? 340 ALA A O   1 
ATOM 819  C CB  . ALA A 1 123 ? -18.495 22.490  82.798  1.00 94.87  ? 340 ALA A CB  1 
ATOM 820  N N   . GLU A 1 124 ? -20.821 24.625  82.843  1.00 92.11  ? 341 GLU A N   1 
ATOM 821  C CA  . GLU A 1 124 ? -21.911 25.349  83.519  1.00 90.91  ? 341 GLU A CA  1 
ATOM 822  C C   . GLU A 1 124 ? -23.224 25.262  82.719  1.00 89.30  ? 341 GLU A C   1 
ATOM 823  O O   . GLU A 1 124 ? -24.297 25.094  83.313  1.00 85.33  ? 341 GLU A O   1 
ATOM 824  C CB  . GLU A 1 124 ? -21.530 26.831  83.760  1.00 98.89  ? 341 GLU A CB  1 
ATOM 825  C CG  . GLU A 1 124 ? -20.339 27.041  84.688  1.00 116.42 ? 341 GLU A CG  1 
ATOM 826  C CD  . GLU A 1 124 ? -18.938 26.871  84.117  1.00 154.20 ? 341 GLU A CD  1 
ATOM 827  O OE1 . GLU A 1 124 ? -18.797 26.629  82.893  1.00 152.94 ? 341 GLU A OE1 1 
ATOM 828  O OE2 . GLU A 1 124 ? -17.974 26.983  84.909  1.00 158.42 ? 341 GLU A OE2 1 
ATOM 829  N N   . GLU A 1 125 ? -23.121 25.373  81.375  1.00 85.50  ? 342 GLU A N   1 
ATOM 830  C CA  . GLU A 1 125 ? -24.252 25.310  80.454  1.00 82.49  ? 342 GLU A CA  1 
ATOM 831  C C   . GLU A 1 125 ? -24.762 23.878  80.315  1.00 82.10  ? 342 GLU A C   1 
ATOM 832  O O   . GLU A 1 125 ? -25.973 23.656  80.397  1.00 80.30  ? 342 GLU A O   1 
ATOM 833  C CB  . GLU A 1 125 ? -23.897 25.914  79.095  1.00 87.10  ? 342 GLU A CB  1 
ATOM 834  C CG  . GLU A 1 125 ? -23.962 27.427  79.075  1.00 104.20 ? 342 GLU A CG  1 
ATOM 835  C CD  . GLU A 1 125 ? -23.241 28.064  77.905  1.00 139.71 ? 342 GLU A CD  1 
ATOM 836  O OE1 . GLU A 1 125 ? -23.785 28.040  76.775  1.00 143.48 ? 342 GLU A OE1 1 
ATOM 837  O OE2 . GLU A 1 125 ? -22.127 28.592  78.123  1.00 136.24 ? 342 GLU A OE2 1 
ATOM 838  N N   . VAL A 1 126 ? -23.841 22.913  80.143  1.00 76.58  ? 343 VAL A N   1 
ATOM 839  C CA  . VAL A 1 126 ? -24.122 21.476  80.055  1.00 72.72  ? 343 VAL A CA  1 
ATOM 840  C C   . VAL A 1 126 ? -25.029 21.078  81.206  1.00 74.86  ? 343 VAL A C   1 
ATOM 841  O O   . VAL A 1 126 ? -26.105 20.511  81.005  1.00 73.28  ? 343 VAL A O   1 
ATOM 842  C CB  . VAL A 1 126 ? -22.805 20.688  80.151  1.00 77.83  ? 343 VAL A CB  1 
ATOM 843  C CG1 . VAL A 1 126 ? -23.073 19.188  80.189  1.00 74.80  ? 343 VAL A CG1 1 
ATOM 844  C CG2 . VAL A 1 126 ? -21.860 21.058  79.017  1.00 81.48  ? 343 VAL A CG2 1 
ATOM 845  N N   . GLU A 1 127 ? -24.569 21.409  82.417  1.00 72.60  ? 344 GLU A N   1 
ATOM 846  C CA  . GLU A 1 127 ? -25.197 21.204  83.710  1.00 70.35  ? 344 GLU A CA  1 
ATOM 847  C C   . GLU A 1 127 ? -26.613 21.819  83.692  1.00 75.99  ? 344 GLU A C   1 
ATOM 848  O O   . GLU A 1 127 ? -27.567 21.125  84.023  1.00 72.82  ? 344 GLU A O   1 
ATOM 849  C CB  . GLU A 1 127 ? -24.285 21.848  84.767  1.00 74.14  ? 344 GLU A CB  1 
ATOM 850  C CG  . GLU A 1 127 ? -24.705 21.727  86.209  1.00 84.14  ? 344 GLU A CG  1 
ATOM 851  C CD  . GLU A 1 127 ? -23.596 22.113  87.164  1.00 109.70 ? 344 GLU A CD  1 
ATOM 852  O OE1 . GLU A 1 127 ? -22.449 21.664  86.943  1.00 98.70  ? 344 GLU A OE1 1 
ATOM 853  O OE2 . GLU A 1 127 ? -23.873 22.840  88.146  1.00 113.61 ? 344 GLU A OE2 1 
ATOM 854  N N   . TYR A 1 128 ? -26.754 23.078  83.225  1.00 77.25  ? 345 TYR A N   1 
ATOM 855  C CA  . TYR A 1 128 ? -28.047 23.752  83.152  1.00 77.49  ? 345 TYR A CA  1 
ATOM 856  C C   . TYR A 1 128 ? -29.001 23.032  82.240  1.00 78.82  ? 345 TYR A C   1 
ATOM 857  O O   . TYR A 1 128 ? -30.163 22.867  82.617  1.00 78.91  ? 345 TYR A O   1 
ATOM 858  C CB  . TYR A 1 128 ? -27.907 25.216  82.718  1.00 83.65  ? 345 TYR A CB  1 
ATOM 859  C CG  . TYR A 1 128 ? -29.233 25.891  82.422  1.00 87.59  ? 345 TYR A CG  1 
ATOM 860  C CD1 . TYR A 1 128 ? -30.077 26.303  83.455  1.00 90.07  ? 345 TYR A CD1 1 
ATOM 861  C CD2 . TYR A 1 128 ? -29.647 26.116  81.110  1.00 90.07  ? 345 TYR A CD2 1 
ATOM 862  C CE1 . TYR A 1 128 ? -31.294 26.928  83.190  1.00 93.47  ? 345 TYR A CE1 1 
ATOM 863  C CE2 . TYR A 1 128 ? -30.865 26.736  80.831  1.00 92.79  ? 345 TYR A CE2 1 
ATOM 864  C CZ  . TYR A 1 128 ? -31.674 27.165  81.875  1.00 105.43 ? 345 TYR A CZ  1 
ATOM 865  O OH  . TYR A 1 128 ? -32.871 27.793  81.607  1.00 112.73 ? 345 TYR A OH  1 
ATOM 866  N N   . TYR A 1 129 ? -28.531 22.633  81.033  1.00 73.58  ? 346 TYR A N   1 
ATOM 867  C CA  . TYR A 1 129 ? -29.381 21.944  80.068  1.00 72.30  ? 346 TYR A CA  1 
ATOM 868  C C   . TYR A 1 129 ? -29.810 20.549  80.530  1.00 70.57  ? 346 TYR A C   1 
ATOM 869  O O   . TYR A 1 129 ? -31.011 20.245  80.481  1.00 68.80  ? 346 TYR A O   1 
ATOM 870  C CB  . TYR A 1 129 ? -28.779 21.942  78.655  1.00 75.63  ? 346 TYR A CB  1 
ATOM 871  C CG  . TYR A 1 129 ? -28.661 23.317  78.034  1.00 81.31  ? 346 TYR A CG  1 
ATOM 872  C CD1 . TYR A 1 129 ? -29.780 24.134  77.874  1.00 84.36  ? 346 TYR A CD1 1 
ATOM 873  C CD2 . TYR A 1 129 ? -27.441 23.785  77.560  1.00 85.46  ? 346 TYR A CD2 1 
ATOM 874  C CE1 . TYR A 1 129 ? -29.680 25.397  77.294  1.00 88.74  ? 346 TYR A CE1 1 
ATOM 875  C CE2 . TYR A 1 129 ? -27.329 25.044  76.972  1.00 90.87  ? 346 TYR A CE2 1 
ATOM 876  C CZ  . TYR A 1 129 ? -28.454 25.842  76.826  1.00 99.37  ? 346 TYR A CZ  1 
ATOM 877  O OH  . TYR A 1 129 ? -28.343 27.080  76.229  1.00 105.21 ? 346 TYR A OH  1 
ATOM 878  N N   . TYR A 1 130 ? -28.851 19.739  81.043  1.00 63.45  ? 347 TYR A N   1 
ATOM 879  C CA  . TYR A 1 130 ? -29.153 18.404  81.550  1.00 60.57  ? 347 TYR A CA  1 
ATOM 880  C C   . TYR A 1 130 ? -30.110 18.447  82.738  1.00 64.65  ? 347 TYR A C   1 
ATOM 881  O O   . TYR A 1 130 ? -31.004 17.596  82.836  1.00 64.57  ? 347 TYR A O   1 
ATOM 882  C CB  . TYR A 1 130 ? -27.873 17.606  81.869  1.00 59.96  ? 347 TYR A CB  1 
ATOM 883  C CG  . TYR A 1 130 ? -27.244 16.969  80.651  1.00 62.29  ? 347 TYR A CG  1 
ATOM 884  C CD1 . TYR A 1 130 ? -28.032 16.424  79.635  1.00 64.90  ? 347 TYR A CD1 1 
ATOM 885  C CD2 . TYR A 1 130 ? -25.857 16.912  80.503  1.00 63.49  ? 347 TYR A CD2 1 
ATOM 886  C CE1 . TYR A 1 130 ? -27.457 15.850  78.497  1.00 65.55  ? 347 TYR A CE1 1 
ATOM 887  C CE2 . TYR A 1 130 ? -25.272 16.336  79.368  1.00 65.03  ? 347 TYR A CE2 1 
ATOM 888  C CZ  . TYR A 1 130 ? -26.079 15.811  78.368  1.00 68.65  ? 347 TYR A CZ  1 
ATOM 889  O OH  . TYR A 1 130 ? -25.523 15.243  77.255  1.00 68.76  ? 347 TYR A OH  1 
ATOM 890  N N   . ARG A 1 131 ? -29.944 19.443  83.622  1.00 61.27  ? 348 ARG A N   1 
ATOM 891  C CA  . ARG A 1 131 ? -30.824 19.623  84.773  1.00 61.34  ? 348 ARG A CA  1 
ATOM 892  C C   . ARG A 1 131 ? -32.252 19.955  84.297  1.00 67.28  ? 348 ARG A C   1 
ATOM 893  O O   . ARG A 1 131 ? -33.227 19.374  84.782  1.00 66.84  ? 348 ARG A O   1 
ATOM 894  C CB  . ARG A 1 131 ? -30.276 20.700  85.721  1.00 62.71  ? 348 ARG A CB  1 
ATOM 895  C CG  . ARG A 1 131 ? -29.085 20.217  86.573  1.00 72.83  ? 348 ARG A CG  1 
ATOM 896  C CD  . ARG A 1 131 ? -28.539 21.330  87.444  1.00 79.33  ? 348 ARG A CD  1 
ATOM 897  N NE  . ARG A 1 131 ? -27.491 20.845  88.332  1.00 89.53  ? 348 ARG A NE  1 
ATOM 898  C CZ  . ARG A 1 131 ? -26.760 21.616  89.127  1.00 107.19 ? 348 ARG A CZ  1 
ATOM 899  N NH1 . ARG A 1 131 ? -26.952 22.930  89.151  1.00 101.44 ? 348 ARG A NH1 1 
ATOM 900  N NH2 . ARG A 1 131 ? -25.800 21.087  89.870  1.00 95.54  ? 348 ARG A NH2 1 
ATOM 901  N N   . ARG A 1 132 ? -32.359 20.822  83.286  1.00 65.78  ? 349 ARG A N   1 
ATOM 902  C CA  . ARG A 1 132 ? -33.635 21.210  82.707  1.00 67.39  ? 349 ARG A CA  1 
ATOM 903  C C   . ARG A 1 132 ? -34.291 20.031  81.992  1.00 72.17  ? 349 ARG A C   1 
ATOM 904  O O   . ARG A 1 132 ? -35.514 19.886  82.026  1.00 75.31  ? 349 ARG A O   1 
ATOM 905  C CB  . ARG A 1 132 ? -33.445 22.387  81.760  1.00 69.63  ? 349 ARG A CB  1 
ATOM 906  C CG  . ARG A 1 132 ? -33.760 23.714  82.411  1.00 82.50  ? 349 ARG A CG  1 
ATOM 907  C CD  . ARG A 1 132 ? -34.041 24.764  81.359  1.00 101.80 ? 349 ARG A CD  1 
ATOM 908  N NE  . ARG A 1 132 ? -35.358 24.609  80.743  1.00 113.21 ? 349 ARG A NE  1 
ATOM 909  C CZ  . ARG A 1 132 ? -35.761 25.263  79.659  1.00 129.14 ? 349 ARG A CZ  1 
ATOM 910  N NH1 . ARG A 1 132 ? -34.951 26.129  79.056  1.00 106.85 ? 349 ARG A NH1 1 
ATOM 911  N NH2 . ARG A 1 132 ? -36.977 25.056  79.167  1.00 123.78 ? 349 ARG A NH2 1 
ATOM 912  N N   . ALA A 1 133 ? -33.472 19.194  81.355  1.00 65.98  ? 350 ALA A N   1 
ATOM 913  C CA  . ALA A 1 133 ? -33.895 17.998  80.644  1.00 65.23  ? 350 ALA A CA  1 
ATOM 914  C C   . ALA A 1 133 ? -34.429 16.969  81.635  1.00 67.12  ? 350 ALA A C   1 
ATOM 915  O O   . ALA A 1 133 ? -35.489 16.392  81.386  1.00 65.71  ? 350 ALA A O   1 
ATOM 916  C CB  . ALA A 1 133 ? -32.719 17.419  79.863  1.00 65.20  ? 350 ALA A CB  1 
ATOM 917  N N   . LEU A 1 134 ? -33.679 16.744  82.764  1.00 63.71  ? 351 LEU A N   1 
ATOM 918  C CA  . LEU A 1 134 ? -34.009 15.769  83.823  1.00 62.50  ? 351 LEU A CA  1 
ATOM 919  C C   . LEU A 1 134 ? -35.337 16.134  84.498  1.00 67.65  ? 351 LEU A C   1 
ATOM 920  O O   . LEU A 1 134 ? -36.166 15.260  84.712  1.00 68.79  ? 351 LEU A O   1 
ATOM 921  C CB  . LEU A 1 134 ? -32.891 15.690  84.863  1.00 59.55  ? 351 LEU A CB  1 
ATOM 922  C CG  . LEU A 1 134 ? -32.486 14.326  85.476  1.00 62.28  ? 351 LEU A CG  1 
ATOM 923  C CD1 . LEU A 1 134 ? -32.046 14.507  86.902  1.00 58.62  ? 351 LEU A CD1 1 
ATOM 924  C CD2 . LEU A 1 134 ? -33.567 13.252  85.393  1.00 66.87  ? 351 LEU A CD2 1 
ATOM 925  N N   . GLU A 1 135 ? -35.551 17.426  84.762  1.00 64.29  ? 352 GLU A N   1 
ATOM 926  C CA  . GLU A 1 135 ? -36.784 17.977  85.328  1.00 66.15  ? 352 GLU A CA  1 
ATOM 927  C C   . GLU A 1 135 ? -38.000 17.460  84.533  1.00 72.17  ? 352 GLU A C   1 
ATOM 928  O O   . GLU A 1 135 ? -38.894 16.863  85.127  1.00 74.11  ? 352 GLU A O   1 
ATOM 929  C CB  . GLU A 1 135 ? -36.712 19.515  85.302  1.00 67.62  ? 352 GLU A CB  1 
ATOM 930  C CG  . GLU A 1 135 ? -37.686 20.204  86.217  1.00 77.96  ? 352 GLU A CG  1 
ATOM 931  C CD  . GLU A 1 135 ? -37.411 21.680  86.411  1.00 104.81 ? 352 GLU A CD  1 
ATOM 932  O OE1 . GLU A 1 135 ? -37.828 22.486  85.543  1.00 112.12 ? 352 GLU A OE1 1 
ATOM 933  O OE2 . GLU A 1 135 ? -36.785 22.029  87.440  1.00 87.84  ? 352 GLU A OE2 1 
ATOM 934  N N   . ILE A 1 136 ? -37.971 17.603  83.198  1.00 69.77  ? 353 ILE A N   1 
ATOM 935  C CA  . ILE A 1 136 ? -39.025 17.123  82.302  1.00 74.06  ? 353 ILE A CA  1 
ATOM 936  C C   . ILE A 1 136 ? -39.193 15.590  82.365  1.00 82.99  ? 353 ILE A C   1 
ATOM 937  O O   . ILE A 1 136 ? -40.247 15.118  82.808  1.00 87.03  ? 353 ILE A O   1 
ATOM 938  C CB  . ILE A 1 136 ? -38.874 17.660  80.846  1.00 77.15  ? 353 ILE A CB  1 
ATOM 939  C CG1 . ILE A 1 136 ? -38.711 19.212  80.854  1.00 76.14  ? 353 ILE A CG1 1 
ATOM 940  C CG2 . ILE A 1 136 ? -40.067 17.190  79.987  1.00 81.26  ? 353 ILE A CG2 1 
ATOM 941  C CD1 . ILE A 1 136 ? -38.506 19.920  79.531  1.00 81.84  ? 353 ILE A CD1 1 
ATOM 942  N N   . TYR A 1 137 ? -38.154 14.832  81.969  1.00 78.61  ? 354 TYR A N   1 
ATOM 943  C CA  . TYR A 1 137 ? -38.176 13.372  81.969  1.00 82.01  ? 354 TYR A CA  1 
ATOM 944  C C   . TYR A 1 137 ? -38.681 12.743  83.291  1.00 89.79  ? 354 TYR A C   1 
ATOM 945  O O   . TYR A 1 137 ? -39.538 11.846  83.259  1.00 93.11  ? 354 TYR A O   1 
ATOM 946  C CB  . TYR A 1 137 ? -36.798 12.801  81.609  1.00 81.21  ? 354 TYR A CB  1 
ATOM 947  C CG  . TYR A 1 137 ? -36.322 13.054  80.190  1.00 83.82  ? 354 TYR A CG  1 
ATOM 948  C CD1 . TYR A 1 137 ? -37.124 12.735  79.092  1.00 89.23  ? 354 TYR A CD1 1 
ATOM 949  C CD2 . TYR A 1 137 ? -35.031 13.511  79.939  1.00 81.92  ? 354 TYR A CD2 1 
ATOM 950  C CE1 . TYR A 1 137 ? -36.678 12.941  77.787  1.00 90.82  ? 354 TYR A CE1 1 
ATOM 951  C CE2 . TYR A 1 137 ? -34.575 13.720  78.639  1.00 83.69  ? 354 TYR A CE2 1 
ATOM 952  C CZ  . TYR A 1 137 ? -35.394 13.418  77.565  1.00 97.30  ? 354 TYR A CZ  1 
ATOM 953  O OH  . TYR A 1 137 ? -34.914 13.616  76.290  1.00 102.75 ? 354 TYR A OH  1 
ATOM 954  N N   . ALA A 1 138 ? -38.151 13.226  84.443  1.00 84.04  ? 355 ALA A N   1 
ATOM 955  C CA  . ALA A 1 138 ? -38.484 12.729  85.780  1.00 84.84  ? 355 ALA A CA  1 
ATOM 956  C C   . ALA A 1 138 ? -39.932 12.951  86.187  1.00 91.55  ? 355 ALA A C   1 
ATOM 957  O O   . ALA A 1 138 ? -40.519 12.065  86.810  1.00 95.11  ? 355 ALA A O   1 
ATOM 958  C CB  . ALA A 1 138 ? -37.554 13.331  86.819  1.00 81.76  ? 355 ALA A CB  1 
ATOM 959  N N   . THR A 1 139 ? -40.506 14.119  85.840  1.00 86.93  ? 356 THR A N   1 
ATOM 960  C CA  . THR A 1 139 ? -41.880 14.481  86.210  1.00 89.90  ? 356 THR A CA  1 
ATOM 961  C C   . THR A 1 139 ? -42.914 14.025  85.181  1.00 98.56  ? 356 THR A C   1 
ATOM 962  O O   . THR A 1 139 ? -43.868 13.342  85.554  1.00 102.18 ? 356 THR A O   1 
ATOM 963  C CB  . THR A 1 139 ? -41.992 15.985  86.524  1.00 95.75  ? 356 THR A CB  1 
ATOM 964  O OG1 . THR A 1 139 ? -41.426 16.691  85.440  1.00 98.78  ? 356 THR A OG1 1 
ATOM 965  C CG2 . THR A 1 139 ? -41.256 16.392  87.775  1.00 92.22  ? 356 THR A CG2 1 
ATOM 966  N N   . ARG A 1 140 ? -42.720 14.390  83.890  1.00 95.56  ? 357 ARG A N   1 
ATOM 967  C CA  . ARG A 1 140 ? -43.641 14.055  82.793  1.00 100.34 ? 357 ARG A CA  1 
ATOM 968  C C   . ARG A 1 140 ? -43.738 12.561  82.485  1.00 108.29 ? 357 ARG A C   1 
ATOM 969  O O   . ARG A 1 140 ? -44.835 12.060  82.235  1.00 113.45 ? 357 ARG A O   1 
ATOM 970  C CB  . ARG A 1 140 ? -43.333 14.878  81.528  1.00 96.93  ? 357 ARG A CB  1 
ATOM 971  C CG  . ARG A 1 140 ? -43.690 16.355  81.662  1.00 100.37 ? 357 ARG A CG  1 
ATOM 972  C CD  . ARG A 1 140 ? -45.197 16.625  81.661  1.00 109.41 ? 357 ARG A CD  1 
ATOM 973  N NE  . ARG A 1 140 ? -45.614 17.502  80.563  1.00 114.45 ? 357 ARG A NE  1 
ATOM 974  C CZ  . ARG A 1 140 ? -46.194 17.082  79.440  1.00 138.89 ? 357 ARG A CZ  1 
ATOM 975  N NH1 . ARG A 1 140 ? -46.448 15.790  79.256  1.00 128.90 ? 357 ARG A NH1 1 
ATOM 976  N NH2 . ARG A 1 140 ? -46.535 17.952  78.497  1.00 130.79 ? 357 ARG A NH2 1 
ATOM 977  N N   . LEU A 1 141 ? -42.598 11.858  82.514  1.00 103.12 ? 358 LEU A N   1 
ATOM 978  C CA  . LEU A 1 141 ? -42.531 10.419  82.261  1.00 107.44 ? 358 LEU A CA  1 
ATOM 979  C C   . LEU A 1 141 ? -42.194 9.665   83.552  1.00 115.66 ? 358 LEU A C   1 
ATOM 980  O O   . LEU A 1 141 ? -41.723 10.281  84.522  1.00 111.20 ? 358 LEU A O   1 
ATOM 981  C CB  . LEU A 1 141 ? -41.488 10.101  81.171  1.00 104.92 ? 358 LEU A CB  1 
ATOM 982  C CG  . LEU A 1 141 ? -41.440 11.007  79.953  1.00 107.53 ? 358 LEU A CG  1 
ATOM 983  C CD1 . LEU A 1 141 ? -40.159 10.815  79.215  1.00 103.66 ? 358 LEU A CD1 1 
ATOM 984  C CD2 . LEU A 1 141 ? -42.608 10.755  79.033  1.00 117.65 ? 358 LEU A CD2 1 
ATOM 985  N N   . GLY A 1 142 ? -42.413 8.341   83.535  1.00 120.02 ? 359 GLY A N   1 
ATOM 986  C CA  . GLY A 1 142 ? -42.162 7.440   84.658  1.00 122.36 ? 359 GLY A CA  1 
ATOM 987  C C   . GLY A 1 142 ? -40.767 7.476   85.282  1.00 123.71 ? 359 GLY A C   1 
ATOM 988  O O   . GLY A 1 142 ? -39.834 8.094   84.741  1.00 119.10 ? 359 GLY A O   1 
ATOM 989  N N   . PRO A 1 143 ? -40.583 6.814   86.450  1.00 121.76 ? 360 PRO A N   1 
ATOM 990  C CA  . PRO A 1 143 ? -39.242 6.800   87.069  1.00 116.75 ? 360 PRO A CA  1 
ATOM 991  C C   . PRO A 1 143 ? -38.316 5.790   86.383  1.00 121.02 ? 360 PRO A C   1 
ATOM 992  O O   . PRO A 1 143 ? -37.088 5.899   86.466  1.00 114.93 ? 360 PRO A O   1 
ATOM 993  C CB  . PRO A 1 143 ? -39.541 6.409   88.512  1.00 120.13 ? 360 PRO A CB  1 
ATOM 994  C CG  . PRO A 1 143 ? -40.773 5.558   88.428  1.00 131.86 ? 360 PRO A CG  1 
ATOM 995  C CD  . PRO A 1 143 ? -41.558 6.021   87.234  1.00 129.10 ? 360 PRO A CD  1 
ATOM 996  N N   . ASP A 1 144 ? -38.945 4.806   85.696  1.00 113.22 ? 361 ASP A N   1 
ATOM 997  C CA  . ASP A 1 144 ? -38.336 3.696   84.969  1.00 113.41 ? 361 ASP A CA  1 
ATOM 998  C C   . ASP A 1 144 ? -38.108 3.970   83.470  1.00 115.38 ? 361 ASP A C   1 
ATOM 999  O O   . ASP A 1 144 ? -37.618 3.081   82.753  1.00 116.35 ? 361 ASP A O   1 
ATOM 1000 C CB  . ASP A 1 144 ? -39.135 2.404   85.223  1.00 120.32 ? 361 ASP A CB  1 
ATOM 1001 C CG  . ASP A 1 144 ? -39.154 1.986   86.685  1.00 128.75 ? 361 ASP A CG  1 
ATOM 1002 O OD1 . ASP A 1 144 ? -38.374 2.564   87.481  1.00 124.27 ? 361 ASP A OD1 1 
ATOM 1003 O OD2 . ASP A 1 144 ? -39.938 1.078   87.031  1.00 139.48 ? 361 ASP A OD2 1 
ATOM 1004 N N   . ASP A 1 145 ? -38.412 5.219   83.012  1.00 108.14 ? 362 ASP A N   1 
ATOM 1005 C CA  . ASP A 1 145 ? -38.174 5.623   81.631  1.00 106.40 ? 362 ASP A CA  1 
ATOM 1006 C C   . ASP A 1 145 ? -36.659 5.683   81.404  1.00 104.68 ? 362 ASP A C   1 
ATOM 1007 O O   . ASP A 1 145 ? -35.936 6.315   82.193  1.00 101.12 ? 362 ASP A O   1 
ATOM 1008 C CB  . ASP A 1 145 ? -38.830 6.967   81.296  1.00 107.86 ? 362 ASP A CB  1 
ATOM 1009 C CG  . ASP A 1 145 ? -38.699 7.333   79.829  1.00 115.75 ? 362 ASP A CG  1 
ATOM 1010 O OD1 . ASP A 1 145 ? -39.239 6.595   78.986  1.00 119.41 ? 362 ASP A OD1 1 
ATOM 1011 O OD2 . ASP A 1 145 ? -38.046 8.355   79.529  1.00 118.28 ? 362 ASP A OD2 1 
ATOM 1012 N N   . PRO A 1 146 ? -36.161 4.985   80.360  1.00 99.90  ? 363 PRO A N   1 
ATOM 1013 C CA  . PRO A 1 146 ? -34.712 4.977   80.093  1.00 96.03  ? 363 PRO A CA  1 
ATOM 1014 C C   . PRO A 1 146 ? -34.032 6.351   80.037  1.00 92.16  ? 363 PRO A C   1 
ATOM 1015 O O   . PRO A 1 146 ? -32.890 6.470   80.482  1.00 87.88  ? 363 PRO A O   1 
ATOM 1016 C CB  . PRO A 1 146 ? -34.609 4.238   78.757  1.00 101.28 ? 363 PRO A CB  1 
ATOM 1017 C CG  . PRO A 1 146 ? -35.988 4.278   78.175  1.00 109.70 ? 363 PRO A CG  1 
ATOM 1018 C CD  . PRO A 1 146 ? -36.879 4.180   79.358  1.00 105.72 ? 363 PRO A CD  1 
ATOM 1019 N N   . ASN A 1 147 ? -34.744 7.385   79.531  1.00 87.05  ? 364 ASN A N   1 
ATOM 1020 C CA  . ASN A 1 147 ? -34.236 8.749   79.405  1.00 83.61  ? 364 ASN A CA  1 
ATOM 1021 C C   . ASN A 1 147 ? -33.862 9.382   80.707  1.00 82.44  ? 364 ASN A C   1 
ATOM 1022 O O   . ASN A 1 147 ? -32.992 10.255  80.715  1.00 79.57  ? 364 ASN A O   1 
ATOM 1023 C CB  . ASN A 1 147 ? -35.204 9.643   78.661  1.00 84.46  ? 364 ASN A CB  1 
ATOM 1024 C CG  . ASN A 1 147 ? -35.314 9.339   77.194  1.00 100.96 ? 364 ASN A CG  1 
ATOM 1025 O OD1 . ASN A 1 147 ? -34.365 8.879   76.542  1.00 93.48  ? 364 ASN A OD1 1 
ATOM 1026 N ND2 . ASN A 1 147 ? -36.478 9.614   76.639  1.00 91.30  ? 364 ASN A ND2 1 
ATOM 1027 N N   . VAL A 1 148 ? -34.501 8.949   81.810  1.00 77.08  ? 365 VAL A N   1 
ATOM 1028 C CA  . VAL A 1 148 ? -34.187 9.451   83.146  1.00 72.84  ? 365 VAL A CA  1 
ATOM 1029 C C   . VAL A 1 148 ? -32.755 9.012   83.512  1.00 73.85  ? 365 VAL A C   1 
ATOM 1030 O O   . VAL A 1 148 ? -31.938 9.874   83.825  1.00 72.50  ? 365 VAL A O   1 
ATOM 1031 C CB  . VAL A 1 148 ? -35.231 9.046   84.219  1.00 77.04  ? 365 VAL A CB  1 
ATOM 1032 C CG1 . VAL A 1 148 ? -34.854 9.607   85.584  1.00 74.56  ? 365 VAL A CG1 1 
ATOM 1033 C CG2 . VAL A 1 148 ? -36.638 9.495   83.832  1.00 79.84  ? 365 VAL A CG2 1 
ATOM 1034 N N   . ALA A 1 149 ? -32.439 7.692   83.420  1.00 70.58  ? 366 ALA A N   1 
ATOM 1035 C CA  . ALA A 1 149 ? -31.098 7.155   83.722  1.00 67.83  ? 366 ALA A CA  1 
ATOM 1036 C C   . ALA A 1 149 ? -30.012 7.721   82.790  1.00 71.99  ? 366 ALA A C   1 
ATOM 1037 O O   . ALA A 1 149 ? -29.000 8.217   83.299  1.00 69.60  ? 366 ALA A O   1 
ATOM 1038 C CB  . ALA A 1 149 ? -31.094 5.648   83.693  1.00 69.97  ? 366 ALA A CB  1 
ATOM 1039 N N   . LYS A 1 150 ? -30.248 7.723   81.443  1.00 70.35  ? 367 LYS A N   1 
ATOM 1040 C CA  . LYS A 1 150 ? -29.323 8.321   80.466  1.00 70.01  ? 367 LYS A CA  1 
ATOM 1041 C C   . LYS A 1 150 ? -29.031 9.792   80.842  1.00 72.78  ? 367 LYS A C   1 
ATOM 1042 O O   . LYS A 1 150 ? -27.857 10.149  80.939  1.00 73.44  ? 367 LYS A O   1 
ATOM 1043 C CB  . LYS A 1 150 ? -29.866 8.224   79.040  1.00 74.99  ? 367 LYS A CB  1 
ATOM 1044 C CG  . LYS A 1 150 ? -30.036 6.793   78.524  1.00 95.11  ? 367 LYS A CG  1 
ATOM 1045 C CD  . LYS A 1 150 ? -30.511 6.748   77.065  1.00 106.99 ? 367 LYS A CD  1 
ATOM 1046 C CE  . LYS A 1 150 ? -30.769 5.336   76.591  1.00 124.57 ? 367 LYS A CE  1 
ATOM 1047 N NZ  . LYS A 1 150 ? -31.258 5.291   75.183  1.00 135.51 ? 367 LYS A NZ  1 
ATOM 1048 N N   . THR A 1 151 ? -30.077 10.614  81.145  1.00 67.13  ? 368 THR A N   1 
ATOM 1049 C CA  . THR A 1 151 ? -29.881 12.015  81.541  1.00 65.39  ? 368 THR A CA  1 
ATOM 1050 C C   . THR A 1 151 ? -29.061 12.134  82.822  1.00 69.34  ? 368 THR A C   1 
ATOM 1051 O O   . THR A 1 151 ? -28.077 12.883  82.845  1.00 69.83  ? 368 THR A O   1 
ATOM 1052 C CB  . THR A 1 151 ? -31.189 12.827  81.499  1.00 69.08  ? 368 THR A CB  1 
ATOM 1053 O OG1 . THR A 1 151 ? -31.699 12.831  80.164  1.00 66.12  ? 368 THR A OG1 1 
ATOM 1054 C CG2 . THR A 1 151 ? -31.011 14.278  81.944  1.00 67.45  ? 368 THR A CG2 1 
ATOM 1055 N N   . LYS A 1 152 ? -29.429 11.364  83.860  1.00 65.82  ? 369 LYS A N   1 
ATOM 1056 C CA  . LYS A 1 152 ? -28.705 11.326  85.136  1.00 64.09  ? 369 LYS A CA  1 
ATOM 1057 C C   . LYS A 1 152 ? -27.256 10.891  84.926  1.00 65.52  ? 369 LYS A C   1 
ATOM 1058 O O   . LYS A 1 152 ? -26.350 11.526  85.457  1.00 63.32  ? 369 LYS A O   1 
ATOM 1059 C CB  . LYS A 1 152 ? -29.404 10.398  86.131  1.00 67.26  ? 369 LYS A CB  1 
ATOM 1060 C CG  . LYS A 1 152 ? -30.676 10.982  86.736  1.00 65.35  ? 369 LYS A CG  1 
ATOM 1061 C CD  . LYS A 1 152 ? -31.060 10.220  87.965  1.00 69.00  ? 369 LYS A CD  1 
ATOM 1062 C CE  . LYS A 1 152 ? -32.308 10.772  88.567  1.00 80.91  ? 369 LYS A CE  1 
ATOM 1063 N NZ  . LYS A 1 152 ? -32.722 9.976   89.736  1.00 103.14 ? 369 LYS A NZ  1 
ATOM 1064 N N   . ASN A 1 153 ? -27.029 9.870   84.077  1.00 63.82  ? 370 ASN A N   1 
ATOM 1065 C CA  . ASN A 1 153 ? -25.672 9.399   83.745  1.00 63.78  ? 370 ASN A CA  1 
ATOM 1066 C C   . ASN A 1 153 ? -24.864 10.499  83.078  1.00 68.16  ? 370 ASN A C   1 
ATOM 1067 O O   . ASN A 1 153 ? -23.729 10.736  83.486  1.00 69.52  ? 370 ASN A O   1 
ATOM 1068 C CB  . ASN A 1 153 ? -25.699 8.129   82.893  1.00 59.10  ? 370 ASN A CB  1 
ATOM 1069 C CG  . ASN A 1 153 ? -25.573 6.825   83.678  1.00 83.89  ? 370 ASN A CG  1 
ATOM 1070 O OD1 . ASN A 1 153 ? -25.470 6.792   84.913  1.00 79.24  ? 370 ASN A OD1 1 
ATOM 1071 N ND2 . ASN A 1 153 ? -25.543 5.705   82.970  1.00 81.24  ? 370 ASN A ND2 1 
ATOM 1072 N N   . ASN A 1 154 ? -25.473 11.211  82.112  1.00 64.20  ? 371 ASN A N   1 
ATOM 1073 C CA  . ASN A 1 154 ? -24.863 12.331  81.386  1.00 65.79  ? 371 ASN A CA  1 
ATOM 1074 C C   . ASN A 1 154 ? -24.514 13.494  82.302  1.00 65.96  ? 371 ASN A C   1 
ATOM 1075 O O   . ASN A 1 154 ? -23.418 14.051  82.173  1.00 67.97  ? 371 ASN A O   1 
ATOM 1076 C CB  . ASN A 1 154 ? -25.780 12.832  80.260  1.00 71.26  ? 371 ASN A CB  1 
ATOM 1077 C CG  . ASN A 1 154 ? -25.890 11.930  79.063  1.00 86.34  ? 371 ASN A CG  1 
ATOM 1078 O OD1 . ASN A 1 154 ? -25.075 11.019  78.835  1.00 78.52  ? 371 ASN A OD1 1 
ATOM 1079 N ND2 . ASN A 1 154 ? -26.920 12.177  78.274  1.00 79.13  ? 371 ASN A ND2 1 
ATOM 1080 N N   . LEU A 1 155 ? -25.420 13.845  83.243  1.00 56.52  ? 372 LEU A N   1 
ATOM 1081 C CA  . LEU A 1 155 ? -25.167 14.916  84.210  1.00 54.19  ? 372 LEU A CA  1 
ATOM 1082 C C   . LEU A 1 155 ? -24.110 14.466  85.201  1.00 60.34  ? 372 LEU A C   1 
ATOM 1083 O O   . LEU A 1 155 ? -23.277 15.283  85.604  1.00 61.92  ? 372 LEU A O   1 
ATOM 1084 C CB  . LEU A 1 155 ? -26.468 15.303  84.936  1.00 52.27  ? 372 LEU A CB  1 
ATOM 1085 C CG  . LEU A 1 155 ? -26.428 16.420  85.978  1.00 55.44  ? 372 LEU A CG  1 
ATOM 1086 C CD1 . LEU A 1 155 ? -26.058 17.764  85.369  1.00 56.38  ? 372 LEU A CD1 1 
ATOM 1087 C CD2 . LEU A 1 155 ? -27.756 16.512  86.703  1.00 59.00  ? 372 LEU A CD2 1 
ATOM 1088 N N   . ALA A 1 156 ? -24.122 13.170  85.597  1.00 56.82  ? 373 ALA A N   1 
ATOM 1089 C CA  . ALA A 1 156 ? -23.128 12.690  86.548  1.00 57.87  ? 373 ALA A CA  1 
ATOM 1090 C C   . ALA A 1 156 ? -21.734 12.808  85.987  1.00 66.74  ? 373 ALA A C   1 
ATOM 1091 O O   . ALA A 1 156 ? -20.826 13.268  86.698  1.00 67.47  ? 373 ALA A O   1 
ATOM 1092 C CB  . ALA A 1 156 ? -23.422 11.267  86.970  1.00 58.09  ? 373 ALA A CB  1 
ATOM 1093 N N   . SER A 1 157 ? -21.586 12.488  84.682  1.00 67.12  ? 374 SER A N   1 
ATOM 1094 C CA  . SER A 1 157 ? -20.321 12.578  83.962  1.00 71.08  ? 374 SER A CA  1 
ATOM 1095 C C   . SER A 1 157 ? -19.811 14.019  83.900  1.00 79.10  ? 374 SER A C   1 
ATOM 1096 O O   . SER A 1 157 ? -18.604 14.258  84.018  1.00 82.73  ? 374 SER A O   1 
ATOM 1097 C CB  . SER A 1 157 ? -20.449 11.977  82.574  1.00 77.37  ? 374 SER A CB  1 
ATOM 1098 O OG  . SER A 1 157 ? -19.156 11.737  82.047  1.00 93.98  ? 374 SER A OG  1 
ATOM 1099 N N   . CYS A 1 158 ? -20.740 14.975  83.783  1.00 75.50  ? 375 CYS A N   1 
ATOM 1100 C CA  . CYS A 1 158 ? -20.445 16.401  83.779  1.00 78.11  ? 375 CYS A CA  1 
ATOM 1101 C C   . CYS A 1 158 ? -19.943 16.843  85.159  1.00 81.58  ? 375 CYS A C   1 
ATOM 1102 O O   . CYS A 1 158 ? -19.001 17.625  85.245  1.00 84.88  ? 375 CYS A O   1 
ATOM 1103 C CB  . CYS A 1 158 ? -21.674 17.192  83.355  1.00 79.02  ? 375 CYS A CB  1 
ATOM 1104 S SG  . CYS A 1 158 ? -21.419 18.976  83.338  1.00 86.93  ? 375 CYS A SG  1 
ATOM 1105 N N   . TYR A 1 159 ? -20.565 16.327  86.235  1.00 74.56  ? 376 TYR A N   1 
ATOM 1106 C CA  . TYR A 1 159 ? -20.195 16.612  87.615  1.00 72.99  ? 376 TYR A CA  1 
ATOM 1107 C C   . TYR A 1 159 ? -18.805 16.077  87.914  1.00 77.42  ? 376 TYR A C   1 
ATOM 1108 O O   . TYR A 1 159 ? -18.081 16.707  88.669  1.00 78.70  ? 376 TYR A O   1 
ATOM 1109 C CB  . TYR A 1 159 ? -21.198 15.968  88.584  1.00 70.32  ? 376 TYR A CB  1 
ATOM 1110 C CG  . TYR A 1 159 ? -22.553 16.629  88.672  1.00 68.84  ? 376 TYR A CG  1 
ATOM 1111 C CD1 . TYR A 1 159 ? -22.700 18.006  88.463  1.00 70.85  ? 376 TYR A CD1 1 
ATOM 1112 C CD2 . TYR A 1 159 ? -23.666 15.915  89.118  1.00 66.66  ? 376 TYR A CD2 1 
ATOM 1113 C CE1 . TYR A 1 159 ? -23.935 18.632  88.619  1.00 68.49  ? 376 TYR A CE1 1 
ATOM 1114 C CE2 . TYR A 1 159 ? -24.901 16.533  89.289  1.00 66.33  ? 376 TYR A CE2 1 
ATOM 1115 C CZ  . TYR A 1 159 ? -25.040 17.882  89.006  1.00 72.47  ? 376 TYR A CZ  1 
ATOM 1116 O OH  . TYR A 1 159 ? -26.284 18.445  89.143  1.00 70.45  ? 376 TYR A OH  1 
ATOM 1117 N N   . LEU A 1 160 ? -18.434 14.920  87.343  1.00 73.75  ? 377 LEU A N   1 
ATOM 1118 C CA  . LEU A 1 160 ? -17.092 14.361  87.522  1.00 77.21  ? 377 LEU A CA  1 
ATOM 1119 C C   . LEU A 1 160 ? -16.026 15.267  86.893  1.00 85.62  ? 377 LEU A C   1 
ATOM 1120 O O   . LEU A 1 160 ? -15.042 15.577  87.558  1.00 87.71  ? 377 LEU A O   1 
ATOM 1121 C CB  . LEU A 1 160 ? -16.982 12.956  86.919  1.00 78.05  ? 377 LEU A CB  1 
ATOM 1122 C CG  . LEU A 1 160 ? -17.767 11.858  87.610  1.00 80.95  ? 377 LEU A CG  1 
ATOM 1123 C CD1 . LEU A 1 160 ? -17.851 10.632  86.718  1.00 82.05  ? 377 LEU A CD1 1 
ATOM 1124 C CD2 . LEU A 1 160 ? -17.150 11.509  88.955  1.00 83.98  ? 377 LEU A CD2 1 
ATOM 1125 N N   . LYS A 1 161 ? -16.248 15.728  85.634  1.00 83.14  ? 378 LYS A N   1 
ATOM 1126 C CA  . LYS A 1 161 ? -15.338 16.606  84.913  1.00 87.89  ? 378 LYS A CA  1 
ATOM 1127 C C   . LYS A 1 161 ? -15.033 17.868  85.711  1.00 92.23  ? 378 LYS A C   1 
ATOM 1128 O O   . LYS A 1 161 ? -13.945 18.428  85.572  1.00 98.19  ? 378 LYS A O   1 
ATOM 1129 C CB  . LYS A 1 161 ? -15.921 16.983  83.538  1.00 93.13  ? 378 LYS A CB  1 
ATOM 1130 C CG  . LYS A 1 161 ? -15.224 16.326  82.347  1.00 109.81 ? 378 LYS A CG  1 
ATOM 1131 C CD  . LYS A 1 161 ? -15.847 14.970  81.959  1.00 113.12 ? 378 LYS A CD  1 
ATOM 1132 C CE  . LYS A 1 161 ? -16.864 15.084  80.843  1.00 120.16 ? 378 LYS A CE  1 
ATOM 1133 N NZ  . LYS A 1 161 ? -17.174 13.764  80.230  1.00 123.27 ? 378 LYS A NZ  1 
ATOM 1134 N N   . GLN A 1 162 ? -15.988 18.298  86.549  1.00 83.06  ? 379 GLN A N   1 
ATOM 1135 C CA  . GLN A 1 162 ? -15.895 19.484  87.397  1.00 83.99  ? 379 GLN A CA  1 
ATOM 1136 C C   . GLN A 1 162 ? -15.358 19.160  88.792  1.00 88.17  ? 379 GLN A C   1 
ATOM 1137 O O   . GLN A 1 162 ? -15.053 20.082  89.551  1.00 91.23  ? 379 GLN A O   1 
ATOM 1138 C CB  . GLN A 1 162 ? -17.265 20.172  87.507  1.00 82.66  ? 379 GLN A CB  1 
ATOM 1139 C CG  . GLN A 1 162 ? -17.821 20.703  86.191  1.00 82.83  ? 379 GLN A CG  1 
ATOM 1140 C CD  . GLN A 1 162 ? -19.214 21.238  86.394  1.00 92.99  ? 379 GLN A CD  1 
ATOM 1141 O OE1 . GLN A 1 162 ? -19.442 22.294  86.995  1.00 88.60  ? 379 GLN A OE1 1 
ATOM 1142 N NE2 . GLN A 1 162 ? -20.184 20.511  85.908  1.00 88.26  ? 379 GLN A NE2 1 
ATOM 1143 N N   . GLY A 1 163 ? -15.244 17.870  89.110  1.00 81.45  ? 380 GLY A N   1 
ATOM 1144 C CA  . GLY A 1 163 ? -14.768 17.397  90.406  1.00 80.41  ? 380 GLY A CA  1 
ATOM 1145 C C   . GLY A 1 163 ? -15.835 17.428  91.484  1.00 81.62  ? 380 GLY A C   1 
ATOM 1146 O O   . GLY A 1 163 ? -15.521 17.385  92.677  1.00 81.85  ? 380 GLY A O   1 
ATOM 1147 N N   . LYS A 1 164 ? -17.117 17.477  91.062  1.00 74.85  ? 381 LYS A N   1 
ATOM 1148 C CA  . LYS A 1 164 ? -18.303 17.494  91.917  1.00 70.80  ? 381 LYS A CA  1 
ATOM 1149 C C   . LYS A 1 164 ? -18.629 16.034  92.177  1.00 72.86  ? 381 LYS A C   1 
ATOM 1150 O O   . LYS A 1 164 ? -19.675 15.523  91.751  1.00 73.06  ? 381 LYS A O   1 
ATOM 1151 C CB  . LYS A 1 164 ? -19.458 18.268  91.209  1.00 71.27  ? 381 LYS A CB  1 
ATOM 1152 C CG  . LYS A 1 164 ? -19.122 19.749  90.944  1.00 70.98  ? 381 LYS A CG  1 
ATOM 1153 C CD  . LYS A 1 164 ? -20.182 20.553  90.177  1.00 76.98  ? 381 LYS A CD  1 
ATOM 1154 C CE  . LYS A 1 164 ? -21.384 20.928  91.013  1.00 85.93  ? 381 LYS A CE  1 
ATOM 1155 N NZ  . LYS A 1 164 ? -22.424 21.630  90.220  1.00 91.50  ? 381 LYS A NZ  1 
ATOM 1156 N N   . TYR A 1 165 ? -17.680 15.341  92.819  1.00 68.39  ? 382 TYR A N   1 
ATOM 1157 C CA  . TYR A 1 165 ? -17.757 13.914  93.135  1.00 66.34  ? 382 TYR A CA  1 
ATOM 1158 C C   . TYR A 1 165 ? -19.003 13.442  93.887  1.00 69.78  ? 382 TYR A C   1 
ATOM 1159 O O   . TYR A 1 165 ? -19.633 12.503  93.417  1.00 69.64  ? 382 TYR A O   1 
ATOM 1160 C CB  . TYR A 1 165 ? -16.459 13.392  93.755  1.00 67.81  ? 382 TYR A CB  1 
ATOM 1161 C CG  . TYR A 1 165 ? -15.285 13.494  92.820  1.00 71.45  ? 382 TYR A CG  1 
ATOM 1162 C CD1 . TYR A 1 165 ? -15.426 13.237  91.463  1.00 73.98  ? 382 TYR A CD1 1 
ATOM 1163 C CD2 . TYR A 1 165 ? -14.024 13.838  93.288  1.00 75.55  ? 382 TYR A CD2 1 
ATOM 1164 C CE1 . TYR A 1 165 ? -14.349 13.351  90.587  1.00 77.29  ? 382 TYR A CE1 1 
ATOM 1165 C CE2 . TYR A 1 165 ? -12.929 13.930  92.423  1.00 79.13  ? 382 TYR A CE2 1 
ATOM 1166 C CZ  . TYR A 1 165 ? -13.100 13.679  91.073  1.00 80.03  ? 382 TYR A CZ  1 
ATOM 1167 O OH  . TYR A 1 165 ? -12.060 13.744  90.190  1.00 83.78  ? 382 TYR A OH  1 
ATOM 1168 N N   . GLN A 1 166 ? -19.393 14.115  94.993  1.00 66.28  ? 383 GLN A N   1 
ATOM 1169 C CA  . GLN A 1 166 ? -20.607 13.795  95.763  1.00 64.52  ? 383 GLN A CA  1 
ATOM 1170 C C   . GLN A 1 166 ? -21.855 13.938  94.901  1.00 66.71  ? 383 GLN A C   1 
ATOM 1171 O O   . GLN A 1 166 ? -22.733 13.067  94.934  1.00 66.37  ? 383 GLN A O   1 
ATOM 1172 C CB  . GLN A 1 166 ? -20.721 14.678  97.018  1.00 66.43  ? 383 GLN A CB  1 
ATOM 1173 C CG  . GLN A 1 166 ? -21.360 13.964  98.215  1.00 89.08  ? 383 GLN A CG  1 
ATOM 1174 C CD  . GLN A 1 166 ? -20.953 14.561  99.568  1.00 115.19 ? 383 GLN A CD  1 
ATOM 1175 O OE1 . GLN A 1 166 ? -20.844 15.786  99.742  1.00 106.53 ? 383 GLN A OE1 1 
ATOM 1176 N NE2 . GLN A 1 166 ? -20.713 13.703  100.569 1.00 110.89 ? 383 GLN A NE2 1 
ATOM 1177 N N   . ASP A 1 167 ? -21.884 14.987  94.072  1.00 62.87  ? 384 ASP A N   1 
ATOM 1178 C CA  . ASP A 1 167 ? -23.019 15.231  93.200  1.00 63.14  ? 384 ASP A CA  1 
ATOM 1179 C C   . ASP A 1 167 ? -23.211 14.119  92.221  1.00 66.87  ? 384 ASP A C   1 
ATOM 1180 O O   . ASP A 1 167 ? -24.340 13.650  92.086  1.00 65.51  ? 384 ASP A O   1 
ATOM 1181 C CB  . ASP A 1 167 ? -22.933 16.597  92.532  1.00 67.15  ? 384 ASP A CB  1 
ATOM 1182 C CG  . ASP A 1 167 ? -22.827 17.692  93.570  1.00 87.25  ? 384 ASP A CG  1 
ATOM 1183 O OD1 . ASP A 1 167 ? -21.673 17.988  94.009  1.00 92.26  ? 384 ASP A OD1 1 
ATOM 1184 O OD2 . ASP A 1 167 ? -23.898 18.171  94.042  1.00 89.49  ? 384 ASP A OD2 1 
ATOM 1185 N N   . ALA A 1 168 ? -22.097 13.618  91.625  1.00 64.61  ? 385 ALA A N   1 
ATOM 1186 C CA  . ALA A 1 168 ? -22.111 12.489  90.691  1.00 63.69  ? 385 ALA A CA  1 
ATOM 1187 C C   . ALA A 1 168 ? -22.572 11.245  91.428  1.00 66.95  ? 385 ALA A C   1 
ATOM 1188 O O   . ALA A 1 168 ? -23.514 10.590  90.992  1.00 67.12  ? 385 ALA A O   1 
ATOM 1189 C CB  . ALA A 1 168 ? -20.727 12.268  90.110  1.00 65.96  ? 385 ALA A CB  1 
ATOM 1190 N N   . GLU A 1 169 ? -21.980 10.996  92.604  1.00 63.57  ? 386 GLU A N   1 
ATOM 1191 C CA  . GLU A 1 169 ? -22.250 9.848   93.462  1.00 63.33  ? 386 GLU A CA  1 
ATOM 1192 C C   . GLU A 1 169 ? -23.724 9.693   93.774  1.00 64.86  ? 386 GLU A C   1 
ATOM 1193 O O   . GLU A 1 169 ? -24.262 8.580   93.714  1.00 65.17  ? 386 GLU A O   1 
ATOM 1194 C CB  . GLU A 1 169 ? -21.453 9.971   94.758  1.00 65.98  ? 386 GLU A CB  1 
ATOM 1195 C CG  . GLU A 1 169 ? -21.375 8.689   95.559  1.00 79.23  ? 386 GLU A CG  1 
ATOM 1196 C CD  . GLU A 1 169 ? -20.843 8.896   96.960  1.00 100.32 ? 386 GLU A CD  1 
ATOM 1197 O OE1 . GLU A 1 169 ? -19.615 9.094   97.108  1.00 95.81  ? 386 GLU A OE1 1 
ATOM 1198 O OE2 . GLU A 1 169 ? -21.659 8.878   97.908  1.00 90.05  ? 386 GLU A OE2 1 
ATOM 1199 N N   . THR A 1 170 ? -24.380 10.806  94.088  1.00 59.57  ? 387 THR A N   1 
ATOM 1200 C CA  . THR A 1 170 ? -25.804 10.798  94.401  1.00 58.53  ? 387 THR A CA  1 
ATOM 1201 C C   . THR A 1 170 ? -26.630 10.402  93.214  1.00 62.23  ? 387 THR A C   1 
ATOM 1202 O O   . THR A 1 170 ? -27.581 9.642   93.373  1.00 64.71  ? 387 THR A O   1 
ATOM 1203 C CB  . THR A 1 170 ? -26.212 12.099  95.007  1.00 58.63  ? 387 THR A CB  1 
ATOM 1204 O OG1 . THR A 1 170 ? -25.455 12.251  96.218  1.00 65.45  ? 387 THR A OG1 1 
ATOM 1205 C CG2 . THR A 1 170 ? -27.693 12.164  95.295  1.00 51.30  ? 387 THR A CG2 1 
ATOM 1206 N N   . LEU A 1 171 ? -26.251 10.879  92.030  1.00 56.29  ? 388 LEU A N   1 
ATOM 1207 C CA  . LEU A 1 171 ? -26.968 10.552  90.812  1.00 56.55  ? 388 LEU A CA  1 
ATOM 1208 C C   . LEU A 1 171 ? -26.900 9.064   90.498  1.00 60.38  ? 388 LEU A C   1 
ATOM 1209 O O   . LEU A 1 171 ? -27.954 8.467   90.287  1.00 60.10  ? 388 LEU A O   1 
ATOM 1210 C CB  . LEU A 1 171 ? -26.478 11.397  89.636  1.00 56.47  ? 388 LEU A CB  1 
ATOM 1211 C CG  . LEU A 1 171 ? -26.972 12.840  89.621  1.00 60.60  ? 388 LEU A CG  1 
ATOM 1212 C CD1 . LEU A 1 171 ? -26.355 13.567  88.484  1.00 61.71  ? 388 LEU A CD1 1 
ATOM 1213 C CD2 . LEU A 1 171 ? -28.484 12.919  89.521  1.00 60.74  ? 388 LEU A CD2 1 
ATOM 1214 N N   . TYR A 1 172 ? -25.678 8.452   90.544  1.00 56.17  ? 389 TYR A N   1 
ATOM 1215 C CA  . TYR A 1 172 ? -25.478 7.025   90.311  1.00 56.70  ? 389 TYR A CA  1 
ATOM 1216 C C   . TYR A 1 172 ? -26.279 6.199   91.318  1.00 63.29  ? 389 TYR A C   1 
ATOM 1217 O O   . TYR A 1 172 ? -26.991 5.263   90.918  1.00 64.66  ? 389 TYR A O   1 
ATOM 1218 C CB  . TYR A 1 172 ? -24.003 6.667   90.411  1.00 58.80  ? 389 TYR A CB  1 
ATOM 1219 C CG  . TYR A 1 172 ? -23.171 7.297   89.324  1.00 62.71  ? 389 TYR A CG  1 
ATOM 1220 C CD1 . TYR A 1 172 ? -23.620 7.320   87.998  1.00 66.14  ? 389 TYR A CD1 1 
ATOM 1221 C CD2 . TYR A 1 172 ? -21.912 7.839   89.603  1.00 62.46  ? 389 TYR A CD2 1 
ATOM 1222 C CE1 . TYR A 1 172 ? -22.852 7.889   86.987  1.00 67.56  ? 389 TYR A CE1 1 
ATOM 1223 C CE2 . TYR A 1 172 ? -21.140 8.420   88.599  1.00 63.66  ? 389 TYR A CE2 1 
ATOM 1224 C CZ  . TYR A 1 172 ? -21.624 8.461   87.295  1.00 71.72  ? 389 TYR A CZ  1 
ATOM 1225 O OH  . TYR A 1 172 ? -20.899 9.057   86.289  1.00 71.03  ? 389 TYR A OH  1 
ATOM 1226 N N   . LYS A 1 173 ? -26.211 6.585   92.615  1.00 58.47  ? 390 LYS A N   1 
ATOM 1227 C CA  . LYS A 1 173 ? -26.930 5.894   93.669  1.00 60.13  ? 390 LYS A CA  1 
ATOM 1228 C C   . LYS A 1 173 ? -28.443 5.921   93.435  1.00 68.35  ? 390 LYS A C   1 
ATOM 1229 O O   . LYS A 1 173 ? -29.084 4.884   93.602  1.00 70.92  ? 390 LYS A O   1 
ATOM 1230 C CB  . LYS A 1 173 ? -26.532 6.424   95.050  1.00 61.43  ? 390 LYS A CB  1 
ATOM 1231 C CG  . LYS A 1 173 ? -25.247 5.831   95.552  1.00 59.99  ? 390 LYS A CG  1 
ATOM 1232 C CD  . LYS A 1 173 ? -24.833 6.411   96.852  1.00 64.65  ? 390 LYS A CD  1 
ATOM 1233 C CE  . LYS A 1 173 ? -23.405 6.009   97.144  1.00 65.13  ? 390 LYS A CE  1 
ATOM 1234 N NZ  . LYS A 1 173 ? -22.945 6.527   98.467  1.00 57.80  ? 390 LYS A NZ  1 
ATOM 1235 N N   . GLU A 1 174 ? -28.995 7.073   92.982  1.00 65.44  ? 391 GLU A N   1 
ATOM 1236 C CA  . GLU A 1 174 ? -30.427 7.235   92.645  1.00 67.70  ? 391 GLU A CA  1 
ATOM 1237 C C   . GLU A 1 174 ? -30.835 6.244   91.510  1.00 73.93  ? 391 GLU A C   1 
ATOM 1238 O O   . GLU A 1 174 ? -31.916 5.636   91.581  1.00 76.81  ? 391 GLU A O   1 
ATOM 1239 C CB  . GLU A 1 174 ? -30.734 8.680   92.200  1.00 67.84  ? 391 GLU A CB  1 
ATOM 1240 C CG  . GLU A 1 174 ? -30.751 9.717   93.310  1.00 78.38  ? 391 GLU A CG  1 
ATOM 1241 C CD  . GLU A 1 174 ? -30.941 11.156  92.853  1.00 109.94 ? 391 GLU A CD  1 
ATOM 1242 O OE1 . GLU A 1 174 ? -31.321 11.375  91.678  1.00 121.86 ? 391 GLU A OE1 1 
ATOM 1243 O OE2 . GLU A 1 174 ? -30.731 12.069  93.685  1.00 100.41 ? 391 GLU A OE2 1 
ATOM 1244 N N   . ILE A 1 175 ? -29.956 6.084   90.481  1.00 67.27  ? 392 ILE A N   1 
ATOM 1245 C CA  . ILE A 1 175 ? -30.173 5.168   89.359  1.00 67.82  ? 392 ILE A CA  1 
ATOM 1246 C C   . ILE A 1 175 ? -30.226 3.739   89.908  1.00 72.72  ? 392 ILE A C   1 
ATOM 1247 O O   . ILE A 1 175 ? -31.215 3.036   89.686  1.00 74.47  ? 392 ILE A O   1 
ATOM 1248 C CB  . ILE A 1 175 ? -29.104 5.326   88.227  1.00 69.06  ? 392 ILE A CB  1 
ATOM 1249 C CG1 . ILE A 1 175 ? -29.213 6.687   87.520  1.00 65.98  ? 392 ILE A CG1 1 
ATOM 1250 C CG2 . ILE A 1 175 ? -29.151 4.144   87.218  1.00 73.36  ? 392 ILE A CG2 1 
ATOM 1251 C CD1 . ILE A 1 175 ? -27.918 7.169   86.974  1.00 65.81  ? 392 ILE A CD1 1 
ATOM 1252 N N   . LEU A 1 176 ? -29.181 3.341   90.652  1.00 67.49  ? 393 LEU A N   1 
ATOM 1253 C CA  . LEU A 1 176 ? -29.093 2.013   91.257  1.00 69.43  ? 393 LEU A CA  1 
ATOM 1254 C C   . LEU A 1 176 ? -30.249 1.696   92.225  1.00 73.73  ? 393 LEU A C   1 
ATOM 1255 O O   . LEU A 1 176 ? -30.792 0.591   92.143  1.00 76.72  ? 393 LEU A O   1 
ATOM 1256 C CB  . LEU A 1 176 ? -27.724 1.801   91.929  1.00 68.86  ? 393 LEU A CB  1 
ATOM 1257 C CG  . LEU A 1 176 ? -26.495 1.895   91.014  1.00 71.15  ? 393 LEU A CG  1 
ATOM 1258 C CD1 . LEU A 1 176 ? -25.260 1.756   91.803  1.00 71.37  ? 393 LEU A CD1 1 
ATOM 1259 C CD2 . LEU A 1 176 ? -26.521 0.864   89.907  1.00 72.44  ? 393 LEU A CD2 1 
ATOM 1260 N N   . THR A 1 177 ? -30.667 2.675   93.091  1.00 66.76  ? 394 THR A N   1 
ATOM 1261 C CA  . THR A 1 177 ? -31.786 2.486   94.033  1.00 67.87  ? 394 THR A CA  1 
ATOM 1262 C C   . THR A 1 177 ? -33.089 2.242   93.296  1.00 74.10  ? 394 THR A C   1 
ATOM 1263 O O   . THR A 1 177 ? -33.836 1.323   93.670  1.00 78.52  ? 394 THR A O   1 
ATOM 1264 C CB  . THR A 1 177 ? -31.920 3.631   95.043  1.00 67.07  ? 394 THR A CB  1 
ATOM 1265 O OG1 . THR A 1 177 ? -30.679 3.839   95.712  1.00 66.94  ? 394 THR A OG1 1 
ATOM 1266 C CG2 . THR A 1 177 ? -32.976 3.355   96.103  1.00 64.05  ? 394 THR A CG2 1 
ATOM 1267 N N   . ARG A 1 178 ? -33.357 3.034   92.232  1.00 67.74  ? 395 ARG A N   1 
ATOM 1268 C CA  . ARG A 1 178 ? -34.589 2.844   91.465  1.00 69.84  ? 395 ARG A CA  1 
ATOM 1269 C C   . ARG A 1 178 ? -34.578 1.482   90.767  1.00 75.40  ? 395 ARG A C   1 
ATOM 1270 O O   . ARG A 1 178 ? -35.566 0.747   90.854  1.00 80.58  ? 395 ARG A O   1 
ATOM 1271 C CB  . ARG A 1 178 ? -34.850 4.012   90.503  1.00 66.16  ? 395 ARG A CB  1 
ATOM 1272 C CG  . ARG A 1 178 ? -36.123 3.875   89.666  1.00 78.00  ? 395 ARG A CG  1 
ATOM 1273 C CD  . ARG A 1 178 ? -37.384 4.158   90.445  1.00 95.53  ? 395 ARG A CD  1 
ATOM 1274 N NE  . ARG A 1 178 ? -38.461 3.235   90.084  1.00 110.33 ? 395 ARG A NE  1 
ATOM 1275 C CZ  . ARG A 1 178 ? -39.183 2.552   90.965  1.00 136.34 ? 395 ARG A CZ  1 
ATOM 1276 N NH1 . ARG A 1 178 ? -38.952 2.682   92.270  1.00 126.73 ? 395 ARG A NH1 1 
ATOM 1277 N NH2 . ARG A 1 178 ? -40.145 1.735   90.551  1.00 130.79 ? 395 ARG A NH2 1 
ATOM 1278 N N   . ALA A 1 179 ? -33.431 1.122   90.161  1.00 68.08  ? 396 ALA A N   1 
ATOM 1279 C CA  . ALA A 1 179 ? -33.253 -0.153  89.482  1.00 70.98  ? 396 ALA A CA  1 
ATOM 1280 C C   . ALA A 1 179 ? -33.566 -1.308  90.466  1.00 83.84  ? 396 ALA A C   1 
ATOM 1281 O O   . ALA A 1 179 ? -34.330 -2.241  90.125  1.00 88.05  ? 396 ALA A O   1 
ATOM 1282 C CB  . ALA A 1 179 ? -31.834 -0.261  88.946  1.00 68.45  ? 396 ALA A CB  1 
ATOM 1283 N N   . HIS A 1 180 ? -33.046 -1.185  91.716  1.00 80.69  ? 397 HIS A N   1 
ATOM 1284 C CA  . HIS A 1 180 ? -33.273 -2.185  92.751  1.00 85.82  ? 397 HIS A CA  1 
ATOM 1285 C C   . HIS A 1 180 ? -34.739 -2.252  93.129  1.00 97.35  ? 397 HIS A C   1 
ATOM 1286 O O   . HIS A 1 180 ? -35.300 -3.350  93.204  1.00 102.88 ? 397 HIS A O   1 
ATOM 1287 C CB  . HIS A 1 180 ? -32.427 -1.909  93.989  1.00 83.85  ? 397 HIS A CB  1 
ATOM 1288 C CG  . HIS A 1 180 ? -32.588 -2.955  95.043  1.00 91.58  ? 397 HIS A CG  1 
ATOM 1289 N ND1 . HIS A 1 180 ? -31.894 -4.152  94.984  1.00 96.01  ? 397 HIS A ND1 1 
ATOM 1290 C CD2 . HIS A 1 180 ? -33.374 -2.954  96.143  1.00 96.61  ? 397 HIS A CD2 1 
ATOM 1291 C CE1 . HIS A 1 180 ? -32.264 -4.832  96.055  1.00 100.36 ? 397 HIS A CE1 1 
ATOM 1292 N NE2 . HIS A 1 180 ? -33.153 -4.152  96.784  1.00 101.24 ? 397 HIS A NE2 1 
ATOM 1293 N N   . GLU A 1 181 ? -35.351 -1.077  93.359  1.00 92.56  ? 398 GLU A N   1 
ATOM 1294 C CA  . GLU A 1 181 ? -36.744 -0.964  93.754  1.00 96.46  ? 398 GLU A CA  1 
ATOM 1295 C C   . GLU A 1 181 ? -37.722 -1.517  92.726  1.00 103.24 ? 398 GLU A C   1 
ATOM 1296 O O   . GLU A 1 181 ? -38.695 -2.155  93.129  1.00 109.05 ? 398 GLU A O   1 
ATOM 1297 C CB  . GLU A 1 181 ? -37.079 0.468   94.178  1.00 95.38  ? 398 GLU A CB  1 
ATOM 1298 C CG  . GLU A 1 181 ? -36.569 0.789   95.575  1.00 109.34 ? 398 GLU A CG  1 
ATOM 1299 C CD  . GLU A 1 181 ? -37.064 2.095   96.166  1.00 136.27 ? 398 GLU A CD  1 
ATOM 1300 O OE1 . GLU A 1 181 ? -36.813 3.164   95.561  1.00 115.14 ? 398 GLU A OE1 1 
ATOM 1301 O OE2 . GLU A 1 181 ? -37.708 2.045   97.240  1.00 148.81 ? 398 GLU A OE2 1 
ATOM 1302 N N   . LYS A 1 182 ? -37.462 -1.328  91.411  1.00 96.38  ? 399 LYS A N   1 
ATOM 1303 C CA  . LYS A 1 182 ? -38.382 -1.855  90.402  1.00 100.48 ? 399 LYS A CA  1 
ATOM 1304 C C   . LYS A 1 182 ? -38.369 -3.378  90.296  1.00 110.42 ? 399 LYS A C   1 
ATOM 1305 O O   . LYS A 1 182 ? -39.421 -3.974  90.071  1.00 116.45 ? 399 LYS A O   1 
ATOM 1306 C CB  . LYS A 1 182 ? -38.288 -1.141  89.038  1.00 99.66  ? 399 LYS A CB  1 
ATOM 1307 C CG  . LYS A 1 182 ? -36.960 -1.262  88.310  1.00 115.45 ? 399 LYS A CG  1 
ATOM 1308 C CD  . LYS A 1 182 ? -36.998 -2.318  87.197  1.00 130.20 ? 399 LYS A CD  1 
ATOM 1309 C CE  . LYS A 1 182 ? -35.666 -2.460  86.486  1.00 140.01 ? 399 LYS A CE  1 
ATOM 1310 N NZ  . LYS A 1 182 ? -34.583 -3.016  87.356  1.00 144.89 ? 399 LYS A NZ  1 
ATOM 1311 N N   . GLU A 1 183 ? -37.198 -4.004  90.512  1.00 104.86 ? 400 GLU A N   1 
ATOM 1312 C CA  . GLU A 1 183 ? -37.050 -5.454  90.460  1.00 109.45 ? 400 GLU A CA  1 
ATOM 1313 C C   . GLU A 1 183 ? -37.364 -6.122  91.796  1.00 119.90 ? 400 GLU A C   1 
ATOM 1314 O O   . GLU A 1 183 ? -37.873 -7.243  91.793  1.00 127.57 ? 400 GLU A O   1 
ATOM 1315 C CB  . GLU A 1 183 ? -35.639 -5.847  89.981  1.00 107.59 ? 400 GLU A CB  1 
ATOM 1316 C CG  . GLU A 1 183 ? -35.590 -6.409  88.567  1.00 117.63 ? 400 GLU A CG  1 
ATOM 1317 C CD  . GLU A 1 183 ? -35.996 -7.867  88.401  1.00 149.50 ? 400 GLU A CD  1 
ATOM 1318 O OE1 . GLU A 1 183 ? -35.243 -8.754  88.870  1.00 140.86 ? 400 GLU A OE1 1 
ATOM 1319 O OE2 . GLU A 1 183 ? -37.052 -8.124  87.777  1.00 148.21 ? 400 GLU A OE2 1 
ATOM 1320 N N   . PHE A 1 184 ? -37.099 -5.442  92.923  1.00 113.92 ? 401 PHE A N   1 
ATOM 1321 C CA  . PHE A 1 184 ? -37.269 -6.049  94.240  1.00 118.96 ? 401 PHE A CA  1 
ATOM 1322 C C   . PHE A 1 184 ? -38.309 -5.474  95.199  1.00 129.68 ? 401 PHE A C   1 
ATOM 1323 O O   . PHE A 1 184 ? -38.805 -6.204  96.066  1.00 135.99 ? 401 PHE A O   1 
ATOM 1324 C CB  . PHE A 1 184 ? -35.916 -6.231  94.936  1.00 117.25 ? 401 PHE A CB  1 
ATOM 1325 C CG  . PHE A 1 184 ? -34.941 -7.096  94.181  1.00 117.76 ? 401 PHE A CG  1 
ATOM 1326 C CD1 . PHE A 1 184 ? -34.082 -6.544  93.243  1.00 114.56 ? 401 PHE A CD1 1 
ATOM 1327 C CD2 . PHE A 1 184 ? -34.843 -8.458  94.445  1.00 124.72 ? 401 PHE A CD2 1 
ATOM 1328 C CE1 . PHE A 1 184 ? -33.181 -7.345  92.540  1.00 115.53 ? 401 PHE A CE1 1 
ATOM 1329 C CE2 . PHE A 1 184 ? -33.924 -9.246  93.762  1.00 127.98 ? 401 PHE A CE2 1 
ATOM 1330 C CZ  . PHE A 1 184 ? -33.119 -8.687  92.793  1.00 120.17 ? 401 PHE A CZ  1 
ATOM 1331 N N   . GLY A 1 185 ? -38.629 -4.198  95.054  1.00 125.10 ? 402 GLY A N   1 
ATOM 1332 C CA  . GLY A 1 185 ? -39.572 -3.529  95.940  1.00 128.61 ? 402 GLY A CA  1 
ATOM 1333 C C   . GLY A 1 185 ? -38.866 -2.514  96.811  1.00 131.29 ? 402 GLY A C   1 
ATOM 1334 O O   . GLY A 1 185 ? -37.635 -2.398  96.758  1.00 125.64 ? 402 GLY A O   1 
ATOM 1335 N N   . SER A 1 186 ? -39.641 -1.764  97.615  1.00 132.55 ? 403 SER A N   1 
ATOM 1336 C CA  . SER A 1 186 ? -39.098 -0.725  98.495  1.00 129.42 ? 403 SER A CA  1 
ATOM 1337 C C   . SER A 1 186 ? -38.071 -1.274  99.503  1.00 134.68 ? 403 SER A C   1 
ATOM 1338 O O   . SER A 1 186 ? -38.356 -2.252  100.214 1.00 140.28 ? 403 SER A O   1 
ATOM 1339 C CB  . SER A 1 186 ? -40.215 0.075   99.163  1.00 135.97 ? 403 SER A CB  1 
ATOM 1340 O OG  . SER A 1 186 ? -40.725 1.063   98.278  1.00 139.24 ? 403 SER A OG  1 
ATOM 1341 N N   . VAL A 1 187 ? -36.852 -0.666  99.497  1.00 125.03 ? 404 VAL A N   1 
ATOM 1342 C CA  . VAL A 1 187 ? -35.711 -1.055  100.337 1.00 124.23 ? 404 VAL A CA  1 
ATOM 1343 C C   . VAL A 1 187 ? -35.991 -1.029  101.861 1.00 132.99 ? 404 VAL A C   1 
ATOM 1344 O O   . VAL A 1 187 ? -36.414 -0.007  102.405 1.00 132.24 ? 404 VAL A O   1 
ATOM 1345 C CB  . VAL A 1 187 ? -34.313 -0.520  99.879  1.00 121.35 ? 404 VAL A CB  1 
ATOM 1346 C CG1 . VAL A 1 187 ? -34.421 0.530   98.776  1.00 116.51 ? 404 VAL A CG1 1 
ATOM 1347 C CG2 . VAL A 1 187 ? -33.440 -0.042  101.041 1.00 119.70 ? 404 VAL A CG2 1 
ATOM 1348 N N   . ASN A 1 188 ? -35.824 -2.200  102.508 1.00 134.53 ? 405 ASN A N   1 
ATOM 1349 C CA  . ASN A 1 188 ? -36.075 -2.425  103.931 1.00 139.35 ? 405 ASN A CA  1 
ATOM 1350 C C   . ASN A 1 188 ? -34.797 -2.931  104.640 1.00 142.00 ? 405 ASN A C   1 
ATOM 1351 O O   . ASN A 1 188 ? -33.715 -2.411  104.380 1.00 134.71 ? 405 ASN A O   1 
ATOM 1352 C CB  . ASN A 1 188 ? -37.283 -3.378  104.103 1.00 149.56 ? 405 ASN A CB  1 
ATOM 1353 C CG  . ASN A 1 188 ? -38.068 -3.232  105.396 1.00 185.33 ? 405 ASN A CG  1 
ATOM 1354 O OD1 . ASN A 1 188 ? -38.985 -2.411  105.515 1.00 184.17 ? 405 ASN A OD1 1 
ATOM 1355 N ND2 . ASN A 1 188 ? -37.802 -4.103  106.363 1.00 180.56 ? 405 ASN A ND2 1 
ATOM 1356 N N   . GLY A 1 189 ? -34.939 -3.912  105.531 1.00 146.56 ? 406 GLY A N   1 
ATOM 1357 C CA  . GLY A 1 189 ? -33.847 -4.490  106.309 1.00 147.68 ? 406 GLY A CA  1 
ATOM 1358 C C   . GLY A 1 189 ? -32.887 -5.310  105.474 1.00 148.66 ? 406 GLY A C   1 
ATOM 1359 O O   . GLY A 1 189 ? -31.730 -4.919  105.298 1.00 142.92 ? 406 GLY A O   1 
ATOM 1360 N N   . GLU A 1 190 ? -33.372 -6.453  104.952 1.00 148.37 ? 407 GLU A N   1 
ATOM 1361 C CA  . GLU A 1 190 ? -32.602 -7.373  104.104 1.00 146.65 ? 407 GLU A CA  1 
ATOM 1362 C C   . GLU A 1 190 ? -32.463 -6.800  102.679 1.00 140.57 ? 407 GLU A C   1 
ATOM 1363 O O   . GLU A 1 190 ? -31.379 -6.860  102.080 1.00 136.30 ? 407 GLU A O   1 
ATOM 1364 C CB  . GLU A 1 190 ? -33.279 -8.754  104.052 1.00 156.44 ? 407 GLU A CB  1 
ATOM 1365 C CG  . GLU A 1 190 ? -33.284 -9.514  105.368 1.00 173.08 ? 407 GLU A CG  1 
ATOM 1366 C CD  . GLU A 1 190 ? -34.004 -10.854 105.344 1.00 194.92 ? 407 GLU A CD  1 
ATOM 1367 O OE1 . GLU A 1 190 ? -33.681 -11.692 104.470 1.00 183.76 ? 407 GLU A OE1 1 
ATOM 1368 O OE2 . GLU A 1 190 ? -34.864 -11.082 106.225 1.00 191.09 ? 407 GLU A OE2 1 
ATOM 1369 N N   . ASN A 1 191 ? -33.573 -6.236  102.156 1.00 133.10 ? 408 ASN A N   1 
ATOM 1370 C CA  . ASN A 1 191 ? -33.683 -5.642  100.827 1.00 126.19 ? 408 ASN A CA  1 
ATOM 1371 C C   . ASN A 1 191 ? -32.916 -4.308  100.767 1.00 119.86 ? 408 ASN A C   1 
ATOM 1372 O O   . ASN A 1 191 ? -33.429 -3.297  101.240 1.00 118.98 ? 408 ASN A O   1 
ATOM 1373 C CB  . ASN A 1 191 ? -35.171 -5.445  100.499 1.00 128.09 ? 408 ASN A CB  1 
ATOM 1374 C CG  . ASN A 1 191 ? -35.482 -5.139  99.062  1.00 142.51 ? 408 ASN A CG  1 
ATOM 1375 O OD1 . ASN A 1 191 ? -36.315 -4.282  98.753  1.00 133.06 ? 408 ASN A OD1 1 
ATOM 1376 N ND2 . ASN A 1 191 ? -34.873 -5.872  98.152  1.00 134.42 ? 408 ASN A ND2 1 
ATOM 1377 N N   . LYS A 1 192 ? -31.672 -4.312  100.237 1.00 108.30 ? 409 LYS A N   1 
ATOM 1378 C CA  . LYS A 1 192 ? -30.823 -3.109  100.141 1.00 98.77  ? 409 LYS A CA  1 
ATOM 1379 C C   . LYS A 1 192 ? -30.279 -2.957  98.712  1.00 94.25  ? 409 LYS A C   1 
ATOM 1380 O O   . LYS A 1 192 ? -30.004 -3.980  98.090  1.00 96.33  ? 409 LYS A O   1 
ATOM 1381 C CB  . LYS A 1 192 ? -29.612 -3.219  101.097 1.00 100.02 ? 409 LYS A CB  1 
ATOM 1382 C CG  . LYS A 1 192 ? -29.903 -3.275  102.590 1.00 109.68 ? 409 LYS A CG  1 
ATOM 1383 C CD  . LYS A 1 192 ? -28.592 -3.280  103.367 1.00 112.82 ? 409 LYS A CD  1 
ATOM 1384 C CE  . LYS A 1 192 ? -28.739 -3.619  104.832 1.00 128.95 ? 409 LYS A CE  1 
ATOM 1385 N NZ  . LYS A 1 192 ? -28.797 -5.091  105.068 1.00 146.71 ? 409 LYS A NZ  1 
ATOM 1386 N N   . PRO A 1 193 ? -30.018 -1.732  98.187  1.00 83.04  ? 410 PRO A N   1 
ATOM 1387 C CA  . PRO A 1 193 ? -29.423 -1.626  96.840  1.00 79.68  ? 410 PRO A CA  1 
ATOM 1388 C C   . PRO A 1 193 ? -27.963 -2.095  96.832  1.00 84.66  ? 410 PRO A C   1 
ATOM 1389 O O   . PRO A 1 193 ? -27.337 -2.177  97.900  1.00 85.80  ? 410 PRO A O   1 
ATOM 1390 C CB  . PRO A 1 193 ? -29.523 -0.130  96.513  1.00 76.23  ? 410 PRO A CB  1 
ATOM 1391 C CG  . PRO A 1 193 ? -30.402 0.459   97.549  1.00 81.16  ? 410 PRO A CG  1 
ATOM 1392 C CD  . PRO A 1 193 ? -30.236 -0.395  98.764  1.00 81.12  ? 410 PRO A CD  1 
ATOM 1393 N N   . ILE A 1 194 ? -27.428 -2.433  95.635  1.00 79.69  ? 411 ILE A N   1 
ATOM 1394 C CA  . ILE A 1 194 ? -26.048 -2.928  95.454  1.00 78.87  ? 411 ILE A CA  1 
ATOM 1395 C C   . ILE A 1 194 ? -25.001 -2.038  96.117  1.00 78.38  ? 411 ILE A C   1 
ATOM 1396 O O   . ILE A 1 194 ? -24.143 -2.547  96.830  1.00 78.81  ? 411 ILE A O   1 
ATOM 1397 C CB  . ILE A 1 194 ? -25.703 -3.319  93.968  1.00 82.09  ? 411 ILE A CB  1 
ATOM 1398 C CG1 . ILE A 1 194 ? -24.338 -4.047  93.818  1.00 84.33  ? 411 ILE A CG1 1 
ATOM 1399 C CG2 . ILE A 1 194 ? -25.800 -2.127  93.002  1.00 78.77  ? 411 ILE A CG2 1 
ATOM 1400 C CD1 . ILE A 1 194 ? -24.230 -5.429  94.446  1.00 100.99 ? 411 ILE A CD1 1 
ATOM 1401 N N   . TRP A 1 195 ? -25.101 -0.711  95.928  1.00 71.93  ? 412 TRP A N   1 
ATOM 1402 C CA  . TRP A 1 195 ? -24.153 0.235   96.513  1.00 69.43  ? 412 TRP A CA  1 
ATOM 1403 C C   . TRP A 1 195 ? -24.114 0.185   98.060  1.00 79.09  ? 412 TRP A C   1 
ATOM 1404 O O   . TRP A 1 195 ? -23.030 0.303   98.617  1.00 79.76  ? 412 TRP A O   1 
ATOM 1405 C CB  . TRP A 1 195 ? -24.353 1.637   95.947  1.00 63.02  ? 412 TRP A CB  1 
ATOM 1406 C CG  . TRP A 1 195 ? -25.695 2.220   96.259  1.00 63.47  ? 412 TRP A CG  1 
ATOM 1407 C CD1 . TRP A 1 195 ? -26.810 2.191   95.472  1.00 66.27  ? 412 TRP A CD1 1 
ATOM 1408 C CD2 . TRP A 1 195 ? -26.071 2.911   97.466  1.00 63.06  ? 412 TRP A CD2 1 
ATOM 1409 N NE1 . TRP A 1 195 ? -27.847 2.849   96.097  1.00 65.12  ? 412 TRP A NE1 1 
ATOM 1410 C CE2 . TRP A 1 195 ? -27.417 3.314   97.315  1.00 66.30  ? 412 TRP A CE2 1 
ATOM 1411 C CE3 . TRP A 1 195 ? -25.386 3.260   98.650  1.00 63.96  ? 412 TRP A CE3 1 
ATOM 1412 C CZ2 . TRP A 1 195 ? -28.095 4.043   98.303  1.00 65.64  ? 412 TRP A CZ2 1 
ATOM 1413 C CZ3 . TRP A 1 195 ? -26.050 4.013   99.604  1.00 65.11  ? 412 TRP A CZ3 1 
ATOM 1414 C CH2 . TRP A 1 195 ? -27.399 4.369   99.442  1.00 65.65  ? 412 TRP A CH2 1 
ATOM 1415 N N   . MET A 1 196 ? -25.265 -0.056  98.737  1.00 79.51  ? 413 MET A N   1 
ATOM 1416 C CA  . MET A 1 196 ? -25.319 -0.227  100.195 1.00 84.02  ? 413 MET A CA  1 
ATOM 1417 C C   . MET A 1 196 ? -24.556 -1.482  100.625 1.00 94.78  ? 413 MET A C   1 
ATOM 1418 O O   . MET A 1 196 ? -23.798 -1.438  101.593 1.00 95.17  ? 413 MET A O   1 
ATOM 1419 C CB  . MET A 1 196 ? -26.744 -0.368  100.676 1.00 89.46  ? 413 MET A CB  1 
ATOM 1420 C CG  . MET A 1 196 ? -27.397 0.924   100.890 1.00 91.79  ? 413 MET A CG  1 
ATOM 1421 S SD  . MET A 1 196 ? -28.588 0.755   102.201 1.00 101.81 ? 413 MET A SD  1 
ATOM 1422 C CE  . MET A 1 196 ? -29.160 2.381   102.275 1.00 95.15  ? 413 MET A CE  1 
ATOM 1423 N N   . HIS A 1 197 ? -24.741 -2.595  99.889  1.00 96.16  ? 414 HIS A N   1 
ATOM 1424 C CA  . HIS A 1 197 ? -24.036 -3.855  100.136 1.00 101.26 ? 414 HIS A CA  1 
ATOM 1425 C C   . HIS A 1 197 ? -22.522 -3.686  99.948  1.00 103.80 ? 414 HIS A C   1 
ATOM 1426 O O   . HIS A 1 197 ? -21.750 -4.299  100.682 1.00 107.71 ? 414 HIS A O   1 
ATOM 1427 C CB  . HIS A 1 197 ? -24.563 -4.959  99.210  1.00 105.67 ? 414 HIS A CB  1 
ATOM 1428 C CG  . HIS A 1 197 ? -25.921 -5.488  99.583  1.00 113.10 ? 414 HIS A CG  1 
ATOM 1429 N ND1 . HIS A 1 197 ? -26.181 -6.007  100.852 1.00 119.69 ? 414 HIS A ND1 1 
ATOM 1430 C CD2 . HIS A 1 197 ? -27.033 -5.630  98.822  1.00 115.12 ? 414 HIS A CD2 1 
ATOM 1431 C CE1 . HIS A 1 197 ? -27.442 -6.411  100.825 1.00 122.05 ? 414 HIS A CE1 1 
ATOM 1432 N NE2 . HIS A 1 197 ? -27.996 -6.212  99.626  1.00 119.82 ? 414 HIS A NE2 1 
ATOM 1433 N N   . ALA A 1 198 ? -22.111 -2.838  98.970  1.00 94.84  ? 415 ALA A N   1 
ATOM 1434 C CA  . ALA A 1 198 ? -20.721 -2.521  98.635  1.00 92.54  ? 415 ALA A CA  1 
ATOM 1435 C C   . ALA A 1 198 ? -20.075 -1.691  99.742  1.00 92.72  ? 415 ALA A C   1 
ATOM 1436 O O   . ALA A 1 198 ? -18.931 -1.940  100.104 1.00 94.52  ? 415 ALA A O   1 
ATOM 1437 C CB  . ALA A 1 198 ? -20.662 -1.782  97.301  1.00 89.43  ? 415 ALA A CB  1 
ATOM 1438 N N   . GLU A 1 199 ? -20.822 -0.734  100.302 1.00 85.86  ? 416 GLU A N   1 
ATOM 1439 C CA  . GLU A 1 199 ? -20.345 0.137   101.380 1.00 84.37  ? 416 GLU A CA  1 
ATOM 1440 C C   . GLU A 1 199 ? -20.219 -0.603  102.706 1.00 93.73  ? 416 GLU A C   1 
ATOM 1441 O O   . GLU A 1 199 ? -19.270 -0.349  103.447 1.00 94.43  ? 416 GLU A O   1 
ATOM 1442 C CB  . GLU A 1 199 ? -21.162 1.421   101.478 1.00 81.25  ? 416 GLU A CB  1 
ATOM 1443 C CG  . GLU A 1 199 ? -20.943 2.275   100.245 1.00 84.62  ? 416 GLU A CG  1 
ATOM 1444 C CD  . GLU A 1 199 ? -21.387 3.719   100.281 1.00 97.88  ? 416 GLU A CD  1 
ATOM 1445 O OE1 . GLU A 1 199 ? -20.685 4.534   100.919 1.00 83.27  ? 416 GLU A OE1 1 
ATOM 1446 O OE2 . GLU A 1 199 ? -22.344 4.060   99.551  1.00 97.99  ? 416 GLU A OE2 1 
ATOM 1447 N N   . GLU A 1 200 ? -21.126 -1.571  102.962 1.00 93.66  ? 417 GLU A N   1 
ATOM 1448 C CA  . GLU A 1 200 ? -21.123 -2.439  104.154 1.00 97.98  ? 417 GLU A CA  1 
ATOM 1449 C C   . GLU A 1 200 ? -19.971 -3.453  104.085 1.00 105.44 ? 417 GLU A C   1 
ATOM 1450 O O   . GLU A 1 200 ? -19.392 -3.795  105.114 1.00 108.44 ? 417 GLU A O   1 
ATOM 1451 C CB  . GLU A 1 200 ? -22.470 -3.156  104.312 1.00 101.86 ? 417 GLU A CB  1 
ATOM 1452 C CG  . GLU A 1 200 ? -23.577 -2.226  104.790 1.00 109.72 ? 417 GLU A CG  1 
ATOM 1453 C CD  . GLU A 1 200 ? -24.965 -2.813  104.983 1.00 134.13 ? 417 GLU A CD  1 
ATOM 1454 O OE1 . GLU A 1 200 ? -25.241 -3.924  104.470 1.00 127.64 ? 417 GLU A OE1 1 
ATOM 1455 O OE2 . GLU A 1 200 ? -25.786 -2.144  105.653 1.00 126.80 ? 417 GLU A OE2 1 
ATOM 1456 N N   . ARG A 1 201 ? -19.634 -3.906  102.861 1.00 102.14 ? 418 ARG A N   1 
ATOM 1457 C CA  . ARG A 1 201 ? -18.525 -4.809  102.547 1.00 105.49 ? 418 ARG A CA  1 
ATOM 1458 C C   . ARG A 1 201 ? -17.192 -4.115  102.856 1.00 110.92 ? 418 ARG A C   1 
ATOM 1459 O O   . ARG A 1 201 ? -16.284 -4.765  103.385 1.00 116.12 ? 418 ARG A O   1 
ATOM 1460 C CB  . ARG A 1 201 ? -18.553 -5.208  101.064 1.00 102.45 ? 418 ARG A CB  1 
ATOM 1461 C CG  . ARG A 1 201 ? -18.920 -6.653  100.827 1.00 115.43 ? 418 ARG A CG  1 
ATOM 1462 C CD  . ARG A 1 201 ? -18.707 -7.050  99.384  1.00 126.37 ? 418 ARG A CD  1 
ATOM 1463 N NE  . ARG A 1 201 ? -18.199 -8.417  99.278  1.00 142.73 ? 418 ARG A NE  1 
ATOM 1464 C CZ  . ARG A 1 201 ? -18.048 -9.089  98.140  1.00 166.45 ? 418 ARG A CZ  1 
ATOM 1465 N NH1 . ARG A 1 201 ? -18.363 -8.524  96.980  1.00 153.93 ? 418 ARG A NH1 1 
ATOM 1466 N NH2 . ARG A 1 201 ? -17.585 -10.332 98.152  1.00 163.94 ? 418 ARG A NH2 1 
ATOM 1467 N N   . GLU A 1 202 ? -17.072 -2.802  102.516 1.00 102.64 ? 419 GLU A N   1 
ATOM 1468 C CA  . GLU A 1 202 ? -15.885 -1.993  102.783 1.00 102.18 ? 419 GLU A CA  1 
ATOM 1469 C C   . GLU A 1 202 ? -15.704 -1.827  104.287 1.00 110.74 ? 419 GLU A C   1 
ATOM 1470 O O   . GLU A 1 202 ? -14.585 -1.989  104.785 1.00 115.37 ? 419 GLU A O   1 
ATOM 1471 C CB  . GLU A 1 202 ? -15.985 -0.623  102.118 1.00 98.33  ? 419 GLU A CB  1 
ATOM 1472 C CG  . GLU A 1 202 ? -14.987 -0.421  100.994 1.00 112.00 ? 419 GLU A CG  1 
ATOM 1473 C CD  . GLU A 1 202 ? -13.536 -0.195  101.380 1.00 145.84 ? 419 GLU A CD  1 
ATOM 1474 O OE1 . GLU A 1 202 ? -13.287 0.598   102.317 1.00 139.96 ? 419 GLU A OE1 1 
ATOM 1475 O OE2 . GLU A 1 202 ? -12.646 -0.729  100.677 1.00 149.86 ? 419 GLU A OE2 1 
ATOM 1476 N N   . GLU A 1 203 ? -16.815 -1.574  105.021 1.00 124.53 ? 420 GLU A N   1 
ATOM 1477 C CA  . GLU A 1 203 ? -16.837 -1.393  106.479 1.00 126.14 ? 420 GLU A CA  1 
ATOM 1478 C C   . GLU A 1 203 ? -16.300 -2.577  107.302 1.00 130.76 ? 420 GLU A C   1 
ATOM 1479 O O   . GLU A 1 203 ? -16.163 -2.442  108.517 1.00 133.28 ? 420 GLU A O   1 
ATOM 1480 C CB  . GLU A 1 203 ? -18.229 -0.954  106.967 1.00 126.94 ? 420 GLU A CB  1 
ATOM 1481 C CG  . GLU A 1 203 ? -18.569 0.501   106.659 1.00 138.60 ? 420 GLU A CG  1 
ATOM 1482 C CD  . GLU A 1 203 ? -17.671 1.595   107.223 1.00 159.35 ? 420 GLU A CD  1 
ATOM 1483 O OE1 . GLU A 1 203 ? -17.151 1.429   108.352 1.00 159.96 ? 420 GLU A OE1 1 
ATOM 1484 O OE2 . GLU A 1 203 ? -17.512 2.637   106.544 1.00 145.24 ? 420 GLU A OE2 1 
ATOM 1485 N N   . SER A 1 204 ? -15.980 -3.717  106.643 1.00 125.20 ? 421 SER A N   1 
ATOM 1486 C CA  . SER A 1 204 ? -15.428 -4.929  107.257 1.00 136.50 ? 421 SER A CA  1 
ATOM 1487 C C   . SER A 1 204 ? -14.272 -5.506  106.429 1.00 140.14 ? 421 SER A C   1 
ATOM 1488 O O   . SER A 1 204 ? -13.241 -4.854  106.263 1.00 99.06  ? 421 SER A O   1 
ATOM 1489 C CB  . SER A 1 204 ? -16.519 -5.980  107.447 1.00 138.54 ? 421 SER A CB  1 
ATOM 1490 O OG  . SER A 1 204 ? -17.056 -6.431  106.215 1.00 142.33 ? 421 SER A OG  1 
ATOM 1491 N N   . ALA A 1 223 ? -25.693 -11.638 93.456  1.00 144.28 ? 440 ALA A N   1 
ATOM 1492 C CA  . ALA A 1 223 ? -27.150 -11.590 93.530  1.00 145.54 ? 440 ALA A CA  1 
ATOM 1493 C C   . ALA A 1 223 ? -27.708 -10.268 92.962  1.00 149.70 ? 440 ALA A C   1 
ATOM 1494 O O   . ALA A 1 223 ? -28.746 -9.780  93.428  1.00 149.31 ? 440 ALA A O   1 
ATOM 1495 C CB  . ALA A 1 223 ? -27.609 -11.806 94.969  1.00 147.38 ? 440 ALA A CB  1 
ATOM 1496 N N   . CYS A 1 224 ? -27.022 -9.710  91.927  1.00 146.42 ? 441 CYS A N   1 
ATOM 1497 C CA  . CYS A 1 224 ? -27.389 -8.454  91.246  1.00 145.84 ? 441 CYS A CA  1 
ATOM 1498 C C   . CYS A 1 224 ? -27.924 -8.634  89.810  1.00 149.67 ? 441 CYS A C   1 
ATOM 1499 O O   . CYS A 1 224 ? -29.141 -8.564  89.607  1.00 149.84 ? 441 CYS A O   1 
ATOM 1500 C CB  . CYS A 1 224 ? -26.275 -7.400  91.333  1.00 145.12 ? 441 CYS A CB  1 
ATOM 1501 S SG  . CYS A 1 224 ? -24.809 -7.715  90.293  1.00 148.52 ? 441 CYS A SG  1 
ATOM 1502 N N   . LYS A 1 225 ? -27.008 -8.885  88.836  1.00 145.50 ? 442 LYS A N   1 
ATOM 1503 C CA  . LYS A 1 225 ? -27.232 -9.079  87.399  1.00 145.82 ? 442 LYS A CA  1 
ATOM 1504 C C   . LYS A 1 225 ? -28.323 -8.209  86.728  1.00 151.40 ? 442 LYS A C   1 
ATOM 1505 O O   . LYS A 1 225 ? -29.276 -8.740  86.141  1.00 152.45 ? 442 LYS A O   1 
ATOM 1506 C CB  . LYS A 1 225 ? -27.329 -10.568 87.020  1.00 148.43 ? 442 LYS A CB  1 
ATOM 1507 C CG  . LYS A 1 225 ? -26.691 -10.875 85.669  1.00 150.20 ? 442 LYS A CG  1 
ATOM 1508 C CD  . LYS A 1 225 ? -27.562 -11.786 84.822  1.00 151.47 ? 442 LYS A CD  1 
ATOM 1509 C CE  . LYS A 1 225 ? -26.763 -12.848 84.105  1.00 150.59 ? 442 LYS A CE  1 
ATOM 1510 N NZ  . LYS A 1 225 ? -26.009 -12.301 82.948  1.00 153.83 ? 442 LYS A NZ  1 
ATOM 1511 N N   . VAL A 1 226 ? -28.176 -6.868  86.818  1.00 147.40 ? 443 VAL A N   1 
ATOM 1512 C CA  . VAL A 1 226 ? -29.098 -5.940  86.149  1.00 147.58 ? 443 VAL A CA  1 
ATOM 1513 C C   . VAL A 1 226 ? -28.635 -5.860  84.671  1.00 151.77 ? 443 VAL A C   1 
ATOM 1514 O O   . VAL A 1 226 ? -27.544 -5.353  84.390  1.00 151.52 ? 443 VAL A O   1 
ATOM 1515 C CB  . VAL A 1 226 ? -29.218 -4.550  86.836  1.00 150.07 ? 443 VAL A CB  1 
ATOM 1516 C CG1 . VAL A 1 226 ? -30.452 -3.799  86.335  1.00 150.09 ? 443 VAL A CG1 1 
ATOM 1517 C CG2 . VAL A 1 226 ? -29.252 -4.676  88.361  1.00 149.22 ? 443 VAL A CG2 1 
ATOM 1518 N N   . ASP A 1 227 ? -29.455 -6.409  83.746  1.00 148.14 ? 444 ASP A N   1 
ATOM 1519 C CA  . ASP A 1 227 ? -29.187 -6.560  82.304  1.00 148.36 ? 444 ASP A CA  1 
ATOM 1520 C C   . ASP A 1 227 ? -29.071 -5.300  81.417  1.00 149.16 ? 444 ASP A C   1 
ATOM 1521 O O   . ASP A 1 227 ? -28.631 -5.413  80.263  1.00 149.77 ? 444 ASP A O   1 
ATOM 1522 C CB  . ASP A 1 227 ? -30.143 -7.600  81.687  1.00 152.44 ? 444 ASP A CB  1 
ATOM 1523 C CG  . ASP A 1 227 ? -30.140 -8.971  82.351  1.00 164.41 ? 444 ASP A CG  1 
ATOM 1524 O OD1 . ASP A 1 227 ? -29.194 -9.261  83.122  1.00 163.64 ? 444 ASP A OD1 1 
ATOM 1525 O OD2 . ASP A 1 227 ? -31.076 -9.758  82.089  1.00 173.17 ? 444 ASP A OD2 1 
ATOM 1526 N N   . SER A 1 228 ? -29.451 -4.120  81.948  1.00 141.52 ? 445 SER A N   1 
ATOM 1527 C CA  . SER A 1 228 ? -29.407 -2.849  81.224  1.00 139.85 ? 445 SER A CA  1 
ATOM 1528 C C   . SER A 1 228 ? -27.963 -2.377  80.992  1.00 140.60 ? 445 SER A C   1 
ATOM 1529 O O   . SER A 1 228 ? -27.134 -2.505  81.899  1.00 139.35 ? 445 SER A O   1 
ATOM 1530 C CB  . SER A 1 228 ? -30.199 -1.782  81.977  1.00 141.53 ? 445 SER A CB  1 
ATOM 1531 O OG  . SER A 1 228 ? -30.307 -0.573  81.243  1.00 148.54 ? 445 SER A OG  1 
ATOM 1532 N N   . PRO A 1 229 ? -27.634 -1.831  79.797  1.00 136.01 ? 446 PRO A N   1 
ATOM 1533 C CA  . PRO A 1 229 ? -26.262 -1.328  79.581  1.00 135.31 ? 446 PRO A CA  1 
ATOM 1534 C C   . PRO A 1 229 ? -26.045 0.033   80.246  1.00 136.65 ? 446 PRO A C   1 
ATOM 1535 O O   . PRO A 1 229 ? -24.911 0.412   80.549  1.00 135.75 ? 446 PRO A O   1 
ATOM 1536 C CB  . PRO A 1 229 ? -26.134 -1.245  78.053  1.00 139.20 ? 446 PRO A CB  1 
ATOM 1537 C CG  . PRO A 1 229 ? -27.512 -1.453  77.499  1.00 144.64 ? 446 PRO A CG  1 
ATOM 1538 C CD  . PRO A 1 229 ? -28.491 -1.595  78.617  1.00 138.89 ? 446 PRO A CD  1 
ATOM 1539 N N   . THR A 1 230 ? -27.158 0.766   80.452  1.00 98.81  ? 447 THR A N   1 
ATOM 1540 C CA  . THR A 1 230 ? -27.231 2.079   81.098  1.00 96.35  ? 447 THR A CA  1 
ATOM 1541 C C   . THR A 1 230 ? -26.921 1.890   82.588  1.00 95.41  ? 447 THR A C   1 
ATOM 1542 O O   . THR A 1 230 ? -26.141 2.665   83.144  1.00 93.80  ? 447 THR A O   1 
ATOM 1543 C CB  . THR A 1 230 ? -28.604 2.750   80.829  1.00 104.92 ? 447 THR A CB  1 
ATOM 1544 O OG1 . THR A 1 230 ? -29.059 2.439   79.496  1.00 105.99 ? 447 THR A OG1 1 
ATOM 1545 C CG2 . THR A 1 230 ? -28.565 4.264   81.030  1.00 100.62 ? 447 THR A CG2 1 
ATOM 1546 N N   . VAL A 1 231 ? -27.475 0.807   83.205  1.00 89.42  ? 448 VAL A N   1 
ATOM 1547 C CA  . VAL A 1 231 ? -27.240 0.450   84.607  1.00 86.29  ? 448 VAL A CA  1 
ATOM 1548 C C   . VAL A 1 231 ? -25.790 0.016   84.751  1.00 88.35  ? 448 VAL A C   1 
ATOM 1549 O O   . VAL A 1 231 ? -25.114 0.434   85.696  1.00 87.32  ? 448 VAL A O   1 
ATOM 1550 C CB  . VAL A 1 231 ? -28.259 -0.590  85.161  1.00 90.03  ? 448 VAL A CB  1 
ATOM 1551 C CG1 . VAL A 1 231 ? -27.792 -1.176  86.489  1.00 88.00  ? 448 VAL A CG1 1 
ATOM 1552 C CG2 . VAL A 1 231 ? -29.639 0.043   85.340  1.00 90.21  ? 448 VAL A CG2 1 
ATOM 1553 N N   . ASN A 1 232 ? -25.305 -0.776  83.780  1.00 84.10  ? 449 ASN A N   1 
ATOM 1554 C CA  . ASN A 1 232 ? -23.930 -1.252  83.710  1.00 83.14  ? 449 ASN A CA  1 
ATOM 1555 C C   . ASN A 1 232 ? -22.904 -0.095  83.754  1.00 83.79  ? 449 ASN A C   1 
ATOM 1556 O O   . ASN A 1 232 ? -21.909 -0.179  84.478  1.00 82.88  ? 449 ASN A O   1 
ATOM 1557 C CB  . ASN A 1 232 ? -23.742 -2.099  82.448  1.00 87.61  ? 449 ASN A CB  1 
ATOM 1558 C CG  . ASN A 1 232 ? -23.352 -3.530  82.750  1.00 115.60 ? 449 ASN A CG  1 
ATOM 1559 O OD1 . ASN A 1 232 ? -22.162 -3.865  82.829  1.00 108.59 ? 449 ASN A OD1 1 
ATOM 1560 N ND2 . ASN A 1 232 ? -24.346 -4.402  82.962  1.00 105.52 ? 449 ASN A ND2 1 
ATOM 1561 N N   . THR A 1 233 ? -23.165 0.978   82.995  1.00 78.57  ? 450 THR A N   1 
ATOM 1562 C CA  . THR A 1 233 ? -22.330 2.169   82.927  1.00 77.97  ? 450 THR A CA  1 
ATOM 1563 C C   . THR A 1 233 ? -22.277 2.792   84.327  1.00 80.81  ? 450 THR A C   1 
ATOM 1564 O O   . THR A 1 233 ? -21.184 3.049   84.851  1.00 81.46  ? 450 THR A O   1 
ATOM 1565 C CB  . THR A 1 233 ? -22.912 3.157   81.901  1.00 88.81  ? 450 THR A CB  1 
ATOM 1566 O OG1 . THR A 1 233 ? -23.309 2.474   80.697  1.00 90.30  ? 450 THR A OG1 1 
ATOM 1567 C CG2 . THR A 1 233 ? -21.959 4.299   81.596  1.00 85.99  ? 450 THR A CG2 1 
ATOM 1568 N N   . THR A 1 234 ? -23.470 2.984   84.940  1.00 73.65  ? 451 THR A N   1 
ATOM 1569 C CA  . THR A 1 234 ? -23.637 3.496   86.288  1.00 70.17  ? 451 THR A CA  1 
ATOM 1570 C C   . THR A 1 234 ? -22.759 2.714   87.274  1.00 73.46  ? 451 THR A C   1 
ATOM 1571 O O   . THR A 1 234 ? -21.992 3.347   88.009  1.00 74.75  ? 451 THR A O   1 
ATOM 1572 C CB  . THR A 1 234 ? -25.116 3.467   86.656  1.00 65.71  ? 451 THR A CB  1 
ATOM 1573 O OG1 . THR A 1 234 ? -25.816 4.220   85.685  1.00 62.56  ? 451 THR A OG1 1 
ATOM 1574 C CG2 . THR A 1 234 ? -25.392 4.011   88.042  1.00 62.01  ? 451 THR A CG2 1 
ATOM 1575 N N   . LEU A 1 235 ? -22.820 1.357   87.263  1.00 68.34  ? 452 LEU A N   1 
ATOM 1576 C CA  . LEU A 1 235 ? -22.031 0.531   88.191  1.00 68.36  ? 452 LEU A CA  1 
ATOM 1577 C C   . LEU A 1 235 ? -20.551 0.779   88.058  1.00 75.70  ? 452 LEU A C   1 
ATOM 1578 O O   . LEU A 1 235 ? -19.912 1.124   89.048  1.00 77.24  ? 452 LEU A O   1 
ATOM 1579 C CB  . LEU A 1 235 ? -22.317 -0.955  88.065  1.00 68.55  ? 452 LEU A CB  1 
ATOM 1580 C CG  . LEU A 1 235 ? -23.714 -1.387  88.399  1.00 72.78  ? 452 LEU A CG  1 
ATOM 1581 C CD1 . LEU A 1 235 ? -24.177 -2.470  87.436  1.00 74.84  ? 452 LEU A CD1 1 
ATOM 1582 C CD2 . LEU A 1 235 ? -23.811 -1.837  89.816  1.00 71.30  ? 452 LEU A CD2 1 
ATOM 1583 N N   . ARG A 1 236 ? -20.027 0.657   86.829  1.00 73.15  ? 453 ARG A N   1 
ATOM 1584 C CA  . ARG A 1 236 ? -18.643 0.902   86.429  1.00 73.99  ? 453 ARG A CA  1 
ATOM 1585 C C   . ARG A 1 236 ? -18.194 2.328   86.838  1.00 79.00  ? 453 ARG A C   1 
ATOM 1586 O O   . ARG A 1 236 ? -17.054 2.493   87.298  1.00 81.09  ? 453 ARG A O   1 
ATOM 1587 C CB  . ARG A 1 236 ? -18.503 0.723   84.901  1.00 74.94  ? 453 ARG A CB  1 
ATOM 1588 C CG  . ARG A 1 236 ? -18.642 -0.708  84.407  1.00 85.02  ? 453 ARG A CG  1 
ATOM 1589 C CD  . ARG A 1 236 ? -18.308 -0.832  82.936  1.00 110.95 ? 453 ARG A CD  1 
ATOM 1590 N NE  . ARG A 1 236 ? -18.212 -2.236  82.515  1.00 135.50 ? 453 ARG A NE  1 
ATOM 1591 C CZ  . ARG A 1 236 ? -19.177 -2.908  81.889  1.00 150.63 ? 453 ARG A CZ  1 
ATOM 1592 N NH1 . ARG A 1 236 ? -20.328 -2.311  81.591  1.00 134.08 ? 453 ARG A NH1 1 
ATOM 1593 N NH2 . ARG A 1 236 ? -18.996 -4.180  81.549  1.00 133.84 ? 453 ARG A NH2 1 
ATOM 1594 N N   . SER A 1 237 ? -19.095 3.348   86.693  1.00 72.61  ? 454 SER A N   1 
ATOM 1595 C CA  . SER A 1 237 ? -18.788 4.721   87.091  1.00 71.92  ? 454 SER A CA  1 
ATOM 1596 C C   . SER A 1 237 ? -18.790 4.857   88.604  1.00 75.59  ? 454 SER A C   1 
ATOM 1597 O O   . SER A 1 237 ? -17.852 5.437   89.145  1.00 76.40  ? 454 SER A O   1 
ATOM 1598 C CB  . SER A 1 237 ? -19.764 5.716   86.474  1.00 74.96  ? 454 SER A CB  1 
ATOM 1599 O OG  . SER A 1 237 ? -19.711 5.754   85.060  1.00 84.50  ? 454 SER A OG  1 
ATOM 1600 N N   . LEU A 1 238 ? -19.825 4.340   89.308  1.00 71.41  ? 455 LEU A N   1 
ATOM 1601 C CA  . LEU A 1 238 ? -19.835 4.467   90.767  1.00 71.76  ? 455 LEU A CA  1 
ATOM 1602 C C   . LEU A 1 238 ? -18.700 3.637   91.368  1.00 78.31  ? 455 LEU A C   1 
ATOM 1603 O O   . LEU A 1 238 ? -18.169 3.995   92.427  1.00 78.46  ? 455 LEU A O   1 
ATOM 1604 C CB  . LEU A 1 238 ? -21.200 4.122   91.370  1.00 70.53  ? 455 LEU A CB  1 
ATOM 1605 C CG  . LEU A 1 238 ? -21.336 4.260   92.899  1.00 75.36  ? 455 LEU A CG  1 
ATOM 1606 C CD1 . LEU A 1 238 ? -21.088 5.669   93.370  1.00 76.60  ? 455 LEU A CD1 1 
ATOM 1607 C CD2 . LEU A 1 238 ? -22.673 3.808   93.355  1.00 76.61  ? 455 LEU A CD2 1 
ATOM 1608 N N   . GLY A 1 239 ? -18.317 2.577   90.639  1.00 75.31  ? 456 GLY A N   1 
ATOM 1609 C CA  . GLY A 1 239 ? -17.199 1.702   90.944  1.00 76.45  ? 456 GLY A CA  1 
ATOM 1610 C C   . GLY A 1 239 ? -15.925 2.517   90.908  1.00 84.15  ? 456 GLY A C   1 
ATOM 1611 O O   . GLY A 1 239 ? -15.147 2.497   91.869  1.00 86.54  ? 456 GLY A O   1 
ATOM 1612 N N   . ALA A 1 240 ? -15.760 3.314   89.838  1.00 80.14  ? 457 ALA A N   1 
ATOM 1613 C CA  . ALA A 1 240 ? -14.634 4.225   89.635  1.00 82.20  ? 457 ALA A CA  1 
ATOM 1614 C C   . ALA A 1 240 ? -14.509 5.257   90.774  1.00 86.38  ? 457 ALA A C   1 
ATOM 1615 O O   . ALA A 1 240 ? -13.404 5.470   91.279  1.00 88.83  ? 457 ALA A O   1 
ATOM 1616 C CB  . ALA A 1 240 ? -14.778 4.935   88.299  1.00 82.96  ? 457 ALA A CB  1 
ATOM 1617 N N   . LEU A 1 241 ? -15.641 5.856   91.197  1.00 80.23  ? 458 LEU A N   1 
ATOM 1618 C CA  . LEU A 1 241 ? -15.709 6.821   92.294  1.00 80.32  ? 458 LEU A CA  1 
ATOM 1619 C C   . LEU A 1 241 ? -15.252 6.208   93.626  1.00 88.41  ? 458 LEU A C   1 
ATOM 1620 O O   . LEU A 1 241 ? -14.530 6.868   94.378  1.00 91.10  ? 458 LEU A O   1 
ATOM 1621 C CB  . LEU A 1 241 ? -17.137 7.371   92.444  1.00 78.03  ? 458 LEU A CB  1 
ATOM 1622 C CG  . LEU A 1 241 ? -17.451 8.700   91.774  1.00 82.15  ? 458 LEU A CG  1 
ATOM 1623 C CD1 . LEU A 1 241 ? -18.901 9.072   91.973  1.00 80.31  ? 458 LEU A CD1 1 
ATOM 1624 C CD2 . LEU A 1 241 ? -16.628 9.810   92.349  1.00 87.63  ? 458 LEU A CD2 1 
ATOM 1625 N N   . TYR A 1 242 ? -15.667 4.950   93.918  1.00 85.15  ? 459 TYR A N   1 
ATOM 1626 C CA  . TYR A 1 242 ? -15.297 4.249   95.154  1.00 86.87  ? 459 TYR A CA  1 
ATOM 1627 C C   . TYR A 1 242 ? -13.783 4.014   95.228  1.00 93.63  ? 459 TYR A C   1 
ATOM 1628 O O   . TYR A 1 242 ? -13.187 4.146   96.304  1.00 94.24  ? 459 TYR A O   1 
ATOM 1629 C CB  . TYR A 1 242 ? -16.070 2.922   95.292  1.00 86.57  ? 459 TYR A CB  1 
ATOM 1630 C CG  . TYR A 1 242 ? -17.512 3.050   95.733  1.00 86.18  ? 459 TYR A CG  1 
ATOM 1631 C CD1 . TYR A 1 242 ? -17.889 3.988   96.689  1.00 89.48  ? 459 TYR A CD1 1 
ATOM 1632 C CD2 . TYR A 1 242 ? -18.484 2.168   95.271  1.00 84.02  ? 459 TYR A CD2 1 
ATOM 1633 C CE1 . TYR A 1 242 ? -19.210 4.092   97.122  1.00 89.17  ? 459 TYR A CE1 1 
ATOM 1634 C CE2 . TYR A 1 242 ? -19.806 2.252   95.709  1.00 82.82  ? 459 TYR A CE2 1 
ATOM 1635 C CZ  . TYR A 1 242 ? -20.164 3.223   96.627  1.00 91.31  ? 459 TYR A CZ  1 
ATOM 1636 O OH  . TYR A 1 242 ? -21.455 3.330   97.071  1.00 95.29  ? 459 TYR A OH  1 
ATOM 1637 N N   . ARG A 1 243 ? -13.171 3.696   94.057  1.00 90.61  ? 460 ARG A N   1 
ATOM 1638 C CA  . ARG A 1 243 ? -11.736 3.480   93.836  1.00 92.24  ? 460 ARG A CA  1 
ATOM 1639 C C   . ARG A 1 243 ? -10.992 4.789   94.155  1.00 96.78  ? 460 ARG A C   1 
ATOM 1640 O O   . ARG A 1 243 ? -9.979  4.767   94.853  1.00 99.88  ? 460 ARG A O   1 
ATOM 1641 C CB  . ARG A 1 243 ? -11.517 3.067   92.371  1.00 90.92  ? 460 ARG A CB  1 
ATOM 1642 C CG  . ARG A 1 243 ? -10.213 2.360   92.065  1.00 101.88 ? 460 ARG A CG  1 
ATOM 1643 C CD  . ARG A 1 243 ? -10.378 1.517   90.808  1.00 105.58 ? 460 ARG A CD  1 
ATOM 1644 N NE  . ARG A 1 243 ? -11.025 0.245   91.114  1.00 110.29 ? 460 ARG A NE  1 
ATOM 1645 C CZ  . ARG A 1 243 ? -10.370 -0.870  91.424  1.00 138.22 ? 460 ARG A CZ  1 
ATOM 1646 N NH1 . ARG A 1 243 ? -9.042  -0.894  91.415  1.00 137.62 ? 460 ARG A NH1 1 
ATOM 1647 N NH2 . ARG A 1 243 ? -11.035 -1.976  91.717  1.00 126.30 ? 460 ARG A NH2 1 
ATOM 1648 N N   . ARG A 1 244 ? -11.543 5.922   93.688  1.00 93.19  ? 461 ARG A N   1 
ATOM 1649 C CA  . ARG A 1 244 ? -11.064 7.284   93.915  1.00 98.56  ? 461 ARG A CA  1 
ATOM 1650 C C   . ARG A 1 244 ? -11.141 7.668   95.422  1.00 106.70 ? 461 ARG A C   1 
ATOM 1651 O O   . ARG A 1 244 ? -10.312 8.429   95.913  1.00 113.25 ? 461 ARG A O   1 
ATOM 1652 C CB  . ARG A 1 244 ? -11.863 8.266   93.018  1.00 98.32  ? 461 ARG A CB  1 
ATOM 1653 C CG  . ARG A 1 244 ? -11.773 9.734   93.364  1.00 117.93 ? 461 ARG A CG  1 
ATOM 1654 C CD  . ARG A 1 244 ? -10.416 10.323  93.040  1.00 151.03 ? 461 ARG A CD  1 
ATOM 1655 N NE  . ARG A 1 244 ? -10.168 11.581  93.754  1.00 178.08 ? 461 ARG A NE  1 
ATOM 1656 C CZ  . ARG A 1 244 ? -9.249  11.737  94.701  1.00 203.83 ? 461 ARG A CZ  1 
ATOM 1657 N NH1 . ARG A 1 244 ? -8.486  10.713  95.073  1.00 192.65 ? 461 ARG A NH1 1 
ATOM 1658 N NH2 . ARG A 1 244 ? -9.085  12.917  95.286  1.00 199.31 ? 461 ARG A NH2 1 
ATOM 1659 N N   . GLN A 1 245 ? -12.112 7.121   96.146  1.00 99.87  ? 462 GLN A N   1 
ATOM 1660 C CA  . GLN A 1 245 ? -12.298 7.361   97.578  1.00 101.48 ? 462 GLN A CA  1 
ATOM 1661 C C   . GLN A 1 245 ? -11.448 6.404   98.446  1.00 105.79 ? 462 GLN A C   1 
ATOM 1662 O O   . GLN A 1 245 ? -11.452 6.536   99.672  1.00 107.93 ? 462 GLN A O   1 
ATOM 1663 C CB  . GLN A 1 245 ? -13.791 7.210   97.938  1.00 98.69  ? 462 GLN A CB  1 
ATOM 1664 C CG  . GLN A 1 245 ? -14.672 8.335   97.414  1.00 115.27 ? 462 GLN A CG  1 
ATOM 1665 C CD  . GLN A 1 245 ? -16.152 8.015   97.476  1.00 129.76 ? 462 GLN A CD  1 
ATOM 1666 O OE1 . GLN A 1 245 ? -16.635 7.224   98.313  1.00 116.70 ? 462 GLN A OE1 1 
ATOM 1667 N NE2 . GLN A 1 245 ? -16.913 8.670   96.604  1.00 122.46 ? 462 GLN A NE2 1 
ATOM 1668 N N   . GLY A 1 246 ? -10.769 5.440   97.816  1.00 100.89 ? 463 GLY A N   1 
ATOM 1669 C CA  . GLY A 1 246 ? -9.960  4.442   98.514  1.00 103.85 ? 463 GLY A CA  1 
ATOM 1670 C C   . GLY A 1 246 ? -10.742 3.221   98.966  1.00 106.69 ? 463 GLY A C   1 
ATOM 1671 O O   . GLY A 1 246 ? -10.173 2.284   99.545  1.00 108.11 ? 463 GLY A O   1 
ATOM 1672 N N   . LYS A 1 247 ? -12.059 3.222   98.675  1.00 100.14 ? 464 LYS A N   1 
ATOM 1673 C CA  . LYS A 1 247 ? -13.007 2.167   99.011  1.00 96.95  ? 464 LYS A CA  1 
ATOM 1674 C C   . LYS A 1 247 ? -12.947 1.069   97.952  1.00 98.67  ? 464 LYS A C   1 
ATOM 1675 O O   . LYS A 1 247 ? -13.921 0.857   97.228  1.00 94.55  ? 464 LYS A O   1 
ATOM 1676 C CB  . LYS A 1 247 ? -14.424 2.760   99.139  1.00 97.15  ? 464 LYS A CB  1 
ATOM 1677 C CG  . LYS A 1 247 ? -14.639 3.579   100.399 1.00 114.66 ? 464 LYS A CG  1 
ATOM 1678 C CD  . LYS A 1 247 ? -15.963 4.299   100.369 1.00 118.75 ? 464 LYS A CD  1 
ATOM 1679 C CE  . LYS A 1 247 ? -16.261 5.024   101.662 1.00 126.54 ? 464 LYS A CE  1 
ATOM 1680 N NZ  . LYS A 1 247 ? -17.598 5.680   101.620 1.00 129.66 ? 464 LYS A NZ  1 
ATOM 1681 N N   . LEU A 1 248 ? -11.789 0.378   97.856  1.00 98.82  ? 465 LEU A N   1 
ATOM 1682 C CA  . LEU A 1 248 ? -11.546 -0.678  96.869  1.00 97.39  ? 465 LEU A CA  1 
ATOM 1683 C C   . LEU A 1 248 ? -12.458 -1.879  96.962  1.00 100.24 ? 465 LEU A C   1 
ATOM 1684 O O   . LEU A 1 248 ? -12.875 -2.394  95.922  1.00 97.11  ? 465 LEU A O   1 
ATOM 1685 C CB  . LEU A 1 248 ? -10.087 -1.094  96.820  1.00 101.31 ? 465 LEU A CB  1 
ATOM 1686 C CG  . LEU A 1 248 ? -9.224  -0.175  95.984  1.00 108.35 ? 465 LEU A CG  1 
ATOM 1687 C CD1 . LEU A 1 248 ? -8.113  0.442   96.818  1.00 114.83 ? 465 LEU A CD1 1 
ATOM 1688 C CD2 . LEU A 1 248 ? -8.713  -0.894  94.748  1.00 108.88 ? 465 LEU A CD2 1 
ATOM 1689 N N   . GLU A 1 249 ? -12.820 -2.298  98.189  1.00 99.27  ? 466 GLU A N   1 
ATOM 1690 C CA  . GLU A 1 249 ? -13.756 -3.410  98.371  1.00 97.93  ? 466 GLU A CA  1 
ATOM 1691 C C   . GLU A 1 249 ? -15.139 -3.048  97.772  1.00 96.70  ? 466 GLU A C   1 
ATOM 1692 O O   . GLU A 1 249 ? -15.715 -3.871  97.068  1.00 93.51  ? 466 GLU A O   1 
ATOM 1693 C CB  . GLU A 1 249 ? -13.826 -3.839  99.851  1.00 103.71 ? 466 GLU A CB  1 
ATOM 1694 C CG  . GLU A 1 249 ? -14.652 -5.093  100.132 1.00 119.04 ? 466 GLU A CG  1 
ATOM 1695 C CD  . GLU A 1 249 ? -14.356 -6.348  99.324  1.00 141.77 ? 466 GLU A CD  1 
ATOM 1696 O OE1 . GLU A 1 249 ? -13.165 -6.718  99.193  1.00 142.00 ? 466 GLU A OE1 1 
ATOM 1697 O OE2 . GLU A 1 249 ? -15.327 -6.962  98.823  1.00 127.58 ? 466 GLU A OE2 1 
ATOM 1698 N N   . ALA A 1 250 ? -15.592 -1.781  97.949  1.00 93.58  ? 467 ALA A N   1 
ATOM 1699 C CA  . ALA A 1 250 ? -16.833 -1.243  97.368  1.00 90.65  ? 467 ALA A CA  1 
ATOM 1700 C C   . ALA A 1 250 ? -16.714 -1.144  95.823  1.00 93.54  ? 467 ALA A C   1 
ATOM 1701 O O   . ALA A 1 250 ? -17.601 -1.619  95.099  1.00 91.65  ? 467 ALA A O   1 
ATOM 1702 C CB  . ALA A 1 250 ? -17.149 0.115   97.965  1.00 92.22  ? 467 ALA A CB  1 
ATOM 1703 N N   . ALA A 1 251 ? -15.582 -0.584  95.337  1.00 90.35  ? 468 ALA A N   1 
ATOM 1704 C CA  . ALA A 1 251 ? -15.240 -0.439  93.924  1.00 88.23  ? 468 ALA A CA  1 
ATOM 1705 C C   . ALA A 1 251 ? -15.300 -1.796  93.211  1.00 89.74  ? 468 ALA A C   1 
ATOM 1706 O O   . ALA A 1 251 ? -15.971 -1.899  92.190  1.00 87.25  ? 468 ALA A O   1 
ATOM 1707 C CB  . ALA A 1 251 ? -13.850 0.175   93.792  1.00 91.49  ? 468 ALA A CB  1 
ATOM 1708 N N   . HIS A 1 252 ? -14.646 -2.843  93.775  1.00 88.01  ? 469 HIS A N   1 
ATOM 1709 C CA  . HIS A 1 252 ? -14.629 -4.186  93.187  1.00 87.56  ? 469 HIS A CA  1 
ATOM 1710 C C   . HIS A 1 252 ? -16.007 -4.780  93.136  1.00 89.03  ? 469 HIS A C   1 
ATOM 1711 O O   . HIS A 1 252 ? -16.347 -5.379  92.122  1.00 87.69  ? 469 HIS A O   1 
ATOM 1712 C CB  . HIS A 1 252 ? -13.687 -5.139  93.923  1.00 91.01  ? 469 HIS A CB  1 
ATOM 1713 C CG  . HIS A 1 252 ? -12.243 -4.835  93.730  1.00 97.34  ? 469 HIS A CG  1 
ATOM 1714 N ND1 . HIS A 1 252 ? -11.424 -4.512  94.800  1.00 102.84 ? 469 HIS A ND1 1 
ATOM 1715 C CD2 . HIS A 1 252 ? -11.504 -4.834  92.599  1.00 100.06 ? 469 HIS A CD2 1 
ATOM 1716 C CE1 . HIS A 1 252 ? -10.225 -4.294  94.283  1.00 104.33 ? 469 HIS A CE1 1 
ATOM 1717 N NE2 . HIS A 1 252 ? -10.223 -4.473  92.962  1.00 102.93 ? 469 HIS A NE2 1 
ATOM 1718 N N   . THR A 1 253 ? -16.809 -4.601  94.217  1.00 85.26  ? 470 THR A N   1 
ATOM 1719 C CA  . THR A 1 253 ? -18.188 -5.107  94.312  1.00 84.40  ? 470 THR A CA  1 
ATOM 1720 C C   . THR A 1 253 ? -19.018 -4.658  93.073  1.00 84.99  ? 470 THR A C   1 
ATOM 1721 O O   . THR A 1 253 ? -19.589 -5.507  92.385  1.00 84.18  ? 470 THR A O   1 
ATOM 1722 C CB  . THR A 1 253 ? -18.817 -4.777  95.703  1.00 93.63  ? 470 THR A CB  1 
ATOM 1723 O OG1 . THR A 1 253 ? -17.917 -5.171  96.739  1.00 94.78  ? 470 THR A OG1 1 
ATOM 1724 C CG2 . THR A 1 253 ? -20.161 -5.473  95.937  1.00 91.52  ? 470 THR A CG2 1 
ATOM 1725 N N   . LEU A 1 254 ? -19.009 -3.341  92.755  1.00 80.14  ? 471 LEU A N   1 
ATOM 1726 C CA  . LEU A 1 254 ? -19.725 -2.796  91.593  1.00 78.90  ? 471 LEU A CA  1 
ATOM 1727 C C   . LEU A 1 254 ? -19.113 -3.235  90.260  1.00 86.34  ? 471 LEU A C   1 
ATOM 1728 O O   . LEU A 1 254 ? -19.854 -3.484  89.301  1.00 86.65  ? 471 LEU A O   1 
ATOM 1729 C CB  . LEU A 1 254 ? -19.811 -1.282  91.651  1.00 77.65  ? 471 LEU A CB  1 
ATOM 1730 C CG  . LEU A 1 254 ? -20.492 -0.682  92.862  1.00 81.85  ? 471 LEU A CG  1 
ATOM 1731 C CD1 . LEU A 1 254 ? -20.531 0.758   92.720  1.00 83.21  ? 471 LEU A CD1 1 
ATOM 1732 C CD2 . LEU A 1 254 ? -21.929 -1.145  93.006  1.00 82.33  ? 471 LEU A CD2 1 
ATOM 1733 N N   . GLU A 1 255 ? -17.763 -3.344  90.211  1.00 84.71  ? 472 GLU A N   1 
ATOM 1734 C CA  . GLU A 1 255 ? -17.036 -3.733  89.009  1.00 86.48  ? 472 GLU A CA  1 
ATOM 1735 C C   . GLU A 1 255 ? -17.301 -5.185  88.628  1.00 95.04  ? 472 GLU A C   1 
ATOM 1736 O O   . GLU A 1 255 ? -17.442 -5.489  87.437  1.00 95.78  ? 472 GLU A O   1 
ATOM 1737 C CB  . GLU A 1 255 ? -15.547 -3.407  89.127  1.00 88.26  ? 472 GLU A CB  1 
ATOM 1738 C CG  . GLU A 1 255 ? -15.264 -1.915  89.015  1.00 98.54  ? 472 GLU A CG  1 
ATOM 1739 C CD  . GLU A 1 255 ? -13.908 -1.420  89.490  1.00 124.66 ? 472 GLU A CD  1 
ATOM 1740 O OE1 . GLU A 1 255 ? -13.093 -2.236  89.985  1.00 104.48 ? 472 GLU A OE1 1 
ATOM 1741 O OE2 . GLU A 1 255 ? -13.655 -0.201  89.344  1.00 127.63 ? 472 GLU A OE2 1 
ATOM 1742 N N   . ASP A 1 256 ? -17.440 -6.060  89.646  1.00 94.31  ? 473 ASP A N   1 
ATOM 1743 C CA  . ASP A 1 256 ? -17.738 -7.479  89.492  1.00 96.85  ? 473 ASP A CA  1 
ATOM 1744 C C   . ASP A 1 256 ? -19.172 -7.640  89.017  1.00 106.36 ? 473 ASP A C   1 
ATOM 1745 O O   . ASP A 1 256 ? -19.443 -8.481  88.156  1.00 109.22 ? 473 ASP A O   1 
ATOM 1746 C CB  . ASP A 1 256 ? -17.554 -8.232  90.826  1.00 99.12  ? 473 ASP A CB  1 
ATOM 1747 C CG  . ASP A 1 256 ? -16.133 -8.326  91.363  1.00 111.64 ? 473 ASP A CG  1 
ATOM 1748 O OD1 . ASP A 1 256 ? -15.176 -8.336  90.540  1.00 112.27 ? 473 ASP A OD1 1 
ATOM 1749 O OD2 . ASP A 1 256 ? -15.976 -8.459  92.602  1.00 118.61 ? 473 ASP A OD2 1 
ATOM 1750 N N   . CYS A 1 257 ? -20.089 -6.823  89.573  1.00 104.60 ? 474 CYS A N   1 
ATOM 1751 C CA  . CYS A 1 257 ? -21.515 -6.840  89.250  1.00 107.23 ? 474 CYS A CA  1 
ATOM 1752 C C   . CYS A 1 257 ? -21.728 -6.534  87.760  1.00 111.51 ? 474 CYS A C   1 
ATOM 1753 O O   . CYS A 1 257 ? -22.494 -7.222  87.087  1.00 112.98 ? 474 CYS A O   1 
ATOM 1754 C CB  . CYS A 1 257 ? -22.267 -5.865  90.156  1.00 107.33 ? 474 CYS A CB  1 
ATOM 1755 S SG  . CYS A 1 257 ? -24.065 -5.847  89.918  1.00 114.32 ? 474 CYS A SG  1 
ATOM 1756 N N   . ALA A 1 258 ? -20.983 -5.543  87.250  1.00 107.67 ? 475 ALA A N   1 
ATOM 1757 C CA  . ALA A 1 258 ? -20.976 -5.108  85.862  1.00 110.00 ? 475 ALA A CA  1 
ATOM 1758 C C   . ALA A 1 258 ? -20.393 -6.190  84.952  1.00 117.30 ? 475 ALA A C   1 
ATOM 1759 O O   . ALA A 1 258 ? -20.902 -6.401  83.852  1.00 120.64 ? 475 ALA A O   1 
ATOM 1760 C CB  . ALA A 1 258 ? -20.163 -3.836  85.741  1.00 109.68 ? 475 ALA A CB  1 
ATOM 1761 N N   . SER A 1 259 ? -19.337 -6.877  85.419  1.00 113.65 ? 476 SER A N   1 
ATOM 1762 C CA  . SER A 1 259 ? -18.657 -7.964  84.701  1.00 116.02 ? 476 SER A CA  1 
ATOM 1763 C C   . SER A 1 259 ? -19.509 -9.224  84.545  1.00 122.39 ? 476 SER A C   1 
ATOM 1764 O O   . SER A 1 259 ? -19.325 -9.944  83.563  1.00 125.23 ? 476 SER A O   1 
ATOM 1765 C CB  . SER A 1 259 ? -17.350 -8.328  85.394  1.00 118.82 ? 476 SER A CB  1 
ATOM 1766 O OG  . SER A 1 259 ? -16.473 -7.216  85.448  1.00 129.47 ? 476 SER A OG  1 
ATOM 1767 N N   . ARG A 1 260 ? -20.396 -9.514  85.529  1.00 118.30 ? 477 ARG A N   1 
ATOM 1768 C CA  . ARG A 1 260 ? -21.284 -10.677 85.514  1.00 121.75 ? 477 ARG A CA  1 
ATOM 1769 C C   . ARG A 1 260 ? -22.162 -10.664 84.261  1.00 133.57 ? 477 ARG A C   1 
ATOM 1770 O O   . ARG A 1 260 ? -22.301 -11.709 83.623  1.00 138.73 ? 477 ARG A O   1 
ATOM 1771 C CB  . ARG A 1 260 ? -22.114 -10.774 86.816  1.00 117.85 ? 477 ARG A CB  1 
ATOM 1772 C CG  . ARG A 1 260 ? -23.224 -11.839 86.840  1.00 127.72 ? 477 ARG A CG  1 
ATOM 1773 C CD  . ARG A 1 260 ? -22.711 -13.261 87.021  1.00 138.71 ? 477 ARG A CD  1 
ATOM 1774 N NE  . ARG A 1 260 ? -23.585 -14.279 86.419  1.00 148.29 ? 477 ARG A NE  1 
ATOM 1775 C CZ  . ARG A 1 260 ? -23.414 -14.811 85.209  1.00 161.68 ? 477 ARG A CZ  1 
ATOM 1776 N NH1 . ARG A 1 260 ? -22.405 -14.419 84.439  1.00 144.04 ? 477 ARG A NH1 1 
ATOM 1777 N NH2 . ARG A 1 260 ? -24.251 -15.740 84.759  1.00 153.89 ? 477 ARG A NH2 1 
ATOM 1778 N N   . SER A 1 261 ? -22.745 -9.467  83.866  1.00 127.74 ? 478 SER A N   1 
ATOM 1779 C CA  . SER A 1 261 ? -23.587 -9.279  82.668  1.00 132.99 ? 478 SER A CA  1 
ATOM 1780 C C   . SER A 1 261 ? -22.855 -9.631  81.342  1.00 141.44 ? 478 SER A C   1 
ATOM 1781 O O   . SER A 1 261 ? -23.469 -10.185 80.422  1.00 146.61 ? 478 SER A O   1 
ATOM 1782 C CB  . SER A 1 261 ? -24.104 -7.843  82.608  1.00 135.10 ? 478 SER A CB  1 
ATOM 1783 O OG  . SER A 1 261 ? -24.908 -7.600  81.463  1.00 149.06 ? 478 SER A OG  1 
ATOM 1784 N N   . ARG A 1 262 ? -21.481 -9.317  81.260  1.00 139.27 ? 479 ARG A N   1 
ATOM 1785 C CA  . ARG A 1 262 ? -20.635 -9.507  80.078  1.00 159.07 ? 479 ARG A CA  1 
ATOM 1786 C C   . ARG A 1 262 ? -19.801 -10.782 80.169  1.00 172.51 ? 479 ARG A C   1 
ATOM 1787 O O   . ARG A 1 262 ? -20.281 -11.855 79.810  1.00 134.30 ? 479 ARG A O   1 
ATOM 1788 C CB  . ARG A 1 262 ? -19.734 -8.266  79.853  1.00 156.73 ? 479 ARG A CB  1 
ATOM 1789 C CG  . ARG A 1 262 ? -20.454 -6.899  79.962  1.00 165.31 ? 479 ARG A CG  1 
ATOM 1790 C CD  . ARG A 1 262 ? -21.495 -6.686  78.870  1.00 179.88 ? 479 ARG A CD  1 
ATOM 1791 N NE  . ARG A 1 262 ? -22.504 -5.687  79.230  1.00 183.37 ? 479 ARG A NE  1 
ATOM 1792 C CZ  . ARG A 1 262 ? -22.581 -4.473  78.693  1.00 196.73 ? 479 ARG A CZ  1 
ATOM 1793 N NH1 . ARG A 1 262 ? -21.703 -4.088  77.775  1.00 186.76 ? 479 ARG A NH1 1 
ATOM 1794 N NH2 . ARG A 1 262 ? -23.538 -3.636  79.068  1.00 180.45 ? 479 ARG A NH2 1 
ATOM 1795 N N   . HIS B 1 19  ? -25.855 -0.691  45.080  1.00 169.48 ? 236 HIS B N   1 
ATOM 1796 C CA  . HIS B 1 19  ? -26.657 0.476   45.438  1.00 163.77 ? 236 HIS B CA  1 
ATOM 1797 C C   . HIS B 1 19  ? -27.026 1.372   44.215  1.00 161.59 ? 236 HIS B C   1 
ATOM 1798 O O   . HIS B 1 19  ? -26.910 2.600   44.316  1.00 156.20 ? 236 HIS B O   1 
ATOM 1799 C CB  . HIS B 1 19  ? -25.953 1.276   46.560  1.00 163.65 ? 236 HIS B CB  1 
ATOM 1800 C CG  . HIS B 1 19  ? -24.540 1.686   46.249  1.00 166.27 ? 236 HIS B CG  1 
ATOM 1801 N ND1 . HIS B 1 19  ? -23.506 0.760   46.216  1.00 173.46 ? 236 HIS B ND1 1 
ATOM 1802 C CD2 . HIS B 1 19  ? -24.029 2.915   46.006  1.00 163.13 ? 236 HIS B CD2 1 
ATOM 1803 C CE1 . HIS B 1 19  ? -22.412 1.451   45.936  1.00 170.73 ? 236 HIS B CE1 1 
ATOM 1804 N NE2 . HIS B 1 19  ? -22.676 2.751   45.801  1.00 165.04 ? 236 HIS B NE2 1 
ATOM 1805 N N   . PRO B 1 20  ? -27.491 0.816   43.055  1.00 159.37 ? 237 PRO B N   1 
ATOM 1806 C CA  . PRO B 1 20  ? -27.824 1.695   41.913  1.00 153.62 ? 237 PRO B CA  1 
ATOM 1807 C C   . PRO B 1 20  ? -29.198 2.371   41.998  1.00 153.99 ? 237 PRO B C   1 
ATOM 1808 O O   . PRO B 1 20  ? -29.516 3.224   41.167  1.00 149.69 ? 237 PRO B O   1 
ATOM 1809 C CB  . PRO B 1 20  ? -27.669 0.780   40.693  1.00 157.62 ? 237 PRO B CB  1 
ATOM 1810 C CG  . PRO B 1 20  ? -27.873 -0.594  41.206  1.00 168.81 ? 237 PRO B CG  1 
ATOM 1811 C CD  . PRO B 1 20  ? -27.728 -0.602  42.711  1.00 166.80 ? 237 PRO B CD  1 
ATOM 1812 N N   . ASP B 1 21  ? -30.000 2.010   43.015  1.00 153.01 ? 238 ASP B N   1 
ATOM 1813 C CA  . ASP B 1 21  ? -31.309 2.609   43.260  1.00 150.39 ? 238 ASP B CA  1 
ATOM 1814 C C   . ASP B 1 21  ? -31.112 3.981   43.899  1.00 146.83 ? 238 ASP B C   1 
ATOM 1815 O O   . ASP B 1 21  ? -31.929 4.877   43.690  1.00 143.22 ? 238 ASP B O   1 
ATOM 1816 C CB  . ASP B 1 21  ? -32.155 1.700   44.163  1.00 157.89 ? 238 ASP B CB  1 
ATOM 1817 C CG  . ASP B 1 21  ? -32.496 0.356   43.543  1.00 175.27 ? 238 ASP B CG  1 
ATOM 1818 O OD1 . ASP B 1 21  ? -32.837 0.325   42.328  1.00 174.48 ? 238 ASP B OD1 1 
ATOM 1819 O OD2 . ASP B 1 21  ? -32.458 -0.660  44.277  1.00 187.71 ? 238 ASP B OD2 1 
ATOM 1820 N N   . VAL B 1 22  ? -30.002 4.137   44.660  1.00 141.34 ? 239 VAL B N   1 
ATOM 1821 C CA  . VAL B 1 22  ? -29.558 5.373   45.308  1.00 136.78 ? 239 VAL B CA  1 
ATOM 1822 C C   . VAL B 1 22  ? -29.332 6.402   44.199  1.00 135.11 ? 239 VAL B C   1 
ATOM 1823 O O   . VAL B 1 22  ? -29.779 7.539   44.333  1.00 131.83 ? 239 VAL B O   1 
ATOM 1824 C CB  . VAL B 1 22  ? -28.259 5.138   46.118  1.00 142.55 ? 239 VAL B CB  1 
ATOM 1825 C CG1 . VAL B 1 22  ? -27.740 6.434   46.729  1.00 139.41 ? 239 VAL B CG1 1 
ATOM 1826 C CG2 . VAL B 1 22  ? -28.454 4.071   47.187  1.00 147.78 ? 239 VAL B CG2 1 
ATOM 1827 N N   . ALA B 1 23  ? -28.673 5.980   43.092  1.00 130.75 ? 240 ALA B N   1 
ATOM 1828 C CA  . ALA B 1 23  ? -28.409 6.806   41.909  1.00 126.71 ? 240 ALA B CA  1 
ATOM 1829 C C   . ALA B 1 23  ? -29.723 7.248   41.272  1.00 128.02 ? 240 ALA B C   1 
ATOM 1830 O O   . ALA B 1 23  ? -29.839 8.410   40.879  1.00 124.81 ? 240 ALA B O   1 
ATOM 1831 C CB  . ALA B 1 23  ? -27.561 6.040   40.900  1.00 128.62 ? 240 ALA B CB  1 
ATOM 1832 N N   . THR B 1 24  ? -30.723 6.329   41.217  1.00 126.21 ? 241 THR B N   1 
ATOM 1833 C CA  . THR B 1 24  ? -32.067 6.577   40.681  1.00 124.85 ? 241 THR B CA  1 
ATOM 1834 C C   . THR B 1 24  ? -32.792 7.625   41.533  1.00 127.02 ? 241 THR B C   1 
ATOM 1835 O O   . THR B 1 24  ? -33.401 8.539   40.977  1.00 125.11 ? 241 THR B O   1 
ATOM 1836 C CB  . THR B 1 24  ? -32.804 5.245   40.405  1.00 131.55 ? 241 THR B CB  1 
ATOM 1837 O OG1 . THR B 1 24  ? -32.295 4.695   39.185  1.00 128.94 ? 241 THR B OG1 1 
ATOM 1838 C CG2 . THR B 1 24  ? -34.323 5.401   40.299  1.00 128.32 ? 241 THR B CG2 1 
ATOM 1839 N N   . MET B 1 25  ? -32.669 7.530   42.870  1.00 124.02 ? 242 MET B N   1 
ATOM 1840 C CA  . MET B 1 25  ? -33.252 8.494   43.806  1.00 122.38 ? 242 MET B CA  1 
ATOM 1841 C C   . MET B 1 25  ? -32.612 9.874   43.590  1.00 121.30 ? 242 MET B C   1 
ATOM 1842 O O   . MET B 1 25  ? -33.328 10.879  43.594  1.00 118.85 ? 242 MET B O   1 
ATOM 1843 C CB  . MET B 1 25  ? -33.053 8.040   45.264  1.00 127.56 ? 242 MET B CB  1 
ATOM 1844 C CG  . MET B 1 25  ? -33.854 6.816   45.656  1.00 135.89 ? 242 MET B CG  1 
ATOM 1845 S SD  . MET B 1 25  ? -33.419 6.261   47.328  1.00 144.49 ? 242 MET B SD  1 
ATOM 1846 C CE  . MET B 1 25  ? -33.974 4.559   47.264  1.00 147.07 ? 242 MET B CE  1 
ATOM 1847 N N   . LEU B 1 26  ? -31.263 9.911   43.374  1.00 116.97 ? 243 LEU B N   1 
ATOM 1848 C CA  . LEU B 1 26  ? -30.483 11.133  43.120  1.00 114.15 ? 243 LEU B CA  1 
ATOM 1849 C C   . LEU B 1 26  ? -30.975 11.753  41.820  1.00 115.69 ? 243 LEU B C   1 
ATOM 1850 O O   . LEU B 1 26  ? -31.158 12.969  41.744  1.00 114.09 ? 243 LEU B O   1 
ATOM 1851 C CB  . LEU B 1 26  ? -28.963 10.840  43.007  1.00 114.75 ? 243 LEU B CB  1 
ATOM 1852 C CG  . LEU B 1 26  ? -28.203 10.347  44.256  1.00 121.66 ? 243 LEU B CG  1 
ATOM 1853 C CD1 . LEU B 1 26  ? -26.908 9.677   43.868  1.00 123.51 ? 243 LEU B CD1 1 
ATOM 1854 C CD2 . LEU B 1 26  ? -27.883 11.472  45.209  1.00 123.06 ? 243 LEU B CD2 1 
ATOM 1855 N N   . ASN B 1 27  ? -31.230 10.889  40.819  1.00 112.31 ? 244 ASN B N   1 
ATOM 1856 C CA  . ASN B 1 27  ? -31.710 11.227  39.483  1.00 110.99 ? 244 ASN B CA  1 
ATOM 1857 C C   . ASN B 1 27  ? -33.096 11.869  39.540  1.00 114.68 ? 244 ASN B C   1 
ATOM 1858 O O   . ASN B 1 27  ? -33.340 12.853  38.844  1.00 114.09 ? 244 ASN B O   1 
ATOM 1859 C CB  . ASN B 1 27  ? -31.716 9.979   38.605  1.00 113.66 ? 244 ASN B CB  1 
ATOM 1860 C CG  . ASN B 1 27  ? -31.751 10.271  37.140  1.00 139.31 ? 244 ASN B CG  1 
ATOM 1861 O OD1 . ASN B 1 27  ? -32.817 10.498  36.547  1.00 129.82 ? 244 ASN B OD1 1 
ATOM 1862 N ND2 . ASN B 1 27  ? -30.579 10.262  36.530  1.00 134.90 ? 244 ASN B ND2 1 
ATOM 1863 N N   . ILE B 1 28  ? -33.995 11.315  40.365  1.00 111.97 ? 245 ILE B N   1 
ATOM 1864 C CA  . ILE B 1 28  ? -35.343 11.838  40.569  1.00 112.18 ? 245 ILE B CA  1 
ATOM 1865 C C   . ILE B 1 28  ? -35.238 13.251  41.155  1.00 115.12 ? 245 ILE B C   1 
ATOM 1866 O O   . ILE B 1 28  ? -35.873 14.164  40.627  1.00 114.49 ? 245 ILE B O   1 
ATOM 1867 C CB  . ILE B 1 28  ? -36.183 10.861  41.444  1.00 117.75 ? 245 ILE B CB  1 
ATOM 1868 C CG1 . ILE B 1 28  ? -36.602 9.620   40.621  1.00 120.39 ? 245 ILE B CG1 1 
ATOM 1869 C CG2 . ILE B 1 28  ? -37.408 11.554  42.062  1.00 118.96 ? 245 ILE B CG2 1 
ATOM 1870 C CD1 . ILE B 1 28  ? -36.678 8.309   41.404  1.00 131.39 ? 245 ILE B CD1 1 
ATOM 1871 N N   . LEU B 1 29  ? -34.387 13.436  42.201  1.00 111.75 ? 246 LEU B N   1 
ATOM 1872 C CA  . LEU B 1 29  ? -34.178 14.740  42.835  1.00 110.74 ? 246 LEU B CA  1 
ATOM 1873 C C   . LEU B 1 29  ? -33.444 15.760  41.949  1.00 113.42 ? 246 LEU B C   1 
ATOM 1874 O O   . LEU B 1 29  ? -33.611 16.969  42.144  1.00 112.74 ? 246 LEU B O   1 
ATOM 1875 C CB  . LEU B 1 29  ? -33.567 14.629  44.239  1.00 111.27 ? 246 LEU B CB  1 
ATOM 1876 C CG  . LEU B 1 29  ? -33.861 15.836  45.166  1.00 116.64 ? 246 LEU B CG  1 
ATOM 1877 C CD1 . LEU B 1 29  ? -35.359 16.019  45.417  1.00 117.72 ? 246 LEU B CD1 1 
ATOM 1878 C CD2 . LEU B 1 29  ? -33.112 15.740  46.465  1.00 119.81 ? 246 LEU B CD2 1 
ATOM 1879 N N   . ALA B 1 30  ? -32.682 15.272  40.940  1.00 109.39 ? 247 ALA B N   1 
ATOM 1880 C CA  . ALA B 1 30  ? -31.988 16.123  39.973  1.00 108.00 ? 247 ALA B CA  1 
ATOM 1881 C C   . ALA B 1 30  ? -33.014 16.802  39.086  1.00 110.90 ? 247 ALA B C   1 
ATOM 1882 O O   . ALA B 1 30  ? -32.827 17.960  38.741  1.00 111.17 ? 247 ALA B O   1 
ATOM 1883 C CB  . ALA B 1 30  ? -31.037 15.304  39.132  1.00 108.18 ? 247 ALA B CB  1 
ATOM 1884 N N   . LEU B 1 31  ? -34.118 16.101  38.762  1.00 107.85 ? 248 LEU B N   1 
ATOM 1885 C CA  . LEU B 1 31  ? -35.219 16.619  37.939  1.00 109.09 ? 248 LEU B CA  1 
ATOM 1886 C C   . LEU B 1 31  ? -35.953 17.733  38.668  1.00 114.99 ? 248 LEU B C   1 
ATOM 1887 O O   . LEU B 1 31  ? -36.406 18.676  38.034  1.00 115.00 ? 248 LEU B O   1 
ATOM 1888 C CB  . LEU B 1 31  ? -36.204 15.504  37.564  1.00 109.95 ? 248 LEU B CB  1 
ATOM 1889 C CG  . LEU B 1 31  ? -35.659 14.387  36.698  1.00 114.56 ? 248 LEU B CG  1 
ATOM 1890 C CD1 . LEU B 1 31  ? -36.259 13.067  37.084  1.00 116.48 ? 248 LEU B CD1 1 
ATOM 1891 C CD2 . LEU B 1 31  ? -35.918 14.650  35.244  1.00 118.24 ? 248 LEU B CD2 1 
ATOM 1892 N N   . VAL B 1 32  ? -36.042 17.629  40.002  1.00 113.86 ? 249 VAL B N   1 
ATOM 1893 C CA  . VAL B 1 32  ? -36.653 18.627  40.879  1.00 116.20 ? 249 VAL B CA  1 
ATOM 1894 C C   . VAL B 1 32  ? -35.851 19.941  40.772  1.00 122.13 ? 249 VAL B C   1 
ATOM 1895 O O   . VAL B 1 32  ? -36.449 20.997  40.548  1.00 125.13 ? 249 VAL B O   1 
ATOM 1896 C CB  . VAL B 1 32  ? -36.738 18.100  42.338  1.00 120.42 ? 249 VAL B CB  1 
ATOM 1897 C CG1 . VAL B 1 32  ? -36.959 19.231  43.336  1.00 121.86 ? 249 VAL B CG1 1 
ATOM 1898 C CG2 . VAL B 1 32  ? -37.816 17.030  42.480  1.00 120.95 ? 249 VAL B CG2 1 
ATOM 1899 N N   . TYR B 1 33  ? -34.506 19.861  40.896  1.00 116.56 ? 250 TYR B N   1 
ATOM 1900 C CA  . TYR B 1 33  ? -33.611 21.009  40.804  1.00 117.31 ? 250 TYR B CA  1 
ATOM 1901 C C   . TYR B 1 33  ? -33.576 21.591  39.388  1.00 122.53 ? 250 TYR B C   1 
ATOM 1902 O O   . TYR B 1 33  ? -33.595 22.817  39.233  1.00 125.38 ? 250 TYR B O   1 
ATOM 1903 C CB  . TYR B 1 33  ? -32.211 20.626  41.276  1.00 117.86 ? 250 TYR B CB  1 
ATOM 1904 C CG  . TYR B 1 33  ? -32.019 20.698  42.776  1.00 120.39 ? 250 TYR B CG  1 
ATOM 1905 C CD1 . TYR B 1 33  ? -31.712 21.901  43.402  1.00 124.83 ? 250 TYR B CD1 1 
ATOM 1906 C CD2 . TYR B 1 33  ? -32.092 19.555  43.563  1.00 120.09 ? 250 TYR B CD2 1 
ATOM 1907 C CE1 . TYR B 1 33  ? -31.499 21.972  44.778  1.00 126.80 ? 250 TYR B CE1 1 
ATOM 1908 C CE2 . TYR B 1 33  ? -31.880 19.610  44.943  1.00 122.29 ? 250 TYR B CE2 1 
ATOM 1909 C CZ  . TYR B 1 33  ? -31.569 20.820  45.544  1.00 132.47 ? 250 TYR B CZ  1 
ATOM 1910 O OH  . TYR B 1 33  ? -31.318 20.883  46.894  1.00 133.33 ? 250 TYR B OH  1 
ATOM 1911 N N   . ARG B 1 34  ? -33.555 20.707  38.356  1.00 116.56 ? 251 ARG B N   1 
ATOM 1912 C CA  . ARG B 1 34  ? -33.552 21.058  36.932  1.00 116.23 ? 251 ARG B CA  1 
ATOM 1913 C C   . ARG B 1 34  ? -34.770 21.927  36.632  1.00 123.82 ? 251 ARG B C   1 
ATOM 1914 O O   . ARG B 1 34  ? -34.626 22.996  36.042  1.00 126.59 ? 251 ARG B O   1 
ATOM 1915 C CB  . ARG B 1 34  ? -33.565 19.778  36.067  1.00 111.52 ? 251 ARG B CB  1 
ATOM 1916 C CG  . ARG B 1 34  ? -33.638 20.006  34.545  1.00 111.39 ? 251 ARG B CG  1 
ATOM 1917 C CD  . ARG B 1 34  ? -34.143 18.787  33.776  1.00 104.49 ? 251 ARG B CD  1 
ATOM 1918 N NE  . ARG B 1 34  ? -35.532 18.451  34.107  1.00 107.84 ? 251 ARG B NE  1 
ATOM 1919 C CZ  . ARG B 1 34  ? -36.297 17.609  33.416  1.00 122.61 ? 251 ARG B CZ  1 
ATOM 1920 N NH1 . ARG B 1 34  ? -35.822 17.001  32.335  1.00 112.87 ? 251 ARG B NH1 1 
ATOM 1921 N NH2 . ARG B 1 34  ? -37.539 17.363  33.805  1.00 110.06 ? 251 ARG B NH2 1 
ATOM 1922 N N   . ASP B 1 35  ? -35.956 21.481  37.086  1.00 120.86 ? 252 ASP B N   1 
ATOM 1923 C CA  . ASP B 1 35  ? -37.233 22.162  36.886  1.00 123.88 ? 252 ASP B CA  1 
ATOM 1924 C C   . ASP B 1 35  ? -37.324 23.518  37.583  1.00 130.18 ? 252 ASP B C   1 
ATOM 1925 O O   . ASP B 1 35  ? -38.073 24.384  37.133  1.00 132.81 ? 252 ASP B O   1 
ATOM 1926 C CB  . ASP B 1 35  ? -38.415 21.229  37.221  1.00 125.70 ? 252 ASP B CB  1 
ATOM 1927 C CG  . ASP B 1 35  ? -38.641 20.094  36.213  1.00 135.39 ? 252 ASP B CG  1 
ATOM 1928 O OD1 . ASP B 1 35  ? -37.665 19.678  35.545  1.00 133.97 ? 252 ASP B OD1 1 
ATOM 1929 O OD2 . ASP B 1 35  ? -39.787 19.609  36.109  1.00 143.08 ? 252 ASP B OD2 1 
ATOM 1930 N N   . GLN B 1 36  ? -36.529 23.722  38.641  1.00 126.64 ? 253 GLN B N   1 
ATOM 1931 C CA  . GLN B 1 36  ? -36.477 25.000  39.347  1.00 129.98 ? 253 GLN B CA  1 
ATOM 1932 C C   . GLN B 1 36  ? -35.330 25.863  38.798  1.00 136.35 ? 253 GLN B C   1 
ATOM 1933 O O   . GLN B 1 36  ? -35.018 26.916  39.366  1.00 140.08 ? 253 GLN B O   1 
ATOM 1934 C CB  . GLN B 1 36  ? -36.358 24.790  40.861  1.00 129.95 ? 253 GLN B CB  1 
ATOM 1935 C CG  . GLN B 1 36  ? -37.693 24.882  41.573  1.00 147.03 ? 253 GLN B CG  1 
ATOM 1936 C CD  . GLN B 1 36  ? -37.597 25.748  42.806  1.00 173.50 ? 253 GLN B CD  1 
ATOM 1937 O OE1 . GLN B 1 36  ? -37.126 25.317  43.870  1.00 169.91 ? 253 GLN B OE1 1 
ATOM 1938 N NE2 . GLN B 1 36  ? -38.043 26.991  42.690  1.00 167.66 ? 253 GLN B NE2 1 
ATOM 1939 N N   . ASN B 1 37  ? -34.724 25.418  37.673  1.00 130.01 ? 254 ASN B N   1 
ATOM 1940 C CA  . ASN B 1 37  ? -33.608 26.062  36.976  1.00 131.46 ? 254 ASN B CA  1 
ATOM 1941 C C   . ASN B 1 37  ? -32.310 26.145  37.799  1.00 134.41 ? 254 ASN B C   1 
ATOM 1942 O O   . ASN B 1 37  ? -31.427 26.945  37.474  1.00 136.99 ? 254 ASN B O   1 
ATOM 1943 C CB  . ASN B 1 37  ? -34.013 27.408  36.343  1.00 138.61 ? 254 ASN B CB  1 
ATOM 1944 C CG  . ASN B 1 37  ? -35.094 27.310  35.287  1.00 172.66 ? 254 ASN B CG  1 
ATOM 1945 O OD1 . ASN B 1 37  ? -35.062 26.457  34.383  1.00 165.77 ? 254 ASN B OD1 1 
ATOM 1946 N ND2 . ASN B 1 37  ? -36.060 28.219  35.352  1.00 171.35 ? 254 ASN B ND2 1 
ATOM 1947 N N   . LYS B 1 38  ? -32.178 25.286  38.835  1.00 127.45 ? 255 LYS B N   1 
ATOM 1948 C CA  . LYS B 1 38  ? -30.982 25.209  39.685  1.00 126.96 ? 255 LYS B CA  1 
ATOM 1949 C C   . LYS B 1 38  ? -30.035 24.171  39.057  1.00 128.71 ? 255 LYS B C   1 
ATOM 1950 O O   . LYS B 1 38  ? -29.860 23.070  39.591  1.00 125.54 ? 255 LYS B O   1 
ATOM 1951 C CB  . LYS B 1 38  ? -31.340 24.840  41.144  1.00 127.84 ? 255 LYS B CB  1 
ATOM 1952 C CG  . LYS B 1 38  ? -32.163 25.881  41.907  1.00 144.73 ? 255 LYS B CG  1 
ATOM 1953 C CD  . LYS B 1 38  ? -32.515 25.363  43.293  1.00 154.98 ? 255 LYS B CD  1 
ATOM 1954 C CE  . LYS B 1 38  ? -33.547 26.163  44.044  1.00 170.32 ? 255 LYS B CE  1 
ATOM 1955 N NZ  . LYS B 1 38  ? -34.040 25.423  45.244  1.00 177.25 ? 255 LYS B NZ  1 
ATOM 1956 N N   . TYR B 1 39  ? -29.453 24.531  37.891  1.00 126.71 ? 256 TYR B N   1 
ATOM 1957 C CA  . TYR B 1 39  ? -28.566 23.681  37.092  1.00 124.62 ? 256 TYR B CA  1 
ATOM 1958 C C   . TYR B 1 39  ? -27.323 23.187  37.828  1.00 127.95 ? 256 TYR B C   1 
ATOM 1959 O O   . TYR B 1 39  ? -27.080 21.980  37.818  1.00 125.04 ? 256 TYR B O   1 
ATOM 1960 C CB  . TYR B 1 39  ? -28.210 24.322  35.731  1.00 127.89 ? 256 TYR B CB  1 
ATOM 1961 C CG  . TYR B 1 39  ? -29.397 24.898  34.995  1.00 131.40 ? 256 TYR B CG  1 
ATOM 1962 C CD1 . TYR B 1 39  ? -30.483 24.098  34.648  1.00 131.14 ? 256 TYR B CD1 1 
ATOM 1963 C CD2 . TYR B 1 39  ? -29.438 26.241  34.644  1.00 137.19 ? 256 TYR B CD2 1 
ATOM 1964 C CE1 . TYR B 1 39  ? -31.594 24.629  33.994  1.00 134.69 ? 256 TYR B CE1 1 
ATOM 1965 C CE2 . TYR B 1 39  ? -30.535 26.780  33.974  1.00 140.73 ? 256 TYR B CE2 1 
ATOM 1966 C CZ  . TYR B 1 39  ? -31.611 25.969  33.647  1.00 147.05 ? 256 TYR B CZ  1 
ATOM 1967 O OH  . TYR B 1 39  ? -32.692 26.490  32.974  1.00 152.03 ? 256 TYR B OH  1 
ATOM 1968 N N   . LYS B 1 40  ? -26.560 24.096  38.482  1.00 127.18 ? 257 LYS B N   1 
ATOM 1969 C CA  . LYS B 1 40  ? -25.335 23.750  39.218  1.00 127.50 ? 257 LYS B CA  1 
ATOM 1970 C C   . LYS B 1 40  ? -25.602 22.655  40.277  1.00 128.45 ? 257 LYS B C   1 
ATOM 1971 O O   . LYS B 1 40  ? -24.804 21.721  40.433  1.00 126.03 ? 257 LYS B O   1 
ATOM 1972 C CB  . LYS B 1 40  ? -24.728 25.001  39.868  1.00 134.68 ? 257 LYS B CB  1 
ATOM 1973 C CG  . LYS B 1 40  ? -23.205 25.076  39.756  1.00 149.75 ? 257 LYS B CG  1 
ATOM 1974 C CD  . LYS B 1 40  ? -22.602 26.076  40.751  1.00 162.12 ? 257 LYS B CD  1 
ATOM 1975 C CE  . LYS B 1 40  ? -21.093 26.141  40.671  1.00 170.88 ? 257 LYS B CE  1 
ATOM 1976 N NZ  . LYS B 1 40  ? -20.509 26.903  41.807  1.00 179.84 ? 257 LYS B NZ  1 
ATOM 1977 N N   . ASP B 1 41  ? -26.768 22.771  40.957  1.00 125.28 ? 258 ASP B N   1 
ATOM 1978 C CA  . ASP B 1 41  ? -27.284 21.867  41.996  1.00 123.07 ? 258 ASP B CA  1 
ATOM 1979 C C   . ASP B 1 41  ? -27.850 20.561  41.414  1.00 123.36 ? 258 ASP B C   1 
ATOM 1980 O O   . ASP B 1 41  ? -27.814 19.527  42.079  1.00 121.43 ? 258 ASP B O   1 
ATOM 1981 C CB  . ASP B 1 41  ? -28.350 22.578  42.854  1.00 125.67 ? 258 ASP B CB  1 
ATOM 1982 C CG  . ASP B 1 41  ? -27.819 23.565  43.881  1.00 140.26 ? 258 ASP B CG  1 
ATOM 1983 O OD1 . ASP B 1 41  ? -26.784 23.267  44.516  1.00 142.16 ? 258 ASP B OD1 1 
ATOM 1984 O OD2 . ASP B 1 41  ? -28.478 24.599  44.102  1.00 148.75 ? 258 ASP B OD2 1 
ATOM 1985 N N   . ALA B 1 42  ? -28.382 20.612  40.186  1.00 122.67 ? 259 ALA B N   1 
ATOM 1986 C CA  . ALA B 1 42  ? -28.909 19.428  39.515  1.00 119.09 ? 259 ALA B CA  1 
ATOM 1987 C C   . ALA B 1 42  ? -27.730 18.581  38.980  1.00 122.33 ? 259 ALA B C   1 
ATOM 1988 O O   . ALA B 1 42  ? -27.766 17.350  39.049  1.00 119.88 ? 259 ALA B O   1 
ATOM 1989 C CB  . ALA B 1 42  ? -29.830 19.850  38.382  1.00 119.20 ? 259 ALA B CB  1 
ATOM 1990 N N   . ALA B 1 43  ? -26.678 19.265  38.474  1.00 121.11 ? 260 ALA B N   1 
ATOM 1991 C CA  . ALA B 1 43  ? -25.447 18.687  37.940  1.00 120.79 ? 260 ALA B CA  1 
ATOM 1992 C C   . ALA B 1 43  ? -24.678 17.939  39.022  1.00 126.73 ? 260 ALA B C   1 
ATOM 1993 O O   . ALA B 1 43  ? -24.251 16.813  38.761  1.00 125.54 ? 260 ALA B O   1 
ATOM 1994 C CB  . ALA B 1 43  ? -24.575 19.775  37.332  1.00 124.34 ? 260 ALA B CB  1 
ATOM 1995 N N   . HIS B 1 44  ? -24.507 18.548  40.232  1.00 125.99 ? 261 HIS B N   1 
ATOM 1996 C CA  . HIS B 1 44  ? -23.799 17.926  41.360  1.00 127.76 ? 261 HIS B CA  1 
ATOM 1997 C C   . HIS B 1 44  ? -24.418 16.563  41.654  1.00 124.69 ? 261 HIS B C   1 
ATOM 1998 O O   . HIS B 1 44  ? -23.696 15.567  41.721  1.00 122.89 ? 261 HIS B O   1 
ATOM 1999 C CB  . HIS B 1 44  ? -23.860 18.821  42.622  1.00 133.37 ? 261 HIS B CB  1 
ATOM 2000 C CG  . HIS B 1 44  ? -22.690 19.747  42.834  1.00 142.92 ? 261 HIS B CG  1 
ATOM 2001 N ND1 . HIS B 1 44  ? -22.016 20.337  41.768  1.00 146.39 ? 261 HIS B ND1 1 
ATOM 2002 C CD2 . HIS B 1 44  ? -22.160 20.211  43.993  1.00 150.02 ? 261 HIS B CD2 1 
ATOM 2003 C CE1 . HIS B 1 44  ? -21.085 21.105  42.315  1.00 151.75 ? 261 HIS B CE1 1 
ATOM 2004 N NE2 . HIS B 1 44  ? -21.139 21.071  43.650  1.00 154.60 ? 261 HIS B NE2 1 
ATOM 2005 N N   . LEU B 1 45  ? -25.768 16.528  41.747  1.00 118.61 ? 262 LEU B N   1 
ATOM 2006 C CA  . LEU B 1 45  ? -26.576 15.336  41.997  1.00 116.59 ? 262 LEU B CA  1 
ATOM 2007 C C   . LEU B 1 45  ? -26.366 14.266  40.931  1.00 120.04 ? 262 LEU B C   1 
ATOM 2008 O O   . LEU B 1 45  ? -26.214 13.090  41.280  1.00 120.76 ? 262 LEU B O   1 
ATOM 2009 C CB  . LEU B 1 45  ? -28.070 15.692  42.085  1.00 115.35 ? 262 LEU B CB  1 
ATOM 2010 C CG  . LEU B 1 45  ? -28.605 16.217  43.422  1.00 121.95 ? 262 LEU B CG  1 
ATOM 2011 C CD1 . LEU B 1 45  ? -30.064 16.576  43.299  1.00 121.40 ? 262 LEU B CD1 1 
ATOM 2012 C CD2 . LEU B 1 45  ? -28.467 15.188  44.531  1.00 124.65 ? 262 LEU B CD2 1 
ATOM 2013 N N   . LEU B 1 46  ? -26.341 14.670  39.639  1.00 114.80 ? 263 LEU B N   1 
ATOM 2014 C CA  . LEU B 1 46  ? -26.125 13.745  38.527  1.00 112.77 ? 263 LEU B CA  1 
ATOM 2015 C C   . LEU B 1 46  ? -24.722 13.138  38.472  1.00 120.09 ? 263 LEU B C   1 
ATOM 2016 O O   . LEU B 1 46  ? -24.595 11.991  38.047  1.00 119.76 ? 263 LEU B O   1 
ATOM 2017 C CB  . LEU B 1 46  ? -26.505 14.361  37.187  1.00 111.25 ? 263 LEU B CB  1 
ATOM 2018 C CG  . LEU B 1 46  ? -27.994 14.462  36.855  1.00 113.94 ? 263 LEU B CG  1 
ATOM 2019 C CD1 . LEU B 1 46  ? -28.172 14.842  35.400  1.00 114.02 ? 263 LEU B CD1 1 
ATOM 2020 C CD2 . LEU B 1 46  ? -28.736 13.145  37.119  1.00 114.01 ? 263 LEU B CD2 1 
ATOM 2021 N N   . ASN B 1 47  ? -23.680 13.887  38.915  1.00 119.11 ? 264 ASN B N   1 
ATOM 2022 C CA  . ASN B 1 47  ? -22.300 13.404  38.947  1.00 120.70 ? 264 ASN B CA  1 
ATOM 2023 C C   . ASN B 1 47  ? -22.187 12.237  39.913  1.00 127.26 ? 264 ASN B C   1 
ATOM 2024 O O   . ASN B 1 47  ? -21.525 11.252  39.591  1.00 127.45 ? 264 ASN B O   1 
ATOM 2025 C CB  . ASN B 1 47  ? -21.340 14.507  39.371  1.00 120.93 ? 264 ASN B CB  1 
ATOM 2026 C CG  . ASN B 1 47  ? -21.119 15.599  38.361  1.00 131.67 ? 264 ASN B CG  1 
ATOM 2027 O OD1 . ASN B 1 47  ? -21.267 16.782  38.679  1.00 127.32 ? 264 ASN B OD1 1 
ATOM 2028 N ND2 . ASN B 1 47  ? -20.666 15.248  37.158  1.00 118.08 ? 264 ASN B ND2 1 
ATOM 2029 N N   . ASP B 1 48  ? -22.842 12.354  41.096  1.00 126.00 ? 265 ASP B N   1 
ATOM 2030 C CA  . ASP B 1 48  ? -22.878 11.339  42.160  1.00 127.44 ? 265 ASP B CA  1 
ATOM 2031 C C   . ASP B 1 48  ? -23.539 10.075  41.637  1.00 129.18 ? 265 ASP B C   1 
ATOM 2032 O O   . ASP B 1 48  ? -23.003 8.977   41.803  1.00 129.49 ? 265 ASP B O   1 
ATOM 2033 C CB  . ASP B 1 48  ? -23.639 11.861  43.387  1.00 130.46 ? 265 ASP B CB  1 
ATOM 2034 C CG  . ASP B 1 48  ? -22.760 12.591  44.373  1.00 150.39 ? 265 ASP B CG  1 
ATOM 2035 O OD1 . ASP B 1 48  ? -22.145 11.915  45.238  1.00 155.96 ? 265 ASP B OD1 1 
ATOM 2036 O OD2 . ASP B 1 48  ? -22.702 13.838  44.302  1.00 157.61 ? 265 ASP B OD2 1 
ATOM 2037 N N   . ALA B 1 49  ? -24.682 10.249  40.958  1.00 123.49 ? 266 ALA B N   1 
ATOM 2038 C CA  . ALA B 1 49  ? -25.421 9.166   40.335  1.00 122.34 ? 266 ALA B CA  1 
ATOM 2039 C C   . ALA B 1 49  ? -24.596 8.585   39.170  1.00 126.17 ? 266 ALA B C   1 
ATOM 2040 O O   . ALA B 1 49  ? -24.684 7.385   38.919  1.00 127.71 ? 266 ALA B O   1 
ATOM 2041 C CB  . ALA B 1 49  ? -26.769 9.673   39.843  1.00 121.40 ? 266 ALA B CB  1 
ATOM 2042 N N   . LEU B 1 50  ? -23.771 9.421   38.491  1.00 120.46 ? 267 LEU B N   1 
ATOM 2043 C CA  . LEU B 1 50  ? -22.898 8.968   37.407  1.00 119.56 ? 267 LEU B CA  1 
ATOM 2044 C C   . LEU B 1 50  ? -21.799 8.106   38.017  1.00 125.82 ? 267 LEU B C   1 
ATOM 2045 O O   . LEU B 1 50  ? -21.582 6.988   37.552  1.00 126.66 ? 267 LEU B O   1 
ATOM 2046 C CB  . LEU B 1 50  ? -22.300 10.152  36.615  1.00 119.08 ? 267 LEU B CB  1 
ATOM 2047 C CG  . LEU B 1 50  ? -21.182 9.827   35.617  1.00 123.40 ? 267 LEU B CG  1 
ATOM 2048 C CD1 . LEU B 1 50  ? -21.717 9.153   34.389  1.00 121.70 ? 267 LEU B CD1 1 
ATOM 2049 C CD2 . LEU B 1 50  ? -20.422 11.060  35.239  1.00 126.03 ? 267 LEU B CD2 1 
ATOM 2050 N N   . ALA B 1 51  ? -21.156 8.600   39.092  1.00 123.75 ? 268 ALA B N   1 
ATOM 2051 C CA  . ALA B 1 51  ? -20.104 7.892   39.829  1.00 126.17 ? 268 ALA B CA  1 
ATOM 2052 C C   . ALA B 1 51  ? -20.560 6.491   40.265  1.00 129.90 ? 268 ALA B C   1 
ATOM 2053 O O   . ALA B 1 51  ? -19.807 5.532   40.078  1.00 131.08 ? 268 ALA B O   1 
ATOM 2054 C CB  . ALA B 1 51  ? -19.668 8.711   41.031  1.00 129.13 ? 268 ALA B CB  1 
ATOM 2055 N N   . ILE B 1 52  ? -21.817 6.375   40.777  1.00 125.43 ? 269 ILE B N   1 
ATOM 2056 C CA  . ILE B 1 52  ? -22.451 5.119   41.231  1.00 126.50 ? 269 ILE B CA  1 
ATOM 2057 C C   . ILE B 1 52  ? -22.686 4.182   40.043  1.00 129.53 ? 269 ILE B C   1 
ATOM 2058 O O   . ILE B 1 52  ? -22.406 2.987   40.129  1.00 131.57 ? 269 ILE B O   1 
ATOM 2059 C CB  . ILE B 1 52  ? -23.760 5.371   42.074  1.00 128.83 ? 269 ILE B CB  1 
ATOM 2060 C CG1 . ILE B 1 52  ? -23.447 6.048   43.434  1.00 130.61 ? 269 ILE B CG1 1 
ATOM 2061 C CG2 . ILE B 1 52  ? -24.583 4.075   42.290  1.00 130.85 ? 269 ILE B CG2 1 
ATOM 2062 C CD1 . ILE B 1 52  ? -24.666 6.627   44.177  1.00 133.57 ? 269 ILE B CD1 1 
ATOM 2063 N N   . ARG B 1 53  ? -23.197 4.730   38.942  1.00 123.93 ? 270 ARG B N   1 
ATOM 2064 C CA  . ARG B 1 53  ? -23.483 3.968   37.733  1.00 123.86 ? 270 ARG B CA  1 
ATOM 2065 C C   . ARG B 1 53  ? -22.206 3.402   37.103  1.00 130.97 ? 270 ARG B C   1 
ATOM 2066 O O   . ARG B 1 53  ? -22.194 2.246   36.679  1.00 131.87 ? 270 ARG B O   1 
ATOM 2067 C CB  . ARG B 1 53  ? -24.348 4.796   36.768  1.00 119.57 ? 270 ARG B CB  1 
ATOM 2068 C CG  . ARG B 1 53  ? -25.808 4.711   37.185  1.00 122.79 ? 270 ARG B CG  1 
ATOM 2069 C CD  . ARG B 1 53  ? -26.699 5.845   36.744  1.00 121.77 ? 270 ARG B CD  1 
ATOM 2070 N NE  . ARG B 1 53  ? -28.006 5.692   37.388  1.00 128.80 ? 270 ARG B NE  1 
ATOM 2071 C CZ  . ARG B 1 53  ? -29.053 6.492   37.206  1.00 132.72 ? 270 ARG B CZ  1 
ATOM 2072 N NH1 . ARG B 1 53  ? -28.971 7.528   36.379  1.00 113.76 ? 270 ARG B NH1 1 
ATOM 2073 N NH2 . ARG B 1 53  ? -30.192 6.258   37.845  1.00 111.65 ? 270 ARG B NH2 1 
ATOM 2074 N N   . GLU B 1 54  ? -21.107 4.173   37.173  1.00 129.41 ? 271 GLU B N   1 
ATOM 2075 C CA  . GLU B 1 54  ? -19.791 3.806   36.652  1.00 132.02 ? 271 GLU B CA  1 
ATOM 2076 C C   . GLU B 1 54  ? -19.192 2.634   37.435  1.00 141.63 ? 271 GLU B C   1 
ATOM 2077 O O   . GLU B 1 54  ? -18.425 1.849   36.870  1.00 143.90 ? 271 GLU B O   1 
ATOM 2078 C CB  . GLU B 1 54  ? -18.837 5.004   36.746  1.00 133.68 ? 271 GLU B CB  1 
ATOM 2079 C CG  . GLU B 1 54  ? -18.817 5.908   35.528  1.00 144.53 ? 271 GLU B CG  1 
ATOM 2080 C CD  . GLU B 1 54  ? -17.956 7.155   35.666  1.00 172.21 ? 271 GLU B CD  1 
ATOM 2081 O OE1 . GLU B 1 54  ? -17.907 7.737   36.776  1.00 172.04 ? 271 GLU B OE1 1 
ATOM 2082 O OE2 . GLU B 1 54  ? -17.339 7.559   34.653  1.00 160.44 ? 271 GLU B OE2 1 
ATOM 2083 N N   . LYS B 1 55  ? -19.505 2.544   38.740  1.00 139.55 ? 272 LYS B N   1 
ATOM 2084 C CA  . LYS B 1 55  ? -18.984 1.489   39.598  1.00 143.68 ? 272 LYS B CA  1 
ATOM 2085 C C   . LYS B 1 55  ? -19.865 0.238   39.619  1.00 149.39 ? 272 LYS B C   1 
ATOM 2086 O O   . LYS B 1 55  ? -19.357 -0.854  39.363  1.00 152.13 ? 272 LYS B O   1 
ATOM 2087 C CB  . LYS B 1 55  ? -18.694 2.006   41.024  1.00 148.40 ? 272 LYS B CB  1 
ATOM 2088 C CG  . LYS B 1 55  ? -17.487 2.953   41.111  1.00 164.99 ? 272 LYS B CG  1 
ATOM 2089 C CD  . LYS B 1 55  ? -16.919 3.097   42.528  1.00 176.06 ? 272 LYS B CD  1 
ATOM 2090 C CE  . LYS B 1 55  ? -15.753 2.164   42.800  1.00 188.02 ? 272 LYS B CE  1 
ATOM 2091 N NZ  . LYS B 1 55  ? -15.301 2.219   44.219  1.00 197.40 ? 272 LYS B NZ  1 
ATOM 2092 N N   . THR B 1 56  ? -21.173 0.393   39.915  1.00 144.38 ? 273 THR B N   1 
ATOM 2093 C CA  . THR B 1 56  ? -22.121 -0.725  40.005  1.00 145.98 ? 273 THR B CA  1 
ATOM 2094 C C   . THR B 1 56  ? -22.427 -1.358  38.656  1.00 149.94 ? 273 THR B C   1 
ATOM 2095 O O   . THR B 1 56  ? -22.154 -2.542  38.468  1.00 153.57 ? 273 THR B O   1 
ATOM 2096 C CB  . THR B 1 56  ? -23.399 -0.341  40.773  1.00 152.09 ? 273 THR B CB  1 
ATOM 2097 O OG1 . THR B 1 56  ? -24.061 0.728   40.098  1.00 146.44 ? 273 THR B OG1 1 
ATOM 2098 C CG2 . THR B 1 56  ? -23.134 0.025   42.231  1.00 152.68 ? 273 THR B CG2 1 
ATOM 2099 N N   . LEU B 1 57  ? -22.989 -0.577  37.724  1.00 143.13 ? 274 LEU B N   1 
ATOM 2100 C CA  . LEU B 1 57  ? -23.372 -1.053  36.388  1.00 143.41 ? 274 LEU B CA  1 
ATOM 2101 C C   . LEU B 1 57  ? -22.194 -1.103  35.399  1.00 147.16 ? 274 LEU B C   1 
ATOM 2102 O O   . LEU B 1 57  ? -22.309 -1.721  34.337  1.00 147.11 ? 274 LEU B O   1 
ATOM 2103 C CB  . LEU B 1 57  ? -24.546 -0.219  35.821  1.00 140.82 ? 274 LEU B CB  1 
ATOM 2104 C CG  . LEU B 1 57  ? -25.801 -0.089  36.707  1.00 145.64 ? 274 LEU B CG  1 
ATOM 2105 C CD1 . LEU B 1 57  ? -26.594 1.135   36.343  1.00 142.72 ? 274 LEU B CD1 1 
ATOM 2106 C CD2 . LEU B 1 57  ? -26.677 -1.330  36.637  1.00 152.10 ? 274 LEU B CD2 1 
ATOM 2107 N N   . GLY B 1 58  ? -21.082 -0.460  35.769  1.00 144.06 ? 275 GLY B N   1 
ATOM 2108 C CA  . GLY B 1 58  ? -19.857 -0.405  34.975  1.00 144.88 ? 275 GLY B CA  1 
ATOM 2109 C C   . GLY B 1 58  ? -19.889 0.606   33.849  1.00 146.58 ? 275 GLY B C   1 
ATOM 2110 O O   . GLY B 1 58  ? -20.973 1.012   33.415  1.00 144.56 ? 275 GLY B O   1 
ATOM 2111 N N   . LYS B 1 59  ? -18.697 1.021   33.354  1.00 143.59 ? 276 LYS B N   1 
ATOM 2112 C CA  . LYS B 1 59  ? -18.599 1.957   32.222  1.00 141.57 ? 276 LYS B CA  1 
ATOM 2113 C C   . LYS B 1 59  ? -19.092 1.235   30.967  1.00 145.53 ? 276 LYS B C   1 
ATOM 2114 O O   . LYS B 1 59  ? -19.059 -0.003  30.924  1.00 148.51 ? 276 LYS B O   1 
ATOM 2115 C CB  . LYS B 1 59  ? -17.159 2.456   32.025  1.00 145.44 ? 276 LYS B CB  1 
ATOM 2116 C CG  . LYS B 1 59  ? -16.831 3.732   32.786  1.00 158.37 ? 276 LYS B CG  1 
ATOM 2117 C CD  . LYS B 1 59  ? -15.632 4.445   32.167  1.00 169.69 ? 276 LYS B CD  1 
ATOM 2118 C CE  . LYS B 1 59  ? -15.150 5.622   32.982  1.00 177.34 ? 276 LYS B CE  1 
ATOM 2119 N NZ  . LYS B 1 59  ? -14.353 6.576   32.163  1.00 183.16 ? 276 LYS B NZ  1 
ATOM 2120 N N   . ASP B 1 60  ? -19.554 1.993   29.961  1.00 138.74 ? 277 ASP B N   1 
ATOM 2121 C CA  . ASP B 1 60  ? -20.099 1.451   28.708  1.00 139.53 ? 277 ASP B CA  1 
ATOM 2122 C C   . ASP B 1 60  ? -21.470 0.782   28.924  1.00 141.29 ? 277 ASP B C   1 
ATOM 2123 O O   . ASP B 1 60  ? -21.786 -0.247  28.318  1.00 143.18 ? 277 ASP B O   1 
ATOM 2124 C CB  . ASP B 1 60  ? -19.099 0.542   27.943  1.00 145.15 ? 277 ASP B CB  1 
ATOM 2125 C CG  . ASP B 1 60  ? -17.796 1.219   27.578  1.00 159.94 ? 277 ASP B CG  1 
ATOM 2126 O OD1 . ASP B 1 60  ? -17.764 1.930   26.545  1.00 159.75 ? 277 ASP B OD1 1 
ATOM 2127 O OD2 . ASP B 1 60  ? -16.798 1.013   28.305  1.00 169.52 ? 277 ASP B OD2 1 
ATOM 2128 N N   . HIS B 1 61  ? -22.282 1.393   29.793  1.00 134.70 ? 278 HIS B N   1 
ATOM 2129 C CA  . HIS B 1 61  ? -23.639 0.954   30.094  1.00 135.14 ? 278 HIS B CA  1 
ATOM 2130 C C   . HIS B 1 61  ? -24.625 2.063   29.670  1.00 137.97 ? 278 HIS B C   1 
ATOM 2131 O O   . HIS B 1 61  ? -24.332 3.247   29.894  1.00 134.48 ? 278 HIS B O   1 
ATOM 2132 C CB  . HIS B 1 61  ? -23.797 0.631   31.589  1.00 135.53 ? 278 HIS B CB  1 
ATOM 2133 C CG  . HIS B 1 61  ? -25.113 0.001   31.931  1.00 140.55 ? 278 HIS B CG  1 
ATOM 2134 N ND1 . HIS B 1 61  ? -26.256 0.760   32.092  1.00 140.58 ? 278 HIS B ND1 1 
ATOM 2135 C CD2 . HIS B 1 61  ? -25.428 -1.302  32.109  1.00 146.21 ? 278 HIS B CD2 1 
ATOM 2136 C CE1 . HIS B 1 61  ? -27.224 -0.097  32.366  1.00 143.02 ? 278 HIS B CE1 1 
ATOM 2137 N NE2 . HIS B 1 61  ? -26.773 -1.349  32.394  1.00 146.97 ? 278 HIS B NE2 1 
ATOM 2138 N N   . PRO B 1 62  ? -25.804 1.702   29.089  1.00 137.02 ? 279 PRO B N   1 
ATOM 2139 C CA  . PRO B 1 62  ? -26.779 2.731   28.670  1.00 135.15 ? 279 PRO B CA  1 
ATOM 2140 C C   . PRO B 1 62  ? -27.149 3.793   29.707  1.00 133.99 ? 279 PRO B C   1 
ATOM 2141 O O   . PRO B 1 62  ? -27.352 4.947   29.336  1.00 131.16 ? 279 PRO B O   1 
ATOM 2142 C CB  . PRO B 1 62  ? -27.991 1.903   28.251  1.00 141.21 ? 279 PRO B CB  1 
ATOM 2143 C CG  . PRO B 1 62  ? -27.396 0.616   27.765  1.00 149.36 ? 279 PRO B CG  1 
ATOM 2144 C CD  . PRO B 1 62  ? -26.284 0.347   28.732  1.00 143.24 ? 279 PRO B CD  1 
ATOM 2145 N N   . ALA B 1 63  ? -27.214 3.415   30.995  1.00 130.18 ? 280 ALA B N   1 
ATOM 2146 C CA  . ALA B 1 63  ? -27.520 4.333   32.099  1.00 127.47 ? 280 ALA B CA  1 
ATOM 2147 C C   . ALA B 1 63  ? -26.417 5.386   32.268  1.00 127.74 ? 280 ALA B C   1 
ATOM 2148 O O   . ALA B 1 63  ? -26.728 6.540   32.574  1.00 125.81 ? 280 ALA B O   1 
ATOM 2149 C CB  . ALA B 1 63  ? -27.720 3.561   33.399  1.00 129.40 ? 280 ALA B CB  1 
ATOM 2150 N N   . VAL B 1 64  ? -25.137 4.990   32.048  1.00 123.18 ? 281 VAL B N   1 
ATOM 2151 C CA  . VAL B 1 64  ? -23.970 5.882   32.127  1.00 120.95 ? 281 VAL B CA  1 
ATOM 2152 C C   . VAL B 1 64  ? -24.120 6.914   31.004  1.00 122.57 ? 281 VAL B C   1 
ATOM 2153 O O   . VAL B 1 64  ? -23.975 8.117   31.252  1.00 121.36 ? 281 VAL B O   1 
ATOM 2154 C CB  . VAL B 1 64  ? -22.624 5.110   32.020  1.00 126.03 ? 281 VAL B CB  1 
ATOM 2155 C CG1 . VAL B 1 64  ? -21.427 6.047   32.152  1.00 125.34 ? 281 VAL B CG1 1 
ATOM 2156 C CG2 . VAL B 1 64  ? -22.542 3.990   33.050  1.00 127.65 ? 281 VAL B CG2 1 
ATOM 2157 N N   . ALA B 1 65  ? -24.462 6.430   29.786  1.00 117.53 ? 282 ALA B N   1 
ATOM 2158 C CA  . ALA B 1 65  ? -24.668 7.256   28.611  1.00 116.41 ? 282 ALA B CA  1 
ATOM 2159 C C   . ALA B 1 65  ? -25.778 8.282   28.854  1.00 118.49 ? 282 ALA B C   1 
ATOM 2160 O O   . ALA B 1 65  ? -25.544 9.473   28.638  1.00 118.59 ? 282 ALA B O   1 
ATOM 2161 C CB  . ALA B 1 65  ? -24.991 6.388   27.403  1.00 119.28 ? 282 ALA B CB  1 
ATOM 2162 N N   . ALA B 1 66  ? -26.957 7.833   29.351  1.00 113.14 ? 283 ALA B N   1 
ATOM 2163 C CA  . ALA B 1 66  ? -28.109 8.693   29.647  1.00 111.52 ? 283 ALA B CA  1 
ATOM 2164 C C   . ALA B 1 66  ? -27.743 9.812   30.649  1.00 113.06 ? 283 ALA B C   1 
ATOM 2165 O O   . ALA B 1 66  ? -28.113 10.969  30.431  1.00 112.49 ? 283 ALA B O   1 
ATOM 2166 C CB  . ALA B 1 66  ? -29.271 7.856   30.171  1.00 113.40 ? 283 ALA B CB  1 
ATOM 2167 N N   . THR B 1 67  ? -26.976 9.471   31.709  1.00 107.84 ? 284 THR B N   1 
ATOM 2168 C CA  . THR B 1 67  ? -26.512 10.397  32.747  1.00 105.80 ? 284 THR B CA  1 
ATOM 2169 C C   . THR B 1 67  ? -25.482 11.391  32.175  1.00 107.49 ? 284 THR B C   1 
ATOM 2170 O O   . THR B 1 67  ? -25.558 12.577  32.488  1.00 107.57 ? 284 THR B O   1 
ATOM 2171 C CB  . THR B 1 67  ? -26.067 9.612   34.006  1.00 112.39 ? 284 THR B CB  1 
ATOM 2172 O OG1 . THR B 1 67  ? -27.105 8.704   34.377  1.00 112.69 ? 284 THR B OG1 1 
ATOM 2173 C CG2 . THR B 1 67  ? -25.762 10.509  35.192  1.00 109.06 ? 284 THR B CG2 1 
ATOM 2174 N N   . LEU B 1 68  ? -24.553 10.923  31.320  1.00 103.17 ? 285 LEU B N   1 
ATOM 2175 C CA  . LEU B 1 68  ? -23.550 11.789  30.685  1.00 103.33 ? 285 LEU B CA  1 
ATOM 2176 C C   . LEU B 1 68  ? -24.212 12.846  29.792  1.00 105.98 ? 285 LEU B C   1 
ATOM 2177 O O   . LEU B 1 68  ? -23.810 14.014  29.830  1.00 106.63 ? 285 LEU B O   1 
ATOM 2178 C CB  . LEU B 1 68  ? -22.519 10.975  29.887  1.00 104.26 ? 285 LEU B CB  1 
ATOM 2179 C CG  . LEU B 1 68  ? -21.502 10.159  30.700  1.00 108.98 ? 285 LEU B CG  1 
ATOM 2180 C CD1 . LEU B 1 68  ? -20.943 9.049   29.871  1.00 110.16 ? 285 LEU B CD1 1 
ATOM 2181 C CD2 . LEU B 1 68  ? -20.373 11.015  31.198  1.00 111.35 ? 285 LEU B CD2 1 
ATOM 2182 N N   . ASN B 1 69  ? -25.253 12.441  29.028  1.00 101.02 ? 286 ASN B N   1 
ATOM 2183 C CA  . ASN B 1 69  ? -26.043 13.315  28.143  1.00 100.63 ? 286 ASN B CA  1 
ATOM 2184 C C   . ASN B 1 69  ? -26.752 14.378  28.967  1.00 104.72 ? 286 ASN B C   1 
ATOM 2185 O O   . ASN B 1 69  ? -26.708 15.554  28.619  1.00 104.87 ? 286 ASN B O   1 
ATOM 2186 C CB  . ASN B 1 69  ? -27.081 12.500  27.360  1.00 97.09  ? 286 ASN B CB  1 
ATOM 2187 C CG  . ASN B 1 69  ? -28.124 13.338  26.657  1.00 124.10 ? 286 ASN B CG  1 
ATOM 2188 O OD1 . ASN B 1 69  ? -27.879 13.917  25.593  1.00 123.19 ? 286 ASN B OD1 1 
ATOM 2189 N ND2 . ASN B 1 69  ? -29.313 13.433  27.244  1.00 115.08 ? 286 ASN B ND2 1 
ATOM 2190 N N   . ASN B 1 70  ? -27.422 13.946  30.053  1.00 100.72 ? 287 ASN B N   1 
ATOM 2191 C CA  . ASN B 1 70  ? -28.164 14.815  30.942  1.00 100.38 ? 287 ASN B CA  1 
ATOM 2192 C C   . ASN B 1 70  ? -27.234 15.792  31.628  1.00 106.82 ? 287 ASN B C   1 
ATOM 2193 O O   . ASN B 1 70  ? -27.573 16.977  31.711  1.00 108.76 ? 287 ASN B O   1 
ATOM 2194 C CB  . ASN B 1 70  ? -29.010 14.001  31.899  1.00 99.42  ? 287 ASN B CB  1 
ATOM 2195 C CG  . ASN B 1 70  ? -30.176 13.331  31.213  1.00 116.89 ? 287 ASN B CG  1 
ATOM 2196 O OD1 . ASN B 1 70  ? -30.657 13.777  30.176  1.00 108.26 ? 287 ASN B OD1 1 
ATOM 2197 N ND2 . ASN B 1 70  ? -30.674 12.250  31.786  1.00 115.08 ? 287 ASN B ND2 1 
ATOM 2198 N N   . LEU B 1 71  ? -26.016 15.337  32.002  1.00 102.86 ? 288 LEU B N   1 
ATOM 2199 C CA  . LEU B 1 71  ? -24.996 16.229  32.550  1.00 104.27 ? 288 LEU B CA  1 
ATOM 2200 C C   . LEU B 1 71  ? -24.592 17.272  31.490  1.00 111.74 ? 288 LEU B C   1 
ATOM 2201 O O   . LEU B 1 71  ? -24.471 18.452  31.830  1.00 113.93 ? 288 LEU B O   1 
ATOM 2202 C CB  . LEU B 1 71  ? -23.773 15.452  33.036  1.00 104.34 ? 288 LEU B CB  1 
ATOM 2203 C CG  . LEU B 1 71  ? -23.843 14.907  34.447  1.00 107.42 ? 288 LEU B CG  1 
ATOM 2204 C CD1 . LEU B 1 71  ? -22.897 13.768  34.611  1.00 107.76 ? 288 LEU B CD1 1 
ATOM 2205 C CD2 . LEU B 1 71  ? -23.549 15.987  35.474  1.00 110.67 ? 288 LEU B CD2 1 
ATOM 2206 N N   . ALA B 1 72  ? -24.461 16.853  30.203  1.00 108.69 ? 289 ALA B N   1 
ATOM 2207 C CA  . ALA B 1 72  ? -24.140 17.752  29.088  1.00 111.00 ? 289 ALA B CA  1 
ATOM 2208 C C   . ALA B 1 72  ? -25.281 18.762  28.854  1.00 116.51 ? 289 ALA B C   1 
ATOM 2209 O O   . ALA B 1 72  ? -25.004 19.931  28.565  1.00 117.75 ? 289 ALA B O   1 
ATOM 2210 C CB  . ALA B 1 72  ? -23.865 16.956  27.817  1.00 111.53 ? 289 ALA B CB  1 
ATOM 2211 N N   . VAL B 1 73  ? -26.557 18.317  29.029  1.00 112.57 ? 290 VAL B N   1 
ATOM 2212 C CA  . VAL B 1 73  ? -27.755 19.156  28.881  1.00 113.82 ? 290 VAL B CA  1 
ATOM 2213 C C   . VAL B 1 73  ? -27.648 20.299  29.882  1.00 121.27 ? 290 VAL B C   1 
ATOM 2214 O O   . VAL B 1 73  ? -27.810 21.454  29.496  1.00 124.92 ? 290 VAL B O   1 
ATOM 2215 C CB  . VAL B 1 73  ? -29.085 18.360  29.046  1.00 115.96 ? 290 VAL B CB  1 
ATOM 2216 C CG1 . VAL B 1 73  ? -30.289 19.285  29.187  1.00 117.24 ? 290 VAL B CG1 1 
ATOM 2217 C CG2 . VAL B 1 73  ? -29.299 17.377  27.899  1.00 115.65 ? 290 VAL B CG2 1 
ATOM 2218 N N   . LEU B 1 74  ? -27.314 19.973  31.148  1.00 116.55 ? 291 LEU B N   1 
ATOM 2219 C CA  . LEU B 1 74  ? -27.158 20.939  32.234  1.00 117.65 ? 291 LEU B CA  1 
ATOM 2220 C C   . LEU B 1 74  ? -25.968 21.873  32.052  1.00 126.30 ? 291 LEU B C   1 
ATOM 2221 O O   . LEU B 1 74  ? -26.115 23.070  32.296  1.00 128.61 ? 291 LEU B O   1 
ATOM 2222 C CB  . LEU B 1 74  ? -27.130 20.250  33.599  1.00 115.53 ? 291 LEU B CB  1 
ATOM 2223 C CG  . LEU B 1 74  ? -28.397 19.479  33.993  1.00 116.75 ? 291 LEU B CG  1 
ATOM 2224 C CD1 . LEU B 1 74  ? -28.142 18.612  35.190  1.00 115.04 ? 291 LEU B CD1 1 
ATOM 2225 C CD2 . LEU B 1 74  ? -29.584 20.418  34.247  1.00 118.96 ? 291 LEU B CD2 1 
ATOM 2226 N N   . TYR B 1 75  ? -24.805 21.351  31.584  1.00 126.06 ? 292 TYR B N   1 
ATOM 2227 C CA  . TYR B 1 75  ? -23.627 22.186  31.307  1.00 128.19 ? 292 TYR B CA  1 
ATOM 2228 C C   . TYR B 1 75  ? -23.955 23.208  30.207  1.00 130.51 ? 292 TYR B C   1 
ATOM 2229 O O   . TYR B 1 75  ? -23.538 24.362  30.312  1.00 133.56 ? 292 TYR B O   1 
ATOM 2230 C CB  . TYR B 1 75  ? -22.385 21.360  30.930  1.00 129.73 ? 292 TYR B CB  1 
ATOM 2231 C CG  . TYR B 1 75  ? -21.516 20.950  32.101  1.00 135.42 ? 292 TYR B CG  1 
ATOM 2232 C CD1 . TYR B 1 75  ? -20.733 21.884  32.778  1.00 142.07 ? 292 TYR B CD1 1 
ATOM 2233 C CD2 . TYR B 1 75  ? -21.420 19.621  32.488  1.00 135.10 ? 292 TYR B CD2 1 
ATOM 2234 C CE1 . TYR B 1 75  ? -19.920 21.509  33.854  1.00 146.06 ? 292 TYR B CE1 1 
ATOM 2235 C CE2 . TYR B 1 75  ? -20.584 19.227  33.534  1.00 138.36 ? 292 TYR B CE2 1 
ATOM 2236 C CZ  . TYR B 1 75  ? -19.853 20.177  34.231  1.00 150.94 ? 292 TYR B CZ  1 
ATOM 2237 O OH  . TYR B 1 75  ? -19.038 19.795  35.273  1.00 153.87 ? 292 TYR B OH  1 
ATOM 2238 N N   . GLY B 1 76  ? -24.744 22.784  29.211  1.00 121.84 ? 293 GLY B N   1 
ATOM 2239 C CA  . GLY B 1 76  ? -25.206 23.625  28.112  1.00 120.54 ? 293 GLY B CA  1 
ATOM 2240 C C   . GLY B 1 76  ? -26.164 24.715  28.550  1.00 125.55 ? 293 GLY B C   1 
ATOM 2241 O O   . GLY B 1 76  ? -26.136 25.817  27.997  1.00 127.34 ? 293 GLY B O   1 
ATOM 2242 N N   . LYS B 1 77  ? -27.011 24.421  29.564  1.00 121.30 ? 294 LYS B N   1 
ATOM 2243 C CA  . LYS B 1 77  ? -27.982 25.352  30.155  1.00 122.60 ? 294 LYS B CA  1 
ATOM 2244 C C   . LYS B 1 77  ? -27.244 26.523  30.810  1.00 130.13 ? 294 LYS B C   1 
ATOM 2245 O O   . LYS B 1 77  ? -27.780 27.629  30.864  1.00 132.86 ? 294 LYS B O   1 
ATOM 2246 C CB  . LYS B 1 77  ? -28.847 24.636  31.219  1.00 124.57 ? 294 LYS B CB  1 
ATOM 2247 C CG  . LYS B 1 77  ? -29.985 23.776  30.687  1.00 133.87 ? 294 LYS B CG  1 
ATOM 2248 C CD  . LYS B 1 77  ? -31.195 24.614  30.321  1.00 150.14 ? 294 LYS B CD  1 
ATOM 2249 C CE  . LYS B 1 77  ? -32.381 23.784  29.921  1.00 164.84 ? 294 LYS B CE  1 
ATOM 2250 N NZ  . LYS B 1 77  ? -33.568 24.642  29.674  1.00 176.56 ? 294 LYS B NZ  1 
ATOM 2251 N N   . ARG B 1 78  ? -26.017 26.261  31.313  1.00 126.37 ? 295 ARG B N   1 
ATOM 2252 C CA  . ARG B 1 78  ? -25.128 27.222  31.971  1.00 129.77 ? 295 ARG B CA  1 
ATOM 2253 C C   . ARG B 1 78  ? -24.198 27.953  30.973  1.00 133.29 ? 295 ARG B C   1 
ATOM 2254 O O   . ARG B 1 78  ? -23.410 28.804  31.391  1.00 137.23 ? 295 ARG B O   1 
ATOM 2255 C CB  . ARG B 1 78  ? -24.292 26.510  33.054  1.00 131.38 ? 295 ARG B CB  1 
ATOM 2256 C CG  . ARG B 1 78  ? -25.049 26.203  34.351  1.00 143.38 ? 295 ARG B CG  1 
ATOM 2257 C CD  . ARG B 1 78  ? -24.161 26.371  35.575  1.00 159.03 ? 295 ARG B CD  1 
ATOM 2258 N NE  . ARG B 1 78  ? -23.119 25.343  35.644  1.00 167.42 ? 295 ARG B NE  1 
ATOM 2259 C CZ  . ARG B 1 78  ? -21.906 25.535  36.151  1.00 182.55 ? 295 ARG B CZ  1 
ATOM 2260 N NH1 . ARG B 1 78  ? -21.563 26.719  36.644  1.00 176.00 ? 295 ARG B NH1 1 
ATOM 2261 N NH2 . ARG B 1 78  ? -21.023 24.546  36.163  1.00 163.27 ? 295 ARG B NH2 1 
ATOM 2262 N N   . GLY B 1 79  ? -24.300 27.611  29.679  1.00 125.06 ? 296 GLY B N   1 
ATOM 2263 C CA  . GLY B 1 79  ? -23.492 28.183  28.601  1.00 124.89 ? 296 GLY B CA  1 
ATOM 2264 C C   . GLY B 1 79  ? -22.085 27.618  28.509  1.00 127.35 ? 296 GLY B C   1 
ATOM 2265 O O   . GLY B 1 79  ? -21.247 28.156  27.779  1.00 127.83 ? 296 GLY B O   1 
ATOM 2266 N N   . LYS B 1 80  ? -21.821 26.519  29.244  1.00 122.68 ? 297 LYS B N   1 
ATOM 2267 C CA  . LYS B 1 80  ? -20.525 25.836  29.324  1.00 123.14 ? 297 LYS B CA  1 
ATOM 2268 C C   . LYS B 1 80  ? -20.397 24.750  28.233  1.00 123.85 ? 297 LYS B C   1 
ATOM 2269 O O   . LYS B 1 80  ? -20.197 23.569  28.537  1.00 121.47 ? 297 LYS B O   1 
ATOM 2270 C CB  . LYS B 1 80  ? -20.319 25.268  30.747  1.00 125.97 ? 297 LYS B CB  1 
ATOM 2271 C CG  . LYS B 1 80  ? -19.954 26.315  31.796  1.00 140.49 ? 297 LYS B CG  1 
ATOM 2272 C CD  . LYS B 1 80  ? -19.723 25.695  33.175  1.00 152.05 ? 297 LYS B CD  1 
ATOM 2273 C CE  . LYS B 1 80  ? -18.262 25.483  33.503  1.00 160.76 ? 297 LYS B CE  1 
ATOM 2274 N NZ  . LYS B 1 80  ? -18.075 24.886  34.849  1.00 164.59 ? 297 LYS B NZ  1 
ATOM 2275 N N   . TYR B 1 81  ? -20.504 25.174  26.957  1.00 120.06 ? 298 TYR B N   1 
ATOM 2276 C CA  . TYR B 1 81  ? -20.474 24.316  25.766  1.00 116.40 ? 298 TYR B CA  1 
ATOM 2277 C C   . TYR B 1 81  ? -19.184 23.527  25.525  1.00 122.86 ? 298 TYR B C   1 
ATOM 2278 O O   . TYR B 1 81  ? -19.266 22.342  25.198  1.00 118.47 ? 298 TYR B O   1 
ATOM 2279 C CB  . TYR B 1 81  ? -20.891 25.095  24.511  1.00 116.32 ? 298 TYR B CB  1 
ATOM 2280 C CG  . TYR B 1 81  ? -22.159 25.905  24.677  1.00 117.31 ? 298 TYR B CG  1 
ATOM 2281 C CD1 . TYR B 1 81  ? -23.375 25.287  24.958  1.00 116.86 ? 298 TYR B CD1 1 
ATOM 2282 C CD2 . TYR B 1 81  ? -22.149 27.287  24.526  1.00 120.71 ? 298 TYR B CD2 1 
ATOM 2283 C CE1 . TYR B 1 81  ? -24.543 26.029  25.123  1.00 118.54 ? 298 TYR B CE1 1 
ATOM 2284 C CE2 . TYR B 1 81  ? -23.314 28.039  24.674  1.00 121.85 ? 298 TYR B CE2 1 
ATOM 2285 C CZ  . TYR B 1 81  ? -24.508 27.406  24.983  1.00 127.76 ? 298 TYR B CZ  1 
ATOM 2286 O OH  . TYR B 1 81  ? -25.665 28.130  25.139  1.00 131.72 ? 298 TYR B OH  1 
ATOM 2287 N N   . LYS B 1 82  ? -18.005 24.170  25.681  1.00 126.62 ? 299 LYS B N   1 
ATOM 2288 C CA  . LYS B 1 82  ? -16.694 23.529  25.482  1.00 128.96 ? 299 LYS B CA  1 
ATOM 2289 C C   . LYS B 1 82  ? -16.474 22.322  26.406  1.00 133.64 ? 299 LYS B C   1 
ATOM 2290 O O   . LYS B 1 82  ? -15.822 21.357  26.002  1.00 133.00 ? 299 LYS B O   1 
ATOM 2291 C CB  . LYS B 1 82  ? -15.540 24.541  25.624  1.00 137.61 ? 299 LYS B CB  1 
ATOM 2292 C CG  . LYS B 1 82  ? -15.296 25.376  24.368  1.00 154.81 ? 299 LYS B CG  1 
ATOM 2293 C CD  . LYS B 1 82  ? -13.969 26.141  24.395  1.00 168.83 ? 299 LYS B CD  1 
ATOM 2294 C CE  . LYS B 1 82  ? -13.813 27.027  23.178  1.00 177.57 ? 299 LYS B CE  1 
ATOM 2295 N NZ  . LYS B 1 82  ? -12.457 27.626  23.086  1.00 191.04 ? 299 LYS B NZ  1 
ATOM 2296 N N   . GLU B 1 83  ? -17.035 22.372  27.627  1.00 130.63 ? 300 GLU B N   1 
ATOM 2297 C CA  . GLU B 1 83  ? -16.940 21.297  28.618  1.00 130.01 ? 300 GLU B CA  1 
ATOM 2298 C C   . GLU B 1 83  ? -18.137 20.332  28.602  1.00 129.35 ? 300 GLU B C   1 
ATOM 2299 O O   . GLU B 1 83  ? -18.085 19.278  29.230  1.00 128.04 ? 300 GLU B O   1 
ATOM 2300 C CB  . GLU B 1 83  ? -16.622 21.828  30.037  1.00 135.46 ? 300 GLU B CB  1 
ATOM 2301 C CG  . GLU B 1 83  ? -17.445 23.022  30.497  1.00 150.14 ? 300 GLU B CG  1 
ATOM 2302 C CD  . GLU B 1 83  ? -16.902 24.379  30.084  1.00 178.28 ? 300 GLU B CD  1 
ATOM 2303 O OE1 . GLU B 1 83  ? -17.174 24.809  28.938  1.00 167.33 ? 300 GLU B OE1 1 
ATOM 2304 O OE2 . GLU B 1 83  ? -16.210 25.017  30.910  1.00 180.95 ? 300 GLU B OE2 1 
ATOM 2305 N N   . ALA B 1 84  ? -19.180 20.671  27.841  1.00 123.71 ? 301 ALA B N   1 
ATOM 2306 C CA  . ALA B 1 84  ? -20.359 19.830  27.668  1.00 120.26 ? 301 ALA B CA  1 
ATOM 2307 C C   . ALA B 1 84  ? -20.116 18.843  26.510  1.00 121.02 ? 301 ALA B C   1 
ATOM 2308 O O   . ALA B 1 84  ? -20.681 17.746  26.495  1.00 118.83 ? 301 ALA B O   1 
ATOM 2309 C CB  . ALA B 1 84  ? -21.570 20.695  27.375  1.00 120.50 ? 301 ALA B CB  1 
ATOM 2310 N N   . GLU B 1 85  ? -19.273 19.254  25.543  1.00 117.66 ? 302 GLU B N   1 
ATOM 2311 C CA  . GLU B 1 85  ? -18.875 18.476  24.368  1.00 115.87 ? 302 GLU B CA  1 
ATOM 2312 C C   . GLU B 1 85  ? -18.196 17.126  24.735  1.00 117.27 ? 302 GLU B C   1 
ATOM 2313 O O   . GLU B 1 85  ? -18.648 16.112  24.197  1.00 113.85 ? 302 GLU B O   1 
ATOM 2314 C CB  . GLU B 1 85  ? -18.014 19.330  23.404  1.00 119.14 ? 302 GLU B CB  1 
ATOM 2315 C CG  . GLU B 1 85  ? -18.105 18.903  21.942  1.00 132.37 ? 302 GLU B CG  1 
ATOM 2316 C CD  . GLU B 1 85  ? -17.607 19.864  20.868  1.00 160.14 ? 302 GLU B CD  1 
ATOM 2317 O OE1 . GLU B 1 85  ? -17.542 21.087  21.134  1.00 160.36 ? 302 GLU B OE1 1 
ATOM 2318 O OE2 . GLU B 1 85  ? -17.333 19.393  19.738  1.00 149.68 ? 302 GLU B OE2 1 
ATOM 2319 N N   . PRO B 1 86  ? -17.182 17.043  25.658  1.00 115.49 ? 303 PRO B N   1 
ATOM 2320 C CA  . PRO B 1 86  ? -16.584 15.725  25.972  1.00 114.61 ? 303 PRO B CA  1 
ATOM 2321 C C   . PRO B 1 86  ? -17.569 14.711  26.539  1.00 114.30 ? 303 PRO B C   1 
ATOM 2322 O O   . PRO B 1 86  ? -17.451 13.522  26.244  1.00 113.11 ? 303 PRO B O   1 
ATOM 2323 C CB  . PRO B 1 86  ? -15.491 16.058  26.996  1.00 119.26 ? 303 PRO B CB  1 
ATOM 2324 C CG  . PRO B 1 86  ? -15.223 17.494  26.834  1.00 125.84 ? 303 PRO B CG  1 
ATOM 2325 C CD  . PRO B 1 86  ? -16.514 18.111  26.434  1.00 119.76 ? 303 PRO B CD  1 
ATOM 2326 N N   . LEU B 1 87  ? -18.539 15.190  27.339  1.00 109.70 ? 304 LEU B N   1 
ATOM 2327 C CA  . LEU B 1 87  ? -19.571 14.375  27.980  1.00 108.48 ? 304 LEU B CA  1 
ATOM 2328 C C   . LEU B 1 87  ? -20.469 13.744  26.942  1.00 112.13 ? 304 LEU B C   1 
ATOM 2329 O O   . LEU B 1 87  ? -20.716 12.538  26.992  1.00 111.68 ? 304 LEU B O   1 
ATOM 2330 C CB  . LEU B 1 87  ? -20.403 15.221  28.952  1.00 108.72 ? 304 LEU B CB  1 
ATOM 2331 C CG  . LEU B 1 87  ? -19.769 15.491  30.302  1.00 115.74 ? 304 LEU B CG  1 
ATOM 2332 C CD1 . LEU B 1 87  ? -19.877 16.941  30.651  1.00 117.85 ? 304 LEU B CD1 1 
ATOM 2333 C CD2 . LEU B 1 87  ? -20.419 14.665  31.376  1.00 118.21 ? 304 LEU B CD2 1 
ATOM 2334 N N   . CYS B 1 88  ? -20.930 14.558  25.983  1.00 108.91 ? 305 CYS B N   1 
ATOM 2335 C CA  . CYS B 1 88  ? -21.810 14.134  24.913  1.00 107.92 ? 305 CYS B CA  1 
ATOM 2336 C C   . CYS B 1 88  ? -21.112 13.181  23.949  1.00 109.56 ? 305 CYS B C   1 
ATOM 2337 O O   . CYS B 1 88  ? -21.717 12.194  23.517  1.00 108.47 ? 305 CYS B O   1 
ATOM 2338 C CB  . CYS B 1 88  ? -22.379 15.349  24.199  1.00 108.90 ? 305 CYS B CB  1 
ATOM 2339 S SG  . CYS B 1 88  ? -24.178 15.332  24.049  1.00 112.90 ? 305 CYS B SG  1 
ATOM 2340 N N   . LYS B 1 89  ? -19.820 13.457  23.654  1.00 105.49 ? 306 LYS B N   1 
ATOM 2341 C CA  . LYS B 1 89  ? -18.978 12.640  22.778  1.00 104.61 ? 306 LYS B CA  1 
ATOM 2342 C C   . LYS B 1 89  ? -18.736 11.270  23.403  1.00 108.53 ? 306 LYS B C   1 
ATOM 2343 O O   . LYS B 1 89  ? -18.718 10.265  22.683  1.00 108.23 ? 306 LYS B O   1 
ATOM 2344 C CB  . LYS B 1 89  ? -17.646 13.349  22.467  1.00 107.33 ? 306 LYS B CB  1 
ATOM 2345 C CG  . LYS B 1 89  ? -17.737 14.375  21.339  1.00 110.54 ? 306 LYS B CG  1 
ATOM 2346 C CD  . LYS B 1 89  ? -16.402 15.047  21.035  1.00 116.56 ? 306 LYS B CD  1 
ATOM 2347 C CE  . LYS B 1 89  ? -16.512 15.979  19.853  1.00 131.26 ? 306 LYS B CE  1 
ATOM 2348 N NZ  . LYS B 1 89  ? -15.223 16.664  19.565  1.00 144.34 ? 306 LYS B NZ  1 
ATOM 2349 N N   . ARG B 1 90  ? -18.575 11.228  24.745  1.00 105.20 ? 307 ARG B N   1 
ATOM 2350 C CA  . ARG B 1 90  ? -18.357 9.982   25.478  1.00 105.82 ? 307 ARG B CA  1 
ATOM 2351 C C   . ARG B 1 90  ? -19.617 9.123   25.481  1.00 108.32 ? 307 ARG B C   1 
ATOM 2352 O O   . ARG B 1 90  ? -19.509 7.900   25.337  1.00 109.08 ? 307 ARG B O   1 
ATOM 2353 C CB  . ARG B 1 90  ? -17.897 10.253  26.914  1.00 107.07 ? 307 ARG B CB  1 
ATOM 2354 C CG  . ARG B 1 90  ? -17.105 9.096   27.500  1.00 117.49 ? 307 ARG B CG  1 
ATOM 2355 C CD  . ARG B 1 90  ? -16.920 9.233   28.987  1.00 123.89 ? 307 ARG B CD  1 
ATOM 2356 N NE  . ARG B 1 90  ? -17.498 8.088   29.688  1.00 131.67 ? 307 ARG B NE  1 
ATOM 2357 C CZ  . ARG B 1 90  ? -17.461 7.920   31.005  1.00 141.08 ? 307 ARG B CZ  1 
ATOM 2358 N NH1 . ARG B 1 90  ? -16.870 8.821   31.779  1.00 131.16 ? 307 ARG B NH1 1 
ATOM 2359 N NH2 . ARG B 1 90  ? -18.021 6.849   31.559  1.00 116.40 ? 307 ARG B NH2 1 
ATOM 2360 N N   . ALA B 1 91  ? -20.804 9.763   25.638  1.00 102.12 ? 308 ALA B N   1 
ATOM 2361 C CA  . ALA B 1 91  ? -22.105 9.086   25.668  1.00 101.34 ? 308 ALA B CA  1 
ATOM 2362 C C   . ALA B 1 91  ? -22.409 8.474   24.320  1.00 104.91 ? 308 ALA B C   1 
ATOM 2363 O O   . ALA B 1 91  ? -22.961 7.377   24.254  1.00 106.73 ? 308 ALA B O   1 
ATOM 2364 C CB  . ALA B 1 91  ? -23.200 10.062  26.058  1.00 101.09 ? 308 ALA B CB  1 
ATOM 2365 N N   . LEU B 1 92  ? -22.025 9.170   23.245  1.00 99.14  ? 309 LEU B N   1 
ATOM 2366 C CA  . LEU B 1 92  ? -22.224 8.693   21.891  1.00 99.30  ? 309 LEU B CA  1 
ATOM 2367 C C   . LEU B 1 92  ? -21.382 7.424   21.654  1.00 104.80 ? 309 LEU B C   1 
ATOM 2368 O O   . LEU B 1 92  ? -21.903 6.435   21.130  1.00 105.22 ? 309 LEU B O   1 
ATOM 2369 C CB  . LEU B 1 92  ? -21.846 9.807   20.896  1.00 97.95  ? 309 LEU B CB  1 
ATOM 2370 C CG  . LEU B 1 92  ? -21.842 9.439   19.418  1.00 102.82 ? 309 LEU B CG  1 
ATOM 2371 C CD1 . LEU B 1 92  ? -23.236 9.473   18.841  1.00 102.80 ? 309 LEU B CD1 1 
ATOM 2372 C CD2 . LEU B 1 92  ? -20.953 10.369  18.647  1.00 105.31 ? 309 LEU B CD2 1 
ATOM 2373 N N   . GLU B 1 93  ? -20.099 7.460   22.073  1.00 101.86 ? 310 GLU B N   1 
ATOM 2374 C CA  . GLU B 1 93  ? -19.146 6.361   21.913  1.00 104.06 ? 310 GLU B CA  1 
ATOM 2375 C C   . GLU B 1 93  ? -19.618 5.081   22.597  1.00 110.37 ? 310 GLU B C   1 
ATOM 2376 O O   . GLU B 1 93  ? -19.483 3.994   22.025  1.00 113.78 ? 310 GLU B O   1 
ATOM 2377 C CB  . GLU B 1 93  ? -17.727 6.791   22.344  1.00 105.65 ? 310 GLU B CB  1 
ATOM 2378 C CG  . GLU B 1 93  ? -16.709 6.825   21.202  1.00 118.52 ? 310 GLU B CG  1 
ATOM 2379 C CD  . GLU B 1 93  ? -17.049 7.593   19.923  1.00 148.22 ? 310 GLU B CD  1 
ATOM 2380 O OE1 . GLU B 1 93  ? -17.605 8.714   20.019  1.00 155.25 ? 310 GLU B OE1 1 
ATOM 2381 O OE2 . GLU B 1 93  ? -16.724 7.086   18.822  1.00 129.93 ? 310 GLU B OE2 1 
ATOM 2382 N N   . ILE B 1 94  ? -20.236 5.230   23.781  1.00 104.46 ? 311 ILE B N   1 
ATOM 2383 C CA  . ILE B 1 94  ? -20.831 4.150   24.560  1.00 105.56 ? 311 ILE B CA  1 
ATOM 2384 C C   . ILE B 1 94  ? -22.000 3.555   23.758  1.00 109.64 ? 311 ILE B C   1 
ATOM 2385 O O   . ILE B 1 94  ? -22.034 2.341   23.538  1.00 111.37 ? 311 ILE B O   1 
ATOM 2386 C CB  . ILE B 1 94  ? -21.275 4.694   25.953  1.00 107.63 ? 311 ILE B CB  1 
ATOM 2387 C CG1 . ILE B 1 94  ? -20.045 4.958   26.844  1.00 107.92 ? 311 ILE B CG1 1 
ATOM 2388 C CG2 . ILE B 1 94  ? -22.284 3.755   26.648  1.00 110.11 ? 311 ILE B CG2 1 
ATOM 2389 C CD1 . ILE B 1 94  ? -20.256 5.923   27.989  1.00 113.71 ? 311 ILE B CD1 1 
ATOM 2390 N N   . ARG B 1 95  ? -22.931 4.428   23.302  1.00 104.03 ? 312 ARG B N   1 
ATOM 2391 C CA  . ARG B 1 95  ? -24.125 4.076   22.533  1.00 104.77 ? 312 ARG B CA  1 
ATOM 2392 C C   . ARG B 1 95  ? -23.798 3.323   21.237  1.00 109.99 ? 312 ARG B C   1 
ATOM 2393 O O   . ARG B 1 95  ? -24.476 2.344   20.920  1.00 112.36 ? 312 ARG B O   1 
ATOM 2394 C CB  . ARG B 1 95  ? -24.974 5.323   22.259  1.00 101.87 ? 312 ARG B CB  1 
ATOM 2395 C CG  . ARG B 1 95  ? -25.750 5.797   23.471  1.00 105.92 ? 312 ARG B CG  1 
ATOM 2396 C CD  . ARG B 1 95  ? -26.781 6.838   23.109  1.00 112.76 ? 312 ARG B CD  1 
ATOM 2397 N NE  . ARG B 1 95  ? -27.866 6.864   24.089  1.00 122.61 ? 312 ARG B NE  1 
ATOM 2398 C CZ  . ARG B 1 95  ? -27.963 7.738   25.083  1.00 131.14 ? 312 ARG B CZ  1 
ATOM 2399 N NH1 . ARG B 1 95  ? -27.052 8.690   25.231  1.00 116.56 ? 312 ARG B NH1 1 
ATOM 2400 N NH2 . ARG B 1 95  ? -28.975 7.668   25.937  1.00 115.75 ? 312 ARG B NH2 1 
ATOM 2401 N N   . GLU B 1 96  ? -22.741 3.757   20.518  1.00 105.59 ? 313 GLU B N   1 
ATOM 2402 C CA  . GLU B 1 96  ? -22.270 3.112   19.282  1.00 107.78 ? 313 GLU B CA  1 
ATOM 2403 C C   . GLU B 1 96  ? -21.691 1.708   19.575  1.00 116.43 ? 313 GLU B C   1 
ATOM 2404 O O   . GLU B 1 96  ? -21.891 0.789   18.775  1.00 119.78 ? 313 GLU B O   1 
ATOM 2405 C CB  . GLU B 1 96  ? -21.217 3.979   18.561  1.00 106.72 ? 313 GLU B CB  1 
ATOM 2406 C CG  . GLU B 1 96  ? -21.784 5.138   17.756  1.00 112.61 ? 313 GLU B CG  1 
ATOM 2407 C CD  . GLU B 1 96  ? -20.793 6.209   17.323  1.00 136.09 ? 313 GLU B CD  1 
ATOM 2408 O OE1 . GLU B 1 96  ? -19.706 6.316   17.937  1.00 121.04 ? 313 GLU B OE1 1 
ATOM 2409 O OE2 . GLU B 1 96  ? -21.126 6.972   16.388  1.00 137.43 ? 313 GLU B OE2 1 
ATOM 2410 N N   . LYS B 1 97  ? -20.975 1.554   20.715  1.00 112.12 ? 314 LYS B N   1 
ATOM 2411 C CA  . LYS B 1 97  ? -20.367 0.297   21.148  1.00 114.79 ? 314 LYS B CA  1 
ATOM 2412 C C   . LYS B 1 97  ? -21.445 -0.752  21.479  1.00 124.21 ? 314 LYS B C   1 
ATOM 2413 O O   . LYS B 1 97  ? -21.381 -1.880  20.987  1.00 128.77 ? 314 LYS B O   1 
ATOM 2414 C CB  . LYS B 1 97  ? -19.439 0.540   22.358  1.00 114.63 ? 314 LYS B CB  1 
ATOM 2415 C CG  . LYS B 1 97  ? -18.757 -0.721  22.883  1.00 124.86 ? 314 LYS B CG  1 
ATOM 2416 C CD  . LYS B 1 97  ? -18.074 -0.513  24.230  1.00 129.59 ? 314 LYS B CD  1 
ATOM 2417 C CE  . LYS B 1 97  ? -17.444 -1.794  24.730  1.00 137.64 ? 314 LYS B CE  1 
ATOM 2418 N NZ  . LYS B 1 97  ? -17.074 -1.715  26.170  1.00 146.10 ? 314 LYS B NZ  1 
ATOM 2419 N N   . VAL B 1 98  ? -22.439 -0.358  22.285  1.00 120.04 ? 315 VAL B N   1 
ATOM 2420 C CA  . VAL B 1 98  ? -23.542 -1.194  22.770  1.00 123.49 ? 315 VAL B CA  1 
ATOM 2421 C C   . VAL B 1 98  ? -24.648 -1.450  21.731  1.00 129.25 ? 315 VAL B C   1 
ATOM 2422 O O   . VAL B 1 98  ? -24.906 -2.609  21.396  1.00 133.39 ? 315 VAL B O   1 
ATOM 2423 C CB  . VAL B 1 98  ? -24.116 -0.598  24.088  1.00 125.89 ? 315 VAL B CB  1 
ATOM 2424 C CG1 . VAL B 1 98  ? -25.358 -1.352  24.564  1.00 129.71 ? 315 VAL B CG1 1 
ATOM 2425 C CG2 . VAL B 1 98  ? -23.056 -0.555  25.178  1.00 124.22 ? 315 VAL B CG2 1 
ATOM 2426 N N   . LEU B 1 99  ? -25.329 -0.377  21.280  1.00 123.06 ? 316 LEU B N   1 
ATOM 2427 C CA  . LEU B 1 99  ? -26.471 -0.448  20.366  1.00 125.59 ? 316 LEU B CA  1 
ATOM 2428 C C   . LEU B 1 99  ? -26.128 -0.611  18.896  1.00 129.59 ? 316 LEU B C   1 
ATOM 2429 O O   . LEU B 1 99  ? -26.866 -1.279  18.176  1.00 133.81 ? 316 LEU B O   1 
ATOM 2430 C CB  . LEU B 1 99  ? -27.396 0.771   20.545  1.00 123.11 ? 316 LEU B CB  1 
ATOM 2431 C CG  . LEU B 1 99  ? -27.941 1.030   21.947  1.00 127.42 ? 316 LEU B CG  1 
ATOM 2432 C CD1 . LEU B 1 99  ? -28.151 2.509   22.172  1.00 123.32 ? 316 LEU B CD1 1 
ATOM 2433 C CD2 . LEU B 1 99  ? -29.229 0.252   22.191  1.00 134.25 ? 316 LEU B CD2 1 
ATOM 2434 N N   . GLY B 1 100 ? -25.053 0.030   18.456  1.00 116.87 ? 317 GLY B N   1 
ATOM 2435 C CA  . GLY B 1 100 ? -24.637 0.012   17.058  1.00 113.64 ? 317 GLY B CA  1 
ATOM 2436 C C   . GLY B 1 100 ? -24.564 1.408   16.476  1.00 110.23 ? 317 GLY B C   1 
ATOM 2437 O O   . GLY B 1 100 ? -25.228 2.328   16.958  1.00 107.73 ? 317 GLY B O   1 
ATOM 2438 N N   . LYS B 1 101 ? -23.765 1.572   15.425  1.00 103.19 ? 318 LYS B N   1 
ATOM 2439 C CA  . LYS B 1 101 ? -23.507 2.842   14.752  1.00 96.61  ? 318 LYS B CA  1 
ATOM 2440 C C   . LYS B 1 101 ? -24.767 3.482   14.154  1.00 95.26  ? 318 LYS B C   1 
ATOM 2441 O O   . LYS B 1 101 ? -24.813 4.712   13.997  1.00 91.25  ? 318 LYS B O   1 
ATOM 2442 C CB  . LYS B 1 101 ? -22.451 2.600   13.667  1.00 99.73  ? 318 LYS B CB  1 
ATOM 2443 C CG  . LYS B 1 101 ? -21.535 3.771   13.339  1.00 118.56 ? 318 LYS B CG  1 
ATOM 2444 C CD  . LYS B 1 101 ? -20.872 3.534   11.954  1.00 127.59 ? 318 LYS B CD  1 
ATOM 2445 C CE  . LYS B 1 101 ? -20.115 4.731   11.422  1.00 134.17 ? 318 LYS B CE  1 
ATOM 2446 N NZ  . LYS B 1 101 ? -21.014 5.875   11.082  1.00 134.40 ? 318 LYS B NZ  1 
ATOM 2447 N N   . PHE B 1 102 ? -25.784 2.660   13.813  1.00 92.12  ? 319 PHE B N   1 
ATOM 2448 C CA  . PHE B 1 102 ? -27.013 3.146   13.163  1.00 88.59  ? 319 PHE B CA  1 
ATOM 2449 C C   . PHE B 1 102 ? -28.273 2.912   13.966  1.00 95.84  ? 319 PHE B C   1 
ATOM 2450 O O   . PHE B 1 102 ? -29.288 2.516   13.397  1.00 98.22  ? 319 PHE B O   1 
ATOM 2451 C CB  . PHE B 1 102 ? -27.176 2.521   11.765  1.00 89.88  ? 319 PHE B CB  1 
ATOM 2452 C CG  . PHE B 1 102 ? -26.047 2.758   10.806  1.00 87.87  ? 319 PHE B CG  1 
ATOM 2453 C CD1 . PHE B 1 102 ? -25.975 3.938   10.072  1.00 86.46  ? 319 PHE B CD1 1 
ATOM 2454 C CD2 . PHE B 1 102 ? -25.077 1.788   10.602  1.00 92.17  ? 319 PHE B CD2 1 
ATOM 2455 C CE1 . PHE B 1 102 ? -24.950 4.142   9.150   1.00 86.64  ? 319 PHE B CE1 1 
ATOM 2456 C CE2 . PHE B 1 102 ? -24.044 1.990   9.688   1.00 94.63  ? 319 PHE B CE2 1 
ATOM 2457 C CZ  . PHE B 1 102 ? -23.990 3.164   8.961   1.00 89.41  ? 319 PHE B CZ  1 
ATOM 2458 N N   . HIS B 1 103 ? -28.230 3.161   15.269  1.00 93.47  ? 320 HIS B N   1 
ATOM 2459 C CA  . HIS B 1 103 ? -29.406 2.974   16.111  1.00 97.53  ? 320 HIS B CA  1 
ATOM 2460 C C   . HIS B 1 103 ? -30.089 4.321   16.358  1.00 98.17  ? 320 HIS B C   1 
ATOM 2461 O O   . HIS B 1 103 ? -29.393 5.310   16.596  1.00 94.44  ? 320 HIS B O   1 
ATOM 2462 C CB  . HIS B 1 103 ? -29.006 2.316   17.434  1.00 103.32 ? 320 HIS B CB  1 
ATOM 2463 C CG  . HIS B 1 103 ? -30.165 1.830   18.240  1.00 112.88 ? 320 HIS B CG  1 
ATOM 2464 N ND1 . HIS B 1 103 ? -30.869 2.680   19.074  1.00 114.62 ? 320 HIS B ND1 1 
ATOM 2465 C CD2 . HIS B 1 103 ? -30.711 0.592   18.308  1.00 121.37 ? 320 HIS B CD2 1 
ATOM 2466 C CE1 . HIS B 1 103 ? -31.816 1.937   19.621  1.00 120.60 ? 320 HIS B CE1 1 
ATOM 2467 N NE2 . HIS B 1 103 ? -31.758 0.673   19.193  1.00 125.25 ? 320 HIS B NE2 1 
ATOM 2468 N N   . PRO B 1 104 ? -31.440 4.398   16.343  1.00 96.06  ? 321 PRO B N   1 
ATOM 2469 C CA  . PRO B 1 104 ? -32.111 5.692   16.589  1.00 93.13  ? 321 PRO B CA  1 
ATOM 2470 C C   . PRO B 1 104 ? -31.667 6.468   17.832  1.00 96.66  ? 321 PRO B C   1 
ATOM 2471 O O   . PRO B 1 104 ? -31.756 7.702   17.830  1.00 92.83  ? 321 PRO B O   1 
ATOM 2472 C CB  . PRO B 1 104 ? -33.583 5.310   16.634  1.00 99.64  ? 321 PRO B CB  1 
ATOM 2473 C CG  . PRO B 1 104 ? -33.668 4.130   15.743  1.00 106.99 ? 321 PRO B CG  1 
ATOM 2474 C CD  . PRO B 1 104 ? -32.427 3.346   16.039  1.00 102.81 ? 321 PRO B CD  1 
ATOM 2475 N N   . ASP B 1 105 ? -31.143 5.764   18.867  1.00 97.17  ? 322 ASP B N   1 
ATOM 2476 C CA  . ASP B 1 105 ? -30.631 6.403   20.085  1.00 97.81  ? 322 ASP B CA  1 
ATOM 2477 C C   . ASP B 1 105 ? -29.314 7.142   19.802  1.00 98.35  ? 322 ASP B C   1 
ATOM 2478 O O   . ASP B 1 105 ? -29.069 8.202   20.385  1.00 97.16  ? 322 ASP B O   1 
ATOM 2479 C CB  . ASP B 1 105 ? -30.473 5.394   21.242  1.00 105.50 ? 322 ASP B CB  1 
ATOM 2480 C CG  . ASP B 1 105 ? -31.769 4.905   21.885  1.00 121.73 ? 322 ASP B CG  1 
ATOM 2481 O OD1 . ASP B 1 105 ? -32.859 5.152   21.305  1.00 123.52 ? 322 ASP B OD1 1 
ATOM 2482 O OD2 . ASP B 1 105 ? -31.694 4.259   22.958  1.00 128.52 ? 322 ASP B OD2 1 
ATOM 2483 N N   . VAL B 1 106 ? -28.490 6.601   18.885  1.00 92.83  ? 323 VAL B N   1 
ATOM 2484 C CA  . VAL B 1 106 ? -27.220 7.202   18.452  1.00 88.94  ? 323 VAL B CA  1 
ATOM 2485 C C   . VAL B 1 106 ? -27.522 8.516   17.698  1.00 88.86  ? 323 VAL B C   1 
ATOM 2486 O O   . VAL B 1 106 ? -26.805 9.505   17.863  1.00 86.86  ? 323 VAL B O   1 
ATOM 2487 C CB  . VAL B 1 106 ? -26.405 6.196   17.604  1.00 92.69  ? 323 VAL B CB  1 
ATOM 2488 C CG1 . VAL B 1 106 ? -25.111 6.808   17.084  1.00 89.87  ? 323 VAL B CG1 1 
ATOM 2489 C CG2 . VAL B 1 106 ? -26.118 4.929   18.394  1.00 97.43  ? 323 VAL B CG2 1 
ATOM 2490 N N   . ALA B 1 107 ? -28.622 8.529   16.925  1.00 85.01  ? 324 ALA B N   1 
ATOM 2491 C CA  . ALA B 1 107 ? -29.079 9.711   16.196  1.00 81.92  ? 324 ALA B CA  1 
ATOM 2492 C C   . ALA B 1 107 ? -29.539 10.803  17.163  1.00 84.16  ? 324 ALA B C   1 
ATOM 2493 O O   . ALA B 1 107 ? -29.322 11.975  16.870  1.00 81.24  ? 324 ALA B O   1 
ATOM 2494 C CB  . ALA B 1 107 ? -30.208 9.348   15.246  1.00 83.27  ? 324 ALA B CB  1 
ATOM 2495 N N   . LYS B 1 108 ? -30.160 10.430  18.309  1.00 82.41  ? 325 LYS B N   1 
ATOM 2496 C CA  . LYS B 1 108 ? -30.585 11.415  19.303  1.00 83.01  ? 325 LYS B CA  1 
ATOM 2497 C C   . LYS B 1 108 ? -29.354 12.095  19.936  1.00 88.06  ? 325 LYS B C   1 
ATOM 2498 O O   . LYS B 1 108 ? -29.375 13.314  20.156  1.00 87.45  ? 325 LYS B O   1 
ATOM 2499 C CB  . LYS B 1 108 ? -31.546 10.805  20.331  1.00 89.06  ? 325 LYS B CB  1 
ATOM 2500 C CG  . LYS B 1 108 ? -31.840 11.682  21.555  1.00 109.74 ? 325 LYS B CG  1 
ATOM 2501 C CD  . LYS B 1 108 ? -31.119 11.137  22.849  1.00 120.54 ? 325 LYS B CD  1 
ATOM 2502 C CE  . LYS B 1 108 ? -31.383 11.925  24.123  1.00 109.20 ? 325 LYS B CE  1 
ATOM 2503 N NZ  . LYS B 1 108 ? -32.817 11.869  24.533  1.00 104.65 ? 325 LYS B NZ  1 
ATOM 2504 N N   . GLN B 1 109 ? -28.271 11.320  20.179  1.00 86.13  ? 326 GLN B N   1 
ATOM 2505 C CA  . GLN B 1 109 ? -27.021 11.863  20.713  1.00 86.88  ? 326 GLN B CA  1 
ATOM 2506 C C   . GLN B 1 109 ? -26.401 12.809  19.691  1.00 89.85  ? 326 GLN B C   1 
ATOM 2507 O O   . GLN B 1 109 ? -26.014 13.920  20.060  1.00 91.93  ? 326 GLN B O   1 
ATOM 2508 C CB  . GLN B 1 109 ? -26.011 10.760  21.066  1.00 90.45  ? 326 GLN B CB  1 
ATOM 2509 C CG  . GLN B 1 109 ? -25.972 10.322  22.529  1.00 105.36 ? 326 GLN B CG  1 
ATOM 2510 C CD  . GLN B 1 109 ? -26.107 11.435  23.531  1.00 118.85 ? 326 GLN B CD  1 
ATOM 2511 O OE1 . GLN B 1 109 ? -27.151 11.588  24.166  1.00 115.04 ? 326 GLN B OE1 1 
ATOM 2512 N NE2 . GLN B 1 109 ? -25.073 12.249  23.668  1.00 108.87 ? 326 GLN B NE2 1 
ATOM 2513 N N   . LEU B 1 110 ? -26.341 12.384  18.401  1.00 82.16  ? 327 LEU B N   1 
ATOM 2514 C CA  . LEU B 1 110 ? -25.799 13.178  17.301  1.00 77.92  ? 327 LEU B CA  1 
ATOM 2515 C C   . LEU B 1 110 ? -26.483 14.537  17.179  1.00 80.15  ? 327 LEU B C   1 
ATOM 2516 O O   . LEU B 1 110 ? -25.804 15.557  17.058  1.00 78.77  ? 327 LEU B O   1 
ATOM 2517 C CB  . LEU B 1 110 ? -25.872 12.398  15.998  1.00 76.07  ? 327 LEU B CB  1 
ATOM 2518 C CG  . LEU B 1 110 ? -24.894 11.232  15.869  1.00 82.45  ? 327 LEU B CG  1 
ATOM 2519 C CD1 . LEU B 1 110 ? -25.292 10.310  14.720  1.00 81.78  ? 327 LEU B CD1 1 
ATOM 2520 C CD2 . LEU B 1 110 ? -23.455 11.724  15.714  1.00 85.09  ? 327 LEU B CD2 1 
ATOM 2521 N N   . SER B 1 111 ? -27.823 14.552  17.295  1.00 78.75  ? 328 SER B N   1 
ATOM 2522 C CA  . SER B 1 111 ? -28.657 15.753  17.266  1.00 79.04  ? 328 SER B CA  1 
ATOM 2523 C C   . SER B 1 111 ? -28.280 16.704  18.416  1.00 87.17  ? 328 SER B C   1 
ATOM 2524 O O   . SER B 1 111 ? -28.201 17.923  18.211  1.00 86.87  ? 328 SER B O   1 
ATOM 2525 C CB  . SER B 1 111 ? -30.126 15.368  17.378  1.00 83.84  ? 328 SER B CB  1 
ATOM 2526 O OG  . SER B 1 111 ? -30.520 14.541  16.296  1.00 93.83  ? 328 SER B OG  1 
ATOM 2527 N N   . ASN B 1 112 ? -28.026 16.133  19.618  1.00 86.59  ? 329 ASN B N   1 
ATOM 2528 C CA  . ASN B 1 112 ? -27.647 16.882  20.808  1.00 89.45  ? 329 ASN B CA  1 
ATOM 2529 C C   . ASN B 1 112 ? -26.233 17.429  20.668  1.00 94.68  ? 329 ASN B C   1 
ATOM 2530 O O   . ASN B 1 112 ? -25.948 18.549  21.110  1.00 97.24  ? 329 ASN B O   1 
ATOM 2531 C CB  . ASN B 1 112 ? -27.783 16.001  22.046  1.00 93.69  ? 329 ASN B CB  1 
ATOM 2532 C CG  . ASN B 1 112 ? -29.147 16.031  22.712  1.00 125.49 ? 329 ASN B CG  1 
ATOM 2533 O OD1 . ASN B 1 112 ? -29.997 16.890  22.444  1.00 120.00 ? 329 ASN B OD1 1 
ATOM 2534 N ND2 . ASN B 1 112 ? -29.377 15.100  23.626  1.00 123.31 ? 329 ASN B ND2 1 
ATOM 2535 N N   . LEU B 1 113 ? -25.361 16.650  20.011  1.00 89.19  ? 330 LEU B N   1 
ATOM 2536 C CA  . LEU B 1 113 ? -23.973 17.007  19.764  1.00 88.92  ? 330 LEU B CA  1 
ATOM 2537 C C   . LEU B 1 113 ? -23.914 18.145  18.768  1.00 90.64  ? 330 LEU B C   1 
ATOM 2538 O O   . LEU B 1 113 ? -23.107 19.056  18.938  1.00 91.95  ? 330 LEU B O   1 
ATOM 2539 C CB  . LEU B 1 113 ? -23.209 15.773  19.267  1.00 87.89  ? 330 LEU B CB  1 
ATOM 2540 C CG  . LEU B 1 113 ? -21.704 15.724  19.479  1.00 95.06  ? 330 LEU B CG  1 
ATOM 2541 C CD1 . LEU B 1 113 ? -21.291 16.233  20.844  1.00 98.90  ? 330 LEU B CD1 1 
ATOM 2542 C CD2 . LEU B 1 113 ? -21.219 14.313  19.340  1.00 98.91  ? 330 LEU B CD2 1 
ATOM 2543 N N   . ALA B 1 114 ? -24.816 18.116  17.763  1.00 84.59  ? 331 ALA B N   1 
ATOM 2544 C CA  . ALA B 1 114 ? -24.953 19.142  16.731  1.00 82.87  ? 331 ALA B CA  1 
ATOM 2545 C C   . ALA B 1 114 ? -25.342 20.475  17.369  1.00 89.79  ? 331 ALA B C   1 
ATOM 2546 O O   . ALA B 1 114 ? -24.756 21.503  17.025  1.00 91.70  ? 331 ALA B O   1 
ATOM 2547 C CB  . ALA B 1 114 ? -26.010 18.725  15.733  1.00 80.15  ? 331 ALA B CB  1 
ATOM 2548 N N   . LEU B 1 115 ? -26.299 20.446  18.326  1.00 86.75  ? 332 LEU B N   1 
ATOM 2549 C CA  . LEU B 1 115 ? -26.770 21.621  19.080  1.00 88.74  ? 332 LEU B CA  1 
ATOM 2550 C C   . LEU B 1 115 ? -25.646 22.325  19.863  1.00 93.81  ? 332 LEU B C   1 
ATOM 2551 O O   . LEU B 1 115 ? -25.605 23.560  19.882  1.00 94.32  ? 332 LEU B O   1 
ATOM 2552 C CB  . LEU B 1 115 ? -27.904 21.240  20.046  1.00 89.65  ? 332 LEU B CB  1 
ATOM 2553 C CG  . LEU B 1 115 ? -29.318 21.223  19.482  1.00 92.41  ? 332 LEU B CG  1 
ATOM 2554 C CD1 . LEU B 1 115 ? -30.289 20.715  20.527  1.00 95.84  ? 332 LEU B CD1 1 
ATOM 2555 C CD2 . LEU B 1 115 ? -29.750 22.600  19.045  1.00 92.98  ? 332 LEU B CD2 1 
ATOM 2556 N N   . LEU B 1 116 ? -24.746 21.535  20.500  1.00 90.38  ? 333 LEU B N   1 
ATOM 2557 C CA  . LEU B 1 116 ? -23.599 22.051  21.239  1.00 94.38  ? 333 LEU B CA  1 
ATOM 2558 C C   . LEU B 1 116 ? -22.632 22.801  20.321  1.00 99.32  ? 333 LEU B C   1 
ATOM 2559 O O   . LEU B 1 116 ? -22.083 23.825  20.726  1.00 103.26 ? 333 LEU B O   1 
ATOM 2560 C CB  . LEU B 1 116 ? -22.860 20.921  21.963  1.00 95.97  ? 333 LEU B CB  1 
ATOM 2561 C CG  . LEU B 1 116 ? -23.490 20.377  23.256  1.00 102.54 ? 333 LEU B CG  1 
ATOM 2562 C CD1 . LEU B 1 116 ? -22.742 19.146  23.740  1.00 103.91 ? 333 LEU B CD1 1 
ATOM 2563 C CD2 . LEU B 1 116 ? -23.545 21.448  24.366  1.00 108.69 ? 333 LEU B CD2 1 
ATOM 2564 N N   . CYS B 1 117 ? -22.448 22.303  19.081  1.00 92.86  ? 334 CYS B N   1 
ATOM 2565 C CA  . CYS B 1 117 ? -21.592 22.901  18.053  1.00 93.72  ? 334 CYS B CA  1 
ATOM 2566 C C   . CYS B 1 117 ? -22.196 24.202  17.525  1.00 97.37  ? 334 CYS B C   1 
ATOM 2567 O O   . CYS B 1 117 ? -21.487 25.193  17.354  1.00 100.27 ? 334 CYS B O   1 
ATOM 2568 C CB  . CYS B 1 117 ? -21.335 21.905  16.925  1.00 90.38  ? 334 CYS B CB  1 
ATOM 2569 S SG  . CYS B 1 117 ? -20.284 20.513  17.399  1.00 95.36  ? 334 CYS B SG  1 
ATOM 2570 N N   . GLN B 1 118 ? -23.515 24.185  17.275  1.00 90.77  ? 335 GLN B N   1 
ATOM 2571 C CA  . GLN B 1 118 ? -24.324 25.309  16.808  1.00 90.79  ? 335 GLN B CA  1 
ATOM 2572 C C   . GLN B 1 118 ? -24.168 26.484  17.770  1.00 100.49 ? 335 GLN B C   1 
ATOM 2573 O O   . GLN B 1 118 ? -24.011 27.623  17.329  1.00 103.65 ? 335 GLN B O   1 
ATOM 2574 C CB  . GLN B 1 118 ? -25.790 24.859  16.747  1.00 88.28  ? 335 GLN B CB  1 
ATOM 2575 C CG  . GLN B 1 118 ? -26.708 25.705  15.892  1.00 103.50 ? 335 GLN B CG  1 
ATOM 2576 C CD  . GLN B 1 118 ? -28.117 25.170  15.937  1.00 119.31 ? 335 GLN B CD  1 
ATOM 2577 O OE1 . GLN B 1 118 ? -28.906 25.522  16.819  1.00 120.00 ? 335 GLN B OE1 1 
ATOM 2578 N NE2 . GLN B 1 118 ? -28.456 24.280  15.005  1.00 104.46 ? 335 GLN B NE2 1 
ATOM 2579 N N   . ASN B 1 119 ? -24.155 26.187  19.085  1.00 99.16  ? 336 ASN B N   1 
ATOM 2580 C CA  . ASN B 1 119 ? -24.018 27.165  20.170  1.00 104.51 ? 336 ASN B CA  1 
ATOM 2581 C C   . ASN B 1 119 ? -22.554 27.561  20.429  1.00 114.40 ? 336 ASN B C   1 
ATOM 2582 O O   . ASN B 1 119 ? -22.247 28.212  21.427  1.00 120.38 ? 336 ASN B O   1 
ATOM 2583 C CB  . ASN B 1 119 ? -24.732 26.671  21.440  1.00 103.51 ? 336 ASN B CB  1 
ATOM 2584 C CG  . ASN B 1 119 ? -26.225 26.437  21.285  1.00 118.03 ? 336 ASN B CG  1 
ATOM 2585 O OD1 . ASN B 1 119 ? -26.829 26.624  20.212  1.00 116.04 ? 336 ASN B OD1 1 
ATOM 2586 N ND2 . ASN B 1 119 ? -26.857 26.004  22.359  1.00 103.48 ? 336 ASN B ND2 1 
ATOM 2587 N N   . GLN B 1 120 ? -21.666 27.183  19.503  1.00 109.41 ? 337 GLN B N   1 
ATOM 2588 C CA  . GLN B 1 120 ? -20.241 27.502  19.485  1.00 114.30 ? 337 GLN B CA  1 
ATOM 2589 C C   . GLN B 1 120 ? -19.928 28.003  18.066  1.00 119.38 ? 337 GLN B C   1 
ATOM 2590 O O   . GLN B 1 120 ? -18.795 28.400  17.785  1.00 125.23 ? 337 GLN B O   1 
ATOM 2591 C CB  . GLN B 1 120 ? -19.399 26.254  19.794  1.00 114.57 ? 337 GLN B CB  1 
ATOM 2592 C CG  . GLN B 1 120 ? -19.403 25.811  21.244  1.00 112.87 ? 337 GLN B CG  1 
ATOM 2593 C CD  . GLN B 1 120 ? -18.479 24.635  21.445  1.00 124.27 ? 337 GLN B CD  1 
ATOM 2594 O OE1 . GLN B 1 120 ? -17.324 24.789  21.840  1.00 131.20 ? 337 GLN B OE1 1 
ATOM 2595 N NE2 . GLN B 1 120 ? -18.949 23.432  21.147  1.00 100.00 ? 337 GLN B NE2 1 
ATOM 2596 N N   . GLY B 1 121 ? -20.946 27.962  17.197  1.00 110.35 ? 338 GLY B N   1 
ATOM 2597 C CA  . GLY B 1 121 ? -20.877 28.386  15.804  1.00 110.36 ? 338 GLY B CA  1 
ATOM 2598 C C   . GLY B 1 121 ? -19.953 27.557  14.934  1.00 115.30 ? 338 GLY B C   1 
ATOM 2599 O O   . GLY B 1 121 ? -19.281 28.109  14.060  1.00 119.77 ? 338 GLY B O   1 
ATOM 2600 N N   . LYS B 1 122 ? -19.919 26.231  15.156  1.00 107.69 ? 339 LYS B N   1 
ATOM 2601 C CA  . LYS B 1 122 ? -19.065 25.295  14.414  1.00 106.68 ? 339 LYS B CA  1 
ATOM 2602 C C   . LYS B 1 122 ? -19.882 24.604  13.295  1.00 104.65 ? 339 LYS B C   1 
ATOM 2603 O O   . LYS B 1 122 ? -20.043 23.376  13.290  1.00 98.91  ? 339 LYS B O   1 
ATOM 2604 C CB  . LYS B 1 122 ? -18.423 24.271  15.379  1.00 109.43 ? 339 LYS B CB  1 
ATOM 2605 C CG  . LYS B 1 122 ? -17.679 24.883  16.568  1.00 120.70 ? 339 LYS B CG  1 
ATOM 2606 C CD  . LYS B 1 122 ? -17.535 23.873  17.700  1.00 128.84 ? 339 LYS B CD  1 
ATOM 2607 C CE  . LYS B 1 122 ? -16.114 23.428  17.914  1.00 145.16 ? 339 LYS B CE  1 
ATOM 2608 N NZ  . LYS B 1 122 ? -16.025 22.380  18.964  1.00 154.22 ? 339 LYS B NZ  1 
ATOM 2609 N N   . ALA B 1 123 ? -20.402 25.428  12.352  1.00 102.48 ? 340 ALA B N   1 
ATOM 2610 C CA  . ALA B 1 123 ? -21.251 25.051  11.203  1.00 97.91  ? 340 ALA B CA  1 
ATOM 2611 C C   . ALA B 1 123 ? -20.890 23.741  10.503  1.00 98.78  ? 340 ALA B C   1 
ATOM 2612 O O   . ALA B 1 123 ? -21.775 22.918  10.272  1.00 94.32  ? 340 ALA B O   1 
ATOM 2613 C CB  . ALA B 1 123 ? -21.312 26.186  10.196  1.00 101.34 ? 340 ALA B CB  1 
ATOM 2614 N N   . GLU B 1 124 ? -19.597 23.538  10.194  1.00 98.17  ? 341 GLU B N   1 
ATOM 2615 C CA  . GLU B 1 124 ? -19.074 22.337  9.530   1.00 96.58  ? 341 GLU B CA  1 
ATOM 2616 C C   . GLU B 1 124 ? -19.389 21.061  10.340  1.00 94.90  ? 341 GLU B C   1 
ATOM 2617 O O   . GLU B 1 124 ? -19.733 20.028  9.756   1.00 90.02  ? 341 GLU B O   1 
ATOM 2618 C CB  . GLU B 1 124 ? -17.551 22.459  9.306   1.00 104.43 ? 341 GLU B CB  1 
ATOM 2619 C CG  . GLU B 1 124 ? -17.107 23.595  8.392   1.00 124.52 ? 341 GLU B CG  1 
ATOM 2620 C CD  . GLU B 1 124 ? -17.052 25.010  8.953   1.00 157.19 ? 341 GLU B CD  1 
ATOM 2621 O OE1 . GLU B 1 124 ? -17.306 25.204  10.166  1.00 159.30 ? 341 GLU B OE1 1 
ATOM 2622 O OE2 . GLU B 1 124 ? -16.750 25.933  8.162   1.00 151.61 ? 341 GLU B OE2 1 
ATOM 2623 N N   . GLU B 1 125 ? -19.268 21.154  11.687  1.00 92.31  ? 342 GLU B N   1 
ATOM 2624 C CA  . GLU B 1 125 ? -19.531 20.058  12.615  1.00 89.55  ? 342 GLU B CA  1 
ATOM 2625 C C   . GLU B 1 125 ? -21.020 19.794  12.744  1.00 85.63  ? 342 GLU B C   1 
ATOM 2626 O O   . GLU B 1 125 ? -21.433 18.634  12.670  1.00 82.36  ? 342 GLU B O   1 
ATOM 2627 C CB  . GLU B 1 125 ? -18.891 20.337  13.978  1.00 95.43  ? 342 GLU B CB  1 
ATOM 2628 C CG  . GLU B 1 125 ? -17.404 20.025  14.023  1.00 112.81 ? 342 GLU B CG  1 
ATOM 2629 C CD  . GLU B 1 125 ? -16.673 20.643  15.197  1.00 135.07 ? 342 GLU B CD  1 
ATOM 2630 O OE1 . GLU B 1 125 ? -16.790 20.116  16.330  1.00 115.12 ? 342 GLU B OE1 1 
ATOM 2631 O OE2 . GLU B 1 125 ? -15.975 21.659  14.976  1.00 137.84 ? 342 GLU B OE2 1 
ATOM 2632 N N   . VAL B 1 126 ? -21.827 20.871  12.903  1.00 80.16  ? 343 VAL B N   1 
ATOM 2633 C CA  . VAL B 1 126 ? -23.291 20.844  12.988  1.00 75.91  ? 343 VAL B CA  1 
ATOM 2634 C C   . VAL B 1 126 ? -23.823 20.002  11.828  1.00 77.83  ? 343 VAL B C   1 
ATOM 2635 O O   . VAL B 1 126 ? -24.569 19.035  12.034  1.00 75.62  ? 343 VAL B O   1 
ATOM 2636 C CB  . VAL B 1 126 ? -23.840 22.273  12.879  1.00 80.72  ? 343 VAL B CB  1 
ATOM 2637 C CG1 . VAL B 1 126 ? -25.355 22.275  12.831  1.00 78.29  ? 343 VAL B CG1 1 
ATOM 2638 C CG2 . VAL B 1 126 ? -23.338 23.143  14.010  1.00 84.56  ? 343 VAL B CG2 1 
ATOM 2639 N N   . GLU B 1 127 ? -23.393 20.381  10.610  1.00 74.72  ? 344 GLU B N   1 
ATOM 2640 C CA  . GLU B 1 127 ? -23.700 19.776  9.324   1.00 73.71  ? 344 GLU B CA  1 
ATOM 2641 C C   . GLU B 1 127 ? -23.348 18.287  9.360   1.00 79.50  ? 344 GLU B C   1 
ATOM 2642 O O   . GLU B 1 127 ? -24.196 17.469  9.032   1.00 77.30  ? 344 GLU B O   1 
ATOM 2643 C CB  . GLU B 1 127 ? -22.903 20.533  8.253   1.00 77.92  ? 344 GLU B CB  1 
ATOM 2644 C CG  . GLU B 1 127 ? -23.064 20.104  6.803   1.00 86.01  ? 344 GLU B CG  1 
ATOM 2645 C CD  . GLU B 1 127 ? -22.486 21.116  5.833   1.00 102.22 ? 344 GLU B CD  1 
ATOM 2646 O OE1 . GLU B 1 127 ? -22.688 22.333  6.046   1.00 85.24  ? 344 GLU B OE1 1 
ATOM 2647 O OE2 . GLU B 1 127 ? -21.867 20.695  4.832   1.00 107.65 ? 344 GLU B OE2 1 
ATOM 2648 N N   . TYR B 1 128 ? -22.141 17.933  9.843   1.00 81.25  ? 345 TYR B N   1 
ATOM 2649 C CA  . TYR B 1 128 ? -21.698 16.546  9.935   1.00 82.56  ? 345 TYR B CA  1 
ATOM 2650 C C   . TYR B 1 128 ? -22.589 15.736  10.843  1.00 86.70  ? 345 TYR B C   1 
ATOM 2651 O O   . TYR B 1 128 ? -22.962 14.616  10.462  1.00 86.54  ? 345 TYR B O   1 
ATOM 2652 C CB  . TYR B 1 128 ? -20.237 16.446  10.388  1.00 89.08  ? 345 TYR B CB  1 
ATOM 2653 C CG  . TYR B 1 128 ? -19.798 15.029  10.703  1.00 95.60  ? 345 TYR B CG  1 
ATOM 2654 C CD1 . TYR B 1 128 ? -19.512 14.122  9.684   1.00 98.25  ? 345 TYR B CD1 1 
ATOM 2655 C CD2 . TYR B 1 128 ? -19.678 14.588  12.024  1.00 98.67  ? 345 TYR B CD2 1 
ATOM 2656 C CE1 . TYR B 1 128 ? -19.110 12.817  9.968   1.00 100.97 ? 345 TYR B CE1 1 
ATOM 2657 C CE2 . TYR B 1 128 ? -19.286 13.282  12.319  1.00 101.40 ? 345 TYR B CE2 1 
ATOM 2658 C CZ  . TYR B 1 128 ? -18.980 12.408  11.285  1.00 111.87 ? 345 TYR B CZ  1 
ATOM 2659 O OH  . TYR B 1 128 ? -18.596 11.119  11.555  1.00 119.11 ? 345 TYR B OH  1 
ATOM 2660 N N   . TYR B 1 129 ? -22.908 16.279  12.053  1.00 81.86  ? 346 TYR B N   1 
ATOM 2661 C CA  . TYR B 1 129 ? -23.746 15.578  13.014  1.00 79.69  ? 346 TYR B CA  1 
ATOM 2662 C C   . TYR B 1 129 ? -25.187 15.398  12.533  1.00 77.44  ? 346 TYR B C   1 
ATOM 2663 O O   . TYR B 1 129 ? -25.703 14.277  12.584  1.00 75.06  ? 346 TYR B O   1 
ATOM 2664 C CB  . TYR B 1 129 ? -23.656 16.195  14.417  1.00 83.55  ? 346 TYR B CB  1 
ATOM 2665 C CG  . TYR B 1 129 ? -22.285 16.084  15.055  1.00 90.94  ? 346 TYR B CG  1 
ATOM 2666 C CD1 . TYR B 1 129 ? -21.673 14.845  15.234  1.00 94.87  ? 346 TYR B CD1 1 
ATOM 2667 C CD2 . TYR B 1 129 ? -21.619 17.213  15.527  1.00 94.49  ? 346 TYR B CD2 1 
ATOM 2668 C CE1 . TYR B 1 129 ? -20.409 14.739  15.819  1.00 100.35 ? 346 TYR B CE1 1 
ATOM 2669 C CE2 . TYR B 1 129 ? -20.358 17.118  16.119  1.00 99.21  ? 346 TYR B CE2 1 
ATOM 2670 C CZ  . TYR B 1 129 ? -19.762 15.877  16.280  1.00 108.33 ? 346 TYR B CZ  1 
ATOM 2671 O OH  . TYR B 1 129 ? -18.522 15.783  16.877  1.00 113.47 ? 346 TYR B OH  1 
ATOM 2672 N N   . TYR B 1 130 ? -25.813 16.480  12.017  1.00 71.83  ? 347 TYR B N   1 
ATOM 2673 C CA  . TYR B 1 130 ? -27.183 16.417  11.517  1.00 70.23  ? 347 TYR B CA  1 
ATOM 2674 C C   . TYR B 1 130 ? -27.315 15.477  10.319  1.00 74.41  ? 347 TYR B C   1 
ATOM 2675 O O   . TYR B 1 130 ? -28.318 14.763  10.208  1.00 75.43  ? 347 TYR B O   1 
ATOM 2676 C CB  . TYR B 1 130 ? -27.738 17.812  11.201  1.00 71.39  ? 347 TYR B CB  1 
ATOM 2677 C CG  . TYR B 1 130 ? -28.249 18.551  12.421  1.00 74.50  ? 347 TYR B CG  1 
ATOM 2678 C CD1 . TYR B 1 130 ? -28.953 17.886  13.421  1.00 76.50  ? 347 TYR B CD1 1 
ATOM 2679 C CD2 . TYR B 1 130 ? -28.069 19.924  12.556  1.00 76.88  ? 347 TYR B CD2 1 
ATOM 2680 C CE1 . TYR B 1 130 ? -29.437 18.561  14.540  1.00 76.89  ? 347 TYR B CE1 1 
ATOM 2681 C CE2 . TYR B 1 130 ? -28.556 20.612  13.669  1.00 79.19  ? 347 TYR B CE2 1 
ATOM 2682 C CZ  . TYR B 1 130 ? -29.229 19.921  14.663  1.00 84.73  ? 347 TYR B CZ  1 
ATOM 2683 O OH  . TYR B 1 130 ? -29.703 20.574  15.769  1.00 90.78  ? 347 TYR B OH  1 
ATOM 2684 N N   . ARG B 1 131 ? -26.297 15.449  9.444   1.00 69.70  ? 348 ARG B N   1 
ATOM 2685 C CA  . ARG B 1 131 ? -26.291 14.551  8.295   1.00 69.22  ? 348 ARG B CA  1 
ATOM 2686 C C   . ARG B 1 131 ? -26.225 13.090  8.778   1.00 72.74  ? 348 ARG B C   1 
ATOM 2687 O O   . ARG B 1 131 ? -26.977 12.238  8.300   1.00 72.98  ? 348 ARG B O   1 
ATOM 2688 C CB  . ARG B 1 131 ? -25.129 14.883  7.348   1.00 70.82  ? 348 ARG B CB  1 
ATOM 2689 C CG  . ARG B 1 131 ? -25.378 16.117  6.486   1.00 81.74  ? 348 ARG B CG  1 
ATOM 2690 C CD  . ARG B 1 131 ? -24.170 16.446  5.624   1.00 92.91  ? 348 ARG B CD  1 
ATOM 2691 N NE  . ARG B 1 131 ? -24.491 17.522  4.687   1.00 94.92  ? 348 ARG B NE  1 
ATOM 2692 C CZ  . ARG B 1 131 ? -23.632 18.100  3.856   1.00 104.73 ? 348 ARG B CZ  1 
ATOM 2693 N NH1 . ARG B 1 131 ? -22.361 17.731  3.840   1.00 97.38  ? 348 ARG B NH1 1 
ATOM 2694 N NH2 . ARG B 1 131 ? -24.042 19.038  3.021   1.00 99.70  ? 348 ARG B NH2 1 
ATOM 2695 N N   . ARG B 1 132 ? -25.383 12.833  9.782   1.00 69.40  ? 349 ARG B N   1 
ATOM 2696 C CA  . ARG B 1 132 ? -25.231 11.509  10.369  1.00 71.09  ? 349 ARG B CA  1 
ATOM 2697 C C   . ARG B 1 132 ? -26.513 11.080  11.090  1.00 74.16  ? 349 ARG B C   1 
ATOM 2698 O O   . ARG B 1 132 ? -26.873 9.901   11.064  1.00 76.94  ? 349 ARG B O   1 
ATOM 2699 C CB  . ARG B 1 132 ? -24.025 11.491  11.316  1.00 73.56  ? 349 ARG B CB  1 
ATOM 2700 C CG  . ARG B 1 132 ? -22.762 10.969  10.673  1.00 77.64  ? 349 ARG B CG  1 
ATOM 2701 C CD  . ARG B 1 132 ? -21.796 10.515  11.739  1.00 92.76  ? 349 ARG B CD  1 
ATOM 2702 N NE  . ARG B 1 132 ? -22.185 9.248   12.355  1.00 102.99 ? 349 ARG B NE  1 
ATOM 2703 C CZ  . ARG B 1 132 ? -21.613 8.730   13.437  1.00 114.08 ? 349 ARG B CZ  1 
ATOM 2704 N NH1 . ARG B 1 132 ? -20.619 9.370   14.042  1.00 100.34 ? 349 ARG B NH1 1 
ATOM 2705 N NH2 . ARG B 1 132 ? -22.033 7.572   13.925  1.00 99.88  ? 349 ARG B NH2 1 
ATOM 2706 N N   . ALA B 1 133 ? -27.190 12.043  11.723  1.00 67.70  ? 350 ALA B N   1 
ATOM 2707 C CA  . ALA B 1 133 ? -28.451 11.848  12.431  1.00 67.62  ? 350 ALA B CA  1 
ATOM 2708 C C   . ALA B 1 133 ? -29.568 11.513  11.433  1.00 70.09  ? 350 ALA B C   1 
ATOM 2709 O O   . ALA B 1 133 ? -30.334 10.585  11.680  1.00 70.80  ? 350 ALA B O   1 
ATOM 2710 C CB  . ALA B 1 133 ? -28.806 13.104  13.206  1.00 67.65  ? 350 ALA B CB  1 
ATOM 2711 N N   . LEU B 1 134 ? -29.649 12.272  10.305  1.00 65.53  ? 351 LEU B N   1 
ATOM 2712 C CA  . LEU B 1 134 ? -30.671 12.117  9.258   1.00 66.03  ? 351 LEU B CA  1 
ATOM 2713 C C   . LEU B 1 134 ? -30.558 10.760  8.601   1.00 68.93  ? 351 LEU B C   1 
ATOM 2714 O O   . LEU B 1 134 ? -31.575 10.120  8.388   1.00 70.85  ? 351 LEU B O   1 
ATOM 2715 C CB  . LEU B 1 134 ? -30.548 13.214  8.188   1.00 64.92  ? 351 LEU B CB  1 
ATOM 2716 C CG  . LEU B 1 134 ? -31.830 13.867  7.579   1.00 70.29  ? 351 LEU B CG  1 
ATOM 2717 C CD1 . LEU B 1 134 ? -31.586 14.271  6.176   1.00 68.89  ? 351 LEU B CD1 1 
ATOM 2718 C CD2 . LEU B 1 134 ? -33.084 12.997  7.658   1.00 74.96  ? 351 LEU B CD2 1 
ATOM 2719 N N   . GLU B 1 135 ? -29.323 10.306  8.334   1.00 64.18  ? 352 GLU B N   1 
ATOM 2720 C CA  . GLU B 1 135 ? -29.005 8.997   7.760   1.00 65.81  ? 352 GLU B CA  1 
ATOM 2721 C C   . GLU B 1 135 ? -29.744 7.900   8.553   1.00 73.33  ? 352 GLU B C   1 
ATOM 2722 O O   . GLU B 1 135 ? -30.505 7.134   7.964   1.00 73.52  ? 352 GLU B O   1 
ATOM 2723 C CB  . GLU B 1 135 ? -27.476 8.776   7.803   1.00 66.25  ? 352 GLU B CB  1 
ATOM 2724 C CG  . GLU B 1 135 ? -26.986 7.682   6.885   1.00 77.80  ? 352 GLU B CG  1 
ATOM 2725 C CD  . GLU B 1 135 ? -25.490 7.686   6.669   1.00 105.98 ? 352 GLU B CD  1 
ATOM 2726 O OE1 . GLU B 1 135 ? -24.750 7.178   7.544   1.00 93.56  ? 352 GLU B OE1 1 
ATOM 2727 O OE2 . GLU B 1 135 ? -25.058 8.194   5.611   1.00 118.13 ? 352 GLU B OE2 1 
ATOM 2728 N N   . ILE B 1 136 ? -29.582 7.901   9.896   1.00 72.32  ? 353 ILE B N   1 
ATOM 2729 C CA  . ILE B 1 136 ? -30.247 6.956   10.795  1.00 76.90  ? 353 ILE B CA  1 
ATOM 2730 C C   . ILE B 1 136 ? -31.788 7.072   10.726  1.00 83.62  ? 353 ILE B C   1 
ATOM 2731 O O   . ILE B 1 136 ? -32.441 6.125   10.287  1.00 88.53  ? 353 ILE B O   1 
ATOM 2732 C CB  . ILE B 1 136 ? -29.691 7.011   12.246  1.00 79.97  ? 353 ILE B CB  1 
ATOM 2733 C CG1 . ILE B 1 136 ? -28.135 6.894   12.232  1.00 79.96  ? 353 ILE B CG1 1 
ATOM 2734 C CG2 . ILE B 1 136 ? -30.354 5.922   13.102  1.00 83.60  ? 353 ILE B CG2 1 
ATOM 2735 C CD1 . ILE B 1 136 ? -27.375 6.981   13.561  1.00 86.55  ? 353 ILE B CD1 1 
ATOM 2736 N N   . TYR B 1 137 ? -32.350 8.226   11.122  1.00 76.48  ? 354 TYR B N   1 
ATOM 2737 C CA  . TYR B 1 137 ? -33.788 8.465   11.129  1.00 78.92  ? 354 TYR B CA  1 
ATOM 2738 C C   . TYR B 1 137 ? -34.499 8.084   9.817   1.00 85.08  ? 354 TYR B C   1 
ATOM 2739 O O   . TYR B 1 137 ? -35.531 7.408   9.860   1.00 89.88  ? 354 TYR B O   1 
ATOM 2740 C CB  . TYR B 1 137 ? -34.094 9.929   11.488  1.00 78.00  ? 354 TYR B CB  1 
ATOM 2741 C CG  . TYR B 1 137 ? -33.750 10.356  12.902  1.00 78.76  ? 354 TYR B CG  1 
ATOM 2742 C CD1 . TYR B 1 137 ? -34.212 9.634   14.006  1.00 84.41  ? 354 TYR B CD1 1 
ATOM 2743 C CD2 . TYR B 1 137 ? -33.058 11.542  13.143  1.00 75.24  ? 354 TYR B CD2 1 
ATOM 2744 C CE1 . TYR B 1 137 ? -33.924 10.041  15.308  1.00 84.86  ? 354 TYR B CE1 1 
ATOM 2745 C CE2 . TYR B 1 137 ? -32.765 11.957  14.439  1.00 76.28  ? 354 TYR B CE2 1 
ATOM 2746 C CZ  . TYR B 1 137 ? -33.213 11.210  15.518  1.00 89.55  ? 354 TYR B CZ  1 
ATOM 2747 O OH  . TYR B 1 137 ? -32.934 11.634  16.792  1.00 94.20  ? 354 TYR B OH  1 
ATOM 2748 N N   . ALA B 1 138 ? -33.940 8.513   8.660   1.00 78.14  ? 355 ALA B N   1 
ATOM 2749 C CA  . ALA B 1 138 ? -34.497 8.276   7.323   1.00 79.34  ? 355 ALA B CA  1 
ATOM 2750 C C   . ALA B 1 138 ? -34.541 6.813   6.923   1.00 91.20  ? 355 ALA B C   1 
ATOM 2751 O O   . ALA B 1 138 ? -35.523 6.389   6.310   1.00 96.82  ? 355 ALA B O   1 
ATOM 2752 C CB  . ALA B 1 138 ? -33.744 9.083   6.276   1.00 75.30  ? 355 ALA B CB  1 
ATOM 2753 N N   . THR B 1 139 ? -33.492 6.047   7.258   1.00 100.74 ? 356 THR B N   1 
ATOM 2754 C CA  . THR B 1 139 ? -33.385 4.630   6.897   1.00 107.06 ? 356 THR B CA  1 
ATOM 2755 C C   . THR B 1 139 ? -34.005 3.688   7.946   1.00 115.67 ? 356 THR B C   1 
ATOM 2756 O O   . THR B 1 139 ? -34.840 2.859   7.589   1.00 120.19 ? 356 THR B O   1 
ATOM 2757 C CB  . THR B 1 139 ? -31.935 4.264   6.558   1.00 119.08 ? 356 THR B CB  1 
ATOM 2758 O OG1 . THR B 1 139 ? -31.123 4.684   7.643   1.00 123.47 ? 356 THR B OG1 1 
ATOM 2759 C CG2 . THR B 1 139 ? -31.437 4.932   5.292   1.00 114.97 ? 356 THR B CG2 1 
ATOM 2760 N N   . ARG B 1 140 ? -33.603 3.821   9.227   1.00 111.34 ? 357 ARG B N   1 
ATOM 2761 C CA  . ARG B 1 140 ? -34.087 2.982   10.330  1.00 115.84 ? 357 ARG B CA  1 
ATOM 2762 C C   . ARG B 1 140 ? -35.571 3.157   10.654  1.00 124.21 ? 357 ARG B C   1 
ATOM 2763 O O   . ARG B 1 140 ? -36.253 2.170   10.919  1.00 130.15 ? 357 ARG B O   1 
ATOM 2764 C CB  . ARG B 1 140 ? -33.215 3.132   11.585  1.00 112.58 ? 357 ARG B CB  1 
ATOM 2765 C CG  . ARG B 1 140 ? -31.824 2.516   11.447  1.00 120.39 ? 357 ARG B CG  1 
ATOM 2766 C CD  . ARG B 1 140 ? -31.829 0.991   11.454  1.00 131.83 ? 357 ARG B CD  1 
ATOM 2767 N NE  . ARG B 1 140 ? -31.031 0.431   12.548  1.00 137.18 ? 357 ARG B NE  1 
ATOM 2768 C CZ  . ARG B 1 140 ? -31.538 -0.075  13.669  1.00 154.64 ? 357 ARG B CZ  1 
ATOM 2769 N NH1 . ARG B 1 140 ? -32.852 -0.105  13.858  1.00 141.61 ? 357 ARG B NH1 1 
ATOM 2770 N NH2 . ARG B 1 140 ? -30.735 -0.562  14.607  1.00 146.53 ? 357 ARG B NH2 1 
ATOM 2771 N N   . LEU B 1 141 ? -36.070 4.396   10.612  1.00 117.87 ? 358 LEU B N   1 
ATOM 2772 C CA  . LEU B 1 141 ? -37.475 4.713   10.871  1.00 119.90 ? 358 LEU B CA  1 
ATOM 2773 C C   . LEU B 1 141 ? -38.160 5.184   9.579   1.00 127.38 ? 358 LEU B C   1 
ATOM 2774 O O   . LEU B 1 141 ? -37.475 5.536   8.605   1.00 125.35 ? 358 LEU B O   1 
ATOM 2775 C CB  . LEU B 1 141 ? -37.595 5.796   11.957  1.00 115.91 ? 358 LEU B CB  1 
ATOM 2776 C CG  . LEU B 1 141 ? -36.686 5.683   13.176  1.00 119.11 ? 358 LEU B CG  1 
ATOM 2777 C CD1 . LEU B 1 141 ? -36.631 6.988   13.913  1.00 115.21 ? 358 LEU B CD1 1 
ATOM 2778 C CD2 . LEU B 1 141 ? -37.140 4.589   14.101  1.00 125.58 ? 358 LEU B CD2 1 
ATOM 2779 N N   . GLY B 1 142 ? -39.499 5.214   9.598   1.00 128.38 ? 359 GLY B N   1 
ATOM 2780 C CA  . GLY B 1 142 ? -40.345 5.624   8.474   1.00 129.19 ? 359 GLY B CA  1 
ATOM 2781 C C   . GLY B 1 142 ? -40.076 6.989   7.842   1.00 126.19 ? 359 GLY B C   1 
ATOM 2782 O O   . GLY B 1 142 ? -39.290 7.786   8.368   1.00 121.03 ? 359 GLY B O   1 
ATOM 2783 N N   . PRO B 1 143 ? -40.719 7.292   6.688   1.00 122.23 ? 360 PRO B N   1 
ATOM 2784 C CA  . PRO B 1 143 ? -40.502 8.606   6.058   1.00 116.41 ? 360 PRO B CA  1 
ATOM 2785 C C   . PRO B 1 143 ? -41.316 9.699   6.752   1.00 116.99 ? 360 PRO B C   1 
ATOM 2786 O O   . PRO B 1 143 ? -40.986 10.889  6.662   1.00 110.98 ? 360 PRO B O   1 
ATOM 2787 C CB  . PRO B 1 143 ? -40.982 8.383   4.625   1.00 120.95 ? 360 PRO B CB  1 
ATOM 2788 C CG  . PRO B 1 143 ? -42.048 7.338   4.736   1.00 132.36 ? 360 PRO B CG  1 
ATOM 2789 C CD  . PRO B 1 143 ? -41.702 6.480   5.932   1.00 129.81 ? 360 PRO B CD  1 
ATOM 2790 N N   . ASP B 1 144 ? -42.387 9.262   7.453   1.00 117.93 ? 361 ASP B N   1 
ATOM 2791 C CA  . ASP B 1 144 ? -43.347 10.074  8.196   1.00 117.72 ? 361 ASP B CA  1 
ATOM 2792 C C   . ASP B 1 144 ? -43.016 10.224  9.693   1.00 118.52 ? 361 ASP B C   1 
ATOM 2793 O O   . ASP B 1 144 ? -43.794 10.852  10.422  1.00 119.08 ? 361 ASP B O   1 
ATOM 2794 C CB  . ASP B 1 144 ? -44.779 9.563   7.956   1.00 125.82 ? 361 ASP B CB  1 
ATOM 2795 C CG  . ASP B 1 144 ? -45.212 9.632   6.505   1.00 136.25 ? 361 ASP B CG  1 
ATOM 2796 O OD1 . ASP B 1 144 ? -44.505 10.281  5.702   1.00 130.11 ? 361 ASP B OD1 1 
ATOM 2797 O OD2 . ASP B 1 144 ? -46.266 9.048   6.173   1.00 151.62 ? 361 ASP B OD2 1 
ATOM 2798 N N   . ASP B 1 145 ? -41.841 9.701   10.137  1.00 111.47 ? 362 ASP B N   1 
ATOM 2799 C CA  . ASP B 1 145 ? -41.382 9.872   11.510  1.00 109.52 ? 362 ASP B CA  1 
ATOM 2800 C C   . ASP B 1 145 ? -41.045 11.345  11.729  1.00 108.27 ? 362 ASP B C   1 
ATOM 2801 O O   . ASP B 1 145 ? -40.303 11.934  10.928  1.00 104.76 ? 362 ASP B O   1 
ATOM 2802 C CB  . ASP B 1 145 ? -40.165 8.999   11.833  1.00 111.11 ? 362 ASP B CB  1 
ATOM 2803 C CG  . ASP B 1 145 ? -39.769 9.068   13.305  1.00 125.88 ? 362 ASP B CG  1 
ATOM 2804 O OD1 . ASP B 1 145 ? -40.593 8.668   14.171  1.00 131.01 ? 362 ASP B OD1 1 
ATOM 2805 O OD2 . ASP B 1 145 ? -38.656 9.533   13.595  1.00 127.36 ? 362 ASP B OD2 1 
ATOM 2806 N N   . PRO B 1 146 ? -41.636 11.972  12.771  1.00 104.59 ? 363 PRO B N   1 
ATOM 2807 C CA  . PRO B 1 146 ? -41.390 13.405  13.017  1.00 101.02 ? 363 PRO B CA  1 
ATOM 2808 C C   . PRO B 1 146 ? -39.925 13.835  13.066  1.00 99.40  ? 363 PRO B C   1 
ATOM 2809 O O   . PRO B 1 146 ? -39.611 14.937  12.612  1.00 97.99  ? 363 PRO B O   1 
ATOM 2810 C CB  . PRO B 1 146 ? -42.094 13.654  14.347  1.00 105.94 ? 363 PRO B CB  1 
ATOM 2811 C CG  . PRO B 1 146 ? -42.291 12.290  14.952  1.00 113.98 ? 363 PRO B CG  1 
ATOM 2812 C CD  . PRO B 1 146 ? -42.553 11.419  13.780  1.00 110.64 ? 363 PRO B CD  1 
ATOM 2813 N N   . ASN B 1 147 ? -39.030 12.958  13.571  1.00 92.63  ? 364 ASN B N   1 
ATOM 2814 C CA  . ASN B 1 147 ? -37.592 13.221  13.684  1.00 88.00  ? 364 ASN B CA  1 
ATOM 2815 C C   . ASN B 1 147 ? -36.914 13.450  12.380  1.00 85.30  ? 364 ASN B C   1 
ATOM 2816 O O   . ASN B 1 147 ? -35.905 14.146  12.361  1.00 84.06  ? 364 ASN B O   1 
ATOM 2817 C CB  . ASN B 1 147 ? -36.878 12.117  14.442  1.00 92.95  ? 364 ASN B CB  1 
ATOM 2818 C CG  . ASN B 1 147 ? -37.193 12.076  15.909  1.00 106.91 ? 364 ASN B CG  1 
ATOM 2819 O OD1 . ASN B 1 147 ? -37.471 13.102  16.554  1.00 102.52 ? 364 ASN B OD1 1 
ATOM 2820 N ND2 . ASN B 1 147 ? -37.145 10.882  16.463  1.00 95.98  ? 364 ASN B ND2 1 
ATOM 2821 N N   . VAL B 1 148 ? -37.450 12.889  11.288  1.00 79.99  ? 365 VAL B N   1 
ATOM 2822 C CA  . VAL B 1 148 ? -36.919 13.094  9.934   1.00 77.04  ? 365 VAL B CA  1 
ATOM 2823 C C   . VAL B 1 148 ? -37.095 14.569  9.551   1.00 77.75  ? 365 VAL B C   1 
ATOM 2824 O O   . VAL B 1 148 ? -36.093 15.213  9.230   1.00 76.47  ? 365 VAL B O   1 
ATOM 2825 C CB  . VAL B 1 148 ? -37.523 12.137  8.868   1.00 83.05  ? 365 VAL B CB  1 
ATOM 2826 C CG1 . VAL B 1 148 ? -36.920 12.400  7.497   1.00 81.38  ? 365 VAL B CG1 1 
ATOM 2827 C CG2 . VAL B 1 148 ? -37.323 10.676  9.254   1.00 85.61  ? 365 VAL B CG2 1 
ATOM 2828 N N   . ALA B 1 149 ? -38.342 15.121  9.646   1.00 73.96  ? 366 ALA B N   1 
ATOM 2829 C CA  . ALA B 1 149 ? -38.624 16.539  9.334   1.00 71.98  ? 366 ALA B CA  1 
ATOM 2830 C C   . ALA B 1 149 ? -37.862 17.514  10.246  1.00 73.94  ? 366 ALA B C   1 
ATOM 2831 O O   . ALA B 1 149 ? -37.194 18.409  9.727   1.00 72.53  ? 366 ALA B O   1 
ATOM 2832 C CB  . ALA B 1 149 ? -40.115 16.810  9.378   1.00 74.89  ? 366 ALA B CB  1 
ATOM 2833 N N   . LYS B 1 150 ? -37.898 17.297  11.587  1.00 70.33  ? 367 LYS B N   1 
ATOM 2834 C CA  . LYS B 1 150 ? -37.142 18.108  12.546  1.00 70.14  ? 367 LYS B CA  1 
ATOM 2835 C C   . LYS B 1 150 ? -35.638 18.121  12.164  1.00 72.92  ? 367 LYS B C   1 
ATOM 2836 O O   . LYS B 1 150 ? -35.063 19.205  12.056  1.00 72.54  ? 367 LYS B O   1 
ATOM 2837 C CB  . LYS B 1 150 ? -37.334 17.610  13.994  1.00 74.26  ? 367 LYS B CB  1 
ATOM 2838 C CG  . LYS B 1 150 ? -38.765 17.717  14.513  1.00 96.42  ? 367 LYS B CG  1 
ATOM 2839 C CD  . LYS B 1 150 ? -38.905 17.283  15.971  1.00 105.47 ? 367 LYS B CD  1 
ATOM 2840 C CE  . LYS B 1 150 ? -40.348 17.301  16.424  1.00 110.96 ? 367 LYS B CE  1 
ATOM 2841 N NZ  . LYS B 1 150 ? -40.510 16.827  17.831  1.00 119.99 ? 367 LYS B NZ  1 
ATOM 2842 N N   . THR B 1 151 ? -35.029 16.935  11.884  1.00 68.06  ? 368 THR B N   1 
ATOM 2843 C CA  . THR B 1 151 ? -33.621 16.874  11.504  1.00 67.96  ? 368 THR B CA  1 
ATOM 2844 C C   . THR B 1 151 ? -33.345 17.648  10.200  1.00 71.82  ? 368 THR B C   1 
ATOM 2845 O O   . THR B 1 151 ? -32.410 18.463  10.162  1.00 72.37  ? 368 THR B O   1 
ATOM 2846 C CB  . THR B 1 151 ? -33.059 15.436  11.554  1.00 80.80  ? 368 THR B CB  1 
ATOM 2847 O OG1 . THR B 1 151 ? -33.160 14.945  12.897  1.00 78.43  ? 368 THR B OG1 1 
ATOM 2848 C CG2 . THR B 1 151 ? -31.583 15.351  11.091  1.00 79.08  ? 368 THR B CG2 1 
ATOM 2849 N N   . LYS B 1 152 ? -34.180 17.417  9.157   1.00 65.23  ? 369 LYS B N   1 
ATOM 2850 C CA  . LYS B 1 152 ? -34.084 18.118  7.884   1.00 63.17  ? 369 LYS B CA  1 
ATOM 2851 C C   . LYS B 1 152 ? -34.230 19.628  8.084   1.00 67.22  ? 369 LYS B C   1 
ATOM 2852 O O   . LYS B 1 152 ? -33.444 20.390  7.537   1.00 66.68  ? 369 LYS B O   1 
ATOM 2853 C CB  . LYS B 1 152 ? -35.138 17.604  6.901   1.00 65.61  ? 369 LYS B CB  1 
ATOM 2854 C CG  . LYS B 1 152 ? -34.820 16.250  6.299   1.00 64.66  ? 369 LYS B CG  1 
ATOM 2855 C CD  . LYS B 1 152 ? -35.668 16.008  5.090   1.00 53.31  ? 369 LYS B CD  1 
ATOM 2856 C CE  . LYS B 1 152 ? -35.365 14.665  4.495   1.00 75.89  ? 369 LYS B CE  1 
ATOM 2857 N NZ  . LYS B 1 152 ? -36.233 14.395  3.326   1.00 83.65  ? 369 LYS B NZ  1 
ATOM 2858 N N   . ASN B 1 153 ? -35.170 20.052  8.932   1.00 65.97  ? 370 ASN B N   1 
ATOM 2859 C CA  . ASN B 1 153 ? -35.381 21.466  9.231   1.00 67.10  ? 370 ASN B CA  1 
ATOM 2860 C C   . ASN B 1 153 ? -34.149 22.066  9.892   1.00 69.11  ? 370 ASN B C   1 
ATOM 2861 O O   . ASN B 1 153 ? -33.701 23.136  9.477   1.00 69.31  ? 370 ASN B O   1 
ATOM 2862 C CB  . ASN B 1 153 ? -36.648 21.677  10.101  1.00 72.81  ? 370 ASN B CB  1 
ATOM 2863 C CG  . ASN B 1 153 ? -37.900 22.056  9.344   1.00 91.65  ? 370 ASN B CG  1 
ATOM 2864 O OD1 . ASN B 1 153 ? -37.921 22.154  8.117   1.00 83.34  ? 370 ASN B OD1 1 
ATOM 2865 N ND2 . ASN B 1 153 ? -38.967 22.325  10.072  1.00 87.98  ? 370 ASN B ND2 1 
ATOM 2866 N N   . ASN B 1 154 ? -33.579 21.348  10.878  1.00 64.84  ? 371 ASN B N   1 
ATOM 2867 C CA  . ASN B 1 154 ? -32.369 21.756  11.614  1.00 66.15  ? 371 ASN B CA  1 
ATOM 2868 C C   . ASN B 1 154 ? -31.152 21.860  10.706  1.00 69.02  ? 371 ASN B C   1 
ATOM 2869 O O   . ASN B 1 154 ? -30.406 22.824  10.806  1.00 71.60  ? 371 ASN B O   1 
ATOM 2870 C CB  . ASN B 1 154 ? -32.061 20.779  12.745  1.00 67.32  ? 371 ASN B CB  1 
ATOM 2871 C CG  . ASN B 1 154 ? -32.982 20.850  13.933  1.00 80.96  ? 371 ASN B CG  1 
ATOM 2872 O OD1 . ASN B 1 154 ? -33.718 21.816  14.143  1.00 68.39  ? 371 ASN B OD1 1 
ATOM 2873 N ND2 . ASN B 1 154 ? -32.945 19.813  14.742  1.00 79.77  ? 371 ASN B ND2 1 
ATOM 2874 N N   . LEU B 1 155 ? -30.950 20.849  9.841   1.00 63.06  ? 372 LEU B N   1 
ATOM 2875 C CA  . LEU B 1 155 ? -29.869 20.801  8.870   1.00 62.00  ? 372 LEU B CA  1 
ATOM 2876 C C   . LEU B 1 155 ? -30.047 21.916  7.857   1.00 66.93  ? 372 LEU B C   1 
ATOM 2877 O O   . LEU B 1 155 ? -29.047 22.537  7.483   1.00 70.77  ? 372 LEU B O   1 
ATOM 2878 C CB  . LEU B 1 155 ? -29.816 19.438  8.179   1.00 59.62  ? 372 LEU B CB  1 
ATOM 2879 C CG  . LEU B 1 155 ? -28.799 19.276  7.056   1.00 64.03  ? 372 LEU B CG  1 
ATOM 2880 C CD1 . LEU B 1 155 ? -27.367 19.405  7.567   1.00 66.17  ? 372 LEU B CD1 1 
ATOM 2881 C CD2 . LEU B 1 155 ? -28.990 17.932  6.359   1.00 65.54  ? 372 LEU B CD2 1 
ATOM 2882 N N   . ALA B 1 156 ? -31.304 22.200  7.441   1.00 58.51  ? 373 ALA B N   1 
ATOM 2883 C CA  . ALA B 1 156 ? -31.556 23.262  6.489   1.00 58.53  ? 373 ALA B CA  1 
ATOM 2884 C C   . ALA B 1 156 ? -31.154 24.610  7.062   1.00 69.36  ? 373 ALA B C   1 
ATOM 2885 O O   . ALA B 1 156 ? -30.400 25.343  6.419   1.00 71.89  ? 373 ALA B O   1 
ATOM 2886 C CB  . ALA B 1 156 ? -33.001 23.268  6.077   1.00 57.96  ? 373 ALA B CB  1 
ATOM 2887 N N   . SER B 1 157 ? -31.571 24.899  8.311   1.00 68.69  ? 374 SER B N   1 
ATOM 2888 C CA  . SER B 1 157 ? -31.243 26.142  9.012   1.00 72.73  ? 374 SER B CA  1 
ATOM 2889 C C   . SER B 1 157 ? -29.716 26.388  9.072   1.00 79.86  ? 374 SER B C   1 
ATOM 2890 O O   . SER B 1 157 ? -29.242 27.530  8.952   1.00 82.39  ? 374 SER B O   1 
ATOM 2891 C CB  . SER B 1 157 ? -31.856 26.140  10.402  1.00 77.23  ? 374 SER B CB  1 
ATOM 2892 O OG  . SER B 1 157 ? -31.851 27.465  10.907  1.00 97.41  ? 374 SER B OG  1 
ATOM 2893 N N   . CYS B 1 158 ? -28.960 25.289  9.187   1.00 75.23  ? 375 CYS B N   1 
ATOM 2894 C CA  . CYS B 1 158 ? -27.517 25.298  9.187   1.00 76.96  ? 375 CYS B CA  1 
ATOM 2895 C C   . CYS B 1 158 ? -26.978 25.707  7.806   1.00 80.64  ? 375 CYS B C   1 
ATOM 2896 O O   . CYS B 1 158 ? -26.032 26.497  7.707   1.00 83.19  ? 375 CYS B O   1 
ATOM 2897 C CB  . CYS B 1 158 ? -26.997 23.935  9.602   1.00 75.77  ? 375 CYS B CB  1 
ATOM 2898 S SG  . CYS B 1 158 ? -25.198 23.835  9.598   1.00 83.67  ? 375 CYS B SG  1 
ATOM 2899 N N   . TYR B 1 159 ? -27.582 25.158  6.737   1.00 73.26  ? 376 TYR B N   1 
ATOM 2900 C CA  . TYR B 1 159 ? -27.177 25.502  5.385   1.00 72.84  ? 376 TYR B CA  1 
ATOM 2901 C C   . TYR B 1 159 ? -27.418 26.994  5.140   1.00 75.61  ? 376 TYR B C   1 
ATOM 2902 O O   . TYR B 1 159 ? -26.544 27.634  4.566   1.00 78.04  ? 376 TYR B O   1 
ATOM 2903 C CB  . TYR B 1 159 ? -27.935 24.656  4.349   1.00 70.81  ? 376 TYR B CB  1 
ATOM 2904 C CG  . TYR B 1 159 ? -27.566 23.187  4.266   1.00 69.10  ? 376 TYR B CG  1 
ATOM 2905 C CD1 . TYR B 1 159 ? -26.275 22.747  4.580   1.00 72.87  ? 376 TYR B CD1 1 
ATOM 2906 C CD2 . TYR B 1 159 ? -28.471 22.251  3.768   1.00 64.68  ? 376 TYR B CD2 1 
ATOM 2907 C CE1 . TYR B 1 159 ? -25.918 21.402  4.454   1.00 71.03  ? 376 TYR B CE1 1 
ATOM 2908 C CE2 . TYR B 1 159 ? -28.117 20.917  3.611   1.00 63.73  ? 376 TYR B CE2 1 
ATOM 2909 C CZ  . TYR B 1 159 ? -26.842 20.493  3.960   1.00 71.39  ? 376 TYR B CZ  1 
ATOM 2910 O OH  . TYR B 1 159 ? -26.523 19.167  3.824   1.00 66.61  ? 376 TYR B OH  1 
ATOM 2911 N N   . LEU B 1 160 ? -28.569 27.550  5.609   1.00 69.46  ? 377 LEU B N   1 
ATOM 2912 C CA  . LEU B 1 160 ? -28.874 28.976  5.449   1.00 73.26  ? 377 LEU B CA  1 
ATOM 2913 C C   . LEU B 1 160 ? -27.775 29.867  6.064   1.00 81.06  ? 377 LEU B C   1 
ATOM 2914 O O   . LEU B 1 160 ? -27.277 30.791  5.399   1.00 82.77  ? 377 LEU B O   1 
ATOM 2915 C CB  . LEU B 1 160 ? -30.231 29.343  6.063   1.00 73.49  ? 377 LEU B CB  1 
ATOM 2916 C CG  . LEU B 1 160 ? -31.485 28.786  5.384   1.00 75.02  ? 377 LEU B CG  1 
ATOM 2917 C CD1 . LEU B 1 160 ? -32.696 28.955  6.289   1.00 74.71  ? 377 LEU B CD1 1 
ATOM 2918 C CD2 . LEU B 1 160 ? -31.726 29.446  4.026   1.00 77.67  ? 377 LEU B CD2 1 
ATOM 2919 N N   . LYS B 1 161 ? -27.349 29.534  7.309   1.00 77.92  ? 378 LYS B N   1 
ATOM 2920 C CA  . LYS B 1 161 ? -26.297 30.259  8.029   1.00 83.10  ? 378 LYS B CA  1 
ATOM 2921 C C   . LYS B 1 161 ? -25.014 30.337  7.212   1.00 90.22  ? 378 LYS B C   1 
ATOM 2922 O O   . LYS B 1 161 ? -24.263 31.312  7.330   1.00 96.75  ? 378 LYS B O   1 
ATOM 2923 C CB  . LYS B 1 161 ? -26.024 29.620  9.399   1.00 84.64  ? 378 LYS B CB  1 
ATOM 2924 C CG  . LYS B 1 161 ? -26.528 30.444  10.588  1.00 109.42 ? 378 LYS B CG  1 
ATOM 2925 C CD  . LYS B 1 161 ? -27.991 30.102  10.986  1.00 123.00 ? 378 LYS B CD  1 
ATOM 2926 C CE  . LYS B 1 161 ? -28.107 29.082  12.102  1.00 127.40 ? 378 LYS B CE  1 
ATOM 2927 N NZ  . LYS B 1 161 ? -29.474 29.065  12.692  1.00 129.37 ? 378 LYS B NZ  1 
ATOM 2928 N N   . GLN B 1 162 ? -24.786 29.319  6.368   1.00 82.03  ? 379 GLN B N   1 
ATOM 2929 C CA  . GLN B 1 162 ? -23.614 29.174  5.499   1.00 82.84  ? 379 GLN B CA  1 
ATOM 2930 C C   . GLN B 1 162 ? -23.853 29.749  4.100   1.00 85.76  ? 379 GLN B C   1 
ATOM 2931 O O   . GLN B 1 162 ? -22.902 29.823  3.314   1.00 86.33  ? 379 GLN B O   1 
ATOM 2932 C CB  . GLN B 1 162 ? -23.226 27.689  5.387   1.00 79.90  ? 379 GLN B CB  1 
ATOM 2933 C CG  . GLN B 1 162 ? -22.793 27.058  6.702   1.00 81.14  ? 379 GLN B CG  1 
ATOM 2934 C CD  . GLN B 1 162 ? -22.532 25.595  6.528   1.00 91.39  ? 379 GLN B CD  1 
ATOM 2935 O OE1 . GLN B 1 162 ? -21.524 25.188  5.953   1.00 87.05  ? 379 GLN B OE1 1 
ATOM 2936 N NE2 . GLN B 1 162 ? -23.432 24.773  7.036   1.00 84.50  ? 379 GLN B NE2 1 
ATOM 2937 N N   . GLY B 1 163 ? -25.109 30.131  3.803   1.00 80.57  ? 380 GLY B N   1 
ATOM 2938 C CA  . GLY B 1 163 ? -25.508 30.679  2.509   1.00 80.99  ? 380 GLY B CA  1 
ATOM 2939 C C   . GLY B 1 163 ? -25.685 29.627  1.427   1.00 82.25  ? 380 GLY B C   1 
ATOM 2940 O O   . GLY B 1 163 ? -25.710 29.955  0.233   1.00 81.55  ? 380 GLY B O   1 
ATOM 2941 N N   . LYS B 1 164 ? -25.788 28.342  1.844   1.00 74.14  ? 381 LYS B N   1 
ATOM 2942 C CA  . LYS B 1 164 ? -26.039 27.190  0.964   1.00 70.82  ? 381 LYS B CA  1 
ATOM 2943 C C   . LYS B 1 164 ? -27.565 27.142  0.713   1.00 68.56  ? 381 LYS B C   1 
ATOM 2944 O O   . LYS B 1 164 ? -28.234 26.209  1.127   1.00 63.37  ? 381 LYS B O   1 
ATOM 2945 C CB  . LYS B 1 164 ? -25.482 25.871  1.584   1.00 73.50  ? 381 LYS B CB  1 
ATOM 2946 C CG  . LYS B 1 164 ? -23.941 25.784  1.531   1.00 90.56  ? 381 LYS B CG  1 
ATOM 2947 C CD  . LYS B 1 164 ? -23.295 24.796  2.541   1.00 103.35 ? 381 LYS B CD  1 
ATOM 2948 C CE  . LYS B 1 164 ? -23.392 23.326  2.154   1.00 110.34 ? 381 LYS B CE  1 
ATOM 2949 N NZ  . LYS B 1 164 ? -22.211 22.547  2.621   1.00 118.45 ? 381 LYS B NZ  1 
ATOM 2950 N N   . TYR B 1 165 ? -28.103 28.205  0.096   1.00 67.75  ? 382 TYR B N   1 
ATOM 2951 C CA  . TYR B 1 165 ? -29.531 28.381  -0.154  1.00 66.06  ? 382 TYR B CA  1 
ATOM 2952 C C   . TYR B 1 165 ? -30.236 27.235  -0.877  1.00 68.21  ? 382 TYR B C   1 
ATOM 2953 O O   . TYR B 1 165 ? -31.271 26.787  -0.374  1.00 64.15  ? 382 TYR B O   1 
ATOM 2954 C CB  . TYR B 1 165 ? -29.833 29.746  -0.759  1.00 69.77  ? 382 TYR B CB  1 
ATOM 2955 C CG  . TYR B 1 165 ? -29.487 30.884  0.165   1.00 78.67  ? 382 TYR B CG  1 
ATOM 2956 C CD1 . TYR B 1 165 ? -29.738 30.801  1.528   1.00 82.07  ? 382 TYR B CD1 1 
ATOM 2957 C CD2 . TYR B 1 165 ? -28.941 32.065  -0.324  1.00 85.28  ? 382 TYR B CD2 1 
ATOM 2958 C CE1 . TYR B 1 165 ? -29.412 31.849  2.391   1.00 88.32  ? 382 TYR B CE1 1 
ATOM 2959 C CE2 . TYR B 1 165 ? -28.630 33.129  0.526   1.00 91.76  ? 382 TYR B CE2 1 
ATOM 2960 C CZ  . TYR B 1 165 ? -28.866 33.016  1.883   1.00 98.74  ? 382 TYR B CZ  1 
ATOM 2961 O OH  . TYR B 1 165 ? -28.545 34.054  2.718   1.00 105.90 ? 382 TYR B OH  1 
ATOM 2962 N N   . GLN B 1 166 ? -29.653 26.721  -2.007  1.00 66.39  ? 383 GLN B N   1 
ATOM 2963 C CA  . GLN B 1 166 ? -30.213 25.594  -2.771  1.00 63.53  ? 383 GLN B CA  1 
ATOM 2964 C C   . GLN B 1 166 ? -30.302 24.320  -1.902  1.00 65.71  ? 383 GLN B C   1 
ATOM 2965 O O   . GLN B 1 166 ? -31.341 23.663  -1.901  1.00 62.83  ? 383 GLN B O   1 
ATOM 2966 C CB  . GLN B 1 166 ? -29.397 25.317  -4.029  1.00 66.08  ? 383 GLN B CB  1 
ATOM 2967 C CG  . GLN B 1 166 ? -30.246 24.832  -5.210  1.00 82.95  ? 383 GLN B CG  1 
ATOM 2968 C CD  . GLN B 1 166 ? -29.570 24.991  -6.582  1.00 107.88 ? 383 GLN B CD  1 
ATOM 2969 O OE1 . GLN B 1 166 ? -28.331 25.000  -6.753  1.00 95.80  ? 383 GLN B OE1 1 
ATOM 2970 N NE2 . GLN B 1 166 ? -30.388 25.042  -7.616  1.00 107.50 ? 383 GLN B NE2 1 
ATOM 2971 N N   . ASP B 1 167 ? -29.236 23.996  -1.142  1.00 63.16  ? 384 ASP B N   1 
ATOM 2972 C CA  . ASP B 1 167 ? -29.182 22.837  -0.258  1.00 62.19  ? 384 ASP B CA  1 
ATOM 2973 C C   . ASP B 1 167 ? -30.301 22.937  0.820   1.00 67.26  ? 384 ASP B C   1 
ATOM 2974 O O   . ASP B 1 167 ? -30.991 21.923  1.122   1.00 67.34  ? 384 ASP B O   1 
ATOM 2975 C CB  . ASP B 1 167 ? -27.778 22.656  0.365   1.00 67.33  ? 384 ASP B CB  1 
ATOM 2976 C CG  . ASP B 1 167 ? -26.560 22.675  -0.571  1.00 81.90  ? 384 ASP B CG  1 
ATOM 2977 O OD1 . ASP B 1 167 ? -26.102 23.800  -0.951  1.00 82.91  ? 384 ASP B OD1 1 
ATOM 2978 O OD2 . ASP B 1 167 ? -25.970 21.595  -0.796  1.00 90.48  ? 384 ASP B OD2 1 
ATOM 2979 N N   . ALA B 1 168 ? -30.535 24.161  1.349   1.00 63.70  ? 385 ALA B N   1 
ATOM 2980 C CA  . ALA B 1 168 ? -31.630 24.375  2.318   1.00 62.72  ? 385 ALA B CA  1 
ATOM 2981 C C   . ALA B 1 168 ? -33.028 24.265  1.626   1.00 65.38  ? 385 ALA B C   1 
ATOM 2982 O O   . ALA B 1 168 ? -33.947 23.700  2.196   1.00 64.10  ? 385 ALA B O   1 
ATOM 2983 C CB  . ALA B 1 168 ? -31.476 25.715  3.029   1.00 65.77  ? 385 ALA B CB  1 
ATOM 2984 N N   . GLU B 1 169 ? -33.155 24.762  0.389   1.00 63.16  ? 386 GLU B N   1 
ATOM 2985 C CA  . GLU B 1 169 ? -34.369 24.726  -0.445  1.00 61.79  ? 386 GLU B CA  1 
ATOM 2986 C C   . GLU B 1 169 ? -34.807 23.301  -0.762  1.00 63.33  ? 386 GLU B C   1 
ATOM 2987 O O   . GLU B 1 169 ? -35.997 22.982  -0.699  1.00 62.23  ? 386 GLU B O   1 
ATOM 2988 C CB  . GLU B 1 169 ? -34.118 25.498  -1.738  1.00 63.68  ? 386 GLU B CB  1 
ATOM 2989 C CG  . GLU B 1 169 ? -35.369 25.812  -2.514  1.00 76.11  ? 386 GLU B CG  1 
ATOM 2990 C CD  . GLU B 1 169 ? -35.092 26.324  -3.911  1.00 100.05 ? 386 GLU B CD  1 
ATOM 2991 O OE1 . GLU B 1 169 ? -34.678 27.498  -4.049  1.00 91.46  ? 386 GLU B OE1 1 
ATOM 2992 O OE2 . GLU B 1 169 ? -35.268 25.537  -4.869  1.00 96.80  ? 386 GLU B OE2 1 
ATOM 2993 N N   . THR B 1 170 ? -33.839 22.448  -1.067  1.00 58.80  ? 387 THR B N   1 
ATOM 2994 C CA  . THR B 1 170 ? -34.117 21.061  -1.381  1.00 57.94  ? 387 THR B CA  1 
ATOM 2995 C C   . THR B 1 170 ? -34.674 20.323  -0.197  1.00 61.68  ? 387 THR B C   1 
ATOM 2996 O O   . THR B 1 170 ? -35.601 19.524  -0.364  1.00 61.39  ? 387 THR B O   1 
ATOM 2997 C CB  . THR B 1 170 ? -32.903 20.393  -1.966  1.00 62.44  ? 387 THR B CB  1 
ATOM 2998 O OG1 . THR B 1 170 ? -32.570 21.110  -3.136  1.00 70.66  ? 387 THR B OG1 1 
ATOM 2999 C CG2 . THR B 1 170 ? -33.170 18.946  -2.311  1.00 58.24  ? 387 THR B CG2 1 
ATOM 3000 N N   . LEU B 1 171 ? -34.124 20.597  0.991   1.00 57.72  ? 388 LEU B N   1 
ATOM 3001 C CA  . LEU B 1 171 ? -34.567 19.954  2.211   1.00 56.96  ? 388 LEU B CA  1 
ATOM 3002 C C   . LEU B 1 171 ? -35.999 20.308  2.525   1.00 58.67  ? 388 LEU B C   1 
ATOM 3003 O O   . LEU B 1 171 ? -36.793 19.388  2.744   1.00 59.00  ? 388 LEU B O   1 
ATOM 3004 C CB  . LEU B 1 171 ? -33.628 20.288  3.374   1.00 58.85  ? 388 LEU B CB  1 
ATOM 3005 C CG  . LEU B 1 171 ? -32.304 19.519  3.388   1.00 63.87  ? 388 LEU B CG  1 
ATOM 3006 C CD1 . LEU B 1 171 ? -31.444 19.986  4.500   1.00 65.20  ? 388 LEU B CD1 1 
ATOM 3007 C CD2 . LEU B 1 171 ? -32.536 18.009  3.504   1.00 63.28  ? 388 LEU B CD2 1 
ATOM 3008 N N   . TYR B 1 172 ? -36.360 21.616  2.467   1.00 54.16  ? 389 TYR B N   1 
ATOM 3009 C CA  . TYR B 1 172 ? -37.736 22.094  2.703   1.00 53.54  ? 389 TYR B CA  1 
ATOM 3010 C C   . TYR B 1 172 ? -38.710 21.463  1.712   1.00 59.31  ? 389 TYR B C   1 
ATOM 3011 O O   . TYR B 1 172 ? -39.761 20.946  2.118   1.00 60.79  ? 389 TYR B O   1 
ATOM 3012 C CB  . TYR B 1 172 ? -37.804 23.615  2.607   1.00 54.18  ? 389 TYR B CB  1 
ATOM 3013 C CG  . TYR B 1 172 ? -37.010 24.306  3.696   1.00 56.71  ? 389 TYR B CG  1 
ATOM 3014 C CD1 . TYR B 1 172 ? -37.055 23.856  5.012   1.00 58.77  ? 389 TYR B CD1 1 
ATOM 3015 C CD2 . TYR B 1 172 ? -36.248 25.440  3.420   1.00 58.14  ? 389 TYR B CD2 1 
ATOM 3016 C CE1 . TYR B 1 172 ? -36.337 24.493  6.016   1.00 62.41  ? 389 TYR B CE1 1 
ATOM 3017 C CE2 . TYR B 1 172 ? -35.512 26.079  4.421   1.00 60.58  ? 389 TYR B CE2 1 
ATOM 3018 C CZ  . TYR B 1 172 ? -35.546 25.591  5.715   1.00 66.62  ? 389 TYR B CZ  1 
ATOM 3019 O OH  . TYR B 1 172 ? -34.842 26.204  6.731   1.00 70.59  ? 389 TYR B OH  1 
ATOM 3020 N N   . LYS B 1 173 ? -38.323 21.440  0.417   1.00 53.95  ? 390 LYS B N   1 
ATOM 3021 C CA  . LYS B 1 173 ? -39.147 20.859  -0.625  1.00 53.26  ? 390 LYS B CA  1 
ATOM 3022 C C   . LYS B 1 173 ? -39.407 19.359  -0.381  1.00 60.48  ? 390 LYS B C   1 
ATOM 3023 O O   . LYS B 1 173 ? -40.543 18.916  -0.552  1.00 61.23  ? 390 LYS B O   1 
ATOM 3024 C CB  . LYS B 1 173 ? -38.561 21.146  -2.005  1.00 54.30  ? 390 LYS B CB  1 
ATOM 3025 C CG  . LYS B 1 173 ? -38.913 22.521  -2.507  1.00 62.99  ? 390 LYS B CG  1 
ATOM 3026 C CD  . LYS B 1 173 ? -38.264 22.811  -3.827  1.00 70.74  ? 390 LYS B CD  1 
ATOM 3027 C CE  . LYS B 1 173 ? -38.390 24.276  -4.112  1.00 72.57  ? 390 LYS B CE  1 
ATOM 3028 N NZ  . LYS B 1 173 ? -37.790 24.635  -5.409  1.00 74.47  ? 390 LYS B NZ  1 
ATOM 3029 N N   . GLU B 1 174 ? -38.374 18.598  0.076   1.00 57.65  ? 391 GLU B N   1 
ATOM 3030 C CA  . GLU B 1 174 ? -38.481 17.169  0.410   1.00 58.74  ? 391 GLU B CA  1 
ATOM 3031 C C   . GLU B 1 174 ? -39.515 16.967  1.554   1.00 66.08  ? 391 GLU B C   1 
ATOM 3032 O O   . GLU B 1 174 ? -40.311 16.020  1.500   1.00 69.72  ? 391 GLU B O   1 
ATOM 3033 C CB  . GLU B 1 174 ? -37.111 16.607  0.857   1.00 60.00  ? 391 GLU B CB  1 
ATOM 3034 C CG  . GLU B 1 174 ? -36.106 16.387  -0.250  1.00 68.23  ? 391 GLU B CG  1 
ATOM 3035 C CD  . GLU B 1 174 ? -34.729 15.934  0.198   1.00 91.79  ? 391 GLU B CD  1 
ATOM 3036 O OE1 . GLU B 1 174 ? -34.587 15.522  1.371   1.00 91.81  ? 391 GLU B OE1 1 
ATOM 3037 O OE2 . GLU B 1 174 ? -33.793 15.967  -0.633  1.00 86.50  ? 391 GLU B OE2 1 
ATOM 3038 N N   . ILE B 1 175 ? -39.491 17.860  2.583   1.00 60.25  ? 392 ILE B N   1 
ATOM 3039 C CA  . ILE B 1 175 ? -40.432 17.833  3.705   1.00 61.40  ? 392 ILE B CA  1 
ATOM 3040 C C   . ILE B 1 175 ? -41.840 18.044  3.170   1.00 63.27  ? 392 ILE B C   1 
ATOM 3041 O O   . ILE B 1 175 ? -42.702 17.200  3.394   1.00 66.71  ? 392 ILE B O   1 
ATOM 3042 C CB  . ILE B 1 175 ? -40.072 18.862  4.836   1.00 64.97  ? 392 ILE B CB  1 
ATOM 3043 C CG1 . ILE B 1 175 ? -38.741 18.506  5.533   1.00 65.73  ? 392 ILE B CG1 1 
ATOM 3044 C CG2 . ILE B 1 175 ? -41.231 19.045  5.857   1.00 65.54  ? 392 ILE B CG2 1 
ATOM 3045 C CD1 . ILE B 1 175 ? -38.023 19.677  6.056   1.00 68.99  ? 392 ILE B CD1 1 
ATOM 3046 N N   . LEU B 1 176 ? -42.047 19.139  2.433   1.00 56.59  ? 393 LEU B N   1 
ATOM 3047 C CA  . LEU B 1 176 ? -43.335 19.472  1.823   1.00 56.94  ? 393 LEU B CA  1 
ATOM 3048 C C   . LEU B 1 176 ? -43.872 18.383  0.878   1.00 64.72  ? 393 LEU B C   1 
ATOM 3049 O O   . LEU B 1 176 ? -45.054 18.058  0.985   1.00 67.47  ? 393 LEU B O   1 
ATOM 3050 C CB  . LEU B 1 176 ? -43.292 20.850  1.142   1.00 54.88  ? 393 LEU B CB  1 
ATOM 3051 C CG  . LEU B 1 176 ? -42.963 22.040  2.051   1.00 56.12  ? 393 LEU B CG  1 
ATOM 3052 C CD1 . LEU B 1 176 ? -42.871 23.275  1.266   1.00 56.24  ? 393 LEU B CD1 1 
ATOM 3053 C CD2 . LEU B 1 176 ? -43.989 22.218  3.148   1.00 55.26  ? 393 LEU B CD2 1 
ATOM 3054 N N   . THR B 1 177 ? -43.006 17.775  0.014   1.00 61.23  ? 394 THR B N   1 
ATOM 3055 C CA  . THR B 1 177 ? -43.414 16.706  -0.912  1.00 63.40  ? 394 THR B CA  1 
ATOM 3056 C C   . THR B 1 177 ? -43.909 15.476  -0.158  1.00 71.57  ? 394 THR B C   1 
ATOM 3057 O O   . THR B 1 177 ? -44.956 14.915  -0.512  1.00 74.31  ? 394 THR B O   1 
ATOM 3058 C CB  . THR B 1 177 ? -42.332 16.347  -1.936  1.00 62.69  ? 394 THR B CB  1 
ATOM 3059 O OG1 . THR B 1 177 ? -41.909 17.529  -2.622  1.00 67.30  ? 394 THR B OG1 1 
ATOM 3060 C CG2 . THR B 1 177 ? -42.828 15.338  -2.964  1.00 62.26  ? 394 THR B CG2 1 
ATOM 3061 N N   . ARG B 1 178 ? -43.179 15.075  0.895   1.00 67.35  ? 395 ARG B N   1 
ATOM 3062 C CA  . ARG B 1 178 ? -43.581 13.910  1.669   1.00 69.25  ? 395 ARG B CA  1 
ATOM 3063 C C   . ARG B 1 178 ? -44.914 14.196  2.387   1.00 75.26  ? 395 ARG B C   1 
ATOM 3064 O O   . ARG B 1 178 ? -45.843 13.370  2.328   1.00 78.21  ? 395 ARG B O   1 
ATOM 3065 C CB  . ARG B 1 178 ? -42.462 13.444  2.624   1.00 65.49  ? 395 ARG B CB  1 
ATOM 3066 C CG  . ARG B 1 178 ? -42.822 12.217  3.467   1.00 85.27  ? 395 ARG B CG  1 
ATOM 3067 C CD  . ARG B 1 178 ? -42.822 10.917  2.692   1.00 109.92 ? 395 ARG B CD  1 
ATOM 3068 N NE  . ARG B 1 178 ? -43.936 10.050  3.087   1.00 132.71 ? 395 ARG B NE  1 
ATOM 3069 C CZ  . ARG B 1 178 ? -44.774 9.473   2.229   1.00 152.88 ? 395 ARG B CZ  1 
ATOM 3070 N NH1 . ARG B 1 178 ? -44.630 9.656   0.923   1.00 137.64 ? 395 ARG B NH1 1 
ATOM 3071 N NH2 . ARG B 1 178 ? -45.760 8.700   2.673   1.00 144.55 ? 395 ARG B NH2 1 
ATOM 3072 N N   . ALA B 1 179 ? -45.025 15.395  2.994   1.00 68.30  ? 396 ALA B N   1 
ATOM 3073 C CA  . ALA B 1 179 ? -46.231 15.824  3.685   1.00 69.04  ? 396 ALA B CA  1 
ATOM 3074 C C   . ALA B 1 179 ? -47.433 15.739  2.726   1.00 76.83  ? 396 ALA B C   1 
ATOM 3075 O O   . ALA B 1 179 ? -48.477 15.177  3.093   1.00 79.43  ? 396 ALA B O   1 
ATOM 3076 C CB  . ALA B 1 179 ? -46.050 17.242  4.194   1.00 67.26  ? 396 ALA B CB  1 
ATOM 3077 N N   . HIS B 1 180 ? -47.246 16.220  1.465   1.00 72.20  ? 397 HIS B N   1 
ATOM 3078 C CA  . HIS B 1 180 ? -48.280 16.185  0.441   1.00 74.12  ? 397 HIS B CA  1 
ATOM 3079 C C   . HIS B 1 180 ? -48.636 14.773  0.089   1.00 83.06  ? 397 HIS B C   1 
ATOM 3080 O O   . HIS B 1 180 ? -49.820 14.454  0.044   1.00 87.38  ? 397 HIS B O   1 
ATOM 3081 C CB  . HIS B 1 180 ? -47.853 16.937  -0.814  1.00 73.10  ? 397 HIS B CB  1 
ATOM 3082 C CG  . HIS B 1 180 ? -48.923 16.973  -1.859  1.00 79.69  ? 397 HIS B CG  1 
ATOM 3083 N ND1 . HIS B 1 180 ? -49.946 17.898  -1.807  1.00 82.51  ? 397 HIS B ND1 1 
ATOM 3084 C CD2 . HIS B 1 180 ? -49.094 16.192  -2.949  1.00 84.06  ? 397 HIS B CD2 1 
ATOM 3085 C CE1 . HIS B 1 180 ? -50.698 17.660  -2.867  1.00 85.42  ? 397 HIS B CE1 1 
ATOM 3086 N NE2 . HIS B 1 180 ? -50.223 16.644  -3.584  1.00 87.07  ? 397 HIS B NE2 1 
ATOM 3087 N N   . GLU B 1 181 ? -47.615 13.930  -0.157  1.00 80.57  ? 398 GLU B N   1 
ATOM 3088 C CA  . GLU B 1 181 ? -47.791 12.533  -0.532  1.00 85.30  ? 398 GLU B CA  1 
ATOM 3089 C C   . GLU B 1 181 ? -48.517 11.695  0.520   1.00 94.48  ? 398 GLU B C   1 
ATOM 3090 O O   . GLU B 1 181 ? -49.351 10.876  0.142   1.00 98.76  ? 398 GLU B O   1 
ATOM 3091 C CB  . GLU B 1 181 ? -46.474 11.901  -0.969  1.00 85.65  ? 398 GLU B CB  1 
ATOM 3092 C CG  . GLU B 1 181 ? -46.079 12.316  -2.374  1.00 100.72 ? 398 GLU B CG  1 
ATOM 3093 C CD  . GLU B 1 181 ? -44.917 11.551  -2.974  1.00 136.24 ? 398 GLU B CD  1 
ATOM 3094 O OE1 . GLU B 1 181 ? -43.805 11.602  -2.397  1.00 133.11 ? 398 GLU B OE1 1 
ATOM 3095 O OE2 . GLU B 1 181 ? -45.121 10.901  -4.025  1.00 143.83 ? 398 GLU B OE2 1 
ATOM 3096 N N   . LYS B 1 182 ? -48.251 11.923  1.828   1.00 90.03  ? 399 LYS B N   1 
ATOM 3097 C CA  . LYS B 1 182 ? -48.936 11.142  2.860   1.00 93.44  ? 399 LYS B CA  1 
ATOM 3098 C C   . LYS B 1 182 ? -50.426 11.467  2.989   1.00 99.11  ? 399 LYS B C   1 
ATOM 3099 O O   . LYS B 1 182 ? -51.225 10.569  3.238   1.00 104.52 ? 399 LYS B O   1 
ATOM 3100 C CB  . LYS B 1 182 ? -48.182 11.096  4.208   1.00 94.25  ? 399 LYS B CB  1 
ATOM 3101 C CG  . LYS B 1 182 ? -48.020 12.421  4.919   1.00 111.95 ? 399 LYS B CG  1 
ATOM 3102 C CD  . LYS B 1 182 ? -49.035 12.605  6.052   1.00 129.61 ? 399 LYS B CD  1 
ATOM 3103 C CE  . LYS B 1 182 ? -48.890 13.949  6.754   1.00 142.79 ? 399 LYS B CE  1 
ATOM 3104 N NZ  . LYS B 1 182 ? -49.235 15.116  5.886   1.00 143.70 ? 399 LYS B NZ  1 
ATOM 3105 N N   . GLU B 1 183 ? -50.800 12.722  2.766   1.00 92.89  ? 400 GLU B N   1 
ATOM 3106 C CA  . GLU B 1 183 ? -52.193 13.174  2.847   1.00 95.53  ? 400 GLU B CA  1 
ATOM 3107 C C   . GLU B 1 183 ? -52.936 13.005  1.528   1.00 103.54 ? 400 GLU B C   1 
ATOM 3108 O O   . GLU B 1 183 ? -54.141 12.778  1.547   1.00 108.41 ? 400 GLU B O   1 
ATOM 3109 C CB  . GLU B 1 183 ? -52.276 14.648  3.316   1.00 93.18  ? 400 GLU B CB  1 
ATOM 3110 C CG  . GLU B 1 183 ? -52.772 14.833  4.743   1.00 107.06 ? 400 GLU B CG  1 
ATOM 3111 C CD  . GLU B 1 183 ? -54.276 14.734  4.935   1.00 146.54 ? 400 GLU B CD  1 
ATOM 3112 O OE1 . GLU B 1 183 ? -54.995 15.667  4.509   1.00 154.92 ? 400 GLU B OE1 1 
ATOM 3113 O OE2 . GLU B 1 183 ? -54.729 13.761  5.583   1.00 144.42 ? 400 GLU B OE2 1 
ATOM 3114 N N   . PHE B 1 184 ? -52.234 13.127  0.386   1.00 98.87  ? 401 PHE B N   1 
ATOM 3115 C CA  . PHE B 1 184 ? -52.883 13.069  -0.921  1.00 102.67 ? 401 PHE B CA  1 
ATOM 3116 C C   . PHE B 1 184 ? -52.564 11.926  -1.874  1.00 110.75 ? 401 PHE B C   1 
ATOM 3117 O O   . PHE B 1 184 ? -53.405 11.569  -2.710  1.00 115.00 ? 401 PHE B O   1 
ATOM 3118 C CB  . PHE B 1 184 ? -52.801 14.419  -1.628  1.00 101.16 ? 401 PHE B CB  1 
ATOM 3119 C CG  . PHE B 1 184 ? -53.386 15.567  -0.846  1.00 101.65 ? 401 PHE B CG  1 
ATOM 3120 C CD1 . PHE B 1 184 ? -54.733 15.585  -0.496  1.00 109.78 ? 401 PHE B CD1 1 
ATOM 3121 C CD2 . PHE B 1 184 ? -52.584 16.607  -0.416  1.00 99.16  ? 401 PHE B CD2 1 
ATOM 3122 C CE1 . PHE B 1 184 ? -55.267 16.648  0.236   1.00 109.65 ? 401 PHE B CE1 1 
ATOM 3123 C CE2 . PHE B 1 184 ? -53.128 17.693  0.283   1.00 101.33 ? 401 PHE B CE2 1 
ATOM 3124 C CZ  . PHE B 1 184 ? -54.470 17.714  0.589   1.00 103.43 ? 401 PHE B CZ  1 
ATOM 3125 N N   . GLY B 1 185 ? -51.379 11.367  -1.753  1.00 106.38 ? 402 GLY B N   1 
ATOM 3126 C CA  . GLY B 1 185 ? -50.949 10.292  -2.634  1.00 110.63 ? 402 GLY B CA  1 
ATOM 3127 C C   . GLY B 1 185 ? -49.823 10.742  -3.530  1.00 112.80 ? 402 GLY B C   1 
ATOM 3128 O O   . GLY B 1 185 ? -49.450 11.912  -3.501  1.00 106.77 ? 402 GLY B O   1 
ATOM 3129 N N   . SER B 1 186 ? -49.273 9.821   -4.327  1.00 115.75 ? 403 SER B N   1 
ATOM 3130 C CA  . SER B 1 186 ? -48.157 10.111  -5.225  1.00 114.42 ? 403 SER B CA  1 
ATOM 3131 C C   . SER B 1 186 ? -48.485 11.216  -6.244  1.00 117.82 ? 403 SER B C   1 
ATOM 3132 O O   . SER B 1 186 ? -49.507 11.134  -6.939  1.00 121.25 ? 403 SER B O   1 
ATOM 3133 C CB  . SER B 1 186 ? -47.627 8.834   -5.881  1.00 124.39 ? 403 SER B CB  1 
ATOM 3134 O OG  . SER B 1 186 ? -46.778 8.119   -4.995  1.00 133.16 ? 403 SER B OG  1 
ATOM 3135 N N   . VAL B 1 187 ? -47.627 12.280  -6.268  1.00 109.79 ? 404 VAL B N   1 
ATOM 3136 C CA  . VAL B 1 187 ? -47.774 13.471  -7.116  1.00 108.18 ? 404 VAL B CA  1 
ATOM 3137 C C   . VAL B 1 187 ? -47.818 13.170  -8.622  1.00 119.63 ? 404 VAL B C   1 
ATOM 3138 O O   . VAL B 1 187 ? -46.914 12.528  -9.155  1.00 120.48 ? 404 VAL B O   1 
ATOM 3139 C CB  . VAL B 1 187 ? -46.958 14.737  -6.682  1.00 104.52 ? 404 VAL B CB  1 
ATOM 3140 C CG1 . VAL B 1 187 ? -45.938 14.435  -5.587  1.00 100.49 ? 404 VAL B CG1 1 
ATOM 3141 C CG2 . VAL B 1 187 ? -46.319 15.478  -7.857  1.00 103.18 ? 404 VAL B CG2 1 
ATOM 3142 N N   . ASN B 1 188 ? -48.931 13.567  -9.272  1.00 121.88 ? 405 ASN B N   1 
ATOM 3143 C CA  . ASN B 1 188 ? -49.205 13.353  -10.694 1.00 127.57 ? 405 ASN B CA  1 
ATOM 3144 C C   . ASN B 1 188 ? -49.456 14.693  -11.423 1.00 128.95 ? 405 ASN B C   1 
ATOM 3145 O O   . ASN B 1 188 ? -48.728 15.658  -11.181 1.00 121.12 ? 405 ASN B O   1 
ATOM 3146 C CB  . ASN B 1 188 ? -50.363 12.343  -10.877 1.00 139.56 ? 405 ASN B CB  1 
ATOM 3147 C CG  . ASN B 1 188 ? -50.296 11.518  -12.164 1.00 189.16 ? 405 ASN B CG  1 
ATOM 3148 O OD1 . ASN B 1 188 ? -51.322 11.192  -12.770 1.00 196.22 ? 405 ASN B OD1 1 
ATOM 3149 N ND2 . ASN B 1 188 ? -49.096 11.135  -12.610 1.00 182.36 ? 405 ASN B ND2 1 
ATOM 3150 N N   . GLY B 1 189 ? -50.465 14.730  -12.300 1.00 132.11 ? 406 GLY B N   1 
ATOM 3151 C CA  . GLY B 1 189 ? -50.819 15.900  -13.095 1.00 133.10 ? 406 GLY B CA  1 
ATOM 3152 C C   . GLY B 1 189 ? -51.413 17.019  -12.272 1.00 134.38 ? 406 GLY B C   1 
ATOM 3153 O O   . GLY B 1 189 ? -50.793 18.077  -12.125 1.00 128.56 ? 406 GLY B O   1 
ATOM 3154 N N   . GLU B 1 190 ? -52.627 16.786  -11.733 1.00 135.22 ? 407 GLU B N   1 
ATOM 3155 C CA  . GLU B 1 190 ? -53.349 17.745  -10.888 1.00 133.55 ? 407 GLU B CA  1 
ATOM 3156 C C   . GLU B 1 190 ? -52.758 17.776  -9.474  1.00 129.65 ? 407 GLU B C   1 
ATOM 3157 O O   . GLU B 1 190 ? -52.593 18.858  -8.893  1.00 126.55 ? 407 GLU B O   1 
ATOM 3158 C CB  . GLU B 1 190 ? -54.847 17.405  -10.830 1.00 141.91 ? 407 GLU B CB  1 
ATOM 3159 C CG  . GLU B 1 190 ? -55.582 17.615  -12.146 1.00 161.27 ? 407 GLU B CG  1 
ATOM 3160 C CD  . GLU B 1 190 ? -57.085 17.441  -12.066 1.00 197.09 ? 407 GLU B CD  1 
ATOM 3161 O OE1 . GLU B 1 190 ? -57.731 18.183  -11.290 1.00 189.37 ? 407 GLU B OE1 1 
ATOM 3162 O OE2 . GLU B 1 190 ? -57.619 16.581  -12.803 1.00 203.85 ? 407 GLU B OE2 1 
ATOM 3163 N N   . ASN B 1 191 ? -52.431 16.580  -8.936  1.00 122.15 ? 408 ASN B N   1 
ATOM 3164 C CA  . ASN B 1 191 ? -51.858 16.374  -7.608  1.00 114.79 ? 408 ASN B CA  1 
ATOM 3165 C C   . ASN B 1 191 ? -50.395 16.858  -7.567  1.00 109.60 ? 408 ASN B C   1 
ATOM 3166 O O   . ASN B 1 191 ? -49.516 16.146  -8.037  1.00 110.09 ? 408 ASN B O   1 
ATOM 3167 C CB  . ASN B 1 191 ? -51.968 14.886  -7.255  1.00 113.36 ? 408 ASN B CB  1 
ATOM 3168 C CG  . ASN B 1 191 ? -51.729 14.545  -5.809  1.00 121.69 ? 408 ASN B CG  1 
ATOM 3169 O OD1 . ASN B 1 191 ? -51.060 13.560  -5.493  1.00 112.72 ? 408 ASN B OD1 1 
ATOM 3170 N ND2 . ASN B 1 191 ? -52.313 15.306  -4.895  1.00 112.57 ? 408 ASN B ND2 1 
ATOM 3171 N N   . LYS B 1 192 ? -50.145 18.078  -7.063  1.00 98.64  ? 409 LYS B N   1 
ATOM 3172 C CA  . LYS B 1 192 ? -48.795 18.664  -6.993  1.00 92.82  ? 409 LYS B CA  1 
ATOM 3173 C C   . LYS B 1 192 ? -48.521 19.193  -5.570  1.00 92.40  ? 409 LYS B C   1 
ATOM 3174 O O   . LYS B 1 192 ? -49.463 19.677  -4.942  1.00 94.13  ? 409 LYS B O   1 
ATOM 3175 C CB  . LYS B 1 192 ? -48.664 19.856  -7.964  1.00 95.27  ? 409 LYS B CB  1 
ATOM 3176 C CG  . LYS B 1 192 ? -48.784 19.565  -9.453  1.00 103.66 ? 409 LYS B CG  1 
ATOM 3177 C CD  . LYS B 1 192 ? -48.545 20.850  -10.247 1.00 109.49 ? 409 LYS B CD  1 
ATOM 3178 C CE  . LYS B 1 192 ? -48.906 20.761  -11.707 1.00 118.89 ? 409 LYS B CE  1 
ATOM 3179 N NZ  . LYS B 1 192 ? -50.356 20.988  -11.939 1.00 129.95 ? 409 LYS B NZ  1 
ATOM 3180 N N   . PRO B 1 193 ? -47.262 19.212  -5.054  1.00 82.74  ? 410 PRO B N   1 
ATOM 3181 C CA  . PRO B 1 193 ? -47.034 19.791  -3.715  1.00 78.74  ? 410 PRO B CA  1 
ATOM 3182 C C   . PRO B 1 193 ? -47.235 21.306  -3.719  1.00 79.20  ? 410 PRO B C   1 
ATOM 3183 O O   . PRO B 1 193 ? -47.214 21.920  -4.790  1.00 80.17  ? 410 PRO B O   1 
ATOM 3184 C CB  . PRO B 1 193 ? -45.574 19.414  -3.398  1.00 77.61  ? 410 PRO B CB  1 
ATOM 3185 C CG  . PRO B 1 193 ? -45.178 18.431  -4.429  1.00 83.75  ? 410 PRO B CG  1 
ATOM 3186 C CD  . PRO B 1 193 ? -45.998 18.725  -5.635  1.00 82.34  ? 410 PRO B CD  1 
ATOM 3187 N N   . ILE B 1 194 ? -47.451 21.904  -2.525  1.00 72.45  ? 411 ILE B N   1 
ATOM 3188 C CA  . ILE B 1 194 ? -47.687 23.344  -2.351  1.00 70.92  ? 411 ILE B CA  1 
ATOM 3189 C C   . ILE B 1 194 ? -46.628 24.194  -3.025  1.00 72.95  ? 411 ILE B C   1 
ATOM 3190 O O   . ILE B 1 194 ? -46.992 25.109  -3.759  1.00 76.10  ? 411 ILE B O   1 
ATOM 3191 C CB  . ILE B 1 194 ? -48.007 23.773  -0.874  1.00 72.71  ? 411 ILE B CB  1 
ATOM 3192 C CG1 . ILE B 1 194 ? -48.502 25.249  -0.763  1.00 74.39  ? 411 ILE B CG1 1 
ATOM 3193 C CG2 . ILE B 1 194 ? -46.834 23.508  0.089   1.00 69.32  ? 411 ILE B CG2 1 
ATOM 3194 C CD1 . ILE B 1 194 ? -49.828 25.593  -1.375  1.00 81.85  ? 411 ILE B CD1 1 
ATOM 3195 N N   . TRP B 1 195 ? -45.336 23.861  -2.832  1.00 64.87  ? 412 TRP B N   1 
ATOM 3196 C CA  . TRP B 1 195 ? -44.235 24.607  -3.433  1.00 63.64  ? 412 TRP B CA  1 
ATOM 3197 C C   . TRP B 1 195 ? -44.291 24.655  -4.977  1.00 72.03  ? 412 TRP B C   1 
ATOM 3198 O O   . TRP B 1 195 ? -43.986 25.702  -5.541  1.00 71.86  ? 412 TRP B O   1 
ATOM 3199 C CB  . TRP B 1 195 ? -42.887 24.153  -2.888  1.00 59.23  ? 412 TRP B CB  1 
ATOM 3200 C CG  . TRP B 1 195 ? -42.561 22.728  -3.191  1.00 59.42  ? 412 TRP B CG  1 
ATOM 3201 C CD1 . TRP B 1 195 ? -42.784 21.643  -2.393  1.00 62.01  ? 412 TRP B CD1 1 
ATOM 3202 C CD2 . TRP B 1 195 ? -41.960 22.228  -4.394  1.00 59.43  ? 412 TRP B CD2 1 
ATOM 3203 N NE1 . TRP B 1 195 ? -42.327 20.495  -3.013  1.00 61.50  ? 412 TRP B NE1 1 
ATOM 3204 C CE2 . TRP B 1 195 ? -41.799 20.829  -4.233  1.00 62.66  ? 412 TRP B CE2 1 
ATOM 3205 C CE3 . TRP B 1 195 ? -41.499 22.832  -5.579  1.00 60.97  ? 412 TRP B CE3 1 
ATOM 3206 C CZ2 . TRP B 1 195 ? -41.211 20.028  -5.214  1.00 61.74  ? 412 TRP B CZ2 1 
ATOM 3207 C CZ3 . TRP B 1 195 ? -40.896 22.034  -6.539  1.00 62.33  ? 412 TRP B CZ3 1 
ATOM 3208 C CH2 . TRP B 1 195 ? -40.793 20.647  -6.369  1.00 62.47  ? 412 TRP B CH2 1 
ATOM 3209 N N   . MET B 1 196 ? -44.741 23.562  -5.648  1.00 71.86  ? 413 MET B N   1 
ATOM 3210 C CA  . MET B 1 196 ? -44.930 23.526  -7.108  1.00 74.41  ? 413 MET B CA  1 
ATOM 3211 C C   . MET B 1 196 ? -46.004 24.506  -7.533  1.00 80.62  ? 413 MET B C   1 
ATOM 3212 O O   . MET B 1 196 ? -45.808 25.239  -8.498  1.00 80.92  ? 413 MET B O   1 
ATOM 3213 C CB  . MET B 1 196 ? -45.336 22.144  -7.576  1.00 78.31  ? 413 MET B CB  1 
ATOM 3214 C CG  . MET B 1 196 ? -44.181 21.264  -7.797  1.00 80.85  ? 413 MET B CG  1 
ATOM 3215 S SD  . MET B 1 196 ? -44.571 20.082  -9.089  1.00 88.62  ? 413 MET B SD  1 
ATOM 3216 C CE  . MET B 1 196 ? -43.110 19.206  -9.132  1.00 82.96  ? 413 MET B CE  1 
ATOM 3217 N N   . HIS B 1 197 ? -47.129 24.534  -6.801  1.00 80.10  ? 414 HIS B N   1 
ATOM 3218 C CA  . HIS B 1 197 ? -48.239 25.458  -7.056  1.00 84.38  ? 414 HIS B CA  1 
ATOM 3219 C C   . HIS B 1 197 ? -47.795 26.918  -6.871  1.00 85.55  ? 414 HIS B C   1 
ATOM 3220 O O   . HIS B 1 197 ? -48.246 27.777  -7.616  1.00 87.04  ? 414 HIS B O   1 
ATOM 3221 C CB  . HIS B 1 197 ? -49.421 25.159  -6.131  1.00 87.55  ? 414 HIS B CB  1 
ATOM 3222 C CG  . HIS B 1 197 ? -50.193 23.934  -6.491  1.00 94.73  ? 414 HIS B CG  1 
ATOM 3223 N ND1 . HIS B 1 197 ? -50.742 23.767  -7.754  1.00 101.53 ? 414 HIS B ND1 1 
ATOM 3224 C CD2 . HIS B 1 197 ? -50.545 22.880  -5.716  1.00 97.36  ? 414 HIS B CD2 1 
ATOM 3225 C CE1 . HIS B 1 197 ? -51.391 22.612  -7.713  1.00 103.59 ? 414 HIS B CE1 1 
ATOM 3226 N NE2 . HIS B 1 197 ? -51.303 22.041  -6.507  1.00 101.37 ? 414 HIS B NE2 1 
ATOM 3227 N N   . ALA B 1 198 ? -46.897 27.180  -5.887  1.00 78.75  ? 415 ALA B N   1 
ATOM 3228 C CA  . ALA B 1 198 ? -46.330 28.489  -5.552  1.00 77.70  ? 415 ALA B CA  1 
ATOM 3229 C C   . ALA B 1 198 ? -45.393 28.966  -6.666  1.00 82.35  ? 415 ALA B C   1 
ATOM 3230 O O   . ALA B 1 198 ? -45.429 30.136  -7.030  1.00 84.28  ? 415 ALA B O   1 
ATOM 3231 C CB  . ALA B 1 198 ? -45.578 28.406  -4.226  1.00 75.07  ? 415 ALA B CB  1 
ATOM 3232 N N   . GLU B 1 199 ? -44.578 28.053  -7.225  1.00 77.44  ? 416 GLU B N   1 
ATOM 3233 C CA  . GLU B 1 199 ? -43.641 28.366  -8.299  1.00 77.69  ? 416 GLU B CA  1 
ATOM 3234 C C   . GLU B 1 199 ? -44.346 28.618  -9.613  1.00 88.08  ? 416 GLU B C   1 
ATOM 3235 O O   . GLU B 1 199 ? -43.929 29.508  -10.354 1.00 91.48  ? 416 GLU B O   1 
ATOM 3236 C CB  . GLU B 1 199 ? -42.533 27.308  -8.407  1.00 75.78  ? 416 GLU B CB  1 
ATOM 3237 C CG  . GLU B 1 199 ? -41.642 27.361  -7.185  1.00 82.21  ? 416 GLU B CG  1 
ATOM 3238 C CD  . GLU B 1 199 ? -40.307 26.661  -7.237  1.00 104.05 ? 416 GLU B CD  1 
ATOM 3239 O OE1 . GLU B 1 199 ? -39.372 27.197  -7.874  1.00 110.03 ? 416 GLU B OE1 1 
ATOM 3240 O OE2 . GLU B 1 199 ? -40.155 25.660  -6.506  1.00 103.82 ? 416 GLU B OE2 1 
ATOM 3241 N N   . GLU B 1 200 ? -45.454 27.886  -9.874  1.00 86.29  ? 417 GLU B N   1 
ATOM 3242 C CA  . GLU B 1 200 ? -46.295 28.036  -11.069 1.00 90.17  ? 417 GLU B CA  1 
ATOM 3243 C C   . GLU B 1 200 ? -47.081 29.342  -11.013 1.00 97.08  ? 417 GLU B C   1 
ATOM 3244 O O   . GLU B 1 200 ? -47.306 29.955  -12.054 1.00 101.61 ? 417 GLU B O   1 
ATOM 3245 C CB  . GLU B 1 200 ? -47.232 26.830  -11.228 1.00 92.62  ? 417 GLU B CB  1 
ATOM 3246 C CG  . GLU B 1 200 ? -46.519 25.571  -11.705 1.00 100.38 ? 417 GLU B CG  1 
ATOM 3247 C CD  . GLU B 1 200 ? -47.354 24.315  -11.896 1.00 129.12 ? 417 GLU B CD  1 
ATOM 3248 O OE1 . GLU B 1 200 ? -48.500 24.256  -11.385 1.00 127.15 ? 417 GLU B OE1 1 
ATOM 3249 O OE2 . GLU B 1 200 ? -46.839 23.373  -12.544 1.00 121.91 ? 417 GLU B OE2 1 
ATOM 3250 N N   . ARG B 1 201 ? -47.471 29.768  -9.789  1.00 104.53 ? 418 ARG B N   1 
ATOM 3251 C CA  . ARG B 1 201 ? -48.178 31.018  -9.492  1.00 104.97 ? 418 ARG B CA  1 
ATOM 3252 C C   . ARG B 1 201 ? -47.279 32.208  -9.801  1.00 111.42 ? 418 ARG B C   1 
ATOM 3253 O O   . ARG B 1 201 ? -47.760 33.205  -10.344 1.00 113.97 ? 418 ARG B O   1 
ATOM 3254 C CB  . ARG B 1 201 ? -48.591 31.070  -8.016  1.00 104.49 ? 418 ARG B CB  1 
ATOM 3255 C CG  . ARG B 1 201 ? -50.089 30.956  -7.805  1.00 118.53 ? 418 ARG B CG  1 
ATOM 3256 C CD  . ARG B 1 201 ? -50.457 31.222  -6.365  1.00 131.73 ? 418 ARG B CD  1 
ATOM 3257 N NE  . ARG B 1 201 ? -51.718 31.948  -6.260  1.00 146.08 ? 418 ARG B NE  1 
ATOM 3258 C CZ  . ARG B 1 201 ? -52.353 32.178  -5.116  1.00 164.50 ? 418 ARG B CZ  1 
ATOM 3259 N NH1 . ARG B 1 201 ? -51.853 31.730  -3.969  1.00 147.18 ? 418 ARG B NH1 1 
ATOM 3260 N NH2 . ARG B 1 201 ? -53.498 32.848  -5.110  1.00 157.09 ? 418 ARG B NH2 1 
ATOM 3261 N N   . GLU B 1 202 ? -45.977 32.107  -9.450  1.00 107.18 ? 419 GLU B N   1 
ATOM 3262 C CA  . GLU B 1 202 ? -44.978 33.142  -9.716  1.00 108.59 ? 419 GLU B CA  1 
ATOM 3263 C C   . GLU B 1 202 ? -44.763 33.285  -11.217 1.00 116.47 ? 419 GLU B C   1 
ATOM 3264 O O   . GLU B 1 202 ? -44.734 34.412  -11.713 1.00 119.13 ? 419 GLU B O   1 
ATOM 3265 C CB  . GLU B 1 202 ? -43.650 32.809  -9.031  1.00 109.06 ? 419 GLU B CB  1 
ATOM 3266 C CG  . GLU B 1 202 ? -43.302 33.746  -7.892  1.00 114.65 ? 419 GLU B CG  1 
ATOM 3267 C CD  . GLU B 1 202 ? -42.830 35.137  -8.260  1.00 130.98 ? 419 GLU B CD  1 
ATOM 3268 O OE1 . GLU B 1 202 ? -42.002 35.262  -9.189  1.00 132.80 ? 419 GLU B OE1 1 
ATOM 3269 O OE2 . GLU B 1 202 ? -43.202 36.091  -7.542  1.00 121.98 ? 419 GLU B OE2 1 
ATOM 3270 N N   . GLU B 1 203 ? -44.690 32.141  -11.945 1.00 113.23 ? 420 GLU B N   1 
ATOM 3271 C CA  . GLU B 1 203 ? -44.502 32.073  -13.402 1.00 115.34 ? 420 GLU B CA  1 
ATOM 3272 C C   . GLU B 1 203 ? -45.570 32.800  -14.238 1.00 118.96 ? 420 GLU B C   1 
ATOM 3273 O O   . GLU B 1 203 ? -45.387 32.929  -15.449 1.00 121.45 ? 420 GLU B O   1 
ATOM 3274 C CB  . GLU B 1 203 ? -44.317 30.618  -13.880 1.00 116.19 ? 420 GLU B CB  1 
ATOM 3275 C CG  . GLU B 1 203 ? -42.957 30.015  -13.558 1.00 130.45 ? 420 GLU B CG  1 
ATOM 3276 C CD  . GLU B 1 203 ? -41.714 30.685  -14.116 1.00 161.21 ? 420 GLU B CD  1 
ATOM 3277 O OE1 . GLU B 1 203 ? -41.771 31.205  -15.254 1.00 168.49 ? 420 GLU B OE1 1 
ATOM 3278 O OE2 . GLU B 1 203 ? -40.665 30.640  -13.432 1.00 151.02 ? 420 GLU B OE2 1 
ATOM 3279 N N   . SER B 1 204 ? -46.656 33.293  -13.594 1.00 112.78 ? 421 SER B N   1 
ATOM 3280 C CA  . SER B 1 204 ? -47.756 34.031  -14.234 1.00 135.01 ? 421 SER B CA  1 
ATOM 3281 C C   . SER B 1 204 ? -48.163 35.268  -13.424 1.00 137.58 ? 421 SER B C   1 
ATOM 3282 O O   . SER B 1 204 ? -47.373 36.195  -13.262 1.00 94.29  ? 421 SER B O   1 
ATOM 3283 C CB  . SER B 1 204 ? -48.961 33.120  -14.446 1.00 136.56 ? 421 SER B CB  1 
ATOM 3284 O OG  . SER B 1 204 ? -49.504 32.653  -13.223 1.00 140.79 ? 421 SER B OG  1 
ATOM 3285 N N   . LYS B 1 222 ? -55.515 25.662  -1.357  1.00 124.52 ? 439 LYS B N   1 
ATOM 3286 C CA  . LYS B 1 222 ? -56.147 24.571  -0.612  1.00 126.98 ? 439 LYS B CA  1 
ATOM 3287 C C   . LYS B 1 222 ? -55.415 23.216  -0.765  1.00 133.87 ? 439 LYS B C   1 
ATOM 3288 O O   . LYS B 1 222 ? -55.901 22.195  -0.262  1.00 135.41 ? 439 LYS B O   1 
ATOM 3289 C CB  . LYS B 1 222 ? -57.623 24.443  -1.016  1.00 130.25 ? 439 LYS B CB  1 
ATOM 3290 C CG  . LYS B 1 222 ? -58.547 24.102  0.144   1.00 140.28 ? 439 LYS B CG  1 
ATOM 3291 C CD  . LYS B 1 222 ? -59.985 23.965  -0.329  1.00 144.39 ? 439 LYS B CD  1 
ATOM 3292 C CE  . LYS B 1 222 ? -60.894 23.401  0.732   1.00 145.81 ? 439 LYS B CE  1 
ATOM 3293 N NZ  . LYS B 1 222 ? -62.197 22.982  0.155   1.00 148.47 ? 439 LYS B NZ  1 
ATOM 3294 N N   . ALA B 1 223 ? -54.232 23.214  -1.430  1.00 130.80 ? 440 ALA B N   1 
ATOM 3295 C CA  . ALA B 1 223 ? -53.391 22.019  -1.645  1.00 131.88 ? 440 ALA B CA  1 
ATOM 3296 C C   . ALA B 1 223 ? -52.417 21.787  -0.469  1.00 137.24 ? 440 ALA B C   1 
ATOM 3297 O O   . ALA B 1 223 ? -51.325 21.215  -0.646  1.00 135.88 ? 440 ALA B O   1 
ATOM 3298 C CB  . ALA B 1 223 ? -52.615 22.159  -2.949  1.00 131.19 ? 440 ALA B CB  1 
ATOM 3299 N N   . CYS B 1 224 ? -52.833 22.222  0.739   1.00 135.70 ? 441 CYS B N   1 
ATOM 3300 C CA  . CYS B 1 224 ? -52.017 22.127  1.935   1.00 136.77 ? 441 CYS B CA  1 
ATOM 3301 C C   . CYS B 1 224 ? -52.804 21.874  3.229   1.00 144.31 ? 441 CYS B C   1 
ATOM 3302 O O   . CYS B 1 224 ? -53.000 20.712  3.585   1.00 146.21 ? 441 CYS B O   1 
ATOM 3303 C CB  . CYS B 1 224 ? -51.104 23.345  2.042   1.00 135.25 ? 441 CYS B CB  1 
ATOM 3304 S SG  . CYS B 1 224 ? -51.971 24.922  2.296   1.00 138.50 ? 441 CYS B SG  1 
ATOM 3305 N N   . LYS B 1 225 ? -53.211 22.958  3.950   1.00 141.57 ? 442 LYS B N   1 
ATOM 3306 C CA  . LYS B 1 225 ? -53.943 22.956  5.228   1.00 144.29 ? 442 LYS B CA  1 
ATOM 3307 C C   . LYS B 1 225 ? -53.240 22.091  6.328   1.00 150.49 ? 442 LYS B C   1 
ATOM 3308 O O   . LYS B 1 225 ? -53.890 21.628  7.272   1.00 153.45 ? 442 LYS B O   1 
ATOM 3309 C CB  . LYS B 1 225 ? -55.416 22.547  4.992   1.00 148.06 ? 442 LYS B CB  1 
ATOM 3310 C CG  . LYS B 1 225 ? -56.423 23.239  5.912   1.00 157.57 ? 442 LYS B CG  1 
ATOM 3311 C CD  . LYS B 1 225 ? -57.768 22.503  5.979   1.00 166.20 ? 442 LYS B CD  1 
ATOM 3312 C CE  . LYS B 1 225 ? -57.710 21.098  6.556   1.00 179.50 ? 442 LYS B CE  1 
ATOM 3313 N NZ  . LYS B 1 225 ? -57.288 21.080  7.982   1.00 191.48 ? 442 LYS B NZ  1 
ATOM 3314 N N   . VAL B 1 226 ? -51.899 21.927  6.208   1.00 145.20 ? 443 VAL B N   1 
ATOM 3315 C CA  . VAL B 1 226 ? -51.039 21.102  7.063   1.00 146.93 ? 443 VAL B CA  1 
ATOM 3316 C C   . VAL B 1 226 ? -50.848 21.657  8.493   1.00 152.26 ? 443 VAL B C   1 
ATOM 3317 O O   . VAL B 1 226 ? -50.077 22.598  8.706   1.00 149.65 ? 443 VAL B O   1 
ATOM 3318 C CB  . VAL B 1 226 ? -49.705 20.672  6.374   1.00 148.95 ? 443 VAL B CB  1 
ATOM 3319 C CG1 . VAL B 1 226 ? -49.204 19.331  6.929   1.00 151.46 ? 443 VAL B CG1 1 
ATOM 3320 C CG2 . VAL B 1 226 ? -49.835 20.610  4.847   1.00 145.94 ? 443 VAL B CG2 1 
ATOM 3321 N N   . ASP B 1 227 ? -51.565 21.041  9.462   1.00 126.83 ? 444 ASP B N   1 
ATOM 3322 C CA  . ASP B 1 227 ? -51.605 21.402  10.886  1.00 131.19 ? 444 ASP B CA  1 
ATOM 3323 C C   . ASP B 1 227 ? -50.347 21.122  11.769  1.00 132.62 ? 444 ASP B C   1 
ATOM 3324 O O   . ASP B 1 227 ? -50.323 21.555  12.931  1.00 136.47 ? 444 ASP B O   1 
ATOM 3325 C CB  . ASP B 1 227 ? -52.899 20.867  11.539  1.00 142.69 ? 444 ASP B CB  1 
ATOM 3326 C CG  . ASP B 1 227 ? -54.202 21.405  10.945  1.00 159.36 ? 444 ASP B CG  1 
ATOM 3327 O OD1 . ASP B 1 227 ? -54.145 22.369  10.140  1.00 155.71 ? 444 ASP B OD1 1 
ATOM 3328 O OD2 . ASP B 1 227 ? -55.276 20.874  11.296  1.00 172.24 ? 444 ASP B OD2 1 
ATOM 3329 N N   . SER B 1 228 ? -49.311 20.425  11.226  1.00 121.77 ? 445 SER B N   1 
ATOM 3330 C CA  . SER B 1 228 ? -48.058 20.130  11.941  1.00 119.02 ? 445 SER B CA  1 
ATOM 3331 C C   . SER B 1 228 ? -47.199 21.420  12.183  1.00 115.69 ? 445 SER B C   1 
ATOM 3332 O O   . SER B 1 228 ? -47.092 22.256  11.275  1.00 109.71 ? 445 SER B O   1 
ATOM 3333 C CB  . SER B 1 228 ? -47.256 19.077  11.182  1.00 118.35 ? 445 SER B CB  1 
ATOM 3334 O OG  . SER B 1 228 ? -45.892 19.026  11.571  1.00 120.30 ? 445 SER B OG  1 
ATOM 3335 N N   . PRO B 1 229 ? -46.597 21.611  13.391  1.00 112.63 ? 446 PRO B N   1 
ATOM 3336 C CA  . PRO B 1 229 ? -45.778 22.819  13.620  1.00 108.64 ? 446 PRO B CA  1 
ATOM 3337 C C   . PRO B 1 229 ? -44.419 22.777  12.925  1.00 105.16 ? 446 PRO B C   1 
ATOM 3338 O O   . PRO B 1 229 ? -43.893 23.835  12.571  1.00 101.52 ? 446 PRO B O   1 
ATOM 3339 C CB  . PRO B 1 229 ? -45.638 22.896  15.141  1.00 117.06 ? 446 PRO B CB  1 
ATOM 3340 C CG  . PRO B 1 229 ? -46.194 21.643  15.674  1.00 127.97 ? 446 PRO B CG  1 
ATOM 3341 C CD  . PRO B 1 229 ? -46.592 20.731  14.572  1.00 120.70 ? 446 PRO B CD  1 
ATOM 3342 N N   . THR B 1 230 ? -43.860 21.556  12.727  1.00 99.17  ? 447 THR B N   1 
ATOM 3343 C CA  . THR B 1 230 ? -42.597 21.288  12.031  1.00 93.20  ? 447 THR B CA  1 
ATOM 3344 C C   . THR B 1 230 ? -42.766 21.694  10.564  1.00 90.06  ? 447 THR B C   1 
ATOM 3345 O O   . THR B 1 230 ? -41.874 22.323  9.992   1.00 86.10  ? 447 THR B O   1 
ATOM 3346 C CB  . THR B 1 230 ? -42.207 19.806  12.181  1.00 96.47  ? 447 THR B CB  1 
ATOM 3347 O OG1 . THR B 1 230 ? -42.379 19.408  13.545  1.00 101.97 ? 447 THR B OG1 1 
ATOM 3348 C CG2 . THR B 1 230 ? -40.776 19.527  11.732  1.00 87.11  ? 447 THR B CG2 1 
ATOM 3349 N N   . VAL B 1 231 ? -43.940 21.375  9.987   1.00 85.96  ? 448 VAL B N   1 
ATOM 3350 C CA  . VAL B 1 231 ? -44.342 21.718  8.625   1.00 81.22  ? 448 VAL B CA  1 
ATOM 3351 C C   . VAL B 1 231 ? -44.538 23.228  8.524   1.00 83.57  ? 448 VAL B C   1 
ATOM 3352 O O   . VAL B 1 231 ? -44.026 23.845  7.579   1.00 80.11  ? 448 VAL B O   1 
ATOM 3353 C CB  . VAL B 1 231 ? -45.610 20.955  8.180   1.00 87.33  ? 448 VAL B CB  1 
ATOM 3354 C CG1 . VAL B 1 231 ? -46.126 21.502  6.861   1.00 83.80  ? 448 VAL B CG1 1 
ATOM 3355 C CG2 . VAL B 1 231 ? -45.350 19.447  8.074   1.00 89.97  ? 448 VAL B CG2 1 
ATOM 3356 N N   . ASN B 1 232 ? -45.259 23.834  9.501   1.00 82.75  ? 449 ASN B N   1 
ATOM 3357 C CA  . ASN B 1 232 ? -45.487 25.283  9.496   1.00 81.51  ? 449 ASN B CA  1 
ATOM 3358 C C   . ASN B 1 232 ? -44.158 26.037  9.486   1.00 83.31  ? 449 ASN B C   1 
ATOM 3359 O O   . ASN B 1 232 ? -44.053 27.061  8.817   1.00 81.35  ? 449 ASN B O   1 
ATOM 3360 C CB  . ASN B 1 232 ? -46.418 25.730  10.625  1.00 87.38  ? 449 ASN B CB  1 
ATOM 3361 C CG  . ASN B 1 232 ? -47.880 25.279  10.487  1.00 116.75 ? 449 ASN B CG  1 
ATOM 3362 O OD1 . ASN B 1 232 ? -48.537 25.445  9.442   1.00 97.13  ? 449 ASN B OD1 1 
ATOM 3363 N ND2 . ASN B 1 232 ? -48.456 24.752  11.577  1.00 118.14 ? 449 ASN B ND2 1 
ATOM 3364 N N   . THR B 1 233 ? -43.118 25.467  10.126  1.00 80.16  ? 450 THR B N   1 
ATOM 3365 C CA  . THR B 1 233 ? -41.766 26.029  10.143  1.00 78.89  ? 450 THR B CA  1 
ATOM 3366 C C   . THR B 1 233 ? -41.148 25.939  8.743   1.00 78.43  ? 450 THR B C   1 
ATOM 3367 O O   . THR B 1 233 ? -40.513 26.894  8.281   1.00 77.28  ? 450 THR B O   1 
ATOM 3368 C CB  . THR B 1 233 ? -40.905 25.320  11.205  1.00 88.87  ? 450 THR B CB  1 
ATOM 3369 O OG1 . THR B 1 233 ? -41.530 25.494  12.471  1.00 97.13  ? 450 THR B OG1 1 
ATOM 3370 C CG2 . THR B 1 233 ? -39.473 25.848  11.268  1.00 83.21  ? 450 THR B CG2 1 
ATOM 3371 N N   . THR B 1 234 ? -41.322 24.785  8.085   1.00 71.94  ? 451 THR B N   1 
ATOM 3372 C CA  . THR B 1 234 ? -40.813 24.537  6.742   1.00 67.87  ? 451 THR B CA  1 
ATOM 3373 C C   . THR B 1 234 ? -41.412 25.543  5.765   1.00 69.90  ? 451 THR B C   1 
ATOM 3374 O O   . THR B 1 234 ? -40.658 26.202  5.043   1.00 67.94  ? 451 THR B O   1 
ATOM 3375 C CB  . THR B 1 234 ? -41.119 23.113  6.374   1.00 67.50  ? 451 THR B CB  1 
ATOM 3376 O OG1 . THR B 1 234 ? -40.488 22.293  7.341   1.00 72.26  ? 451 THR B OG1 1 
ATOM 3377 C CG2 . THR B 1 234 ? -40.655 22.753  4.989   1.00 59.55  ? 451 THR B CG2 1 
ATOM 3378 N N   . LEU B 1 235 ? -42.763 25.656  5.761   1.00 66.17  ? 452 LEU B N   1 
ATOM 3379 C CA  . LEU B 1 235 ? -43.517 26.587  4.933   1.00 64.62  ? 452 LEU B CA  1 
ATOM 3380 C C   . LEU B 1 235 ? -43.004 28.015  5.139   1.00 72.76  ? 452 LEU B C   1 
ATOM 3381 O O   . LEU B 1 235 ? -42.691 28.700  4.158   1.00 72.44  ? 452 LEU B O   1 
ATOM 3382 C CB  . LEU B 1 235 ? -45.011 26.505  5.277   1.00 66.01  ? 452 LEU B CB  1 
ATOM 3383 C CG  . LEU B 1 235 ? -45.752 25.278  4.790   1.00 70.28  ? 452 LEU B CG  1 
ATOM 3384 C CD1 . LEU B 1 235 ? -47.157 25.223  5.377   1.00 72.17  ? 452 LEU B CD1 1 
ATOM 3385 C CD2 . LEU B 1 235 ? -45.800 25.241  3.260   1.00 71.39  ? 452 LEU B CD2 1 
ATOM 3386 N N   . ARG B 1 236 ? -42.853 28.437  6.411   1.00 74.10  ? 453 ARG B N   1 
ATOM 3387 C CA  . ARG B 1 236 ? -42.365 29.772  6.759   1.00 77.01  ? 453 ARG B CA  1 
ATOM 3388 C C   . ARG B 1 236 ? -40.933 30.010  6.290   1.00 81.23  ? 453 ARG B C   1 
ATOM 3389 O O   . ARG B 1 236 ? -40.654 31.060  5.716   1.00 83.36  ? 453 ARG B O   1 
ATOM 3390 C CB  . ARG B 1 236 ? -42.547 30.069  8.255   1.00 82.22  ? 453 ARG B CB  1 
ATOM 3391 C CG  . ARG B 1 236 ? -43.818 30.858  8.527   1.00 92.01  ? 453 ARG B CG  1 
ATOM 3392 C CD  . ARG B 1 236 ? -44.067 31.058  10.000  1.00 100.81 ? 453 ARG B CD  1 
ATOM 3393 N NE  . ARG B 1 236 ? -45.367 30.512  10.383  1.00 109.03 ? 453 ARG B NE  1 
ATOM 3394 C CZ  . ARG B 1 236 ? -45.542 29.379  11.063  1.00 120.01 ? 453 ARG B CZ  1 
ATOM 3395 N NH1 . ARG B 1 236 ? -44.490 28.671  11.479  1.00 93.36  ? 453 ARG B NH1 1 
ATOM 3396 N NH2 . ARG B 1 236 ? -46.765 28.959  11.357  1.00 108.15 ? 453 ARG B NH2 1 
ATOM 3397 N N   . SER B 1 237 ? -40.066 29.010  6.457   1.00 75.61  ? 454 SER B N   1 
ATOM 3398 C CA  . SER B 1 237 ? -38.682 29.066  6.015   1.00 74.75  ? 454 SER B CA  1 
ATOM 3399 C C   . SER B 1 237 ? -38.594 29.036  4.494   1.00 74.95  ? 454 SER B C   1 
ATOM 3400 O O   . SER B 1 237 ? -37.858 29.842  3.929   1.00 75.52  ? 454 SER B O   1 
ATOM 3401 C CB  . SER B 1 237 ? -37.877 27.914  6.603   1.00 79.79  ? 454 SER B CB  1 
ATOM 3402 O OG  . SER B 1 237 ? -37.832 27.930  8.019   1.00 93.91  ? 454 SER B OG  1 
ATOM 3403 N N   . LEU B 1 238 ? -39.310 28.102  3.821   1.00 69.52  ? 455 LEU B N   1 
ATOM 3404 C CA  . LEU B 1 238 ? -39.277 28.066  2.352   1.00 68.40  ? 455 LEU B CA  1 
ATOM 3405 C C   . LEU B 1 238 ? -39.863 29.370  1.760   1.00 74.40  ? 455 LEU B C   1 
ATOM 3406 O O   . LEU B 1 238 ? -39.330 29.891  0.767   1.00 75.01  ? 455 LEU B O   1 
ATOM 3407 C CB  . LEU B 1 238 ? -39.914 26.808  1.753   1.00 66.65  ? 455 LEU B CB  1 
ATOM 3408 C CG  . LEU B 1 238 ? -39.767 26.611  0.220   1.00 70.51  ? 455 LEU B CG  1 
ATOM 3409 C CD1 . LEU B 1 238 ? -38.312 26.797  -0.265  1.00 71.60  ? 455 LEU B CD1 1 
ATOM 3410 C CD2 . LEU B 1 238 ? -40.302 25.253  -0.210  1.00 71.33  ? 455 LEU B CD2 1 
ATOM 3411 N N   . GLY B 1 239 ? -40.881 29.920  2.432   1.00 70.82  ? 456 GLY B N   1 
ATOM 3412 C CA  . GLY B 1 239 ? -41.460 31.201  2.056   1.00 72.41  ? 456 GLY B CA  1 
ATOM 3413 C C   . GLY B 1 239 ? -40.377 32.259  2.110   1.00 79.34  ? 456 GLY B C   1 
ATOM 3414 O O   . GLY B 1 239 ? -40.135 32.953  1.116   1.00 80.04  ? 456 GLY B O   1 
ATOM 3415 N N   . ALA B 1 240 ? -39.631 32.294  3.249   1.00 77.47  ? 457 ALA B N   1 
ATOM 3416 C CA  . ALA B 1 240 ? -38.518 33.218  3.453   1.00 80.18  ? 457 ALA B CA  1 
ATOM 3417 C C   . ALA B 1 240 ? -37.515 33.155  2.301   1.00 85.34  ? 457 ALA B C   1 
ATOM 3418 O O   . ALA B 1 240 ? -37.144 34.210  1.784   1.00 89.58  ? 457 ALA B O   1 
ATOM 3419 C CB  . ALA B 1 240 ? -37.828 32.946  4.777   1.00 82.27  ? 457 ALA B CB  1 
ATOM 3420 N N   . LEU B 1 241 ? -37.120 31.931  1.873   1.00 78.58  ? 458 LEU B N   1 
ATOM 3421 C CA  . LEU B 1 241 ? -36.200 31.698  0.753   1.00 78.26  ? 458 LEU B CA  1 
ATOM 3422 C C   . LEU B 1 241 ? -36.742 32.265  -0.574  1.00 81.57  ? 458 LEU B C   1 
ATOM 3423 O O   . LEU B 1 241 ? -35.979 32.876  -1.323  1.00 83.77  ? 458 LEU B O   1 
ATOM 3424 C CB  . LEU B 1 241 ? -35.898 30.196  0.603   1.00 75.63  ? 458 LEU B CB  1 
ATOM 3425 C CG  . LEU B 1 241 ? -34.613 29.665  1.237   1.00 80.45  ? 458 LEU B CG  1 
ATOM 3426 C CD1 . LEU B 1 241 ? -34.511 28.174  1.053   1.00 78.36  ? 458 LEU B CD1 1 
ATOM 3427 C CD2 . LEU B 1 241 ? -33.379 30.286  0.619   1.00 86.06  ? 458 LEU B CD2 1 
ATOM 3428 N N   . TYR B 1 242 ? -38.055 32.074  -0.852  1.00 75.53  ? 459 TYR B N   1 
ATOM 3429 C CA  . TYR B 1 242 ? -38.709 32.567  -2.066  1.00 76.42  ? 459 TYR B CA  1 
ATOM 3430 C C   . TYR B 1 242 ? -38.692 34.093  -2.124  1.00 86.10  ? 459 TYR B C   1 
ATOM 3431 O O   . TYR B 1 242 ? -38.472 34.668  -3.197  1.00 89.56  ? 459 TYR B O   1 
ATOM 3432 C CB  . TYR B 1 242 ? -40.141 32.027  -2.189  1.00 74.92  ? 459 TYR B CB  1 
ATOM 3433 C CG  . TYR B 1 242 ? -40.261 30.583  -2.640  1.00 74.29  ? 459 TYR B CG  1 
ATOM 3434 C CD1 . TYR B 1 242 ? -39.411 30.060  -3.613  1.00 78.35  ? 459 TYR B CD1 1 
ATOM 3435 C CD2 . TYR B 1 242 ? -41.283 29.767  -2.164  1.00 72.34  ? 459 TYR B CD2 1 
ATOM 3436 C CE1 . TYR B 1 242 ? -39.537 28.745  -4.057  1.00 78.78  ? 459 TYR B CE1 1 
ATOM 3437 C CE2 . TYR B 1 242 ? -41.430 28.454  -2.615  1.00 72.55  ? 459 TYR B CE2 1 
ATOM 3438 C CZ  . TYR B 1 242 ? -40.558 27.952  -3.570  1.00 79.02  ? 459 TYR B CZ  1 
ATOM 3439 O OH  . TYR B 1 242 ? -40.687 26.668  -4.036  1.00 73.65  ? 459 TYR B OH  1 
ATOM 3440 N N   . ARG B 1 243 ? -38.883 34.740  -0.948  1.00 83.85  ? 460 ARG B N   1 
ATOM 3441 C CA  . ARG B 1 243 ? -38.849 36.196  -0.726  1.00 87.79  ? 460 ARG B CA  1 
ATOM 3442 C C   . ARG B 1 243 ? -37.435 36.707  -1.051  1.00 93.74  ? 460 ARG B C   1 
ATOM 3443 O O   . ARG B 1 243 ? -37.301 37.712  -1.737  1.00 97.83  ? 460 ARG B O   1 
ATOM 3444 C CB  . ARG B 1 243 ? -39.209 36.480  0.739   1.00 90.18  ? 460 ARG B CB  1 
ATOM 3445 C CG  . ARG B 1 243 ? -39.682 37.888  1.051   1.00 106.12 ? 460 ARG B CG  1 
ATOM 3446 C CD  . ARG B 1 243 ? -40.534 37.871  2.307   1.00 115.12 ? 460 ARG B CD  1 
ATOM 3447 N NE  . ARG B 1 243 ? -41.902 37.458  2.003   1.00 122.87 ? 460 ARG B NE  1 
ATOM 3448 C CZ  . ARG B 1 243 ? -42.892 38.300  1.718   1.00 142.60 ? 460 ARG B CZ  1 
ATOM 3449 N NH1 . ARG B 1 243 ? -42.686 39.612  1.739   1.00 132.93 ? 460 ARG B NH1 1 
ATOM 3450 N NH2 . ARG B 1 243 ? -44.102 37.838  1.430   1.00 129.50 ? 460 ARG B NH2 1 
ATOM 3451 N N   . ARG B 1 244 ? -36.399 35.968  -0.606  1.00 89.36  ? 461 ARG B N   1 
ATOM 3452 C CA  . ARG B 1 244 ? -34.970 36.206  -0.850  1.00 93.81  ? 461 ARG B CA  1 
ATOM 3453 C C   . ARG B 1 244 ? -34.635 36.087  -2.355  1.00 99.11  ? 461 ARG B C   1 
ATOM 3454 O O   . ARG B 1 244 ? -33.748 36.787  -2.847  1.00 104.08 ? 461 ARG B O   1 
ATOM 3455 C CB  . ARG B 1 244 ? -34.134 35.224  0.015   1.00 93.84  ? 461 ARG B CB  1 
ATOM 3456 C CG  . ARG B 1 244 ? -32.649 35.032  -0.339  1.00 111.18 ? 461 ARG B CG  1 
ATOM 3457 C CD  . ARG B 1 244 ? -31.811 36.247  0.002   1.00 125.07 ? 461 ARG B CD  1 
ATOM 3458 N NE  . ARG B 1 244 ? -30.547 36.276  -0.733  1.00 135.47 ? 461 ARG B NE  1 
ATOM 3459 C CZ  . ARG B 1 244 ? -30.249 37.142  -1.700  1.00 158.79 ? 461 ARG B CZ  1 
ATOM 3460 N NH1 . ARG B 1 244 ? -31.129 38.067  -2.069  1.00 144.94 ? 461 ARG B NH1 1 
ATOM 3461 N NH2 . ARG B 1 244 ? -29.067 37.098  -2.297  1.00 159.74 ? 461 ARG B NH2 1 
ATOM 3462 N N   . GLN B 1 245 ? -35.369 35.235  -3.078  1.00 92.22  ? 462 GLN B N   1 
ATOM 3463 C CA  . GLN B 1 245 ? -35.192 35.019  -4.514  1.00 94.92  ? 462 GLN B CA  1 
ATOM 3464 C C   . GLN B 1 245 ? -36.000 36.024  -5.362  1.00 101.40 ? 462 GLN B C   1 
ATOM 3465 O O   . GLN B 1 245 ? -35.895 36.014  -6.590  1.00 104.55 ? 462 GLN B O   1 
ATOM 3466 C CB  . GLN B 1 245 ? -35.588 33.574  -4.882  1.00 92.36  ? 462 GLN B CB  1 
ATOM 3467 C CG  . GLN B 1 245 ? -34.610 32.512  -4.392  1.00 102.85 ? 462 GLN B CG  1 
ATOM 3468 C CD  . GLN B 1 245 ? -35.167 31.108  -4.450  1.00 120.74 ? 462 GLN B CD  1 
ATOM 3469 O OE1 . GLN B 1 245 ? -36.039 30.772  -5.272  1.00 112.10 ? 462 GLN B OE1 1 
ATOM 3470 N NE2 . GLN B 1 245 ? -34.629 30.239  -3.593  1.00 118.55 ? 462 GLN B NE2 1 
ATOM 3471 N N   . GLY B 1 246 ? -36.810 36.857  -4.712  1.00 97.18  ? 463 GLY B N   1 
ATOM 3472 C CA  . GLY B 1 246 ? -37.664 37.833  -5.390  1.00 100.36 ? 463 GLY B CA  1 
ATOM 3473 C C   . GLY B 1 246 ? -39.014 37.272  -5.817  1.00 101.32 ? 463 GLY B C   1 
ATOM 3474 O O   . GLY B 1 246 ? -39.848 37.997  -6.370  1.00 103.34 ? 463 GLY B O   1 
ATOM 3475 N N   . LYS B 1 247 ? -39.238 35.972  -5.542  1.00 92.83  ? 464 LYS B N   1 
ATOM 3476 C CA  . LYS B 1 247 ? -40.434 35.211  -5.869  1.00 89.90  ? 464 LYS B CA  1 
ATOM 3477 C C   . LYS B 1 247 ? -41.503 35.440  -4.797  1.00 94.07  ? 464 LYS B C   1 
ATOM 3478 O O   . LYS B 1 247 ? -41.885 34.508  -4.078  1.00 90.57  ? 464 LYS B O   1 
ATOM 3479 C CB  . LYS B 1 247 ? -40.089 33.711  -6.023  1.00 88.57  ? 464 LYS B CB  1 
ATOM 3480 C CG  . LYS B 1 247 ? -39.321 33.377  -7.297  1.00 100.44 ? 464 LYS B CG  1 
ATOM 3481 C CD  . LYS B 1 247 ? -38.835 31.947  -7.285  1.00 108.17 ? 464 LYS B CD  1 
ATOM 3482 C CE  . LYS B 1 247 ? -38.190 31.541  -8.584  1.00 122.80 ? 464 LYS B CE  1 
ATOM 3483 N NZ  . LYS B 1 247 ? -37.777 30.111  -8.562  1.00 130.34 ? 464 LYS B NZ  1 
ATOM 3484 N N   . LEU B 1 248 ? -41.979 36.693  -4.690  1.00 94.59  ? 465 LEU B N   1 
ATOM 3485 C CA  . LEU B 1 248 ? -42.977 37.117  -3.703  1.00 93.58  ? 465 LEU B CA  1 
ATOM 3486 C C   . LEU B 1 248 ? -44.327 36.449  -3.825  1.00 94.70  ? 465 LEU B C   1 
ATOM 3487 O O   . LEU B 1 248 ? -44.945 36.176  -2.797  1.00 92.36  ? 465 LEU B O   1 
ATOM 3488 C CB  . LEU B 1 248 ? -43.122 38.634  -3.652  1.00 99.01  ? 465 LEU B CB  1 
ATOM 3489 C CG  . LEU B 1 248 ? -42.055 39.321  -2.828  1.00 107.13 ? 465 LEU B CG  1 
ATOM 3490 C CD1 . LEU B 1 248 ? -41.284 40.314  -3.657  1.00 113.12 ? 465 LEU B CD1 1 
ATOM 3491 C CD2 . LEU B 1 248 ? -42.645 39.954  -1.593  1.00 112.46 ? 465 LEU B CD2 1 
ATOM 3492 N N   . GLU B 1 249 ? -44.787 36.166  -5.058  1.00 92.63  ? 466 GLU B N   1 
ATOM 3493 C CA  . GLU B 1 249 ? -46.055 35.463  -5.275  1.00 91.65  ? 466 GLU B CA  1 
ATOM 3494 C C   . GLU B 1 249 ? -45.951 34.035  -4.691  1.00 89.08  ? 466 GLU B C   1 
ATOM 3495 O O   . GLU B 1 249 ? -46.848 33.614  -3.961  1.00 87.42  ? 466 GLU B O   1 
ATOM 3496 C CB  . GLU B 1 249 ? -46.466 35.479  -6.769  1.00 97.18  ? 466 GLU B CB  1 
ATOM 3497 C CG  . GLU B 1 249 ? -47.838 34.880  -7.078  1.00 115.77 ? 466 GLU B CG  1 
ATOM 3498 C CD  . GLU B 1 249 ? -49.035 35.376  -6.279  1.00 148.15 ? 466 GLU B CD  1 
ATOM 3499 O OE1 . GLU B 1 249 ? -49.197 36.613  -6.147  1.00 151.72 ? 466 GLU B OE1 1 
ATOM 3500 O OE2 . GLU B 1 249 ? -49.815 34.521  -5.792  1.00 128.31 ? 466 GLU B OE2 1 
ATOM 3501 N N   . ALA B 1 250 ? -44.816 33.340  -4.955  1.00 82.60  ? 467 ALA B N   1 
ATOM 3502 C CA  . ALA B 1 250 ? -44.488 32.028  -4.423  1.00 78.32  ? 467 ALA B CA  1 
ATOM 3503 C C   . ALA B 1 250 ? -44.389 32.130  -2.921  1.00 80.32  ? 467 ALA B C   1 
ATOM 3504 O O   . ALA B 1 250 ? -44.890 31.257  -2.232  1.00 78.28  ? 467 ALA B O   1 
ATOM 3505 C CB  . ALA B 1 250 ? -43.162 31.552  -4.981  1.00 79.25  ? 467 ALA B CB  1 
ATOM 3506 N N   . ALA B 1 251 ? -43.760 33.205  -2.411  1.00 79.10  ? 468 ALA B N   1 
ATOM 3507 C CA  . ALA B 1 251 ? -43.600 33.447  -0.979  1.00 78.55  ? 468 ALA B CA  1 
ATOM 3508 C C   . ALA B 1 251 ? -44.947 33.655  -0.247  1.00 84.29  ? 468 ALA B C   1 
ATOM 3509 O O   . ALA B 1 251 ? -45.124 33.115  0.843   1.00 81.78  ? 468 ALA B O   1 
ATOM 3510 C CB  . ALA B 1 251 ? -42.667 34.625  -0.748  1.00 81.51  ? 468 ALA B CB  1 
ATOM 3511 N N   . HIS B 1 252 ? -45.895 34.411  -0.841  1.00 93.49  ? 469 HIS B N   1 
ATOM 3512 C CA  . HIS B 1 252 ? -47.205 34.643  -0.213  1.00 93.88  ? 469 HIS B CA  1 
ATOM 3513 C C   . HIS B 1 252 ? -48.002 33.360  -0.087  1.00 92.94  ? 469 HIS B C   1 
ATOM 3514 O O   . HIS B 1 252 ? -48.641 33.153  0.939   1.00 91.27  ? 469 HIS B O   1 
ATOM 3515 C CB  . HIS B 1 252 ? -48.015 35.733  -0.927  1.00 97.52  ? 469 HIS B CB  1 
ATOM 3516 C CG  . HIS B 1 252 ? -47.561 37.101  -0.546  1.00 105.15 ? 469 HIS B CG  1 
ATOM 3517 N ND1 . HIS B 1 252 ? -46.569 37.762  -1.261  1.00 110.73 ? 469 HIS B ND1 1 
ATOM 3518 C CD2 . HIS B 1 252 ? -47.923 37.873  0.508   1.00 108.72 ? 469 HIS B CD2 1 
ATOM 3519 C CE1 . HIS B 1 252 ? -46.398 38.932  -0.656  1.00 112.39 ? 469 HIS B CE1 1 
ATOM 3520 N NE2 . HIS B 1 252 ? -47.184 39.047  0.419   1.00 111.40 ? 469 HIS B NE2 1 
ATOM 3521 N N   . THR B 1 253 ? -47.906 32.479  -1.106  1.00 86.61  ? 470 THR B N   1 
ATOM 3522 C CA  . THR B 1 253 ? -48.602 31.190  -1.187  1.00 83.85  ? 470 THR B CA  1 
ATOM 3523 C C   . THR B 1 253 ? -48.287 30.281  0.011   1.00 85.93  ? 470 THR B C   1 
ATOM 3524 O O   . THR B 1 253 ? -49.195 29.620  0.528   1.00 84.74  ? 470 THR B O   1 
ATOM 3525 C CB  . THR B 1 253 ? -48.294 30.506  -2.533  1.00 84.26  ? 470 THR B CB  1 
ATOM 3526 O OG1 . THR B 1 253 ? -48.359 31.463  -3.583  1.00 88.08  ? 470 THR B OG1 1 
ATOM 3527 C CG2 . THR B 1 253 ? -49.239 29.382  -2.849  1.00 77.45  ? 470 THR B CG2 1 
ATOM 3528 N N   . LEU B 1 254 ? -47.010 30.264  0.452   1.00 81.89  ? 471 LEU B N   1 
ATOM 3529 C CA  . LEU B 1 254 ? -46.553 29.427  1.561   1.00 81.03  ? 471 LEU B CA  1 
ATOM 3530 C C   . LEU B 1 254 ? -46.830 30.055  2.895   1.00 88.21  ? 471 LEU B C   1 
ATOM 3531 O O   . LEU B 1 254 ? -47.322 29.367  3.792   1.00 88.69  ? 471 LEU B O   1 
ATOM 3532 C CB  . LEU B 1 254 ? -45.064 29.092  1.457   1.00 80.80  ? 471 LEU B CB  1 
ATOM 3533 C CG  . LEU B 1 254 ? -44.571 28.381  0.222   1.00 84.28  ? 471 LEU B CG  1 
ATOM 3534 C CD1 . LEU B 1 254 ? -43.191 27.988  0.429   1.00 85.30  ? 471 LEU B CD1 1 
ATOM 3535 C CD2 . LEU B 1 254 ? -45.360 27.119  -0.076  1.00 84.12  ? 471 LEU B CD2 1 
ATOM 3536 N N   . GLU B 1 255 ? -46.498 31.352  3.041   1.00 86.84  ? 472 GLU B N   1 
ATOM 3537 C CA  . GLU B 1 255 ? -46.702 32.114  4.275   1.00 87.50  ? 472 GLU B CA  1 
ATOM 3538 C C   . GLU B 1 255 ? -48.202 32.170  4.618   1.00 92.11  ? 472 GLU B C   1 
ATOM 3539 O O   . GLU B 1 255 ? -48.553 32.121  5.799   1.00 92.03  ? 472 GLU B O   1 
ATOM 3540 C CB  . GLU B 1 255 ? -46.063 33.519  4.179   1.00 90.11  ? 472 GLU B CB  1 
ATOM 3541 C CG  . GLU B 1 255 ? -44.540 33.500  4.083   1.00 102.96 ? 472 GLU B CG  1 
ATOM 3542 C CD  . GLU B 1 255 ? -43.826 34.779  3.676   1.00 120.86 ? 472 GLU B CD  1 
ATOM 3543 O OE1 . GLU B 1 255 ? -44.512 35.767  3.328   1.00 112.39 ? 472 GLU B OE1 1 
ATOM 3544 O OE2 . GLU B 1 255 ? -42.573 34.781  3.676   1.00 110.95 ? 472 GLU B OE2 1 
ATOM 3545 N N   . ASP B 1 256 ? -49.081 32.191  3.587   1.00 88.96  ? 473 ASP B N   1 
ATOM 3546 C CA  . ASP B 1 256 ? -50.526 32.170  3.794   1.00 89.32  ? 473 ASP B CA  1 
ATOM 3547 C C   . ASP B 1 256 ? -50.978 30.814  4.259   1.00 93.41  ? 473 ASP B C   1 
ATOM 3548 O O   . ASP B 1 256 ? -51.904 30.731  5.063   1.00 91.77  ? 473 ASP B O   1 
ATOM 3549 C CB  . ASP B 1 256 ? -51.300 32.543  2.529   1.00 91.89  ? 473 ASP B CB  1 
ATOM 3550 C CG  . ASP B 1 256 ? -52.793 32.616  2.766   1.00 102.77 ? 473 ASP B CG  1 
ATOM 3551 O OD1 . ASP B 1 256 ? -53.231 33.494  3.555   1.00 105.28 ? 473 ASP B OD1 1 
ATOM 3552 O OD2 . ASP B 1 256 ? -53.527 31.824  2.146   1.00 107.37 ? 473 ASP B OD2 1 
ATOM 3553 N N   . CYS B 1 257 ? -50.353 29.750  3.746   1.00 92.69  ? 474 CYS B N   1 
ATOM 3554 C CA  . CYS B 1 257 ? -50.728 28.431  4.196   1.00 94.77  ? 474 CYS B CA  1 
ATOM 3555 C C   . CYS B 1 257 ? -50.296 28.185  5.643   1.00 99.24  ? 474 CYS B C   1 
ATOM 3556 O O   . CYS B 1 257 ? -51.079 27.640  6.418   1.00 99.07  ? 474 CYS B O   1 
ATOM 3557 C CB  . CYS B 1 257 ? -50.240 27.338  3.261   1.00 96.66  ? 474 CYS B CB  1 
ATOM 3558 S SG  . CYS B 1 257 ? -50.778 25.686  3.769   1.00 102.92 ? 474 CYS B SG  1 
ATOM 3559 N N   . ALA B 1 258 ? -49.101 28.656  6.035   1.00 96.82  ? 475 ALA B N   1 
ATOM 3560 C CA  . ALA B 1 258 ? -48.627 28.516  7.413   1.00 98.32  ? 475 ALA B CA  1 
ATOM 3561 C C   . ALA B 1 258 ? -49.511 29.296  8.450   1.00 107.09 ? 475 ALA B C   1 
ATOM 3562 O O   . ALA B 1 258 ? -49.496 28.973  9.643   1.00 108.89 ? 475 ALA B O   1 
ATOM 3563 C CB  . ALA B 1 258 ? -47.164 28.923  7.509   1.00 98.87  ? 475 ALA B CB  1 
ATOM 3564 N N   . SER B 1 259 ? -50.328 30.266  7.972   1.00 104.01 ? 476 SER B N   1 
ATOM 3565 C CA  . SER B 1 259 ? -51.256 31.077  8.768   1.00 104.28 ? 476 SER B CA  1 
ATOM 3566 C C   . SER B 1 259 ? -52.578 30.323  9.096   1.00 109.91 ? 476 SER B C   1 
ATOM 3567 O O   . SER B 1 259 ? -53.427 30.840  9.824   1.00 110.34 ? 476 SER B O   1 
ATOM 3568 C CB  . SER B 1 259 ? -51.551 32.384  8.039   1.00 107.82 ? 476 SER B CB  1 
ATOM 3569 O OG  . SER B 1 259 ? -50.353 33.091  7.767   1.00 117.98 ? 476 SER B OG  1 
ATOM 3570 N N   . ARG B 1 260 ? -52.740 29.096  8.571   1.00 107.27 ? 477 ARG B N   1 
ATOM 3571 C CA  . ARG B 1 260 ? -53.920 28.256  8.808   1.00 122.46 ? 477 ARG B CA  1 
ATOM 3572 C C   . ARG B 1 260 ? -53.534 27.118  9.755   1.00 149.21 ? 477 ARG B C   1 
ATOM 3573 O O   . ARG B 1 260 ? -54.210 26.890  10.754  1.00 114.29 ? 477 ARG B O   1 
ATOM 3574 C CB  . ARG B 1 260 ? -54.464 27.675  7.489   1.00 120.84 ? 477 ARG B CB  1 
ATOM 3575 C CG  . ARG B 1 260 ? -54.942 28.689  6.448   1.00 124.38 ? 477 ARG B CG  1 
ATOM 3576 C CD  . ARG B 1 260 ? -55.293 27.958  5.161   1.00 130.73 ? 477 ARG B CD  1 
ATOM 3577 N NE  . ARG B 1 260 ? -54.772 28.631  3.965   1.00 138.92 ? 477 ARG B NE  1 
ATOM 3578 C CZ  . ARG B 1 260 ? -54.868 28.153  2.724   1.00 151.16 ? 477 ARG B CZ  1 
ATOM 3579 N NH1 . ARG B 1 260 ? -55.459 26.983  2.497   1.00 143.90 ? 477 ARG B NH1 1 
ATOM 3580 N NH2 . ARG B 1 260 ? -54.372 28.840  1.701   1.00 127.10 ? 477 ARG B NH2 1 
ATOM 3581 N N   . THR C 2 22  ? -18.482 13.686  70.689  1.00 138.05 ? 203 THR X N   1 
ATOM 3582 C CA  . THR C 2 22  ? -19.793 13.024  70.715  1.00 133.56 ? 203 THR X CA  1 
ATOM 3583 C C   . THR C 2 22  ? -20.797 13.535  69.646  1.00 132.20 ? 203 THR X C   1 
ATOM 3584 O O   . THR C 2 22  ? -20.663 14.666  69.166  1.00 132.29 ? 203 THR X O   1 
ATOM 3585 C CB  . THR C 2 22  ? -20.315 12.826  72.159  1.00 140.48 ? 203 THR X CB  1 
ATOM 3586 O OG1 . THR C 2 22  ? -21.703 12.483  72.140  1.00 133.11 ? 203 THR X OG1 1 
ATOM 3587 C CG2 . THR C 2 22  ? -20.077 14.030  73.053  1.00 140.77 ? 203 THR X CG2 1 
ATOM 3588 N N   . ASN C 2 23  ? -21.770 12.689  69.240  1.00 123.54 ? 204 ASN X N   1 
ATOM 3589 C CA  . ASN C 2 23  ? -22.746 13.053  68.200  1.00 118.05 ? 204 ASN X CA  1 
ATOM 3590 C C   . ASN C 2 23  ? -24.182 13.248  68.691  1.00 113.45 ? 204 ASN X C   1 
ATOM 3591 O O   . ASN C 2 23  ? -24.697 12.420  69.451  1.00 113.35 ? 204 ASN X O   1 
ATOM 3592 C CB  . ASN C 2 23  ? -22.694 12.086  67.008  1.00 121.74 ? 204 ASN X CB  1 
ATOM 3593 C CG  . ASN C 2 23  ? -21.296 11.838  66.491  1.00 159.31 ? 204 ASN X CG  1 
ATOM 3594 O OD1 . ASN C 2 23  ? -20.650 12.706  65.896  1.00 158.63 ? 204 ASN X OD1 1 
ATOM 3595 N ND2 . ASN C 2 23  ? -20.779 10.658  66.759  1.00 155.98 ? 204 ASN X ND2 1 
ATOM 3596 N N   . LEU C 2 24  ? -24.817 14.350  68.230  1.00 103.26 ? 205 LEU X N   1 
ATOM 3597 C CA  . LEU C 2 24  ? -26.178 14.762  68.564  1.00 99.39  ? 205 LEU X CA  1 
ATOM 3598 C C   . LEU C 2 24  ? -27.227 13.791  68.026  1.00 101.64 ? 205 LEU X C   1 
ATOM 3599 O O   . LEU C 2 24  ? -26.980 13.152  67.006  1.00 102.47 ? 205 LEU X O   1 
ATOM 3600 C CB  . LEU C 2 24  ? -26.429 16.178  68.017  1.00 97.83  ? 205 LEU X CB  1 
ATOM 3601 C CG  . LEU C 2 24  ? -26.242 17.357  68.994  1.00 102.75 ? 205 LEU X CG  1 
ATOM 3602 C CD1 . LEU C 2 24  ? -24.777 17.672  69.223  1.00 105.37 ? 205 LEU X CD1 1 
ATOM 3603 C CD2 . LEU C 2 24  ? -26.945 18.597  68.483  1.00 102.26 ? 205 LEU X CD2 1 
ATOM 3604 N N   . GLU C 2 25  ? -28.401 13.702  68.690  1.00 96.08  ? 206 GLU X N   1 
ATOM 3605 C CA  . GLU C 2 25  ? -29.518 12.828  68.311  1.00 94.87  ? 206 GLU X CA  1 
ATOM 3606 C C   . GLU C 2 25  ? -30.370 13.406  67.161  1.00 99.03  ? 206 GLU X C   1 
ATOM 3607 O O   . GLU C 2 25  ? -30.851 14.538  67.245  1.00 96.65  ? 206 GLU X O   1 
ATOM 3608 C CB  . GLU C 2 25  ? -30.400 12.550  69.535  1.00 96.12  ? 206 GLU X CB  1 
ATOM 3609 C CG  . GLU C 2 25  ? -31.147 11.227  69.505  1.00 105.37 ? 206 GLU X CG  1 
ATOM 3610 C CD  . GLU C 2 25  ? -32.375 11.174  70.398  1.00 136.93 ? 206 GLU X CD  1 
ATOM 3611 O OE1 . GLU C 2 25  ? -32.247 11.398  71.628  1.00 141.76 ? 206 GLU X OE1 1 
ATOM 3612 O OE2 . GLU C 2 25  ? -33.476 10.923  69.854  1.00 119.11 ? 206 GLU X OE2 1 
ATOM 3613 N N   . TRP C 2 26  ? -30.575 12.597  66.102  1.00 98.33  ? 207 TRP X N   1 
ATOM 3614 C CA  . TRP C 2 26  ? -31.366 12.947  64.918  1.00 98.65  ? 207 TRP X CA  1 
ATOM 3615 C C   . TRP C 2 26  ? -32.863 12.909  65.222  1.00 106.18 ? 207 TRP X C   1 
ATOM 3616 O O   . TRP C 2 26  ? -33.343 11.958  65.853  1.00 106.63 ? 207 TRP X O   1 
ATOM 3617 C CB  . TRP C 2 26  ? -31.046 11.968  63.782  1.00 97.83  ? 207 TRP X CB  1 
ATOM 3618 C CG  . TRP C 2 26  ? -31.477 12.398  62.407  1.00 98.86  ? 207 TRP X CG  1 
ATOM 3619 C CD1 . TRP C 2 26  ? -32.605 12.014  61.741  1.00 101.89 ? 207 TRP X CD1 1 
ATOM 3620 C CD2 . TRP C 2 26  ? -30.729 13.213  61.493  1.00 98.90  ? 207 TRP X CD2 1 
ATOM 3621 N NE1 . TRP C 2 26  ? -32.635 12.588  60.490  1.00 101.00 ? 207 TRP X NE1 1 
ATOM 3622 C CE2 . TRP C 2 26  ? -31.495 13.328  60.311  1.00 102.29 ? 207 TRP X CE2 1 
ATOM 3623 C CE3 . TRP C 2 26  ? -29.505 13.909  61.580  1.00 100.55 ? 207 TRP X CE3 1 
ATOM 3624 C CZ2 . TRP C 2 26  ? -31.069 14.086  59.215  1.00 102.29 ? 207 TRP X CZ2 1 
ATOM 3625 C CZ3 . TRP C 2 26  ? -29.084 14.660  60.491  1.00 102.39 ? 207 TRP X CZ3 1 
ATOM 3626 C CH2 . TRP C 2 26  ? -29.856 14.731  59.321  1.00 103.10 ? 207 TRP X CH2 1 
ATOM 3627 N N   . ASP C 2 27  ? -33.599 13.949  64.783  1.00 105.18 ? 208 ASP X N   1 
ATOM 3628 C CA  . ASP C 2 27  ? -35.050 14.034  64.947  1.00 106.61 ? 208 ASP X CA  1 
ATOM 3629 C C   . ASP C 2 27  ? -35.716 13.439  63.702  1.00 115.09 ? 208 ASP X C   1 
ATOM 3630 O O   . ASP C 2 27  ? -35.411 13.856  62.582  1.00 115.17 ? 208 ASP X O   1 
ATOM 3631 C CB  . ASP C 2 27  ? -35.502 15.484  65.194  1.00 108.51 ? 208 ASP X CB  1 
ATOM 3632 C CG  . ASP C 2 27  ? -36.902 15.578  65.755  1.00 119.76 ? 208 ASP X CG  1 
ATOM 3633 O OD1 . ASP C 2 27  ? -37.854 15.325  65.008  1.00 119.93 ? 208 ASP X OD1 1 
ATOM 3634 O OD2 . ASP C 2 27  ? -37.041 15.866  66.959  1.00 132.83 ? 208 ASP X OD2 1 
ATOM 3635 N N   . ASP C 2 28  ? -36.613 12.455  63.900  1.00 115.78 ? 209 ASP X N   1 
ATOM 3636 C CA  . ASP C 2 28  ? -37.288 11.735  62.818  1.00 119.00 ? 209 ASP X CA  1 
ATOM 3637 C C   . ASP C 2 28  ? -38.686 12.264  62.425  1.00 129.35 ? 209 ASP X C   1 
ATOM 3638 O O   . ASP C 2 28  ? -39.280 11.742  61.478  1.00 131.39 ? 209 ASP X O   1 
ATOM 3639 C CB  . ASP C 2 28  ? -37.290 10.218  63.091  1.00 121.33 ? 209 ASP X CB  1 
ATOM 3640 C CG  . ASP C 2 28  ? -35.911 9.624   63.357  1.00 132.16 ? 209 ASP X CG  1 
ATOM 3641 O OD1 . ASP C 2 28  ? -35.109 9.519   62.397  1.00 132.05 ? 209 ASP X OD1 1 
ATOM 3642 O OD2 . ASP C 2 28  ? -35.636 9.258   64.522  1.00 140.00 ? 209 ASP X OD2 1 
ATOM 3643 N N   . SER C 2 29  ? -39.187 13.319  63.118  1.00 128.28 ? 210 SER X N   1 
ATOM 3644 C CA  . SER C 2 29  ? -40.489 13.947  62.844  1.00 131.79 ? 210 SER X CA  1 
ATOM 3645 C C   . SER C 2 29  ? -40.585 14.454  61.407  1.00 141.12 ? 210 SER X C   1 
ATOM 3646 O O   . SER C 2 29  ? -41.631 14.291  60.774  1.00 143.93 ? 210 SER X O   1 
ATOM 3647 C CB  . SER C 2 29  ? -40.744 15.119  63.787  1.00 134.47 ? 210 SER X CB  1 
ATOM 3648 O OG  . SER C 2 29  ? -40.427 14.802  65.131  1.00 142.24 ? 210 SER X OG  1 
ATOM 3649 N N   . ALA C 2 30  ? -39.490 15.074  60.906  1.00 138.99 ? 211 ALA X N   1 
ATOM 3650 C CA  . ALA C 2 30  ? -39.350 15.661  59.564  1.00 141.88 ? 211 ALA X CA  1 
ATOM 3651 C C   . ALA C 2 30  ? -39.880 14.741  58.427  1.00 149.93 ? 211 ALA X C   1 
ATOM 3652 O O   . ALA C 2 30  ? -40.663 15.179  57.573  1.00 152.62 ? 211 ALA X O   1 
ATOM 3653 C CB  . ALA C 2 30  ? -37.891 16.042  59.325  1.00 140.48 ? 211 ALA X CB  1 
ATOM 3654 N N   . ILE C 2 31  ? -39.480 13.456  58.474  1.00 146.17 ? 212 ILE X N   1 
ATOM 3655 C CA  . ILE C 2 31  ? -39.871 12.398  57.542  1.00 147.98 ? 212 ILE X CA  1 
ATOM 3656 C C   . ILE C 2 31  ? -41.190 11.718  58.005  1.00 154.52 ? 212 ILE X C   1 
ATOM 3657 O O   . ILE C 2 31  ? -42.087 11.538  57.182  1.00 157.83 ? 212 ILE X O   1 
ATOM 3658 C CB  . ILE C 2 31  ? -38.678 11.418  57.280  1.00 148.81 ? 212 ILE X CB  1 
ATOM 3659 C CG1 . ILE C 2 31  ? -39.030 10.331  56.241  1.00 151.69 ? 212 ILE X CG1 1 
ATOM 3660 C CG2 . ILE C 2 31  ? -38.065 10.845  58.584  1.00 146.86 ? 212 ILE X CG2 1 
ATOM 3661 C CD1 . ILE C 2 31  ? -37.873 9.406   55.831  1.00 158.47 ? 212 ILE X CD1 1 
ATOM 3662 N N   . THR C 2 32  ? -41.323 11.409  59.329  1.00 149.31 ? 213 THR X N   1 
ATOM 3663 C CA  . THR C 2 32  ? -42.509 10.781  59.949  1.00 166.26 ? 213 THR X CA  1 
ATOM 3664 C C   . THR C 2 32  ? -43.031 11.596  61.142  1.00 179.50 ? 213 THR X C   1 
ATOM 3665 O O   . THR C 2 32  ? -43.947 12.409  61.007  1.00 137.92 ? 213 THR X O   1 
ATOM 3666 C CB  . THR C 2 32  ? -42.211 9.339   60.403  1.00 170.31 ? 213 THR X CB  1 
ATOM 3667 O OG1 . THR C 2 32  ? -41.048 9.327   61.234  1.00 165.22 ? 213 THR X OG1 1 
ATOM 3668 C CG2 . THR C 2 32  ? -42.050 8.368   59.240  1.00 168.98 ? 213 THR X CG2 1 
ATOM 3669 N N   . THR D 2 22  ? -30.001 27.732  22.170  1.00 129.75 ? 203 THR Y N   1 
ATOM 3670 C CA  . THR D 2 22  ? -30.895 26.565  22.166  1.00 126.70 ? 203 THR Y CA  1 
ATOM 3671 C C   . THR D 2 22  ? -30.503 25.435  23.152  1.00 127.90 ? 203 THR Y C   1 
ATOM 3672 O O   . THR D 2 22  ? -29.324 25.291  23.487  1.00 127.34 ? 203 THR Y O   1 
ATOM 3673 C CB  . THR D 2 22  ? -31.327 26.147  20.741  1.00 134.60 ? 203 THR Y CB  1 
ATOM 3674 O OG1 . THR D 2 22  ? -31.908 24.839  20.768  1.00 129.73 ? 203 THR Y OG1 1 
ATOM 3675 C CG2 . THR D 2 22  ? -30.191 26.217  19.725  1.00 134.78 ? 203 THR Y CG2 1 
ATOM 3676 N N   . ASN D 2 23  ? -31.504 24.660  23.637  1.00 122.10 ? 204 ASN Y N   1 
ATOM 3677 C CA  . ASN D 2 23  ? -31.304 23.608  24.639  1.00 118.57 ? 204 ASN Y CA  1 
ATOM 3678 C C   . ASN D 2 23  ? -31.434 22.162  24.149  1.00 119.64 ? 204 ASN Y C   1 
ATOM 3679 O O   . ASN D 2 23  ? -32.368 21.825  23.424  1.00 120.24 ? 204 ASN Y O   1 
ATOM 3680 C CB  . ASN D 2 23  ? -32.159 23.849  25.882  1.00 119.20 ? 204 ASN Y CB  1 
ATOM 3681 C CG  . ASN D 2 23  ? -32.123 25.261  26.404  1.00 148.08 ? 204 ASN Y CG  1 
ATOM 3682 O OD1 . ASN D 2 23  ? -33.089 26.008  26.253  1.00 144.82 ? 204 ASN Y OD1 1 
ATOM 3683 N ND2 . ASN D 2 23  ? -31.017 25.665  27.022  1.00 140.68 ? 204 ASN Y ND2 1 
ATOM 3684 N N   . LEU D 2 24  ? -30.488 21.309  24.592  1.00 112.20 ? 205 LEU Y N   1 
ATOM 3685 C CA  . LEU D 2 24  ? -30.369 19.876  24.295  1.00 109.00 ? 205 LEU Y CA  1 
ATOM 3686 C C   . LEU D 2 24  ? -31.540 19.070  24.872  1.00 110.60 ? 205 LEU Y C   1 
ATOM 3687 O O   . LEU D 2 24  ? -32.091 19.451  25.902  1.00 110.71 ? 205 LEU Y O   1 
ATOM 3688 C CB  . LEU D 2 24  ? -29.056 19.352  24.900  1.00 107.84 ? 205 LEU Y CB  1 
ATOM 3689 C CG  . LEU D 2 24  ? -27.820 19.280  24.028  1.00 112.83 ? 205 LEU Y CG  1 
ATOM 3690 C CD1 . LEU D 2 24  ? -27.211 20.649  23.835  1.00 115.11 ? 205 LEU Y CD1 1 
ATOM 3691 C CD2 . LEU D 2 24  ? -26.780 18.380  24.668  1.00 112.72 ? 205 LEU Y CD2 1 
ATOM 3692 N N   . GLU D 2 25  ? -31.880 17.934  24.236  1.00 105.94 ? 206 GLU Y N   1 
ATOM 3693 C CA  . GLU D 2 25  ? -32.952 17.027  24.657  1.00 105.19 ? 206 GLU Y CA  1 
ATOM 3694 C C   . GLU D 2 25  ? -32.499 16.052  25.777  1.00 109.86 ? 206 GLU Y C   1 
ATOM 3695 O O   . GLU D 2 25  ? -31.499 15.340  25.634  1.00 109.95 ? 206 GLU Y O   1 
ATOM 3696 C CB  . GLU D 2 25  ? -33.479 16.239  23.456  1.00 106.85 ? 206 GLU Y CB  1 
ATOM 3697 C CG  . GLU D 2 25  ? -34.922 15.774  23.571  1.00 122.04 ? 206 GLU Y CG  1 
ATOM 3698 C CD  . GLU D 2 25  ? -35.275 14.604  22.669  1.00 154.77 ? 206 GLU Y CD  1 
ATOM 3699 O OE1 . GLU D 2 25  ? -35.136 14.732  21.429  1.00 146.85 ? 206 GLU Y OE1 1 
ATOM 3700 O OE2 . GLU D 2 25  ? -35.675 13.546  23.210  1.00 161.64 ? 206 GLU Y OE2 1 
ATOM 3701 N N   . TRP D 2 26  ? -33.265 16.020  26.877  1.00 106.32 ? 207 TRP Y N   1 
ATOM 3702 C CA  . TRP D 2 26  ? -33.045 15.181  28.059  1.00 106.06 ? 207 TRP Y CA  1 
ATOM 3703 C C   . TRP D 2 26  ? -33.395 13.712  27.770  1.00 110.61 ? 207 TRP Y C   1 
ATOM 3704 O O   . TRP D 2 26  ? -34.429 13.431  27.143  1.00 110.84 ? 207 TRP Y O   1 
ATOM 3705 C CB  . TRP D 2 26  ? -33.938 15.710  29.191  1.00 105.06 ? 207 TRP Y CB  1 
ATOM 3706 C CG  . TRP D 2 26  ? -33.629 15.212  30.563  1.00 106.14 ? 207 TRP Y CG  1 
ATOM 3707 C CD1 . TRP D 2 26  ? -34.267 14.211  31.231  1.00 109.72 ? 207 TRP Y CD1 1 
ATOM 3708 C CD2 . TRP D 2 26  ? -32.718 15.799  31.497  1.00 105.94 ? 207 TRP Y CD2 1 
ATOM 3709 N NE1 . TRP D 2 26  ? -33.760 14.089  32.505  1.00 109.48 ? 207 TRP Y NE1 1 
ATOM 3710 C CE2 . TRP D 2 26  ? -32.810 15.055  32.699  1.00 110.27 ? 207 TRP Y CE2 1 
ATOM 3711 C CE3 . TRP D 2 26  ? -31.806 16.866  31.431  1.00 107.06 ? 207 TRP Y CE3 1 
ATOM 3712 C CZ2 . TRP D 2 26  ? -32.037 15.354  33.831  1.00 109.38 ? 207 TRP Y CZ2 1 
ATOM 3713 C CZ3 . TRP D 2 26  ? -31.038 17.161  32.553  1.00 108.44 ? 207 TRP Y CZ3 1 
ATOM 3714 C CH2 . TRP D 2 26  ? -31.155 16.408  33.734  1.00 109.14 ? 207 TRP Y CH2 1 
ATOM 3715 N N   . ASP D 2 27  ? -32.540 12.780  28.233  1.00 107.09 ? 208 ASP Y N   1 
ATOM 3716 C CA  . ASP D 2 27  ? -32.786 11.341  28.100  1.00 107.95 ? 208 ASP Y CA  1 
ATOM 3717 C C   . ASP D 2 27  ? -33.537 10.841  29.364  1.00 115.02 ? 208 ASP Y C   1 
ATOM 3718 O O   . ASP D 2 27  ? -33.083 11.073  30.490  1.00 113.87 ? 208 ASP Y O   1 
ATOM 3719 C CB  . ASP D 2 27  ? -31.479 10.574  27.886  1.00 110.18 ? 208 ASP Y CB  1 
ATOM 3720 C CG  . ASP D 2 27  ? -31.679 9.155   27.393  1.00 122.11 ? 208 ASP Y CG  1 
ATOM 3721 O OD1 . ASP D 2 27  ? -32.115 8.306   28.192  1.00 124.09 ? 208 ASP Y OD1 1 
ATOM 3722 O OD2 . ASP D 2 27  ? -31.389 8.895   26.210  1.00 129.49 ? 208 ASP Y OD2 1 
ATOM 3723 N N   . ASP D 2 28  ? -34.695 10.184  29.165  1.00 114.61 ? 209 ASP Y N   1 
ATOM 3724 C CA  . ASP D 2 28  ? -35.572 9.715   30.243  1.00 116.46 ? 209 ASP Y CA  1 
ATOM 3725 C C   . ASP D 2 28  ? -35.391 8.246   30.665  1.00 124.76 ? 209 ASP Y C   1 
ATOM 3726 O O   . ASP D 2 28  ? -36.061 7.804   31.609  1.00 125.99 ? 209 ASP Y O   1 
ATOM 3727 C CB  . ASP D 2 28  ? -37.048 10.040  29.928  1.00 118.37 ? 209 ASP Y CB  1 
ATOM 3728 C CG  . ASP D 2 28  ? -37.309 11.502  29.616  1.00 129.46 ? 209 ASP Y CG  1 
ATOM 3729 O OD1 . ASP D 2 28  ? -37.256 12.327  30.555  1.00 130.28 ? 209 ASP Y OD1 1 
ATOM 3730 O OD2 . ASP D 2 28  ? -37.570 11.821  28.425  1.00 136.61 ? 209 ASP Y OD2 1 
ATOM 3731 N N   . SER D 2 29  ? -34.471 7.503   30.002  1.00 123.34 ? 210 SER Y N   1 
ATOM 3732 C CA  . SER D 2 29  ? -34.179 6.096   30.312  1.00 126.46 ? 210 SER Y CA  1 
ATOM 3733 C C   . SER D 2 29  ? -33.737 5.912   31.772  1.00 134.50 ? 210 SER Y C   1 
ATOM 3734 O O   . SER D 2 29  ? -34.165 4.949   32.421  1.00 136.30 ? 210 SER Y O   1 
ATOM 3735 C CB  . SER D 2 29  ? -33.085 5.552   29.400  1.00 130.31 ? 210 SER Y CB  1 
ATOM 3736 O OG  . SER D 2 29  ? -33.286 5.912   28.046  1.00 141.81 ? 210 SER Y OG  1 
ATOM 3737 N N   . ALA D 2 30  ? -32.882 6.845   32.269  1.00 131.54 ? 211 ALA Y N   1 
ATOM 3738 C CA  . ALA D 2 30  ? -32.301 6.892   33.615  1.00 133.21 ? 211 ALA Y CA  1 
ATOM 3739 C C   . ALA D 2 30  ? -33.338 6.618   34.740  1.00 141.02 ? 211 ALA Y C   1 
ATOM 3740 O O   . ALA D 2 30  ? -33.101 5.780   35.620  1.00 142.08 ? 211 ALA Y O   1 
ATOM 3741 C CB  . ALA D 2 30  ? -31.607 8.237   33.826  1.00 131.80 ? 211 ALA Y CB  1 
ATOM 3742 N N   . ILE D 2 31  ? -34.503 7.295   34.656  1.00 138.45 ? 212 ILE Y N   1 
ATOM 3743 C CA  . ILE D 2 31  ? -35.630 7.181   35.581  1.00 175.08 ? 212 ILE Y CA  1 
ATOM 3744 C C   . ILE D 2 31  ? -36.586 6.057   35.132  1.00 196.22 ? 212 ILE Y C   1 
ATOM 3745 O O   . ILE D 2 31  ? -36.978 5.216   35.941  1.00 155.77 ? 212 ILE Y O   1 
ATOM 3746 C CB  . ILE D 2 31  ? -36.324 8.569   35.790  1.00 176.89 ? 212 ILE Y CB  1 
ATOM 3747 C CG1 . ILE D 2 31  ? -37.487 8.488   36.810  1.00 179.81 ? 212 ILE Y CG1 1 
ATOM 3748 C CG2 . ILE D 2 31  ? -36.734 9.247   34.457  1.00 175.61 ? 212 ILE Y CG2 1 
ATOM 3749 C CD1 . ILE D 2 31  ? -38.138 9.818   37.206  1.00 186.91 ? 212 ILE Y CD1 1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . HIS A 19  ? 1.9464 2.1597 1.3154 0.0606  -0.1904 -0.0431 236 HIS A N   
2    C CA  . HIS A 19  ? 1.9473 2.1722 1.3294 0.0566  -0.1899 -0.0430 236 HIS A CA  
3    C C   . HIS A 19  ? 1.9914 2.2024 1.3644 0.0500  -0.1868 -0.0488 236 HIS A C   
4    O O   . HIS A 19  ? 1.9882 2.1899 1.3484 0.0464  -0.1902 -0.0527 236 HIS A O   
5    C CB  . HIS A 19  ? 1.9585 2.2037 1.3502 0.0510  -0.1998 -0.0426 236 HIS A CB  
6    C CG  . HIS A 19  ? 2.0074 2.2630 1.4077 0.0433  -0.1995 -0.0438 236 HIS A CG  
7    N ND1 . HIS A 19  ? 2.0342 2.3081 1.4508 0.0460  -0.1954 -0.0378 236 HIS A ND1 
8    C CD2 . HIS A 19  ? 2.0340 2.2828 1.4268 0.0332  -0.2017 -0.0501 236 HIS A CD2 
9    C CE1 . HIS A 19  ? 2.0288 2.3071 1.4471 0.0357  -0.1963 -0.0415 236 HIS A CE1 
10   N NE2 . HIS A 19  ? 2.0340 2.2956 1.4371 0.0278  -0.1994 -0.0492 236 HIS A NE2 
11   N N   . PRO A 20  ? 1.9401 2.1517 1.3202 0.0488  -0.1803 -0.0484 237 PRO A N   
12   C CA  . PRO A 20  ? 1.9322 2.1313 1.3035 0.0430  -0.1770 -0.0530 237 PRO A CA  
13   C C   . PRO A 20  ? 1.9556 2.1530 1.3209 0.0366  -0.1825 -0.0571 237 PRO A C   
14   O O   . PRO A 20  ? 1.9553 2.1416 1.3092 0.0348  -0.1801 -0.0589 237 PRO A O   
15   C CB  . PRO A 20  ? 1.9573 2.1594 1.3394 0.0433  -0.1694 -0.0513 237 PRO A CB  
16   C CG  . PRO A 20  ? 2.0146 2.2374 1.4137 0.0476  -0.1713 -0.0458 237 PRO A CG  
17   C CD  . PRO A 20  ? 1.9613 2.1851 1.3570 0.0539  -0.1745 -0.0426 237 PRO A CD  
18   N N   . ASP A 21  ? 1.8872 2.0950 1.2579 0.0327  -0.1886 -0.0579 238 ASP A N   
19   C CA  . ASP A 21  ? 1.8762 2.0761 1.2365 0.0265  -0.1906 -0.0619 238 ASP A CA  
20   C C   . ASP A 21  ? 1.8732 2.0637 1.2198 0.0294  -0.1937 -0.0623 238 ASP A C   
21   O O   . ASP A 21  ? 1.8671 2.0461 1.2018 0.0280  -0.1917 -0.0638 238 ASP A O   
22   C CB  . ASP A 21  ? 1.9068 2.1176 1.2721 0.0179  -0.1942 -0.0633 238 ASP A CB  
23   C CG  . ASP A 21  ? 2.0277 2.2488 1.4042 0.0131  -0.1906 -0.0630 238 ASP A CG  
24   O OD1 . ASP A 21  ? 2.0274 2.2367 1.3998 0.0121  -0.1843 -0.0653 238 ASP A OD1 
25   O OD2 . ASP A 21  ? 2.0862 2.3297 1.4757 0.0100  -0.1940 -0.0598 238 ASP A OD2 
26   N N   . VAL A 22  ? 1.7909 1.9855 1.1381 0.0342  -0.1973 -0.0602 239 VAL A N   
27   C CA  . VAL A 22  ? 1.7715 1.9602 1.1065 0.0369  -0.2005 -0.0601 239 VAL A CA  
28   C C   . VAL A 22  ? 1.8010 1.9818 1.1255 0.0384  -0.1953 -0.0590 239 VAL A C   
29   O O   . VAL A 22  ? 1.8002 1.9768 1.1143 0.0394  -0.1955 -0.0581 239 VAL A O   
30   C CB  . VAL A 22  ? 1.8077 2.0019 1.1448 0.0409  -0.2045 -0.0583 239 VAL A CB  
31   C CG1 . VAL A 22  ? 1.7993 1.9888 1.1235 0.0423  -0.2084 -0.0587 239 VAL A CG1 
32   C CG2 . VAL A 22  ? 1.8045 2.0122 1.1542 0.0401  -0.2093 -0.0569 239 VAL A CG2 
33   N N   . ALA A 23  ? 1.7311 1.9111 1.0581 0.0381  -0.1898 -0.0582 240 ALA A N   
34   C CA  . ALA A 23  ? 1.7193 1.8953 1.0366 0.0366  -0.1846 -0.0566 240 ALA A CA  
35   C C   . ALA A 23  ? 1.7538 1.9270 1.0684 0.0360  -0.1819 -0.0560 240 ALA A C   
36   O O   . ALA A 23  ? 1.7430 1.9175 1.0475 0.0369  -0.1802 -0.0524 240 ALA A O   
37   C CB  . ALA A 23  ? 1.7288 1.9012 1.0486 0.0345  -0.1779 -0.0567 240 ALA A CB  
38   N N   . THR A 24  ? 1.7053 1.8759 1.0277 0.0345  -0.1809 -0.0586 241 THR A N   
39   C CA  . THR A 24  ? 1.7037 1.8665 1.0212 0.0336  -0.1764 -0.0587 241 THR A CA  
40   C C   . THR A 24  ? 1.7363 1.8930 1.0420 0.0372  -0.1770 -0.0569 241 THR A C   
41   O O   . THR A 24  ? 1.7413 1.8920 1.0375 0.0408  -0.1714 -0.0532 241 THR A O   
42   C CB  . THR A 24  ? 1.8243 1.9857 1.1507 0.0283  -0.1748 -0.0628 241 THR A CB  
43   O OG1 . THR A 24  ? 1.8409 2.0102 1.1797 0.0273  -0.1743 -0.0630 241 THR A OG1 
44   C CG2 . THR A 24  ? 1.8079 1.9581 1.1275 0.0265  -0.1677 -0.0634 241 THR A CG2 
45   N N   . MET A 25  ? 1.6746 1.8327 0.9802 0.0370  -0.1828 -0.0586 242 MET A N   
46   C CA  . MET A 25  ? 1.6706 1.8214 0.9644 0.0404  -0.1829 -0.0571 242 MET A CA  
47   C C   . MET A 25  ? 1.6730 1.8303 0.9597 0.0474  -0.1827 -0.0507 242 MET A C   
48   O O   . MET A 25  ? 1.6728 1.8246 0.9488 0.0534  -0.1773 -0.0457 242 MET A O   
49   C CB  . MET A 25  ? 1.7030 1.8564 0.9996 0.0369  -0.1901 -0.0605 242 MET A CB  
50   C CG  . MET A 25  ? 1.7623 1.9142 1.0635 0.0278  -0.1907 -0.0653 242 MET A CG  
51   S SD  . MET A 25  ? 1.8243 1.9817 1.1260 0.0224  -0.1991 -0.0676 242 MET A SD  
52   C CE  . MET A 25  ? 1.7691 1.9498 1.0924 0.0204  -0.2053 -0.0668 242 MET A CE  
53   N N   . LEU A 26  ? 1.5924 1.7616 0.8836 0.0463  -0.1874 -0.0502 243 LEU A N   
54   C CA  . LEU A 26  ? 1.5747 1.7546 0.8582 0.0487  -0.1880 -0.0446 243 LEU A CA  
55   C C   . LEU A 26  ? 1.6272 1.8115 0.9066 0.0499  -0.1814 -0.0388 243 LEU A C   
56   O O   . LEU A 26  ? 1.6251 1.8192 0.8964 0.0546  -0.1797 -0.0309 243 LEU A O   
57   C CB  . LEU A 26  ? 1.5624 1.7485 0.8478 0.0438  -0.1918 -0.0469 243 LEU A CB  
58   C CG  . LEU A 26  ? 1.5987 1.7839 0.8860 0.0440  -0.1983 -0.0504 243 LEU A CG  
59   C CD1 . LEU A 26  ? 1.5897 1.7730 0.8831 0.0409  -0.1980 -0.0536 243 LEU A CD1 
60   C CD2 . LEU A 26  ? 1.6266 1.8193 0.9031 0.0446  -0.2015 -0.0474 243 LEU A CD2 
61   N N   . ASN A 27  ? 1.5863 1.7655 0.8719 0.0461  -0.1776 -0.0416 244 ASN A N   
62   C CA  . ASN A 27  ? 1.5906 1.7726 0.8733 0.0462  -0.1712 -0.0367 244 ASN A CA  
63   C C   . ASN A 27  ? 1.6427 1.8174 0.9188 0.0545  -0.1651 -0.0316 244 ASN A C   
64   O O   . ASN A 27  ? 1.6443 1.8287 0.9141 0.0595  -0.1607 -0.0223 244 ASN A O   
65   C CB  . ASN A 27  ? 1.5992 1.7746 0.8904 0.0401  -0.1684 -0.0422 244 ASN A CB  
66   C CG  . ASN A 27  ? 1.9874 2.1684 1.2752 0.0371  -0.1632 -0.0378 244 ASN A CG  
67   O OD1 . ASN A 27  ? 1.9963 2.1744 1.2814 0.0408  -0.1579 -0.0340 244 ASN A OD1 
68   N ND2 . ASN A 27  ? 1.9079 2.0954 1.1934 0.0298  -0.1636 -0.0382 244 ASN A ND2 
69   N N   . ILE A 28  ? 1.7622 1.6893 0.6118 -0.0033 -0.0292 0.0949  245 ILE A N   
70   C CA  . ILE A 28  ? 1.7940 1.6764 0.6155 -0.0214 -0.0339 0.0835  245 ILE A CA  
71   C C   . ILE A 28  ? 1.8263 1.6768 0.6545 -0.0018 -0.0303 0.0695  245 ILE A C   
72   O O   . ILE A 28  ? 1.8388 1.6381 0.6577 0.0046  -0.0370 0.0593  245 ILE A O   
73   C CB  . ILE A 28  ? 1.8610 1.7721 0.6578 -0.0517 -0.0346 0.0808  245 ILE A CB  
74   C CG1 . ILE A 28  ? 1.8897 1.8155 0.6653 -0.0832 -0.0410 0.0862  245 ILE A CG1 
75   C CG2 . ILE A 28  ? 1.9122 1.7814 0.6820 -0.0642 -0.0335 0.0623  245 ILE A CG2 
76   C CD1 . ILE A 28  ? 2.0331 2.0395 0.8031 -0.1075 -0.0398 0.0883  245 ILE A CD1 
77   N N   . LEU A 29  ? 1.7733 1.6572 0.6158 0.0079  -0.0218 0.0689  246 LEU A N   
78   C CA  . LEU A 29  ? 1.7869 1.6658 0.6371 0.0204  -0.0156 0.0514  246 LEU A CA  
79   C C   . LEU A 29  ? 1.8531 1.7261 0.7240 0.0407  -0.0146 0.0521  246 LEU A C   
80   O O   . LEU A 29  ? 1.8735 1.7471 0.7537 0.0538  -0.0122 0.0325  246 LEU A O   
81   C CB  . LEU A 29  ? 1.7808 1.7014 0.6269 0.0094  -0.0079 0.0505  246 LEU A CB  
82   C CG  . LEU A 29  ? 1.8609 1.7910 0.7061 0.0088  0.0003  0.0208  246 LEU A CG  
83   C CD1 . LEU A 29  ? 1.9095 1.8086 0.7386 0.0035  -0.0014 -0.0042 246 LEU A CD1 
84   C CD2 . LEU A 29  ? 1.8926 1.8703 0.7286 -0.0106 0.0072  0.0246  246 LEU A CD2 
85   N N   . ALA A 30  ? 1.7826 1.6578 0.6615 0.0431  -0.0159 0.0707  247 ALA A N   
86   C CA  . ALA A 30  ? 1.7538 1.6264 0.6474 0.0547  -0.0142 0.0720  247 ALA A CA  
87   C C   . ALA A 30  ? 1.8089 1.6517 0.7034 0.0638  -0.0253 0.0654  247 ALA A C   
88   O O   . ALA A 30  ? 1.8131 1.6627 0.7213 0.0786  -0.0261 0.0567  247 ALA A O   
89   C CB  . ALA A 30  ? 1.7440 1.6221 0.6415 0.0526  -0.0122 0.0883  247 ALA A CB  
90   N N   . LEU A 31  ? 1.7832 1.5940 0.6584 0.0526  -0.0361 0.0704  248 LEU A N   
91   C CA  . LEU A 31  ? 1.8227 1.5832 0.6838 0.0567  -0.0533 0.0705  248 LEU A CA  
92   C C   . LEU A 31  ? 1.9171 1.6511 0.7796 0.0808  -0.0586 0.0473  248 LEU A C   
93   O O   . LEU A 31  ? 1.9412 1.6455 0.8070 0.1034  -0.0735 0.0442  248 LEU A O   
94   C CB  . LEU A 31  ? 1.8537 1.5826 0.6798 0.0263  -0.0631 0.0814  248 LEU A CB  
95   C CG  . LEU A 31  ? 1.8786 1.6463 0.7057 0.0035  -0.0591 0.0973  248 LEU A CG  
96   C CD1 . LEU A 31  ? 1.8977 1.6803 0.7000 -0.0281 -0.0587 0.0988  248 LEU A CD1 
97   C CD2 . LEU A 31  ? 1.9108 1.6580 0.7280 -0.0059 -0.0719 0.1105  248 LEU A CD2 
98   N N   . VAL A 32  ? 1.8817 1.6329 0.7429 0.0779  -0.0473 0.0294  249 VAL A N   
99   C CA  . VAL A 32  ? 1.9212 1.6635 0.7871 0.0999  -0.0469 -0.0027 249 VAL A CA  
100  C C   . VAL A 32  ? 1.9459 1.7387 0.8485 0.1289  -0.0426 -0.0167 249 VAL A C   
101  O O   . VAL A 32  ? 1.9800 1.7554 0.8941 0.1629  -0.0546 -0.0357 249 VAL A O   
102  C CB  . VAL A 32  ? 1.9719 1.7427 0.8275 0.0791  -0.0318 -0.0177 249 VAL A CB  
103  C CG1 . VAL A 32  ? 1.9940 1.7830 0.8619 0.0995  -0.0248 -0.0583 249 VAL A CG1 
104  C CG2 . VAL A 32  ? 2.0078 1.7350 0.8245 0.0491  -0.0373 -0.0099 249 VAL A CG2 
105  N N   . TYR A 33  ? 1.8449 1.6987 0.7619 0.1149  -0.0273 -0.0073 250 TYR A N   
106  C CA  . TYR A 33  ? 1.8230 1.7364 0.7659 0.1268  -0.0201 -0.0189 250 TYR A CA  
107  C C   . TYR A 33  ? 1.8814 1.7868 0.8375 0.1449  -0.0336 -0.0070 250 TYR A C   
108  O O   . TYR A 33  ? 1.8846 1.8302 0.8648 0.1702  -0.0373 -0.0260 250 TYR A O   
109  C CB  . TYR A 33  ? 1.8066 1.7624 0.7435 0.0968  -0.0034 -0.0062 250 TYR A CB  
110  C CG  . TYR A 33  ? 1.8514 1.8457 0.7799 0.0797  0.0093  -0.0237 250 TYR A CG  
111  C CD1 . TYR A 33  ? 1.8802 1.9409 0.8224 0.0811  0.0191  -0.0545 250 TYR A CD1 
112  C CD2 . TYR A 33  ? 1.8727 1.8506 0.7786 0.0579  0.0113  -0.0097 250 TYR A CD2 
113  C CE1 . TYR A 33  ? 1.9047 2.0098 0.8341 0.0562  0.0315  -0.0713 250 TYR A CE1 
114  C CE2 . TYR A 33  ? 1.8966 1.9141 0.7897 0.0357  0.0213  -0.0221 250 TYR A CE2 
115  C CZ  . TYR A 33  ? 1.9974 2.0763 0.9002 0.0322  0.0318  -0.0531 250 TYR A CZ  
116  O OH  . TYR A 33  ? 2.0117 2.1381 0.8973 0.0020  0.0422  -0.0664 250 TYR A OH  
117  N N   . ARG A 34  ? 1.8387 1.7034 0.7795 0.1304  -0.0414 0.0224  251 ARG A N   
118  C CA  . ARG A 34  ? 1.8404 1.6957 0.7855 0.1368  -0.0554 0.0389  251 ARG A CA  
119  C C   . ARG A 34  ? 1.9488 1.7665 0.8959 0.1717  -0.0801 0.0302  251 ARG A C   
120  O O   . ARG A 34  ? 1.9512 1.7990 0.9186 0.1946  -0.0906 0.0280  251 ARG A O   
121  C CB  . ARG A 34  ? 1.8282 1.6497 0.7509 0.1085  -0.0581 0.0660  251 ARG A CB  
122  C CG  . ARG A 34  ? 1.8827 1.6965 0.8024 0.1043  -0.0726 0.0846  251 ARG A CG  
123  C CD  . ARG A 34  ? 1.8475 1.6244 0.7382 0.0751  -0.0806 0.1045  251 ARG A CD  
124  N NE  . ARG A 34  ? 1.9020 1.6143 0.7626 0.0736  -0.0978 0.1058  251 ARG A NE  
125  C CZ  . ARG A 34  ? 2.1304 1.8035 0.9541 0.0425  -0.1107 0.1228  251 ARG A CZ  
126  N NH1 . ARG A 34  ? 1.9660 1.6698 0.7850 0.0131  -0.1075 0.1373  251 ARG A NH1 
127  N NH2 . ARG A 34  ? 1.9808 1.5852 0.7674 0.0353  -0.1261 0.1227  251 ARG A NH2 
128  N N   . ASP A 35  ? 1.9572 1.7077 0.8803 0.1760  -0.0906 0.0243  252 ASP A N   
129  C CA  . ASP A 35  ? 2.0358 1.7194 0.9483 0.2109  -0.1178 0.0156  252 ASP A CA  
130  C C   . ASP A 35  ? 2.0993 1.8270 1.0486 0.2602  -0.1179 -0.0235 252 ASP A C   
131  O O   . ASP A 35  ? 2.1571 1.8501 1.1119 0.3043  -0.1443 -0.0303 252 ASP A O   
132  C CB  . ASP A 35  ? 2.1240 1.7147 0.9887 0.1909  -0.1265 0.0187  252 ASP A CB  
133  C CG  . ASP A 35  ? 2.3110 1.8582 1.1355 0.1462  -0.1360 0.0558  252 ASP A CG  
134  O OD1 . ASP A 35  ? 2.2693 1.8721 1.1080 0.1253  -0.1259 0.0748  252 ASP A OD1 
135  O OD2 . ASP A 35  ? 2.4708 1.9307 1.2461 0.1281  -0.1524 0.0627  252 ASP A OD2 
136  N N   . GLN A 36  ? 2.0083 1.8177 0.9816 0.2528  -0.0905 -0.0491 253 GLN A N   
137  C CA  . GLN A 36  ? 2.0119 1.8944 1.0232 0.2906  -0.0848 -0.0927 253 GLN A CA  
138  C C   . GLN A 36  ? 1.9985 1.9836 1.0433 0.2919  -0.0782 -0.0907 253 GLN A C   
139  O O   . GLN A 36  ? 1.9883 2.0664 1.0665 0.3119  -0.0687 -0.1272 253 GLN A O   
140  C CB  . GLN A 36  ? 2.0153 1.9352 1.0250 0.2710  -0.0591 -0.1236 253 GLN A CB  
141  C CG  . GLN A 36  ? 2.2942 2.1514 1.2918 0.2979  -0.0671 -0.1572 253 GLN A CG  
142  C CD  . GLN A 36  ? 2.6013 2.5487 1.6290 0.3140  -0.0483 -0.2125 253 GLN A CD  
143  O OE1 . GLN A 36  ? 2.5468 2.5447 1.5661 0.2734  -0.0236 -0.2224 253 GLN A OE1 
144  N NE2 . GLN A 36  ? 2.5336 2.5092 1.5966 0.3741  -0.0611 -0.2507 253 GLN A NE2 
145  N N   . ASN A 37  ? 1.9172 1.8915 0.9506 0.2664  -0.0822 -0.0515 254 ASN A N   
146  C CA  . ASN A 37  ? 1.8707 1.9284 0.9237 0.2549  -0.0755 -0.0439 254 ASN A CA  
147  C C   . ASN A 37  ? 1.8580 1.9969 0.9133 0.2164  -0.0439 -0.0573 254 ASN A C   
148  O O   . ASN A 37  ? 1.8328 2.0554 0.9029 0.2061  -0.0360 -0.0636 254 ASN A O   
149  C CB  . ASN A 37  ? 1.9221 2.0276 1.0087 0.3051  -0.0985 -0.0575 254 ASN A CB  
150  C CG  . ASN A 37  ? 2.3393 2.3524 1.4108 0.3344  -0.1356 -0.0310 254 ASN A CG  
151  O OD1 . ASN A 37  ? 2.2265 2.1795 1.2665 0.3018  -0.1426 0.0075  254 ASN A OD1 
152  N ND2 . ASN A 37  ? 2.3126 2.3141 1.4039 0.3965  -0.1621 -0.0522 254 ASN A ND2 
153  N N   . LYS A 38  ? 1.7935 1.9050 0.8270 0.1896  -0.0280 -0.0583 255 LYS A N   
154  C CA  . LYS A 38  ? 1.7626 1.9270 0.7835 0.1475  -0.0032 -0.0631 255 LYS A CA  
155  C C   . LYS A 38  ? 1.7929 1.9116 0.7852 0.1108  0.0026  -0.0254 255 LYS A C   
156  O O   . LYS A 38  ? 1.7937 1.8668 0.7624 0.0912  0.0081  -0.0104 255 LYS A O   
157  C CB  . LYS A 38  ? 1.7960 1.9568 0.8060 0.1391  0.0068  -0.0821 255 LYS A CB  
158  C CG  . LYS A 38  ? 1.9100 2.1285 0.9479 0.1717  0.0070  -0.1303 255 LYS A CG  
159  C CD  . LYS A 38  ? 1.9873 2.1865 1.0079 0.1584  0.0162  -0.1460 255 LYS A CD  
160  C CE  . LYS A 38  ? 2.0786 2.3298 1.1245 0.1899  0.0193  -0.2012 255 LYS A CE  
161  N NZ  . LYS A 38  ? 2.1617 2.3922 1.1840 0.1672  0.0300  -0.2147 255 LYS A NZ  
162  N N   . TYR A 39  ? 1.7210 1.8566 0.7171 0.1045  0.0003  -0.0129 256 TYR A N   
163  C CA  . TYR A 39  ? 1.7033 1.7986 0.6760 0.0752  0.0060  0.0148  256 TYR A CA  
164  C C   . TYR A 39  ? 1.7755 1.8620 0.7169 0.0371  0.0238  0.0210  256 TYR A C   
165  O O   . TYR A 39  ? 1.7772 1.8040 0.7000 0.0293  0.0244  0.0401  256 TYR A O   
166  C CB  . TYR A 39  ? 1.7038 1.8288 0.6853 0.0723  0.0013  0.0214  256 TYR A CB  
167  C CG  . TYR A 39  ? 1.7233 1.8529 0.7301 0.1112  -0.0228 0.0210  256 TYR A CG  
168  C CD1 . TYR A 39  ? 1.7618 1.8175 0.7619 0.1280  -0.0404 0.0367  256 TYR A CD1 
169  C CD2 . TYR A 39  ? 1.7345 1.9426 0.7675 0.1299  -0.0307 0.0060  256 TYR A CD2 
170  C CE1 . TYR A 39  ? 1.8017 1.8410 0.8127 0.1617  -0.0678 0.0407  256 TYR A CE1 
171  C CE2 . TYR A 39  ? 1.7730 1.9756 0.8266 0.1729  -0.0592 0.0090  256 TYR A CE2 
172  C CZ  . TYR A 39  ? 1.9079 2.0154 0.9463 0.1881  -0.0789 0.0284  256 TYR A CZ  
173  O OH  . TYR A 39  ? 1.9774 2.0592 1.0236 0.2273  -0.1120 0.0366  256 TYR A OH  
174  N N   . LYS A 40  ? 1.7485 1.8953 0.6809 0.0129  0.0360  0.0047  257 LYS A N   
175  C CA  . LYS A 40  ? 1.7747 1.9039 0.6638 -0.0305 0.0489  0.0135  257 LYS A CA  
176  C C   . LYS A 40  ? 1.8112 1.8867 0.6838 -0.0286 0.0456  0.0263  257 LYS A C   
177  O O   . LYS A 40  ? 1.8197 1.8347 0.6589 -0.0460 0.0461  0.0487  257 LYS A O   
178  C CB  . LYS A 40  ? 1.8406 2.0583 0.7197 -0.0630 0.0608  -0.0099 257 LYS A CB  
179  C CG  . LYS A 40  ? 2.1885 2.3903 1.0136 -0.1202 0.0724  0.0019  257 LYS A CG  
180  C CD  . LYS A 40  ? 2.3896 2.6799 1.1917 -0.1661 0.0843  -0.0200 257 LYS A CD  
181  C CE  . LYS A 40  ? 2.6232 2.8805 1.3549 -0.2337 0.0939  -0.0054 257 LYS A CE  
182  N NZ  . LYS A 40  ? 2.7409 3.0764 1.4353 -0.2916 0.1044  -0.0223 257 LYS A NZ  
183  N N   . ASP A 41  ? 1.7485 1.8446 0.6434 -0.0053 0.0408  0.0110  258 ASP A N   
184  C CA  . ASP A 41  ? 1.7463 1.8080 0.6276 -0.0059 0.0375  0.0202  258 ASP A CA  
185  C C   . ASP A 41  ? 1.7947 1.7908 0.6793 0.0140  0.0273  0.0428  258 ASP A C   
186  O O   . ASP A 41  ? 1.8063 1.7661 0.6689 0.0044  0.0250  0.0634  258 ASP A O   
187  C CB  . ASP A 41  ? 1.7620 1.8678 0.6633 0.0089  0.0380  -0.0098 258 ASP A CB  
188  C CG  . ASP A 41  ? 1.8514 2.0448 0.7531 -0.0119 0.0502  -0.0407 258 ASP A CG  
189  O OD1 . ASP A 41  ? 1.8735 2.0832 0.7392 -0.0566 0.0583  -0.0306 258 ASP A OD1 
190  O OD2 . ASP A 41  ? 1.9040 2.1487 0.8380 0.0150  0.0506  -0.0767 258 ASP A OD2 
191  N N   . ALA A 42  ? 1.7409 1.7268 0.6509 0.0402  0.0192  0.0393  259 ALA A N   
192  C CA  . ALA A 42  ? 1.7356 1.6750 0.6469 0.0510  0.0103  0.0569  259 ALA A CA  
193  C C   . ALA A 42  ? 1.8106 1.7244 0.7069 0.0390  0.0147  0.0755  259 ALA A C   
194  O O   . ALA A 42  ? 1.8144 1.7041 0.7051 0.0428  0.0110  0.0881  259 ALA A O   
195  C CB  . ALA A 42  ? 1.7392 1.6730 0.6687 0.0694  -0.0004 0.0531  259 ALA A CB  
196  N N   . ALA A 43  ? 1.7843 1.7070 0.6725 0.0244  0.0228  0.0738  260 ALA A N   
197  C CA  . ALA A 43  ? 1.8085 1.6950 0.6753 0.0118  0.0284  0.0854  260 ALA A CA  
198  C C   . ALA A 43  ? 1.9339 1.7845 0.7709 0.0045  0.0268  0.0989  260 ALA A C   
199  O O   . ALA A 43  ? 1.9507 1.7616 0.7819 0.0171  0.0225  0.1101  260 ALA A O   
200  C CB  . ALA A 43  ? 1.8258 1.7314 0.6807 -0.0117 0.0382  0.0775  260 ALA A CB  
201  N N   . HIS A 44  ? 1.9325 1.8031 0.7514 -0.0146 0.0284  0.0970  261 HIS A N   
202  C CA  . HIS A 44  ? 1.9863 1.8248 0.7693 -0.0278 0.0226  0.1149  261 HIS A CA  
203  C C   . HIS A 44  ? 2.0072 1.8361 0.8050 -0.0009 0.0109  0.1264  261 HIS A C   
204  O O   . HIS A 44  ? 2.0390 1.8248 0.8172 0.0074  0.0012  0.1459  261 HIS A O   
205  C CB  . HIS A 44  ? 2.0243 1.9073 0.7870 -0.0606 0.0275  0.1063  261 HIS A CB  
206  C CG  . HIS A 44  ? 2.1427 1.9908 0.8556 -0.0863 0.0191  0.1295  261 HIS A CG  
207  N ND1 . HIS A 44  ? 2.1738 2.0332 0.8874 -0.0799 0.0095  0.1391  261 HIS A ND1 
208  C CD2 . HIS A 44  ? 2.2434 2.0432 0.8984 -0.1225 0.0169  0.1465  261 HIS A CD2 
209  C CE1 . HIS A 44  ? 2.2336 2.0549 0.8931 -0.1090 -0.0004 0.1643  261 HIS A CE1 
210  N NE2 . HIS A 44  ? 2.2870 2.0642 0.9061 -0.1361 0.0028  0.1704  261 HIS A NE2 
211  N N   . LEU A 45  ? 1.9094 1.7766 0.7393 0.0134  0.0102  0.1136  262 LEU A N   
212  C CA  . LEU A 45  ? 1.8892 1.7608 0.7302 0.0296  0.0010  0.1210  262 LEU A CA  
213  C C   . LEU A 45  ? 1.9116 1.7664 0.7676 0.0516  -0.0034 0.1274  262 LEU A C   
214  O O   . LEU A 45  ? 1.9145 1.7764 0.7732 0.0644  -0.0123 0.1375  262 LEU A O   
215  C CB  . LEU A 45  ? 1.8646 1.7682 0.7234 0.0306  0.0019  0.1033  262 LEU A CB  
216  C CG  . LEU A 45  ? 1.9342 1.8680 0.7822 0.0130  0.0060  0.0902  262 LEU A CG  
217  C CD1 . LEU A 45  ? 1.9284 1.8746 0.7919 0.0206  0.0062  0.0678  262 LEU A CD1 
218  C CD2 . LEU A 45  ? 1.9898 1.9294 0.8135 -0.0013 -0.0003 0.1085  262 LEU A CD2 
219  N N   . LEU A 46  ? 1.8455 1.6908 0.7124 0.0544  0.0030  0.1190  263 LEU A N   
220  C CA  . LEU A 46  ? 1.8284 1.6689 0.7095 0.0702  0.0021  0.1182  263 LEU A CA  
221  C C   . LEU A 46  ? 1.9195 1.7189 0.7849 0.0821  0.0011  0.1252  263 LEU A C   
222  O O   . LEU A 46  ? 1.9160 1.7211 0.7948 0.1053  -0.0036 0.1239  263 LEU A O   
223  C CB  . LEU A 46  ? 1.7986 1.6500 0.6942 0.0637  0.0079  0.1066  263 LEU A CB  
224  C CG  . LEU A 46  ? 1.8358 1.7110 0.7436 0.0599  0.0017  0.1028  263 LEU A CG  
225  C CD1 . LEU A 46  ? 1.8294 1.7091 0.7442 0.0521  0.0021  0.0982  263 LEU A CD1 
226  C CD2 . LEU A 46  ? 1.8677 1.7641 0.7797 0.0638  -0.0048 0.1057  263 LEU A CD2 
227  N N   . ASN A 47  ? 1.9218 1.6797 0.7553 0.0654  0.0047  0.1307  264 ASN A N   
228  C CA  . ASN A 47  ? 1.9969 1.6878 0.7990 0.0724  0.0006  0.1397  264 ASN A CA  
229  C C   . ASN A 47  ? 2.0909 1.7678 0.8840 0.0950  -0.0179 0.1594  264 ASN A C   
230  O O   . ASN A 47  ? 2.1239 1.7584 0.9111 0.1255  -0.0280 0.1640  264 ASN A O   
231  C CB  . ASN A 47  ? 2.0703 1.7207 0.8269 0.0350  0.0071  0.1437  264 ASN A CB  
232  C CG  . ASN A 47  ? 2.4738 2.1282 1.2312 0.0152  0.0232  0.1259  264 ASN A CG  
233  O OD1 . ASN A 47  ? 2.4149 2.1132 1.1743 -0.0116 0.0318  0.1180  264 ASN A OD1 
234  N ND2 . ASN A 47  ? 2.4197 2.0347 1.1752 0.0280  0.0275  0.1166  264 ASN A ND2 
235  N N   . ASP A 48  ? 2.0424 1.7601 0.8361 0.0823  -0.0231 0.1685  265 ASP A N   
236  C CA  . ASP A 48  ? 2.0735 1.7990 0.8599 0.0965  -0.0414 0.1887  265 ASP A CA  
237  C C   . ASP A 48  ? 2.0800 1.8547 0.9081 0.1324  -0.0472 0.1816  265 ASP A C   
238  O O   . ASP A 48  ? 2.1366 1.9024 0.9646 0.1649  -0.0643 0.1941  265 ASP A O   
239  C CB  . ASP A 48  ? 2.0863 1.8522 0.8610 0.0644  -0.0408 0.1935  265 ASP A CB  
240  C CG  . ASP A 48  ? 2.3629 2.0871 1.0838 0.0309  -0.0456 0.2113  265 ASP A CG  
241  O OD1 . ASP A 48  ? 2.3782 2.0929 1.0825 0.0011  -0.0317 0.1998  265 ASP A OD1 
242  O OD2 . ASP A 48  ? 2.5259 2.2327 1.2179 0.0308  -0.0648 0.2378  265 ASP A OD2 
243  N N   . ALA A 49  ? 1.9403 1.7667 0.8007 0.1262  -0.0350 0.1613  266 ALA A N   
244  C CA  . ALA A 49  ? 1.8970 1.7821 0.7912 0.1463  -0.0375 0.1506  266 ALA A CA  
245  C C   . ALA A 49  ? 1.9420 1.8127 0.8517 0.1778  -0.0361 0.1378  266 ALA A C   
246  O O   . ALA A 49  ? 1.9432 1.8646 0.8786 0.2060  -0.0431 0.1301  266 ALA A O   
247  C CB  . ALA A 49  ? 1.8536 1.7779 0.7618 0.1205  -0.0269 0.1356  266 ALA A CB  
248  N N   . LEU A 50  ? 1.8921 1.7013 0.7856 0.1716  -0.0263 0.1317  267 LEU A N   
249  C CA  . LEU A 50  ? 1.9092 1.6928 0.8107 0.1968  -0.0216 0.1139  267 LEU A CA  
250  C C   . LEU A 50  ? 2.0193 1.7546 0.9087 0.2406  -0.0400 0.1240  267 LEU A C   
251  O O   . LEU A 50  ? 2.0334 1.8035 0.9529 0.2822  -0.0453 0.1073  267 LEU A O   
252  C CB  . LEU A 50  ? 1.9154 1.6456 0.7947 0.1694  -0.0056 0.1050  267 LEU A CB  
253  C CG  . LEU A 50  ? 2.0004 1.7035 0.8838 0.1862  0.0041  0.0799  267 LEU A CG  
254  C CD1 . LEU A 50  ? 1.9430 1.7300 0.8664 0.1830  0.0152  0.0548  267 LEU A CD1 
255  C CD2 . LEU A 50  ? 2.0514 1.6858 0.8964 0.1546  0.0162  0.0780  267 LEU A CD2 
256  N N   . ALA A 51  ? 2.0100 1.6702 0.8539 0.2312  -0.0520 0.1511  268 ALA A N   
257  C CA  . ALA A 51  ? 2.0912 1.6838 0.9094 0.2698  -0.0768 0.1702  268 ALA A CA  
258  C C   . ALA A 51  ? 2.1096 1.7813 0.9657 0.3128  -0.0959 0.1750  268 ALA A C   
259  O O   . ALA A 51  ? 2.1710 1.8186 1.0339 0.3685  -0.1148 0.1741  268 ALA A O   
260  C CB  . ALA A 51  ? 2.1543 1.6729 0.9107 0.2340  -0.0876 0.2037  268 ALA A CB  
261  N N   . ILE A 52  ? 1.9751 1.7438 0.8557 0.2881  -0.0910 0.1767  269 ILE A N   
262  C CA  . ILE A 52  ? 1.9489 1.8154 0.8637 0.3138  -0.1053 0.1790  269 ILE A CA  
263  C C   . ILE A 52  ? 1.9676 1.9104 0.9334 0.3487  -0.0981 0.1437  269 ILE A C   
264  O O   . ILE A 52  ? 2.0026 1.9797 0.9922 0.4034  -0.1164 0.1396  269 ILE A O   
265  C CB  . ILE A 52  ? 1.9212 1.8561 0.8351 0.2661  -0.0993 0.1877  269 ILE A CB  
266  C CG1 . ILE A 52  ? 1.9637 1.8472 0.8310 0.2407  -0.1116 0.2208  269 ILE A CG1 
267  C CG2 . ILE A 52  ? 1.8947 1.9499 0.8453 0.2791  -0.1067 0.1803  269 ILE A CG2 
268  C CD1 . ILE A 52  ? 1.9929 1.9170 0.8513 0.1880  -0.0989 0.2204  269 ILE A CD1 
269  N N   . ARG A 53  ? 1.8667 1.8408 0.8480 0.3171  -0.0733 0.1177  270 ARG A N   
270  C CA  . ARG A 53  ? 1.8434 1.9004 0.8669 0.3330  -0.0624 0.0811  270 ARG A CA  
271  C C   . ARG A 53  ? 1.9760 1.9901 1.0113 0.3875  -0.0644 0.0579  270 ARG A C   
272  O O   . ARG A 53  ? 1.9681 2.0678 1.0453 0.4269  -0.0667 0.0290  270 ARG A O   
273  C CB  . ARG A 53  ? 1.7633 1.8494 0.7872 0.2773  -0.0394 0.0665  270 ARG A CB  
274  C CG  . ARG A 53  ? 1.7936 1.9418 0.8134 0.2351  -0.0403 0.0783  270 ARG A CG  
275  C CD  . ARG A 53  ? 1.8565 1.9961 0.8621 0.1824  -0.0253 0.0738  270 ARG A CD  
276  N NE  . ARG A 53  ? 2.0106 2.1998 1.0067 0.1459  -0.0285 0.0809  270 ARG A NE  
277  C CZ  . ARG A 53  ? 2.1581 2.3095 1.1291 0.1062  -0.0248 0.0893  270 ARG A CZ  
278  N NH1 . ARG A 53  ? 1.9181 1.9980 0.8770 0.0995  -0.0183 0.0925  270 ARG A NH1 
279  N NH2 . ARG A 53  ? 1.9390 2.1240 0.8949 0.0740  -0.0286 0.0925  270 ARG A NH2 
280  N N   . GLU A 54  ? 2.0152 1.8990 1.0107 0.3893  -0.0643 0.0680  271 GLU A N   
281  C CA  . GLU A 54  ? 2.1151 1.9208 1.1050 0.4381  -0.0679 0.0479  271 GLU A CA  
282  C C   . GLU A 54  ? 2.2745 2.0733 1.2751 0.5110  -0.0999 0.0571  271 GLU A C   
283  O O   . GLU A 54  ? 2.3424 2.1281 1.3636 0.5710  -0.1051 0.0266  271 GLU A O   
284  C CB  . GLU A 54  ? 2.1925 1.8521 1.1206 0.4089  -0.0637 0.0650  271 GLU A CB  
285  C CG  . GLU A 54  ? 2.3032 1.9530 1.2257 0.3649  -0.0337 0.0394  271 GLU A CG  
286  C CD  . GLU A 54  ? 2.6268 2.1529 1.4865 0.3265  -0.0280 0.0549  271 GLU A CD  
287  O OE1 . GLU A 54  ? 2.6451 2.1269 1.4665 0.3009  -0.0396 0.0912  271 GLU A OE1 
288  O OE2 . GLU A 54  ? 2.3643 1.8466 1.2108 0.3160  -0.0106 0.0283  271 GLU A OE2 
289  N N   . LYS A 55  ? 2.2482 2.0548 1.2334 0.5076  -0.1227 0.0980  272 LYS A N   
290  C CA  . LYS A 55  ? 2.3299 2.1331 1.3200 0.5732  -0.1593 0.1171  272 LYS A CA  
291  C C   . LYS A 55  ? 2.3436 2.3208 1.3998 0.6053  -0.1653 0.0979  272 LYS A C   
292  O O   . LYS A 55  ? 2.3983 2.4125 1.4916 0.6805  -0.1819 0.0751  272 LYS A O   
293  C CB  . LYS A 55  ? 2.4004 2.1242 1.3321 0.5468  -0.1827 0.1732  272 LYS A CB  
294  C CG  . LYS A 55  ? 2.6710 2.2162 1.5286 0.5288  -0.1876 0.1943  272 LYS A CG  
295  C CD  . LYS A 55  ? 2.8368 2.3196 1.6321 0.4934  -0.2115 0.2495  272 LYS A CD  
296  C CE  . LYS A 55  ? 3.0848 2.5067 1.8560 0.5550  -0.2589 0.2834  272 LYS A CE  
297  N NZ  . LYS A 55  ? 3.2356 2.6051 1.9399 0.5082  -0.2816 0.3386  272 LYS A NZ  
298  N N   . THR A 56  ? 1.8772 2.2194 0.9513 0.4861  -0.1536 0.1013  273 THR A N   
299  C CA  . THR A 56  ? 1.8434 2.3087 0.9906 0.4884  -0.1799 0.0985  273 THR A CA  
300  C C   . THR A 56  ? 1.8461 2.4341 1.0637 0.4814  -0.1754 0.1149  273 THR A C   
301  O O   . THR A 56  ? 1.8620 2.5352 1.0780 0.5261  -0.1862 0.1114  273 THR A O   
302  C CB  . THR A 56  ? 1.9310 2.4008 1.1329 0.4447  -0.1988 0.0979  273 THR A CB  
303  O OG1 . THR A 56  ? 1.9343 2.3895 1.1798 0.3903  -0.1826 0.1141  273 THR A OG1 
304  C CG2 . THR A 56  ? 1.9451 2.3124 1.0730 0.4699  -0.2089 0.0804  273 THR A CG2 
305  N N   . LEU A 57  ? 1.7472 2.3482 1.0216 0.4316  -0.1585 0.1332  274 LEU A N   
306  C CA  . LEU A 57  ? 1.6980 2.4104 1.0396 0.4220  -0.1496 0.1531  274 LEU A CA  
307  C C   . LEU A 57  ? 1.7737 2.4653 1.0569 0.4686  -0.1313 0.1559  274 LEU A C   
308  O O   . LEU A 57  ? 1.7327 2.5226 1.0542 0.4828  -0.1247 0.1715  274 LEU A O   
309  C CB  . LEU A 57  ? 1.6392 2.3630 1.0536 0.3541  -0.1417 0.1699  274 LEU A CB  
310  C CG  . LEU A 57  ? 1.6795 2.4061 1.1386 0.3067  -0.1670 0.1684  274 LEU A CG  
311  C CD1 . LEU A 57  ? 1.6522 2.3252 1.1303 0.2552  -0.1576 0.1770  274 LEU A CD1 
312  C CD2 . LEU A 57  ? 1.6790 2.5429 1.2177 0.2901  -0.1911 0.1802  274 LEU A CD2 
313  N N   . GLY A 58  ? 1.8033 2.3642 0.9894 0.4923  -0.1255 0.1426  275 GLY A N   
314  C CA  . GLY A 58  ? 1.8568 2.3593 0.9633 0.5354  -0.1175 0.1420  275 GLY A CA  
315  C C   . GLY A 58  ? 1.8980 2.3730 1.0275 0.5034  -0.0989 0.1547  275 GLY A C   
316  O O   . GLY A 58  ? 1.8370 2.3706 1.0540 0.4558  -0.0895 0.1668  275 GLY A O   
317  N N   . LYS A 59  ? 1.9183 2.2952 0.9614 0.5304  -0.0972 0.1509  276 LYS A N   
318  C CA  . LYS A 59  ? 1.8951 2.2401 0.9509 0.5082  -0.0848 0.1593  276 LYS A CA  
319  C C   . LYS A 59  ? 1.9100 2.3708 1.0173 0.5346  -0.0807 0.1734  276 LYS A C   
320  O O   . LYS A 59  ? 1.9253 2.4717 1.0272 0.5844  -0.0893 0.1762  276 LYS A O   
321  C CB  . LYS A 59  ? 2.0183 2.2245 0.9619 0.5306  -0.0930 0.1516  276 LYS A CB  
322  C CG  . LYS A 59  ? 2.3188 2.4183 1.2417 0.4769  -0.0856 0.1485  276 LYS A CG  
323  C CD  . LYS A 59  ? 2.5634 2.5445 1.4077 0.4763  -0.0935 0.1478  276 LYS A CD  
324  C CE  . LYS A 59  ? 2.7342 2.6193 1.5539 0.4221  -0.0857 0.1496  276 LYS A CE  
325  N NZ  . LYS A 59  ? 2.8578 2.6595 1.6434 0.3986  -0.0929 0.1523  276 LYS A NZ  
326  N N   . ASP A 60  ? 1.8151 2.2852 0.9709 0.5048  -0.0665 0.1830  277 ASP A N   
327  C CA  . ASP A 60  ? 1.7791 2.3530 0.9852 0.5250  -0.0569 0.2005  277 ASP A CA  
328  C C   . ASP A 60  ? 1.7502 2.4617 1.0583 0.4935  -0.0504 0.2168  277 ASP A C   
329  O O   . ASP A 60  ? 1.7229 2.5546 1.0650 0.5240  -0.0468 0.2345  277 ASP A O   
330  C CB  . ASP A 60  ? 1.8758 2.4575 1.0043 0.6100  -0.0674 0.2020  277 ASP A CB  
331  C CG  . ASP A 60  ? 2.1278 2.5593 1.1502 0.6353  -0.0811 0.1880  277 ASP A CG  
332  O OD1 . ASP A 60  ? 2.1334 2.5338 1.1630 0.6281  -0.0756 0.1910  277 ASP A OD1 
333  O OD2 . ASP A 60  ? 2.2898 2.6302 1.2167 0.6630  -0.1000 0.1741  277 ASP A OD2 
334  N N   . HIS A 61  ? 1.6771 2.3689 1.0301 0.4313  -0.0507 0.2126  278 HIS A N   
335  C CA  . HIS A 61  ? 1.6310 2.4201 1.0712 0.3872  -0.0530 0.2262  278 HIS A CA  
336  C C   . HIS A 61  ? 1.6353 2.3965 1.1202 0.3284  -0.0415 0.2324  278 HIS A C   
337  O O   . HIS A 61  ? 1.6326 2.2920 1.0831 0.3129  -0.0374 0.2177  278 HIS A O   
338  C CB  . HIS A 61  ? 1.6593 2.4336 1.0932 0.3755  -0.0732 0.2123  278 HIS A CB  
339  C CG  . HIS A 61  ? 1.6760 2.5479 1.1919 0.3335  -0.0861 0.2252  278 HIS A CG  
340  N ND1 . HIS A 61  ? 1.6751 2.5175 1.2305 0.2709  -0.0897 0.2290  278 HIS A ND1 
341  C CD2 . HIS A 61  ? 1.7003 2.6969 1.2608 0.3454  -0.0992 0.2355  278 HIS A CD2 
342  C CE1 . HIS A 61  ? 1.6605 2.5959 1.2794 0.2413  -0.1080 0.2421  278 HIS A CE1 
343  N NE2 . HIS A 61  ? 1.6743 2.7136 1.3066 0.2813  -0.1134 0.2471  278 HIS A NE2 
344  N N   . PRO A 62  ? 1.5514 2.4021 1.1083 0.2946  -0.0371 0.2547  279 PRO A N   
345  C CA  . PRO A 62  ? 1.5171 2.3275 1.0984 0.2443  -0.0290 0.2590  279 PRO A CA  
346  C C   . PRO A 62  ? 1.5242 2.2369 1.0834 0.2082  -0.0409 0.2394  279 PRO A C   
347  O O   . PRO A 62  ? 1.5003 2.1482 1.0434 0.1931  -0.0313 0.2319  279 PRO A O   
348  C CB  . PRO A 62  ? 1.5311 2.4502 1.1845 0.2085  -0.0302 0.2884  279 PRO A CB  
349  C CG  . PRO A 62  ? 1.5983 2.6334 1.2684 0.2561  -0.0245 0.3045  279 PRO A CG  
350  C CD  . PRO A 62  ? 1.5665 2.5612 1.1810 0.3010  -0.0389 0.2796  279 PRO A CD  
351  N N   . ALA A 63  ? 1.4759 2.1814 1.0294 0.2017  -0.0623 0.2303  280 ALA A N   
352  C CA  . ALA A 63  ? 1.4749 2.0926 0.9985 0.1795  -0.0749 0.2134  280 ALA A CA  
353  C C   . ALA A 63  ? 1.5051 2.0352 0.9703 0.2022  -0.0601 0.1962  280 ALA A C   
354  O O   . ALA A 63  ? 1.5000 1.9688 0.9467 0.1834  -0.0578 0.1876  280 ALA A O   
355  C CB  . ALA A 63  ? 1.5082 2.1401 1.0332 0.1789  -0.1023 0.2076  280 ALA A CB  
356  N N   . VAL A 64  ? 1.4551 1.9802 0.8871 0.2424  -0.0522 0.1928  281 VAL A N   
357  C CA  . VAL A 64  ? 1.4654 1.9063 0.8404 0.2570  -0.0415 0.1810  281 VAL A CA  
358  C C   . VAL A 64  ? 1.4816 1.9059 0.8692 0.2425  -0.0261 0.1817  281 VAL A C   
359  O O   . VAL A 64  ? 1.4681 1.8373 0.8382 0.2254  -0.0194 0.1730  281 VAL A O   
360  C CB  . VAL A 64  ? 1.5519 1.9777 0.8739 0.3043  -0.0444 0.1782  281 VAL A CB  
361  C CG1 . VAL A 64  ? 1.5862 1.9111 0.8440 0.3074  -0.0386 0.1692  281 VAL A CG1 
362  C CG2 . VAL A 64  ? 1.5768 2.0298 0.8847 0.3271  -0.0608 0.1748  281 VAL A CG2 
363  N N   . ALA A 65  ? 1.4278 1.9084 0.8466 0.2518  -0.0201 0.1930  282 ALA A N   
364  C CA  . ALA A 65  ? 1.4126 1.8819 0.8414 0.2466  -0.0068 0.1928  282 ALA A CA  
365  C C   . ALA A 65  ? 1.4437 1.8928 0.8906 0.2074  -0.0050 0.1878  282 ALA A C   
366  O O   . ALA A 65  ? 1.4432 1.8478 0.8742 0.2024  0.0024  0.1755  282 ALA A O   
367  C CB  . ALA A 65  ? 1.4076 1.9489 0.8646 0.2680  0.0003  0.2103  282 ALA A CB  
368  N N   . ALA A 66  ? 1.3851 1.8641 0.8586 0.1815  -0.0159 0.1961  283 ALA A N   
369  C CA  . ALA A 66  ? 1.3817 1.8285 0.8532 0.1505  -0.0221 0.1912  283 ALA A CA  
370  C C   . ALA A 66  ? 1.4634 1.8497 0.8966 0.1509  -0.0237 0.1737  283 ALA A C   
371  O O   . ALA A 66  ? 1.4612 1.8167 0.8782 0.1451  -0.0187 0.1637  283 ALA A O   
372  C CB  . ALA A 66  ? 1.4000 1.8766 0.8955 0.1225  -0.0431 0.2042  283 ALA A CB  
373  N N   . THR A 67  ? 1.4311 1.8052 0.8461 0.1624  -0.0290 0.1709  284 THR A N   
374  C CA  . THR A 67  ? 1.4419 1.7677 0.8199 0.1649  -0.0265 0.1607  284 THR A CA  
375  C C   . THR A 67  ? 1.4759 1.7809 0.8414 0.1688  -0.0072 0.1548  284 THR A C   
376  O O   . THR A 67  ? 1.4754 1.7631 0.8273 0.1617  0.0000  0.1483  284 THR A O   
377  C CB  . THR A 67  ? 1.4825 1.7970 0.8392 0.1775  -0.0381 0.1614  284 THR A CB  
378  O OG1 . THR A 67  ? 1.4610 1.8004 0.8372 0.1685  -0.0614 0.1653  284 THR A OG1 
379  C CG2 . THR A 67  ? 1.4586 1.7254 0.7735 0.1820  -0.0332 0.1558  284 THR A CG2 
380  N N   . LEU A 68  ? 1.4156 1.7258 0.7837 0.1820  -0.0020 0.1574  285 LEU A N   
381  C CA  . LEU A 68  ? 1.4137 1.6968 0.7688 0.1823  0.0077  0.1517  285 LEU A CA  
382  C C   . LEU A 68  ? 1.4196 1.7161 0.7962 0.1731  0.0150  0.1432  285 LEU A C   
383  O O   . LEU A 68  ? 1.4138 1.6983 0.7852 0.1624  0.0217  0.1355  285 LEU A O   
384  C CB  . LEU A 68  ? 1.4300 1.7027 0.7685 0.2072  0.0033  0.1550  285 LEU A CB  
385  C CG  . LEU A 68  ? 1.5211 1.7594 0.8142 0.2239  -0.0051 0.1587  285 LEU A CG  
386  C CD1 . LEU A 68  ? 1.5335 1.7817 0.8081 0.2625  -0.0139 0.1625  285 LEU A CD1 
387  C CD2 . LEU A 68  ? 1.5889 1.7609 0.8405 0.2086  -0.0032 0.1565  285 LEU A CD2 
388  N N   . ASN A 69  ? 1.3435 1.6682 0.7423 0.1767  0.0134  0.1457  286 ASN A N   
389  C CA  . ASN A 69  ? 1.3263 1.6551 0.7331 0.1745  0.0188  0.1365  286 ASN A CA  
390  C C   . ASN A 69  ? 1.3761 1.6940 0.7668 0.1628  0.0175  0.1270  286 ASN A C   
391  O O   . ASN A 69  ? 1.3550 1.6728 0.7403 0.1653  0.0240  0.1135  286 ASN A O   
392  C CB  . ASN A 69  ? 1.3300 1.6832 0.7539 0.1763  0.0173  0.1474  286 ASN A CB  
393  C CG  . ASN A 69  ? 1.4632 1.8043 0.8785 0.1738  0.0204  0.1383  286 ASN A CG  
394  O OD1 . ASN A 69  ? 1.3615 1.6973 0.7743 0.1902  0.0290  0.1279  286 ASN A OD1 
395  N ND2 . ASN A 69  ? 1.2929 1.6193 0.6931 0.1570  0.0096  0.1401  286 ASN A ND2 
396  N N   . ASN A 70  ? 1.3555 1.6669 0.7347 0.1554  0.0062  0.1331  287 ASN A N   
397  C CA  . ASN A 70  ? 1.3726 1.6666 0.7212 0.1553  -0.0003 0.1255  287 ASN A CA  
398  C C   . ASN A 70  ? 1.4392 1.7383 0.7771 0.1589  0.0124  0.1213  287 ASN A C   
399  O O   . ASN A 70  ? 1.4526 1.7602 0.7729 0.1668  0.0166  0.1113  287 ASN A O   
400  C CB  . ASN A 70  ? 1.4042 1.6808 0.7382 0.1498  -0.0216 0.1333  287 ASN A CB  
401  C CG  . ASN A 70  ? 1.7485 2.0224 1.0912 0.1356  -0.0362 0.1402  287 ASN A CG  
402  O OD1 . ASN A 70  ? 1.5843 1.8538 0.9240 0.1351  -0.0307 0.1363  287 ASN A OD1 
403  N ND2 . ASN A 70  ? 1.7548 2.0322 1.1078 0.1221  -0.0557 0.1517  287 ASN A ND2 
404  N N   . LEU A 71  ? 1.3908 1.6875 0.7362 0.1538  0.0190  0.1298  288 LEU A N   
405  C CA  . LEU A 71  ? 1.3994 1.6998 0.7372 0.1469  0.0328  0.1319  288 LEU A CA  
406  C C   . LEU A 71  ? 1.4386 1.7626 0.7974 0.1397  0.0420  0.1222  288 LEU A C   
407  O O   . LEU A 71  ? 1.4534 1.8068 0.8119 0.1352  0.0520  0.1197  288 LEU A O   
408  C CB  . LEU A 71  ? 1.4225 1.6950 0.7493 0.1416  0.0340  0.1433  288 LEU A CB  
409  C CG  . LEU A 71  ? 1.4981 1.7492 0.7950 0.1507  0.0296  0.1514  288 LEU A CG  
410  C CD1 . LEU A 71  ? 1.5198 1.7390 0.7999 0.1564  0.0239  0.1574  288 LEU A CD1 
411  C CD2 . LEU A 71  ? 1.5395 1.7941 0.8145 0.1473  0.0444  0.1583  288 LEU A CD2 
412  N N   . ALA A 72  ? 1.3637 1.6818 0.7399 0.1431  0.0375  0.1165  289 ALA A N   
413  C CA  . ALA A 72  ? 1.3364 1.6697 0.7299 0.1423  0.0403  0.1034  289 ALA A CA  
414  C C   . ALA A 72  ? 1.3733 1.7354 0.7637 0.1549  0.0429  0.0879  289 ALA A C   
415  O O   . ALA A 72  ? 1.3657 1.7606 0.7671 0.1528  0.0478  0.0764  289 ALA A O   
416  C CB  . ALA A 72  ? 1.3338 1.6465 0.7339 0.1556  0.0331  0.1015  289 ALA A CB  
417  N N   . VAL A 73  ? 1.3321 1.6803 0.7020 0.1677  0.0364  0.0876  290 VAL A N   
418  C CA  . VAL A 73  ? 1.3384 1.6906 0.6801 0.1859  0.0330  0.0725  290 VAL A CA  
419  C C   . VAL A 73  ? 1.4144 1.8016 0.7408 0.1918  0.0391  0.0691  290 VAL A C   
420  O O   . VAL A 73  ? 1.3991 1.8217 0.7204 0.2068  0.0433  0.0528  290 VAL A O   
421  C CB  . VAL A 73  ? 1.4013 1.7132 0.7118 0.1900  0.0180  0.0777  290 VAL A CB  
422  C CG1 . VAL A 73  ? 1.4282 1.7225 0.6842 0.2125  0.0086  0.0618  290 VAL A CG1 
423  C CG2 . VAL A 73  ? 1.3867 1.6848 0.7168 0.1847  0.0170  0.0849  290 VAL A CG2 
424  N N   . LEU A 74  ? 1.4116 1.7957 0.7304 0.1839  0.0407  0.0850  291 LEU A N   
425  C CA  . LEU A 74  ? 1.4392 1.8615 0.7410 0.1929  0.0501  0.0890  291 LEU A CA  
426  C C   . LEU A 74  ? 1.5271 2.0086 0.8688 0.1725  0.0681  0.0923  291 LEU A C   
427  O O   . LEU A 74  ? 1.5410 2.0845 0.8788 0.1857  0.0774  0.0877  291 LEU A O   
428  C CB  . LEU A 74  ? 1.4631 1.8566 0.7401 0.1943  0.0467  0.1060  291 LEU A CB  
429  C CG  . LEU A 74  ? 1.5446 1.8821 0.7790 0.2116  0.0218  0.1031  291 LEU A CG  
430  C CD1 . LEU A 74  ? 1.5632 1.8707 0.7856 0.2093  0.0156  0.1178  291 LEU A CD1 
431  C CD2 . LEU A 74  ? 1.6129 1.9457 0.7874 0.2482  0.0097  0.0902  291 LEU A CD2 
432  N N   . TYR A 75  ? 1.4981 1.9621 0.8738 0.1417  0.0699  0.1001  292 TYR A N   
433  C CA  . TYR A 75  ? 1.5068 2.0120 0.9183 0.1121  0.0791  0.1042  292 TYR A CA  
434  C C   . TYR A 75  ? 1.5231 2.0769 0.9559 0.1229  0.0762  0.0810  292 TYR A C   
435  O O   . TYR A 75  ? 1.5237 2.1506 0.9820 0.1104  0.0851  0.0810  292 TYR A O   
436  C CB  . TYR A 75  ? 1.5492 1.9994 0.9708 0.0832  0.0720  0.1144  292 TYR A CB  
437  C CG  . TYR A 75  ? 1.6347 2.0583 1.0378 0.0611  0.0799  0.1392  292 TYR A CG  
438  C CD1 . TYR A 75  ? 1.6690 2.0420 1.0391 0.0771  0.0764  0.1471  292 TYR A CD1 
439  C CD2 . TYR A 75  ? 1.6886 2.1376 1.1054 0.0228  0.0899  0.1556  292 TYR A CD2 
440  C CE1 . TYR A 75  ? 1.7266 2.0668 1.0690 0.0640  0.0834  0.1673  292 TYR A CE1 
441  C CE2 . TYR A 75  ? 1.7551 2.1685 1.1436 0.0029  0.0990  0.1806  292 TYR A CE2 
442  C CZ  . TYR A 75  ? 1.8927 2.2471 1.2398 0.0278  0.0960  0.1846  292 TYR A CZ  
443  O OH  . TYR A 75  ? 1.9828 2.2945 1.2917 0.0156  0.1048  0.2065  292 TYR A OH  
444  N N   . GLY A 76  ? 1.4559 1.9745 0.8763 0.1477  0.0647  0.0626  293 GLY A N   
445  C CA  . GLY A 76  ? 1.4365 1.9837 0.8620 0.1693  0.0601  0.0363  293 GLY A CA  
446  C C   . GLY A 76  ? 1.4865 2.0886 0.8837 0.2012  0.0648  0.0235  293 GLY A C   
447  O O   . GLY A 76  ? 1.4735 2.1372 0.8848 0.2135  0.0655  0.0046  293 GLY A O   
448  N N   . LYS A 77  ? 1.4658 2.0457 0.8169 0.2197  0.0646  0.0325  294 LYS A N   
449  C CA  . LYS A 77  ? 1.4876 2.1049 0.7890 0.2612  0.0644  0.0223  294 LYS A CA  
450  C C   . LYS A 77  ? 1.5323 2.2586 0.8645 0.2554  0.0825  0.0315  294 LYS A C   
451  O O   . LYS A 77  ? 1.5456 2.3396 0.8534 0.2936  0.0846  0.0170  294 LYS A O   
452  C CB  . LYS A 77  ? 1.5492 2.1024 0.7895 0.2795  0.0536  0.0332  294 LYS A CB  
453  C CG  . LYS A 77  ? 1.7477 2.2091 0.9412 0.2924  0.0321  0.0226  294 LYS A CG  
454  C CD  . LYS A 77  ? 1.9431 2.3906 1.0611 0.3417  0.0185  -0.0022 294 LYS A CD  
455  C CE  . LYS A 77  ? 2.1706 2.5142 1.2321 0.3460  -0.0046 -0.0068 294 LYS A CE  
456  N NZ  . LYS A 77  ? 2.4144 2.7199 1.3754 0.3977  -0.0235 -0.0297 294 LYS A NZ  
457  N N   . ARG A 78  ? 1.4740 2.2181 0.8552 0.2082  0.0952  0.0572  295 ARG A N   
458  C CA  . ARG A 78  ? 1.4764 2.3227 0.8963 0.1855  0.1152  0.0762  295 ARG A CA  
459  C C   . ARG A 78  ? 1.5154 2.4269 1.0028 0.1496  0.1148  0.0677  295 ARG A C   
460  O O   . ARG A 78  ? 1.5245 2.5340 1.0549 0.1205  0.1297  0.0850  295 ARG A O   
461  C CB  . ARG A 78  ? 1.4871 2.3007 0.9111 0.1502  0.1271  0.1106  295 ARG A CB  
462  C CG  . ARG A 78  ? 1.6073 2.3923 0.9693 0.1889  0.1300  0.1219  295 ARG A CG  
463  C CD  . ARG A 78  ? 1.7680 2.5898 1.1365 0.1674  0.1535  0.1569  295 ARG A CD  
464  N NE  . ARG A 78  ? 1.9633 2.7102 1.3480 0.1189  0.1533  0.1741  295 ARG A NE  
465  C CZ  . ARG A 78  ? 2.2109 2.9798 1.6172 0.0747  0.1720  0.2038  295 ARG A CZ  
466  N NH1 . ARG A 78  ? 2.0583 2.9388 1.4873 0.0662  0.1961  0.2238  295 ARG A NH1 
467  N NH2 . ARG A 78  ? 2.1020 2.7829 1.5025 0.0394  0.1664  0.2154  295 ARG A NH2 
468  N N   . GLY A 79  ? 1.4508 2.3091 0.9457 0.1515  0.0967  0.0433  296 GLY A N   
469  C CA  . GLY A 79  ? 1.4346 2.3317 0.9838 0.1245  0.0870  0.0295  296 GLY A CA  
470  C C   . GLY A 79  ? 1.4761 2.3264 1.0613 0.0631  0.0803  0.0503  296 GLY A C   
471  O O   . GLY A 79  ? 1.4782 2.3563 1.1074 0.0314  0.0673  0.0434  296 GLY A O   
472  N N   . LYS A 80  ? 1.4290 2.2001 0.9870 0.0491  0.0846  0.0740  297 LYS A N   
473  C CA  . LYS A 80  ? 1.4589 2.1628 1.0242 -0.0001 0.0768  0.0951  297 LYS A CA  
474  C C   . LYS A 80  ? 1.5006 2.1013 1.0454 0.0143  0.0541  0.0799  297 LYS A C   
475  O O   . LYS A 80  ? 1.5028 2.0239 1.0143 0.0175  0.0515  0.0921  297 LYS A O   
476  C CB  . LYS A 80  ? 1.5216 2.1984 1.0572 -0.0113 0.0941  0.1264  297 LYS A CB  
477  C CG  . LYS A 80  ? 1.7301 2.5046 1.2868 -0.0360 0.1181  0.1516  297 LYS A CG  
478  C CD  . LYS A 80  ? 1.9142 2.6473 1.4311 -0.0394 0.1349  0.1814  297 LYS A CD  
479  C CE  . LYS A 80  ? 2.1313 2.8136 1.6472 -0.1002 0.1351  0.2104  297 LYS A CE  
480  N NZ  . LYS A 80  ? 2.2809 2.9164 1.7481 -0.0948 0.1522  0.2366  297 LYS A NZ  
481  N N   . TYR A 81  ? 1.4565 2.0656 1.0190 0.0285  0.0377  0.0533  298 TYR A N   
482  C CA  . TYR A 81  ? 1.4626 1.9880 1.0040 0.0538  0.0179  0.0378  298 TYR A CA  
483  C C   . TYR A 81  ? 1.5655 2.0042 1.0906 0.0271  -0.0027 0.0510  298 TYR A C   
484  O O   . TYR A 81  ? 1.5724 1.9381 1.0622 0.0545  -0.0093 0.0525  298 TYR A O   
485  C CB  . TYR A 81  ? 1.4676 2.0229 1.0241 0.0834  0.0061  0.0047  298 TYR A CB  
486  C CG  . TYR A 81  ? 1.4691 2.0982 1.0229 0.1181  0.0219  -0.0122 298 TYR A CG  
487  C CD1 . TYR A 81  ? 1.4812 2.0801 0.9927 0.1549  0.0331  -0.0126 298 TYR A CD1 
488  C CD2 . TYR A 81  ? 1.4797 2.2067 1.0668 0.1159  0.0217  -0.0286 298 TYR A CD2 
489  C CE1 . TYR A 81  ? 1.4893 2.1347 0.9770 0.1912  0.0412  -0.0291 298 TYR A CE1 
490  C CE2 . TYR A 81  ? 1.4779 2.2678 1.0454 0.1591  0.0332  -0.0467 298 TYR A CE2 
491  C CZ  . TYR A 81  ? 1.5683 2.3073 1.0786 0.1982  0.0417  -0.0471 298 TYR A CZ  
492  O OH  . TYR A 81  ? 1.5754 2.3557 1.0459 0.2448  0.0470  -0.0658 298 TYR A OH  
493  N N   . LYS A 82  ? 1.8030 1.9016 1.3300 0.2186  -0.0022 0.2046  299 LYS A N   
494  C CA  . LYS A 82  ? 1.8069 1.8695 1.2947 0.1856  -0.0164 0.2341  299 LYS A CA  
495  C C   . LYS A 82  ? 1.8840 1.9158 1.2964 0.1796  -0.0025 0.2333  299 LYS A C   
496  O O   . LYS A 82  ? 1.8853 1.8588 1.2491 0.1686  -0.0245 0.2444  299 LYS A O   
497  C CB  . LYS A 82  ? 1.8442 1.9619 1.3795 0.1548  -0.0154 0.2638  299 LYS A CB  
498  C CG  . LYS A 82  ? 1.9757 2.0865 1.5699 0.1489  -0.0498 0.2787  299 LYS A CG  
499  C CD  . LYS A 82  ? 2.0922 2.2410 1.7187 0.1095  -0.0609 0.3195  299 LYS A CD  
500  C CE  . LYS A 82  ? 2.1571 2.2807 1.8351 0.1010  -0.1034 0.3397  299 LYS A CE  
501  N NZ  . LYS A 82  ? 2.2165 2.3626 1.9136 0.0574  -0.1251 0.3878  299 LYS A NZ  
502  N N   . GLU A 83  ? 1.8634 1.9280 1.2635 0.1894  0.0313  0.2188  300 GLU A N   
503  C CA  . GLU A 83  ? 1.8902 1.9177 1.2188 0.1826  0.0420  0.2176  300 GLU A CA  
504  C C   . GLU A 83  ? 1.9195 1.8982 1.2100 0.2106  0.0360  0.1980  300 GLU A C   
505  O O   . GLU A 83  ? 1.9403 1.8780 1.1748 0.2055  0.0369  0.1992  300 GLU A O   
506  C CB  . GLU A 83  ? 1.9496 2.0234 1.2670 0.1658  0.0785  0.2205  300 GLU A CB  
507  C CG  . GLU A 83  ? 2.1561 2.3025 1.5213 0.1901  0.1134  0.2023  300 GLU A CG  
508  C CD  . GLU A 83  ? 2.5349 2.7661 1.9858 0.1793  0.1202  0.2146  300 GLU A CD  
509  O OE1 . GLU A 83  ? 2.4476 2.6810 1.9535 0.1942  0.0950  0.2121  300 GLU A OE1 
510  O OE2 . GLU A 83  ? 2.5508 2.8453 2.0132 0.1527  0.1491  0.2285  300 GLU A OE2 
511  N N   . ALA A 84  ? 1.8386 1.8170 1.1577 0.2359  0.0234  0.1825  301 ALA A N   
512  C CA  . ALA A 84  ? 1.8283 1.7617 1.1116 0.2567  0.0085  0.1689  301 ALA A CA  
513  C C   . ALA A 84  ? 1.8488 1.7386 1.1169 0.2481  -0.0194 0.1780  301 ALA A C   
514  O O   . ALA A 84  ? 1.8414 1.6960 1.0708 0.2528  -0.0296 0.1772  301 ALA A O   
515  C CB  . ALA A 84  ? 1.8390 1.7883 1.1519 0.2845  0.0011  0.1470  301 ALA A CB  
516  N N   . GLU A 85  ? 1.7888 1.6808 1.0859 0.2355  -0.0323 0.1884  302 GLU A N   
517  C CA  . GLU A 85  ? 1.7698 1.6191 1.0481 0.2292  -0.0554 0.1963  302 GLU A CA  
518  C C   . GLU A 85  ? 1.8090 1.6314 1.0404 0.2234  -0.0545 0.2051  302 GLU A C   
519  O O   . GLU A 85  ? 1.7963 1.5948 1.0050 0.2309  -0.0634 0.2018  302 GLU A O   
520  C CB  . GLU A 85  ? 1.7889 1.6338 1.0977 0.2167  -0.0718 0.2087  302 GLU A CB  
521  C CG  . GLU A 85  ? 1.9424 1.7349 1.2323 0.2171  -0.0975 0.2091  302 GLU A CG  
522  C CD  . GLU A 85  ? 2.2397 2.0084 1.5551 0.2063  -0.1217 0.2197  302 GLU A CD  
523  O OE1 . GLU A 85  ? 2.1843 1.9903 1.5543 0.2015  -0.1213 0.2236  302 GLU A OE1 
524  O OE2 . GLU A 85  ? 2.1883 1.8997 1.4692 0.2034  -0.1415 0.2241  302 GLU A OE2 
525  N N   . PRO A 86  ? 1.7821 1.6084 0.9977 0.2091  -0.0465 0.2153  303 PRO A N   
526  C CA  . PRO A 86  ? 1.7918 1.5840 0.9643 0.2065  -0.0547 0.2195  303 PRO A CA  
527  C C   . PRO A 86  ? 1.8368 1.6194 0.9896 0.2181  -0.0489 0.2117  303 PRO A C   
528  O O   . PRO A 86  ? 1.8350 1.5962 0.9700 0.2242  -0.0600 0.2126  303 PRO A O   
529  C CB  . PRO A 86  ? 1.8419 1.6359 0.9977 0.1829  -0.0524 0.2306  303 PRO A CB  
530  C CG  . PRO A 86  ? 1.8955 1.7286 1.0905 0.1709  -0.0461 0.2387  303 PRO A CG  
531  C CD  . PRO A 86  ? 1.8143 1.6763 1.0492 0.1916  -0.0331 0.2240  303 PRO A CD  
532  N N   . LEU A 87  ? 1.7895 1.5867 0.9448 0.2228  -0.0340 0.2050  304 LEU A N   
533  C CA  . LEU A 87  ? 1.7898 1.5669 0.9185 0.2316  -0.0352 0.2025  304 LEU A CA  
534  C C   . LEU A 87  ? 1.8217 1.5957 0.9564 0.2424  -0.0513 0.2012  304 LEU A C   
535  O O   . LEU A 87  ? 1.8157 1.5746 0.9341 0.2431  -0.0609 0.2081  304 LEU A O   
536  C CB  . LEU A 87  ? 1.8080 1.5925 0.9280 0.2389  -0.0195 0.1944  304 LEU A CB  
537  C CG  . LEU A 87  ? 1.8922 1.6717 0.9860 0.2247  0.0004  0.1971  304 LEU A CG  
538  C CD1 . LEU A 87  ? 1.9008 1.7265 1.0195 0.2296  0.0254  0.1877  304 LEU A CD1 
539  C CD2 . LEU A 87  ? 1.9437 1.6738 0.9845 0.2267  -0.0025 0.1994  304 LEU A CD2 
540  N N   . CYS A 88  ? 1.7800 1.5687 0.9390 0.2474  -0.0565 0.1937  305 CYS A N   
541  C CA  . CYS A 88  ? 1.7711 1.5535 0.9288 0.2499  -0.0743 0.1921  305 CYS A CA  
542  C C   . CYS A 88  ? 1.7947 1.5736 0.9497 0.2459  -0.0774 0.1988  305 CYS A C   
543  O O   . CYS A 88  ? 1.7796 1.5601 0.9232 0.2451  -0.0846 0.2036  305 CYS A O   
544  C CB  . CYS A 88  ? 1.7793 1.5659 0.9594 0.2529  -0.0845 0.1803  305 CYS A CB  
545  S SG  . CYS A 88  ? 1.8522 1.6212 1.0099 0.2596  -0.1113 0.1713  305 CYS A SG  
546  N N   . LYS A 89  ? 1.7515 1.5262 0.9134 0.2439  -0.0733 0.2004  306 LYS A N   
547  C CA  . LYS A 89  ? 1.7583 1.5205 0.9078 0.2475  -0.0775 0.2034  306 LYS A CA  
548  C C   . LYS A 89  ? 1.8358 1.6012 0.9732 0.2542  -0.0753 0.2069  306 LYS A C   
549  O O   . LYS A 89  ? 1.8573 1.6284 0.9898 0.2635  -0.0760 0.2063  306 LYS A O   
550  C CB  . LYS A 89  ? 1.7971 1.5396 0.9449 0.2438  -0.0837 0.2074  306 LYS A CB  
551  C CG  . LYS A 89  ? 1.8694 1.5963 1.0278 0.2388  -0.0939 0.2069  306 LYS A CG  
552  C CD  . LYS A 89  ? 1.9750 1.6747 1.1276 0.2320  -0.1076 0.2181  306 LYS A CD  
553  C CE  . LYS A 89  ? 2.1947 1.8664 1.3565 0.2254  -0.1236 0.2207  306 LYS A CE  
554  N NZ  . LYS A 89  ? 2.3585 1.9948 1.5106 0.2160  -0.1445 0.2382  306 LYS A NZ  
555  N N   . ARG A 90  ? 1.7831 1.5441 0.9155 0.2492  -0.0730 0.2099  307 ARG A N   
556  C CA  . ARG A 90  ? 1.7828 1.5360 0.9057 0.2525  -0.0780 0.2137  307 ARG A CA  
557  C C   . ARG A 90  ? 1.8043 1.5741 0.9342 0.2545  -0.0798 0.2203  307 ARG A C   
558  O O   . ARG A 90  ? 1.8076 1.5893 0.9463 0.2619  -0.0845 0.2242  307 ARG A O   
559  C CB  . ARG A 90  ? 1.8160 1.5444 0.9204 0.2396  -0.0789 0.2162  307 ARG A CB  
560  C CG  . ARG A 90  ? 1.9752 1.6773 1.0653 0.2403  -0.0949 0.2175  307 ARG A CG  
561  C CD  . ARG A 90  ? 2.1475 1.8130 1.2086 0.2210  -0.0986 0.2213  307 ARG A CD  
562  N NE  . ARG A 90  ? 2.2391 1.8823 1.2954 0.2218  -0.1108 0.2278  307 ARG A NE  
563  C CZ  . ARG A 90  ? 2.3271 1.9212 1.3497 0.2046  -0.1196 0.2327  307 ARG A CZ  
564  N NH1 . ARG A 90  ? 2.0721 1.6421 1.0605 0.1838  -0.1125 0.2304  307 ARG A NH1 
565  N NH2 . ARG A 90  ? 2.1603 1.7275 1.1813 0.2048  -0.1366 0.2423  307 ARG A NH2 
566  N N   . ALA A 91  ? 1.7363 1.5073 0.8623 0.2486  -0.0801 0.2223  308 ALA A N   
567  C CA  . ALA A 91  ? 1.7251 1.5026 0.8465 0.2449  -0.0919 0.2336  308 ALA A CA  
568  C C   . ALA A 91  ? 1.7560 1.5658 0.8906 0.2440  -0.0934 0.2359  308 ALA A C   
569  O O   . ALA A 91  ? 1.7524 1.5834 0.8931 0.2393  -0.1008 0.2500  308 ALA A O   
570  C CB  . ALA A 91  ? 1.7436 1.5034 0.8459 0.2425  -0.0995 0.2312  308 ALA A CB  
571  N N   . LEU A 92  ? 1.7032 1.5158 0.8407 0.2459  -0.0867 0.2242  309 LEU A N   
572  C CA  . LEU A 92  ? 1.7024 1.5356 0.8401 0.2430  -0.0845 0.2238  309 LEU A CA  
573  C C   . LEU A 92  ? 1.7846 1.6443 0.9346 0.2576  -0.0722 0.2249  309 LEU A C   
574  O O   . LEU A 92  ? 1.7921 1.6907 0.9504 0.2545  -0.0683 0.2329  309 LEU A O   
575  C CB  . LEU A 92  ? 1.7006 1.5097 0.8301 0.2413  -0.0846 0.2115  309 LEU A CB  
576  C CG  . LEU A 92  ? 1.7704 1.5818 0.8850 0.2374  -0.0810 0.2087  309 LEU A CG  
577  C CD1 . LEU A 92  ? 1.7777 1.5930 0.8773 0.2139  -0.0962 0.2133  309 LEU A CD1 
578  C CD2 . LEU A 92  ? 1.8284 1.5987 0.9314 0.2412  -0.0828 0.1996  309 LEU A CD2 
579  N N   . GLU A 93  ? 1.7513 1.5918 0.9016 0.2731  -0.0691 0.2169  310 GLU A N   
580  C CA  . GLU A 93  ? 1.7638 1.6183 0.9216 0.2944  -0.0648 0.2119  310 GLU A CA  
581  C C   . GLU A 93  ? 1.7963 1.6862 0.9821 0.2961  -0.0678 0.2231  310 GLU A C   
582  O O   . GLU A 93  ? 1.8011 1.7343 1.0073 0.3112  -0.0590 0.2219  310 GLU A O   
583  C CB  . GLU A 93  ? 1.8041 1.6153 0.9446 0.3051  -0.0744 0.2025  310 GLU A CB  
584  C CG  . GLU A 93  ? 2.0423 1.8334 1.1583 0.3242  -0.0744 0.1913  310 GLU A CG  
585  C CD  . GLU A 93  ? 2.4188 2.1988 1.5172 0.3168  -0.0673 0.1905  310 GLU A CD  
586  O OE1 . GLU A 93  ? 2.3292 2.0951 1.4301 0.2958  -0.0712 0.1955  310 GLU A OE1 
587  O OE2 . GLU A 93  ? 2.4058 2.1866 1.4850 0.3336  -0.0592 0.1832  310 GLU A OE2 
588  N N   . ILE A 94  ? 1.7394 1.6113 0.9256 0.2805  -0.0802 0.2353  311 ILE A N   
589  C CA  . ILE A 94  ? 1.7278 1.6165 0.9358 0.2754  -0.0919 0.2528  311 ILE A CA  
590  C C   . ILE A 94  ? 1.7533 1.6972 0.9779 0.2638  -0.0890 0.2691  311 ILE A C   
591  O O   . ILE A 94  ? 1.7491 1.7450 1.0100 0.2703  -0.0860 0.2780  311 ILE A O   
592  C CB  . ILE A 94  ? 1.7720 1.6071 0.9555 0.2595  -0.1079 0.2625  311 ILE A CB  
593  C CG1 . ILE A 94  ? 1.7999 1.5874 0.9673 0.2642  -0.1123 0.2502  311 ILE A CG1 
594  C CG2 . ILE A 94  ? 1.7822 1.6202 0.9756 0.2472  -0.1277 0.2886  311 ILE A CG2 
595  C CD1 . ILE A 94  ? 1.9766 1.7116 1.1067 0.2487  -0.1156 0.2519  311 ILE A CD1 
596  N N   . ARG A 95  ? 1.6968 1.6313 0.8955 0.2455  -0.0922 0.2724  312 ARG A N   
597  C CA  . ARG A 95  ? 1.7000 1.6736 0.8976 0.2243  -0.0980 0.2892  312 ARG A CA  
598  C C   . ARG A 95  ? 1.7611 1.7969 0.9782 0.2309  -0.0737 0.2839  312 ARG A C   
599  O O   . ARG A 95  ? 1.7500 1.8453 0.9884 0.2169  -0.0734 0.3039  312 ARG A O   
600  C CB  . ARG A 95  ? 1.6977 1.6317 0.8552 0.2064  -0.1135 0.2859  312 ARG A CB  
601  C CG  . ARG A 95  ? 1.7666 1.6522 0.8995 0.1994  -0.1402 0.2965  312 ARG A CG  
602  C CD  . ARG A 95  ? 1.9101 1.7633 1.0048 0.1854  -0.1631 0.2925  312 ARG A CD  
603  N NE  . ARG A 95  ? 2.0825 1.8958 1.1437 0.1772  -0.1973 0.3104  312 ARG A NE  
604  C CZ  . ARG A 95  ? 2.2198 1.9806 1.2553 0.1915  -0.2039 0.3006  312 ARG A CZ  
605  N NH1 . ARG A 95  ? 2.0780 1.8314 1.1262 0.2099  -0.1776 0.2749  312 ARG A NH1 
606  N NH2 . ARG A 95  ? 1.9925 1.7072 0.9854 0.1869  -0.2378 0.3179  312 ARG A NH2 
607  N N   . GLU A 96  ? 1.7383 1.7592 0.9448 0.2520  -0.0543 0.2592  313 GLU A N   
608  C CA  . GLU A 96  ? 1.7647 1.8289 0.9749 0.2663  -0.0286 0.2490  313 GLU A CA  
609  C C   . GLU A 96  ? 1.8249 1.9474 1.0824 0.2933  -0.0167 0.2494  313 GLU A C   
610  O O   . GLU A 96  ? 1.8417 2.0346 1.1189 0.2984  0.0052  0.2518  313 GLU A O   
611  C CB  . GLU A 96  ? 1.8029 1.8133 0.9773 0.2843  -0.0204 0.2249  313 GLU A CB  
612  C CG  . GLU A 96  ? 1.9300 1.8973 1.0646 0.2589  -0.0282 0.2226  313 GLU A CG  
613  C CD  . GLU A 96  ? 2.1241 2.0241 1.2277 0.2709  -0.0311 0.2061  313 GLU A CD  
614  O OE1 . GLU A 96  ? 2.0340 1.9111 1.1421 0.2943  -0.0335 0.1987  313 GLU A OE1 
615  O OE2 . GLU A 96  ? 1.9428 1.8067 1.0150 0.2528  -0.0373 0.2030  313 GLU A OE2 
616  N N   . LYS A 97  ? 1.7571 1.8506 1.0324 0.3099  -0.0319 0.2461  314 LYS A N   
617  C CA  . LYS A 97  ? 1.7502 1.8837 1.0730 0.3371  -0.0318 0.2436  314 LYS A CA  
618  C C   . LYS A 97  ? 1.7572 1.9607 1.1306 0.3177  -0.0369 0.2740  314 LYS A C   
619  O O   . LYS A 97  ? 1.7584 2.0440 1.1793 0.3341  -0.0197 0.2754  314 LYS A O   
620  C CB  . LYS A 97  ? 1.7911 1.8546 1.1059 0.3484  -0.0569 0.2339  314 LYS A CB  
621  C CG  . LYS A 97  ? 2.0898 2.1761 1.4497 0.3767  -0.0682 0.2272  314 LYS A CG  
622  C CD  . LYS A 97  ? 2.2472 2.2538 1.5913 0.3729  -0.1017 0.2240  314 LYS A CD  
623  C CE  . LYS A 97  ? 2.4057 2.4271 1.7964 0.3982  -0.1220 0.2169  314 LYS A CE  
624  N NZ  . LYS A 97  ? 2.5434 2.4770 1.9118 0.3842  -0.1604 0.2173  314 LYS A NZ  
625  N N   . VAL A 98  ? 1.6823 1.8533 1.0430 0.2837  -0.0620 0.2993  315 VAL A N   
626  C CA  . VAL A 98  ? 1.6656 1.8783 1.0601 0.2576  -0.0810 0.3365  315 VAL A CA  
627  C C   . VAL A 98  ? 1.6937 1.9776 1.0889 0.2280  -0.0711 0.3579  315 VAL A C   
628  O O   . VAL A 98  ? 1.6784 2.0547 1.1276 0.2260  -0.0603 0.3751  315 VAL A O   
629  C CB  . VAL A 98  ? 1.7171 1.8438 1.0773 0.2359  -0.1180 0.3544  315 VAL A CB  
630  C CG1 . VAL A 98  ? 1.7226 1.8719 1.1015 0.2053  -0.1481 0.3988  315 VAL A CG1 
631  C CG2 . VAL A 98  ? 1.7222 1.7833 1.0803 0.2569  -0.1285 0.3373  315 VAL A CG2 
632  N N   . LEU A 99  ? 1.3774 2.5991 0.9445 0.5160  -0.1705 0.0851  316 LEU A N   
633  C CA  . LEU A 99  ? 1.2928 2.5619 0.9760 0.4254  -0.1857 0.0581  316 LEU A CA  
634  C C   . LEU A 99  ? 1.3021 2.5044 0.9975 0.4361  -0.1689 0.0954  316 LEU A C   
635  O O   . LEU A 99  ? 1.2528 2.5644 1.0282 0.4013  -0.1793 0.0903  316 LEU A O   
636  C CB  . LEU A 99  ? 1.2601 2.4298 0.9972 0.3298  -0.1880 0.0159  316 LEU A CB  
637  C CG  . LEU A 99  ? 1.3481 2.5740 1.0768 0.3107  -0.2080 -0.0297 316 LEU A CG  
638  C CD1 . LEU A 99  ? 1.3492 2.4073 1.0674 0.2682  -0.1933 -0.0429 316 LEU A CD1 
639  C CD2 . LEU A 99  ? 1.3596 2.7587 1.1737 0.2438  -0.2431 -0.0833 316 LEU A CD2 
640  N N   . GLY A 100 ? 1.2832 2.3059 0.9022 0.4786  -0.1428 0.1302  317 GLY A N   
641  C CA  . GLY A 100 ? 1.2717 2.2072 0.8869 0.4946  -0.1289 0.1603  317 GLY A CA  
642  C C   . GLY A 100 ? 1.3066 2.0536 0.9349 0.4405  -0.1141 0.1527  317 GLY A C   
643  O O   . GLY A 100 ? 1.2791 1.9951 0.9524 0.3725  -0.1167 0.1206  317 GLY A O   
644  N N   . LYS A 101 ? 1.2728 1.8994 0.8576 0.4744  -0.0998 0.1801  318 LYS A N   
645  C CA  . LYS A 101 ? 1.2427 1.7020 0.8327 0.4334  -0.0876 0.1737  318 LYS A CA  
646  C C   . LYS A 101 ? 1.1778 1.6584 0.8742 0.3531  -0.0926 0.1441  318 LYS A C   
647  O O   . LYS A 101 ? 1.1657 1.5417 0.8756 0.3093  -0.0842 0.1293  318 LYS A O   
648  C CB  . LYS A 101 ? 1.3276 1.6802 0.8462 0.4934  -0.0782 0.2033  318 LYS A CB  
649  C CG  . LYS A 101 ? 1.5680 1.7310 1.0445 0.4735  -0.0648 0.2008  318 LYS A CG  
650  C CD  . LYS A 101 ? 1.7603 1.8361 1.1933 0.5156  -0.0647 0.2142  318 LYS A CD  
651  C CE  . LYS A 101 ? 1.9586 1.8615 1.3629 0.4841  -0.0576 0.2019  318 LYS A CE  
652  N NZ  . LYS A 101 ? 1.9081 1.8238 1.4121 0.4061  -0.0624 0.1707  318 LYS A NZ  
653  N N   . PHE A 102 ? 1.0694 1.6858 0.8377 0.3352  -0.1025 0.1381  319 PHE A N   
654  C CA  . PHE A 102 ? 1.0032 1.6278 0.8622 0.2653  -0.0992 0.1162  319 PHE A CA  
655  C C   . PHE A 102 ? 1.0424 1.7766 0.9687 0.2009  -0.1100 0.0830  319 PHE A C   
656  O O   . PHE A 102 ? 1.0023 1.8090 1.0023 0.1609  -0.1080 0.0771  319 PHE A O   
657  C CB  . PHE A 102 ? 0.9994 1.6547 0.8891 0.2900  -0.0926 0.1406  319 PHE A CB  
658  C CG  . PHE A 102 ? 1.0529 1.5945 0.8748 0.3522  -0.0858 0.1654  319 PHE A CG  
659  C CD1 . PHE A 102 ? 1.1016 1.5198 0.9268 0.3315  -0.0765 0.1544  319 PHE A CD1 
660  C CD2 . PHE A 102 ? 1.1299 1.6933 0.8804 0.4351  -0.0893 0.1976  319 PHE A CD2 
661  C CE1 . PHE A 102 ? 1.1599 1.4780 0.9235 0.3840  -0.0754 0.1688  319 PHE A CE1 
662  C CE2 . PHE A 102 ? 1.2226 1.6645 0.8996 0.4919  -0.0849 0.2147  319 PHE A CE2 
663  C CZ  . PHE A 102 ? 1.1913 1.5119 0.8786 0.4616  -0.0802 0.1971  319 PHE A CZ  
664  N N   . HIS A 103 ? 1.0408 1.7805 0.9393 0.1893  -0.1198 0.0604  320 HIS A N   
665  C CA  . HIS A 103 ? 1.0434 1.8742 0.9922 0.1286  -0.1349 0.0195  320 HIS A CA  
666  C C   . HIS A 103 ? 1.1172 1.8322 1.0744 0.0714  -0.1254 -0.0110 320 HIS A C   
667  O O   . HIS A 103 ? 1.1345 1.7409 1.0404 0.0923  -0.1149 -0.0024 320 HIS A O   
668  C CB  . HIS A 103 ? 1.0958 2.0276 0.9995 0.1663  -0.1549 0.0114  320 HIS A CB  
669  C CG  . HIS A 103 ? 1.1475 2.2098 1.1038 0.1096  -0.1792 -0.0355 320 HIS A CG  
670  N ND1 . HIS A 103 ? 1.1869 2.1961 1.1411 0.0597  -0.1857 -0.0789 320 HIS A ND1 
671  C CD2 . HIS A 103 ? 1.1714 2.4155 1.1810 0.0950  -0.1992 -0.0469 320 HIS A CD2 
672  C CE1 . HIS A 103 ? 1.1976 2.3426 1.1993 0.0130  -0.2114 -0.1205 320 HIS A CE1 
673  N NE2 . HIS A 103 ? 1.1890 2.4871 1.2320 0.0274  -0.2207 -0.1035 320 HIS A NE2 
674  N N   . PRO A 104 ? 1.0711 1.8045 1.0863 0.0004  -0.1264 -0.0453 321 PRO A N   
675  C CA  . PRO A 104 ? 1.0763 1.6922 1.0808 -0.0404 -0.1142 -0.0720 321 PRO A CA  
676  C C   . PRO A 104 ? 1.1637 1.7370 1.1039 -0.0200 -0.1214 -0.0855 321 PRO A C   
677  O O   . PRO A 104 ? 1.1719 1.6381 1.0877 -0.0266 -0.1052 -0.0884 321 PRO A O   
678  C CB  . PRO A 104 ? 1.1208 1.7765 1.1815 -0.1151 -0.1175 -0.1098 321 PRO A CB  
679  C CG  . PRO A 104 ? 1.1573 1.9188 1.2794 -0.1187 -0.1168 -0.0870 321 PRO A CG  
680  C CD  . PRO A 104 ? 1.0889 1.9431 1.1783 -0.0473 -0.1344 -0.0592 321 PRO A CD  
681  N N   . ASP A 105 ? 1.1359 1.8012 1.0452 0.0133  -0.1428 -0.0891 322 ASP A N   
682  C CA  . ASP A 105 ? 1.1651 1.8001 1.0087 0.0451  -0.1456 -0.0938 322 ASP A CA  
683  C C   . ASP A 105 ? 1.1797 1.7165 0.9763 0.0933  -0.1220 -0.0480 322 ASP A C   
684  O O   . ASP A 105 ? 1.2003 1.6648 0.9600 0.0992  -0.1099 -0.0453 322 ASP A O   
685  C CB  . ASP A 105 ? 1.2293 2.0000 1.0483 0.0773  -0.1726 -0.1092 322 ASP A CB  
686  C CG  . ASP A 105 ? 1.3916 2.2569 1.2470 0.0214  -0.2018 -0.1686 322 ASP A CG  
687  O OD1 . ASP A 105 ? 1.3807 2.2032 1.2860 -0.0489 -0.1981 -0.1947 322 ASP A OD1 
688  O OD2 . ASP A 105 ? 1.5375 2.5174 1.3674 0.0486  -0.2274 -0.1904 322 ASP A OD2 
689  N N   . VAL A 106 ? 1.0986 1.6318 0.8957 0.1249  -0.1149 -0.0129 323 VAL A N   
690  C CA  . VAL A 106 ? 1.1046 1.5334 0.8572 0.1610  -0.0942 0.0255  323 VAL A CA  
691  C C   . VAL A 106 ? 1.1454 1.4740 0.9258 0.1205  -0.0780 0.0204  323 VAL A C   
692  O O   . VAL A 106 ? 1.1635 1.4121 0.9135 0.1260  -0.0624 0.0354  323 VAL A O   
693  C CB  . VAL A 106 ? 1.1509 1.5970 0.8877 0.2078  -0.0941 0.0571  323 VAL A CB  
694  C CG1 . VAL A 106 ? 1.1798 1.4968 0.8655 0.2357  -0.0746 0.0887  323 VAL A CG1 
695  C CG2 . VAL A 106 ? 1.1860 1.7470 0.8863 0.2599  -0.1076 0.0649  323 VAL A CG2 
696  N N   . ALA A 107 ? 1.0531 1.3945 0.8905 0.0803  -0.0791 0.0001  324 ALA A N   
697  C CA  . ALA A 107 ? 1.0160 1.2791 0.8747 0.0521  -0.0620 -0.0062 324 ALA A CA  
698  C C   . ALA A 107 ? 1.0292 1.2586 0.8661 0.0337  -0.0558 -0.0250 324 ALA A C   
699  O O   . ALA A 107 ? 1.0167 1.1842 0.8468 0.0316  -0.0394 -0.0174 324 ALA A O   
700  C CB  . ALA A 107 ? 1.0037 1.2868 0.9166 0.0228  -0.0582 -0.0188 324 ALA A CB  
701  N N   . LYS A 108 ? 0.9842 1.2632 0.8075 0.0242  -0.0701 -0.0506 325 LYS A N   
702  C CA  . LYS A 108 ? 1.0052 1.2530 0.7935 0.0187  -0.0658 -0.0685 325 LYS A CA  
703  C C   . LYS A 108 ? 1.0616 1.2837 0.8069 0.0548  -0.0541 -0.0365 325 LYS A C   
704  O O   . LYS A 108 ? 1.0627 1.2393 0.7924 0.0531  -0.0373 -0.0314 325 LYS A O   
705  C CB  . LYS A 108 ? 1.0711 1.3771 0.8488 0.0025  -0.0884 -0.1097 325 LYS A CB  
706  C CG  . LYS A 108 ? 1.4466 1.7268 1.1691 0.0145  -0.0880 -0.1275 325 LYS A CG  
707  C CD  . LYS A 108 ? 1.5928 1.9451 1.2720 0.0585  -0.1045 -0.1237 325 LYS A CD  
708  C CE  . LYS A 108 ? 1.5245 1.8594 1.1427 0.0836  -0.1031 -0.1360 325 LYS A CE  
709  N NZ  . LYS A 108 ? 1.5292 1.8609 1.1328 0.0522  -0.1233 -0.1952 325 LYS A NZ  
710  N N   . GLN A 109 ? 1.0162 1.2659 0.7401 0.0891  -0.0583 -0.0110 326 GLN A N   
711  C CA  . GLN A 109 ? 1.0511 1.2603 0.7316 0.1197  -0.0401 0.0253  326 GLN A CA  
712  C C   . GLN A 109 ? 1.1251 1.2595 0.8255 0.1011  -0.0209 0.0459  326 GLN A C   
713  O O   . GLN A 109 ? 1.1658 1.2673 0.8547 0.0960  -0.0023 0.0614  326 GLN A O   
714  C CB  . GLN A 109 ? 1.1020 1.3365 0.7417 0.1668  -0.0428 0.0505  326 GLN A CB  
715  C CG  . GLN A 109 ? 1.2568 1.5555 0.8467 0.2079  -0.0492 0.0477  326 GLN A CG  
716  C CD  . GLN A 109 ? 1.4537 1.7305 1.0168 0.2109  -0.0349 0.0500  326 GLN A CD  
717  O OE1 . GLN A 109 ? 1.3851 1.7040 0.9495 0.2010  -0.0506 0.0139  326 GLN A OE1 
718  N NE2 . GLN A 109 ? 1.3203 1.5280 0.8575 0.2225  -0.0038 0.0921  326 GLN A NE2 
719  N N   . LEU A 110 ? 1.0394 1.1590 0.7717 0.0919  -0.0263 0.0450  327 LEU A N   
720  C CA  . LEU A 110 ? 1.0126 1.0733 0.7648 0.0765  -0.0150 0.0554  327 LEU A CA  
721  C C   . LEU A 110 ? 1.0584 1.1131 0.8356 0.0497  -0.0034 0.0422  327 LEU A C   
722  O O   . LEU A 110 ? 1.0819 1.1091 0.8614 0.0385  0.0103  0.0559  327 LEU A O   
723  C CB  . LEU A 110 ? 0.9785 1.0391 0.7553 0.0824  -0.0255 0.0519  327 LEU A CB  
724  C CG  . LEU A 110 ? 1.0608 1.1133 0.8004 0.1204  -0.0324 0.0730  327 LEU A CG  
725  C CD1 . LEU A 110 ? 1.0316 1.1165 0.7987 0.1335  -0.0441 0.0690  327 LEU A CD1 
726  C CD2 . LEU A 110 ? 1.1039 1.0658 0.8023 0.1277  -0.0201 0.0959  327 LEU A CD2 
727  N N   . SER A 111 ? 0.9841 1.0658 0.7738 0.0402  -0.0072 0.0160  328 SER A N   
728  C CA  . SER A 111 ? 0.9859 1.0578 0.7793 0.0291  0.0068  0.0037  328 SER A CA  
729  C C   . SER A 111 ? 1.1050 1.1827 0.8664 0.0374  0.0188  0.0178  328 SER A C   
730  O O   . SER A 111 ? 1.1138 1.1909 0.8810 0.0341  0.0353  0.0267  328 SER A O   
731  C CB  . SER A 111 ? 1.0695 1.1460 0.8626 0.0191  0.0022  -0.0274 328 SER A CB  
732  O OG  . SER A 111 ? 1.2474 1.3264 1.0761 0.0095  -0.0028 -0.0337 328 SER A OG  
733  N N   . ASN A 112 ? 1.0841 1.1805 0.8117 0.0539  0.0118  0.0228  329 ASN A N   
734  C CA  . ASN A 112 ? 1.1040 1.2111 0.7957 0.0717  0.0257  0.0422  329 ASN A CA  
735  C C   . ASN A 112 ? 1.1406 1.2277 0.8398 0.0658  0.0450  0.0822  329 ASN A C   
736  O O   . ASN A 112 ? 1.1666 1.2651 0.8623 0.0644  0.0658  0.1034  329 ASN A O   
737  C CB  . ASN A 112 ? 1.1685 1.3068 0.8180 0.0997  0.0119  0.0341  329 ASN A CB  
738  C CG  . ASN A 112 ? 1.4496 1.6052 1.0731 0.1041  -0.0011 -0.0052 329 ASN A CG  
739  O OD1 . ASN A 112 ? 1.3849 1.5160 1.0065 0.0942  0.0073  -0.0201 329 ASN A OD1 
740  N ND2 . ASN A 112 ? 1.3565 1.5528 0.9504 0.1233  -0.0216 -0.0246 329 ASN A ND2 
741  N N   . LEU A 113 ? 1.0650 1.1206 0.7725 0.0610  0.0395  0.0923  330 LEU A N   
742  C CA  . LEU A 113 ? 1.0861 1.0958 0.7934 0.0472  0.0564  0.1240  330 LEU A CA  
743  C C   . LEU A 113 ? 1.1236 1.1346 0.8784 0.0105  0.0623  0.1185  330 LEU A C   
744  O O   . LEU A 113 ? 1.1550 1.1605 0.9194 -0.0128 0.0818  0.1417  330 LEU A O   
745  C CB  . LEU A 113 ? 1.1046 1.0682 0.7914 0.0614  0.0462  0.1295  330 LEU A CB  
746  C CG  . LEU A 113 ? 1.2341 1.1217 0.8823 0.0631  0.0666  0.1653  330 LEU A CG  
747  C CD1 . LEU A 113 ? 1.2885 1.1776 0.9057 0.0726  0.0955  0.1987  330 LEU A CD1 
748  C CD2 . LEU A 113 ? 1.3081 1.1636 0.9065 0.1053  0.0578  0.1722  330 LEU A CD2 
749  N N   . ALA A 114 ? 1.0329 1.0609 0.8177 0.0067  0.0479  0.0886  331 ALA A N   
750  C CA  . ALA A 114 ? 1.0025 1.0502 0.8275 -0.0137 0.0514  0.0780  331 ALA A CA  
751  C C   . ALA A 114 ? 1.0751 1.1767 0.9036 -0.0153 0.0704  0.0868  331 ALA A C   
752  O O   . ALA A 114 ? 1.0859 1.2194 0.9444 -0.0389 0.0806  0.0960  331 ALA A O   
753  C CB  . ALA A 114 ? 0.9695 1.0220 0.8102 -0.0012 0.0392  0.0501  331 ALA A CB  
754  N N   . LEU A 115 ? 1.0470 1.1645 0.8415 0.0111  0.0740  0.0828  332 LEU A N   
755  C CA  . LEU A 115 ? 1.0698 1.2354 0.8487 0.0257  0.0928  0.0935  332 LEU A CA  
756  C C   . LEU A 115 ? 1.1469 1.3406 0.9317 0.0123  0.1132  0.1333  332 LEU A C   
757  O O   . LEU A 115 ? 1.1418 1.3980 0.9456 0.0074  0.1309  0.1484  332 LEU A O   
758  C CB  . LEU A 115 ? 1.1048 1.2609 0.8305 0.0593  0.0882  0.0769  332 LEU A CB  
759  C CG  . LEU A 115 ? 1.1608 1.2945 0.8710 0.0713  0.0830  0.0417  332 LEU A CG  
760  C CD1 . LEU A 115 ? 1.2110 1.3212 0.8649 0.0922  0.0737  0.0190  332 LEU A CD1 
761  C CD2 . LEU A 115 ? 1.1806 1.3458 0.8879 0.0876  0.1038  0.0459  332 LEU A CD2 
762  N N   . LEU A 116 ? 1.1250 1.2774 0.8911 0.0099  0.1146  0.1536  333 LEU A N   
763  C CA  . LEU A 116 ? 1.1743 1.3319 0.9408 -0.0046 0.1414  0.1977  333 LEU A CA  
764  C C   . LEU A 116 ? 1.2483 1.4109 1.0708 -0.0609 0.1497  0.2068  333 LEU A C   
765  O O   . LEU A 116 ? 1.2682 1.4803 1.1150 -0.0847 0.1751  0.2377  333 LEU A O   
766  C CB  . LEU A 116 ? 1.2298 1.3250 0.9514 0.0139  0.1445  0.2169  333 LEU A CB  
767  C CG  . LEU A 116 ? 1.3024 1.4165 0.9659 0.0701  0.1429  0.2183  333 LEU A CG  
768  C CD1 . LEU A 116 ? 1.3508 1.4137 0.9691 0.0962  0.1425  0.2323  333 LEU A CD1 
769  C CD2 . LEU A 116 ? 1.3470 1.5150 0.9946 0.0907  0.1716  0.2522  333 LEU A CD2 
770  N N   . CYS A 117 ? 1.2016 1.3216 1.0453 -0.0821 0.1275  0.1783  334 CYS A N   
771  C CA  . CYS A 117 ? 1.2236 1.3437 1.1158 -0.1350 0.1254  0.1720  334 CYS A CA  
772  C C   . CYS A 117 ? 1.2387 1.4688 1.1785 -0.1442 0.1268  0.1594  334 CYS A C   
773  O O   . CYS A 117 ? 1.2542 1.5390 1.2396 -0.1905 0.1383  0.1708  334 CYS A O   
774  C CB  . CYS A 117 ? 1.2316 1.2771 1.1173 -0.1361 0.0988  0.1428  334 CYS A CB  
775  S SG  . CYS A 117 ? 1.3722 1.2907 1.1947 -0.1241 0.1019  0.1636  334 CYS A SG  
776  N N   . GLN A 118 ? 1.1552 1.4191 1.0809 -0.0991 0.1174  0.1368  335 GLN A N   
777  C CA  . GLN A 118 ? 1.1227 1.4841 1.0692 -0.0826 0.1226  0.1258  335 GLN A CA  
778  C C   . GLN A 118 ? 1.1792 1.6313 1.1335 -0.0843 0.1499  0.1611  335 GLN A C   
779  O O   . GLN A 118 ? 1.1605 1.7183 1.1571 -0.0991 0.1578  0.1640  335 GLN A O   
780  C CB  . GLN A 118 ? 1.1206 1.4579 1.0229 -0.0276 0.1168  0.1032  335 GLN A CB  
781  C CG  . GLN A 118 ? 1.2757 1.6772 1.1814 0.0033  0.1221  0.0859  335 GLN A CG  
782  C CD  . GLN A 118 ? 1.5987 1.9403 1.4494 0.0499  0.1229  0.0670  335 GLN A CD  
783  O OE1 . GLN A 118 ? 1.5422 1.8830 1.3422 0.0837  0.1370  0.0731  335 GLN A OE1 
784  N NE2 . GLN A 118 ? 1.5188 1.8025 1.3746 0.0512  0.1088  0.0438  335 GLN A NE2 
785  N N   . ASN A 119 ? 1.1646 1.5868 1.0785 -0.0658 0.1646  0.1895  336 ASN A N   
786  C CA  . ASN A 119 ? 1.1928 1.6945 1.1034 -0.0557 0.1943  0.2311  336 ASN A CA  
787  C C   . ASN A 119 ? 1.2822 1.8020 1.2425 -0.1198 0.2149  0.2684  336 ASN A C   
788  O O   . ASN A 119 ? 1.3273 1.9062 1.2888 -0.1167 0.2453  0.3129  336 ASN A O   
789  C CB  . ASN A 119 ? 1.2220 1.6848 1.0583 0.0030  0.2000  0.2413  336 ASN A CB  
790  C CG  . ASN A 119 ? 1.5141 1.9580 1.2977 0.0573  0.1852  0.2048  336 ASN A CG  
791  O OD1 . ASN A 119 ? 1.4536 1.9149 1.2491 0.0624  0.1775  0.1782  336 ASN A OD1 
792  N ND2 . ASN A 119 ? 1.4307 1.8330 1.1492 0.1002  0.1824  0.2016  336 ASN A ND2 
793  N N   . GLN A 120 ? 1.2227 1.6862 1.2200 -0.1775 0.2003  0.2505  337 GLN A N   
794  C CA  . GLN A 120 ? 1.2665 1.7168 1.3088 -0.2534 0.2171  0.2747  337 GLN A CA  
795  C C   . GLN A 120 ? 1.2838 1.7825 1.3901 -0.3075 0.1943  0.2363  337 GLN A C   
796  O O   . GLN A 120 ? 1.3397 1.8392 1.4937 -0.3844 0.2017  0.2426  337 GLN A O   
797  C CB  . GLN A 120 ? 1.3432 1.6358 1.3391 -0.2624 0.2189  0.2840  337 GLN A CB  
798  C CG  . GLN A 120 ? 1.4034 1.6578 1.3386 -0.2140 0.2455  0.3265  337 GLN A CG  
799  C CD  . GLN A 120 ? 1.6677 1.7749 1.5519 -0.2172 0.2514  0.3383  337 GLN A CD  
800  O OE1 . GLN A 120 ? 1.7117 1.7607 1.5964 -0.2611 0.2837  0.3754  337 GLN A OE1 
801  N NE2 . GLN A 120 ? 1.4897 1.5325 1.3262 -0.1708 0.2233  0.3087  337 GLN A NE2 
802  N N   . GLY A 121 ? 1.1618 1.6962 1.2639 -0.2657 0.1681  0.1958  338 GLY A N   
803  C CA  . GLY A 121 ? 1.1344 1.7267 1.2849 -0.2928 0.1432  0.1542  338 GLY A CA  
804  C C   . GLY A 121 ? 1.2345 1.7080 1.3857 -0.3362 0.1186  0.1247  338 GLY A C   
805  O O   . GLY A 121 ? 1.2604 1.7745 1.4621 -0.3937 0.1043  0.0996  338 GLY A O   
806  N N   . LYS A 122 ? 1.1982 1.5302 1.2890 -0.3057 0.1120  0.1252  339 LYS A N   
807  C CA  . LYS A 122 ? 1.2399 1.4429 1.3088 -0.3283 0.0913  0.1027  339 LYS A CA  
808  C C   . LYS A 122 ? 1.2203 1.4109 1.2726 -0.2757 0.0608  0.0632  339 LYS A C   
809  O O   . LYS A 122 ? 1.2367 1.3318 1.2395 -0.2375 0.0523  0.0624  339 LYS A O   
810  C CB  . LYS A 122 ? 1.3384 1.4059 1.3454 -0.3207 0.1091  0.1364  339 LYS A CB  
811  C CG  . LYS A 122 ? 1.5038 1.5729 1.5181 -0.3622 0.1482  0.1848  339 LYS A CG  
812  C CD  . LYS A 122 ? 1.6168 1.5878 1.5576 -0.3173 0.1692  0.2217  339 LYS A CD  
813  C CE  . LYS A 122 ? 1.9016 1.7299 1.8029 -0.3563 0.1910  0.2457  339 LYS A CE  
814  N NZ  . LYS A 122 ? 2.1012 1.8424 1.9192 -0.2937 0.2100  0.2795  339 LYS A NZ  
815  N N   . ALA A 123 ? 1.1000 1.4003 1.1943 -0.2696 0.0474  0.0339  340 ALA A N   
816  C CA  . ALA A 123 ? 1.0272 1.3400 1.1120 -0.2151 0.0263  0.0009  340 ALA A CA  
817  C C   . ALA A 123 ? 1.0683 1.2587 1.1152 -0.1980 0.0041  -0.0167 340 ALA A C   
818  O O   . ALA A 123 ? 0.9917 1.1564 1.0109 -0.1424 0.0010  -0.0187 340 ALA A O   
819  C CB  . ALA A 123 ? 1.0092 1.4521 1.1432 -0.2221 0.0149  -0.0289 340 ALA A CB  
820  N N   . GLU A 124 ? 1.1156 1.2273 1.1569 -0.2460 -0.0088 -0.0275 341 GLU A N   
821  C CA  . GLU A 124 ? 1.1588 1.1452 1.1503 -0.2262 -0.0292 -0.0421 341 GLU A CA  
822  C C   . GLU A 124 ? 1.1844 1.0876 1.1209 -0.1829 -0.0173 -0.0106 341 GLU A C   
823  O O   . GLU A 124 ? 1.1584 1.0204 1.0633 -0.1328 -0.0310 -0.0179 341 GLU A O   
824  C CB  . GLU A 124 ? 1.2938 1.1896 1.2739 -0.2917 -0.0386 -0.0563 341 GLU A CB  
825  C CG  . GLU A 124 ? 1.4686 1.4505 1.5043 -0.3412 -0.0597 -0.0993 341 GLU A CG  
826  C CD  . GLU A 124 ? 1.8786 1.9938 1.9866 -0.4025 -0.0426 -0.0901 341 GLU A CD  
827  O OE1 . GLU A 124 ? 1.8556 1.9872 1.9680 -0.4091 -0.0100 -0.0450 341 GLU A OE1 
828  O OE2 . GLU A 124 ? 1.8809 2.0975 2.0409 -0.4397 -0.0626 -0.1284 341 GLU A OE2 
829  N N   . GLU A 125 ? 1.1428 1.0361 1.0697 -0.1993 0.0087  0.0252  342 GLU A N   
830  C CA  . GLU A 125 ? 1.1398 0.9784 1.0162 -0.1590 0.0198  0.0534  342 GLU A CA  
831  C C   . GLU A 125 ? 1.1064 1.0195 0.9937 -0.1117 0.0183  0.0500  342 GLU A C   
832  O O   . GLU A 125 ? 1.1033 0.9865 0.9611 -0.0710 0.0098  0.0504  342 GLU A O   
833  C CB  . GLU A 125 ? 1.2140 1.0232 1.0721 -0.1854 0.0492  0.0916  342 GLU A CB  
834  C CG  . GLU A 125 ? 1.4879 1.1685 1.3026 -0.2184 0.0579  0.1034  342 GLU A CG  
835  C CD  . GLU A 125 ? 1.9470 1.6048 1.7566 -0.2577 0.0951  0.1439  342 GLU A CD  
836  O OE1 . GLU A 125 ? 2.0141 1.6562 1.7812 -0.2183 0.1162  0.1785  342 GLU A OE1 
837  O OE2 . GLU A 125 ? 1.8881 1.5507 1.7376 -0.3282 0.1039  0.1412  342 GLU A OE2 
838  N N   . VAL A 126 ? 0.9916 1.0007 0.9175 -0.1170 0.0278  0.0465  343 VAL A N   
839  C CA  . VAL A 126 ? 0.9240 0.9876 0.8517 -0.0771 0.0313  0.0401  343 VAL A CA  
840  C C   . VAL A 126 ? 0.9584 1.0023 0.8834 -0.0435 0.0148  0.0191  343 VAL A C   
841  O O   . VAL A 126 ? 0.9505 0.9769 0.8569 -0.0159 0.0137  0.0210  343 VAL A O   
842  C CB  . VAL A 126 ? 0.9452 1.1069 0.9053 -0.0811 0.0437  0.0355  343 VAL A CB  
843  C CG1 . VAL A 126 ? 0.9030 1.0918 0.8473 -0.0353 0.0516  0.0272  343 VAL A CG1 
844  C CG2 . VAL A 126 ? 0.9763 1.1754 0.9440 -0.1114 0.0637  0.0628  343 VAL A CG2 
845  N N   . GLU A 127 ? 0.9194 0.9739 0.8650 -0.0477 0.0018  -0.0015 344 GLU A N   
846  C CA  . GLU A 127 ? 0.8949 0.9384 0.8395 -0.0119 -0.0128 -0.0200 344 GLU A CA  
847  C C   . GLU A 127 ? 1.0044 0.9698 0.9130 0.0071  -0.0234 -0.0096 344 GLU A C   
848  O O   . GLU A 127 ? 0.9636 0.9343 0.8690 0.0427  -0.0231 -0.0078 344 GLU A O   
849  C CB  . GLU A 127 ? 0.9282 0.9950 0.8937 -0.0279 -0.0289 -0.0456 344 GLU A CB  
850  C CG  . GLU A 127 ? 1.0554 1.1242 1.0175 0.0171  -0.0445 -0.0674 344 GLU A CG  
851  C CD  . GLU A 127 ? 1.3534 1.4754 1.3392 0.0037  -0.0620 -0.1004 344 GLU A CD  
852  O OE1 . GLU A 127 ? 1.1718 1.3866 1.1917 -0.0166 -0.0529 -0.1059 344 GLU A OE1 
853  O OE2 . GLU A 127 ? 1.4229 1.5033 1.3904 0.0181  -0.0860 -0.1225 344 GLU A OE2 
854  N N   . TYR A 128 ? 1.0538 0.9495 0.9320 -0.0149 -0.0281 0.0011  345 TYR A N   
855  C CA  . TYR A 128 ? 1.0962 0.9220 0.9261 0.0141  -0.0352 0.0150  345 TYR A CA  
856  C C   . TYR A 128 ? 1.1052 0.9611 0.9284 0.0355  -0.0264 0.0328  345 TYR A C   
857  O O   . TYR A 128 ? 1.1096 0.9683 0.9204 0.0719  -0.0342 0.0367  345 TYR A O   
858  C CB  . TYR A 128 ? 1.2218 0.9517 1.0047 -0.0093 -0.0335 0.0264  345 TYR A CB  
859  C CG  . TYR A 128 ? 1.3165 0.9784 1.0330 0.0336  -0.0342 0.0480  345 TYR A CG  
860  C CD1 . TYR A 128 ? 1.3736 0.9946 1.0539 0.0786  -0.0511 0.0416  345 TYR A CD1 
861  C CD2 . TYR A 128 ? 1.3629 1.0124 1.0470 0.0397  -0.0171 0.0767  345 TYR A CD2 
862  C CE1 . TYR A 128 ? 1.4552 1.0284 1.0680 0.1284  -0.0501 0.0650  345 TYR A CE1 
863  C CE2 . TYR A 128 ? 1.4343 1.0395 1.0518 0.0898  -0.0166 0.0976  345 TYR A CE2 
864  C CZ  . TYR A 128 ? 1.6192 1.1865 1.2001 0.1338  -0.0326 0.0927  345 TYR A CZ  
865  O OH  . TYR A 128 ? 1.7466 1.2819 1.2547 0.1928  -0.0303 0.1170  345 TYR A OH  
866  N N   . TYR A 129 ? 1.0267 0.9119 0.8570 0.0138  -0.0115 0.0429  346 TYR A N   
867  C CA  . TYR A 129 ? 1.0030 0.9205 0.8234 0.0302  -0.0074 0.0516  346 TYR A CA  
868  C C   . TYR A 129 ? 0.9535 0.9227 0.8053 0.0416  -0.0087 0.0352  346 TYR A C   
869  O O   . TYR A 129 ? 0.9263 0.9132 0.7745 0.0592  -0.0154 0.0362  346 TYR A O   
870  C CB  . TYR A 129 ? 1.0455 0.9746 0.8536 0.0131  0.0081  0.0659  346 TYR A CB  
871  C CG  . TYR A 129 ? 1.1520 1.0188 0.9186 0.0082  0.0175  0.0913  346 TYR A CG  
872  C CD1 . TYR A 129 ? 1.2226 1.0447 0.9381 0.0418  0.0133  0.1058  346 TYR A CD1 
873  C CD2 . TYR A 129 ? 1.2063 1.0611 0.9798 -0.0268 0.0355  0.1049  346 TYR A CD2 
874  C CE1 . TYR A 129 ? 1.3220 1.0667 0.9829 0.0452  0.0296  0.1333  346 TYR A CE1 
875  C CE2 . TYR A 129 ? 1.3135 1.0947 1.0446 -0.0350 0.0523  0.1330  346 TYR A CE2 
876  C CZ  . TYR A 129 ? 1.4638 1.1797 1.1323 0.0038  0.0510  0.1473  346 TYR A CZ  
877  O OH  . TYR A 129 ? 1.5873 1.2118 1.1983 0.0035  0.0750  0.1790  346 TYR A OH  
878  N N   . TYR A 130 ? 0.8454 0.8401 0.7253 0.0331  0.0001  0.0216  347 TYR A N   
879  C CA  . TYR A 130 ? 0.7945 0.8147 0.6924 0.0466  0.0078  0.0094  347 TYR A CA  
880  C C   . TYR A 130 ? 0.8439 0.8592 0.7532 0.0717  0.0003  0.0092  347 TYR A C   
881  O O   . TYR A 130 ? 0.8344 0.8643 0.7545 0.0775  0.0057  0.0086  347 TYR A O   
882  C CB  . TYR A 130 ? 0.7747 0.8200 0.6835 0.0473  0.0242  -0.0002 347 TYR A CB  
883  C CG  . TYR A 130 ? 0.8052 0.8653 0.6963 0.0368  0.0376  0.0014  347 TYR A CG  
884  C CD1 . TYR A 130 ? 0.8493 0.8973 0.7193 0.0330  0.0373  -0.0011 347 TYR A CD1 
885  C CD2 . TYR A 130 ? 0.8074 0.9040 0.7009 0.0339  0.0494  0.0039  347 TYR A CD2 
886  C CE1 . TYR A 130 ? 0.8642 0.9202 0.7062 0.0321  0.0476  -0.0021 347 TYR A CE1 
887  C CE2 . TYR A 130 ? 0.8294 0.9432 0.6983 0.0351  0.0633  0.0096  347 TYR A CE2 
888  C CZ  . TYR A 130 ? 0.8949 0.9803 0.7332 0.0370  0.0620  0.0061  347 TYR A CZ  
889  O OH  . TYR A 130 ? 0.9044 1.0008 0.7074 0.0465  0.0736  0.0090  347 TYR A OH  
890  N N   . ARG A 131 ? 0.8097 0.8038 0.7144 0.0853  -0.0117 0.0097  348 ARG A N   
891  C CA  . ARG A 131 ? 0.8116 0.8016 0.7173 0.1210  -0.0195 0.0130  348 ARG A CA  
892  C C   . ARG A 131 ? 0.8904 0.8846 0.7812 0.1328  -0.0272 0.0299  348 ARG A C   
893  O O   . ARG A 131 ? 0.8677 0.8952 0.7767 0.1521  -0.0235 0.0374  348 ARG A O   
894  C CB  . ARG A 131 ? 0.8456 0.8020 0.7350 0.1348  -0.0350 0.0038  348 ARG A CB  
895  C CG  . ARG A 131 ? 0.9557 0.9432 0.8683 0.1389  -0.0305 -0.0163 348 ARG A CG  
896  C CD  . ARG A 131 ? 1.0524 1.0121 0.9496 0.1411  -0.0523 -0.0351 348 ARG A CD  
897  N NE  . ARG A 131 ? 1.1555 1.1702 1.0761 0.1538  -0.0514 -0.0578 348 ARG A NE  
898  C CZ  . ARG A 131 ? 1.3802 1.3957 1.2967 0.1525  -0.0729 -0.0852 348 ARG A CZ  
899  N NH1 . ARG A 131 ? 1.3436 1.2836 1.2270 0.1344  -0.0951 -0.0933 348 ARG A NH1 
900  N NH2 . ARG A 131 ? 1.2002 1.2905 1.1395 0.1698  -0.0720 -0.1068 348 ARG A NH2 
901  N N   . ARG A 132 ? 0.8901 0.8608 0.7484 0.1223  -0.0341 0.0384  349 ARG A N   
902  C CA  . ARG A 132 ? 0.9118 0.9018 0.7469 0.1418  -0.0411 0.0547  349 ARG A CA  
903  C C   . ARG A 132 ? 0.9386 0.9973 0.8060 0.1231  -0.0366 0.0491  349 ARG A C   
904  O O   . ARG A 132 ? 0.9571 1.0703 0.8339 0.1382  -0.0425 0.0572  349 ARG A O   
905  C CB  . ARG A 132 ? 0.9747 0.9148 0.7563 0.1427  -0.0428 0.0671  349 ARG A CB  
906  C CG  . ARG A 132 ? 1.1794 1.0496 0.9056 0.1792  -0.0504 0.0794  349 ARG A CG  
907  C CD  . ARG A 132 ? 1.4616 1.2857 1.1205 0.1962  -0.0450 0.1009  349 ARG A CD  
908  N NE  . ARG A 132 ? 1.5851 1.4851 1.2311 0.2322  -0.0483 0.1155  349 ARG A NE  
909  C CZ  . ARG A 132 ? 1.8070 1.7023 1.3976 0.2572  -0.0415 0.1345  349 ARG A CZ  
910  N NH1 . ARG A 132 ? 1.5726 1.3740 1.1133 0.2484  -0.0257 0.1464  349 ARG A NH1 
911  N NH2 . ARG A 132 ? 1.7086 1.7006 1.2940 0.2918  -0.0485 0.1428  349 ARG A NH2 
912  N N   . ALA A 133 ? 0.8554 0.9142 0.7372 0.0900  -0.0267 0.0340  350 ALA A N   
913  C CA  . ALA A 133 ? 0.8257 0.9254 0.7273 0.0657  -0.0227 0.0196  350 ALA A CA  
914  C C   . ALA A 133 ? 0.8306 0.9483 0.7715 0.0623  -0.0122 0.0153  350 ALA A C   
915  O O   . ALA A 133 ? 0.7892 0.9552 0.7524 0.0471  -0.0152 0.0112  350 ALA A O   
916  C CB  . ALA A 133 ? 0.8368 0.9133 0.7271 0.0438  -0.0118 0.0065  350 ALA A CB  
917  N N   . LEU A 134 ? 0.7952 0.8803 0.7452 0.0768  0.0018  0.0168  351 LEU A N   
918  C CA  . LEU A 134 ? 0.7690 0.8579 0.7480 0.0848  0.0213  0.0195  351 LEU A CA  
919  C C   . LEU A 134 ? 0.8118 0.9464 0.8121 0.1061  0.0144  0.0392  351 LEU A C   
920  O O   . LEU A 134 ? 0.8046 0.9707 0.8384 0.0906  0.0280  0.0436  351 LEU A O   
921  C CB  . LEU A 134 ? 0.7438 0.8019 0.7168 0.1126  0.0348  0.0186  351 LEU A CB  
922  C CG  . LEU A 134 ? 0.7835 0.8208 0.7620 0.1195  0.0683  0.0155  351 LEU A CG  
923  C CD1 . LEU A 134 ? 0.7357 0.7756 0.7161 0.1694  0.0775  0.0240  351 LEU A CD1 
924  C CD2 . LEU A 134 ? 0.8353 0.8711 0.8341 0.0930  0.0870  0.0184  351 LEU A CD2 
925  N N   . GLU A 135 ? 0.7767 0.9131 0.7530 0.1401  -0.0048 0.0520  352 GLU A N   
926  C CA  . GLU A 135 ? 0.7834 0.9671 0.7629 0.1755  -0.0133 0.0749  352 GLU A CA  
927  C C   . GLU A 135 ? 0.8217 1.0882 0.8322 0.1472  -0.0160 0.0777  352 GLU A C   
928  O O   . GLU A 135 ? 0.8131 1.1376 0.8649 0.1480  -0.0050 0.0921  352 GLU A O   
929  C CB  . GLU A 135 ? 0.8329 0.9808 0.7557 0.2135  -0.0338 0.0833  352 GLU A CB  
930  C CG  . GLU A 135 ? 0.9612 1.1355 0.8655 0.2719  -0.0405 0.1082  352 GLU A CG  
931  C CD  . GLU A 135 ? 1.3513 1.4499 1.1810 0.3141  -0.0565 0.1122  352 GLU A CD  
932  O OE1 . GLU A 135 ? 1.4616 1.5534 1.2452 0.3254  -0.0648 0.1218  352 GLU A OE1 
933  O OE2 . GLU A 135 ? 1.1616 1.2035 0.9726 0.3381  -0.0596 0.1041  352 GLU A OE2 
934  N N   . ILE A 136 ? 0.7929 1.0707 0.7872 0.1193  -0.0288 0.0624  353 ILE A N   
935  C CA  . ILE A 136 ? 0.8085 1.1759 0.8295 0.0885  -0.0378 0.0541  353 ILE A CA  
936  C C   . ILE A 136 ? 0.9006 1.2783 0.9742 0.0319  -0.0203 0.0359  353 ILE A C   
937  O O   . ILE A 136 ? 0.9110 1.3626 1.0332 0.0178  -0.0143 0.0463  353 ILE A O   
938  C CB  . ILE A 136 ? 0.8583 1.2347 0.8383 0.0846  -0.0559 0.0406  353 ILE A CB  
939  C CG1 . ILE A 136 ? 0.8771 1.2215 0.7944 0.1424  -0.0645 0.0647  353 ILE A CG1 
940  C CG2 . ILE A 136 ? 0.8623 1.3539 0.8714 0.0569  -0.0708 0.0256  353 ILE A CG2 
941  C CD1 . ILE A 136 ? 0.9718 1.3018 0.8361 0.1514  -0.0721 0.0619  353 ILE A CD1 
942  N N   . TYR A 137 ? 0.8756 1.1761 0.9350 0.0017  -0.0086 0.0118  354 TYR A N   
943  C CA  . TYR A 137 ? 0.9192 1.1920 1.0046 -0.0483 0.0130  -0.0075 354 TYR A CA  
944  C C   . TYR A 137 ? 1.0028 1.2777 1.1313 -0.0466 0.0424  0.0152  354 TYR A C   
945  O O   . TYR A 137 ? 1.0197 1.3272 1.1907 -0.0952 0.0540  0.0094  354 TYR A O   
946  C CB  . TYR A 137 ? 0.9564 1.1301 0.9991 -0.0538 0.0273  -0.0269 354 TYR A CB  
947  C CG  . TYR A 137 ? 1.0041 1.1742 1.0065 -0.0624 0.0063  -0.0493 354 TYR A CG  
948  C CD1 . TYR A 137 ? 1.0535 1.2769 1.0598 -0.0976 -0.0144 -0.0750 354 TYR A CD1 
949  C CD2 . TYR A 137 ? 1.0105 1.1303 0.9718 -0.0362 0.0091  -0.0462 354 TYR A CD2 
950  C CE1 . TYR A 137 ? 1.0889 1.3107 1.0512 -0.0947 -0.0317 -0.0941 354 TYR A CE1 
951  C CE2 . TYR A 137 ? 1.0455 1.1649 0.9692 -0.0387 -0.0044 -0.0599 354 TYR A CE2 
952  C CZ  . TYR A 137 ? 1.2039 1.3693 1.1237 -0.0632 -0.0240 -0.0832 354 TYR A CZ  
953  O OH  . TYR A 137 ? 1.2873 1.4535 1.1631 -0.0547 -0.0354 -0.0948 354 TYR A OH  
954  N N   . ALA A 138 ? 0.9447 1.1869 1.0616 0.0083  0.0550  0.0404  355 ALA A N   
955  C CA  . ALA A 138 ? 0.9450 1.1863 1.0921 0.0289  0.0865  0.0675  355 ALA A CA  
956  C C   . ALA A 138 ? 0.9778 1.3254 1.1753 0.0299  0.0832  0.0943  355 ALA A C   
957  O O   . ALA A 138 ? 1.0032 1.3660 1.2447 0.0078  0.1145  0.1108  355 ALA A O   
958  C CB  . ALA A 138 ? 0.9314 1.1283 1.0468 0.0957  0.0922  0.0816  355 ALA A CB  
959  N N   . THR A 139 ? 0.8979 1.3196 1.0854 0.0582  0.0498  0.1025  356 THR A N   
960  C CA  . THR A 139 ? 0.8819 1.4257 1.1081 0.0753  0.0444  0.1326  356 THR A CA  
961  C C   . THR A 139 ? 0.9403 1.5907 1.2138 0.0099  0.0310  0.1162  356 THR A C   
962  O O   . THR A 139 ? 0.9378 1.6679 1.2768 -0.0250 0.0487  0.1313  356 THR A O   
963  C CB  . THR A 139 ? 0.9665 1.5302 1.1413 0.1542  0.0194  0.1531  356 THR A CB  
964  O OG1 . THR A 139 ? 1.0337 1.5607 1.1587 0.1489  -0.0066 0.1280  356 THR A OG1 
965  C CG2 . THR A 139 ? 0.9604 1.4446 1.0989 0.2186  0.0299  0.1688  356 THR A CG2 
966  N N   . ARG A 140 ? 0.9100 1.5692 1.1517 -0.0067 0.0006  0.0852  357 ARG A N   
967  C CA  . ARG A 140 ? 0.9209 1.6939 1.1976 -0.0612 -0.0208 0.0604  357 ARG A CA  
968  C C   . ARG A 140 ? 1.0139 1.7628 1.3378 -0.1547 -0.0049 0.0271  357 ARG A C   
969  O O   . ARG A 140 ? 1.0193 1.8849 1.4066 -0.2101 -0.0100 0.0187  357 ARG A O   
970  C CB  . ARG A 140 ? 0.8950 1.6757 1.1121 -0.0387 -0.0541 0.0387  357 ARG A CB  
971  C CG  . ARG A 140 ? 0.9388 1.7668 1.1081 0.0470  -0.0691 0.0726  357 ARG A CG  
972  C CD  . ARG A 140 ? 0.9800 1.9908 1.1864 0.0640  -0.0818 0.0928  357 ARG A CD  
973  N NE  . ARG A 140 ? 1.0337 2.1244 1.1905 0.1029  -0.1093 0.0869  357 ARG A NE  
974  C CZ  . ARG A 140 ? 1.2974 2.5003 1.4794 0.0604  -0.1312 0.0528  357 ARG A CZ  
975  N NH1 . ARG A 140 ? 1.1337 2.3727 1.3911 -0.0329 -0.1308 0.0176  357 ARG A NH1 
976  N NH2 . ARG A 140 ? 1.1894 2.4652 1.3147 0.1135  -0.1525 0.0522  357 ARG A NH2 
977  N N   . LEU A 141 ? 1.0100 1.6088 1.2992 -0.1714 0.0155  0.0081  358 LEU A N   
978  C CA  . LEU A 141 ? 1.0812 1.6124 1.3887 -0.2509 0.0369  -0.0237 358 LEU A CA  
979  C C   . LEU A 141 ? 1.2123 1.6502 1.5319 -0.2456 0.0884  0.0056  358 LEU A C   
980  O O   . LEU A 141 ? 1.1696 1.5838 1.4716 -0.1737 0.1015  0.0418  358 LEU A O   
981  C CB  . LEU A 141 ? 1.1061 1.5337 1.3467 -0.2636 0.0249  -0.0673 358 LEU A CB  
982  C CG  . LEU A 141 ? 1.1282 1.6221 1.3353 -0.2444 -0.0194 -0.0892 358 LEU A CG  
983  C CD1 . LEU A 141 ? 1.1415 1.5207 1.2766 -0.2315 -0.0202 -0.1132 358 LEU A CD1 
984  C CD2 . LEU A 141 ? 1.2016 1.8191 1.4494 -0.3042 -0.0485 -0.1242 358 LEU A CD2 
985  N N   . GLY A 142 ? 1.2803 1.6584 1.6216 -0.3192 0.1182  -0.0123 359 GLY A N   
986  C CA  . GLY A 142 ? 1.3424 1.6192 1.6876 -0.3186 0.1765  0.0159  359 GLY A CA  
987  C C   . GLY A 142 ? 1.4280 1.5730 1.6995 -0.2446 0.2018  0.0287  359 GLY A C   
988  O O   . GLY A 142 ? 1.3988 1.5122 1.6143 -0.2087 0.1751  0.0087  359 GLY A O   
989  N N   . PRO A 143 ? 1.4267 1.5025 1.6972 -0.2171 0.2561  0.0643  360 PRO A N   
990  C CA  . PRO A 143 ? 1.4222 1.3925 1.6214 -0.1406 0.2799  0.0739  360 PRO A CA  
991  C C   . PRO A 143 ? 1.5483 1.3747 1.6751 -0.1659 0.3009  0.0391  360 PRO A C   
992  O O   . PRO A 143 ? 1.5135 1.2784 1.5748 -0.1076 0.3049  0.0345  360 PRO A O   
993  C CB  . PRO A 143 ? 1.4606 1.4218 1.6820 -0.0979 0.3324  0.1250  360 PRO A CB  
994  C CG  . PRO A 143 ? 1.5782 1.5659 1.8661 -0.1823 0.3579  0.1344  360 PRO A CG  
995  C CD  . PRO A 143 ? 1.4920 1.5886 1.8246 -0.2522 0.3014  0.0990  360 PRO A CD  
996  N N   . ASP A 144 ? 1.2321 1.4599 1.6096 -0.1739 -0.1881 -0.1384 361 ASP A N   
997  C CA  . ASP A 144 ? 1.2890 1.4076 1.6124 -0.1921 -0.2024 -0.1440 361 ASP A CA  
998  C C   . ASP A 144 ? 1.3533 1.4127 1.6181 -0.1677 -0.2362 -0.1728 361 ASP A C   
999  O O   . ASP A 144 ? 1.4134 1.3821 1.6254 -0.1753 -0.2512 -0.1842 361 ASP A O   
1000 C CB  . ASP A 144 ? 1.3613 1.4808 1.7294 -0.2528 -0.2144 -0.1344 361 ASP A CB  
1001 C CG  . ASP A 144 ? 1.4463 1.5978 1.8477 -0.2799 -0.1768 -0.0993 361 ASP A CG  
1002 O OD1 . ASP A 144 ? 1.3955 1.5521 1.7740 -0.2471 -0.1429 -0.0854 361 ASP A OD1 
1003 O OD2 . ASP A 144 ? 1.5617 1.7299 2.0080 -0.3364 -0.1826 -0.0844 361 ASP A OD2 
1004 N N   . ASP A 145 ? 1.2468 1.3506 1.5112 -0.1342 -0.2485 -0.1845 362 ASP A N   
1005 C CA  . ASP A 145 ? 1.2650 1.3143 1.4634 -0.1083 -0.2778 -0.2064 362 ASP A CA  
1006 C C   . ASP A 145 ? 1.2978 1.2657 1.4141 -0.0825 -0.2520 -0.2018 362 ASP A C   
1007 O O   . ASP A 145 ? 1.2477 1.2304 1.3642 -0.0657 -0.2183 -0.1844 362 ASP A O   
1008 C CB  . ASP A 145 ? 1.2595 1.3671 1.4714 -0.0774 -0.2976 -0.2146 362 ASP A CB  
1009 C CG  . ASP A 145 ? 1.4033 1.4531 1.5416 -0.0546 -0.3328 -0.2340 362 ASP A CG  
1010 O OD1 . ASP A 145 ? 1.4577 1.4883 1.5909 -0.0728 -0.3694 -0.2534 362 ASP A OD1 
1011 O OD2 . ASP A 145 ? 1.4640 1.4844 1.5456 -0.0207 -0.3252 -0.2288 362 ASP A OD2 
1012 N N   . PRO A 146 ? 1.2869 1.1742 1.3348 -0.0788 -0.2676 -0.2188 363 PRO A N   
1013 C CA  . PRO A 146 ? 1.2819 1.1088 1.2579 -0.0524 -0.2399 -0.2161 363 PRO A CA  
1014 C C   . PRO A 146 ? 1.2353 1.0817 1.1847 -0.0226 -0.2194 -0.2040 363 PRO A C   
1015 O O   . PRO A 146 ? 1.1886 1.0270 1.1233 -0.0110 -0.1852 -0.1905 363 PRO A O   
1016 C CB  . PRO A 146 ? 1.3968 1.1499 1.3016 -0.0470 -0.2677 -0.2429 363 PRO A CB  
1017 C CG  . PRO A 146 ? 1.4864 1.2641 1.4175 -0.0639 -0.3149 -0.2593 363 PRO A CG  
1018 C CD  . PRO A 146 ? 1.3777 1.2298 1.4093 -0.0961 -0.3121 -0.2441 363 PRO A CD  
1019 N N   . ASN A 147 ? 1.1637 1.0346 1.1093 -0.0116 -0.2439 -0.2080 364 ASN A N   
1020 C CA  . ASN A 147 ? 1.1298 1.0037 1.0432 0.0123  -0.2339 -0.1953 364 ASN A CA  
1021 C C   . ASN A 147 ? 1.0863 1.0013 1.0449 0.0147  -0.2051 -0.1760 364 ASN A C   
1022 O O   . ASN A 147 ? 1.0665 0.9657 0.9912 0.0277  -0.1882 -0.1631 364 ASN A O   
1023 C CB  . ASN A 147 ? 1.1416 1.0249 1.0425 0.0259  -0.2738 -0.2039 364 ASN A CB  
1024 C CG  . ASN A 147 ? 1.3930 1.2231 1.2202 0.0321  -0.3032 -0.2210 364 ASN A CG  
1025 O OD1 . ASN A 147 ? 1.3386 1.1161 1.0971 0.0365  -0.2864 -0.2226 364 ASN A OD1 
1026 N ND2 . ASN A 147 ? 1.2608 1.1091 1.0993 0.0367  -0.3488 -0.2360 364 ASN A ND2 
1027 N N   . VAL A 148 ? 0.9765 0.9437 1.0083 -0.0002 -0.1997 -0.1730 365 VAL A N   
1028 C CA  . VAL A 148 ? 0.8966 0.9041 0.9668 0.0044  -0.1730 -0.1572 365 VAL A CA  
1029 C C   . VAL A 148 ? 0.9296 0.9031 0.9733 0.0039  -0.1396 -0.1454 365 VAL A C   
1030 O O   . VAL A 148 ? 0.9184 0.8902 0.9459 0.0170  -0.1244 -0.1353 365 VAL A O   
1031 C CB  . VAL A 148 ? 0.9001 0.9787 1.0482 -0.0113 -0.1711 -0.1549 365 VAL A CB  
1032 C CG1 . VAL A 148 ? 0.8484 0.9642 1.0206 0.0001  -0.1439 -0.1408 365 VAL A CG1 
1033 C CG2 . VAL A 148 ? 0.9057 1.0367 1.0910 -0.0075 -0.2049 -0.1693 365 VAL A CG2 
1034 N N   . ALA A 149 ? 0.9005 0.8436 0.9377 -0.0096 -0.1324 -0.1482 366 ALA A N   
1035 C CA  . ALA A 149 ? 0.8832 0.7973 0.8968 -0.0027 -0.1047 -0.1408 366 ALA A CA  
1036 C C   . ALA A 149 ? 0.9637 0.8515 0.9202 0.0156  -0.0954 -0.1429 366 ALA A C   
1037 O O   . ALA A 149 ? 0.9285 0.8308 0.8853 0.0239  -0.0723 -0.1310 366 ALA A O   
1038 C CB  . ALA A 149 ? 0.9256 0.7987 0.9343 -0.0148 -0.1076 -0.1471 366 ALA A CB  
1039 N N   . LYS A 150 ? 0.9702 0.8251 0.8776 0.0198  -0.1138 -0.1569 367 LYS A N   
1040 C CA  . LYS A 150 ? 0.9934 0.8282 0.8387 0.0336  -0.1028 -0.1554 367 LYS A CA  
1041 C C   . LYS A 150 ? 1.0184 0.8773 0.8695 0.0336  -0.0953 -0.1361 367 LYS A C   
1042 O O   . LYS A 150 ? 1.0282 0.8954 0.8668 0.0355  -0.0693 -0.1241 367 LYS A O   
1043 C CB  . LYS A 150 ? 1.0887 0.8853 0.8753 0.0383  -0.1290 -0.1720 367 LYS A CB  
1044 C CG  . LYS A 150 ? 1.3644 1.1209 1.1283 0.0403  -0.1401 -0.1956 367 LYS A CG  
1045 C CD  . LYS A 150 ? 1.5513 1.2674 1.2464 0.0481  -0.1695 -0.2152 367 LYS A CD  
1046 C CE  . LYS A 150 ? 1.7991 1.4649 1.4691 0.0494  -0.1886 -0.2434 367 LYS A CE  
1047 N NZ  . LYS A 150 ? 1.9759 1.6004 1.5722 0.0594  -0.2215 -0.2660 367 LYS A NZ  
1048 N N   . THR A 151 ? 0.9345 0.8070 0.8092 0.0319  -0.1195 -0.1343 368 THR A N   
1049 C CA  . THR A 151 ? 0.9109 0.7892 0.7845 0.0350  -0.1203 -0.1194 368 THR A CA  
1050 C C   . THR A 151 ? 0.9377 0.8455 0.8515 0.0316  -0.0951 -0.1084 368 THR A C   
1051 O O   . THR A 151 ? 0.9522 0.8534 0.8475 0.0274  -0.0822 -0.0949 368 THR A O   
1052 C CB  . THR A 151 ? 0.9525 0.8353 0.8370 0.0446  -0.1558 -0.1256 368 THR A CB  
1053 O OG1 . THR A 151 ? 0.9431 0.7923 0.7770 0.0496  -0.1814 -0.1340 368 THR A OG1 
1054 C CG2 . THR A 151 ? 0.9385 0.8102 0.8139 0.0527  -0.1627 -0.1135 368 THR A CG2 
1055 N N   . LYS A 152 ? 0.8653 0.8046 0.8308 0.0304  -0.0891 -0.1126 369 LYS A N   
1056 C CA  . LYS A 152 ? 0.8235 0.7897 0.8220 0.0305  -0.0683 -0.1035 369 LYS A CA  
1057 C C   . LYS A 152 ? 0.8494 0.8096 0.8302 0.0299  -0.0439 -0.0979 369 LYS A C   
1058 O O   . LYS A 152 ? 0.8141 0.7897 0.8023 0.0288  -0.0329 -0.0882 369 LYS A O   
1059 C CB  . LYS A 152 ? 0.8393 0.8334 0.8828 0.0274  -0.0651 -0.1055 369 LYS A CB  
1060 C CG  . LYS A 152 ? 0.7916 0.8221 0.8691 0.0311  -0.0802 -0.1090 369 LYS A CG  
1061 C CD  . LYS A 152 ? 0.8116 0.8795 0.9305 0.0249  -0.0662 -0.1028 369 LYS A CD  
1062 C CE  . LYS A 152 ? 0.9324 1.0538 1.0881 0.0312  -0.0757 -0.1076 369 LYS A CE  
1063 N NZ  . LYS A 152 ? 1.1875 1.3519 1.3794 0.0208  -0.0571 -0.0971 369 LYS A NZ  
1064 N N   . ASN A 153 ? 0.8429 0.7827 0.7991 0.0326  -0.0379 -0.1064 370 ASN A N   
1065 C CA  . ASN A 153 ? 0.8472 0.7907 0.7856 0.0407  -0.0138 -0.1057 370 ASN A CA  
1066 C C   . ASN A 153 ? 0.9091 0.8613 0.8195 0.0341  -0.0036 -0.0946 370 ASN A C   
1067 O O   . ASN A 153 ? 0.9093 0.8949 0.8370 0.0323  0.0157  -0.0855 370 ASN A O   
1068 C CB  . ASN A 153 ? 0.8091 0.7206 0.7159 0.0518  -0.0139 -0.1225 370 ASN A CB  
1069 C CG  . ASN A 153 ? 1.1194 1.0199 1.0483 0.0606  -0.0108 -0.1281 370 ASN A CG  
1070 O OD1 . ASN A 153 ? 1.0405 0.9621 1.0084 0.0586  -0.0061 -0.1170 370 ASN A OD1 
1071 N ND2 . ASN A 153 ? 1.1109 0.9693 1.0064 0.0725  -0.0157 -0.1454 370 ASN A ND2 
1072 N N   . ASN A 154 ? 0.8824 0.8055 0.7512 0.0278  -0.0193 -0.0931 371 ASN A N   
1073 C CA  . ASN A 154 ? 0.9181 0.8343 0.7475 0.0151  -0.0132 -0.0766 371 ASN A CA  
1074 C C   . ASN A 154 ? 0.9067 0.8346 0.7648 0.0000  -0.0166 -0.0604 371 ASN A C   
1075 O O   . ASN A 154 ? 0.9279 0.8737 0.7811 -0.0166 0.0012  -0.0446 371 ASN A O   
1076 C CB  . ASN A 154 ? 1.0219 0.8912 0.7944 0.0152  -0.0380 -0.0775 371 ASN A CB  
1077 C CG  . ASN A 154 ? 1.2361 1.0859 0.9583 0.0274  -0.0361 -0.0924 371 ASN A CG  
1078 O OD1 . ASN A 154 ? 1.1331 1.0012 0.8492 0.0371  -0.0107 -0.1009 371 ASN A OD1 
1079 N ND2 . ASN A 154 ? 1.1712 0.9821 0.8533 0.0316  -0.0668 -0.0989 371 ASN A ND2 
1080 N N   . LEU A 155 ? 0.7786 0.7010 0.6679 0.0054  -0.0391 -0.0656 372 LEU A N   
1081 C CA  . LEU A 155 ? 0.7414 0.6660 0.6517 -0.0027 -0.0478 -0.0567 372 LEU A CA  
1082 C C   . LEU A 155 ? 0.7890 0.7601 0.7436 -0.0051 -0.0270 -0.0552 372 LEU A C   
1083 O O   . LEU A 155 ? 0.8036 0.7823 0.7666 -0.0212 -0.0263 -0.0445 372 LEU A O   
1084 C CB  . LEU A 155 ? 0.7148 0.6291 0.6422 0.0132  -0.0754 -0.0678 372 LEU A CB  
1085 C CG  . LEU A 155 ? 0.7541 0.6597 0.6929 0.0144  -0.0912 -0.0660 372 LEU A CG  
1086 C CD1 . LEU A 155 ? 0.7999 0.6503 0.6919 -0.0021 -0.1077 -0.0514 372 LEU A CD1 
1087 C CD2 . LEU A 155 ? 0.7890 0.7042 0.7487 0.0394  -0.1111 -0.0820 372 LEU A CD2 
1088 N N   . ALA A 156 ? 0.7269 0.7243 0.7076 0.0099  -0.0139 -0.0654 373 ALA A N   
1089 C CA  . ALA A 156 ? 0.7142 0.7525 0.7321 0.0143  0.0015  -0.0644 373 ALA A CA  
1090 C C   . ALA A 156 ? 0.8163 0.8862 0.8332 0.0039  0.0226  -0.0562 373 ALA A C   
1091 O O   . ALA A 156 ? 0.8039 0.9085 0.8510 -0.0051 0.0253  -0.0499 373 ALA A O   
1092 C CB  . ALA A 156 ? 0.7101 0.7537 0.7434 0.0330  0.0079  -0.0738 373 ALA A CB  
1093 N N   . SER A 157 ? 0.8357 0.8983 0.8165 0.0039  0.0362  -0.0564 374 SER A N   
1094 C CA  . SER A 157 ? 0.8730 0.9784 0.8491 -0.0053 0.0628  -0.0480 374 SER A CA  
1095 C C   . SER A 157 ? 0.9741 1.0835 0.9480 -0.0420 0.0599  -0.0263 374 SER A C   
1096 O O   . SER A 157 ? 0.9907 1.1584 0.9943 -0.0583 0.0780  -0.0164 374 SER A O   
1097 C CB  . SER A 157 ? 0.9751 1.0652 0.8995 0.0064  0.0767  -0.0550 374 SER A CB  
1098 O OG  . SER A 157 ? 1.1637 1.3152 1.0920 0.0082  0.1095  -0.0517 374 SER A OG  
1099 N N   . CYS A 158 ? 0.9598 1.0072 0.9016 -0.0549 0.0336  -0.0194 375 CYS A N   
1100 C CA  . CYS A 158 ? 1.0059 1.0280 0.9341 -0.0899 0.0206  0.0013  375 CYS A CA  
1101 C C   . CYS A 158 ? 1.0247 1.0695 1.0053 -0.0984 0.0075  -0.0007 375 CYS A C   
1102 O O   . CYS A 158 ? 1.0563 1.1183 1.0503 -0.1328 0.0089  0.0153  375 CYS A O   
1103 C CB  . CYS A 158 ? 1.0624 1.0025 0.9376 -0.0885 -0.0105 0.0038  375 CYS A CB  
1104 S SG  . CYS A 158 ? 1.1939 1.0713 1.0377 -0.1278 -0.0367 0.0287  375 CYS A SG  
1105 N N   . TYR A 159 ? 0.9266 0.9723 0.9341 -0.0695 -0.0058 -0.0196 376 TYR A N   
1106 C CA  . TYR A 159 ? 0.8870 0.9519 0.9344 -0.0684 -0.0202 -0.0258 376 TYR A CA  
1107 C C   . TYR A 159 ? 0.9017 1.0435 0.9965 -0.0747 0.0005  -0.0235 376 TYR A C   
1108 O O   . TYR A 159 ? 0.9018 1.0634 1.0251 -0.0925 -0.0126 -0.0211 376 TYR A O   
1109 C CB  . TYR A 159 ? 0.8522 0.9099 0.9097 -0.0335 -0.0306 -0.0436 376 TYR A CB  
1110 C CG  . TYR A 159 ? 0.8615 0.8642 0.8901 -0.0224 -0.0560 -0.0505 376 TYR A CG  
1111 C CD1 . TYR A 159 ? 0.9150 0.8642 0.9128 -0.0381 -0.0812 -0.0449 376 TYR A CD1 
1112 C CD2 . TYR A 159 ? 0.8301 0.8370 0.8657 0.0048  -0.0575 -0.0631 376 TYR A CD2 
1113 C CE1 . TYR A 159 ? 0.9091 0.8116 0.8817 -0.0178 -0.1079 -0.0555 376 TYR A CE1 
1114 C CE2 . TYR A 159 ? 0.8413 0.8179 0.8610 0.0198  -0.0799 -0.0723 376 TYR A CE2 
1115 C CZ  . TYR A 159 ? 0.9469 0.8720 0.9345 0.0131  -0.1057 -0.0704 376 TYR A CZ  
1116 O OH  . TYR A 159 ? 0.9351 0.8343 0.9076 0.0374  -0.1296 -0.0831 376 TYR A OH  
1117 N N   . LEU A 160 ? 0.8381 1.0231 0.9410 -0.0570 0.0290  -0.0271 377 LEU A N   
1118 C CA  . LEU A 160 ? 0.8387 1.1069 0.9881 -0.0537 0.0496  -0.0277 377 LEU A CA  
1119 C C   . LEU A 160 ? 0.9255 1.2383 1.0892 -0.0973 0.0620  -0.0087 377 LEU A C   
1120 O O   . LEU A 160 ? 0.9152 1.2873 1.1302 -0.1129 0.0581  -0.0065 377 LEU A O   
1121 C CB  . LEU A 160 ? 0.8437 1.1354 0.9864 -0.0183 0.0749  -0.0391 377 LEU A CB  
1122 C CG  . LEU A 160 ? 0.8938 1.1510 1.0311 0.0192  0.0651  -0.0544 377 LEU A CG  
1123 C CD1 . LEU A 160 ? 0.9186 1.1689 1.0302 0.0476  0.0834  -0.0660 377 LEU A CD1 
1124 C CD2 . LEU A 160 ? 0.9058 1.1992 1.0859 0.0363  0.0552  -0.0592 377 LEU A CD2 
1125 N N   . LYS A 161 ? 0.9197 1.2029 1.0363 -0.1199 0.0745  0.0067  378 LYS A N   
1126 C CA  . LYS A 161 ? 0.9680 1.2852 1.0862 -0.1690 0.0900  0.0321  378 LYS A CA  
1127 C C   . LYS A 161 ? 1.0225 1.3185 1.1631 -0.2122 0.0591  0.0439  378 LYS A C   
1128 O O   . LYS A 161 ? 1.0666 1.4217 1.2424 -0.2563 0.0694  0.0619  378 LYS A O   
1129 C CB  . LYS A 161 ? 1.0793 1.3379 1.1215 -0.1832 0.0998  0.0488  378 LYS A CB  
1130 C CG  . LYS A 161 ? 1.2726 1.5989 1.3007 -0.1776 0.1453  0.0540  378 LYS A CG  
1131 C CD  . LYS A 161 ? 1.3273 1.6420 1.3288 -0.1201 0.1545  0.0265  378 LYS A CD  
1132 C CE  . LYS A 161 ? 1.4718 1.7064 1.3876 -0.1158 0.1497  0.0303  378 LYS A CE  
1133 N NZ  . LYS A 161 ? 1.5200 1.7554 1.4083 -0.0677 0.1626  0.0040  378 LYS A NZ  
1134 N N   . GLN A 162 ? 0.9399 1.1551 1.0608 -0.1993 0.0209  0.0324  379 GLN A N   
1135 C CA  . GLN A 162 ? 0.9642 1.1354 1.0917 -0.2293 -0.0173 0.0355  379 GLN A CA  
1136 C C   . GLN A 162 ? 0.9795 1.2038 1.1667 -0.2134 -0.0323 0.0160  379 GLN A C   
1137 O O   . GLN A 162 ? 1.0220 1.2233 1.2210 -0.2396 -0.0650 0.0151  379 GLN A O   
1138 C CB  . GLN A 162 ? 1.0061 1.0624 1.0722 -0.2140 -0.0514 0.0291  379 GLN A CB  
1139 C CG  . GLN A 162 ? 1.0534 1.0420 1.0519 -0.2303 -0.0485 0.0494  379 GLN A CG  
1140 C CD  . GLN A 162 ? 1.2319 1.1218 1.1797 -0.2023 -0.0850 0.0371  379 GLN A CD  
1141 O OE1 . GLN A 162 ? 1.2049 1.0269 1.1347 -0.2115 -0.1231 0.0344  379 GLN A OE1 
1142 N NE2 . GLN A 162 ? 1.1821 1.0643 1.1072 -0.1650 -0.0764 0.0265  379 GLN A NE2 
1143 N N   . GLY A 163 ? 0.8642 1.1495 1.0810 -0.1700 -0.0124 0.0004  380 GLY A N   
1144 C CA  . GLY A 163 ? 0.8193 1.1531 1.0831 -0.1461 -0.0259 -0.0169 380 GLY A CA  
1145 C C   . GLY A 163 ? 0.8661 1.1341 1.1010 -0.1135 -0.0543 -0.0341 380 GLY A C   
1146 O O   . GLY A 163 ? 0.8544 1.1429 1.1125 -0.0992 -0.0743 -0.0467 380 GLY A O   
1147 N N   . LYS A 164 ? 0.8216 1.0173 1.0051 -0.0993 -0.0556 -0.0352 381 LYS A N   
1148 C CA  . LYS A 164 ? 0.7970 0.9408 0.9524 -0.0671 -0.0755 -0.0504 381 LYS A CA  
1149 C C   . LYS A 164 ? 0.8093 0.9846 0.9743 -0.0285 -0.0539 -0.0571 381 LYS A C   
1150 O O   . LYS A 164 ? 0.8297 0.9762 0.9700 -0.0118 -0.0445 -0.0586 381 LYS A O   
1151 C CB  . LYS A 164 ? 0.8461 0.9113 0.9505 -0.0710 -0.0877 -0.0479 381 LYS A CB  
1152 C CG  . LYS A 164 ? 0.8675 0.8793 0.9501 -0.1103 -0.1141 -0.0382 381 LYS A CG  
1153 C CD  . LYS A 164 ? 0.9908 0.9179 1.0163 -0.1095 -0.1299 -0.0340 381 LYS A CD  
1154 C CE  . LYS A 164 ? 1.1295 1.0060 1.1293 -0.0723 -0.1601 -0.0563 381 LYS A CE  
1155 N NZ  . LYS A 164 ? 1.2411 1.0452 1.1901 -0.0622 -0.1768 -0.0548 381 LYS A NZ  
1156 N N   . TYR A 165 ? 0.7211 0.9547 0.9227 -0.0163 -0.0487 -0.0602 382 TYR A N   
1157 C CA  . TYR A 165 ? 0.6856 0.9416 0.8935 0.0195  -0.0323 -0.0639 382 TYR A CA  
1158 C C   . TYR A 165 ? 0.7521 0.9680 0.9314 0.0455  -0.0373 -0.0686 382 TYR A C   
1159 O O   . TYR A 165 ? 0.7593 0.9604 0.9262 0.0588  -0.0211 -0.0664 382 TYR A O   
1160 C CB  . TYR A 165 ? 0.6679 0.9909 0.9175 0.0314  -0.0328 -0.0664 382 TYR A CB  
1161 C CG  . TYR A 165 ? 0.6807 1.0667 0.9674 0.0108  -0.0163 -0.0610 382 TYR A CG  
1162 C CD1 . TYR A 165 ? 0.7185 1.1019 0.9906 0.0044  0.0108  -0.0551 382 TYR A CD1 
1163 C CD2 . TYR A 165 ? 0.6921 1.1489 1.0294 -0.0019 -0.0272 -0.0624 382 TYR A CD2 
1164 C CE1 . TYR A 165 ? 0.7271 1.1795 1.0302 -0.0137 0.0319  -0.0489 382 TYR A CE1 
1165 C CE2 . TYR A 165 ? 0.6973 1.2318 1.0774 -0.0233 -0.0072 -0.0559 382 TYR A CE2 
1166 C CZ  . TYR A 165 ? 0.7153 1.2490 1.0764 -0.0282 0.0253  -0.0484 382 TYR A CZ  
1167 O OH  . TYR A 165 ? 0.7220 1.3409 1.1206 -0.0473 0.0509  -0.0411 382 TYR A OH  
1168 N N   . GLN A 166 ? 0.7173 0.9168 0.8844 0.0509  -0.0594 -0.0755 383 GLN A N   
1169 C CA  . GLN A 166 ? 0.7114 0.8875 0.8524 0.0740  -0.0598 -0.0787 383 GLN A CA  
1170 C C   . GLN A 166 ? 0.7557 0.8997 0.8795 0.0689  -0.0525 -0.0782 383 GLN A C   
1171 O O   . GLN A 166 ? 0.7543 0.8953 0.8720 0.0802  -0.0392 -0.0746 383 GLN A O   
1172 C CB  . GLN A 166 ? 0.7436 0.9122 0.8683 0.0840  -0.0850 -0.0903 383 GLN A CB  
1173 C CG  . GLN A 166 ? 1.0353 1.2107 1.1387 0.1135  -0.0798 -0.0899 383 GLN A CG  
1174 C CD  . GLN A 166 ? 1.3706 1.5507 1.4555 0.1294  -0.1048 -0.1024 383 GLN A CD  
1175 O OE1 . GLN A 166 ? 1.2708 1.4305 1.3464 0.1226  -0.1307 -0.1179 383 GLN A OE1 
1176 N NE2 . GLN A 166 ? 1.3145 1.5129 1.3858 0.1518  -0.1012 -0.0963 383 GLN A NE2 
1177 N N   . ASP A 167 ? 0.7178 0.8371 0.8340 0.0492  -0.0629 -0.0798 384 ASP A N   
1178 C CA  . ASP A 167 ? 0.7380 0.8256 0.8353 0.0472  -0.0629 -0.0806 384 ASP A CA  
1179 C C   . ASP A 167 ? 0.7824 0.8753 0.8830 0.0449  -0.0412 -0.0738 384 ASP A C   
1180 O O   . ASP A 167 ? 0.7699 0.8543 0.8648 0.0531  -0.0386 -0.0764 384 ASP A O   
1181 C CB  . ASP A 167 ? 0.8090 0.8561 0.8864 0.0278  -0.0830 -0.0807 384 ASP A CB  
1182 C CG  . ASP A 167 ? 1.0740 1.1005 1.1407 0.0329  -0.1113 -0.0921 384 ASP A CG  
1183 O OD1 . ASP A 167 ? 1.1279 1.1683 1.2094 0.0169  -0.1194 -0.0906 384 ASP A OD1 
1184 O OD2 . ASP A 167 ? 1.1170 1.1202 1.1629 0.0565  -0.1264 -0.1056 384 ASP A OD2 
1185 N N   . ALA A 168 ? 0.7434 0.8559 0.8554 0.0358  -0.0265 -0.0675 385 ALA A N   
1186 C CA  . ALA A 168 ? 0.7333 0.8456 0.8409 0.0395  -0.0077 -0.0658 385 ALA A CA  
1187 C C   . ALA A 168 ? 0.7724 0.8858 0.8857 0.0586  -0.0016 -0.0667 385 ALA A C   
1188 O O   . ALA A 168 ? 0.7855 0.8765 0.8882 0.0594  0.0009  -0.0681 385 ALA A O   
1189 C CB  . ALA A 168 ? 0.7471 0.8922 0.8669 0.0339  0.0075  -0.0622 385 ALA A CB  
1190 N N   . GLU A 169 ? 0.7177 0.8531 0.8447 0.0712  -0.0030 -0.0646 386 GLU A N   
1191 C CA  . GLU A 169 ? 0.7171 0.8476 0.8414 0.0881  0.0016  -0.0594 386 GLU A CA  
1192 C C   . GLU A 169 ? 0.7454 0.8589 0.8602 0.0838  0.0012  -0.0565 386 GLU A C   
1193 O O   . GLU A 169 ? 0.7580 0.8514 0.8667 0.0830  0.0084  -0.0501 386 GLU A O   
1194 C CB  . GLU A 169 ? 0.7396 0.8956 0.8715 0.1022  -0.0066 -0.0574 386 GLU A CB  
1195 C CG  . GLU A 169 ? 0.9147 1.0604 1.0354 0.1224  -0.0027 -0.0478 386 GLU A CG  
1196 C CD  . GLU A 169 ? 1.1763 1.3425 1.2927 0.1385  -0.0150 -0.0454 386 GLU A CD  
1197 O OE1 . GLU A 169 ? 1.1026 1.2998 1.2379 0.1474  -0.0247 -0.0511 386 GLU A OE1 
1198 O OE2 . GLU A 169 ? 1.0564 1.2142 1.1510 0.1421  -0.0151 -0.0385 386 GLU A OE2 
1199 N N   . THR A 170 ? 0.6756 0.7979 0.7899 0.0809  -0.0086 -0.0619 387 THR A N   
1200 C CA  . THR A 170 ? 0.6608 0.7882 0.7750 0.0804  -0.0077 -0.0618 387 THR A CA  
1201 C C   . THR A 170 ? 0.7115 0.8235 0.8295 0.0666  -0.0067 -0.0638 387 THR A C   
1202 O O   . THR A 170 ? 0.7383 0.8558 0.8645 0.0595  -0.0005 -0.0580 387 THR A O   
1203 C CB  . THR A 170 ? 0.6590 0.8000 0.7687 0.0907  -0.0210 -0.0725 387 THR A CB  
1204 O OG1 . THR A 170 ? 0.7443 0.8970 0.8453 0.1041  -0.0241 -0.0717 387 THR A OG1 
1205 C CG2 . THR A 170 ? 0.5560 0.7208 0.6723 0.0962  -0.0182 -0.0757 387 THR A CG2 
1206 N N   . LEU A 171 ? 0.6453 0.7383 0.7552 0.0601  -0.0132 -0.0704 388 LEU A N   
1207 C CA  . LEU A 171 ? 0.6568 0.7306 0.7611 0.0500  -0.0169 -0.0749 388 LEU A CA  
1208 C C   . LEU A 171 ? 0.7127 0.7669 0.8144 0.0450  -0.0075 -0.0714 388 LEU A C   
1209 O O   . LEU A 171 ? 0.7086 0.7573 0.8176 0.0341  -0.0117 -0.0721 388 LEU A O   
1210 C CB  . LEU A 171 ? 0.6699 0.7231 0.7527 0.0452  -0.0244 -0.0794 388 LEU A CB  
1211 C CG  . LEU A 171 ? 0.7269 0.7742 0.8012 0.0475  -0.0432 -0.0838 388 LEU A CG  
1212 C CD1 . LEU A 171 ? 0.7609 0.7784 0.8053 0.0367  -0.0483 -0.0805 388 LEU A CD1 
1213 C CD2 . LEU A 171 ? 0.7230 0.7788 0.8062 0.0537  -0.0566 -0.0920 388 LEU A CD2 
1214 N N   . TYR A 172 ? 0.6653 0.7100 0.7588 0.0542  0.0023  -0.0685 389 TYR A N   
1215 C CA  . TYR A 172 ? 0.6867 0.6988 0.7688 0.0580  0.0071  -0.0678 389 TYR A CA  
1216 C C   . TYR A 172 ? 0.7705 0.7738 0.8602 0.0498  0.0075  -0.0549 389 TYR A C   
1217 O O   . TYR A 172 ? 0.8013 0.7705 0.8852 0.0357  0.0025  -0.0545 389 TYR A O   
1218 C CB  . TYR A 172 ? 0.7135 0.7301 0.7904 0.0788  0.0158  -0.0686 389 TYR A CB  
1219 C CG  . TYR A 172 ? 0.7599 0.7929 0.8300 0.0817  0.0216  -0.0779 389 TYR A CG  
1220 C CD1 . TYR A 172 ? 0.8190 0.8288 0.8653 0.0743  0.0196  -0.0874 389 TYR A CD1 
1221 C CD2 . TYR A 172 ? 0.7372 0.8126 0.8234 0.0900  0.0289  -0.0762 389 TYR A CD2 
1222 C CE1 . TYR A 172 ? 0.8364 0.8627 0.8679 0.0751  0.0291  -0.0917 389 TYR A CE1 
1223 C CE2 . TYR A 172 ? 0.7455 0.8454 0.8279 0.0856  0.0388  -0.0800 389 TYR A CE2 
1224 C CZ  . TYR A 172 ? 0.8665 0.9405 0.9178 0.0780  0.0410  -0.0860 389 TYR A CZ  
1225 O OH  . TYR A 172 ? 0.8540 0.9523 0.8926 0.0714  0.0542  -0.0854 389 TYR A OH  
1226 N N   . LYS A 173 ? 0.6962 0.7296 0.7957 0.0554  0.0123  -0.0438 390 LYS A N   
1227 C CA  . LYS A 173 ? 0.7169 0.7501 0.8178 0.0462  0.0178  -0.0263 390 LYS A CA  
1228 C C   . LYS A 173 ? 0.8078 0.8598 0.9293 0.0210  0.0165  -0.0253 390 LYS A C   
1229 O O   . LYS A 173 ? 0.8464 0.8790 0.9692 -0.0003 0.0190  -0.0115 390 LYS A O   
1230 C CB  . LYS A 173 ? 0.7234 0.7893 0.8213 0.0620  0.0230  -0.0174 390 LYS A CB  
1231 C CG  . LYS A 173 ? 0.7184 0.7630 0.7977 0.0834  0.0218  -0.0116 390 LYS A CG  
1232 C CD  . LYS A 173 ? 0.7693 0.8453 0.8416 0.1000  0.0211  -0.0063 390 LYS A CD  
1233 C CE  . LYS A 173 ? 0.7821 0.8480 0.8444 0.1249  0.0136  -0.0062 390 LYS A CE  
1234 N NZ  . LYS A 173 ? 0.6836 0.7778 0.7349 0.1425  0.0066  -0.0031 390 LYS A NZ  
1235 N N   . GLU A 174 ? 0.7537 0.8410 0.8918 0.0225  0.0096  -0.0397 391 GLU A N   
1236 C CA  . GLU A 174 ? 0.7623 0.8818 0.9280 0.0054  0.0039  -0.0441 391 GLU A CA  
1237 C C   . GLU A 174 ? 0.8551 0.9338 1.0201 -0.0175 -0.0075 -0.0482 391 GLU A C   
1238 O O   . GLU A 174 ? 0.8775 0.9730 1.0679 -0.0440 -0.0095 -0.0417 391 GLU A O   
1239 C CB  . GLU A 174 ? 0.7530 0.8999 0.9249 0.0213  -0.0087 -0.0619 391 GLU A CB  
1240 C CG  . GLU A 174 ? 0.8722 1.0594 1.0464 0.0430  -0.0045 -0.0636 391 GLU A CG  
1241 C CD  . GLU A 174 ? 1.2722 1.4637 1.4414 0.0619  -0.0231 -0.0818 391 GLU A CD  
1242 O OE1 . GLU A 174 ? 1.4297 1.6032 1.5973 0.0572  -0.0388 -0.0907 391 GLU A OE1 
1243 O OE2 . GLU A 174 ? 1.1496 1.3555 1.3099 0.0831  -0.0252 -0.0875 391 GLU A OE2 
1244 N N   . ILE A 175 ? 0.7973 0.8259 0.9326 -0.0079 -0.0151 -0.0598 392 ILE A N   
1245 C CA  . ILE A 175 ? 0.8262 0.8047 0.9461 -0.0214 -0.0289 -0.0696 392 ILE A CA  
1246 C C   . ILE A 175 ? 0.9046 0.8400 1.0186 -0.0386 -0.0263 -0.0548 392 ILE A C   
1247 O O   . ILE A 175 ? 0.9257 0.8492 1.0545 -0.0695 -0.0380 -0.0526 392 ILE A O   
1248 C CB  . ILE A 175 ? 0.8671 0.8086 0.9481 -0.0003 -0.0317 -0.0854 392 ILE A CB  
1249 C CG1 . ILE A 175 ? 0.8202 0.7887 0.8980 0.0074  -0.0385 -0.0953 392 ILE A CG1 
1250 C CG2 . ILE A 175 ? 0.9531 0.8302 1.0040 -0.0057 -0.0453 -0.0985 392 ILE A CG2 
1251 C CD1 . ILE A 175 ? 0.8320 0.7895 0.8791 0.0255  -0.0291 -0.0992 392 ILE A CD1 
1252 N N   . LEU A 176 ? 0.8532 0.7649 0.9462 -0.0202 -0.0142 -0.0436 393 LEU A N   
1253 C CA  . LEU A 176 ? 0.9028 0.7581 0.9774 -0.0308 -0.0143 -0.0260 393 LEU A CA  
1254 C C   . LEU A 176 ? 0.9394 0.8219 1.0401 -0.0674 -0.0073 -0.0002 393 LEU A C   
1255 O O   . LEU A 176 ? 0.9971 0.8273 1.0908 -0.0986 -0.0169 0.0111  393 LEU A O   
1256 C CB  . LEU A 176 ? 0.9118 0.7455 0.9589 0.0042  -0.0059 -0.0198 393 LEU A CB  
1257 C CG  . LEU A 176 ? 0.9538 0.7699 0.9795 0.0394  -0.0088 -0.0431 393 LEU A CG  
1258 C CD1 . LEU A 176 ? 0.9597 0.7784 0.9739 0.0728  -0.0020 -0.0367 393 LEU A CD1 
1259 C CD2 . LEU A 176 ? 1.0057 0.7470 0.9998 0.0400  -0.0246 -0.0600 393 LEU A CD2 
1260 N N   . THR A 177 ? 0.8142 0.7788 0.9436 -0.0652 0.0086  0.0082  394 THR A N   
1261 C CA  . THR A 177 ? 0.8027 0.8166 0.9596 -0.0966 0.0223  0.0322  394 THR A CA  
1262 C C   . THR A 177 ? 0.8604 0.8972 1.0579 -0.1364 0.0103  0.0269  394 THR A C   
1263 O O   . THR A 177 ? 0.9145 0.9442 1.1247 -0.1790 0.0133  0.0499  394 THR A O   
1264 C CB  . THR A 177 ? 0.7592 0.8577 0.9316 -0.0754 0.0406  0.0345  394 THR A CB  
1265 O OG1 . THR A 177 ? 0.7774 0.8528 0.9130 -0.0414 0.0456  0.0374  394 THR A OG1 
1266 C CG2 . THR A 177 ? 0.6934 0.8520 0.8880 -0.1031 0.0615  0.0607  394 THR A CG2 
1267 N N   . ARG A 178 ? 0.7654 0.8269 0.9814 -0.1252 -0.0058 -0.0019 395 ARG A N   
1268 C CA  . ARG A 178 ? 0.7695 0.8579 1.0260 -0.1586 -0.0241 -0.0115 395 ARG A CA  
1269 C C   . ARG A 178 ? 0.8788 0.8739 1.1121 -0.1895 -0.0454 -0.0114 395 ARG A C   
1270 O O   . ARG A 178 ? 0.9305 0.9350 1.1961 -0.2378 -0.0531 0.0008  395 ARG A O   
1271 C CB  . ARG A 178 ? 0.7057 0.8325 0.9755 -0.1334 -0.0407 -0.0411 395 ARG A CB  
1272 C CG  . ARG A 178 ? 0.8284 0.9928 1.1425 -0.1617 -0.0654 -0.0544 395 ARG A CG  
1273 C CD  . ARG A 178 ? 0.9899 1.2673 1.3725 -0.1811 -0.0531 -0.0434 395 ARG A CD  
1274 N NE  . ARG A 178 ? 1.1551 1.4527 1.5844 -0.2342 -0.0700 -0.0396 395 ARG A NE  
1275 C CZ  . ARG A 178 ? 1.4534 1.8015 1.9254 -0.2794 -0.0517 -0.0120 395 ARG A CZ  
1276 N NH1 . ARG A 178 ? 1.3222 1.7044 1.7884 -0.2726 -0.0143 0.0140  395 ARG A NH1 
1277 N NH2 . ARG A 178 ? 1.3617 1.7274 1.8804 -0.3344 -0.0713 -0.0090 395 ARG A NH2 
1278 N N   . ALA A 179 ? 0.8343 0.7408 1.0115 -0.1619 -0.0545 -0.0243 396 ALA A N   
1279 C CA  . ALA A 179 ? 0.9181 0.7204 1.0584 -0.1782 -0.0775 -0.0305 396 ALA A CA  
1280 C C   . ALA A 179 ? 1.0957 0.8560 1.2338 -0.2182 -0.0726 0.0038  396 ALA A C   
1281 O O   . ALA A 179 ? 1.1632 0.8754 1.3068 -0.2643 -0.0948 0.0074  396 ALA A O   
1282 C CB  . ALA A 179 ? 0.9286 0.6624 1.0097 -0.1300 -0.0788 -0.0482 396 ALA A CB  
1283 N N   . HIS A 180 ? 1.0518 0.8329 1.1813 -0.2043 -0.0451 0.0309  397 HIS A N   
1284 C CA  . HIS A 180 ? 1.1341 0.8763 1.2504 -0.2392 -0.0363 0.0700  397 HIS A CA  
1285 C C   . HIS A 180 ? 1.2340 1.0538 1.4108 -0.3001 -0.0281 0.0918  397 HIS A C   
1286 O O   . HIS A 180 ? 1.3237 1.0876 1.4978 -0.3538 -0.0391 0.1146  397 HIS A O   
1287 C CB  . HIS A 180 ? 1.1143 0.8693 1.2022 -0.2048 -0.0105 0.0917  397 HIS A CB  
1288 C CG  . HIS A 180 ? 1.2402 0.9413 1.2982 -0.2371 -0.0028 0.1356  397 HIS A CG  
1289 N ND1 . HIS A 180 ? 1.3619 0.9287 1.3574 -0.2319 -0.0232 0.1447  397 HIS A ND1 
1290 C CD2 . HIS A 180 ? 1.2767 1.0396 1.3545 -0.2736 0.0227  0.1730  397 HIS A CD2 
1291 C CE1 . HIS A 180 ? 1.4323 0.9735 1.4075 -0.2681 -0.0116 0.1905  397 HIS A CE1 
1292 N NE2 . HIS A 180 ? 1.3873 1.0487 1.4108 -0.2961 0.0188  0.2102  397 HIS A NE2 
1293 N N   . GLU A 181 ? 1.1124 1.0609 1.3436 -0.2913 -0.0098 0.0846  398 GLU A N   
1294 C CA  . GLU A 181 ? 1.1037 1.1581 1.4034 -0.3393 0.0030  0.1015  398 GLU A CA  
1295 C C   . GLU A 181 ? 1.1766 1.2267 1.5194 -0.3902 -0.0283 0.0891  398 GLU A C   
1296 O O   . GLU A 181 ? 1.2229 1.3120 1.6085 -0.4522 -0.0226 0.1164  398 GLU A O   
1297 C CB  . GLU A 181 ? 1.0320 1.2190 1.3730 -0.3037 0.0255  0.0894  398 GLU A CB  
1298 C CG  . GLU A 181 ? 1.2098 1.4238 1.5208 -0.2780 0.0603  0.1137  398 GLU A CG  
1299 C CD  . GLU A 181 ? 1.4968 1.8378 1.8431 -0.2445 0.0819  0.1021  398 GLU A CD  
1300 O OE1 . GLU A 181 ? 1.2243 1.5788 1.5718 -0.1994 0.0682  0.0679  398 GLU A OE1 
1301 O OE2 . GLU A 181 ? 1.6211 2.0445 1.9885 -0.2626 0.1125  0.1277  398 GLU A OE2 
1302 N N   . LYS A 182 ? 1.1100 1.1128 1.4391 -0.3677 -0.0619 0.0498  399 LYS A N   
1303 C CA  . LYS A 182 ? 1.1537 1.1469 1.5173 -0.4131 -0.0987 0.0334  399 LYS A CA  
1304 C C   . LYS A 182 ? 1.3339 1.1995 1.6620 -0.4642 -0.1220 0.0495  399 LYS A C   
1305 O O   . LYS A 182 ? 1.3907 1.2692 1.7646 -0.5277 -0.1440 0.0544  399 LYS A O   
1306 C CB  . LYS A 182 ? 1.1461 1.1380 1.5027 -0.3742 -0.1286 -0.0128 399 LYS A CB  
1307 C CG  . LYS A 182 ? 1.4125 1.2894 1.6846 -0.3240 -0.1394 -0.0351 399 LYS A CG  
1308 C CD  . LYS A 182 ? 1.6492 1.4149 1.8828 -0.3433 -0.1828 -0.0585 399 LYS A CD  
1309 C CE  . LYS A 182 ? 1.8357 1.4996 1.9846 -0.2878 -0.1884 -0.0820 399 LYS A CE  
1310 N NZ  . LYS A 182 ? 1.9361 1.5298 2.0391 -0.2696 -0.1671 -0.0597 399 LYS A NZ  
1311 N N   . GLU A 183 ? 1.3307 1.0743 1.5792 -0.4369 -0.1196 0.0579  400 GLU A N   
1312 C CA  . GLU A 183 ? 1.4543 1.0523 1.6520 -0.4740 -0.1452 0.0722  400 GLU A CA  
1313 C C   . GLU A 183 ? 1.5888 1.1793 1.7874 -0.5236 -0.1208 0.1283  400 GLU A C   
1314 O O   . GLU A 183 ? 1.7177 1.2230 1.9064 -0.5866 -0.1436 0.1489  400 GLU A O   
1315 C CB  . GLU A 183 ? 1.5047 0.9714 1.6118 -0.4106 -0.1596 0.0486  400 GLU A CB  
1316 C CG  . GLU A 183 ? 1.6761 1.0459 1.7475 -0.4052 -0.2065 0.0056  400 GLU A CG  
1317 C CD  . GLU A 183 ? 2.1366 1.3685 2.1751 -0.4608 -0.2460 0.0142  400 GLU A CD  
1318 O OE1 . GLU A 183 ? 2.0920 1.1990 2.0613 -0.4464 -0.2508 0.0296  400 GLU A OE1 
1319 O OE2 . GLU A 183 ? 2.1026 1.3463 2.1825 -0.5177 -0.2766 0.0042  400 GLU A OE2 
1320 N N   . PHE A 184 ? 1.4825 1.1576 1.6884 -0.4986 -0.0765 0.1536  401 PHE A N   
1321 C CA  . PHE A 184 ? 1.5556 1.2198 1.7447 -0.5370 -0.0495 0.2094  401 PHE A CA  
1322 C C   . PHE A 184 ? 1.6136 1.4406 1.8732 -0.5732 -0.0070 0.2410  401 PHE A C   
1323 O O   . PHE A 184 ? 1.6983 1.5178 1.9510 -0.6283 0.0122  0.2916  401 PHE A O   
1324 C CB  . PHE A 184 ? 1.5926 1.1667 1.6956 -0.4784 -0.0396 0.2210  401 PHE A CB  
1325 C CG  . PHE A 184 ? 1.6785 1.0876 1.7081 -0.4461 -0.0793 0.1967  401 PHE A CG  
1326 C CD1 . PHE A 184 ? 1.6446 1.0485 1.6596 -0.3775 -0.0914 0.1475  401 PHE A CD1 
1327 C CD2 . PHE A 184 ? 1.8372 1.0943 1.8072 -0.4817 -0.1039 0.2238  401 PHE A CD2 
1328 C CE1 . PHE A 184 ? 1.7259 0.9904 1.6735 -0.3418 -0.1247 0.1219  401 PHE A CE1 
1329 C CE2 . PHE A 184 ? 1.9537 1.0574 1.8514 -0.4416 -0.1423 0.1961  401 PHE A CE2 
1330 C CZ  . PHE A 184 ? 1.8535 0.9692 1.7431 -0.3701 -0.1510 0.1434  401 PHE A CZ  
1331 N N   . GLY A 185 ? 1.4876 1.4565 1.8090 -0.5415 0.0072  0.2124  402 GLY A N   
1332 C CA  . GLY A 185 ? 1.4544 1.5898 1.8422 -0.5598 0.0481  0.2333  402 GLY A CA  
1333 C C   . GLY A 185 ? 1.4810 1.6694 1.8380 -0.4895 0.0813  0.2307  402 GLY A C   
1334 O O   . GLY A 185 ? 1.4628 1.5588 1.7520 -0.4354 0.0719  0.2175  402 GLY A O   
1335 N N   . SER A 186 ? 1.4288 1.7709 1.8367 -0.4885 0.1186  0.2408  403 SER A N   
1336 C CA  . SER A 186 ? 1.3791 1.7795 1.7587 -0.4224 0.1476  0.2345  403 SER A CA  
1337 C C   . SER A 186 ? 1.5086 1.8121 1.7965 -0.4071 0.1619  0.2682  403 SER A C   
1338 O O   . SER A 186 ? 1.5970 1.8718 1.8613 -0.4587 0.1789  0.3172  403 SER A O   
1339 C CB  . SER A 186 ? 1.3795 1.9601 1.8265 -0.4241 0.1838  0.2375  403 SER A CB  
1340 O OG  . SER A 186 ? 1.3719 2.0352 1.8834 -0.3952 0.1650  0.1910  403 SER A OG  
1341 N N   . VAL A 187 ? 1.4222 1.6704 1.6579 -0.3381 0.1508  0.2424  404 VAL A N   
1342 C CA  . VAL A 187 ? 1.4708 1.6282 1.6211 -0.3084 0.1547  0.2638  404 VAL A CA  
1343 C C   . VAL A 187 ? 1.5717 1.7898 1.6915 -0.3130 0.1951  0.3045  404 VAL A C   
1344 O O   . VAL A 187 ? 1.5141 1.8519 1.6585 -0.2856 0.2200  0.2921  404 VAL A O   
1345 C CB  . VAL A 187 ? 1.4684 1.5609 1.5813 -0.2405 0.1301  0.2262  404 VAL A CB  
1346 C CG1 . VAL A 187 ? 1.3708 1.5199 1.5360 -0.2139 0.1152  0.1774  404 VAL A CG1 
1347 C CG2 . VAL A 187 ? 1.4656 1.5605 1.5222 -0.1917 0.1441  0.2347  404 VAL A CG2 
1348 N N   . ASN A 188 ? 1.6403 1.7699 1.7013 -0.3488 0.2000  0.3538  405 ASN A N   
1349 C CA  . ASN A 188 ? 1.7053 1.8698 1.7198 -0.3627 0.2378  0.4028  405 ASN A CA  
1350 C C   . ASN A 188 ? 1.8147 1.8554 1.7252 -0.3245 0.2251  0.4230  405 ASN A C   
1351 O O   . ASN A 188 ? 1.7416 1.7452 1.6315 -0.2613 0.2012  0.3861  405 ASN A O   
1352 C CB  . ASN A 188 ? 1.8185 2.0031 1.8608 -0.4538 0.2579  0.4529  405 ASN A CB  
1353 C CG  . ASN A 188 ? 2.2322 2.5387 2.2707 -0.4766 0.3120  0.4946  405 ASN A CG  
1354 O OD1 . ASN A 188 ? 2.1411 2.6089 2.2478 -0.4694 0.3405  0.4757  405 ASN A OD1 
1355 N ND2 . ASN A 188 ? 2.2242 2.4560 2.1801 -0.5055 0.3274  0.5539  405 ASN A ND2 
1356 N N   . GLY A 189 ? 1.9127 1.8958 1.7599 -0.3636 0.2402  0.4823  406 GLY A N   
1357 C CA  . GLY A 189 ? 2.0018 1.8658 1.7434 -0.3300 0.2267  0.5090  406 GLY A CA  
1358 C C   . GLY A 189 ? 2.0788 1.7812 1.7883 -0.3160 0.1775  0.4966  406 GLY A C   
1359 O O   . GLY A 189 ? 2.0255 1.6911 1.7136 -0.2479 0.1520  0.4608  406 GLY A O   
1360 N N   . GLU A 190 ? 2.1073 1.7152 1.8147 -0.3808 0.1630  0.5246  407 GLU A N   
1361 C CA  . GLU A 190 ? 2.1523 1.5957 1.8241 -0.3702 0.1142  0.5117  407 GLU A CA  
1362 C C   . GLU A 190 ? 2.0405 1.5141 1.7862 -0.3458 0.0913  0.4458  407 GLU A C   
1363 O O   . GLU A 190 ? 2.0202 1.4171 1.7415 -0.2895 0.0591  0.4107  407 GLU A O   
1364 C CB  . GLU A 190 ? 2.3251 1.6522 1.9669 -0.4533 0.1034  0.5626  407 GLU A CB  
1365 C CG  . GLU A 190 ? 2.5908 1.8476 2.1378 -0.4788 0.1190  0.6344  407 GLU A CG  
1366 C CD  . GLU A 190 ? 2.9195 2.0528 2.4338 -0.5707 0.1073  0.6903  407 GLU A CD  
1367 O OE1 . GLU A 190 ? 2.8357 1.8180 2.3282 -0.5754 0.0590  0.6749  407 GLU A OE1 
1368 O OE2 . GLU A 190 ? 2.8574 2.0410 2.3623 -0.6381 0.1460  0.7506  407 GLU A OE2 
1369 N N   . ASN A 191 ? 1.8765 1.4696 1.7113 -0.3861 0.1089  0.4298  408 ASN A N   
1370 C CA  . ASN A 191 ? 1.7525 1.3857 1.6564 -0.3714 0.0898  0.3729  408 ASN A CA  
1371 C C   . ASN A 191 ? 1.6399 1.3543 1.5599 -0.2947 0.0952  0.3282  408 ASN A C   
1372 O O   . ASN A 191 ? 1.5719 1.4168 1.5319 -0.2872 0.1239  0.3227  408 ASN A O   
1373 C CB  . ASN A 191 ? 1.7115 1.4533 1.7020 -0.4383 0.1058  0.3760  408 ASN A CB  
1374 C CG  . ASN A 191 ? 1.8704 1.6231 1.9214 -0.4408 0.0773  0.3267  408 ASN A CG  
1375 O OD1 . ASN A 191 ? 1.6817 1.5634 1.8104 -0.4513 0.0892  0.3058  408 ASN A OD1 
1376 N ND2 . ASN A 191 ? 1.8262 1.4423 1.8389 -0.4302 0.0374  0.3072  408 ASN A ND2 
1377 N N   . LYS A 192 ? 1.5301 1.1676 1.4171 -0.2375 0.0673  0.2970  409 LYS A N   
1378 C CA  . LYS A 192 ? 1.3830 1.0857 1.2840 -0.1716 0.0684  0.2572  409 LYS A CA  
1379 C C   . LYS A 192 ? 1.3296 0.9992 1.2524 -0.1463 0.0414  0.2100  409 LYS A C   
1380 O O   . LYS A 192 ? 1.4026 0.9625 1.2952 -0.1526 0.0164  0.2086  409 LYS A O   
1381 C CB  . LYS A 192 ? 1.4357 1.0945 1.2702 -0.1201 0.0647  0.2698  409 LYS A CB  
1382 C CG  . LYS A 192 ? 1.5611 1.2509 1.3554 -0.1301 0.0905  0.3138  409 LYS A CG  
1383 C CD  . LYS A 192 ? 1.6341 1.2861 1.3663 -0.0695 0.0780  0.3155  409 LYS A CD  
1384 C CE  . LYS A 192 ? 1.8664 1.5038 1.5291 -0.0770 0.0947  0.3660  409 LYS A CE  
1385 N NZ  . LYS A 192 ? 2.1592 1.6586 1.7564 -0.1066 0.0802  0.4109  409 LYS A NZ  
1386 N N   . PRO A 193 ? 1.1468 0.8978 1.1107 -0.1139 0.0441  0.1717  410 PRO A N   
1387 C CA  . PRO A 193 ? 1.1121 0.8299 1.0854 -0.0898 0.0220  0.1316  410 PRO A CA  
1388 C C   . PRO A 193 ? 1.2156 0.8604 1.1408 -0.0386 0.0066  0.1227  410 PRO A C   
1389 O O   . PRO A 193 ? 1.2425 0.8821 1.1356 -0.0142 0.0114  0.1421  410 PRO A O   
1390 C CB  . PRO A 193 ? 1.0171 0.8409 1.0382 -0.0719 0.0318  0.1028  410 PRO A CB  
1391 C CG  . PRO A 193 ? 1.0435 0.9536 1.0866 -0.0895 0.0558  0.1229  410 PRO A CG  
1392 C CD  . PRO A 193 ? 1.0731 0.9406 1.0686 -0.0967 0.0654  0.1628  410 PRO A CD  
1393 N N   . ILE A 194 ? 1.1722 0.7649 1.0906 -0.0191 -0.0129 0.0924  411 ILE A N   
1394 C CA  . ILE A 194 ? 1.1940 0.7285 1.0742 0.0352  -0.0277 0.0775  411 ILE A CA  
1395 C C   . ILE A 194 ? 1.1601 0.7676 1.0504 0.0792  -0.0177 0.0720  411 ILE A C   
1396 O O   . ILE A 194 ? 1.1896 0.7603 1.0447 0.1134  -0.0263 0.0829  411 ILE A O   
1397 C CB  . ILE A 194 ? 1.2534 0.7395 1.1263 0.0524  -0.0453 0.0402  411 ILE A CB  
1398 C CG1 . ILE A 194 ? 1.3165 0.7405 1.1473 0.1130  -0.0605 0.0245  411 ILE A CG1 
1399 C CG2 . ILE A 194 ? 1.1668 0.7413 1.0847 0.0528  -0.0349 0.0106  411 ILE A CG2 
1400 C CD1 . ILE A 194 ? 1.5888 0.8887 1.3595 0.1186  -0.0821 0.0465  411 ILE A CD1 
1401 N N   . TRP A 195 ? 1.0305 0.7362 0.9662 0.0770  -0.0037 0.0562  412 TRP A N   
1402 C CA  . TRP A 195 ? 0.9713 0.7459 0.9207 0.1105  0.0016  0.0487  412 TRP A CA  
1403 C C   . TRP A 195 ? 1.0997 0.8815 1.0236 0.1164  0.0052  0.0776  412 TRP A C   
1404 O O   . TRP A 195 ? 1.1076 0.9023 1.0207 0.1544  -0.0030 0.0744  412 TRP A O   
1405 C CB  . TRP A 195 ? 0.8479 0.7047 0.8419 0.1021  0.0107  0.0274  412 TRP A CB  
1406 C CG  . TRP A 195 ? 0.8335 0.7304 0.8477 0.0664  0.0218  0.0374  412 TRP A CG  
1407 C CD1 . TRP A 195 ? 0.8621 0.7595 0.8963 0.0340  0.0225  0.0325  412 TRP A CD1 
1408 C CD2 . TRP A 195 ? 0.8096 0.7599 0.8265 0.0648  0.0327  0.0509  412 TRP A CD2 
1409 N NE1 . TRP A 195 ? 0.8202 0.7772 0.8770 0.0138  0.0344  0.0420  412 TRP A NE1 
1410 C CE2 . TRP A 195 ? 0.8288 0.8178 0.8723 0.0338  0.0424  0.0525  412 TRP A CE2 
1411 C CE3 . TRP A 195 ? 0.8201 0.7926 0.8176 0.0903  0.0329  0.0587  412 TRP A CE3 
1412 C CZ2 . TRP A 195 ? 0.7971 0.8491 0.8477 0.0314  0.0560  0.0605  412 TRP A CZ2 
1413 C CZ3 . TRP A 195 ? 0.8167 0.8427 0.8144 0.0860  0.0443  0.0658  412 TRP A CZ3 
1414 C CH2 . TRP A 195 ? 0.8020 0.8676 0.8249 0.0583  0.0577  0.0669  412 TRP A CH2 
1415 N N   . MET A 196 ? 1.1109 0.8869 1.0234 0.0795  0.0170  0.1063  413 MET A N   
1416 C CA  . MET A 196 ? 1.1803 0.9570 1.0549 0.0826  0.0239  0.1383  413 MET A CA  
1417 C C   . MET A 196 ? 1.3685 1.0487 1.1842 0.1062  0.0058  0.1587  413 MET A C   
1418 O O   . MET A 196 ? 1.3830 1.0666 1.1664 0.1394  -0.0010 0.1687  413 MET A O   
1419 C CB  . MET A 196 ? 1.2426 1.0377 1.1190 0.0335  0.0449  0.1667  413 MET A CB  
1420 C CG  . MET A 196 ? 1.2243 1.1234 1.1400 0.0282  0.0627  0.1535  413 MET A CG  
1421 S SD  . MET A 196 ? 1.3438 1.2841 1.2404 -0.0061 0.0923  0.1945  413 MET A SD  
1422 C CE  . MET A 196 ? 1.2049 1.2640 1.1464 0.0085  0.1057  0.1642  413 MET A CE  
1423 N N   . HIS A 197 ? 1.4228 1.0108 1.2200 0.0921  -0.0067 0.1628  414 HIS A N   
1424 C CA  . HIS A 197 ? 1.5455 1.0210 1.2808 0.1187  -0.0302 0.1786  414 HIS A CA  
1425 C C   . HIS A 197 ? 1.5723 1.0616 1.3100 0.1860  -0.0483 0.1485  414 HIS A C   
1426 O O   . HIS A 197 ? 1.6549 1.0931 1.3446 0.2245  -0.0666 0.1626  414 HIS A O   
1427 C CB  . HIS A 197 ? 1.6420 1.0129 1.3600 0.0905  -0.0444 0.1794  414 HIS A CB  
1428 C CG  . HIS A 197 ? 1.7512 1.0883 1.4579 0.0208  -0.0332 0.2185  414 HIS A CG  
1429 N ND1 . HIS A 197 ? 1.8688 1.1588 1.5200 0.0028  -0.0287 0.2683  414 HIS A ND1 
1430 C CD2 . HIS A 197 ? 1.7617 1.1070 1.5055 -0.0350 -0.0276 0.2155  414 HIS A CD2 
1431 C CE1 . HIS A 197 ? 1.8982 1.1784 1.5606 -0.0675 -0.0161 0.2954  414 HIS A CE1 
1432 N NE2 . HIS A 197 ? 1.8390 1.1534 1.5604 -0.0921 -0.0171 0.2636  414 HIS A NE2 
1433 N N   . ALA A 198 ? 1.4153 0.9787 1.2096 0.1992  -0.0434 0.1088  415 ALA A N   
1434 C CA  . ALA A 198 ? 1.3645 0.9714 1.1803 0.2543  -0.0542 0.0778  415 ALA A CA  
1435 C C   . ALA A 198 ? 1.3376 1.0215 1.1640 0.2758  -0.0548 0.0822  415 ALA A C   
1436 O O   . ALA A 198 ? 1.3618 1.0499 1.1795 0.3249  -0.0734 0.0752  415 ALA A O   
1437 C CB  . ALA A 198 ? 1.2874 0.9542 1.1562 0.2473  -0.0431 0.0424  415 ALA A CB  
1438 N N   . GLU A 199 ? 1.2251 0.9689 1.0684 0.2425  -0.0377 0.0917  416 GLU A N   
1439 C CA  . GLU A 199 ? 1.1828 0.9938 1.0292 0.2598  -0.0411 0.0926  416 GLU A CA  
1440 C C   . GLU A 199 ? 1.3410 1.1000 1.1202 0.2780  -0.0528 0.1257  416 GLU A C   
1441 O O   . GLU A 199 ? 1.3426 1.1324 1.1129 0.3153  -0.0708 0.1209  416 GLU A O   
1442 C CB  . GLU A 199 ? 1.1075 0.9923 0.9873 0.2270  -0.0225 0.0853  416 GLU A CB  
1443 C CG  . GLU A 199 ? 1.1130 1.0502 1.0520 0.2205  -0.0190 0.0522  416 GLU A CG  
1444 C CD  . GLU A 199 ? 1.2479 1.2526 1.2185 0.2000  -0.0103 0.0389  416 GLU A CD  
1445 O OE1 . GLU A 199 ? 1.0447 1.0957 1.0234 0.2163  -0.0218 0.0284  416 GLU A OE1 
1446 O OE2 . GLU A 199 ? 1.2420 1.2505 1.2305 0.1700  0.0031  0.0352  416 GLU A OE2 
1447 N N   . GLU A 200 ? 1.3842 1.0604 1.1139 0.2507  -0.0456 0.1602  417 GLU A N   
1448 C CA  . GLU A 200 ? 1.4889 1.0941 1.1396 0.2612  -0.0553 0.2006  417 GLU A CA  
1449 C C   . GLU A 200 ? 1.6220 1.1477 1.2366 0.3141  -0.0891 0.1985  417 GLU A C   
1450 O O   . GLU A 200 ? 1.6892 1.1835 1.2475 0.3484  -0.1085 0.2184  417 GLU A O   
1451 C CB  . GLU A 200 ? 1.5702 1.1146 1.1855 0.2048  -0.0349 0.2409  417 GLU A CB  
1452 C CG  . GLU A 200 ? 1.6333 1.2655 1.2700 0.1652  -0.0021 0.2497  417 GLU A CG  
1453 C CD  . GLU A 200 ? 1.9580 1.5626 1.5756 0.1041  0.0234  0.2898  417 GLU A CD  
1454 O OE1 . GLU A 200 ? 1.9133 1.4233 1.5130 0.0777  0.0150  0.3076  417 GLU A OE1 
1455 O OE2 . GLU A 200 ? 1.8384 1.5194 1.4600 0.0825  0.0512  0.3021  417 GLU A OE2 
1456 N N   . ARG A 201 ? 1.5803 1.0764 1.2242 0.3261  -0.0975 0.1718  418 ARG A N   
1457 C CA  . ARG A 201 ? 1.6516 1.0843 1.2723 0.3852  -0.1288 0.1581  418 ARG A CA  
1458 C C   . ARG A 201 ? 1.6755 1.2050 1.3340 0.4409  -0.1446 0.1307  418 ARG A C   
1459 O O   . ARG A 201 ? 1.7665 1.2574 1.3881 0.4967  -0.1751 0.1337  418 ARG A O   
1460 C CB  . ARG A 201 ? 1.6135 1.0160 1.2630 0.3842  -0.1278 0.1278  418 ARG A CB  
1461 C CG  . ARG A 201 ? 1.8526 1.0999 1.4334 0.3806  -0.1463 0.1467  418 ARG A CG  
1462 C CD  . ARG A 201 ? 1.9944 1.2120 1.5951 0.3965  -0.1521 0.1077  418 ARG A CD  
1463 N NE  . ARG A 201 ? 2.2665 1.3549 1.8018 0.4505  -0.1880 0.1044  418 ARG A NE  
1464 C CZ  . ARG A 201 ? 2.5947 1.6129 2.1166 0.4720  -0.2015 0.0739  418 ARG A CZ  
1465 N NH1 . ARG A 201 ? 2.4039 1.4719 1.9728 0.4415  -0.1813 0.0456  418 ARG A NH1 
1466 N NH2 . ARG A 201 ? 2.6276 1.5196 2.0819 0.5282  -0.2383 0.0700  418 ARG A NH2 
1467 N N   . GLU A 202 ? 1.5050 1.1577 1.2372 0.4246  -0.1274 0.1043  419 GLU A N   
1468 C CA  . GLU A 202 ? 1.4481 1.2055 1.2287 0.4618  -0.1416 0.0783  419 GLU A CA  
1469 C C   . GLU A 202 ? 1.5695 1.3327 1.3056 0.4776  -0.1594 0.1000  419 GLU A C   
1470 O O   . GLU A 202 ? 1.6172 1.4102 1.3562 0.5290  -0.1894 0.0894  419 GLU A O   
1471 C CB  . GLU A 202 ? 1.3376 1.2026 1.1960 0.4278  -0.1198 0.0516  419 GLU A CB  
1472 C CG  . GLU A 202 ? 1.4665 1.3984 1.3905 0.4518  -0.1201 0.0158  419 GLU A CG  
1473 C CD  . GLU A 202 ? 1.8546 1.8692 1.8173 0.5000  -0.1447 -0.0031 419 GLU A CD  
1474 O OE1 . GLU A 202 ? 1.7585 1.8279 1.7317 0.4951  -0.1572 -0.0009 419 GLU A OE1 
1475 O OE2 . GLU A 202 ? 1.8897 1.9257 1.8788 0.5418  -0.1511 -0.0241 419 GLU A OE2 
1476 N N   . GLU A 203 ? 1.7250 1.2859 1.7208 0.3648  -0.4522 -0.0822 420 GLU A N   
1477 C CA  . GLU A 203 ? 1.7868 1.2911 1.7149 0.4453  -0.4868 -0.1007 420 GLU A CA  
1478 C C   . GLU A 203 ? 1.8850 1.3382 1.7451 0.4981  -0.4871 -0.1222 420 GLU A C   
1479 O O   . GLU A 203 ? 1.9550 1.3527 1.7562 0.5752  -0.5210 -0.1451 420 GLU A O   
1480 C CB  . GLU A 203 ? 1.8252 1.3124 1.6856 0.4652  -0.4698 -0.0640 420 GLU A CB  
1481 C CG  . GLU A 203 ? 1.9458 1.4646 1.8556 0.4440  -0.4925 -0.0574 420 GLU A CG  
1482 C CD  . GLU A 203 ? 2.1970 1.7052 2.1523 0.4829  -0.5590 -0.0979 420 GLU A CD  
1483 O OE1 . GLU A 203 ? 2.2391 1.6932 2.1457 0.5575  -0.5966 -0.1265 420 GLU A OE1 
1484 O OE2 . GLU A 203 ? 1.9759 1.5265 2.0159 0.4426  -0.5738 -0.1019 420 GLU A OE2 
1485 N N   . SER A 204 ? 1.8086 1.2766 1.6719 0.4612  -0.4515 -0.1165 421 SER A N   
1486 C CA  . SER A 204 ? 1.9872 1.4120 1.7874 0.5021  -0.4454 -0.1358 421 SER A CA  
1487 C C   . SER A 204 ? 2.0013 1.4577 1.8656 0.4598  -0.4473 -0.1580 421 SER A C   
1488 O O   . SER A 204 ? 1.4493 0.9219 1.3926 0.4570  -0.4891 -0.1931 421 SER A O   
1489 C CB  . SER A 204 ? 2.0497 1.4499 1.7642 0.5076  -0.3871 -0.0958 421 SER A CB  
1490 O OG  . SER A 204 ? 2.0672 1.5180 1.8228 0.4311  -0.3437 -0.0616 421 SER A OG  
1491 N N   . ALA A 223 ? 1.8783 1.6153 1.9884 -0.0600 -0.1232 0.1378  440 ALA A N   
1492 C CA  . ALA A 223 ? 1.8797 1.6198 2.0303 -0.0644 -0.1149 0.1447  440 ALA A CA  
1493 C C   . ALA A 223 ? 1.9245 1.6798 2.0837 -0.0709 -0.1306 0.1403  440 ALA A C   
1494 O O   . ALA A 223 ? 1.9114 1.6699 2.0917 -0.0691 -0.1229 0.1476  440 ALA A O   
1495 C CB  . ALA A 223 ? 1.9092 1.6337 2.0571 -0.0458 -0.0866 0.1598  440 ALA A CB  
1496 N N   . CYS A 224 ? 1.8868 1.6482 2.0282 -0.0761 -0.1496 0.1299  441 CYS A N   
1497 C CA  . CYS A 224 ? 1.8768 1.6478 2.0168 -0.0791 -0.1622 0.1243  441 CYS A CA  
1498 C C   . CYS A 224 ? 1.9229 1.6903 2.0734 -0.0830 -0.1787 0.1120  441 CYS A C   
1499 O O   . CYS A 224 ? 1.9142 1.6845 2.0943 -0.0859 -0.1848 0.1064  441 CYS A O   
1500 C CB  . CYS A 224 ? 1.8755 1.6502 1.9883 -0.0738 -0.1653 0.1235  441 CYS A CB  
1501 S SG  . CYS A 224 ? 1.9271 1.6937 2.0222 -0.0729 -0.1694 0.1184  441 CYS A SG  
1502 N N   . LYS A 225 ? 1.8817 1.6390 2.0076 -0.0784 -0.1865 0.1071  442 LYS A N   
1503 C CA  . LYS A 225 ? 1.8940 1.6363 2.0104 -0.0697 -0.2038 0.0955  442 LYS A CA  
1504 C C   . LYS A 225 ? 1.9636 1.7038 2.0850 -0.0637 -0.2170 0.0828  442 LYS A C   
1505 O O   . LYS A 225 ? 1.9714 1.7039 2.1171 -0.0593 -0.2351 0.0685  442 LYS A O   
1506 C CB  . LYS A 225 ? 1.9269 1.6575 2.0552 -0.0683 -0.2138 0.0913  442 LYS A CB  
1507 C CG  . LYS A 225 ? 1.9693 1.6761 2.0615 -0.0501 -0.2291 0.0852  442 LYS A CG  
1508 C CD  . LYS A 225 ? 1.9836 1.6749 2.0966 -0.0400 -0.2561 0.0691  442 LYS A CD  
1509 C CE  . LYS A 225 ? 1.9876 1.6596 2.0745 -0.0289 -0.2659 0.0713  442 LYS A CE  
1510 N NZ  . LYS A 225 ? 2.0580 1.7021 2.0847 -0.0016 -0.2702 0.0734  442 LYS A NZ  
1511 N N   . VAL A 226 ? 1.9177 1.6638 2.0189 -0.0620 -0.2098 0.0855  443 VAL A N   
1512 C CA  . VAL A 226 ? 1.9241 1.6657 2.0174 -0.0536 -0.2206 0.0724  443 VAL A CA  
1513 C C   . VAL A 226 ? 2.0017 1.7123 2.0528 -0.0284 -0.2287 0.0630  443 VAL A C   
1514 O O   . VAL A 226 ? 2.0116 1.7127 2.0327 -0.0205 -0.2129 0.0737  443 VAL A O   
1515 C CB  . VAL A 226 ? 1.9529 1.7111 2.0381 -0.0600 -0.2096 0.0793  443 VAL A CB  
1516 C CG1 . VAL A 226 ? 1.9548 1.7113 2.0367 -0.0542 -0.2220 0.0641  443 VAL A CG1 
1517 C CG2 . VAL A 226 ? 1.9269 1.7057 2.0370 -0.0743 -0.1986 0.0938  443 VAL A CG2 
1518 N N   . ASP A 227 ? 1.9616 1.6526 2.0144 -0.0119 -0.2534 0.0428  444 ASP A N   
1519 C CA  . ASP A 227 ? 1.9936 1.6442 1.9993 0.0235  -0.2670 0.0310  444 ASP A CA  
1520 C C   . ASP A 227 ? 2.0312 1.6559 1.9802 0.0512  -0.2583 0.0266  444 ASP A C   
1521 O O   . ASP A 227 ? 2.0698 1.6527 1.9680 0.0882  -0.2609 0.0232  444 ASP A O   
1522 C CB  . ASP A 227 ? 2.0420 1.6768 2.0732 0.0375  -0.3035 0.0061  444 ASP A CB  
1523 C CG  . ASP A 227 ? 2.1715 1.8216 2.2538 0.0172  -0.3089 0.0115  444 ASP A CG  
1524 O OD1 . ASP A 227 ? 2.1575 1.8227 2.2373 -0.0010 -0.2851 0.0344  444 ASP A OD1 
1525 O OD2 . ASP A 227 ? 2.2691 1.9141 2.3966 0.0218  -0.3374 -0.0091 444 ASP A OD2 
1526 N N   . SER A 228 ? 1.9264 1.5714 1.8792 0.0377  -0.2460 0.0285  445 SER A N   
1527 C CA  . SER A 228 ? 1.9301 1.5523 1.8314 0.0618  -0.2333 0.0249  445 SER A CA  
1528 C C   . SER A 228 ? 1.9531 1.5614 1.8278 0.0706  -0.1987 0.0488  445 SER A C   
1529 O O   . SER A 228 ? 1.9164 1.5524 1.8259 0.0437  -0.1835 0.0675  445 SER A O   
1530 C CB  . SER A 228 ? 1.9363 1.5878 1.8532 0.0415  -0.2311 0.0215  445 SER A CB  
1531 O OG  . SER A 228 ? 2.0503 1.6785 1.9150 0.0656  -0.2195 0.0153  445 SER A OG  
1532 N N   . PRO A 229 ? 1.9301 1.4918 1.7459 0.1120  -0.1845 0.0479  446 PRO A N   
1533 C CA  . PRO A 229 ? 1.9297 1.4768 1.7346 0.1209  -0.1444 0.0737  446 PRO A CA  
1534 C C   . PRO A 229 ? 1.9308 1.5033 1.7579 0.1005  -0.1194 0.0835  446 PRO A C   
1535 O O   . PRO A 229 ? 1.9073 1.4875 1.7632 0.0909  -0.0909 0.1039  446 PRO A O   
1536 C CB  . PRO A 229 ? 2.0260 1.5066 1.7563 0.1798  -0.1346 0.0705  446 PRO A CB  
1537 C CG  . PRO A 229 ? 2.1119 1.5730 1.8109 0.2031  -0.1759 0.0371  446 PRO A CG  
1538 C CD  . PRO A 229 ? 2.0011 1.5172 1.7590 0.1571  -0.2016 0.0232  446 PRO A CD  
1539 N N   . THR A 230 ? 1.3293 1.2130 1.2120 0.0753  -0.0186 -0.2662 447 THR A N   
1540 C CA  . THR A 230 ? 1.2928 1.1845 1.1835 0.0836  -0.0100 -0.2400 447 THR A CA  
1541 C C   . THR A 230 ? 1.2778 1.1476 1.2000 0.0749  -0.0061 -0.2321 447 THR A C   
1542 O O   . THR A 230 ? 1.2607 1.1186 1.1846 0.0788  0.0058  -0.2173 447 THR A O   
1543 C CB  . THR A 230 ? 1.3917 1.3182 1.2766 0.0871  -0.0192 -0.2268 447 THR A CB  
1544 O OG1 . THR A 230 ? 1.4060 1.3574 1.2636 0.0918  -0.0320 -0.2415 447 THR A OG1 
1545 C CG2 . THR A 230 ? 1.3390 1.2700 1.2140 0.1008  0.0012  -0.1982 447 THR A CG2 
1546 N N   . VAL A 231 ? 1.1963 1.0588 1.1423 0.0642  -0.0147 -0.2438 448 VAL A N   
1547 C CA  . VAL A 231 ? 1.1557 0.9947 1.1283 0.0619  -0.0096 -0.2381 448 VAL A CA  
1548 C C   . VAL A 231 ? 1.1861 1.0105 1.1605 0.0637  0.0022  -0.2427 448 VAL A C   
1549 O O   . VAL A 231 ? 1.1737 0.9867 1.1572 0.0659  0.0067  -0.2300 448 VAL A O   
1550 C CB  . VAL A 231 ? 1.1951 1.0289 1.1966 0.0561  -0.0152 -0.2481 448 VAL A CB  
1551 C CG1 . VAL A 231 ? 1.1713 0.9768 1.1955 0.0613  -0.0044 -0.2448 448 VAL A CG1 
1552 C CG2 . VAL A 231 ? 1.1903 1.0374 1.1999 0.0561  -0.0253 -0.2320 448 VAL A CG2 
1553 N N   . ASN A 232 ? 1.1363 0.9600 1.0992 0.0627  0.0077  -0.2583 449 ASN A N   
1554 C CA  . ASN A 232 ? 1.1281 0.9383 1.0925 0.0664  0.0238  -0.2568 449 ASN A CA  
1555 C C   . ASN A 232 ? 1.1358 0.9485 1.0996 0.0733  0.0285  -0.2377 449 ASN A C   
1556 O O   . ASN A 232 ? 1.1187 0.9280 1.1025 0.0738  0.0352  -0.2273 449 ASN A O   
1557 C CB  . ASN A 232 ? 1.1971 0.9959 1.1358 0.0656  0.0324  -0.2727 449 ASN A CB  
1558 C CG  . ASN A 232 ? 1.5546 1.3344 1.5035 0.0614  0.0513  -0.2817 449 ASN A CG  
1559 O OD1 . ASN A 232 ? 1.4692 1.2361 1.4206 0.0677  0.0717  -0.2696 449 ASN A OD1 
1560 N ND2 . ASN A 232 ? 1.4241 1.2024 1.3829 0.0517  0.0491  -0.3005 449 ASN A ND2 
1561 N N   . THR A 233 ? 1.0733 0.8950 1.0170 0.0793  0.0264  -0.2329 450 THR A N   
1562 C CA  . THR A 233 ? 1.0650 0.8877 1.0099 0.0862  0.0360  -0.2174 450 THR A CA  
1563 C C   . THR A 233 ? 1.0952 0.9164 1.0587 0.0770  0.0309  -0.2061 450 THR A C   
1564 O O   . THR A 233 ? 1.0982 0.9167 1.0802 0.0740  0.0348  -0.1977 450 THR A O   
1565 C CB  . THR A 233 ? 1.2079 1.0414 1.1251 0.0983  0.0406  -0.2149 450 THR A CB  
1566 O OG1 . THR A 233 ? 1.2353 1.0698 1.1259 0.1054  0.0374  -0.2292 450 THR A OG1 
1567 C CG2 . THR A 233 ? 1.1727 1.0023 1.0924 0.1099  0.0601  -0.2018 450 THR A CG2 
1568 N N   . THR A 234 ? 1.0068 0.8271 0.9644 0.0725  0.0217  -0.2045 451 THR A N   
1569 C CA  . THR A 234 ? 0.9662 0.7714 0.9284 0.0660  0.0178  -0.1933 451 THR A CA  
1570 C C   . THR A 234 ? 1.0030 0.8007 0.9876 0.0624  0.0130  -0.1956 451 THR A C   
1571 O O   . THR A 234 ? 1.0202 0.8118 1.0083 0.0567  0.0114  -0.1873 451 THR A O   
1572 C CB  . THR A 234 ? 0.9142 0.7130 0.8694 0.0665  0.0122  -0.1888 451 THR A CB  
1573 O OG1 . THR A 234 ? 0.8749 0.6908 0.8112 0.0716  0.0177  -0.1824 451 THR A OG1 
1574 C CG2 . THR A 234 ? 0.8795 0.6477 0.8290 0.0637  0.0123  -0.1736 451 THR A CG2 
1575 N N   . LEU A 235 ? 0.9326 0.7326 0.9314 0.0657  0.0130  -0.2068 452 LEU A N   
1576 C CA  . LEU A 235 ? 0.9263 0.7246 0.9463 0.0679  0.0147  -0.2058 452 LEU A CA  
1577 C C   . LEU A 235 ? 1.0103 0.8224 1.0435 0.0658  0.0184  -0.1966 452 LEU A C   
1578 O O   . LEU A 235 ? 1.0253 0.8401 1.0693 0.0625  0.0108  -0.1876 452 LEU A O   
1579 C CB  . LEU A 235 ? 0.9253 0.7226 0.9568 0.0735  0.0251  -0.2186 452 LEU A CB  
1580 C CG  . LEU A 235 ? 0.9824 0.7669 1.0159 0.0758  0.0226  -0.2277 452 LEU A CG  
1581 C CD1 . LEU A 235 ? 1.0068 0.7943 1.0423 0.0730  0.0322  -0.2467 452 LEU A CD1 
1582 C CD2 . LEU A 235 ? 0.9643 0.7322 1.0126 0.0865  0.0257  -0.2228 452 LEU A CD2 
1583 N N   . ARG A 236 ? 0.9763 0.7951 1.0081 0.0684  0.0294  -0.1973 453 ARG A N   
1584 C CA  . ARG A 236 ? 0.9777 0.8062 1.0274 0.0695  0.0379  -0.1842 453 ARG A CA  
1585 C C   . ARG A 236 ? 1.0373 0.8707 1.0938 0.0609  0.0295  -0.1757 453 ARG A C   
1586 O O   . ARG A 236 ? 1.0497 0.8968 1.1345 0.0558  0.0269  -0.1640 453 ARG A O   
1587 C CB  . ARG A 236 ? 0.9979 0.8172 1.0323 0.0789  0.0540  -0.1864 453 ARG A CB  
1588 C CG  . ARG A 236 ? 1.1330 0.9402 1.1572 0.0837  0.0675  -0.1938 453 ARG A CG  
1589 C CD  . ARG A 236 ? 1.4756 1.2628 1.4773 0.0943  0.0849  -0.1920 453 ARG A CD  
1590 N NE  . ARG A 236 ? 1.7991 1.5651 1.7840 0.0960  0.1029  -0.1981 453 ARG A NE  
1591 C CZ  . ARG A 236 ? 2.0069 1.7582 1.9581 0.0921  0.1009  -0.2210 453 ARG A CZ  
1592 N NH1 . ARG A 236 ? 1.7989 1.5616 1.7338 0.0885  0.0793  -0.2363 453 ARG A NH1 
1593 N NH2 . ARG A 236 ? 1.8085 1.5346 1.7424 0.0906  0.1222  -0.2273 453 ARG A NH2 
1594 N N   . SER A 237 ? 0.9681 0.7913 0.9995 0.0584  0.0275  -0.1802 454 SER A N   
1595 C CA  . SER A 237 ? 0.9610 0.7804 0.9911 0.0485  0.0272  -0.1738 454 SER A CA  
1596 C C   . SER A 237 ? 1.0109 0.8216 1.0396 0.0355  0.0102  -0.1719 454 SER A C   
1597 O O   . SER A 237 ? 1.0141 0.8303 1.0585 0.0231  0.0042  -0.1672 454 SER A O   
1598 C CB  . SER A 237 ? 1.0132 0.8227 1.0124 0.0532  0.0393  -0.1746 454 SER A CB  
1599 O OG  . SER A 237 ? 1.1331 0.9497 1.1280 0.0689  0.0551  -0.1762 454 SER A OG  
1600 N N   . LEU A 238 ? 0.9692 0.7640 0.9798 0.0392  0.0023  -0.1753 455 LEU A N   
1601 C CA  . LEU A 238 ? 0.9830 0.7595 0.9842 0.0328  -0.0120 -0.1723 455 LEU A CA  
1602 C C   . LEU A 238 ? 1.0477 0.8483 1.0795 0.0336  -0.0226 -0.1704 455 LEU A C   
1603 O O   . LEU A 238 ? 1.0517 0.8489 1.0806 0.0246  -0.0378 -0.1672 455 LEU A O   
1604 C CB  . LEU A 238 ? 0.9856 0.7315 0.9626 0.0421  -0.0126 -0.1721 455 LEU A CB  
1605 C CG  . LEU A 238 ? 1.0659 0.7766 1.0207 0.0416  -0.0236 -0.1667 455 LEU A CG  
1606 C CD1 . LEU A 238 ? 1.1015 0.7849 1.0241 0.0242  -0.0240 -0.1603 455 LEU A CD1 
1607 C CD2 . LEU A 238 ? 1.0976 0.7750 1.0382 0.0574  -0.0186 -0.1631 455 LEU A CD2 
1608 N N   . GLY A 239 ? 0.9932 0.8175 1.0506 0.0440  -0.0126 -0.1706 456 GLY A N   
1609 C CA  . GLY A 239 ? 0.9871 0.8404 1.0772 0.0482  -0.0133 -0.1618 456 GLY A CA  
1610 C C   . GLY A 239 ? 1.0687 0.9444 1.1841 0.0337  -0.0214 -0.1514 456 GLY A C   
1611 O O   . GLY A 239 ? 1.0875 0.9822 1.2185 0.0267  -0.0383 -0.1444 456 GLY A O   
1612 N N   . ALA A 240 ? 1.0179 0.8903 1.1367 0.0296  -0.0097 -0.1513 457 ALA A N   
1613 C CA  . ALA A 240 ? 1.0286 0.9169 1.1777 0.0167  -0.0111 -0.1427 457 ALA A CA  
1614 C C   . ALA A 240 ? 1.0868 0.9693 1.2258 -0.0053 -0.0322 -0.1477 457 ALA A C   
1615 O O   . ALA A 240 ? 1.0976 1.0068 1.2706 -0.0192 -0.0469 -0.1402 457 ALA A O   
1616 C CB  . ALA A 240 ? 1.0445 0.9187 1.1887 0.0230  0.0113  -0.1446 457 ALA A CB  
1617 N N   . LEU A 241 ? 1.0373 0.8830 1.1280 -0.0088 -0.0334 -0.1584 458 LEU A N   
1618 C CA  . LEU A 241 ? 1.0556 0.8778 1.1186 -0.0291 -0.0483 -0.1632 458 LEU A CA  
1619 C C   . LEU A 241 ? 1.1537 0.9871 1.2183 -0.0322 -0.0764 -0.1615 458 LEU A C   
1620 O O   . LEU A 241 ? 1.1862 1.0234 1.2520 -0.0539 -0.0958 -0.1635 458 LEU A O   
1621 C CB  . LEU A 241 ? 1.0617 0.8347 1.0683 -0.0258 -0.0365 -0.1672 458 LEU A CB  
1622 C CG  . LEU A 241 ? 1.1273 0.8794 1.1147 -0.0345 -0.0121 -0.1675 458 LEU A CG  
1623 C CD1 . LEU A 241 ? 1.1358 0.8449 1.0707 -0.0267 0.0022  -0.1630 458 LEU A CD1 
1624 C CD2 . LEU A 241 ? 1.2010 0.9422 1.1862 -0.0622 -0.0167 -0.1713 458 LEU A CD2 
1625 N N   . TYR A 242 ? 1.1110 0.9497 1.1747 -0.0098 -0.0770 -0.1589 459 TYR A N   
1626 C CA  . TYR A 242 ? 1.1286 0.9797 1.1922 -0.0030 -0.0973 -0.1554 459 TYR A CA  
1627 C C   . TYR A 242 ? 1.1768 1.0874 1.2934 -0.0116 -0.1112 -0.1436 459 TYR A C   
1628 O O   . TYR A 242 ? 1.1800 1.1060 1.2949 -0.0201 -0.1377 -0.1419 459 TYR A O   
1629 C CB  . TYR A 242 ? 1.1292 0.9729 1.1871 0.0271  -0.0838 -0.1547 459 TYR A CB  
1630 C CG  . TYR A 242 ? 1.1596 0.9452 1.1697 0.0378  -0.0777 -0.1617 459 TYR A CG  
1631 C CD1 . TYR A 242 ? 1.2327 0.9716 1.1957 0.0283  -0.0912 -0.1632 459 TYR A CD1 
1632 C CD2 . TYR A 242 ? 1.1354 0.9094 1.1477 0.0580  -0.0573 -0.1646 459 TYR A CD2 
1633 C CE1 . TYR A 242 ? 1.2626 0.9419 1.1833 0.0417  -0.0812 -0.1623 459 TYR A CE1 
1634 C CE2 . TYR A 242 ? 1.1484 0.8714 1.1270 0.0692  -0.0512 -0.1663 459 TYR A CE2 
1635 C CZ  . TYR A 242 ? 1.2870 0.9617 1.2207 0.0628  -0.0618 -0.1624 459 TYR A CZ  
1636 O OH  . TYR A 242 ? 1.3669 0.9851 1.2685 0.0765  -0.0515 -0.1572 459 TYR A OH  
1637 N N   . ARG A 243 ? 1.1131 1.0547 1.2751 -0.0086 -0.0929 -0.1333 460 ARG A N   
1638 C CA  . ARG A 243 ? 1.0952 1.0919 1.3177 -0.0144 -0.0976 -0.1140 460 ARG A CA  
1639 C C   . ARG A 243 ? 1.1441 1.1505 1.3826 -0.0465 -0.1206 -0.1182 460 ARG A C   
1640 O O   . ARG A 243 ? 1.1569 1.2080 1.4300 -0.0584 -0.1450 -0.1075 460 ARG A O   
1641 C CB  . ARG A 243 ? 1.0668 1.0687 1.3191 -0.0017 -0.0656 -0.1022 460 ARG A CB  
1642 C CG  . ARG A 243 ? 1.1694 1.2202 1.4813 0.0052  -0.0575 -0.0725 460 ARG A CG  
1643 C CD  . ARG A 243 ? 1.2209 1.2558 1.5347 0.0276  -0.0195 -0.0616 460 ARG A CD  
1644 N NE  . ARG A 243 ? 1.2918 1.3197 1.5789 0.0476  -0.0056 -0.0637 460 ARG A NE  
1645 C CZ  . ARG A 243 ? 1.6270 1.6864 1.9383 0.0629  0.0094  -0.0397 460 ARG A CZ  
1646 N NH1 . ARG A 243 ? 1.5870 1.6902 1.9516 0.0606  0.0105  -0.0072 460 ARG A NH1 
1647 N NH2 . ARG A 243 ? 1.4884 1.5362 1.7743 0.0817  0.0281  -0.0453 460 ARG A NH2 
1648 N N   . ARG A 244 ? 0.9137 0.9335 1.6938 0.0433  0.0307  -0.2834 461 ARG A N   
1649 C CA  . ARG A 244 ? 0.9309 0.9627 1.8511 0.0107  0.0653  -0.3358 461 ARG A CA  
1650 C C   . ARG A 244 ? 1.0030 1.1004 1.9508 -0.0006 0.0209  -0.4161 461 ARG A C   
1651 O O   . ARG A 244 ? 1.0247 1.1777 2.1007 -0.0258 0.0241  -0.4899 461 ARG A O   
1652 C CB  . ARG A 244 ? 0.9541 0.8939 1.8877 0.0043  0.1296  -0.2893 461 ARG A CB  
1653 C CG  . ARG A 244 ? 1.1614 1.0896 2.2296 -0.0283 0.1751  -0.3377 461 ARG A CG  
1654 C CD  . ARG A 244 ? 1.5206 1.4701 2.7478 -0.0530 0.2235  -0.3718 461 ARG A CD  
1655 N NE  . ARG A 244 ? 1.8080 1.7714 3.1870 -0.0921 0.2528  -0.4499 461 ARG A NE  
1656 C CZ  . ARG A 244 ? 2.0888 2.1412 3.5144 -0.1153 0.2070  -0.5287 461 ARG A CZ  
1657 N NH1 . ARG A 244 ? 1.9048 2.0549 3.3599 -0.1040 0.1495  -0.5763 461 ARG A NH1 
1658 N NH2 . ARG A 244 ? 2.0172 2.0665 3.4893 -0.1475 0.2207  -0.5705 461 ARG A NH2 
1659 N N   . GLN A 245 ? 0.9567 1.0502 1.7878 0.0199  -0.0184 -0.4054 462 GLN A N   
1660 C CA  . GLN A 245 ? 0.9620 1.1110 1.7828 0.0220  -0.0596 -0.4723 462 GLN A CA  
1661 C C   . GLN A 245 ? 0.9954 1.2427 1.7815 0.0512  -0.1204 -0.5079 462 GLN A C   
1662 O O   . GLN A 245 ? 1.0082 1.3170 1.7757 0.0636  -0.1602 -0.5681 462 GLN A O   
1663 C CB  . GLN A 245 ? 0.9825 1.0757 1.6918 0.0373  -0.0628 -0.4352 462 GLN A CB  
1664 C CG  . GLN A 245 ? 1.2052 1.2199 1.9548 0.0153  -0.0105 -0.4138 462 GLN A CG  
1665 C CD  . GLN A 245 ? 1.4404 1.4016 2.0883 0.0334  -0.0114 -0.3626 462 GLN A CD  
1666 O OE1 . GLN A 245 ? 1.2980 1.2791 1.8568 0.0563  -0.0460 -0.3621 462 GLN A OE1 
1667 N NE2 . GLN A 245 ? 1.3641 1.2577 2.0311 0.0269  0.0316  -0.3177 462 GLN A NE2 
1668 N N   . GLY A 246 ? 0.9348 1.1951 1.7033 0.0686  -0.1255 -0.4684 463 GLY A N   
1669 C CA  . GLY A 246 ? 0.9551 1.3031 1.6876 0.1056  -0.1766 -0.4863 463 GLY A CA  
1670 C C   . GLY A 246 ? 1.0513 1.3744 1.6282 0.1504  -0.1981 -0.4313 463 GLY A C   
1671 O O   . GLY A 246 ? 1.0650 1.4491 1.5935 0.1923  -0.2331 -0.4307 463 GLY A O   
1672 N N   . LYS A 247 ? 1.0218 1.2547 1.5284 0.1443  -0.1721 -0.3825 464 LYS A N   
1673 C CA  . LYS A 247 ? 1.0368 1.2289 1.4182 0.1777  -0.1768 -0.3300 464 LYS A CA  
1674 C C   . LYS A 247 ? 1.0850 1.2320 1.4322 0.1865  -0.1597 -0.2674 464 LYS A C   
1675 O O   . LYS A 247 ? 1.0692 1.1419 1.3813 0.1761  -0.1354 -0.2234 464 LYS A O   
1676 C CB  . LYS A 247 ? 1.0714 1.1976 1.4221 0.1624  -0.1556 -0.3167 464 LYS A CB  
1677 C CG  . LYS A 247 ? 1.2792 1.4425 1.6351 0.1636  -0.1711 -0.3765 464 LYS A CG  
1678 C CD  . LYS A 247 ? 1.3577 1.4515 1.7026 0.1454  -0.1416 -0.3607 464 LYS A CD  
1679 C CE  . LYS A 247 ? 1.4495 1.5714 1.7870 0.1503  -0.1517 -0.4197 464 LYS A CE  
1680 N NZ  . LYS A 247 ? 1.5138 1.5651 1.8475 0.1344  -0.1173 -0.3996 464 LYS A NZ  
1681 N N   . LEU A 248 ? 1.0647 1.2628 1.4275 0.2072  -0.1739 -0.2691 465 LEU A N   
1682 C CA  . LEU A 248 ? 1.0677 1.2281 1.4047 0.2175  -0.1556 -0.2187 465 LEU A CA  
1683 C C   . LEU A 248 ? 1.1561 1.2596 1.3928 0.2432  -0.1468 -0.1691 465 LEU A C   
1684 O O   . LEU A 248 ? 1.1437 1.1840 1.3619 0.2327  -0.1229 -0.1335 465 LEU A O   
1685 C CB  . LEU A 248 ? 1.0771 1.3095 1.4629 0.2370  -0.1699 -0.2339 465 LEU A CB  
1686 C CG  . LEU A 248 ? 1.1198 1.3725 1.6245 0.2021  -0.1516 -0.2611 465 LEU A CG  
1687 C CD1 . LEU A 248 ? 1.1318 1.4984 1.7327 0.2051  -0.1849 -0.3300 465 LEU A CD1 
1688 C CD2 . LEU A 248 ? 1.1398 1.3522 1.6450 0.2051  -0.1199 -0.2173 465 LEU A CD2 
1689 N N   . GLU A 249 ? 1.1579 1.2814 1.3323 0.2781  -0.1617 -0.1690 466 GLU A N   
1690 C CA  . GLU A 249 ? 1.1882 1.2503 1.2823 0.3022  -0.1401 -0.1212 466 GLU A CA  
1691 C C   . GLU A 249 ? 1.1972 1.1852 1.2918 0.2656  -0.1178 -0.1076 466 GLU A C   
1692 O O   . GLU A 249 ? 1.1820 1.1120 1.2588 0.2608  -0.0956 -0.0757 466 GLU A O   
1693 C CB  . GLU A 249 ? 1.2731 1.3701 1.2972 0.3557  -0.1509 -0.1185 466 GLU A CB  
1694 C CG  . GLU A 249 ? 1.5140 1.5429 1.4660 0.3876  -0.1136 -0.0631 466 GLU A CG  
1695 C CD  . GLU A 249 ? 1.8172 1.8018 1.7676 0.3969  -0.0862 -0.0228 466 GLU A CD  
1696 O OE1 . GLU A 249 ? 1.8005 1.8315 1.7635 0.4198  -0.0998 -0.0234 466 GLU A OE1 
1697 O OE2 . GLU A 249 ? 1.6657 1.5713 1.6107 0.3805  -0.0502 0.0045  466 GLU A OE2 
1698 N N   . ALA A 250 ? 1.1446 1.1403 1.2707 0.2396  -0.1243 -0.1370 467 ALA A N   
1699 C CA  . ALA A 250 ? 1.1217 1.0622 1.2604 0.2090  -0.1072 -0.1267 467 ALA A CA  
1700 C C   . ALA A 250 ? 1.1568 1.0678 1.3294 0.1840  -0.0974 -0.1127 467 ALA A C   
1701 O O   . ALA A 250 ? 1.1532 1.0181 1.3111 0.1758  -0.0863 -0.0899 467 ALA A O   
1702 C CB  . ALA A 250 ? 1.1241 1.0836 1.2963 0.1922  -0.1125 -0.1627 467 ALA A CB  
1703 N N   . ALA A 251 ? 1.0902 1.0319 1.3106 0.1751  -0.1001 -0.1291 468 ALA A N   
1704 C CA  . ALA A 251 ? 1.0640 0.9799 1.3084 0.1611  -0.0835 -0.1133 468 ALA A CA  
1705 C C   . ALA A 251 ? 1.1101 0.9944 1.3053 0.1751  -0.0784 -0.0850 468 ALA A C   
1706 O O   . ALA A 251 ? 1.0981 0.9422 1.2748 0.1680  -0.0699 -0.0687 468 ALA A O   
1707 C CB  . ALA A 251 ? 1.0679 1.0265 1.3818 0.1542  -0.0787 -0.1367 468 ALA A CB  
1708 N N   . HIS A 252 ? 1.0885 0.9931 1.2623 0.1990  -0.0836 -0.0816 469 HIS A N   
1709 C CA  . HIS A 252 ? 1.1075 0.9766 1.2428 0.2129  -0.0712 -0.0586 469 HIS A CA  
1710 C C   . HIS A 252 ? 1.1531 0.9729 1.2568 0.2074  -0.0644 -0.0478 469 HIS A C   
1711 O O   . HIS A 252 ? 1.1525 0.9358 1.2436 0.2003  -0.0561 -0.0432 469 HIS A O   
1712 C CB  . HIS A 252 ? 1.1458 1.0445 1.2677 0.2467  -0.0721 -0.0515 469 HIS A CB  
1713 C CG  . HIS A 252 ? 1.1932 1.1448 1.3605 0.2534  -0.0775 -0.0637 469 HIS A CG  
1714 N ND1 . HIS A 252 ? 1.2276 1.2554 1.4245 0.2712  -0.1010 -0.0867 469 HIS A ND1 
1715 C CD2 . HIS A 252 ? 1.2227 1.1649 1.4142 0.2470  -0.0610 -0.0586 469 HIS A CD2 
1716 C CE1 . HIS A 252 ? 1.2140 1.2805 1.4697 0.2698  -0.0986 -0.0976 469 HIS A CE1 
1717 N NE2 . HIS A 252 ? 1.2155 1.2273 1.4679 0.2561  -0.0702 -0.0772 469 HIS A NE2 
1718 N N   . THR A 253 ? 1.1071 0.9290 1.2035 0.2108  -0.0667 -0.0488 470 THR A N   
1719 C CA  . THR A 253 ? 1.1129 0.8927 1.2013 0.2036  -0.0542 -0.0408 470 THR A CA  
1720 C C   . THR A 253 ? 1.1200 0.8813 1.2281 0.1770  -0.0617 -0.0493 470 THR A C   
1721 O O   . THR A 253 ? 1.1194 0.8516 1.2274 0.1712  -0.0558 -0.0517 470 THR A O   
1722 C CB  . THR A 253 ? 1.2297 1.0185 1.3094 0.2141  -0.0505 -0.0398 470 THR A CB  
1723 O OG1 . THR A 253 ? 1.2461 1.0630 1.2920 0.2506  -0.0494 -0.0326 470 THR A OG1 
1724 C CG2 . THR A 253 ? 1.2158 0.9601 1.3014 0.2096  -0.0262 -0.0282 470 THR A CG2 
1725 N N   . LEU A 254 ? 1.0457 0.8267 1.1726 0.1651  -0.0734 -0.0560 471 LEU A N   
1726 C CA  . LEU A 254 ? 1.0309 0.8017 1.1652 0.1539  -0.0804 -0.0562 471 LEU A CA  
1727 C C   . LEU A 254 ? 1.1370 0.8975 1.2460 0.1605  -0.0801 -0.0537 471 LEU A C   
1728 O O   . LEU A 254 ? 1.1490 0.8995 1.2439 0.1606  -0.0901 -0.0592 471 LEU A O   
1729 C CB  . LEU A 254 ? 1.0013 0.7862 1.1627 0.1471  -0.0801 -0.0554 471 LEU A CB  
1730 C CG  . LEU A 254 ? 1.0447 0.8368 1.2285 0.1410  -0.0786 -0.0626 471 LEU A CG  
1731 C CD1 . LEU A 254 ? 1.0494 0.8459 1.2661 0.1339  -0.0716 -0.0633 471 LEU A CD1 
1732 C CD2 . LEU A 254 ? 1.0542 0.8314 1.2427 0.1378  -0.0804 -0.0600 471 LEU A CD2 
1733 N N   . GLU A 255 ? 1.1150 0.8839 1.2197 0.1689  -0.0698 -0.0493 472 GLU A N   
1734 C CA  . GLU A 255 ? 1.1508 0.9064 1.2286 0.1791  -0.0609 -0.0445 472 GLU A CA  
1735 C C   . GLU A 255 ? 1.2775 1.0074 1.3261 0.1836  -0.0607 -0.0541 472 GLU A C   
1736 O O   . GLU A 255 ? 1.3034 1.0172 1.3188 0.1897  -0.0622 -0.0615 472 GLU A O   
1737 C CB  . GLU A 255 ? 1.1589 0.9344 1.2602 0.1854  -0.0446 -0.0387 472 GLU A CB  
1738 C CG  . GLU A 255 ? 1.2695 1.0604 1.4142 0.1773  -0.0340 -0.0355 472 GLU A CG  
1739 C CD  . GLU A 255 ? 1.5686 1.3936 1.7741 0.1746  -0.0195 -0.0439 472 GLU A CD  
1740 O OE1 . GLU A 255 ? 1.3017 1.1532 1.5147 0.1832  -0.0264 -0.0521 472 GLU A OE1 
1741 O OE2 . GLU A 255 ? 1.5889 1.4165 1.8440 0.1655  0.0012  -0.0434 472 GLU A OE2 
1742 N N   . ASP A 256 ? 1.2666 0.9901 1.3267 0.1837  -0.0551 -0.0554 473 ASP A N   
1743 C CA  . ASP A 256 ? 1.3127 1.0021 1.3650 0.1857  -0.0421 -0.0646 473 ASP A CA  
1744 C C   . ASP A 256 ? 1.4322 1.1102 1.4989 0.1683  -0.0551 -0.0887 473 ASP A C   
1745 O O   . ASP A 256 ? 1.4772 1.1352 1.5376 0.1648  -0.0546 -0.1138 473 ASP A O   
1746 C CB  . ASP A 256 ? 1.3406 1.0223 1.4031 0.1990  -0.0216 -0.0487 473 ASP A CB  
1747 C CG  . ASP A 256 ? 1.4941 1.2007 1.5470 0.2246  -0.0143 -0.0299 473 ASP A CG  
1748 O OD1 . ASP A 256 ? 1.5026 1.2143 1.5487 0.2301  -0.0117 -0.0304 473 ASP A OD1 
1749 O OD2 . ASP A 256 ? 1.5773 1.3010 1.6285 0.2440  -0.0100 -0.0152 473 ASP A OD2 
1750 N N   . CYS A 257 ? 1.3953 1.0913 1.4879 0.1579  -0.0678 -0.0869 474 CYS A N   
1751 C CA  . CYS A 257 ? 1.4164 1.1169 1.5410 0.1427  -0.0835 -0.1104 474 CYS A CA  
1752 C C   . CYS A 257 ? 1.4743 1.1923 1.5703 0.1480  -0.1117 -0.1302 474 CYS A C   
1753 O O   . CYS A 257 ? 1.4867 1.2078 1.5980 0.1411  -0.1263 -0.1670 474 CYS A O   
1754 C CB  . CYS A 257 ? 1.4015 1.1200 1.5566 0.1364  -0.0874 -0.0981 474 CYS A CB  
1755 S SG  . CYS A 257 ? 1.4639 1.1987 1.6810 0.1196  -0.1043 -0.1253 474 CYS A SG  
1756 N N   . ALA A 258 ? 1.4352 1.1649 1.4909 0.1639  -0.1152 -0.1078 475 ALA A N   
1757 C CA  . ALA A 258 ? 1.4770 1.2187 1.4838 0.1838  -0.1318 -0.1116 475 ALA A CA  
1758 C C   . ALA A 258 ? 1.5908 1.3126 1.5535 0.1933  -0.1270 -0.1336 475 ALA A C   
1759 O O   . ALA A 258 ? 1.6410 1.3758 1.5669 0.2071  -0.1504 -0.1612 475 ALA A O   
1760 C CB  . ALA A 258 ? 1.4782 1.2227 1.4663 0.1990  -0.1161 -0.0736 475 ALA A CB  
1761 N N   . SER A 259 ? 1.5527 1.2474 1.5181 0.1901  -0.0981 -0.1240 476 SER A N   
1762 C CA  . SER A 259 ? 1.6032 1.2705 1.5346 0.1990  -0.0830 -0.1415 476 SER A CA  
1763 C C   . SER A 259 ? 1.6805 1.3330 1.6368 0.1834  -0.0903 -0.1914 476 SER A C   
1764 O O   . SER A 259 ? 1.7329 1.3740 1.6513 0.1921  -0.0937 -0.2255 476 SER A O   
1765 C CB  . SER A 259 ? 1.6406 1.2901 1.5838 0.2032  -0.0493 -0.1142 476 SER A CB  
1766 O OG  . SER A 259 ? 1.7713 1.4391 1.7087 0.2145  -0.0402 -0.0813 476 SER A OG  
1767 N N   . ARG A 260 ? 1.6066 1.2568 1.6313 0.1607  -0.0871 -0.1987 477 ARG A N   
1768 C CA  . ARG A 260 ? 1.6372 1.2704 1.7183 0.1395  -0.0827 -0.2475 477 ARG A CA  
1769 C C   . ARG A 260 ? 1.7771 1.4468 1.8510 0.1379  -0.1269 -0.3059 477 ARG A C   
1770 O O   . ARG A 260 ? 1.8432 1.4979 1.9301 0.1295  -0.1252 -0.3608 477 ARG A O   
1771 C CB  . ARG A 260 ? 1.5644 1.1907 1.7227 0.1204  -0.0643 -0.2348 477 ARG A CB  
1772 C CG  . ARG A 260 ? 1.6649 1.2762 1.9117 0.0933  -0.0525 -0.2866 477 ARG A CG  
1773 C CD  . ARG A 260 ? 1.8166 1.3644 2.0893 0.0897  0.0004  -0.2966 477 ARG A CD  
1774 N NE  . ARG A 260 ? 1.9152 1.4530 2.2662 0.0621  0.0037  -0.3716 477 ARG A NE  
1775 C CZ  . ARG A 260 ? 2.0918 1.6320 2.4194 0.0606  -0.0151 -0.4297 477 ARG A CZ  
1776 N NH1 . ARG A 260 ? 1.9016 1.4484 2.1229 0.0883  -0.0334 -0.4126 477 ARG A NH1 
1777 N NH2 . ARG A 260 ? 1.9650 1.5017 2.3803 0.0318  -0.0128 -0.5097 477 ARG A NH2 
1778 N N   . SER A 261 ? 1.7353 1.3866 1.7316 0.1582  -0.1929 -0.2858 478 SER A N   
1779 C CA  . SER A 261 ? 1.7973 1.4866 1.7690 0.1712  -0.2459 -0.3318 478 SER A CA  
1780 C C   . SER A 261 ? 1.9456 1.6186 1.8099 0.2058  -0.2554 -0.3558 478 SER A C   
1781 O O   . SER A 261 ? 2.0107 1.6998 1.8602 0.2126  -0.2960 -0.4202 478 SER A O   
1782 C CB  . SER A 261 ? 1.8105 1.5496 1.7732 0.1868  -0.2684 -0.2984 478 SER A CB  
1783 O OG  . SER A 261 ? 1.9781 1.7662 1.9191 0.2075  -0.3235 -0.3392 478 SER A OG  
1784 N N   . ARG A 262 ? 1.8996 1.6304 1.7614 0.2151  -0.1918 -0.3159 479 ARG A N   
1785 C CA  . ARG A 262 ? 2.1886 1.9046 1.9509 0.2490  -0.1853 -0.3222 479 ARG A CA  
1786 C C   . ARG A 262 ? 2.3743 2.0341 2.1462 0.2354  -0.1440 -0.3381 479 ARG A C   
1787 O O   . ARG A 262 ? 1.8888 1.5401 1.6738 0.2244  -0.1513 -0.4050 479 ARG A O   
1788 C CB  . ARG A 262 ? 2.1827 1.8953 1.8769 0.2840  -0.1653 -0.2508 479 ARG A CB  
1789 C CG  . ARG A 262 ? 2.2759 2.0295 1.9755 0.2975  -0.1886 -0.2172 479 ARG A CG  
1790 C CD  . ARG A 262 ? 2.4612 2.2684 2.1050 0.3325  -0.2399 -0.2523 479 ARG A CD  
1791 N NE  . ARG A 262 ? 2.4793 2.3294 2.1587 0.3385  -0.2648 -0.2290 479 ARG A NE  
1792 C CZ  . ARG A 262 ? 2.6640 2.5298 2.2812 0.3863  -0.2633 -0.1800 479 ARG A CZ  
1793 N NH1 . ARG A 262 ? 2.5806 2.4210 2.0942 0.4331  -0.2348 -0.1467 479 ARG A NH1 
1794 N NH2 . ARG A 262 ? 2.4314 2.3335 2.0911 0.3913  -0.2826 -0.1601 479 ARG A NH2 
1795 N N   . HIS B 19  ? 2.8372 2.2642 1.3381 0.6788  0.0483  0.3060  236 HIS B N   
1796 C CA  . HIS B 19  ? 2.7040 2.2325 1.2860 0.6055  0.0402  0.2951  236 HIS B CA  
1797 C C   . HIS B 19  ? 2.6147 2.2270 1.2981 0.5389  0.0178  0.2473  236 HIS B C   
1798 O O   . HIS B 19  ? 2.4780 2.2276 1.2294 0.5215  -0.0064 0.2303  236 HIS B O   
1799 C CB  . HIS B 19  ? 2.6531 2.3211 1.2439 0.6494  0.0218  0.3084  236 HIS B CB  
1800 C CG  . HIS B 19  ? 2.6371 2.4354 1.2448 0.7111  -0.0104 0.2873  236 HIS B CG  
1801 N ND1 . HIS B 19  ? 2.7650 2.5290 1.2965 0.8020  -0.0101 0.3010  236 HIS B ND1 
1802 C CD2 . HIS B 19  ? 2.5170 2.4786 1.2026 0.6923  -0.0400 0.2529  236 HIS B CD2 
1803 C CE1 . HIS B 19  ? 2.6627 2.5892 1.2352 0.8320  -0.0415 0.2712  236 HIS B CE1 
1804 N NE2 . HIS B 19  ? 2.5212 2.5641 1.1855 0.7629  -0.0582 0.2416  236 HIS B NE2 
1805 N N   . PRO B 20  ? 2.6104 2.1427 1.3021 0.5011  0.0275  0.2242  237 PRO B N   
1806 C CA  . PRO B 20  ? 2.4764 2.1016 1.2589 0.4487  0.0062  0.1828  237 PRO B CA  
1807 C C   . PRO B 20  ? 2.4508 2.1123 1.2877 0.3707  0.0136  0.1725  237 PRO B C   
1808 O O   . PRO B 20  ? 2.3445 2.0925 1.2507 0.3371  -0.0038 0.1435  237 PRO B O   
1809 C CB  . PRO B 20  ? 2.5608 2.1022 1.3257 0.4504  0.0129  0.1602  237 PRO B CB  
1810 C CG  . PRO B 20  ? 2.7923 2.1595 1.4622 0.4647  0.0504  0.1862  237 PRO B CG  
1811 C CD  . PRO B 20  ? 2.7887 2.1443 1.4047 0.5047  0.0600  0.2320  237 PRO B CD  
1812 N N   . ASP B 21  ? 2.4706 2.0719 1.2713 0.3468  0.0402  0.1975  238 ASP B N   
1813 C CA  . ASP B 21  ? 2.4067 2.0554 1.2518 0.2790  0.0480  0.1880  238 ASP B CA  
1814 C C   . ASP B 21  ? 2.3023 2.0820 1.1947 0.2908  0.0227  0.1896  238 ASP B C   
1815 O O   . ASP B 21  ? 2.2148 2.0667 1.1602 0.2484  0.0168  0.1710  238 ASP B O   
1816 C CB  . ASP B 21  ? 2.5568 2.1005 1.3417 0.2468  0.0877  0.2137  238 ASP B CB  
1817 C CG  . ASP B 21  ? 2.8409 2.2410 1.5775 0.2140  0.1215  0.2043  238 ASP B CG  
1818 O OD1 . ASP B 21  ? 2.8071 2.2318 1.5905 0.1692  0.1187  0.1625  238 ASP B OD1 
1819 O OD2 . ASP B 21  ? 3.0745 2.3354 1.7221 0.2321  0.1535  0.2376  238 ASP B OD2 
1820 N N   . VAL B 22  ? 2.2301 2.0418 1.0983 0.3510  0.0095  0.2089  239 VAL B N   
1821 C CA  . VAL B 22  ? 2.1207 2.0520 1.0243 0.3669  -0.0124 0.2055  239 VAL B CA  
1822 C C   . VAL B 22  ? 2.0511 2.0620 1.0205 0.3493  -0.0362 0.1706  239 VAL B C   
1823 O O   . VAL B 22  ? 1.9717 2.0537 0.9836 0.3251  -0.0453 0.1575  239 VAL B O   
1824 C CB  . VAL B 22  ? 2.2009 2.1564 1.0589 0.4378  -0.0192 0.2253  239 VAL B CB  
1825 C CG1 . VAL B 22  ? 2.1038 2.1923 1.0010 0.4458  -0.0396 0.2113  239 VAL B CG1 
1826 C CG2 . VAL B 22  ? 2.3247 2.1873 1.1030 0.4661  0.0080  0.2674  239 VAL B CG2 
1827 N N   . ALA B 23  ? 2.0018 1.9934 0.9726 0.3639  -0.0441 0.1568  240 ALA B N   
1828 C CA  . ALA B 23  ? 1.9117 1.9675 0.9352 0.3492  -0.0629 0.1279  240 ALA B CA  
1829 C C   . ALA B 23  ? 1.9136 1.9737 0.9770 0.2970  -0.0574 0.1130  240 ALA B C   
1830 O O   . ALA B 23  ? 1.8376 1.9636 0.9409 0.2831  -0.0691 0.0989  240 ALA B O   
1831 C CB  . ALA B 23  ? 1.9494 1.9786 0.9588 0.3770  -0.0691 0.1182  240 ALA B CB  
1832 N N   . THR B 24  ? 1.9194 1.9105 0.9657 0.2688  -0.0366 0.1152  241 THR B N   
1833 C CA  . THR B 24  ? 1.8840 1.8963 0.9633 0.2196  -0.0283 0.0967  241 THR B CA  
1834 C C   . THR B 24  ? 1.8843 1.9591 0.9828 0.2069  -0.0306 0.1014  241 THR B C   
1835 O O   . THR B 24  ? 1.8267 1.9645 0.9624 0.1932  -0.0386 0.0840  241 THR B O   
1836 C CB  . THR B 24  ? 2.0065 1.9340 1.0576 0.1862  -0.0016 0.0912  241 THR B CB  
1837 O OG1 . THR B 24  ? 1.9835 1.8805 1.0353 0.1958  -0.0054 0.0726  241 THR B OG1 
1838 C CG2 . THR B 24  ? 1.9427 1.9118 1.0210 0.1300  0.0122  0.0711  241 THR B CG2 
1839 N N   . MET B 25  ? 1.8608 1.9217 0.9297 0.2199  -0.0243 0.1251  242 MET B N   
1840 C CA  . MET B 25  ? 1.8154 1.9364 0.8981 0.2139  -0.0271 0.1283  242 MET B CA  
1841 C C   . MET B 25  ? 1.7699 1.9558 0.8832 0.2330  -0.0487 0.1149  242 MET B C   
1842 O O   . MET B 25  ? 1.7156 1.9478 0.8523 0.2218  -0.0524 0.1029  242 MET B O   
1843 C CB  . MET B 25  ? 1.9026 2.0003 0.9437 0.2307  -0.0163 0.1570  242 MET B CB  
1844 C CG  . MET B 25  ? 2.0478 2.0679 1.0476 0.2044  0.0126  0.1746  242 MET B CG  
1845 S SD  . MET B 25  ? 2.1909 2.1723 1.1266 0.2389  0.0274  0.2179  242 MET B SD  
1846 C CE  . MET B 25  ? 2.2933 2.1306 1.1642 0.2069  0.0681  0.2378  242 MET B CE  
1847 N N   . LEU B 26  ? 1.7165 1.9039 0.8241 0.2614  -0.0602 0.1150  243 LEU B N   
1848 C CA  . LEU B 26  ? 1.6559 1.8959 0.7855 0.2697  -0.0750 0.0996  243 LEU B CA  
1849 C C   . LEU B 26  ? 1.6635 1.9110 0.8212 0.2528  -0.0785 0.0836  243 LEU B C   
1850 O O   . LEU B 26  ? 1.6301 1.9037 0.8009 0.2479  -0.0814 0.0740  243 LEU B O   
1851 C CB  . LEU B 26  ? 1.6630 1.9175 0.7793 0.2981  -0.0841 0.0986  243 LEU B CB  
1852 C CG  . LEU B 26  ? 1.7556 2.0280 0.8391 0.3304  -0.0831 0.1126  243 LEU B CG  
1853 C CD1 . LEU B 26  ? 1.7852 2.0622 0.8456 0.3679  -0.0899 0.1138  243 LEU B CD1 
1854 C CD2 . LEU B 26  ? 1.7447 2.0905 0.8404 0.3276  -0.0881 0.0987  243 LEU B CD2 
1855 N N   . ASN B 27  ? 1.6285 1.8490 0.7897 0.2466  -0.0759 0.0805  244 ASN B N   
1856 C CA  . ASN B 27  ? 1.5978 1.8360 0.7833 0.2362  -0.0786 0.0656  244 ASN B CA  
1857 C C   . ASN B 27  ? 1.6307 1.8982 0.8282 0.2222  -0.0728 0.0598  244 ASN B C   
1858 O O   . ASN B 27  ? 1.6100 1.9060 0.8189 0.2290  -0.0768 0.0526  244 ASN B O   
1859 C CB  . ASN B 27  ? 1.6419 1.8504 0.8263 0.2312  -0.0750 0.0586  244 ASN B CB  
1860 C CG  . ASN B 27  ? 1.9474 2.1890 1.1566 0.2303  -0.0817 0.0422  244 ASN B CG  
1861 O OD1 . ASN B 27  ? 1.8102 2.0856 1.0368 0.2171  -0.0776 0.0304  244 ASN B OD1 
1862 N ND2 . ASN B 27  ? 1.8900 2.1360 1.0995 0.2476  -0.0921 0.0402  244 ASN B ND2 
1863 N N   . ILE B 28  ? 1.6011 1.8635 0.7899 0.2060  -0.0617 0.0638  245 ILE B N   
1864 C CA  . ILE B 28  ? 1.5850 1.8943 0.7829 0.1948  -0.0563 0.0553  245 ILE B CA  
1865 C C   . ILE B 28  ? 1.6160 1.9466 0.8113 0.2165  -0.0638 0.0578  245 ILE B C   
1866 O O   . ILE B 28  ? 1.5955 1.9586 0.7961 0.2292  -0.0659 0.0485  245 ILE B O   
1867 C CB  . ILE B 28  ? 1.6629 1.9636 0.8476 0.1660  -0.0399 0.0595  245 ILE B CB  
1868 C CG1 . ILE B 28  ? 1.7022 1.9832 0.8887 0.1340  -0.0263 0.0455  245 ILE B CG1 
1869 C CG2 . ILE B 28  ? 1.6546 2.0207 0.8446 0.1605  -0.0368 0.0527  245 ILE B CG2 
1870 C CD1 . ILE B 28  ? 1.8762 2.0865 1.0295 0.1067  -0.0048 0.0585  245 ILE B CD1 
1871 N N   . LEU B 29  ? 1.5844 1.8953 0.7664 0.2244  -0.0663 0.0684  246 LEU B N   
1872 C CA  . LEU B 29  ? 1.5693 1.8923 0.7462 0.2381  -0.0702 0.0642  246 LEU B CA  
1873 C C   . LEU B 29  ? 1.6089 1.9151 0.7855 0.2474  -0.0742 0.0568  246 LEU B C   
1874 O O   . LEU B 29  ? 1.6061 1.9060 0.7717 0.2562  -0.0717 0.0496  246 LEU B O   
1875 C CB  . LEU B 29  ? 1.5786 1.9057 0.7436 0.2406  -0.0700 0.0711  246 LEU B CB  
1876 C CG  . LEU B 29  ? 1.6400 1.9916 0.8002 0.2480  -0.0699 0.0607  246 LEU B CG  
1877 C CD1 . LEU B 29  ? 1.6427 2.0263 0.8040 0.2476  -0.0657 0.0590  246 LEU B CD1 
1878 C CD2 . LEU B 29  ? 1.6763 2.0477 0.8281 0.2519  -0.0709 0.0622  246 LEU B CD2 
1879 N N   . ALA B 30  ? 1.5596 1.8534 0.7431 0.2448  -0.0778 0.0580  247 ALA B N   
1880 C CA  . ALA B 30  ? 1.5472 1.8282 0.7281 0.2479  -0.0786 0.0534  247 ALA B CA  
1881 C C   . ALA B 30  ? 1.5848 1.8673 0.7618 0.2614  -0.0743 0.0529  247 ALA B C   
1882 O O   . ALA B 30  ? 1.6038 1.8590 0.7613 0.2698  -0.0681 0.0529  247 ALA B O   
1883 C CB  . ALA B 30  ? 1.5456 1.8291 0.7359 0.2450  -0.0846 0.0540  247 ALA B CB  
1884 N N   . LEU B 31  ? 1.5309 1.8465 0.7205 0.2639  -0.0748 0.0510  248 LEU B N   
1885 C CA  . LEU B 31  ? 1.5372 1.8845 0.7232 0.2848  -0.0719 0.0471  248 LEU B CA  
1886 C C   . LEU B 31  ? 1.6206 1.9657 0.7828 0.3072  -0.0672 0.0468  248 LEU B C   
1887 O O   . LEU B 31  ? 1.6296 1.9712 0.7686 0.3392  -0.0626 0.0491  248 LEU B O   
1888 C CB  . LEU B 31  ? 1.5216 1.9263 0.7299 0.2725  -0.0717 0.0355  248 LEU B CB  
1889 C CG  . LEU B 31  ? 1.5740 1.9773 0.8016 0.2543  -0.0742 0.0300  248 LEU B CG  
1890 C CD1 . LEU B 31  ? 1.5898 2.0069 0.8291 0.2229  -0.0677 0.0187  248 LEU B CD1 
1891 C CD2 . LEU B 31  ? 1.6045 2.0490 0.8390 0.2725  -0.0759 0.0230  248 LEU B CD2 
1892 N N   . VAL B 32  ? 1.6065 1.9511 0.7685 0.2957  -0.0674 0.0448  249 VAL B N   
1893 C CA  . VAL B 32  ? 1.6435 1.9877 0.7837 0.3160  -0.0640 0.0403  249 VAL B CA  
1894 C C   . VAL B 32  ? 1.7538 2.0247 0.8619 0.3291  -0.0568 0.0415  249 VAL B C   
1895 O O   . VAL B 32  ? 1.8103 2.0589 0.8850 0.3639  -0.0498 0.0410  249 VAL B O   
1896 C CB  . VAL B 32  ? 1.6871 2.0515 0.8370 0.2962  -0.0658 0.0384  249 VAL B CB  
1897 C CG1 . VAL B 32  ? 1.7145 2.0736 0.8422 0.3158  -0.0634 0.0299  249 VAL B CG1 
1898 C CG2 . VAL B 32  ? 1.6674 2.0920 0.8362 0.2785  -0.0651 0.0373  249 VAL B CG2 
1899 N N   . TYR B 33  ? 1.6938 1.9283 0.8065 0.3017  -0.0560 0.0414  250 TYR B N   
1900 C CA  . TYR B 33  ? 1.7357 1.9025 0.8191 0.2956  -0.0442 0.0367  250 TYR B CA  
1901 C C   . TYR B 33  ? 1.8240 1.9487 0.8829 0.3113  -0.0350 0.0483  250 TYR B C   
1902 O O   . TYR B 33  ? 1.8996 1.9513 0.9130 0.3242  -0.0183 0.0492  250 TYR B O   
1903 C CB  . TYR B 33  ? 1.7348 1.9085 0.8347 0.2591  -0.0464 0.0282  250 TYR B CB  
1904 C CG  . TYR B 33  ? 1.7581 1.9545 0.8619 0.2486  -0.0477 0.0135  250 TYR B CG  
1905 C CD1 . TYR B 33  ? 1.8360 1.9930 0.9138 0.2395  -0.0347 -0.0064 250 TYR B CD1 
1906 C CD2 . TYR B 33  ? 1.7268 1.9807 0.8554 0.2467  -0.0592 0.0185  250 TYR B CD2 
1907 C CE1 . TYR B 33  ? 1.8466 2.0402 0.9309 0.2301  -0.0365 -0.0247 250 TYR B CE1 
1908 C CE2 . TYR B 33  ? 1.7435 2.0296 0.8734 0.2419  -0.0602 0.0072  250 TYR B CE2 
1909 C CZ  . TYR B 33  ? 1.8851 2.1510 0.9971 0.2337  -0.0505 -0.0165 250 TYR B CZ  
1910 O OH  . TYR B 33  ? 1.8788 2.1919 0.9951 0.2293  -0.0519 -0.0322 250 TYR B OH  
1911 N N   . ARG B 34  ? 1.7264 1.8922 0.8102 0.3118  -0.0435 0.0574  251 ARG B N   
1912 C CA  . ARG B 34  ? 1.7334 1.8829 0.7998 0.3300  -0.0371 0.0702  251 ARG B CA  
1913 C C   . ARG B 34  ? 1.8469 1.9838 0.8739 0.3811  -0.0286 0.0780  251 ARG B C   
1914 O O   . ARG B 34  ? 1.9213 1.9895 0.8992 0.4032  -0.0119 0.0913  251 ARG B O   
1915 C CB  . ARG B 34  ? 1.6372 1.8550 0.7449 0.3235  -0.0507 0.0706  251 ARG B CB  
1916 C CG  . ARG B 34  ? 1.6366 1.8626 0.7331 0.3450  -0.0466 0.0819  251 ARG B CG  
1917 C CD  . ARG B 34  ? 1.5081 1.8179 0.6441 0.3477  -0.0593 0.0736  251 ARG B CD  
1918 N NE  . ARG B 34  ? 1.5279 1.8968 0.6728 0.3653  -0.0624 0.0631  251 ARG B NE  
1919 C CZ  . ARG B 34  ? 1.6782 2.1299 0.8504 0.3679  -0.0678 0.0489  251 ARG B CZ  
1920 N NH1 . ARG B 34  ? 1.5386 2.0174 0.7324 0.3588  -0.0722 0.0442  251 ARG B NH1 
1921 N NH2 . ARG B 34  ? 1.4952 2.0124 0.6740 0.3761  -0.0679 0.0345  251 ARG B NH2 
1922 N N   . ASP B 35  ? 1.7821 1.9857 0.8243 0.4013  -0.0379 0.0697  252 ASP B N   
1923 C CA  . ASP B 35  ? 1.8245 2.0500 0.8322 0.4581  -0.0336 0.0717  252 ASP B CA  
1924 C C   . ASP B 35  ? 1.9536 2.0896 0.9032 0.4859  -0.0191 0.0731  252 ASP B C   
1925 O O   . ASP B 35  ? 2.0116 2.1261 0.9086 0.5457  -0.0095 0.0820  252 ASP B O   
1926 C CB  . ASP B 35  ? 1.7958 2.1392 0.8409 0.4606  -0.0467 0.0559  252 ASP B CB  
1927 C CG  . ASP B 35  ? 1.8767 2.3047 0.9628 0.4457  -0.0544 0.0500  252 ASP B CG  
1928 O OD1 . ASP B 35  ? 1.8638 2.2618 0.9645 0.4218  -0.0552 0.0570  252 ASP B OD1 
1929 O OD2 . ASP B 35  ? 1.9341 2.4649 1.0374 0.4552  -0.0586 0.0340  252 ASP B OD2 
1930 N N   . GLN B 36  ? 1.9251 2.0079 0.8787 0.4465  -0.0160 0.0628  253 GLN B N   
1931 C CA  . GLN B 36  ? 2.0172 2.0049 0.9166 0.4613  0.0006  0.0562  253 GLN B CA  
1932 C C   . GLN B 36  ? 2.1524 2.0193 1.0091 0.4377  0.0242  0.0640  253 GLN B C   
1933 O O   . GLN B 36  ? 2.2484 2.0158 1.0580 0.4314  0.0440  0.0534  253 GLN B O   
1934 C CB  . GLN B 36  ? 1.9983 2.0135 0.9258 0.4306  -0.0074 0.0339  253 GLN B CB  
1935 C CG  . GLN B 36  ? 2.1967 2.2715 1.1184 0.4729  -0.0156 0.0245  253 GLN B CG  
1936 C CD  . GLN B 36  ? 2.5590 2.5802 1.4530 0.4729  -0.0072 0.0040  253 GLN B CD  
1937 O OE1 . GLN B 36  ? 2.4911 2.5450 1.4198 0.4323  -0.0138 -0.0112 253 GLN B OE1 
1938 N NE2 . GLN B 36  ? 2.5366 2.4721 1.3618 0.5229  0.0091  0.0025  253 GLN B NE2 
1939 N N   . ASN B 37  ? 2.0635 1.9413 0.9348 0.4214  0.0241  0.0797  254 ASN B N   
1940 C CA  . ASN B 37  ? 2.1241 1.9100 0.9607 0.3912  0.0466  0.0890  254 ASN B CA  
1941 C C   . ASN B 37  ? 2.1640 1.9252 1.0178 0.3200  0.0534  0.0648  254 ASN B C   
1942 O O   . ASN B 37  ? 2.2399 1.9122 1.0528 0.2863  0.0796  0.0636  254 ASN B O   
1943 C CB  . ASN B 37  ? 2.2870 1.9483 1.0311 0.4394  0.0766  0.1099  254 ASN B CB  
1944 C CG  . ASN B 37  ? 2.7098 2.4166 1.4338 0.5144  0.0709  0.1352  254 ASN B CG  
1945 O OD1 . ASN B 37  ? 2.5784 2.3757 1.3444 0.5144  0.0560  0.1445  254 ASN B OD1 
1946 N ND2 . ASN B 37  ? 2.7358 2.3845 1.3901 0.5844  0.0840  0.1443  254 ASN B ND2 
1947 N N   . LYS B 38  ? 2.0274 1.8758 0.9393 0.2961  0.0316  0.0449  255 LYS B N   
1948 C CA  . LYS B 38  ? 2.0082 1.8726 0.9432 0.2378  0.0333  0.0187  255 LYS B CA  
1949 C C   . LYS B 38  ? 1.9908 1.9288 0.9708 0.2095  0.0195  0.0228  255 LYS B C   
1950 O O   . LYS B 38  ? 1.9058 1.9302 0.9338 0.2046  -0.0023 0.0171  255 LYS B O   
1951 C CB  . LYS B 38  ? 1.9898 1.9133 0.9542 0.2393  0.0183  -0.0009 255 LYS B CB  
1952 C CG  . LYS B 38  ? 2.2392 2.0993 1.1605 0.2641  0.0312  -0.0134 255 LYS B CG  
1953 C CD  . LYS B 38  ? 2.3286 2.2736 1.2865 0.2720  0.0120  -0.0268 255 LYS B CD  
1954 C CE  . LYS B 38  ? 2.5477 2.4535 1.4701 0.3008  0.0199  -0.0429 255 LYS B CE  
1955 N NZ  . LYS B 38  ? 2.5887 2.5952 1.5510 0.3059  0.0002  -0.0527 255 LYS B NZ  
1956 N N   . TYR B 39  ? 1.9864 1.8847 0.9435 0.1961  0.0340  0.0347  256 TYR B N   
1957 C CA  . TYR B 39  ? 1.9262 1.8910 0.9179 0.1752  0.0228  0.0384  256 TYR B CA  
1958 C C   . TYR B 39  ? 1.9338 1.9691 0.9587 0.1306  0.0152  0.0111  256 TYR B C   
1959 O O   . TYR B 39  ? 1.8551 1.9737 0.9223 0.1391  -0.0081 0.0119  256 TYR B O   
1960 C CB  . TYR B 39  ? 1.9989 1.9081 0.9524 0.1702  0.0433  0.0574  256 TYR B CB  
1961 C CG  . TYR B 39  ? 2.0795 1.9241 0.9888 0.2256  0.0532  0.0860  256 TYR B CG  
1962 C CD1 . TYR B 39  ? 2.0448 1.9553 0.9826 0.2759  0.0307  0.0984  256 TYR B CD1 
1963 C CD2 . TYR B 39  ? 2.2201 1.9394 1.0531 0.2292  0.0879  0.0991  256 TYR B CD2 
1964 C CE1 . TYR B 39  ? 2.1145 1.9922 1.0108 0.3341  0.0387  0.1205  256 TYR B CE1 
1965 C CE2 . TYR B 39  ? 2.3003 1.9645 1.0824 0.2948  0.0974  0.1280  256 TYR B CE2 
1966 C CZ  . TYR B 39  ? 2.3379 2.0946 1.1547 0.3500  0.0708  0.1375  256 TYR B CZ  
1967 O OH  . TYR B 39  ? 2.4269 2.1561 1.1934 0.4213  0.0791  0.1623  256 TYR B OH  
1968 N N   . LYS B 40  ? 1.9420 1.9466 0.9436 0.0860  0.0362  -0.0157 257 LYS B N   
1969 C CA  . LYS B 40  ? 1.9075 2.0004 0.9366 0.0446  0.0314  -0.0487 257 LYS B CA  
1970 C C   . LYS B 40  ? 1.8775 2.0555 0.9474 0.0740  0.0035  -0.0522 257 LYS B C   
1971 O O   . LYS B 40  ? 1.8055 2.0779 0.9050 0.0733  -0.0130 -0.0602 257 LYS B O   
1972 C CB  . LYS B 40  ? 2.0260 2.0708 1.0204 -0.0102 0.0625  -0.0840 257 LYS B CB  
1973 C CG  . LYS B 40  ? 2.1872 2.3111 1.1914 -0.0718 0.0724  -0.1177 257 LYS B CG  
1974 C CD  . LYS B 40  ? 2.3566 2.4653 1.3378 -0.1324 0.1008  -0.1663 257 LYS B CD  
1975 C CE  . LYS B 40  ? 2.4264 2.6451 1.4211 -0.1979 0.1109  -0.2081 257 LYS B CE  
1976 N NZ  . LYS B 40  ? 2.5369 2.7761 1.5203 -0.2580 0.1350  -0.2658 257 LYS B NZ  
1977 N N   . ASP B 41  ? 1.8511 1.9930 0.9158 0.1052  -0.0002 -0.0435 258 ASP B N   
1978 C CA  . ASP B 41  ? 1.7931 1.9968 0.8860 0.1327  -0.0210 -0.0409 258 ASP B CA  
1979 C C   . ASP B 41  ? 1.7793 2.0111 0.8967 0.1669  -0.0411 -0.0123 258 ASP B C   
1980 O O   . ASP B 41  ? 1.7294 2.0173 0.8671 0.1805  -0.0558 -0.0088 258 ASP B O   
1981 C CB  . ASP B 41  ? 1.8462 2.0073 0.9216 0.1481  -0.0147 -0.0457 258 ASP B CB  
1982 C CG  . ASP B 41  ? 2.0397 2.1920 1.0976 0.1146  0.0022  -0.0829 258 ASP B CG  
1983 O OD1 . ASP B 41  ? 2.0302 2.2639 1.1072 0.0886  -0.0009 -0.1075 258 ASP B OD1 
1984 O OD2 . ASP B 41  ? 2.1861 2.2568 1.2091 0.1182  0.0188  -0.0905 258 ASP B OD2 
1985 N N   . ALA B 42  ? 2.2177 1.7694 0.6738 0.2908  -0.0499 0.0976  259 ALA B N   
1986 C CA  . ALA B 42  ? 2.1245 1.7569 0.6433 0.3134  -0.0662 0.1209  259 ALA B CA  
1987 C C   . ALA B 42  ? 2.1151 1.8036 0.7294 0.2821  -0.0894 0.1036  259 ALA B C   
1988 O O   . ALA B 42  ? 2.0429 1.7968 0.7153 0.2856  -0.1197 0.1124  259 ALA B O   
1989 C CB  . ALA B 42  ? 2.1429 1.7612 0.6250 0.3518  -0.0274 0.1413  259 ALA B CB  
1990 N N   . ALA B 43  ? 2.1058 1.7626 0.7332 0.2526  -0.0691 0.0812  260 ALA B N   
1991 C CA  . ALA B 43  ? 2.0567 1.7637 0.7691 0.2257  -0.0827 0.0681  260 ALA B CA  
1992 C C   . ALA B 43  ? 2.0949 1.8651 0.8552 0.2024  -0.1285 0.0546  260 ALA B C   
1993 O O   . ALA B 43  ? 2.0371 1.8722 0.8608 0.2068  -0.1500 0.0626  260 ALA B O   
1994 C CB  . ALA B 43  ? 2.1189 1.7735 0.8320 0.1987  -0.0421 0.0503  260 ALA B CB  
1995 N N   . HIS B 44  ? 2.1051 1.8558 0.8263 0.1849  -0.1422 0.0347  261 HIS B N   
1996 C CA  . HIS B 44  ? 2.0936 1.9140 0.8468 0.1742  -0.1871 0.0204  261 HIS B CA  
1997 C C   . HIS B 44  ? 2.0325 1.9026 0.8024 0.2153  -0.2088 0.0531  261 HIS B C   
1998 O O   . HIS B 44  ? 1.9670 1.9082 0.7940 0.2185  -0.2315 0.0564  261 HIS B O   
1999 C CB  . HIS B 44  ? 2.2001 1.9814 0.8860 0.1606  -0.1978 -0.0073 261 HIS B CB  
2000 C CG  . HIS B 44  ? 2.3141 2.0957 1.0206 0.1030  -0.2003 -0.0566 261 HIS B CG  
2001 N ND1 . HIS B 44  ? 2.3511 2.1102 1.1010 0.0656  -0.1657 -0.0686 261 HIS B ND1 
2002 C CD2 . HIS B 44  ? 2.4040 2.2045 1.0916 0.0768  -0.2307 -0.0982 261 HIS B CD2 
2003 C CE1 . HIS B 44  ? 2.4102 2.1779 1.1775 0.0104  -0.1747 -0.1171 261 HIS B CE1 
2004 N NE2 . HIS B 44  ? 2.4497 2.2451 1.1792 0.0134  -0.2170 -0.1405 261 HIS B NE2 
2005 N N   . LEU B 45  ? 1.9844 1.8161 0.7060 0.2475  -0.1952 0.0796  262 LEU B N   
2006 C CA  . LEU B 45  ? 1.9424 1.8068 0.6809 0.2809  -0.2044 0.1116  262 LEU B CA  
2007 C C   . LEU B 45  ? 1.9507 1.8523 0.7579 0.2805  -0.2026 0.1210  262 LEU B C   
2008 O O   . LEU B 45  ? 1.9352 1.8750 0.7782 0.2938  -0.2153 0.1349  262 LEU B O   
2009 C CB  . LEU B 45  ? 1.9585 1.7828 0.6414 0.3085  -0.1845 0.1361  262 LEU B CB  
2010 C CG  . LEU B 45  ? 2.0785 1.8687 0.6862 0.3295  -0.1872 0.1430  262 LEU B CG  
2011 C CD1 . LEU B 45  ? 2.0982 1.8579 0.6566 0.3596  -0.1610 0.1727  262 LEU B CD1 
2012 C CD2 . LEU B 45  ? 2.0932 1.9260 0.7170 0.3523  -0.2108 0.1576  262 LEU B CD2 
2013 N N   . LEU B 46  ? 1.8875 1.7701 0.7042 0.2709  -0.1824 0.1142  263 LEU B N   
2014 C CA  . LEU B 46  ? 1.8356 1.7443 0.7049 0.2739  -0.1804 0.1186  263 LEU B CA  
2015 C C   . LEU B 46  ? 1.8972 1.8467 0.8191 0.2618  -0.1940 0.1114  263 LEU B C   
2016 O O   . LEU B 46  ? 1.8742 1.8450 0.8311 0.2733  -0.1974 0.1219  263 LEU B O   
2017 C CB  . LEU B 46  ? 1.8305 1.7118 0.6846 0.2799  -0.1545 0.1147  263 LEU B CB  
2018 C CG  . LEU B 46  ? 1.8786 1.7526 0.6979 0.3045  -0.1430 0.1269  263 LEU B CG  
2019 C CD1 . LEU B 46  ? 1.8853 1.7522 0.6948 0.3216  -0.1209 0.1218  263 LEU B CD1 
2020 C CD2 . LEU B 46  ? 1.8551 1.7667 0.7100 0.3103  -0.1604 0.1385  263 LEU B CD2 
2021 N N   . ASN B 47  ? 1.8786 1.8415 0.8057 0.2384  -0.2001 0.0927  264 ASN B N   
2022 C CA  . ASN B 47  ? 1.8599 1.8845 0.8416 0.2279  -0.2143 0.0866  264 ASN B CA  
2023 C C   . ASN B 47  ? 1.9235 1.9967 0.9151 0.2539  -0.2368 0.1025  264 ASN B C   
2024 O O   . ASN B 47  ? 1.9008 2.0120 0.9297 0.2689  -0.2379 0.1157  264 ASN B O   
2025 C CB  . ASN B 47  ? 1.8548 1.8960 0.8442 0.1904  -0.2191 0.0567  264 ASN B CB  
2026 C CG  . ASN B 47  ? 2.0069 1.9985 0.9976 0.1636  -0.1852 0.0434  264 ASN B CG  
2027 O OD1 . ASN B 47  ? 1.9817 1.9222 0.9336 0.1390  -0.1715 0.0225  264 ASN B OD1 
2028 N ND2 . ASN B 47  ? 1.8178 1.8189 0.8497 0.1700  -0.1665 0.0552  264 ASN B ND2 
2029 N N   . ASP B 48  ? 1.9240 1.9895 0.8739 0.2666  -0.2487 0.1050  265 ASP B N   
2030 C CA  . ASP B 48  ? 1.9321 2.0329 0.8772 0.3024  -0.2614 0.1251  265 ASP B CA  
2031 C C   . ASP B 48  ? 1.9580 2.0325 0.9176 0.3253  -0.2418 0.1544  265 ASP B C   
2032 O O   . ASP B 48  ? 1.9465 2.0484 0.9251 0.3512  -0.2388 0.1724  265 ASP B O   
2033 C CB  . ASP B 48  ? 1.9963 2.0771 0.8836 0.3165  -0.2706 0.1247  265 ASP B CB  
2034 C CG  . ASP B 48  ? 2.2391 2.3655 1.1096 0.3058  -0.2988 0.0936  265 ASP B CG  
2035 O OD1 . ASP B 48  ? 2.2835 2.4805 1.1618 0.3349  -0.3183 0.0975  265 ASP B OD1 
2036 O OD2 . ASP B 48  ? 2.3511 2.4419 1.1956 0.2711  -0.2993 0.0639  265 ASP B OD2 
2037 N N   . ALA B 49  ? 1.9067 1.9294 0.8560 0.3156  -0.2260 0.1567  266 ALA B N   
2038 C CA  . ALA B 49  ? 1.8940 1.8920 0.8625 0.3238  -0.2091 0.1724  266 ALA B CA  
2039 C C   . ALA B 49  ? 1.9291 1.9329 0.9318 0.3196  -0.2040 0.1667  266 ALA B C   
2040 O O   . ALA B 49  ? 1.9486 1.9371 0.9666 0.3319  -0.1917 0.1791  266 ALA B O   
2041 C CB  . ALA B 49  ? 1.8980 1.8651 0.8497 0.3137  -0.1997 0.1692  266 ALA B CB  
2042 N N   . LEU B 50  ? 1.8490 1.8674 0.8606 0.3039  -0.2081 0.1497  267 LEU B N   
2043 C CA  . LEU B 50  ? 1.8253 1.8520 0.8654 0.3068  -0.2011 0.1488  267 LEU B CA  
2044 C C   . LEU B 50  ? 1.8831 1.9554 0.9420 0.3276  -0.2058 0.1648  267 LEU B C   
2045 O O   . LEU B 50  ? 1.8956 1.9548 0.9621 0.3477  -0.1930 0.1785  267 LEU B O   
2046 C CB  . LEU B 50  ? 1.8150 1.8465 0.8630 0.2877  -0.1962 0.1324  267 LEU B CB  
2047 C CG  . LEU B 50  ? 1.8530 1.9025 0.9331 0.2953  -0.1863 0.1367  267 LEU B CG  
2048 C CD1 . LEU B 50  ? 1.8499 1.8555 0.9186 0.3131  -0.1730 0.1381  267 LEU B CD1 
2049 C CD2 . LEU B 50  ? 1.8751 1.9399 0.9738 0.2728  -0.1771 0.1246  267 LEU B CD2 
2050 N N   . ALA B 51  ? 1.8391 1.9650 0.8979 0.3275  -0.2232 0.1619  268 ALA B N   
2051 C CA  . ALA B 51  ? 1.8429 2.0365 0.9144 0.3566  -0.2307 0.1770  268 ALA B CA  
2052 C C   . ALA B 51  ? 1.9075 2.0701 0.9581 0.3980  -0.2118 0.2073  268 ALA B C   
2053 O O   . ALA B 51  ? 1.9144 2.0948 0.9713 0.4293  -0.1981 0.2277  268 ALA B O   
2054 C CB  . ALA B 51  ? 1.8610 2.1188 0.9265 0.3498  -0.2577 0.1603  268 ALA B CB  
2055 N N   . ILE B 52  ? 1.8769 1.9869 0.9020 0.3991  -0.2041 0.2127  269 ILE B N   
2056 C CA  . ILE B 52  ? 1.9108 1.9753 0.9202 0.4308  -0.1762 0.2412  269 ILE B CA  
2057 C C   . ILE B 52  ? 1.9659 1.9684 0.9873 0.4239  -0.1509 0.2434  269 ILE B C   
2058 O O   . ILE B 52  ? 2.0039 1.9799 1.0154 0.4559  -0.1232 0.2664  269 ILE B O   
2059 C CB  . ILE B 52  ? 1.9581 1.9897 0.9472 0.4286  -0.1722 0.2470  269 ILE B CB  
2060 C CG1 . ILE B 52  ? 1.9726 2.0576 0.9325 0.4524  -0.1937 0.2488  269 ILE B CG1 
2061 C CG2 . ILE B 52  ? 2.0049 1.9739 0.9929 0.4472  -0.1328 0.2742  269 ILE B CG2 
2062 C CD1 . ILE B 52  ? 2.0291 2.0850 0.9610 0.4482  -0.1956 0.2505  269 ILE B CD1 
2063 N N   . ARG B 53  ? 1.8994 1.8759 0.9336 0.3873  -0.1581 0.2184  270 ARG B N   
2064 C CA  . ARG B 53  ? 1.9146 1.8366 0.9550 0.3782  -0.1418 0.2095  270 ARG B CA  
2065 C C   . ARG B 53  ? 2.0023 1.9321 1.0416 0.4024  -0.1337 0.2185  270 ARG B C   
2066 O O   . ARG B 53  ? 2.0371 1.9099 1.0636 0.4165  -0.1088 0.2255  270 ARG B O   
2067 C CB  . ARG B 53  ? 1.8613 1.7734 0.9083 0.3450  -0.1550 0.1802  270 ARG B CB  
2068 C CG  . ARG B 53  ? 1.9078 1.8000 0.9577 0.3277  -0.1507 0.1772  270 ARG B CG  
2069 C CD  . ARG B 53  ? 1.8899 1.8001 0.9366 0.3076  -0.1656 0.1573  270 ARG B CD  
2070 N NE  . ARG B 53  ? 1.9775 1.8850 1.0313 0.2973  -0.1595 0.1632  270 ARG B NE  
2071 C CZ  . ARG B 53  ? 2.0218 1.9512 1.0697 0.2873  -0.1669 0.1545  270 ARG B CZ  
2072 N NH1 . ARG B 53  ? 1.7834 1.7283 0.8105 0.2890  -0.1771 0.1389  270 ARG B NH1 
2073 N NH2 . ARG B 53  ? 1.7483 1.6844 0.8094 0.2807  -0.1583 0.1657  270 ARG B NH2 
2074 N N   . GLU B 54  ? 1.9548 1.9553 1.0070 0.4079  -0.1512 0.2198  271 GLU B N   
2075 C CA  . GLU B 54  ? 1.9747 2.0074 1.0341 0.4337  -0.1443 0.2339  271 GLU B CA  
2076 C C   . GLU B 54  ? 2.0999 2.1426 1.1389 0.4828  -0.1232 0.2680  271 GLU B C   
2077 O O   . GLU B 54  ? 2.1364 2.1677 1.1633 0.5149  -0.1026 0.2868  271 GLU B O   
2078 C CB  . GLU B 54  ? 1.9553 2.0762 1.0476 0.4185  -0.1672 0.2248  271 GLU B CB  
2079 C CG  . GLU B 54  ? 2.0927 2.1978 1.2011 0.3909  -0.1686 0.2044  271 GLU B CG  
2080 C CD  . GLU B 54  ? 2.4061 2.5842 1.5527 0.3668  -0.1813 0.1936  271 GLU B CD  
2081 O OE1 . GLU B 54  ? 2.3860 2.6110 1.5396 0.3494  -0.2005 0.1828  271 GLU B OE1 
2082 O OE2 . GLU B 54  ? 2.2476 2.4322 1.4163 0.3648  -0.1693 0.1944  271 GLU B OE2 
2083 N N   . LYS B 55  ? 2.0702 2.1344 1.0976 0.4976  -0.1247 0.2796  272 LYS B N   
2084 C CA  . LYS B 55  ? 2.1280 2.2045 1.1265 0.5565  -0.0988 0.3163  272 LYS B CA  
2085 C C   . LYS B 55  ? 2.2504 2.2103 1.2156 0.5712  -0.0530 0.3330  272 LYS B C   
2086 O O   . LYS B 55  ? 2.3097 2.2263 1.2441 0.6125  -0.0151 0.3590  272 LYS B O   
2087 C CB  . LYS B 55  ? 2.1580 2.3265 1.1541 0.5781  -0.1213 0.3217  272 LYS B CB  
2088 C CG  . LYS B 55  ? 2.3134 2.6110 1.3445 0.5701  -0.1601 0.3063  272 LYS B CG  
2089 C CD  . LYS B 55  ? 2.4218 2.8265 1.4411 0.6099  -0.1801 0.3131  272 LYS B CD  
2090 C CE  . LYS B 55  ? 2.5519 3.0349 1.5571 0.6818  -0.1626 0.3494  272 LYS B CE  
2091 N NZ  . LYS B 55  ? 2.6457 3.1943 1.6602 0.6840  -0.1871 0.3472  272 LYS B NZ  
2092 N N   . THR B 56  ? 2.2023 2.1097 1.1738 0.5370  -0.0519 0.3188  273 THR B N   
2093 C CA  . THR B 56  ? 2.2634 2.0642 1.2190 0.5374  -0.0061 0.3299  273 THR B CA  
2094 C C   . THR B 56  ? 2.3421 2.0565 1.2984 0.5075  0.0102  0.3077  273 THR B C   
2095 O O   . THR B 56  ? 2.4242 2.0631 1.3476 0.5358  0.0545  0.3257  273 THR B O   
2096 C CB  . THR B 56  ? 2.3392 2.1290 1.3104 0.5116  -0.0092 0.3251  273 THR B CB  
2097 O OG1 . THR B 56  ? 2.2494 2.0636 1.2509 0.4570  -0.0488 0.2879  273 THR B OG1 
2098 C CG2 . THR B 56  ? 2.3322 2.1850 1.2840 0.5566  -0.0145 0.3520  273 THR B CG2 
2099 N N   . LEU B 57  ? 2.2438 1.9663 1.2284 0.4563  -0.0230 0.2683  274 LEU B N   
2100 C CA  . LEU B 57  ? 2.2707 1.9246 1.2537 0.4281  -0.0172 0.2376  274 LEU B CA  
2101 C C   . LEU B 57  ? 2.3230 1.9836 1.2847 0.4541  -0.0216 0.2387  274 LEU B C   
2102 O O   . LEU B 57  ? 2.3516 1.9436 1.2943 0.4466  -0.0106 0.2180  274 LEU B O   
2103 C CB  . LEU B 57  ? 2.2208 1.8932 1.2367 0.3751  -0.0488 0.1973  274 LEU B CB  
2104 C CG  . LEU B 57  ? 2.2723 1.9472 1.3142 0.3488  -0.0444 0.1980  274 LEU B CG  
2105 C CD1 . LEU B 57  ? 2.2086 1.9406 1.2737 0.3165  -0.0816 0.1709  274 LEU B CD1 
2106 C CD2 . LEU B 57  ? 2.3798 1.9681 1.4310 0.3255  -0.0053 0.1896  274 LEU B CD2 
2107 N N   . GLY B 58  ? 2.2536 2.0002 1.2198 0.4843  -0.0372 0.2614  275 GLY B N   
2108 C CA  . GLY B 58  ? 2.2577 2.0328 1.2145 0.5133  -0.0388 0.2717  275 GLY B CA  
2109 C C   . GLY B 58  ? 2.2635 2.0636 1.2423 0.4854  -0.0678 0.2422  275 GLY B C   
2110 O O   . GLY B 58  ? 2.2435 2.0176 1.2315 0.4474  -0.0824 0.2092  275 GLY B O   
2111 N N   . LYS B 59  ? 2.2040 2.0600 1.1916 0.5093  -0.0720 0.2571  276 LYS B N   
2112 C CA  . LYS B 59  ? 2.1675 2.0397 1.1717 0.4942  -0.0875 0.2371  276 LYS B CA  
2113 C C   . LYS B 59  ? 2.2627 2.0407 1.2261 0.5022  -0.0747 0.2175  276 LYS B C   
2114 O O   . LYS B 59  ? 2.3379 2.0436 1.2610 0.5246  -0.0495 0.2264  276 LYS B O   
2115 C CB  . LYS B 59  ? 2.1800 2.1350 1.2112 0.5184  -0.0866 0.2627  276 LYS B CB  
2116 C CG  . LYS B 59  ? 2.2935 2.3464 1.3774 0.4877  -0.1103 0.2572  276 LYS B CG  
2117 C CD  . LYS B 59  ? 2.4004 2.5224 1.5248 0.4931  -0.1069 0.2689  276 LYS B CD  
2118 C CE  . LYS B 59  ? 2.4458 2.6655 1.6266 0.4565  -0.1270 0.2590  276 LYS B CE  
2119 N NZ  . LYS B 59  ? 2.4899 2.7519 1.7176 0.4439  -0.1167 0.2604  276 LYS B NZ  
2120 N N   . ASP B 60  ? 2.1768 1.9516 1.1432 0.4875  -0.0892 0.1894  277 ASP B N   
2121 C CA  . ASP B 60  ? 2.2249 1.9261 1.1506 0.4961  -0.0860 0.1606  277 ASP B CA  
2122 C C   . ASP B 60  ? 2.2690 1.9145 1.1848 0.4609  -0.0911 0.1255  277 ASP B C   
2123 O O   . ASP B 60  ? 2.3320 1.8983 1.2100 0.4649  -0.0798 0.1045  277 ASP B O   
2124 C CB  . ASP B 60  ? 2.3271 1.9795 1.2085 0.5466  -0.0610 0.1816  277 ASP B CB  
2125 C CG  . ASP B 60  ? 2.4860 2.2035 1.3873 0.5804  -0.0536 0.2164  277 ASP B CG  
2126 O OD1 . ASP B 60  ? 2.4814 2.2067 1.3815 0.5909  -0.0572 0.2058  277 ASP B OD1 
2127 O OD2 . ASP B 60  ? 2.5856 2.3511 1.5045 0.6000  -0.0411 0.2555  277 ASP B OD2 
2128 N N   . HIS B 61  ? 2.1598 1.8472 1.1111 0.4245  -0.1066 0.1180  278 HIS B N   
2129 C CA  . HIS B 61  ? 2.1716 1.8310 1.1322 0.3860  -0.1112 0.0892  278 HIS B CA  
2130 C C   . HIS B 61  ? 2.1842 1.8962 1.1617 0.3641  -0.1384 0.0595  278 HIS B C   
2131 O O   . HIS B 61  ? 2.1176 1.8853 1.1069 0.3702  -0.1473 0.0738  278 HIS B O   
2132 C CB  . HIS B 61  ? 2.1678 1.8322 1.1494 0.3742  -0.0979 0.1163  278 HIS B CB  
2133 C CG  . HIS B 61  ? 2.2384 1.8661 1.2359 0.3361  -0.0910 0.0946  278 HIS B CG  
2134 N ND1 . HIS B 61  ? 2.2115 1.8893 1.2406 0.3040  -0.1124 0.0762  278 HIS B ND1 
2135 C CD2 . HIS B 61  ? 2.3409 1.8860 1.3284 0.3254  -0.0600 0.0898  278 HIS B CD2 
2136 C CE1 . HIS B 61  ? 2.2495 1.8874 1.2973 0.2720  -0.0971 0.0610  278 HIS B CE1 
2137 N NE2 . HIS B 61  ? 2.3357 1.8874 1.3609 0.2802  -0.0636 0.0668  278 HIS B NE2 
2138 N N   . PRO B 62  ? 2.1764 1.8748 1.1548 0.3387  -0.1493 0.0175  279 PRO B N   
2139 C CA  . PRO B 62  ? 2.1279 1.8906 1.1166 0.3290  -0.1731 -0.0072 279 PRO B CA  
2140 C C   . PRO B 62  ? 2.0865 1.9049 1.0997 0.3173  -0.1773 0.0164  279 PRO B C   
2141 O O   . PRO B 62  ? 2.0396 1.9020 1.0421 0.3314  -0.1858 0.0145  279 PRO B O   
2142 C CB  . PRO B 62  ? 2.2042 1.9562 1.2049 0.2948  -0.1828 -0.0540 279 PRO B CB  
2143 C CG  . PRO B 62  ? 2.3462 2.0094 1.3194 0.2991  -0.1662 -0.0657 279 PRO B CG  
2144 C CD  . PRO B 62  ? 2.2823 1.9094 1.2509 0.3184  -0.1386 -0.0126 279 PRO B CD  
2145 N N   . ALA B 63  ? 2.0340 1.8423 1.0701 0.2987  -0.1666 0.0402  280 ALA B N   
2146 C CA  . ALA B 63  ? 1.9812 1.8317 1.0305 0.2919  -0.1699 0.0632  280 ALA B CA  
2147 C C   . ALA B 63  ? 1.9821 1.8543 1.0173 0.3134  -0.1709 0.0850  280 ALA B C   
2148 O O   . ALA B 63  ? 1.9491 1.8528 0.9781 0.3115  -0.1765 0.0889  280 ALA B O   
2149 C CB  . ALA B 63  ? 2.0064 1.8348 1.0752 0.2788  -0.1542 0.0858  280 ALA B CB  
2150 N N   . VAL B 64  ? 1.9319 1.7868 0.9618 0.3330  -0.1624 0.0986  281 VAL B N   
2151 C CA  . VAL B 64  ? 1.8932 1.7779 0.9246 0.3464  -0.1614 0.1159  281 VAL B CA  
2152 C C   . VAL B 64  ? 1.9158 1.8088 0.9324 0.3556  -0.1608 0.1009  281 VAL B C   
2153 O O   . VAL B 64  ? 1.8934 1.8079 0.9097 0.3505  -0.1581 0.1058  281 VAL B O   
2154 C CB  . VAL B 64  ? 1.9587 1.8369 0.9930 0.3699  -0.1499 0.1365  281 VAL B CB  
2155 C CG1 . VAL B 64  ? 1.9266 1.8559 0.9800 0.3751  -0.1498 0.1518  281 VAL B CG1 
2156 C CG2 . VAL B 64  ? 1.9846 1.8459 1.0196 0.3745  -0.1408 0.1549  281 VAL B CG2 
2157 N N   . ALA B 65  ? 1.8658 1.7362 0.8636 0.3722  -0.1602 0.0810  282 ALA B N   
2158 C CA  . ALA B 65  ? 1.8578 1.7348 0.8306 0.3965  -0.1555 0.0680  282 ALA B CA  
2159 C C   . ALA B 65  ? 1.8785 1.7835 0.8401 0.3890  -0.1590 0.0594  282 ALA B C   
2160 O O   . ALA B 65  ? 1.8839 1.7937 0.8283 0.4045  -0.1425 0.0682  282 ALA B O   
2161 C CB  . ALA B 65  ? 1.9104 1.7632 0.8584 0.4182  -0.1607 0.0419  282 ALA B CB  
2162 N N   . ALA B 66  ? 1.8023 1.7228 0.7735 0.3664  -0.1742 0.0461  283 ALA B N   
2163 C CA  . ALA B 66  ? 1.7741 1.7297 0.7334 0.3637  -0.1768 0.0428  283 ALA B CA  
2164 C C   . ALA B 66  ? 1.7980 1.7482 0.7493 0.3570  -0.1645 0.0683  283 ALA B C   
2165 O O   . ALA B 66  ? 1.8003 1.7562 0.7177 0.3743  -0.1505 0.0719  283 ALA B O   
2166 C CB  . ALA B 66  ? 1.7816 1.7589 0.7683 0.3355  -0.1921 0.0298  283 ALA B CB  
2167 N N   . THR B 67  ? 1.7284 1.6655 0.7038 0.3362  -0.1672 0.0843  284 THR B N   
2168 C CA  . THR B 67  ? 1.7053 1.6400 0.6746 0.3248  -0.1621 0.0998  284 THR B CA  
2169 C C   . THR B 67  ? 1.7341 1.6559 0.6942 0.3322  -0.1430 0.1015  284 THR B C   
2170 O O   . THR B 67  ? 1.7482 1.6560 0.6831 0.3274  -0.1288 0.1035  284 THR B O   
2171 C CB  . THR B 67  ? 1.7784 1.7185 0.7735 0.3091  -0.1737 0.1127  284 THR B CB  
2172 O OG1 . THR B 67  ? 1.7789 1.7201 0.7829 0.3037  -0.1793 0.1136  284 THR B OG1 
2173 C CG2 . THR B 67  ? 1.7381 1.6842 0.7216 0.2982  -0.1759 0.1208  284 THR B CG2 
2174 N N   . LEU B 68  ? 1.6741 1.5937 0.6520 0.3449  -0.1371 0.1020  285 LEU B N   
2175 C CA  . LEU B 68  ? 1.6787 1.5882 0.6590 0.3528  -0.1119 0.1076  285 LEU B CA  
2176 C C   . LEU B 68  ? 1.7359 1.6206 0.6705 0.3794  -0.0845 0.1040  285 LEU B C   
2177 O O   . LEU B 68  ? 1.7559 1.6163 0.6794 0.3740  -0.0552 0.1093  285 LEU B O   
2178 C CB  . LEU B 68  ? 1.6807 1.5952 0.6854 0.3712  -0.1083 0.1151  285 LEU B CB  
2179 C CG  . LEU B 68  ? 1.7169 1.6612 0.7627 0.3562  -0.1223 0.1276  285 LEU B CG  
2180 C CD1 . LEU B 68  ? 1.7339 1.6699 0.7816 0.3854  -0.1199 0.1357  285 LEU B CD1 
2181 C CD2 . LEU B 68  ? 1.7244 1.7003 0.8062 0.3342  -0.1123 0.1350  285 LEU B CD2 
2182 N N   . ASN B 69  ? 1.6798 1.5724 0.5859 0.4084  -0.0918 0.0932  286 ASN B N   
2183 C CA  . ASN B 69  ? 1.6947 1.5810 0.5479 0.4491  -0.0679 0.0907  286 ASN B CA  
2184 C C   . ASN B 69  ? 1.7614 1.6359 0.5816 0.4399  -0.0542 0.0977  286 ASN B C   
2185 O O   . ASN B 69  ? 1.7894 1.6274 0.5677 0.4620  -0.0134 0.1077  286 ASN B O   
2186 C CB  . ASN B 69  ? 1.6421 1.5659 0.4808 0.4755  -0.0912 0.0699  286 ASN B CB  
2187 C CG  . ASN B 69  ? 1.9960 1.9414 0.7778 0.5226  -0.0741 0.0666  286 ASN B CG  
2188 O OD1 . ASN B 69  ? 2.0026 1.9333 0.7447 0.5734  -0.0432 0.0721  286 ASN B OD1 
2189 N ND2 . ASN B 69  ? 1.8713 1.8559 0.6453 0.5141  -0.0892 0.0621  286 ASN B ND2 
2190 N N   . ASN B 70  ? 1.6990 1.5957 0.5324 0.4117  -0.0824 0.0954  287 ASN B N   
2191 C CA  . ASN B 70  ? 1.7109 1.5955 0.5075 0.4066  -0.0730 0.1045  287 ASN B CA  
2192 C C   . ASN B 70  ? 1.8130 1.6453 0.6005 0.3818  -0.0505 0.1105  287 ASN B C   
2193 O O   . ASN B 70  ? 1.8707 1.6604 0.6013 0.3948  -0.0176 0.1174  287 ASN B O   
2194 C CB  . ASN B 70  ? 1.6789 1.5999 0.4988 0.3857  -0.1056 0.1044  287 ASN B CB  
2195 C CG  . ASN B 70  ? 1.8791 1.8557 0.7064 0.4039  -0.1216 0.0932  287 ASN B CG  
2196 O OD1 . ASN B 70  ? 1.7742 1.7721 0.5672 0.4428  -0.1087 0.0875  287 ASN B OD1 
2197 N ND2 . ASN B 70  ? 1.8316 1.8365 0.7044 0.3771  -0.1478 0.0883  287 ASN B ND2 
2198 N N   . LEU B 71  ? 1.7440 1.5801 0.5843 0.3489  -0.0640 0.1063  288 LEU B N   
2199 C CA  . LEU B 71  ? 1.7702 1.5741 0.6175 0.3170  -0.0467 0.1029  288 LEU B CA  
2200 C C   . LEU B 71  ? 1.8893 1.6440 0.7123 0.3349  0.0058  0.1067  288 LEU B C   
2201 O O   . LEU B 71  ? 1.9471 1.6456 0.7360 0.3199  0.0392  0.1039  288 LEU B O   
2202 C CB  . LEU B 71  ? 1.7343 1.5799 0.6501 0.2861  -0.0737 0.0986  288 LEU B CB  
2203 C CG  . LEU B 71  ? 1.7582 1.6355 0.6876 0.2647  -0.1111 0.0958  288 LEU B CG  
2204 C CD1 . LEU B 71  ? 1.7260 1.6557 0.7126 0.2603  -0.1350 0.0999  288 LEU B CD1 
2205 C CD2 . LEU B 71  ? 1.8125 1.6692 0.7232 0.2331  -0.1083 0.0823  288 LEU B CD2 
2206 N N   . ALA B 72  ? 1.8440 1.6104 0.6753 0.3717  0.0180  0.1134  289 ALA B N   
2207 C CA  . ALA B 72  ? 1.8983 1.6177 0.7015 0.4047  0.0749  0.1238  289 ALA B CA  
2208 C C   . ALA B 72  ? 2.0122 1.6871 0.7277 0.4462  0.1128  0.1317  289 ALA B C   
2209 O O   . ALA B 72  ? 2.0638 1.6685 0.7417 0.4558  0.1725  0.1408  289 ALA B O   
2210 C CB  . ALA B 72  ? 1.8903 1.6374 0.7099 0.4472  0.0734  0.1297  289 ALA B CB  
2211 N N   . VAL B 73  ? 1.9589 1.6753 0.6431 0.4703  0.0826  0.1300  290 VAL B N   
2212 C CA  . VAL B 73  ? 2.0086 1.7072 0.6087 0.5177  0.1128  0.1415  290 VAL B CA  
2213 C C   . VAL B 73  ? 2.1428 1.7635 0.7014 0.4891  0.1451  0.1461  290 VAL B C   
2214 O O   . VAL B 73  ? 2.2367 1.7863 0.7236 0.5234  0.2078  0.1601  290 VAL B O   
2215 C CB  . VAL B 73  ? 2.0099 1.7895 0.6066 0.5351  0.0672  0.1368  290 VAL B CB  
2216 C CG1 . VAL B 73  ? 2.0562 1.8297 0.5687 0.5811  0.0971  0.1536  290 VAL B CG1 
2217 C CG2 . VAL B 73  ? 1.9747 1.8216 0.5977 0.5660  0.0411  0.1237  290 VAL B CG2 
2218 N N   . LEU B 74  ? 2.0673 1.6952 0.6658 0.4296  0.1061  0.1334  291 LEU B N   
2219 C CA  . LEU B 74  ? 2.1174 1.6748 0.6779 0.3954  0.1250  0.1283  291 LEU B CA  
2220 C C   . LEU B 74  ? 2.2490 1.7311 0.8187 0.3623  0.1724  0.1184  291 LEU B C   
2221 O O   . LEU B 74  ? 2.3326 1.7215 0.8326 0.3616  0.2234  0.1190  291 LEU B O   
2222 C CB  . LEU B 74  ? 2.0643 1.6627 0.6627 0.3513  0.0666  0.1161  291 LEU B CB  
2223 C CG  . LEU B 74  ? 2.0626 1.7216 0.6519 0.3772  0.0304  0.1287  291 LEU B CG  
2224 C CD1 . LEU B 74  ? 2.0088 1.7111 0.6510 0.3397  -0.0213 0.1205  291 LEU B CD1 
2225 C CD2 . LEU B 74  ? 2.1361 1.7536 0.6301 0.4150  0.0614  0.1469  291 LEU B CD2 
2226 N N   . TYR B 75  ? 1.8301 1.9865 0.9731 0.2920  -0.1240 -0.0040 292 TYR B N   
2227 C CA  . TYR B 75  ? 1.8718 1.9876 1.0113 0.2512  -0.1398 -0.0280 292 TYR B CA  
2228 C C   . TYR B 75  ? 1.9336 1.9821 1.0429 0.2428  -0.1238 -0.0343 292 TYR B C   
2229 O O   . TYR B 75  ? 2.0128 1.9892 1.0727 0.2249  -0.1347 -0.0547 292 TYR B O   
2230 C CB  . TYR B 75  ? 1.8442 2.0214 1.0637 0.2169  -0.1459 -0.0223 292 TYR B CB  
2231 C CG  . TYR B 75  ? 1.8981 2.1206 1.1267 0.2122  -0.1688 -0.0293 292 TYR B CG  
2232 C CD1 . TYR B 75  ? 2.0051 2.1956 1.1972 0.1899  -0.1969 -0.0556 292 TYR B CD1 
2233 C CD2 . TYR B 75  ? 1.8544 2.1512 1.1274 0.2288  -0.1626 -0.0104 292 TYR B CD2 
2234 C CE1 . TYR B 75  ? 2.0352 2.2790 1.2356 0.1884  -0.2196 -0.0646 292 TYR B CE1 
2235 C CE2 . TYR B 75  ? 1.8766 2.2244 1.1560 0.2314  -0.1790 -0.0158 292 TYR B CE2 
2236 C CZ  . TYR B 75  ? 2.0544 2.3821 1.2985 0.2130  -0.2082 -0.0437 292 TYR B CZ  
2237 O OH  . TYR B 75  ? 2.0693 2.4580 1.3191 0.2185  -0.2261 -0.0516 292 TYR B OH  
2238 N N   . GLY B 76  ? 1.8085 1.8781 0.9427 0.2584  -0.0983 -0.0173 293 GLY B N   
2239 C CA  . GLY B 76  ? 1.8174 1.8385 0.9240 0.2640  -0.0758 -0.0195 293 GLY B CA  
2240 C C   . GLY B 76  ? 1.9382 1.8904 0.9418 0.2988  -0.0673 -0.0258 293 GLY B C   
2241 O O   . GLY B 76  ? 2.0020 1.8807 0.9557 0.2972  -0.0547 -0.0364 293 GLY B O   
2242 N N   . LYS B 77  ? 1.8899 1.8637 0.8554 0.3358  -0.0720 -0.0155 294 LYS B N   
2243 C CA  . LYS B 77  ? 1.9627 1.8789 0.8165 0.3833  -0.0653 -0.0150 294 LYS B CA  
2244 C C   . LYS B 77  ? 2.1193 1.9320 0.8929 0.3716  -0.0880 -0.0453 294 LYS B C   
2245 O O   . LYS B 77  ? 2.2190 1.9436 0.8854 0.4018  -0.0790 -0.0526 294 LYS B O   
2246 C CB  . LYS B 77  ? 1.9697 1.9495 0.8141 0.4274  -0.0684 0.0105  294 LYS B CB  
2247 C CG  . LYS B 77  ? 2.0446 2.1077 0.9341 0.4477  -0.0444 0.0444  294 LYS B CG  
2248 C CD  . LYS B 77  ? 2.2884 2.3279 1.0884 0.4966  -0.0192 0.0581  294 LYS B CD  
2249 C CE  . LYS B 77  ? 2.4262 2.5636 1.2735 0.5139  0.0000  0.0938  294 LYS B CE  
2250 N NZ  . LYS B 77  ? 2.6090 2.7401 1.3594 0.5709  0.0251  0.1133  294 LYS B NZ  
2251 N N   . ARG B 78  ? 2.0523 1.8756 0.8736 0.3284  -0.1183 -0.0626 295 ARG B N   
2252 C CA  . ARG B 78  ? 2.1430 1.8804 0.9071 0.3026  -0.1496 -0.0948 295 ARG B CA  
2253 C C   . ARG B 78  ? 2.1986 1.8792 0.9866 0.2453  -0.1476 -0.1082 295 ARG B C   
2254 O O   . ARG B 78  ? 2.2885 1.8908 1.0347 0.2120  -0.1747 -0.1342 295 ARG B O   
2255 C CB  . ARG B 78  ? 2.1289 1.9267 0.9361 0.2875  -0.1839 -0.1040 295 ARG B CB  
2256 C CG  . ARG B 78  ? 2.2902 2.1132 1.0445 0.3502  -0.1922 -0.0961 295 ARG B CG  
2257 C CD  . ARG B 78  ? 2.4997 2.3138 1.2289 0.3443  -0.2341 -0.1241 295 ARG B CD  
2258 N NE  . ARG B 78  ? 2.5366 2.4505 1.3739 0.3053  -0.2443 -0.1217 295 ARG B NE  
2259 C CZ  . ARG B 78  ? 2.7224 2.6417 1.5719 0.2676  -0.2796 -0.1491 295 ARG B CZ  
2260 N NH1 . ARG B 78  ? 2.7008 2.5221 1.4643 0.2568  -0.3133 -0.1852 295 ARG B NH1 
2261 N NH2 . ARG B 78  ? 2.4130 2.4347 1.3558 0.2410  -0.2825 -0.1403 295 ARG B NH2 
2262 N N   . GLY B 79  ? 2.0584 1.7797 0.9135 0.2359  -0.1170 -0.0891 296 GLY B N   
2263 C CA  . GLY B 79  ? 2.0555 1.7427 0.9471 0.1919  -0.1071 -0.0905 296 GLY B CA  
2264 C C   . GLY B 79  ? 2.0300 1.7851 1.0235 0.1356  -0.1292 -0.0875 296 GLY B C   
2265 O O   . GLY B 79  ? 2.0317 1.7651 1.0601 0.0942  -0.1268 -0.0843 296 GLY B O   
2266 N N   . LYS B 80  ? 1.9258 1.7690 0.9665 0.1378  -0.1481 -0.0836 297 LYS B N   
2267 C CA  . LYS B 80  ? 1.8757 1.8002 1.0028 0.0961  -0.1683 -0.0774 297 LYS B CA  
2268 C C   . LYS B 80  ? 1.8282 1.8373 1.0402 0.1037  -0.1445 -0.0484 297 LYS B C   
2269 O O   . LYS B 80  ? 1.7569 1.8455 1.0127 0.1147  -0.1485 -0.0370 297 LYS B O   
2270 C CB  . LYS B 80  ? 1.9000 1.8689 1.0173 0.1056  -0.1973 -0.0890 297 LYS B CB  
2271 C CG  . LYS B 80  ? 2.1334 2.0276 1.1770 0.0887  -0.2329 -0.1219 297 LYS B CG  
2272 C CD  . LYS B 80  ? 2.2632 2.2143 1.2997 0.1087  -0.2599 -0.1329 297 LYS B CD  
2273 C CE  . LYS B 80  ? 2.3293 2.3517 1.4273 0.0589  -0.2896 -0.1393 297 LYS B CE  
2274 N NZ  . LYS B 80  ? 2.3610 2.4446 1.4479 0.0882  -0.3114 -0.1505 297 LYS B NZ  
2275 N N   . TYR B 81  ? 1.7829 1.7679 1.0107 0.1025  -0.1191 -0.0368 298 TYR B N   
2276 C CA  . TYR B 81  ? 1.6940 1.7418 0.9868 0.1188  -0.0972 -0.0125 298 TYR B CA  
2277 C C   . TYR B 81  ? 1.7227 1.8531 1.0925 0.0947  -0.1090 0.0072  298 TYR B C   
2278 O O   . TYR B 81  ? 1.6353 1.8251 1.0407 0.1184  -0.1025 0.0222  298 TYR B O   
2279 C CB  . TYR B 81  ? 1.7123 1.7133 0.9939 0.1334  -0.0662 -0.0063 298 TYR B CB  
2280 C CG  . TYR B 81  ? 1.7793 1.7033 0.9745 0.1646  -0.0493 -0.0215 298 TYR B CG  
2281 C CD1 . TYR B 81  ? 1.7747 1.7215 0.9439 0.2058  -0.0412 -0.0217 298 TYR B CD1 
2282 C CD2 . TYR B 81  ? 1.8736 1.7027 1.0101 0.1547  -0.0394 -0.0312 298 TYR B CD2 
2283 C CE1 . TYR B 81  ? 1.8430 1.7330 0.9278 0.2410  -0.0239 -0.0288 298 TYR B CE1 
2284 C CE2 . TYR B 81  ? 1.9441 1.7000 0.9856 0.1928  -0.0203 -0.0420 298 TYR B CE2 
2285 C CZ  . TYR B 81  ? 2.0153 1.8085 1.0303 0.2385  -0.0125 -0.0394 298 TYR B CZ  
2286 O OH  . TYR B 81  ? 2.1173 1.8528 1.0347 0.2824  0.0079  -0.0434 298 TYR B OH  
2287 N N   . LYS B 82  ? 1.7619 1.8959 1.1533 0.0483  -0.1268 0.0094  299 LYS B N   
2288 C CA  . LYS B 82  ? 1.7377 1.9635 1.1989 0.0261  -0.1378 0.0348  299 LYS B CA  
2289 C C   . LYS B 82  ? 1.7696 2.0677 1.2404 0.0391  -0.1530 0.0347  299 LYS B C   
2290 O O   . LYS B 82  ? 1.7213 2.0962 1.2360 0.0510  -0.1486 0.0607  299 LYS B O   
2291 C CB  . LYS B 82  ? 1.8414 2.0628 1.3242 -0.0336 -0.1579 0.0381  299 LYS B CB  
2292 C CG  . LYS B 82  ? 2.0616 2.2507 1.5699 -0.0456 -0.1358 0.0600  299 LYS B CG  
2293 C CD  . LYS B 82  ? 2.2159 2.4285 1.7704 -0.1112 -0.1564 0.0768  299 LYS B CD  
2294 C CE  . LYS B 82  ? 2.3309 2.5047 1.9111 -0.1205 -0.1299 0.1030  299 LYS B CE  
2295 N NZ  . LYS B 82  ? 2.4679 2.6812 2.1095 -0.1885 -0.1492 0.1301  299 LYS B NZ  
2296 N N   . GLU B 83  ? 1.7563 2.0274 1.1795 0.0447  -0.1679 0.0082  300 GLU B N   
2297 C CA  . GLU B 83  ? 1.7268 2.0601 1.1528 0.0640  -0.1778 0.0078  300 GLU B CA  
2298 C C   . GLU B 83  ? 1.7253 2.0530 1.1364 0.1121  -0.1580 0.0120  300 GLU B C   
2299 O O   . GLU B 83  ? 1.6898 2.0668 1.1084 0.1324  -0.1590 0.0186  300 GLU B O   
2300 C CB  . GLU B 83  ? 1.8085 2.1375 1.2009 0.0450  -0.2089 -0.0186 300 GLU B CB  
2301 C CG  . GLU B 83  ? 2.0533 2.2780 1.3733 0.0444  -0.2183 -0.0488 300 GLU B CG  
2302 C CD  . GLU B 83  ? 2.4358 2.5935 1.7445 -0.0048 -0.2308 -0.0598 300 GLU B CD  
2303 O OE1 . GLU B 83  ? 2.3084 2.4245 1.6249 -0.0064 -0.2067 -0.0472 300 GLU B OE1 
2304 O OE2 . GLU B 83  ? 2.4795 2.6250 1.7709 -0.0414 -0.2652 -0.0814 300 GLU B OE2 
2305 N N   . ALA B 84  ? 1.6779 1.9511 1.0712 0.1292  -0.1388 0.0110  301 ALA B N   
2306 C CA  . ALA B 84  ? 1.6367 1.9089 1.0239 0.1662  -0.1221 0.0175  301 ALA B CA  
2307 C C   . ALA B 84  ? 1.6199 1.9265 1.0519 0.1776  -0.1093 0.0380  301 ALA B C   
2308 O O   . ALA B 84  ? 1.5838 1.9070 1.0242 0.1998  -0.1033 0.0467  301 ALA B O   
2309 C CB  . ALA B 84  ? 1.6766 1.8840 1.0177 0.1812  -0.1091 0.0067  301 ALA B CB  
2310 N N   . GLU B 85  ? 1.5665 1.8798 1.0242 0.1641  -0.1062 0.0476  302 GLU B N   
2311 C CA  . GLU B 85  ? 1.5228 1.8660 1.0138 0.1827  -0.0963 0.0688  302 GLU B CA  
2312 C C   . GLU B 85  ? 1.5169 1.9156 1.0231 0.1949  -0.1027 0.0856  302 GLU B C   
2313 O O   . GLU B 85  ? 1.4755 1.8692 0.9812 0.2227  -0.0960 0.0924  302 GLU B O   
2314 C CB  . GLU B 85  ? 1.5542 1.9027 1.0700 0.1695  -0.0910 0.0827  302 GLU B CB  
2315 C CG  . GLU B 85  ? 1.7136 2.0687 1.2473 0.2050  -0.0751 0.0998  302 GLU B CG  
2316 C CD  . GLU B 85  ? 2.0589 2.4110 1.6148 0.2048  -0.0614 0.1159  302 GLU B CD  
2317 O OE1 . GLU B 85  ? 2.0751 2.3931 1.6247 0.1733  -0.0595 0.1079  302 GLU B OE1 
2318 O OE2 . GLU B 85  ? 1.9119 2.2889 1.4864 0.2408  -0.0516 0.1370  302 GLU B OE2 
2319 N N   . PRO B 86  ? 1.4756 1.9239 0.9887 0.1774  -0.1154 0.0911  303 PRO B N   
2320 C CA  . PRO B 86  ? 1.4461 1.9461 0.9625 0.1989  -0.1147 0.1097  303 PRO B CA  
2321 C C   . PRO B 86  ? 1.4565 1.9330 0.9532 0.2224  -0.1085 0.1039  303 PRO B C   
2322 O O   . PRO B 86  ? 1.4405 1.9244 0.9326 0.2483  -0.1013 0.1199  303 PRO B O   
2323 C CB  . PRO B 86  ? 1.4818 2.0438 1.0058 0.1746  -0.1293 0.1113  303 PRO B CB  
2324 C CG  . PRO B 86  ? 1.5669 2.1116 1.1028 0.1348  -0.1404 0.1010  303 PRO B CG  
2325 C CD  . PRO B 86  ? 1.5256 1.9855 1.0392 0.1391  -0.1318 0.0804  303 PRO B CD  
2326 N N   . LEU B 87  ? 1.4137 1.8592 0.8952 0.2155  -0.1109 0.0844  304 LEU B N   
2327 C CA  . LEU B 87  ? 1.4067 1.8376 0.8776 0.2346  -0.1043 0.0850  304 LEU B CA  
2328 C C   . LEU B 87  ? 1.4637 1.8568 0.9398 0.2469  -0.0959 0.0896  304 LEU B C   
2329 O O   . LEU B 87  ? 1.4589 1.8479 0.9365 0.2615  -0.0910 0.1015  304 LEU B O   
2330 C CB  . LEU B 87  ? 1.4231 1.8355 0.8724 0.2309  -0.1090 0.0689  304 LEU B CB  
2331 C CG  . LEU B 87  ? 1.5048 1.9521 0.9407 0.2295  -0.1208 0.0615  304 LEU B CG  
2332 C CD1 . LEU B 87  ? 1.5524 1.9658 0.9596 0.2116  -0.1353 0.0382  304 LEU B CD1 
2333 C CD2 . LEU B 87  ? 1.5328 1.9974 0.9613 0.2585  -0.1134 0.0710  304 LEU B CD2 
2334 N N   . CYS B 88  ? 1.4326 1.7961 0.9094 0.2412  -0.0945 0.0796  305 CYS B N   
2335 C CA  . CYS B 88  ? 1.4285 1.7624 0.9095 0.2534  -0.0899 0.0785  305 CYS B CA  
2336 C C   . CYS B 88  ? 1.4475 1.7817 0.9337 0.2710  -0.0914 0.0905  305 CYS B C   
2337 O O   . CYS B 88  ? 1.4429 1.7522 0.9262 0.2828  -0.0937 0.0922  305 CYS B O   
2338 C CB  . CYS B 88  ? 1.4509 1.7618 0.9251 0.2507  -0.0841 0.0651  305 CYS B CB  
2339 S SG  . CYS B 88  ? 1.5113 1.8039 0.9746 0.2581  -0.0779 0.0575  305 CYS B SG  
2340 N N   . LYS B 89  ? 1.3850 1.7477 0.8753 0.2736  -0.0919 0.1015  306 LYS B N   
2341 C CA  . LYS B 89  ? 1.3729 1.7444 0.8574 0.3012  -0.0923 0.1199  306 LYS B CA  
2342 C C   . LYS B 89  ? 1.4292 1.8014 0.8931 0.3162  -0.0924 0.1325  306 LYS B C   
2343 O O   . LYS B 89  ? 1.4431 1.7851 0.8839 0.3448  -0.0940 0.1406  306 LYS B O   
2344 C CB  . LYS B 89  ? 1.3861 1.8069 0.8850 0.2991  -0.0911 0.1378  306 LYS B CB  
2345 C CG  . LYS B 89  ? 1.4252 1.8347 0.9401 0.3022  -0.0858 0.1361  306 LYS B CG  
2346 C CD  . LYS B 89  ? 1.4752 1.9396 1.0141 0.2962  -0.0839 0.1624  306 LYS B CD  
2347 C CE  . LYS B 89  ? 1.6599 2.1109 1.2164 0.3059  -0.0732 0.1663  306 LYS B CE  
2348 N NZ  . LYS B 89  ? 1.7950 2.3049 1.3846 0.2963  -0.0705 0.2000  306 LYS B NZ  
2349 N N   . ARG B 90  ? 1.3770 1.7777 0.8425 0.3017  -0.0902 0.1335  307 ARG B N   
2350 C CA  . ARG B 90  ? 1.3906 1.7946 0.8354 0.3193  -0.0839 0.1475  307 ARG B CA  
2351 C C   . ARG B 90  ? 1.4436 1.7881 0.8841 0.3198  -0.0831 0.1420  307 ARG B C   
2352 O O   . ARG B 90  ? 1.4732 1.7837 0.8875 0.3403  -0.0796 0.1539  307 ARG B O   
2353 C CB  . ARG B 90  ? 1.3861 1.8461 0.8361 0.3098  -0.0806 0.1493  307 ARG B CB  
2354 C CG  . ARG B 90  ? 1.5176 2.0052 0.9413 0.3389  -0.0684 0.1709  307 ARG B CG  
2355 C CD  . ARG B 90  ? 1.5798 2.1194 1.0080 0.3371  -0.0637 0.1691  307 ARG B CD  
2356 N NE  . ARG B 90  ? 1.6916 2.2061 1.1050 0.3594  -0.0472 0.1804  307 ARG B NE  
2357 C CZ  . ARG B 90  ? 1.7972 2.3530 1.2100 0.3729  -0.0369 0.1843  307 ARG B CZ  
2358 N NH1 . ARG B 90  ? 1.6465 2.2690 1.0680 0.3653  -0.0464 0.1725  307 ARG B NH1 
2359 N NH2 . ARG B 90  ? 1.4968 2.0259 0.9001 0.3948  -0.0178 0.2003  307 ARG B NH2 
2360 N N   . ALA B 91  ? 1.3621 1.6936 0.8246 0.2975  -0.0864 0.1266  308 ALA B N   
2361 C CA  . ALA B 91  ? 1.3624 1.6548 0.8332 0.2899  -0.0877 0.1257  308 ALA B CA  
2362 C C   . ALA B 91  ? 1.4284 1.6687 0.8891 0.2973  -0.0982 0.1192  308 ALA B C   
2363 O O   . ALA B 91  ? 1.4677 1.6645 0.9230 0.2951  -0.1025 0.1239  308 ALA B O   
2364 C CB  . ALA B 91  ? 1.3477 1.6546 0.8384 0.2718  -0.0880 0.1159  308 ALA B CB  
2365 N N   . LEU B 92  ? 1.3560 1.5984 0.8124 0.3078  -0.1030 0.1092  309 LEU B N   
2366 C CA  . LEU B 92  ? 1.3781 1.5761 0.8189 0.3261  -0.1148 0.1005  309 LEU B CA  
2367 C C   . LEU B 92  ? 1.4744 1.6351 0.8722 0.3559  -0.1180 0.1147  309 LEU B C   
2368 O O   . LEU B 92  ? 1.5087 1.6055 0.8839 0.3624  -0.1311 0.1083  309 LEU B O   
2369 C CB  . LEU B 92  ? 1.3514 1.5717 0.7987 0.3400  -0.1132 0.0928  309 LEU B CB  
2370 C CG  . LEU B 92  ? 1.4313 1.6174 0.8581 0.3745  -0.1240 0.0857  309 LEU B CG  
2371 C CD1 . LEU B 92  ? 1.4356 1.5967 0.8737 0.3649  -0.1346 0.0619  309 LEU B CD1 
2372 C CD2 . LEU B 92  ? 1.4493 1.6710 0.8809 0.3991  -0.1152 0.0944  309 LEU B CD2 
2373 N N   . GLU B 93  ? 1.4295 1.6296 0.8110 0.3742  -0.1069 0.1345  310 GLU B N   
2374 C CA  . GLU B 93  ? 1.4833 1.6592 0.8112 0.4128  -0.1043 0.1544  310 GLU B CA  
2375 C C   . GLU B 93  ? 1.5909 1.7089 0.8938 0.4089  -0.1015 0.1589  310 GLU B C   
2376 O O   . GLU B 93  ? 1.6766 1.7216 0.9250 0.4368  -0.1083 0.1624  310 GLU B O   
2377 C CB  . GLU B 93  ? 1.4787 1.7334 0.8020 0.4293  -0.0911 0.1787  310 GLU B CB  
2378 C CG  . GLU B 93  ? 1.6463 1.9165 0.9404 0.4734  -0.0936 0.1971  310 GLU B CG  
2379 C CD  . GLU B 93  ? 2.0185 2.2795 1.3338 0.4795  -0.1038 0.1845  310 GLU B CD  
2380 O OE1 . GLU B 93  ? 2.0814 2.3694 1.4480 0.4433  -0.1029 0.1686  310 GLU B OE1 
2381 O OE2 . GLU B 93  ? 1.8126 2.0383 1.0857 0.5276  -0.1112 0.1918  310 GLU B OE2 
2382 N N   . ILE B 94  ? 1.4953 1.6385 0.8353 0.3767  -0.0920 0.1592  311 ILE B N   
2383 C CA  . ILE B 94  ? 1.5265 1.6247 0.8595 0.3675  -0.0850 0.1687  311 ILE B CA  
2384 C C   . ILE B 94  ? 1.6045 1.6218 0.9396 0.3477  -0.1059 0.1536  311 ILE B C   
2385 O O   . ILE B 94  ? 1.6680 1.6039 0.9596 0.3583  -0.1102 0.1591  311 ILE B O   
2386 C CB  . ILE B 94  ? 1.5164 1.6768 0.8964 0.3440  -0.0708 0.1751  311 ILE B CB  
2387 C CG1 . ILE B 94  ? 1.5010 1.7321 0.8675 0.3672  -0.0531 0.1890  311 ILE B CG1 
2388 C CG2 . ILE B 94  ? 1.5563 1.6764 0.9509 0.3274  -0.0643 0.1882  311 ILE B CG2 
2389 C CD1 . ILE B 94  ? 1.5373 1.8398 0.9432 0.3510  -0.0477 0.1856  311 ILE B CD1 
2390 N N   . ARG B 95  ? 1.5113 1.5500 0.8914 0.3204  -0.1194 0.1342  312 ARG B N   
2391 C CA  . ARG B 95  ? 1.5334 1.5208 0.9266 0.2967  -0.1422 0.1173  312 ARG B CA  
2392 C C   . ARG B 95  ? 1.6454 1.5517 0.9821 0.3250  -0.1638 0.1029  312 ARG B C   
2393 O O   . ARG B 95  ? 1.7058 1.5353 1.0279 0.3091  -0.1831 0.0955  312 ARG B O   
2394 C CB  . ARG B 95  ? 1.4612 1.5062 0.9030 0.2753  -0.1467 0.1016  312 ARG B CB  
2395 C CG  . ARG B 95  ? 1.4783 1.5799 0.9662 0.2472  -0.1328 0.1162  312 ARG B CG  
2396 C CD  . ARG B 95  ? 1.5395 1.6849 1.0600 0.2311  -0.1375 0.1035  312 ARG B CD  
2397 N NE  . ARG B 95  ? 1.6386 1.8228 1.1974 0.2057  -0.1309 0.1232  312 ARG B NE  
2398 C CZ  . ARG B 95  ? 1.7245 1.9646 1.2936 0.2105  -0.1139 0.1354  312 ARG B CZ  
2399 N NH1 . ARG B 95  ? 1.5412 1.7996 1.0880 0.2304  -0.1047 0.1255  312 ARG B NH1 
2400 N NH2 . ARG B 95  ? 1.5068 1.7846 1.1067 0.1966  -0.1079 0.1596  312 ARG B NH2 
2401 N N   . GLU B 96  ? 1.5957 1.5180 0.8983 0.3685  -0.1616 0.1018  313 GLU B N   
2402 C CA  . GLU B 96  ? 1.6685 1.5210 0.9054 0.4133  -0.1803 0.0932  313 GLU B CA  
2403 C C   . GLU B 96  ? 1.8307 1.5998 0.9934 0.4384  -0.1779 0.1099  313 GLU B C   
2404 O O   . GLU B 96  ? 1.9263 1.5958 1.0291 0.4585  -0.2015 0.0971  313 GLU B O   
2405 C CB  . GLU B 96  ? 1.6401 1.5492 0.8657 0.4585  -0.1727 0.1000  313 GLU B CB  
2406 C CG  . GLU B 96  ? 1.6842 1.6382 0.9562 0.4518  -0.1788 0.0796  313 GLU B CG  
2407 C CD  . GLU B 96  ? 1.9548 1.9794 1.2367 0.4837  -0.1638 0.0940  313 GLU B CD  
2408 O OE1 . GLU B 96  ? 1.7530 1.8200 1.0260 0.4955  -0.1472 0.1216  313 GLU B OE1 
2409 O OE2 . GLU B 96  ? 1.9585 2.0022 1.2610 0.4954  -0.1674 0.0796  313 GLU B OE2 
2410 N N   . LYS B 97  ? 1.7646 1.5712 0.9241 0.4415  -0.1494 0.1372  314 LYS B N   
2411 C CA  . LYS B 97  ? 1.8460 1.5842 0.9313 0.4709  -0.1370 0.1583  314 LYS B CA  
2412 C C   . LYS B 97  ? 1.9981 1.6385 1.0827 0.4321  -0.1473 0.1522  314 LYS B C   
2413 O O   . LYS B 97  ? 2.1212 1.6438 1.1275 0.4537  -0.1605 0.1496  314 LYS B O   
2414 C CB  . LYS B 97  ? 1.8118 1.6379 0.9055 0.4833  -0.1017 0.1876  314 LYS B CB  
2415 C CG  . LYS B 97  ? 1.9882 1.7569 0.9990 0.5235  -0.0804 0.2136  314 LYS B CG  
2416 C CD  . LYS B 97  ? 2.0095 1.8736 1.0406 0.5296  -0.0454 0.2388  314 LYS B CD  
2417 C CE  . LYS B 97  ? 2.1601 1.9669 1.1028 0.5758  -0.0189 0.2659  314 LYS B CE  
2418 N NZ  . LYS B 97  ? 2.2283 2.1266 1.1962 0.5809  0.0163  0.2875  314 LYS B NZ  
2419 N N   . VAL B 98  ? 1.9014 1.5893 1.0703 0.3762  -0.1424 0.1524  315 VAL B N   
2420 C CA  . VAL B 98  ? 1.9575 1.5827 1.1519 0.3294  -0.1484 0.1567  315 VAL B CA  
2421 C C   . VAL B 98  ? 2.0489 1.6068 1.2554 0.2935  -0.1901 0.1274  315 VAL B C   
2422 O O   . VAL B 98  ? 2.1583 1.5957 1.3141 0.2869  -0.2089 0.1223  315 VAL B O   
2423 C CB  . VAL B 98  ? 1.9270 1.6493 1.2069 0.2944  -0.1243 0.1769  315 VAL B CB  
2424 C CG1 . VAL B 98  ? 1.9766 1.6534 1.2983 0.2440  -0.1292 0.1905  315 VAL B CG1 
2425 C CG2 . VAL B 98  ? 1.8929 1.6730 1.1538 0.3317  -0.0867 0.2027  315 VAL B CG2 
2426 N N   . LEU B 99  ? 1.9235 1.5580 1.1942 0.2696  -0.2042 0.1082  316 LEU B N   
2427 C CA  . LEU B 99  ? 1.9577 1.5610 1.2534 0.2340  -0.2423 0.0802  316 LEU B CA  
2428 C C   . LEU B 99  ? 2.0528 1.5891 1.2819 0.2738  -0.2737 0.0474  316 LEU B C   
2429 O O   . LEU B 99  ? 2.1371 1.5955 1.3517 0.2515  -0.3109 0.0237  316 LEU B O   
2430 C CB  . LEU B 99  ? 1.8580 1.5783 1.2415 0.2009  -0.2392 0.0768  316 LEU B CB  
2431 C CG  . LEU B 99  ? 1.8658 1.6597 1.3160 0.1665  -0.2129 0.1097  316 LEU B CG  
2432 C CD1 . LEU B 99  ? 1.7605 1.6694 1.2557 0.1707  -0.1974 0.1088  316 LEU B CD1 
2433 C CD2 . LEU B 99  ? 1.9443 1.7141 1.4424 0.1075  -0.2307 0.1210  316 LEU B CD2 
2434 N N   . GLY B 100 ? 2.1315 1.3192 0.9898 0.3414  0.0683  0.2585  317 GLY B N   
2435 C CA  . GLY B 100 ? 2.0671 1.2816 0.9691 0.3572  0.0371  0.2384  317 GLY B CA  
2436 C C   . GLY B 100 ? 1.9101 1.3061 0.9721 0.3370  0.0229  0.2114  317 GLY B C   
2437 O O   . GLY B 100 ? 1.8224 1.3011 0.9698 0.2882  0.0385  0.2060  317 GLY B O   
2438 N N   . LYS B 101 ? 1.7926 1.2425 0.8855 0.3778  -0.0033 0.1962  318 LYS B N   
2439 C CA  . LYS B 101 ? 1.6135 1.2180 0.8394 0.3665  -0.0151 0.1741  318 LYS B CA  
2440 C C   . LYS B 101 ? 1.5569 1.1858 0.8769 0.2897  -0.0062 0.1605  318 LYS B C   
2441 O O   . LYS B 101 ? 1.4332 1.1798 0.8541 0.2698  -0.0078 0.1450  318 LYS B O   
2442 C CB  . LYS B 101 ? 1.6485 1.2769 0.8638 0.4298  -0.0352 0.1685  318 LYS B CB  
2443 C CG  . LYS B 101 ? 1.7935 1.5916 1.1195 0.4441  -0.0442 0.1549  318 LYS B CG  
2444 C CD  . LYS B 101 ? 1.9032 1.7145 1.2303 0.4892  -0.0511 0.1521  318 LYS B CD  
2445 C CE  . LYS B 101 ? 1.8945 1.8676 1.3358 0.4916  -0.0509 0.1433  318 LYS B CE  
2446 N NZ  . LYS B 101 ? 1.8541 1.8660 1.3866 0.4205  -0.0429 0.1291  318 LYS B NZ  
2447 N N   . PHE B 102 ? 1.5664 1.0830 0.8509 0.2471  0.0003  0.1649  319 PHE B N   
2448 C CA  . PHE B 102 ? 1.4811 1.0280 0.8569 0.1794  0.0018  0.1490  319 PHE B CA  
2449 C C   . PHE B 102 ? 1.5785 1.0948 0.9684 0.1112  0.0295  0.1607  319 PHE B C   
2450 O O   . PHE B 102 ? 1.6156 1.0870 1.0292 0.0571  0.0267  0.1549  319 PHE B O   
2451 C CB  . PHE B 102 ? 1.5309 1.0016 0.8825 0.1820  -0.0237 0.1356  319 PHE B CB  
2452 C CG  . PHE B 102 ? 1.4989 1.0016 0.8381 0.2503  -0.0432 0.1267  319 PHE B CG  
2453 C CD1 . PHE B 102 ? 1.4125 1.0275 0.8452 0.2505  -0.0485 0.1092  319 PHE B CD1 
2454 C CD2 . PHE B 102 ? 1.6204 1.0348 0.8469 0.3178  -0.0526 0.1376  319 PHE B CD2 
2455 C CE1 . PHE B 102 ? 1.4083 1.0534 0.8302 0.3100  -0.0574 0.1060  319 PHE B CE1 
2456 C CE2 . PHE B 102 ? 1.6393 1.0967 0.8594 0.3847  -0.0636 0.1326  319 PHE B CE2 
2457 C CZ  . PHE B 102 ? 1.5000 1.0754 0.8220 0.3768  -0.0633 0.1182  319 PHE B CZ  
2458 N N   . HIS B 103 ? 1.5425 1.0885 0.9203 0.1134  0.0559  0.1766  320 HIS B N   
2459 C CA  . HIS B 103 ? 1.5957 1.1245 0.9855 0.0544  0.0935  0.1936  320 HIS B CA  
2460 C C   . HIS B 103 ? 1.5173 1.1893 1.0232 0.0295  0.1064  0.1797  320 HIS B C   
2461 O O   . HIS B 103 ? 1.4365 1.1886 0.9632 0.0688  0.0952  0.1678  320 HIS B O   
2462 C CB  . HIS B 103 ? 1.7364 1.1808 1.0084 0.0830  0.1200  0.2240  320 HIS B CB  
2463 C CG  . HIS B 103 ? 1.8807 1.2712 1.1372 0.0224  0.1677  0.2508  320 HIS B CG  
2464 N ND1 . HIS B 103 ? 1.8499 1.3362 1.1690 0.0000  0.2024  0.2563  320 HIS B ND1 
2465 C CD2 . HIS B 103 ? 2.0600 1.3088 1.2428 -0.0202 0.1885  0.2746  320 HIS B CD2 
2466 C CE1 . HIS B 103 ? 1.9578 1.3744 1.2502 -0.0549 0.2481  0.2857  320 HIS B CE1 
2467 N NE2 . HIS B 103 ? 2.0925 1.3621 1.3045 -0.0748 0.2414  0.2980  320 HIS B NE2 
2468 N N   . PRO B 104 ? 1.4537 1.1617 1.0345 -0.0338 0.1291  0.1803  321 PRO B N   
2469 C CA  . PRO B 104 ? 1.3396 1.1811 1.0177 -0.0432 0.1419  0.1668  321 PRO B CA  
2470 C C   . PRO B 104 ? 1.3835 1.2635 1.0257 -0.0036 0.1618  0.1750  321 PRO B C   
2471 O O   . PRO B 104 ? 1.2861 1.2580 0.9830 0.0113  0.1553  0.1557  321 PRO B O   
2472 C CB  . PRO B 104 ? 1.3913 1.2567 1.1380 -0.1130 0.1712  0.1753  321 PRO B CB  
2473 C CG  . PRO B 104 ? 1.5263 1.2905 1.2484 -0.1478 0.1486  0.1747  321 PRO B CG  
2474 C CD  . PRO B 104 ? 1.5616 1.1974 1.1473 -0.1002 0.1410  0.1911  321 PRO B CD  
2475 N N   . ASP B 105 ? 1.4532 1.2498 0.9891 0.0190  0.1813  0.2015  322 ASP B N   
2476 C CA  . ASP B 105 ? 1.4728 1.2895 0.9539 0.0642  0.1916  0.2065  322 ASP B CA  
2477 C C   . ASP B 105 ? 1.4671 1.3243 0.9454 0.1151  0.1437  0.1814  322 ASP B C   
2478 O O   . ASP B 105 ? 1.4294 1.3464 0.9160 0.1374  0.1365  0.1676  322 ASP B O   
2479 C CB  . ASP B 105 ? 1.6492 1.3554 1.0040 0.0807  0.2238  0.2418  322 ASP B CB  
2480 C CG  . ASP B 105 ? 1.8637 1.5432 1.2181 0.0292  0.2858  0.2731  322 ASP B CG  
2481 O OD1 . ASP B 105 ? 1.8245 1.5774 1.2913 -0.0269 0.2999  0.2666  322 ASP B OD1 
2482 O OD2 . ASP B 105 ? 2.0176 1.6062 1.2594 0.0461  0.3213  0.3052  322 ASP B OD2 
2483 N N   . VAL B 106 ? 1.4110 1.2369 0.8792 0.1312  0.1119  0.1752  323 VAL B N   
2484 C CA  . VAL B 106 ? 1.3388 1.2183 0.8223 0.1725  0.0715  0.1550  323 VAL B CA  
2485 C C   . VAL B 106 ? 1.2717 1.2458 0.8587 0.1500  0.0599  0.1288  323 VAL B C   
2486 O O   . VAL B 106 ? 1.2193 1.2541 0.8269 0.1682  0.0399  0.1126  323 VAL B O   
2487 C CB  . VAL B 106 ? 1.4188 1.2411 0.8618 0.2002  0.0503  0.1594  323 VAL B CB  
2488 C CG1 . VAL B 106 ? 1.3453 1.2464 0.8228 0.2395  0.0165  0.1421  323 VAL B CG1 
2489 C CG2 . VAL B 106 ? 1.5580 1.2677 0.8764 0.2311  0.0613  0.1855  323 VAL B CG2 
2490 N N   . ALA B 107 ? 1.2009 1.1818 0.8472 0.1096  0.0714  0.1241  324 ALA B N   
2491 C CA  . ALA B 107 ? 1.1100 1.1645 0.8382 0.0949  0.0629  0.1006  324 ALA B CA  
2492 C C   . ALA B 107 ? 1.1187 1.2226 0.8565 0.0959  0.0781  0.0943  324 ALA B C   
2493 O O   . ALA B 107 ? 1.0568 1.2051 0.8247 0.1035  0.0627  0.0741  324 ALA B O   
2494 C CB  . ALA B 107 ? 1.1106 1.1616 0.8915 0.0588  0.0667  0.0958  324 ALA B CB  
2495 N N   . LYS B 108 ? 1.1156 1.2002 0.8154 0.0910  0.1105  0.1130  325 LYS B N   
2496 C CA  . LYS B 108 ? 1.1153 1.2354 0.8031 0.1038  0.1277  0.1084  325 LYS B CA  
2497 C C   . LYS B 108 ? 1.1986 1.3142 0.8331 0.1401  0.0977  0.0956  325 LYS B C   
2498 O O   . LYS B 108 ? 1.1790 1.3245 0.8193 0.1495  0.0872  0.0754  325 LYS B O   
2499 C CB  . LYS B 108 ? 1.2101 1.3098 0.8641 0.0937  0.1767  0.1361  325 LYS B CB  
2500 C CG  . LYS B 108 ? 1.4803 1.5995 1.0897 0.1232  0.1985  0.1357  325 LYS B CG  
2501 C CD  . LYS B 108 ? 1.6807 1.7275 1.1719 0.1575  0.2074  0.1556  325 LYS B CD  
2502 C CE  . LYS B 108 ? 1.5596 1.6074 0.9822 0.1965  0.2244  0.1535  325 LYS B CE  
2503 N NZ  . LYS B 108 ? 1.4853 1.5647 0.9263 0.1844  0.2880  0.1760  325 LYS B NZ  
2504 N N   . GLN B 109 ? 1.2044 1.2819 0.7865 0.1613  0.0795  0.1047  326 GLN B N   
2505 C CA  . GLN B 109 ? 1.2208 1.3122 0.7679 0.1924  0.0427  0.0899  326 GLN B CA  
2506 C C   . GLN B 109 ? 1.2163 1.3626 0.8350 0.1792  0.0113  0.0656  326 GLN B C   
2507 O O   . GLN B 109 ? 1.2350 1.4051 0.8527 0.1811  -0.0107 0.0451  326 GLN B O   
2508 C CB  . GLN B 109 ? 1.2998 1.3536 0.7835 0.2256  0.0281  0.1045  326 GLN B CB  
2509 C CG  . GLN B 109 ? 1.5433 1.5409 0.9190 0.2605  0.0404  0.1197  326 GLN B CG  
2510 C CD  . GLN B 109 ? 1.7189 1.7333 1.0637 0.2740  0.0326  0.1025  326 GLN B CD  
2511 O OE1 . GLN B 109 ? 1.6890 1.6790 1.0031 0.2704  0.0714  0.1132  326 GLN B OE1 
2512 N NE2 . GLN B 109 ? 1.5747 1.6329 0.9288 0.2882  -0.0174 0.0750  326 GLN B NE2 
2513 N N   . LEU B 110 ? 1.0987 1.2533 0.7698 0.1649  0.0104  0.0685  327 LEU B N   
2514 C CA  . LEU B 110 ? 1.0105 1.2075 0.7426 0.1536  -0.0090 0.0521  327 LEU B CA  
2515 C C   . LEU B 110 ? 1.0257 1.2363 0.7833 0.1350  -0.0056 0.0334  327 LEU B C   
2516 O O   . LEU B 110 ? 0.9966 1.2278 0.7686 0.1279  -0.0255 0.0174  327 LEU B O   
2517 C CB  . LEU B 110 ? 0.9818 1.1660 0.7426 0.1506  -0.0044 0.0605  327 LEU B CB  
2518 C CG  . LEU B 110 ? 1.0790 1.2465 0.8071 0.1803  -0.0143 0.0753  327 LEU B CG  
2519 C CD1 . LEU B 110 ? 1.0864 1.2070 0.8139 0.1796  -0.0072 0.0834  327 LEU B CD1 
2520 C CD2 . LEU B 110 ? 1.0816 1.3155 0.8362 0.1980  -0.0383 0.0682  327 LEU B CD2 
2521 N N   . SER B 111 ? 1.0116 1.2101 0.7702 0.1281  0.0202  0.0359  328 SER B N   
2522 C CA  . SER B 111 ? 1.0090 1.2168 0.7772 0.1251  0.0268  0.0192  328 SER B CA  
2523 C C   . SER B 111 ? 1.1354 1.3291 0.8475 0.1387  0.0146  0.0062  328 SER B C   
2524 O O   . SER B 111 ? 1.1371 1.3206 0.8431 0.1361  0.0007  -0.0137 328 SER B O   
2525 C CB  . SER B 111 ? 1.0599 1.2799 0.8458 0.1214  0.0590  0.0278  328 SER B CB  
2526 O OG  . SER B 111 ? 1.1681 1.3940 1.0031 0.1036  0.0613  0.0343  328 SER B OG  
2527 N N   . ASN B 112 ? 1.1515 1.3297 0.8088 0.1554  0.0172  0.0168  329 ASN B N   
2528 C CA  . ASN B 112 ? 1.2190 1.3734 0.8064 0.1749  -0.0005 0.0029  329 ASN B CA  
2529 C C   . ASN B 112 ? 1.2786 1.4441 0.8747 0.1635  -0.0475 -0.0159 329 ASN B C   
2530 O O   . ASN B 112 ? 1.3301 1.4732 0.8914 0.1613  -0.0729 -0.0392 329 ASN B O   
2531 C CB  . ASN B 112 ? 1.3045 1.4333 0.8220 0.2022  0.0172  0.0221  329 ASN B CB  
2532 C CG  . ASN B 112 ? 1.7227 1.8391 1.2063 0.2176  0.0636  0.0344  329 ASN B CG  
2533 O OD1 . ASN B 112 ? 1.6414 1.7731 1.1449 0.2176  0.0769  0.0232  329 ASN B OD1 
2534 N ND2 . ASN B 112 ? 1.7236 1.8125 1.1490 0.2361  0.0922  0.0595  329 ASN B ND2 
2535 N N   . LEU B 113 ? 1.1814 1.3822 0.8252 0.1553  -0.0587 -0.0059 330 LEU B N   
2536 C CA  . LEU B 113 ? 1.1529 1.3949 0.8309 0.1416  -0.0972 -0.0186 330 LEU B CA  
2537 C C   . LEU B 113 ? 1.1578 1.4032 0.8827 0.1065  -0.1007 -0.0326 330 LEU B C   
2538 O O   . LEU B 113 ? 1.1693 1.4238 0.9005 0.0833  -0.1314 -0.0513 330 LEU B O   
2539 C CB  . LEU B 113 ? 1.1153 1.3976 0.8264 0.1551  -0.0978 0.0004  330 LEU B CB  
2540 C CG  . LEU B 113 ? 1.1753 1.5242 0.9125 0.1612  -0.1368 -0.0071 330 LEU B CG  
2541 C CD1 . LEU B 113 ? 1.2411 1.5881 0.9287 0.1691  -0.1750 -0.0286 330 LEU B CD1 
2542 C CD2 . LEU B 113 ? 1.2231 1.5869 0.9480 0.2006  -0.1328 0.0141  330 LEU B CD2 
2543 N N   . ALA B 114 ? 1.0777 1.3082 0.8282 0.1018  -0.0707 -0.0245 331 ALA B N   
2544 C CA  . ALA B 114 ? 1.0534 1.2672 0.8283 0.0793  -0.0671 -0.0343 331 ALA B CA  
2545 C C   . ALA B 114 ? 1.1790 1.3365 0.8962 0.0749  -0.0775 -0.0566 331 ALA B C   
2546 O O   . ALA B 114 ? 1.2115 1.3442 0.9283 0.0467  -0.0928 -0.0697 331 ALA B O   
2547 C CB  . ALA B 114 ? 1.0143 1.2201 0.8111 0.0893  -0.0387 -0.0241 331 ALA B CB  
2548 N N   . LEU B 115 ? 1.1685 1.2989 0.8289 0.1037  -0.0670 -0.0594 332 LEU B N   
2549 C CA  . LEU B 115 ? 1.2410 1.3073 0.8232 0.1163  -0.0753 -0.0807 332 LEU B CA  
2550 C C   . LEU B 115 ? 1.3283 1.3657 0.8703 0.0963  -0.1199 -0.1020 332 LEU B C   
2551 O O   . LEU B 115 ? 1.3741 1.3426 0.8671 0.0828  -0.1372 -0.1235 332 LEU B O   
2552 C CB  . LEU B 115 ? 1.2713 1.3318 0.8033 0.1584  -0.0487 -0.0736 332 LEU B CB  
2553 C CG  . LEU B 115 ? 1.2928 1.3707 0.8475 0.1785  -0.0100 -0.0652 332 LEU B CG  
2554 C CD1 . LEU B 115 ? 1.3417 1.4365 0.8633 0.2123  0.0228  -0.0518 332 LEU B CD1 
2555 C CD2 . LEU B 115 ? 1.3308 1.3559 0.8459 0.1905  -0.0146 -0.0861 332 LEU B CD2 
2556 N N   . LEU B 116 ? 1.2641 1.3487 0.8211 0.0957  -0.1419 -0.0977 333 LEU B N   
2557 C CA  . LEU B 116 ? 1.3231 1.4042 0.8587 0.0755  -0.1935 -0.1207 333 LEU B CA  
2558 C C   . LEU B 116 ? 1.3572 1.4573 0.9594 0.0168  -0.2134 -0.1296 333 LEU B C   
2559 O O   . LEU B 116 ? 1.4327 1.4881 1.0025 -0.0156 -0.2514 -0.1558 333 LEU B O   
2560 C CB  . LEU B 116 ? 1.3194 1.4625 0.8647 0.0973  -0.2121 -0.1123 333 LEU B CB  
2561 C CG  . LEU B 116 ? 1.4482 1.5512 0.8967 0.1518  -0.2042 -0.1082 333 LEU B CG  
2562 C CD1 . LEU B 116 ? 1.4461 1.6014 0.9005 0.1784  -0.2162 -0.0940 333 LEU B CD1 
2563 C CD2 . LEU B 116 ? 1.5871 1.6119 0.9306 0.1642  -0.2401 -0.1401 333 LEU B CD2 
2564 N N   . CYS B 117 ? 1.2275 1.3853 0.9156 0.0021  -0.1859 -0.1072 334 CYS B N   
2565 C CA  . CYS B 117 ? 1.2071 1.3903 0.9633 -0.0499 -0.1880 -0.1057 334 CYS B CA  
2566 C C   . CYS B 117 ? 1.3055 1.3840 1.0101 -0.0709 -0.1763 -0.1164 334 CYS B C   
2567 O O   . CYS B 117 ? 1.3516 1.3988 1.0594 -0.1236 -0.1954 -0.1289 334 CYS B O   
2568 C CB  . CYS B 117 ? 1.1124 1.3723 0.9492 -0.0411 -0.1566 -0.0769 334 CYS B CB  
2569 S SG  . CYS B 117 ? 1.1179 1.4954 1.0100 -0.0168 -0.1752 -0.0649 334 CYS B SG  
2570 N N   . GLN B 118 ? 1.2565 1.2809 0.9116 -0.0293 -0.1455 -0.1115 335 GLN B N   
2571 C CA  . GLN B 118 ? 1.3143 1.2344 0.9010 -0.0246 -0.1319 -0.1214 335 GLN B CA  
2572 C C   . GLN B 118 ? 1.5015 1.3232 0.9934 -0.0387 -0.1669 -0.1509 335 GLN B C   
2573 O O   . GLN B 118 ? 1.5894 1.3159 1.0329 -0.0678 -0.1715 -0.1617 335 GLN B O   
2574 C CB  . GLN B 118 ? 1.2919 1.2089 0.8535 0.0344  -0.1007 -0.1140 335 GLN B CB  
2575 C CG  . GLN B 118 ? 1.5257 1.3675 1.0392 0.0554  -0.0808 -0.1184 335 GLN B CG  
2576 C CD  . GLN B 118 ? 1.7149 1.5901 1.2282 0.1111  -0.0553 -0.1130 335 GLN B CD  
2577 O OE1 . GLN B 118 ? 1.7535 1.6023 1.2037 0.1491  -0.0527 -0.1240 335 GLN B OE1 
2578 N NE2 . GLN B 118 ? 1.4813 1.4206 1.0672 0.1167  -0.0361 -0.0962 335 GLN B NE2 
2579 N N   . ASN B 119 ? 1.4939 1.3261 0.9477 -0.0172 -0.1930 -0.1639 336 ASN B N   
2580 C CA  . ASN B 119 ? 1.6294 1.3639 0.9776 -0.0202 -0.2341 -0.1958 336 ASN B CA  
2581 C C   . ASN B 119 ? 1.7375 1.4868 1.1222 -0.0908 -0.2856 -0.2136 336 ASN B C   
2582 O O   . ASN B 119 ? 1.8643 1.5413 1.1684 -0.1001 -0.3329 -0.2444 336 ASN B O   
2583 C CB  . ASN B 119 ? 1.6408 1.3738 0.9182 0.0444  -0.2350 -0.2002 336 ASN B CB  
2584 C CG  . ASN B 119 ? 1.8404 1.5620 1.0822 0.1076  -0.1848 -0.1857 336 ASN B CG  
2585 O OD1 . ASN B 119 ? 1.8153 1.5209 1.0728 0.1121  -0.1556 -0.1777 336 ASN B OD1 
2586 N ND2 . ASN B 119 ? 1.6674 1.4031 0.8614 0.1599  -0.1729 -0.1813 336 ASN B ND2 
2587 N N   . GLN B 120 ? 1.6017 1.4474 1.1080 -0.1395 -0.2768 -0.1951 337 GLN B N   
2588 C CA  . GLN B 120 ? 1.6213 1.5205 1.2012 -0.2149 -0.3157 -0.2055 337 GLN B CA  
2589 C C   . GLN B 120 ? 1.6691 1.5601 1.3067 -0.2693 -0.2808 -0.1859 337 GLN B C   
2590 O O   . GLN B 120 ? 1.7059 1.6382 1.4140 -0.3442 -0.2992 -0.1885 337 GLN B O   
2591 C CB  . GLN B 120 ? 1.5361 1.5974 1.2195 -0.2051 -0.3305 -0.1948 337 GLN B CB  
2592 C CG  . GLN B 120 ? 1.5329 1.6005 1.1553 -0.1591 -0.3725 -0.2151 337 GLN B CG  
2593 C CD  . GLN B 120 ? 1.5953 1.8148 1.3118 -0.1460 -0.3887 -0.2043 337 GLN B CD  
2594 O OE1 . GLN B 120 ? 1.6377 1.9341 1.4133 -0.1860 -0.4393 -0.2227 337 GLN B OE1 
2595 N NE2 . GLN B 120 ? 1.2667 1.5335 0.9994 -0.0898 -0.3479 -0.1748 337 GLN B NE2 
2596 N N   . GLY B 121 ? 1.5813 1.4232 1.1883 -0.2296 -0.2303 -0.1660 338 GLY B N   
2597 C CA  . GLY B 121 ? 1.5828 1.3953 1.2152 -0.2597 -0.1899 -0.1446 338 GLY B CA  
2598 C C   . GLY B 121 ? 1.5528 1.5087 1.3195 -0.2828 -0.1662 -0.1152 338 GLY B C   
2599 O O   . GLY B 121 ? 1.5964 1.5502 1.4041 -0.3392 -0.1469 -0.1012 338 GLY B O   
2600 N N   . LYS B 122 ? 1.3973 1.4705 1.2239 -0.2364 -0.1638 -0.1038 339 LYS B N   
2601 C CA  . LYS B 122 ? 1.3009 1.5112 1.2411 -0.2392 -0.1433 -0.0769 339 LYS B CA  
2602 C C   . LYS B 122 ? 1.2810 1.4806 1.2145 -0.1864 -0.0957 -0.0520 339 LYS B C   
2603 O O   . LYS B 122 ? 1.1762 1.4441 1.1380 -0.1391 -0.0893 -0.0404 339 LYS B O   
2604 C CB  . LYS B 122 ? 1.2785 1.6086 1.2709 -0.2174 -0.1777 -0.0826 339 LYS B CB  
2605 C CG  . LYS B 122 ? 1.4154 1.7611 1.4095 -0.2609 -0.2362 -0.1133 339 LYS B CG  
2606 C CD  . LYS B 122 ? 1.4972 1.9116 1.4863 -0.2100 -0.2710 -0.1230 339 LYS B CD  
2607 C CE  . LYS B 122 ? 1.6164 2.1868 1.7123 -0.2306 -0.3042 -0.1249 339 LYS B CE  
2608 N NZ  . LYS B 122 ? 1.7215 2.3447 1.7933 -0.1646 -0.3329 -0.1304 339 LYS B NZ  
2609 N N   . ALA B 123 ? 1.3033 1.4033 1.1871 -0.1941 -0.0661 -0.0458 340 ALA B N   
2610 C CA  . ALA B 123 ? 1.2649 1.3309 1.1243 -0.1458 -0.0281 -0.0286 340 ALA B CA  
2611 C C   . ALA B 123 ? 1.2179 1.3869 1.1486 -0.1145 -0.0080 -0.0044 340 ALA B C   
2612 O O   . ALA B 123 ? 1.1696 1.3329 1.0811 -0.0623 -0.0012 -0.0021 340 ALA B O   
2613 C CB  . ALA B 123 ? 1.3617 1.3209 1.1677 -0.1691 -0.0006 -0.0213 340 ALA B CB  
2614 N N   . GLU B 124 ? 1.1514 1.4157 1.1629 -0.1457 0.0000  0.0125  341 GLU B N   
2615 C CA  . GLU B 124 ? 1.0795 1.4405 1.1495 -0.1098 0.0197  0.0362  341 GLU B CA  
2616 C C   . GLU B 124 ? 1.0411 1.4503 1.1142 -0.0622 -0.0049 0.0296  341 GLU B C   
2617 O O   . GLU B 124 ? 0.9806 1.3949 1.0448 -0.0131 0.0092  0.0420  341 GLU B O   
2618 C CB  . GLU B 124 ? 1.1089 1.5854 1.2736 -0.1522 0.0304  0.0533  341 GLU B CB  
2619 C CG  . GLU B 124 ? 1.3764 1.8106 1.5444 -0.2054 0.0671  0.0694  341 GLU B CG  
2620 C CD  . GLU B 124 ? 1.8269 2.1794 1.9662 -0.2794 0.0489  0.0505  341 GLU B CD  
2621 O OE1 . GLU B 124 ? 1.8656 2.2019 1.9850 -0.2911 0.0014  0.0208  341 GLU B OE1 
2622 O OE2 . GLU B 124 ? 1.7817 2.0731 1.9057 -0.3240 0.0837  0.0664  341 GLU B OE2 
2623 N N   . GLU B 125 ? 1.0015 1.4312 1.0744 -0.0768 -0.0423 0.0098  342 GLU B N   
2624 C CA  . GLU B 125 ? 0.9618 1.4200 1.0206 -0.0350 -0.0637 0.0050  342 GLU B CA  
2625 C C   . GLU B 125 ? 0.9652 1.3343 0.9540 -0.0029 -0.0561 -0.0010 342 GLU B C   
2626 O O   . GLU B 125 ? 0.9249 1.3000 0.9044 0.0362  -0.0494 0.0090  342 GLU B O   
2627 C CB  . GLU B 125 ? 1.0186 1.5198 1.0873 -0.0565 -0.1063 -0.0147 342 GLU B CB  
2628 C CG  . GLU B 125 ? 1.1649 1.7994 1.3218 -0.0699 -0.1212 -0.0082 342 GLU B CG  
2629 C CD  . GLU B 125 ? 1.4258 2.1044 1.6017 -0.1058 -0.1716 -0.0339 342 GLU B CD  
2630 O OE1 . GLU B 125 ? 1.1881 1.8654 1.3206 -0.0708 -0.2035 -0.0473 342 GLU B OE1 
2631 O OE2 . GLU B 125 ? 1.4327 2.1421 1.6626 -0.1705 -0.1798 -0.0407 342 GLU B OE2 
2632 N N   . VAL B 126 ? 0.9402 1.2265 0.8791 -0.0195 -0.0566 -0.0170 343 VAL B N   
2633 C CA  . VAL B 126 ? 0.9275 1.1461 0.8106 0.0100  -0.0474 -0.0243 343 VAL B CA  
2634 C C   . VAL B 126 ? 0.9471 1.1666 0.8436 0.0398  -0.0244 -0.0093 343 VAL B C   
2635 O O   . VAL B 126 ? 0.9199 1.1430 0.8102 0.0660  -0.0221 -0.0064 343 VAL B O   
2636 C CB  . VAL B 126 ? 1.0361 1.1673 0.8637 -0.0051 -0.0463 -0.0406 343 VAL B CB  
2637 C CG1 . VAL B 126 ? 1.0360 1.1208 0.8179 0.0340  -0.0350 -0.0478 343 VAL B CG1 
2638 C CG2 . VAL B 126 ? 1.1023 1.2103 0.9001 -0.0356 -0.0754 -0.0598 343 VAL B CG2 
2639 N N   . GLU B 127 ? 0.9064 1.1164 0.8163 0.0330  -0.0076 0.0005  344 GLU B N   
2640 C CA  . GLU B 127 ? 0.8977 1.0957 0.8075 0.0628  0.0107  0.0127  344 GLU B CA  
2641 C C   . GLU B 127 ? 0.9451 1.1950 0.8808 0.0877  0.0076  0.0256  344 GLU B C   
2642 O O   . GLU B 127 ? 0.9312 1.1558 0.8498 0.1140  0.0071  0.0250  344 GLU B O   
2643 C CB  . GLU B 127 ? 0.9539 1.1387 0.8680 0.0472  0.0326  0.0253  344 GLU B CB  
2644 C CG  . GLU B 127 ? 1.0727 1.2286 0.9668 0.0838  0.0534  0.0379  344 GLU B CG  
2645 C CD  . GLU B 127 ? 1.2961 1.4152 1.1727 0.0684  0.0828  0.0519  344 GLU B CD  
2646 O OE1 . GLU B 127 ? 1.1120 1.1712 0.9557 0.0385  0.0847  0.0434  344 GLU B OE1 
2647 O OE2 . GLU B 127 ? 1.3564 1.4942 1.2397 0.0898  0.1068  0.0727  344 GLU B OE2 
2648 N N   . TYR B 128 ? 0.9315 1.2513 0.9044 0.0800  0.0015  0.0350  345 TYR B N   
2649 C CA  . TYR B 128 ? 0.9324 1.2918 0.9128 0.1134  -0.0025 0.0477  345 TYR B CA  
2650 C C   . TYR B 128 ? 1.0066 1.3345 0.9532 0.1267  -0.0153 0.0417  345 TYR B C   
2651 O O   . TYR B 128 ? 1.0219 1.3213 0.9450 0.1545  -0.0127 0.0497  345 TYR B O   
2652 C CB  . TYR B 128 ? 0.9669 1.4219 0.9958 0.1087  -0.0104 0.0560  345 TYR B CB  
2653 C CG  . TYR B 128 ? 1.0425 1.5295 1.0602 0.1546  -0.0192 0.0667  345 TYR B CG  
2654 C CD1 . TYR B 128 ? 1.0819 1.5655 1.0855 0.1985  -0.0033 0.0834  345 TYR B CD1 
2655 C CD2 . TYR B 128 ? 1.0809 1.5853 1.0829 0.1621  -0.0436 0.0602  345 TYR B CD2 
2656 C CE1 . TYR B 128 ? 1.1244 1.6156 1.0965 0.2479  -0.0122 0.0929  345 TYR B CE1 
2657 C CE2 . TYR B 128 ? 1.1228 1.6363 1.0937 0.2112  -0.0510 0.0713  345 TYR B CE2 
2658 C CZ  . TYR B 128 ? 1.2628 1.7688 1.2189 0.2537  -0.0355 0.0875  345 TYR B CZ  
2659 O OH  . TYR B 128 ? 1.3748 1.8700 1.2809 0.3089  -0.0434 0.0981  345 TYR B OH  
2660 N N   . TYR B 129 ? 0.9498 1.2749 0.8858 0.1067  -0.0280 0.0288  346 TYR B N   
2661 C CA  . TYR B 129 ? 0.9434 1.2405 0.8439 0.1177  -0.0313 0.0276  346 TYR B CA  
2662 C C   . TYR B 129 ? 0.9356 1.1838 0.8232 0.1188  -0.0176 0.0245  346 TYR B C   
2663 O O   . TYR B 129 ? 0.9178 1.1439 0.7904 0.1292  -0.0131 0.0333  346 TYR B O   
2664 C CB  . TYR B 129 ? 0.9965 1.3013 0.8769 0.1058  -0.0464 0.0157  346 TYR B CB  
2665 C CG  . TYR B 129 ? 1.0659 1.4295 0.9600 0.1095  -0.0699 0.0160  346 TYR B CG  
2666 C CD1 . TYR B 129 ? 1.1108 1.4986 0.9950 0.1434  -0.0747 0.0304  346 TYR B CD1 
2667 C CD2 . TYR B 129 ? 1.0959 1.4873 1.0070 0.0808  -0.0918 -0.0006 346 TYR B CD2 
2668 C CE1 . TYR B 129 ? 1.1514 1.6094 1.0519 0.1561  -0.1010 0.0282  346 TYR B CE1 
2669 C CE2 . TYR B 129 ? 1.1228 1.5868 1.0598 0.0816  -0.1210 -0.0045 346 TYR B CE2 
2670 C CZ  . TYR B 129 ? 1.2251 1.7310 1.1600 0.1233  -0.1260 0.0096  346 TYR B CZ  
2671 O OH  . TYR B 129 ? 1.2520 1.8442 1.2154 0.1332  -0.1593 0.0033  346 TYR B OH  
2672 N N   . TYR B 130 ? 0.8691 1.0990 0.7612 0.1083  -0.0129 0.0116  347 TYR B N   
2673 C CA  . TYR B 130 ? 0.8577 1.0622 0.7486 0.1142  -0.0056 0.0044  347 TYR B CA  
2674 C C   . TYR B 130 ? 0.9138 1.1015 0.8119 0.1279  -0.0067 0.0105  347 TYR B C   
2675 O O   . TYR B 130 ? 0.9288 1.1052 0.8322 0.1271  -0.0078 0.0082  347 TYR B O   
2676 C CB  . TYR B 130 ? 0.8832 1.0668 0.7624 0.1137  -0.0037 -0.0121 347 TYR B CB  
2677 C CG  . TYR B 130 ? 0.9317 1.1127 0.7861 0.1109  -0.0028 -0.0226 347 TYR B CG  
2678 C CD1 . TYR B 130 ? 0.9505 1.1518 0.8044 0.1146  0.0053  -0.0183 347 TYR B CD1 
2679 C CD2 . TYR B 130 ? 0.9852 1.1311 0.8049 0.1070  -0.0071 -0.0358 347 TYR B CD2 
2680 C CE1 . TYR B 130 ? 0.9689 1.1648 0.7879 0.1223  0.0105  -0.0264 347 TYR B CE1 
2681 C CE2 . TYR B 130 ? 1.0342 1.1624 0.8121 0.1139  -0.0084 -0.0477 347 TYR B CE2 
2682 C CZ  . TYR B 130 ? 1.0945 1.2525 0.8722 0.1256  0.0011  -0.0427 347 TYR B CZ  
2683 O OH  . TYR B 130 ? 1.1950 1.3337 0.9207 0.1419  0.0040  -0.0526 347 TYR B OH  
2684 N N   . ARG B 131 ? 0.8550 1.0413 0.7520 0.1396  -0.0063 0.0183  348 ARG B N   
2685 C CA  . ARG B 131 ? 0.8631 1.0201 0.7468 0.1631  -0.0091 0.0235  348 ARG B CA  
2686 C C   . ARG B 131 ? 0.9180 1.0606 0.7852 0.1696  -0.0152 0.0341  348 ARG B C   
2687 O O   . ARG B 131 ? 0.9412 1.0397 0.7921 0.1733  -0.0240 0.0304  348 ARG B O   
2688 C CB  . ARG B 131 ? 0.8820 1.0469 0.7618 0.1807  0.0014  0.0345  348 ARG B CB  
2689 C CG  . ARG B 131 ? 1.0319 1.1717 0.9023 0.1807  0.0106  0.0269  348 ARG B CG  
2690 C CD  . ARG B 131 ? 1.1692 1.3222 1.0390 0.1903  0.0318  0.0444  348 ARG B CD  
2691 N NE  . ARG B 131 ? 1.2218 1.3244 1.0603 0.1955  0.0448  0.0406  348 ARG B NE  
2692 C CZ  . ARG B 131 ? 1.3518 1.4483 1.1793 0.1998  0.0723  0.0577  348 ARG B CZ  
2693 N NH1 . ARG B 131 ? 1.2258 1.3860 1.0883 0.1980  0.0899  0.0792  348 ARG B NH1 
2694 N NH2 . ARG B 131 ? 1.3268 1.3555 1.1057 0.2097  0.0849  0.0550  348 ARG B NH2 
2695 N N   . ARG B 132 ? 0.8667 1.0388 0.7312 0.1698  -0.0136 0.0452  349 ARG B N   
2696 C CA  . ARG B 132 ? 0.9094 1.0534 0.7382 0.1826  -0.0172 0.0576  349 ARG B CA  
2697 C C   . ARG B 132 ? 0.9619 1.0727 0.7832 0.1561  -0.0133 0.0553  349 ARG B C   
2698 O O   . ARG B 132 ? 1.0278 1.0807 0.8148 0.1561  -0.0147 0.0631  349 ARG B O   
2699 C CB  . ARG B 132 ? 0.9262 1.1177 0.7508 0.1970  -0.0202 0.0671  349 ARG B CB  
2700 C CG  . ARG B 132 ? 0.9728 1.1879 0.7892 0.2373  -0.0224 0.0788  349 ARG B CG  
2701 C CD  . ARG B 132 ? 1.1575 1.4106 0.9564 0.2622  -0.0322 0.0876  349 ARG B CD  
2702 N NE  . ARG B 132 ? 1.3385 1.5116 1.0631 0.2807  -0.0343 0.0970  349 ARG B NE  
2703 C CZ  . ARG B 132 ? 1.4918 1.6683 1.1746 0.3068  -0.0430 0.1045  349 ARG B CZ  
2704 N NH1 . ARG B 132 ? 1.2742 1.5452 0.9933 0.3169  -0.0575 0.0994  349 ARG B NH1 
2705 N NH2 . ARG B 132 ? 1.3716 1.4519 0.9715 0.3217  -0.0391 0.1166  349 ARG B NH2 
2706 N N   . ALA B 133 ? 0.8595 1.0037 0.7092 0.1335  -0.0061 0.0456  350 ALA B N   
2707 C CA  . ALA B 133 ? 0.8578 0.9967 0.7148 0.1095  0.0062  0.0452  350 ALA B CA  
2708 C C   . ALA B 133 ? 0.8847 1.0084 0.7700 0.0948  0.0007  0.0351  350 ALA B C   
2709 O O   . ALA B 133 ? 0.9019 1.0006 0.7874 0.0718  0.0064  0.0419  350 ALA B O   
2710 C CB  . ALA B 133 ? 0.8392 1.0200 0.7113 0.1037  0.0146  0.0351  350 ALA B CB  
2711 N N   . LEU B 134 ? 0.8166 0.9514 0.7218 0.1070  -0.0118 0.0185  351 LEU B N   
2712 C CA  . LEU B 134 ? 0.8180 0.9441 0.7467 0.1027  -0.0273 0.0022  351 LEU B CA  
2713 C C   . LEU B 134 ? 0.8868 0.9476 0.7848 0.1024  -0.0433 0.0065  351 LEU B C   
2714 O O   . LEU B 134 ? 0.9083 0.9566 0.8272 0.0762  -0.0548 -0.0017 351 LEU B O   
2715 C CB  . LEU B 134 ? 0.8027 0.9337 0.7303 0.1295  -0.0367 -0.0134 351 LEU B CB  
2716 C CG  . LEU B 134 ? 0.8515 1.0091 0.8102 0.1342  -0.0492 -0.0369 351 LEU B CG  
2717 C CD1 . LEU B 134 ? 0.8574 0.9758 0.7844 0.1680  -0.0662 -0.0487 351 LEU B CD1 
2718 C CD2 . LEU B 134 ? 0.8854 1.0707 0.8919 0.1051  -0.0593 -0.0449 351 LEU B CD2 
2719 N N   . GLU B 135 ? 0.8566 0.8775 0.7043 0.1310  -0.0445 0.0193  352 GLU B N   
2720 C CA  . GLU B 135 ? 0.9233 0.8628 0.7144 0.1453  -0.0590 0.0250  352 GLU B CA  
2721 C C   . GLU B 135 ? 1.0370 0.9320 0.8173 0.1059  -0.0566 0.0332  352 GLU B C   
2722 O O   . GLU B 135 ? 1.0618 0.8996 0.8322 0.0853  -0.0768 0.0230  352 GLU B O   
2723 C CB  . GLU B 135 ? 0.9472 0.8785 0.6914 0.1886  -0.0510 0.0427  352 GLU B CB  
2724 C CG  . GLU B 135 ? 1.1473 0.9918 0.8169 0.2262  -0.0658 0.0463  352 GLU B CG  
2725 C CD  . GLU B 135 ? 1.5071 1.3739 1.1459 0.2810  -0.0553 0.0618  352 GLU B CD  
2726 O OE1 . GLU B 135 ? 1.3565 1.2290 0.9693 0.2974  -0.0483 0.0779  352 GLU B OE1 
2727 O OE2 . GLU B 135 ? 1.6553 1.5381 1.2950 0.3108  -0.0526 0.0588  352 GLU B OE2 
2728 N N   . ILE B 136 ? 1.0156 0.9351 0.7971 0.0918  -0.0321 0.0505  353 ILE B N   
2729 C CA  . ILE B 136 ? 1.0940 0.9694 0.8584 0.0532  -0.0175 0.0653  353 ILE B CA  
2730 C C   . ILE B 136 ? 1.1406 1.0563 0.9805 -0.0011 -0.0156 0.0532  353 ILE B C   
2731 O O   . ILE B 136 ? 1.2242 1.0806 1.0589 -0.0356 -0.0296 0.0497  353 ILE B O   
2732 C CB  . ILE B 136 ? 1.1397 1.0269 0.8720 0.0627  0.0095  0.0874  353 ILE B CB  
2733 C CG1 . ILE B 136 ? 1.1670 1.0341 0.8371 0.1193  -0.0001 0.0958  353 ILE B CG1 
2734 C CG2 . ILE B 136 ? 1.2194 1.0404 0.9165 0.0243  0.0321  0.1082  353 ILE B CG2 
2735 C CD1 . ILE B 136 ? 1.2530 1.1447 0.8910 0.1417  0.0129  0.1100  353 ILE B CD1 
2736 N N   . TYR B 137 ? 0.9939 1.0100 0.9018 -0.0067 -0.0011 0.0452  354 TYR B N   
2737 C CA  . TYR B 137 ? 0.9739 1.0597 0.9650 -0.0468 0.0037  0.0338  354 TYR B CA  
2738 C C   . TYR B 137 ? 1.0440 1.1188 1.0697 -0.0640 -0.0354 0.0084  354 TYR B C   
2739 O O   . TYR B 137 ? 1.0848 1.1710 1.1592 -0.1170 -0.0374 0.0064  354 TYR B O   
2740 C CB  . TYR B 137 ? 0.9135 1.0988 0.9513 -0.0250 0.0171  0.0234  354 TYR B CB  
2741 C CG  . TYR B 137 ? 0.9267 1.1299 0.9361 -0.0142 0.0521  0.0429  354 TYR B CG  
2742 C CD1 . TYR B 137 ? 1.0043 1.1986 1.0045 -0.0439 0.0868  0.0677  354 TYR B CD1 
2743 C CD2 . TYR B 137 ? 0.8818 1.1071 0.8699 0.0238  0.0509  0.0353  354 TYR B CD2 
2744 C CE1 . TYR B 137 ? 1.0207 1.2235 0.9800 -0.0251 0.1168  0.0839  354 TYR B CE1 
2745 C CE2 . TYR B 137 ? 0.9038 1.1376 0.8568 0.0359  0.0745  0.0477  354 TYR B CE2 
2746 C CZ  . TYR B 137 ? 1.0810 1.3047 1.0168 0.0164  0.1067  0.0712  354 TYR B CZ  
2747 O OH  . TYR B 137 ? 1.1564 1.3801 1.0426 0.0374  0.1279  0.0818  354 TYR B OH  
2748 N N   . ALA B 138 ? 0.9724 1.0250 0.9717 -0.0204 -0.0664 -0.0106 355 ALA B N   
2749 C CA  . ALA B 138 ? 0.9903 1.0223 1.0021 -0.0205 -0.1102 -0.0388 355 ALA B CA  
2750 C C   . ALA B 138 ? 1.1923 1.1159 1.1569 -0.0505 -0.1342 -0.0382 355 ALA B C   
2751 O O   . ALA B 138 ? 1.2487 1.1750 1.2551 -0.0869 -0.1669 -0.0605 355 ALA B O   
2752 C CB  . ALA B 138 ? 0.9586 0.9740 0.9284 0.0413  -0.1277 -0.0522 355 ALA B CB  
2753 N N   . THR B 139 ? 1.5857 1.0777 1.1642 -0.0056 -0.0201 0.0309  356 THR B N   
2754 C CA  . THR B 139 ? 1.7449 1.0854 1.2376 -0.0028 -0.0426 0.0267  356 THR B CA  
2755 C C   . THR B 139 ? 1.8674 1.1572 1.3702 -0.0421 -0.0447 0.0647  356 THR B C   
2756 O O   . THR B 139 ? 1.9625 1.1573 1.4469 -0.0937 -0.0788 0.0698  356 THR B O   
2757 C CB  . THR B 139 ? 1.9418 1.2331 1.3495 0.0752  -0.0285 0.0108  356 THR B CB  
2758 O OG1 . THR B 139 ? 1.9560 1.3394 1.3960 0.1067  0.0081  0.0313  356 THR B OG1 
2759 C CG2 . THR B 139 ? 1.8870 1.2082 1.2733 0.1127  -0.0335 -0.0195 356 THR B CG2 
2760 N N   . ARG B 140 ? 1.7810 1.1363 1.3132 -0.0188 -0.0104 0.0933  357 ARG B N   
2761 C CA  . ARG B 140 ? 1.8430 1.1691 1.3893 -0.0439 -0.0038 0.1384  357 ARG B CA  
2762 C C   . ARG B 140 ? 1.8996 1.2888 1.5310 -0.1170 -0.0173 0.1735  357 ARG B C   
2763 O O   . ARG B 140 ? 1.9991 1.3157 1.6304 -0.1639 -0.0345 0.2081  357 ARG B O   
2764 C CB  . ARG B 140 ? 1.7759 1.1731 1.3285 0.0109  0.0376  0.1584  357 ARG B CB  
2765 C CG  . ARG B 140 ? 1.9303 1.2542 1.3897 0.0816  0.0513  0.1423  357 ARG B CG  
2766 C CD  . ARG B 140 ? 2.1597 1.3139 1.5353 0.0849  0.0415  0.1597  357 ARG B CD  
2767 N NE  . ARG B 140 ? 2.2353 1.3954 1.5815 0.1393  0.0775  0.1901  357 ARG B NE  
2768 C CZ  . ARG B 140 ? 2.4405 1.6119 1.8230 0.1201  0.0928  0.2382  357 ARG B CZ  
2769 N NH1 . ARG B 140 ? 2.2481 1.4310 1.7013 0.0448  0.0744  0.2661  357 ARG B NH1 
2770 N NH2 . ARG B 140 ? 2.3447 1.5282 1.6947 0.1793  0.1281  0.2646  357 ARG B NH2 
2771 N N   . LEU B 141 ? 1.7519 1.2743 1.4524 -0.1257 -0.0100 0.1688  358 LEU B N   
2772 C CA  . LEU B 141 ? 1.7222 1.3320 1.5015 -0.1825 -0.0187 0.2058  358 LEU B CA  
2773 C C   . LEU B 141 ? 1.8114 1.4272 1.6011 -0.2196 -0.0495 0.1792  358 LEU B C   
2774 O O   . LEU B 141 ? 1.8134 1.3907 1.5585 -0.1902 -0.0560 0.1311  358 LEU B O   
2775 C CB  . LEU B 141 ? 1.6011 1.3625 1.4403 -0.1517 0.0163  0.2257  358 LEU B CB  
2776 C CG  . LEU B 141 ? 1.6388 1.4217 1.4650 -0.0990 0.0491  0.2397  358 LEU B CG  
2777 C CD1 . LEU B 141 ? 1.5343 1.4467 1.3964 -0.0605 0.0737  0.2341  358 LEU B CD1 
2778 C CD2 . LEU B 141 ? 1.7210 1.4867 1.5639 -0.1212 0.0537  0.2997  358 LEU B CD2 
2779 N N   . GLY B 142 ? 1.7820 1.4625 1.6332 -0.2796 -0.0660 0.2163  359 GLY B N   
2780 C CA  . GLY B 142 ? 1.7757 1.4865 1.6463 -0.3200 -0.0955 0.2014  359 GLY B CA  
2781 C C   . GLY B 142 ? 1.7080 1.5000 1.5868 -0.2772 -0.0784 0.1646  359 GLY B C   
2782 O O   . GLY B 142 ? 1.6253 1.4664 1.5067 -0.2224 -0.0437 0.1545  359 GLY B O   
2783 N N   . PRO B 143 ? 1.6521 1.4581 1.5340 -0.3029 -0.1043 0.1446  360 PRO B N   
2784 C CA  . PRO B 143 ? 1.5503 1.4317 1.4413 -0.2610 -0.0852 0.1161  360 PRO B CA  
2785 C C   . PRO B 143 ? 1.4869 1.5146 1.4436 -0.2559 -0.0581 0.1526  360 PRO B C   
2786 O O   . PRO B 143 ? 1.3914 1.4727 1.3524 -0.2103 -0.0318 0.1356  360 PRO B O   
2787 C CB  . PRO B 143 ? 1.6268 1.4742 1.4947 -0.2882 -0.1231 0.0882  360 PRO B CB  
2788 C CG  . PRO B 143 ? 1.7755 1.5945 1.6589 -0.3652 -0.1629 0.1193  360 PRO B CG  
2789 C CD  . PRO B 143 ? 1.7653 1.5234 1.6435 -0.3729 -0.1537 0.1496  360 PRO B CD  
2790 N N   . ASP B 144 ? 1.4626 1.5515 1.4665 -0.3011 -0.0654 0.2072  361 ASP B N   
2791 C CA  . ASP B 144 ? 1.3923 1.6278 1.4527 -0.2934 -0.0417 0.2554  361 ASP B CA  
2792 C C   . ASP B 144 ? 1.3879 1.6582 1.4571 -0.2529 -0.0079 0.2828  361 ASP B C   
2793 O O   . ASP B 144 ? 1.3431 1.7329 1.4483 -0.2348 0.0129  0.3259  361 ASP B O   
2794 C CB  . ASP B 144 ? 1.4527 1.7636 1.5644 -0.3635 -0.0702 0.3082  361 ASP B CB  
2795 C CG  . ASP B 144 ? 1.5857 1.8988 1.6924 -0.3959 -0.1023 0.2821  361 ASP B CG  
2796 O OD1 . ASP B 144 ? 1.5330 1.8096 1.6011 -0.3532 -0.0945 0.2283  361 ASP B OD1 
2797 O OD2 . ASP B 144 ? 1.7519 2.1128 1.8960 -0.4646 -0.1361 0.3190  361 ASP B OD2 
2798 N N   . ASP B 145 ? 1.3439 1.5177 1.3737 -0.2294 -0.0013 0.2575  362 ASP B N   
2799 C CA  . ASP B 145 ? 1.3085 1.5140 1.3387 -0.1844 0.0291  0.2748  362 ASP B CA  
2800 C C   . ASP B 145 ? 1.2766 1.5404 1.2969 -0.1249 0.0550  0.2474  362 ASP B C   
2801 O O   . ASP B 145 ? 1.2561 1.4749 1.2493 -0.1091 0.0528  0.1982  362 ASP B O   
2802 C CB  . ASP B 145 ? 1.3799 1.4758 1.3659 -0.1703 0.0297  0.2531  362 ASP B CB  
2803 C CG  . ASP B 145 ? 1.5513 1.6912 1.5404 -0.1265 0.0588  0.2766  362 ASP B CG  
2804 O OD1 . ASP B 145 ? 1.5829 1.7852 1.6098 -0.1400 0.0654  0.3360  362 ASP B OD1 
2805 O OD2 . ASP B 145 ? 1.5868 1.7092 1.5430 -0.0790 0.0737  0.2395  362 ASP B OD2 
2806 N N   . PRO B 146 ? 1.1911 1.5533 1.2298 -0.0903 0.0778  0.2814  363 PRO B N   
2807 C CA  . PRO B 146 ? 1.1422 1.5388 1.1574 -0.0330 0.0975  0.2528  363 PRO B CA  
2808 C C   . PRO B 146 ? 1.1612 1.4801 1.1352 -0.0033 0.1006  0.1949  363 PRO B C   
2809 O O   . PRO B 146 ? 1.1538 1.4598 1.1097 0.0166  0.1035  0.1597  363 PRO B O   
2810 C CB  . PRO B 146 ? 1.1681 1.6635 1.1936 0.0066  0.1183  0.3003  363 PRO B CB  
2811 C CG  . PRO B 146 ? 1.2584 1.7591 1.3133 -0.0244 0.1143  0.3479  363 PRO B CG  
2812 C CD  . PRO B 146 ? 1.2278 1.6722 1.3038 -0.0970 0.0860  0.3502  363 PRO B CD  
2813 N N   . ASN B 147 ? 1.0959 1.3666 1.0568 -0.0025 0.0996  0.1900  364 ASN B N   
2814 C CA  . ASN B 147 ? 1.0663 1.2837 0.9936 0.0228  0.1013  0.1450  364 ASN B CA  
2815 C C   . ASN B 147 ? 1.0563 1.2136 0.9709 0.0077  0.0890  0.1067  364 ASN B C   
2816 O O   . ASN B 147 ? 1.0515 1.1939 0.9486 0.0288  0.0911  0.0739  364 ASN B O   
2817 C CB  . ASN B 147 ? 1.1422 1.3321 1.0572 0.0292  0.1050  0.1571  364 ASN B CB  
2818 C CG  . ASN B 147 ? 1.2943 1.5523 1.2155 0.0621  0.1219  0.1894  364 ASN B CG  
2819 O OD1 . ASN B 147 ? 1.2218 1.5370 1.1365 0.0985  0.1305  0.1831  364 ASN B OD1 
2820 N ND2 . ASN B 147 ? 1.1576 1.4049 1.0843 0.0553  0.1268  0.2251  364 ASN B ND2 
2821 N N   . VAL B 148 ? 0.9959 1.1242 0.9192 -0.0285 0.0739  0.1128  365 VAL B N   
2822 C CA  . VAL B 148 ? 0.9795 1.0600 0.8878 -0.0351 0.0624  0.0801  365 VAL B CA  
2823 C C   . VAL B 148 ? 0.9716 1.0925 0.8902 -0.0186 0.0714  0.0645  365 VAL B C   
2824 O O   . VAL B 148 ? 0.9661 1.0668 0.8727 -0.0011 0.0743  0.0375  365 VAL B O   
2825 C CB  . VAL B 148 ? 1.0714 1.1076 0.9764 -0.0741 0.0389  0.0858  365 VAL B CB  
2826 C CG1 . VAL B 148 ? 1.0718 1.0671 0.9532 -0.0657 0.0290  0.0514  365 VAL B CG1 
2827 C CG2 . VAL B 148 ? 1.1331 1.1028 1.0168 -0.0910 0.0280  0.1014  365 VAL B CG2 
2828 N N   . ALA B 149 ? 0.8963 1.0779 0.8360 -0.0214 0.0772  0.0871  366 ALA B N   
2829 C CA  . ALA B 149 ? 0.8616 1.0729 0.8004 0.0019  0.0892  0.0769  366 ALA B CA  
2830 C C   . ALA B 149 ? 0.8977 1.0974 0.8143 0.0373  0.1004  0.0564  366 ALA B C   
2831 O O   . ALA B 149 ? 0.8929 1.0626 0.8002 0.0462  0.1016  0.0311  366 ALA B O   
2832 C CB  . ALA B 149 ? 0.8668 1.1546 0.8239 0.0013  0.0958  0.1126  366 ALA B CB  
2833 N N   . LYS B 150 ? 0.8476 1.0692 0.7553 0.0554  0.1057  0.0682  367 LYS B N   
2834 C CA  . LYS B 150 ? 0.8596 1.0670 0.7383 0.0878  0.1088  0.0441  367 LYS B CA  
2835 C C   . LYS B 150 ? 0.9129 1.0699 0.7876 0.0752  0.0981  0.0114  367 LYS B C   
2836 O O   . LYS B 150 ? 0.9212 1.0523 0.7828 0.0821  0.0944  -0.0135 367 LYS B O   
2837 C CB  . LYS B 150 ? 0.9016 1.1488 0.7713 0.1118  0.1146  0.0641  367 LYS B CB  
2838 C CG  . LYS B 150 ? 1.1578 1.4758 1.0298 0.1359  0.1276  0.1044  367 LYS B CG  
2839 C CD  . LYS B 150 ? 1.2587 1.6267 1.1219 0.1690  0.1358  0.1292  367 LYS B CD  
2840 C CE  . LYS B 150 ? 1.2949 1.7545 1.1667 0.1957  0.1507  0.1826  367 LYS B CE  
2841 N NZ  . LYS B 150 ? 1.3907 1.9119 1.2565 0.2350  0.1615  0.2148  367 LYS B NZ  
2842 N N   . THR B 151 ? 0.8533 0.9958 0.7370 0.0571  0.0926  0.0160  368 THR B N   
2843 C CA  . THR B 151 ? 0.8624 0.9785 0.7414 0.0531  0.0854  -0.0047 368 THR B CA  
2844 C C   . THR B 151 ? 0.9136 1.0118 0.8034 0.0425  0.0823  -0.0167 368 THR B C   
2845 O O   . THR B 151 ? 0.9215 1.0153 0.8130 0.0426  0.0778  -0.0319 368 THR B O   
2846 C CB  . THR B 151 ? 1.0327 1.1338 0.9034 0.0507  0.0839  0.0064  368 THR B CB  
2847 O OG1 . THR B 151 ? 0.9975 1.1222 0.8603 0.0662  0.0903  0.0200  368 THR B OG1 
2848 C CG2 . THR B 151 ? 1.0172 1.1087 0.8787 0.0568  0.0795  -0.0070 368 THR B CG2 
2849 N N   . LYS B 152 ? 0.8281 0.9226 0.7276 0.0319  0.0832  -0.0067 369 LYS B N   
2850 C CA  . LYS B 152 ? 0.8007 0.8888 0.7106 0.0292  0.0839  -0.0127 369 LYS B CA  
2851 C C   . LYS B 152 ? 0.8516 0.9397 0.7626 0.0383  0.0910  -0.0201 369 LYS B C   
2852 O O   . LYS B 152 ? 0.8462 0.9215 0.7658 0.0361  0.0902  -0.0271 369 LYS B O   
2853 C CB  . LYS B 152 ? 0.8275 0.9222 0.7431 0.0189  0.0813  -0.0015 369 LYS B CB  
2854 C CG  . LYS B 152 ? 0.8303 0.8948 0.7314 0.0103  0.0677  -0.0024 369 LYS B CG  
2855 C CD  . LYS B 152 ? 0.6853 0.7523 0.5880 -0.0001 0.0586  -0.0007 369 LYS B CD  
2856 C CE  . LYS B 152 ? 0.9994 1.0139 0.8703 -0.0056 0.0389  -0.0078 369 LYS B CE  
2857 N NZ  . LYS B 152 ? 1.0994 1.1134 0.9654 -0.0182 0.0224  -0.0117 369 LYS B NZ  
2858 N N   . ASN B 153 ? 0.8365 0.9361 0.7340 0.0517  0.0975  -0.0155 370 ASN B N   
2859 C CA  . ASN B 153 ? 0.8644 0.9431 0.7419 0.0703  0.1033  -0.0253 370 ASN B CA  
2860 C C   . ASN B 153 ? 0.9061 0.9482 0.7715 0.0656  0.0902  -0.0489 370 ASN B C   
2861 O O   . ASN B 153 ? 0.9220 0.9261 0.7854 0.0598  0.0870  -0.0586 370 ASN B O   
2862 C CB  . ASN B 153 ? 0.9363 1.0418 0.7885 0.0994  0.1135  -0.0120 370 ASN B CB  
2863 C CG  . ASN B 153 ? 1.1631 1.3015 1.0175 0.1125  0.1285  0.0102  370 ASN B CG  
2864 O OD1 . ASN B 153 ? 1.0508 1.1903 0.9254 0.0998  0.1314  0.0132  370 ASN B OD1 
2865 N ND2 . ASN B 153 ? 1.1118 1.2885 0.9425 0.1452  0.1397  0.0293  370 ASN B ND2 
2866 N N   . ASN B 154 ? 0.8489 0.9058 0.7089 0.0649  0.0813  -0.0548 371 ASN B N   
2867 C CA  . ASN B 154 ? 0.8737 0.9152 0.7245 0.0570  0.0641  -0.0763 371 ASN B CA  
2868 C C   . ASN B 154 ? 0.8989 0.9416 0.7820 0.0284  0.0560  -0.0744 371 ASN B C   
2869 O O   . ASN B 154 ? 0.9392 0.9577 0.8235 0.0111  0.0411  -0.0867 371 ASN B O   
2870 C CB  . ASN B 154 ? 0.8798 0.9565 0.7216 0.0680  0.0611  -0.0759 371 ASN B CB  
2871 C CG  . ASN B 154 ? 1.0600 1.1480 0.8682 0.1021  0.0662  -0.0757 371 ASN B CG  
2872 O OD1 . ASN B 154 ? 0.9196 0.9820 0.6968 0.1238  0.0678  -0.0838 371 ASN B OD1 
2873 N ND2 . ASN B 154 ? 1.0311 1.1596 0.8400 0.1146  0.0709  -0.0625 371 ASN B ND2 
2874 N N   . LEU B 155 ? 0.8065 0.8774 0.7121 0.0248  0.0635  -0.0566 372 LEU B N   
2875 C CA  . LEU B 155 ? 0.7779 0.8674 0.7106 0.0115  0.0603  -0.0456 372 LEU B CA  
2876 C C   . LEU B 155 ? 0.8407 0.9101 0.7920 0.0025  0.0645  -0.0394 372 LEU B C   
2877 O O   . LEU B 155 ? 0.8775 0.9577 0.8540 -0.0158 0.0567  -0.0306 372 LEU B O   
2878 C CB  . LEU B 155 ? 0.7421 0.8503 0.6730 0.0245  0.0675  -0.0312 372 LEU B CB  
2879 C CG  . LEU B 155 ? 0.7828 0.9196 0.7305 0.0282  0.0678  -0.0146 372 LEU B CG  
2880 C CD1 . LEU B 155 ? 0.7912 0.9729 0.7499 0.0219  0.0585  -0.0076 372 LEU B CD1 
2881 C CD2 . LEU B 155 ? 0.8131 0.9408 0.7362 0.0509  0.0723  -0.0081 372 LEU B CD2 
2882 N N   . ALA B 156 ? 0.7444 0.7931 0.6857 0.0154  0.0773  -0.0384 373 ALA B N   
2883 C CA  . ALA B 156 ? 0.7468 0.7768 0.7005 0.0152  0.0863  -0.0294 373 ALA B CA  
2884 C C   . ALA B 156 ? 0.9043 0.8828 0.8483 0.0011  0.0761  -0.0404 373 ALA B C   
2885 O O   . ALA B 156 ? 0.9302 0.9002 0.9012 -0.0179 0.0730  -0.0272 373 ALA B O   
2886 C CB  . ALA B 156 ? 0.7438 0.7750 0.6835 0.0363  0.1024  -0.0246 373 ALA B CB  
2887 N N   . SER B 157 ? 0.9214 0.8641 0.8242 0.0103  0.0678  -0.0632 374 SER B N   
2888 C CA  . SER B 157 ? 1.0065 0.8776 0.8793 0.0001  0.0504  -0.0834 374 SER B CA  
2889 C C   . SER B 157 ? 1.0833 0.9614 0.9894 -0.0447 0.0248  -0.0830 374 SER B C   
2890 O O   . SER B 157 ? 1.1349 0.9544 1.0412 -0.0719 0.0093  -0.0852 374 SER B O   
2891 C CB  . SER B 157 ? 1.0909 0.9375 0.9060 0.0284  0.0434  -0.1091 374 SER B CB  
2892 O OG  . SER B 157 ? 1.3943 1.1474 1.1593 0.0305  0.0271  -0.1327 374 SER B OG  
2893 N N   . CYS B 158 ? 0.9902 0.9431 0.9250 -0.0527 0.0209  -0.0746 375 CYS B N   
2894 C CA  . CYS B 158 ? 0.9852 0.9811 0.9579 -0.0894 0.0005  -0.0635 375 CYS B CA  
2895 C C   . CYS B 158 ? 1.0056 1.0276 1.0308 -0.1079 0.0089  -0.0258 375 CYS B C   
2896 O O   . CYS B 158 ? 1.0262 1.0509 1.0837 -0.1494 -0.0108 -0.0114 375 CYS B O   
2897 C CB  . CYS B 158 ? 0.9430 1.0154 0.9206 -0.0761 0.0021  -0.0593 375 CYS B CB  
2898 S SG  . CYS B 158 ? 0.9985 1.1574 1.0230 -0.1112 -0.0184 -0.0348 375 CYS B SG  
2899 N N   . TYR B 159 ? 0.9007 0.9476 0.9354 -0.0778 0.0361  -0.0071 376 TYR B N   
2900 C CA  . TYR B 159 ? 0.8694 0.9497 0.9483 -0.0809 0.0483  0.0306  376 TYR B CA  
2901 C C   . TYR B 159 ? 0.9264 0.9354 1.0108 -0.1024 0.0466  0.0359  376 TYR B C   
2902 O O   . TYR B 159 ? 0.9342 0.9653 1.0656 -0.1318 0.0410  0.0696  376 TYR B O   
2903 C CB  . TYR B 159 ? 0.8366 0.9451 0.9089 -0.0386 0.0735  0.0396  376 TYR B CB  
2904 C CG  . TYR B 159 ? 0.7993 0.9635 0.8627 -0.0158 0.0748  0.0420  376 TYR B CG  
2905 C CD1 . TYR B 159 ? 0.8224 1.0441 0.9021 -0.0243 0.0635  0.0571  376 TYR B CD1 
2906 C CD2 . TYR B 159 ? 0.7540 0.9134 0.7900 0.0155  0.0862  0.0333  376 TYR B CD2 
2907 C CE1 . TYR B 159 ? 0.7933 1.0544 0.8510 0.0073  0.0677  0.0615  376 TYR B CE1 
2908 C CE2 . TYR B 159 ? 0.7402 0.9259 0.7555 0.0382  0.0848  0.0346  376 TYR B CE2 
2909 C CZ  . TYR B 159 ? 0.8200 1.0513 0.8413 0.0391  0.0778  0.0484  376 TYR B CZ  
2910 O OH  . TYR B 159 ? 0.7669 1.0107 0.7531 0.0712  0.0789  0.0500  376 TYR B OH  
2911 N N   . LEU B 160 ? 0.8937 0.8182 0.9271 -0.0856 0.0515  0.0075  377 LEU B N   
2912 C CA  . LEU B 160 ? 0.9779 0.8103 0.9951 -0.0956 0.0514  0.0088  377 LEU B CA  
2913 C C   . LEU B 160 ? 1.0893 0.8724 1.1181 -0.1530 0.0150  0.0060  377 LEU B C   
2914 O O   . LEU B 160 ? 1.1093 0.8638 1.1716 -0.1837 0.0123  0.0363  377 LEU B O   
2915 C CB  . LEU B 160 ? 1.0308 0.7864 0.9749 -0.0565 0.0611  -0.0225 377 LEU B CB  
2916 C CG  . LEU B 160 ? 1.0395 0.8376 0.9732 -0.0076 0.0945  -0.0136 377 LEU B CG  
2917 C CD1 . LEU B 160 ? 1.0741 0.8263 0.9381 0.0306  0.1000  -0.0389 377 LEU B CD1 
2918 C CD2 . LEU B 160 ? 1.0640 0.8646 1.0225 0.0050  0.1198  0.0197  377 LEU B CD2 
2919 N N   . LYS B 161 ? 1.0578 0.8397 1.0632 -0.1702 -0.0145 -0.0264 378 LYS B N   
2920 C CA  . LYS B 161 ? 1.1331 0.8787 1.1455 -0.2295 -0.0579 -0.0357 378 LYS B CA  
2921 C C   . LYS B 161 ? 1.1649 0.9974 1.2655 -0.2794 -0.0658 0.0174  378 LYS B C   
2922 O O   . LYS B 161 ? 1.2547 1.0439 1.3775 -0.3400 -0.0979 0.0285  378 LYS B O   
2923 C CB  . LYS B 161 ? 1.1557 0.9255 1.1347 -0.2282 -0.0831 -0.0747 378 LYS B CB  
2924 C CG  . LYS B 161 ? 1.5402 1.1846 1.4328 -0.2216 -0.1106 -0.1281 378 LYS B CG  
2925 C CD  . LYS B 161 ? 1.7460 1.3583 1.5692 -0.1474 -0.0813 -0.1524 378 LYS B CD  
2926 C CE  . LYS B 161 ? 1.7904 1.4630 1.5872 -0.1174 -0.0852 -0.1770 378 LYS B CE  
2927 N NZ  . LYS B 161 ? 1.8531 1.4850 1.5773 -0.0511 -0.0652 -0.1971 378 LYS B NZ  
2928 N N   . GLN B 162 ? 1.0057 0.9588 1.1521 -0.2522 -0.0381 0.0526  379 GLN B N   
2929 C CA  . GLN B 162 ? 0.9513 1.0184 1.1777 -0.2775 -0.0369 0.1122  379 GLN B CA  
2930 C C   . GLN B 162 ? 0.9754 1.0433 1.2396 -0.2664 -0.0087 0.1586  379 GLN B C   
2931 O O   . GLN B 162 ? 0.9282 1.0901 1.2619 -0.2859 -0.0065 0.2174  379 GLN B O   
2932 C CB  . GLN B 162 ? 0.8705 1.0597 1.1055 -0.2376 -0.0216 0.1226  379 GLN B CB  
2933 C CG  . GLN B 162 ? 0.8872 1.1004 1.0952 -0.2462 -0.0458 0.0896  379 GLN B CG  
2934 C CD  . GLN B 162 ? 0.9859 1.2969 1.1896 -0.1983 -0.0258 0.1016  379 GLN B CD  
2935 O OE1 . GLN B 162 ? 0.8802 1.3012 1.1262 -0.1958 -0.0220 0.1481  379 GLN B OE1 
2936 N NE2 . GLN B 162 ? 0.9301 1.2021 1.0786 -0.1569 -0.0130 0.0637  379 GLN B NE2 
2937 N N   . GLY B 163 ? 0.9549 0.9328 1.1736 -0.2298 0.0144  0.1374  380 GLY B N   
2938 C CA  . GLY B 163 ? 0.9530 0.9278 1.1965 -0.2078 0.0456  0.1768  380 GLY B CA  
2939 C C   . GLY B 163 ? 0.9261 1.0104 1.1887 -0.1509 0.0783  0.2008  380 GLY B C   
2940 O O   . GLY B 163 ? 0.8938 1.0144 1.1904 -0.1299 0.1031  0.2441  380 GLY B O   
2941 N N   . LYS B 164 ? 0.7858 1.0066 1.0246 -0.3369 -0.0671 0.0551  381 LYS B N   
2942 C CA  . LYS B 164 ? 0.7438 0.9719 0.9752 -0.2786 -0.0478 0.0915  381 LYS B CA  
2943 C C   . LYS B 164 ? 0.7646 0.8842 0.9562 -0.2457 -0.0385 0.0740  381 LYS B C   
2944 O O   . LYS B 164 ? 0.7072 0.8251 0.8754 -0.2090 -0.0367 0.0688  381 LYS B O   
2945 C CB  . LYS B 164 ? 0.7429 1.0742 0.9757 -0.2456 -0.0507 0.1098  381 LYS B CB  
2946 C CG  . LYS B 164 ? 0.9007 1.3597 1.1805 -0.2680 -0.0567 0.1391  381 LYS B CG  
2947 C CD  . LYS B 164 ? 1.0228 1.5990 1.3049 -0.2427 -0.0657 0.1531  381 LYS B CD  
2948 C CE  . LYS B 164 ? 1.1127 1.6989 1.3809 -0.1721 -0.0397 0.1898  381 LYS B CE  
2949 N NZ  . LYS B 164 ? 1.1621 1.8863 1.4522 -0.1471 -0.0401 0.2255  381 LYS B NZ  
2950 N N   . TYR B 165 ? 0.7839 0.8176 0.9727 -0.2609 -0.0314 0.0675  382 TYR B N   
2951 C CA  . TYR B 165 ? 0.8033 0.7452 0.9615 -0.2332 -0.0240 0.0534  382 TYR B CA  
2952 C C   . TYR B 165 ? 0.8358 0.7775 0.9786 -0.1827 -0.0146 0.0694  382 TYR B C   
2953 O O   . TYR B 165 ? 0.8002 0.7143 0.9228 -0.1603 -0.0162 0.0508  382 TYR B O   
2954 C CB  . TYR B 165 ? 0.8772 0.7354 1.0383 -0.2537 -0.0142 0.0532  382 TYR B CB  
2955 C CG  . TYR B 165 ? 0.9992 0.8247 1.1652 -0.3049 -0.0223 0.0206  382 TYR B CG  
2956 C CD1 . TYR B 165 ? 1.0480 0.8793 1.1910 -0.3125 -0.0377 -0.0210 382 TYR B CD1 
2957 C CD2 . TYR B 165 ? 1.0890 0.8716 1.2797 -0.3463 -0.0124 0.0294  382 TYR B CD2 
2958 C CE1 . TYR B 165 ? 1.1395 0.9378 1.2784 -0.3616 -0.0468 -0.0606 382 TYR B CE1 
2959 C CE2 . TYR B 165 ? 1.1845 0.9237 1.3784 -0.4001 -0.0191 -0.0088 382 TYR B CE2 
2960 C CZ  . TYR B 165 ? 1.2799 1.0271 1.4448 -0.4080 -0.0380 -0.0579 382 TYR B CZ  
2961 O OH  . TYR B 165 ? 1.3869 1.0898 1.5471 -0.4628 -0.0462 -0.1042 382 TYR B OH  
2962 N N   . GLN B 166 ? 0.7981 0.7739 0.9503 -0.1663 -0.0040 0.1015  383 GLN B N   
2963 C CA  . GLN B 166 ? 0.7690 0.7426 0.9022 -0.1230 0.0044  0.1092  383 GLN B CA  
2964 C C   . GLN B 166 ? 0.7886 0.7924 0.9155 -0.1038 0.0030  0.0995  383 GLN B C   
2965 O O   . GLN B 166 ? 0.7686 0.7392 0.8795 -0.0813 0.0051  0.0859  383 GLN B O   
2966 C CB  . GLN B 166 ? 0.7883 0.7966 0.9257 -0.1086 0.0181  0.1418  383 GLN B CB  
2967 C CG  . GLN B 166 ? 1.0223 0.9994 1.1302 -0.0726 0.0249  0.1423  383 GLN B CG  
2968 C CD  . GLN B 166 ? 1.3317 1.3334 1.4339 -0.0581 0.0399  0.1743  383 GLN B CD  
2969 O OE1 . GLN B 166 ? 1.1538 1.2098 1.2763 -0.0647 0.0505  0.2014  383 GLN B OE1 
2970 N NE2 . GLN B 166 ? 1.3458 1.3196 1.4193 -0.0340 0.0415  0.1735  383 GLN B NE2 
2971 N N   . ASP B 167 ? 0.7288 0.7995 0.8715 -0.1133 0.0003  0.1091  384 ASP B N   
2972 C CA  . ASP B 167 ? 0.7068 0.8120 0.8443 -0.0902 0.0035  0.1103  384 ASP B CA  
2973 C C   . ASP B 167 ? 0.7888 0.8561 0.9108 -0.0921 -0.0040 0.0823  384 ASP B C   
2974 O O   . ASP B 167 ? 0.7984 0.8499 0.9105 -0.0651 0.0061  0.0814  384 ASP B O   
2975 C CB  . ASP B 167 ? 0.7322 0.9345 0.8914 -0.0976 0.0002  0.1318  384 ASP B CB  
2976 C CG  . ASP B 167 ? 0.8899 1.1492 1.0728 -0.0971 0.0095  0.1646  384 ASP B CG  
2977 O OD1 . ASP B 167 ? 0.8931 1.1601 1.0969 -0.1346 0.0023  0.1668  384 ASP B OD1 
2978 O OD2 . ASP B 167 ? 0.9840 1.2859 1.1678 -0.0598 0.0265  0.1910  384 ASP B OD2 
2979 N N   . ALA B 168 ? 0.7517 0.7971 0.8713 -0.1233 -0.0178 0.0594  385 ALA B N   
2980 C CA  . ALA B 168 ? 0.7582 0.7664 0.8586 -0.1206 -0.0215 0.0325  385 ALA B CA  
2981 C C   . ALA B 168 ? 0.8166 0.7575 0.9101 -0.1000 -0.0128 0.0259  385 ALA B C   
2982 O O   . ALA B 168 ? 0.8062 0.7360 0.8931 -0.0824 -0.0074 0.0183  385 ALA B O   
2983 C CB  . ALA B 168 ? 0.8041 0.7976 0.8974 -0.1567 -0.0353 0.0050  385 ALA B CB  
2984 N N   . GLU B 169 ? 0.7979 0.7062 0.8956 -0.1014 -0.0111 0.0328  386 GLU B N   
2985 C CA  . GLU B 169 ? 0.7964 0.6617 0.8897 -0.0824 -0.0073 0.0297  386 GLU B CA  
2986 C C   . GLU B 169 ? 0.8113 0.6890 0.9059 -0.0595 -0.0006 0.0329  386 GLU B C   
2987 O O   . GLU B 169 ? 0.8029 0.6620 0.8997 -0.0491 0.0004  0.0214  386 GLU B O   
2988 C CB  . GLU B 169 ? 0.8261 0.6737 0.9200 -0.0854 -0.0061 0.0450  386 GLU B CB  
2989 C CG  . GLU B 169 ? 0.9971 0.8105 1.0842 -0.0662 -0.0060 0.0431  386 GLU B CG  
2990 C CD  . GLU B 169 ? 1.3031 1.1133 1.3851 -0.0590 -0.0023 0.0661  386 GLU B CD  
2991 O OE1 . GLU B 169 ? 1.2020 0.9857 1.2875 -0.0731 0.0030  0.0790  386 GLU B OE1 
2992 O OE2 . GLU B 169 ? 1.2576 1.0901 1.3301 -0.0398 -0.0029 0.0710  386 GLU B OE2 
2993 N N   . THR B 170 ? 0.7433 0.6521 0.8389 -0.0525 0.0063  0.0484  387 THR B N   
2994 C CA  . THR B 170 ? 0.7342 0.6394 0.8277 -0.0321 0.0177  0.0489  387 THR B CA  
2995 C C   . THR B 170 ? 0.7797 0.6836 0.8801 -0.0266 0.0253  0.0444  387 THR B C   
2996 O O   . THR B 170 ? 0.7828 0.6611 0.8887 -0.0198 0.0322  0.0347  387 THR B O   
2997 C CB  . THR B 170 ? 0.7836 0.7162 0.8726 -0.0191 0.0289  0.0684  387 THR B CB  
2998 O OG1 . THR B 170 ? 0.8897 0.8236 0.9716 -0.0222 0.0247  0.0749  387 THR B OG1 
2999 C CG2 . THR B 170 ? 0.7405 0.6504 0.8218 0.0033  0.0457  0.0645  387 THR B CG2 
3000 N N   . LEU B 171 ? 0.7187 0.6548 0.8195 -0.0314 0.0239  0.0514  388 LEU B N   
3001 C CA  . LEU B 171 ? 0.7056 0.6505 0.8081 -0.0212 0.0338  0.0541  388 LEU B CA  
3002 C C   . LEU B 171 ? 0.7364 0.6499 0.8430 -0.0249 0.0321  0.0356  388 LEU B C   
3003 O O   . LEU B 171 ? 0.7409 0.6410 0.8599 -0.0152 0.0465  0.0384  388 LEU B O   
3004 C CB  . LEU B 171 ? 0.7135 0.7146 0.8081 -0.0242 0.0283  0.0633  388 LEU B CB  
3005 C CG  . LEU B 171 ? 0.7577 0.8129 0.8560 -0.0088 0.0366  0.0926  388 LEU B CG  
3006 C CD1 . LEU B 171 ? 0.7521 0.8804 0.8447 -0.0168 0.0238  0.0978  388 LEU B CD1 
3007 C CD2 . LEU B 171 ? 0.7542 0.7943 0.8558 0.0237  0.0644  0.1143  388 LEU B CD2 
3008 N N   . TYR B 172 ? 0.6864 0.5850 0.7863 -0.0382 0.0180  0.0190  389 TYR B N   
3009 C CA  . TYR B 172 ? 0.6853 0.5594 0.7896 -0.0351 0.0182  0.0045  389 TYR B CA  
3010 C C   . TYR B 172 ? 0.7562 0.6160 0.8811 -0.0300 0.0207  0.0032  389 TYR B C   
3011 O O   . TYR B 172 ? 0.7679 0.6303 0.9114 -0.0249 0.0296  0.0016  389 TYR B O   
3012 C CB  . TYR B 172 ? 0.7063 0.5552 0.7972 -0.0447 0.0075  -0.0096 389 TYR B CB  
3013 C CG  . TYR B 172 ? 0.7421 0.6013 0.8115 -0.0576 0.0028  -0.0203 389 TYR B CG  
3014 C CD1 . TYR B 172 ? 0.7620 0.6516 0.8193 -0.0493 0.0085  -0.0228 389 TYR B CD1 
3015 C CD2 . TYR B 172 ? 0.7694 0.6095 0.8300 -0.0799 -0.0071 -0.0290 389 TYR B CD2 
3016 C CE1 . TYR B 172 ? 0.8102 0.7196 0.8416 -0.0625 -0.0003 -0.0390 389 TYR B CE1 
3017 C CE2 . TYR B 172 ? 0.8024 0.6548 0.8444 -0.1004 -0.0151 -0.0472 389 TYR B CE2 
3018 C CZ  . TYR B 172 ? 0.8717 0.7633 0.8964 -0.0915 -0.0141 -0.0547 389 TYR B CZ  
3019 O OH  . TYR B 172 ? 0.9226 0.8370 0.9226 -0.1123 -0.0260 -0.0785 389 TYR B OH  
3020 N N   . LYS B 173 ? 0.6916 0.5442 0.8140 -0.0327 0.0132  0.0041  390 LYS B N   
3021 C CA  . LYS B 173 ? 0.6805 0.5280 0.8152 -0.0310 0.0102  -0.0039 390 LYS B CA  
3022 C C   . LYS B 173 ? 0.7679 0.6114 0.9188 -0.0320 0.0247  -0.0054 390 LYS B C   
3023 O O   . LYS B 173 ? 0.7692 0.6134 0.9438 -0.0384 0.0245  -0.0166 390 LYS B O   
3024 C CB  . LYS B 173 ? 0.6999 0.5457 0.8175 -0.0293 0.0007  -0.0023 390 LYS B CB  
3025 C CG  . LYS B 173 ? 0.8133 0.6553 0.9247 -0.0262 -0.0101 0.0011  390 LYS B CG  
3026 C CD  . LYS B 173 ? 0.9165 0.7621 1.0092 -0.0210 -0.0149 0.0108  390 LYS B CD  
3027 C CE  . LYS B 173 ? 0.9461 0.7779 1.0335 -0.0165 -0.0179 0.0237  390 LYS B CE  
3028 N NZ  . LYS B 173 ? 0.9737 0.8125 1.0433 -0.0085 -0.0183 0.0417  390 LYS B NZ  
3029 N N   . GLU B 174 ? 0.7356 0.5770 0.8778 -0.0256 0.0396  0.0086  391 GLU B N   
3030 C CA  . GLU B 174 ? 0.7510 0.5745 0.9064 -0.0215 0.0620  0.0144  391 GLU B CA  
3031 C C   . GLU B 174 ? 0.8333 0.6628 1.0146 -0.0243 0.0737  0.0197  391 GLU B C   
3032 O O   . GLU B 174 ? 0.8769 0.6868 1.0851 -0.0332 0.0873  0.0157  391 GLU B O   
3033 C CB  . GLU B 174 ? 0.7697 0.6010 0.9091 -0.0037 0.0781  0.0386  391 GLU B CB  
3034 C CG  . GLU B 174 ? 0.8825 0.7076 1.0023 0.0048  0.0779  0.0388  391 GLU B CG  
3035 C CD  . GLU B 174 ? 1.1759 1.0262 1.2855 0.0274  0.0941  0.0684  391 GLU B CD  
3036 O OE1 . GLU B 174 ? 1.1677 1.0367 1.2841 0.0390  0.1078  0.0900  391 GLU B OE1 
3037 O OE2 . GLU B 174 ? 1.1107 0.9703 1.2056 0.0372  0.0946  0.0735  391 GLU B OE2 
3038 N N   . ILE B 175 ? 0.7534 0.6097 0.9260 -0.0182 0.0699  0.0275  392 ILE B N   
3039 C CA  . ILE B 175 ? 0.7577 0.6282 0.9470 -0.0142 0.0828  0.0346  392 ILE B CA  
3040 C C   . ILE B 175 ? 0.7707 0.6418 0.9914 -0.0261 0.0758  0.0191  392 ILE B C   
3041 O O   . ILE B 175 ? 0.8022 0.6741 1.0586 -0.0336 0.0919  0.0244  392 ILE B O   
3042 C CB  . ILE B 175 ? 0.8035 0.7010 0.9641 -0.0034 0.0780  0.0371  392 ILE B CB  
3043 C CG1 . ILE B 175 ? 0.8132 0.7347 0.9496 0.0080  0.0839  0.0559  392 ILE B CG1 
3044 C CG2 . ILE B 175 ? 0.8017 0.7152 0.9732 0.0057  0.0911  0.0401  392 ILE B CG2 
3045 C CD1 . ILE B 175 ? 0.8568 0.8036 0.9611 0.0050  0.0659  0.0443  392 ILE B CD1 
3046 N N   . LEU B 176 ? 0.6880 0.5627 0.8994 -0.0279 0.0536  0.0036  393 LEU B N   
3047 C CA  . LEU B 176 ? 0.6771 0.5691 0.9171 -0.0329 0.0434  -0.0072 393 LEU B CA  
3048 C C   . LEU B 176 ? 0.7650 0.6583 1.0358 -0.0530 0.0401  -0.0191 393 LEU B C   
3049 O O   . LEU B 176 ? 0.7764 0.6974 1.0899 -0.0635 0.0429  -0.0214 393 LEU B O   
3050 C CB  . LEU B 176 ? 0.6583 0.5500 0.8769 -0.0234 0.0242  -0.0139 393 LEU B CB  
3051 C CG  . LEU B 176 ? 0.6878 0.5664 0.8779 -0.0093 0.0281  -0.0113 393 LEU B CG  
3052 C CD1 . LEU B 176 ? 0.7014 0.5622 0.8734 -0.0023 0.0152  -0.0147 393 LEU B CD1 
3053 C CD2 . LEU B 176 ? 0.6659 0.5631 0.8707 0.0044  0.0436  -0.0077 393 LEU B CD2 
3054 N N   . THR B 177 ? 0.7369 0.6024 0.9872 -0.0595 0.0362  -0.0282 394 THR B N   
3055 C CA  . THR B 177 ? 0.7621 0.6165 1.0303 -0.0806 0.0334  -0.0494 394 THR B CA  
3056 C C   . THR B 177 ? 0.8586 0.6949 1.1660 -0.0968 0.0598  -0.0440 394 THR B C   
3057 O O   . THR B 177 ? 0.8750 0.7246 1.2239 -0.1234 0.0565  -0.0609 394 THR B O   
3058 C CB  . THR B 177 ? 0.7770 0.5998 1.0053 -0.0766 0.0291  -0.0609 394 THR B CB  
3059 O OG1 . THR B 177 ? 0.8389 0.6819 1.0365 -0.0624 0.0087  -0.0589 394 THR B OG1 
3060 C CG2 . THR B 177 ? 0.7740 0.5808 1.0108 -0.0990 0.0239  -0.0935 394 THR B CG2 
3061 N N   . ARG B 178 ? 0.8164 0.6288 1.1137 -0.0815 0.0865  -0.0177 395 ARG B N   
3062 C CA  . ARG B 178 ? 0.8363 0.6260 1.1690 -0.0908 0.1192  -0.0018 395 ARG B CA  
3063 C C   . ARG B 178 ? 0.8810 0.7174 1.2610 -0.0999 0.1238  0.0081  395 ARG B C   
3064 O O   . ARG B 178 ? 0.9017 0.7362 1.3336 -0.1281 0.1365  0.0043  395 ARG B O   
3065 C CB  . ARG B 178 ? 0.8054 0.5714 1.1116 -0.0630 0.1474  0.0317  395 ARG B CB  
3066 C CG  . ARG B 178 ? 1.0550 0.7902 1.3947 -0.0654 0.1888  0.0585  395 ARG B CG  
3067 C CD  . ARG B 178 ? 1.3861 1.0497 1.7409 -0.0864 0.2061  0.0416  395 ARG B CD  
3068 N NE  . ARG B 178 ? 1.6616 1.3048 2.0760 -0.1154 0.2332  0.0486  395 ARG B NE  
3069 C CZ  . ARG B 178 ? 1.9129 1.5304 2.3655 -0.1603 0.2268  0.0119  395 ARG B CZ  
3070 N NH1 . ARG B 178 ? 1.7301 1.3407 2.1588 -0.1756 0.1937  -0.0351 395 ARG B NH1 
3071 N NH2 . ARG B 178 ? 1.7911 1.3948 2.3064 -0.1919 0.2538  0.0219  395 ARG B NH2 
3072 N N   . ALA B 179 ? 0.7845 0.6627 1.1480 -0.0779 0.1138  0.0180  396 ALA B N   
3073 C CA  . ALA B 179 ? 0.7651 0.6925 1.1656 -0.0758 0.1204  0.0291  396 ALA B CA  
3074 C C   . ALA B 179 ? 0.8348 0.7980 1.2865 -0.1043 0.1021  0.0080  396 ALA B C   
3075 O O   . ALA B 179 ? 0.8372 0.8327 1.3482 -0.1224 0.1176  0.0178  396 ALA B O   
3076 C CB  . ALA B 179 ? 0.7480 0.6980 1.1095 -0.0458 0.1095  0.0318  396 ALA B CB  
3077 N N   . HIS B 180 ? 0.7827 0.7473 1.2134 -0.1096 0.0697  -0.0191 397 HIS B N   
3078 C CA  . HIS B 180 ? 0.7779 0.7904 1.2480 -0.1341 0.0454  -0.0419 397 HIS B CA  
3079 C C   . HIS B 180 ? 0.8838 0.8764 1.3955 -0.1779 0.0532  -0.0605 397 HIS B C   
3080 O O   . HIS B 180 ? 0.8995 0.9458 1.4749 -0.2067 0.0500  -0.0659 397 HIS B O   
3081 C CB  . HIS B 180 ? 0.7775 0.7956 1.2045 -0.1232 0.0122  -0.0617 397 HIS B CB  
3082 C CG  . HIS B 180 ? 0.8267 0.9129 1.2884 -0.1420 -0.0165 -0.0827 397 HIS B CG  
3083 N ND1 . HIS B 180 ? 0.8272 0.9900 1.3178 -0.1243 -0.0274 -0.0686 397 HIS B ND1 
3084 C CD2 . HIS B 180 ? 0.8771 0.9703 1.3463 -0.1747 -0.0359 -0.1172 397 HIS B CD2 
3085 C CE1 . HIS B 180 ? 0.8334 1.0601 1.3520 -0.1464 -0.0557 -0.0910 397 HIS B CE1 
3086 N NE2 . HIS B 180 ? 0.8721 1.0592 1.3768 -0.1799 -0.0636 -0.1245 397 HIS B NE2 
3087 N N   . GLU B 181 ? 0.8891 0.8049 1.3672 -0.1836 0.0651  -0.0705 398 GLU B N   
3088 C CA  . GLU B 181 ? 0.9550 0.8240 1.4620 -0.2242 0.0779  -0.0934 398 GLU B CA  
3089 C C   . GLU B 181 ? 1.0514 0.9145 1.6238 -0.2468 0.1146  -0.0690 398 GLU B C   
3090 O O   . GLU B 181 ? 1.0871 0.9509 1.7143 -0.2950 0.1156  -0.0919 398 GLU B O   
3091 C CB  . GLU B 181 ? 1.0072 0.7899 1.4570 -0.2132 0.0889  -0.1049 398 GLU B CB  
3092 C CG  . GLU B 181 ? 1.2114 1.0022 1.6135 -0.2101 0.0532  -0.1415 398 GLU B CG  
3093 C CD  . GLU B 181 ? 1.7057 1.4166 2.0542 -0.1996 0.0660  -0.1573 398 GLU B CD  
3094 O OE1 . GLU B 181 ? 1.6878 1.3688 2.0011 -0.1637 0.0856  -0.1263 398 GLU B OE1 
3095 O OE2 . GLU B 181 ? 1.8137 1.4975 2.1538 -0.2263 0.0558  -0.2024 398 GLU B OE2 
3096 N N   . LYS B 182 ? 0.9963 0.8600 1.5647 -0.2145 0.1444  -0.0232 399 LYS B N   
3097 C CA  . LYS B 182 ? 1.0194 0.8828 1.6480 -0.2298 0.1848  0.0093  399 LYS B CA  
3098 C C   . LYS B 182 ? 1.0357 0.9920 1.7379 -0.2531 0.1769  0.0129  399 LYS B C   
3099 O O   . LYS B 182 ? 1.0790 1.0398 1.8525 -0.2907 0.2020  0.0233  399 LYS B O   
3100 C CB  . LYS B 182 ? 1.0486 0.8875 1.6449 -0.1857 0.2223  0.0588  399 LYS B CB  
3101 C CG  . LYS B 182 ? 1.2672 1.1633 1.8230 -0.1412 0.2099  0.0759  399 LYS B CG  
3102 C CD  . LYS B 182 ? 1.4575 1.4129 2.0543 -0.1307 0.2360  0.1117  399 LYS B CD  
3103 C CE  . LYS B 182 ? 1.6256 1.6265 2.1734 -0.0858 0.2250  0.1196  399 LYS B CE  
3104 N NZ  . LYS B 182 ? 1.6269 1.6648 2.1682 -0.0856 0.1849  0.0879  399 LYS B NZ  
3105 N N   . GLU B 183 ? 0.9368 0.9668 1.6259 -0.2310 0.1446  0.0063  400 GLU B N   
3106 C CA  . GLU B 183 ? 0.9139 1.0464 1.6694 -0.2411 0.1360  0.0138  400 GLU B CA  
3107 C C   . GLU B 183 ? 0.9841 1.1690 1.7810 -0.2853 0.0970  -0.0278 400 GLU B C   
3108 O O   . GLU B 183 ? 0.9912 1.2589 1.8691 -0.3157 0.0958  -0.0237 400 GLU B O   
3109 C CB  . GLU B 183 ? 0.8803 1.0624 1.5979 -0.1855 0.1275  0.0324  400 GLU B CB  
3110 C CG  . GLU B 183 ? 1.0386 1.2531 1.7759 -0.1573 0.1659  0.0760  400 GLU B CG  
3111 C CD  . GLU B 183 ? 1.4749 1.7896 2.3035 -0.1745 0.1752  0.0936  400 GLU B CD  
3112 O OE1 . GLU B 183 ? 1.5516 1.9422 2.3926 -0.1560 0.1523  0.0892  400 GLU B OE1 
3113 O OE2 . GLU B 183 ? 1.4259 1.7462 2.3150 -0.2020 0.2098  0.1180  400 GLU B OE2 
3114 N N   . PHE B 184 ? 0.9550 1.1044 1.6971 -0.2877 0.0645  -0.0665 401 PHE B N   
3115 C CA  . PHE B 184 ? 0.9751 1.1850 1.7407 -0.3228 0.0221  -0.1090 401 PHE B CA  
3116 C C   . PHE B 184 ? 1.1015 1.2485 1.8582 -0.3720 0.0114  -0.1597 401 PHE B C   
3117 O O   . PHE B 184 ? 1.1213 1.3306 1.9177 -0.4167 -0.0198 -0.1981 401 PHE B O   
3118 C CB  . PHE B 184 ? 0.9531 1.2197 1.6709 -0.2790 -0.0140 -0.1106 401 PHE B CB  
3119 C CG  . PHE B 184 ? 0.9327 1.2646 1.6652 -0.2336 -0.0047 -0.0688 401 PHE B CG  
3120 C CD1 . PHE B 184 ? 0.9732 1.4093 1.7888 -0.2460 -0.0019 -0.0517 401 PHE B CD1 
3121 C CD2 . PHE B 184 ? 0.9384 1.2260 1.6031 -0.1796 0.0043  -0.0476 401 PHE B CD2 
3122 C CE1 . PHE B 184 ? 0.9509 1.4413 1.7741 -0.1965 0.0121  -0.0134 401 PHE B CE1 
3123 C CE2 . PHE B 184 ? 0.9487 1.2827 1.6189 -0.1362 0.0154  -0.0159 401 PHE B CE2 
3124 C CZ  . PHE B 184 ? 0.9169 1.3499 1.6630 -0.1407 0.0206  0.0015  401 PHE B CZ  
3125 N N   . GLY B 185 ? 1.1022 1.1325 1.8072 -0.3628 0.0373  -0.1609 402 GLY B N   
3126 C CA  . GLY B 185 ? 1.1897 1.1404 1.8732 -0.3999 0.0345  -0.2098 402 GLY B CA  
3127 C C   . GLY B 185 ? 1.2607 1.1747 1.8507 -0.3632 0.0134  -0.2302 402 GLY B C   
3128 O O   . GLY B 185 ? 1.1831 1.1388 1.7347 -0.3164 -0.0015 -0.2063 402 GLY B O   
3129 N N   . SER B 186 ? 1.3377 1.1697 1.8907 -0.3838 0.0155  -0.2739 403 SER B N   
3130 C CA  . SER B 186 ? 1.3628 1.1582 1.8266 -0.3485 0.0012  -0.2928 403 SER B CA  
3131 C C   . SER B 186 ? 1.3806 1.2784 1.8177 -0.3336 -0.0490 -0.3083 403 SER B C   
3132 O O   . SER B 186 ? 1.3889 1.3602 1.8580 -0.3710 -0.0822 -0.3448 403 SER B O   
3133 C CB  . SER B 186 ? 1.5357 1.2239 1.9666 -0.3728 0.0172  -0.3405 403 SER B CB  
3134 O OG  . SER B 186 ? 1.6846 1.2671 2.1076 -0.3532 0.0694  -0.3082 403 SER B OG  
3135 N N   . VAL B 187 ? 1.2937 1.2014 1.6763 -0.2786 -0.0528 -0.2756 404 VAL B N   
3136 C CA  . VAL B 187 ? 1.2555 1.2475 1.6074 -0.2509 -0.0902 -0.2731 404 VAL B CA  
3137 C C   . VAL B 187 ? 1.4069 1.4228 1.7157 -0.2642 -0.1230 -0.3255 404 VAL B C   
3138 O O   . VAL B 187 ? 1.4612 1.4030 1.7134 -0.2596 -0.1125 -0.3509 404 VAL B O   
3139 C CB  . VAL B 187 ? 1.2220 1.2124 1.5367 -0.1965 -0.0818 -0.2235 404 VAL B CB  
3140 C CG1 . VAL B 187 ? 1.2035 1.1096 1.5050 -0.1809 -0.0427 -0.1958 404 VAL B CG1 
3141 C CG2 . VAL B 187 ? 1.2191 1.2324 1.4689 -0.1651 -0.1045 -0.2270 404 VAL B CG2 
3142 N N   . ASN B 188 ? 1.3891 1.5155 1.7261 -0.2797 -0.1619 -0.3420 405 ASN B N   
3143 C CA  . ASN B 188 ? 1.4554 1.6361 1.7557 -0.2943 -0.2009 -0.3937 405 ASN B CA  
3144 C C   . ASN B 188 ? 1.4458 1.7354 1.7185 -0.2487 -0.2329 -0.3665 405 ASN B C   
3145 O O   . ASN B 188 ? 1.3648 1.6325 1.6046 -0.1984 -0.2175 -0.3183 405 ASN B O   
3146 C CB  . ASN B 188 ? 1.5715 1.7947 1.9362 -0.3642 -0.2201 -0.4457 405 ASN B CB  
3147 C CG  . ASN B 188 ? 2.2190 2.4336 2.5344 -0.3975 -0.2463 -0.5224 405 ASN B CG  
3148 O OD1 . ASN B 188 ? 2.2655 2.5769 2.6129 -0.4409 -0.2859 -0.5661 405 ASN B OD1 
3149 N ND2 . ASN B 188 ? 2.1963 2.3003 2.4322 -0.3781 -0.2250 -0.5431 405 ASN B ND2 
3150 N N   . GLY B 189 ? 1.4421 1.8481 1.7295 -0.2674 -0.2758 -0.3963 406 GLY B N   
3151 C CA  . GLY B 189 ? 1.4246 1.9457 1.6872 -0.2217 -0.3065 -0.3689 406 GLY B CA  
3152 C C   . GLY B 189 ? 1.4027 1.9817 1.7213 -0.1896 -0.2983 -0.3055 406 GLY B C   
3153 O O   . GLY B 189 ? 1.3495 1.9006 1.6345 -0.1354 -0.2807 -0.2549 406 GLY B O   
3154 N N   . GLU B 190 ? 1.3579 2.0161 1.7636 -0.2240 -0.3085 -0.3088 407 GLU B N   
3155 C CA  . GLU B 190 ? 1.2968 2.0158 1.7616 -0.1932 -0.2973 -0.2518 407 GLU B CA  
3156 C C   . GLU B 190 ? 1.2818 1.8839 1.7604 -0.1862 -0.2488 -0.2206 407 GLU B C   
3157 O O   . GLU B 190 ? 1.2488 1.8389 1.7206 -0.1369 -0.2293 -0.1709 407 GLU B O   
3158 C CB  . GLU B 190 ? 1.3257 2.1826 1.8834 -0.2328 -0.3230 -0.2647 407 GLU B CB  
3159 C CG  . GLU B 190 ? 1.5232 2.5322 2.0722 -0.2283 -0.3754 -0.2842 407 GLU B CG  
3160 C CD  . GLU B 190 ? 1.8883 3.0633 2.5369 -0.2589 -0.4031 -0.2855 407 GLU B CD  
3161 O OE1 . GLU B 190 ? 1.7534 2.9849 2.4570 -0.2226 -0.3859 -0.2290 407 GLU B OE1 
3162 O OE2 . GLU B 190 ? 1.9399 3.1945 2.6109 -0.3184 -0.4424 -0.3445 407 GLU B OE2 
3163 N N   . ASN B 191 ? 1.2116 1.7251 1.7046 -0.2338 -0.2284 -0.2508 408 ASN B N   
3164 C CA  . ASN B 191 ? 1.1492 1.5597 1.6527 -0.2306 -0.1837 -0.2246 408 ASN B CA  
3165 C C   . ASN B 191 ? 1.1437 1.4543 1.5665 -0.1889 -0.1644 -0.2062 408 ASN B C   
3166 O O   . ASN B 191 ? 1.1893 1.4284 1.5652 -0.2006 -0.1604 -0.2343 408 ASN B O   
3167 C CB  . ASN B 191 ? 1.1370 1.4903 1.6800 -0.2920 -0.1676 -0.2598 408 ASN B CB  
3168 C CG  . ASN B 191 ? 1.2552 1.5376 1.8309 -0.2928 -0.1220 -0.2269 408 ASN B CG  
3169 O OD1 . ASN B 191 ? 1.1779 1.3611 1.7440 -0.3148 -0.0952 -0.2398 408 ASN B OD1 
3170 N ND2 . ASN B 191 ? 1.1097 1.4439 1.7238 -0.2663 -0.1099 -0.1831 408 ASN B ND2 
3171 N N   . LYS B 192 ? 1.0107 1.3192 1.4181 -0.1410 -0.1522 -0.1609 409 LYS B N   
3172 C CA  . LYS B 192 ? 0.9860 1.2130 1.3277 -0.1068 -0.1354 -0.1408 409 LYS B CA  
3173 C C   . LYS B 192 ? 0.9924 1.1723 1.3460 -0.0885 -0.1038 -0.1064 409 LYS B C   
3174 O O   . LYS B 192 ? 0.9836 1.2123 1.3806 -0.0789 -0.0996 -0.0875 409 LYS B O   
3175 C CB  . LYS B 192 ? 1.0174 1.2858 1.3166 -0.0651 -0.1540 -0.1216 409 LYS B CB  
3176 C CG  . LYS B 192 ? 1.1167 1.4385 1.3835 -0.0699 -0.1859 -0.1505 409 LYS B CG  
3177 C CD  . LYS B 192 ? 1.1960 1.5474 1.4168 -0.0194 -0.1939 -0.1163 409 LYS B CD  
3178 C CE  . LYS B 192 ? 1.2941 1.7360 1.4873 -0.0127 -0.2292 -0.1350 409 LYS B CE  
3179 N NZ  . LYS B 192 ? 1.3753 1.9411 1.6210 -0.0098 -0.2549 -0.1296 409 LYS B NZ  
3180 N N   . PRO B 193 ? 0.9112 1.0078 1.2248 -0.0793 -0.0822 -0.0968 410 PRO B N   
3181 C CA  . PRO B 193 ? 0.8698 0.9340 1.1881 -0.0622 -0.0572 -0.0696 410 PRO B CA  
3182 C C   . PRO B 193 ? 0.8752 0.9558 1.1781 -0.0251 -0.0601 -0.0453 410 PRO B C   
3183 O O   . PRO B 193 ? 0.8877 0.9907 1.1676 -0.0086 -0.0775 -0.0417 410 PRO B O   
3184 C CB  . PRO B 193 ? 0.8938 0.8837 1.1713 -0.0635 -0.0407 -0.0687 410 PRO B CB  
3185 C CG  . PRO B 193 ? 0.9819 0.9581 1.2420 -0.0814 -0.0500 -0.0948 410 PRO B CG  
3186 C CD  . PRO B 193 ? 0.9423 0.9810 1.2050 -0.0816 -0.0794 -0.1099 410 PRO B CD  
3187 N N   . ILE B 194 ? 0.7913 0.8576 1.1037 -0.0093 -0.0403 -0.0280 411 ILE B N   
3188 C CA  . ILE B 194 ? 0.7786 0.8406 1.0755 0.0274  -0.0350 -0.0077 411 ILE B CA  
3189 C C   . ILE B 194 ? 0.8372 0.8510 1.0836 0.0406  -0.0391 -0.0006 411 ILE B C   
3190 O O   . ILE B 194 ? 0.8741 0.9050 1.1124 0.0676  -0.0452 0.0156  411 ILE B O   
3191 C CB  . ILE B 194 ? 0.8054 0.8480 1.1093 0.0419  -0.0095 0.0015  411 ILE B CB  
3192 C CG1 . ILE B 194 ? 0.8337 0.8684 1.1243 0.0838  -0.0005 0.0184  411 ILE B CG1 
3193 C CG2 . ILE B 194 ? 0.7940 0.7741 1.0658 0.0287  0.0049  -0.0051 411 ILE B CG2 
3194 C CD1 . ILE B 194 ? 0.8892 1.0021 1.2187 0.1088  -0.0073 0.0341  411 ILE B CD1 
3195 N N   . TRP B 195 ? 0.7620 0.7238 0.9788 0.0233  -0.0340 -0.0077 412 TRP B N   
3196 C CA  . TRP B 195 ? 0.7730 0.6948 0.9500 0.0295  -0.0350 0.0019  412 TRP B CA  
3197 C C   . TRP B 195 ? 0.8727 0.8274 1.0368 0.0392  -0.0521 0.0077  412 TRP B C   
3198 O O   . TRP B 195 ? 0.8837 0.8212 1.0256 0.0591  -0.0495 0.0288  412 TRP B O   
3199 C CB  . TRP B 195 ? 0.7372 0.6187 0.8945 0.0093  -0.0266 -0.0039 412 TRP B CB  
3200 C CG  . TRP B 195 ? 0.7338 0.6280 0.8961 -0.0088 -0.0298 -0.0175 412 TRP B CG  
3201 C CD1 . TRP B 195 ? 0.7590 0.6546 0.9427 -0.0226 -0.0204 -0.0269 412 TRP B CD1 
3202 C CD2 . TRP B 195 ? 0.7390 0.6382 0.8808 -0.0114 -0.0384 -0.0222 412 TRP B CD2 
3203 N NE1 . TRP B 195 ? 0.7559 0.6463 0.9346 -0.0348 -0.0211 -0.0386 412 TRP B NE1 
3204 C CE2 . TRP B 195 ? 0.7792 0.6725 0.9292 -0.0274 -0.0328 -0.0387 412 TRP B CE2 
3205 C CE3 . TRP B 195 ? 0.7658 0.6708 0.8798 0.0014  -0.0464 -0.0116 412 TRP B CE3 
3206 C CZ2 . TRP B 195 ? 0.7769 0.6646 0.9042 -0.0300 -0.0352 -0.0511 412 TRP B CZ2 
3207 C CZ3 . TRP B 195 ? 0.7887 0.6998 0.8797 -0.0006 -0.0500 -0.0214 412 TRP B CZ3 
3208 C CH2 . TRP B 195 ? 0.7923 0.6930 0.8884 -0.0158 -0.0452 -0.0443 412 TRP B CH2 
3209 N N   . MET B 196 ? 0.8506 0.8524 1.0275 0.0256  -0.0681 -0.0113 413 MET B N   
3210 C CA  . MET B 196 ? 0.8733 0.9216 1.0322 0.0357  -0.0882 -0.0126 413 MET B CA  
3211 C C   . MET B 196 ? 0.9298 1.0323 1.1011 0.0676  -0.0970 0.0096  413 MET B C   
3212 O O   . MET B 196 ? 0.9385 1.0550 1.0808 0.0939  -0.1016 0.0314  413 MET B O   
3213 C CB  . MET B 196 ? 0.9066 0.9909 1.0780 0.0086  -0.1042 -0.0479 413 MET B CB  
3214 C CG  . MET B 196 ? 0.9648 1.0022 1.1050 -0.0070 -0.0970 -0.0647 413 MET B CG  
3215 S SD  . MET B 196 ? 1.0542 1.1319 1.1809 -0.0258 -0.1203 -0.1084 413 MET B SD  
3216 C CE  . MET B 196 ? 1.0202 1.0256 1.1063 -0.0307 -0.1001 -0.1190 413 MET B CE  
3217 N N   . HIS B 197 ? 0.8969 1.0345 1.1122 0.0700  -0.0957 0.0098  414 HIS B N   
3218 C CA  . HIS B 197 ? 0.9247 1.1221 1.1593 0.1073  -0.0997 0.0357  414 HIS B CA  
3219 C C   . HIS B 197 ? 0.9706 1.1030 1.1767 0.1447  -0.0765 0.0704  414 HIS B C   
3220 O O   . HIS B 197 ? 0.9813 1.1460 1.1798 0.1844  -0.0779 0.1009  414 HIS B O   
3221 C CB  . HIS B 197 ? 0.9302 1.1748 1.2217 0.1020  -0.0959 0.0311  414 HIS B CB  
3222 C CG  . HIS B 197 ? 0.9799 1.3062 1.3134 0.0665  -0.1195 0.0029  414 HIS B CG  
3223 N ND1 . HIS B 197 ? 1.0323 1.4539 1.3714 0.0699  -0.1506 -0.0023 414 HIS B ND1 
3224 C CD2 . HIS B 197 ? 0.9999 1.3264 1.3730 0.0263  -0.1146 -0.0204 414 HIS B CD2 
3225 C CE1 . HIS B 197 ? 1.0266 1.4993 1.4101 0.0251  -0.1660 -0.0353 414 HIS B CE1 
3226 N NE2 . HIS B 197 ? 1.0103 1.4234 1.4180 -0.0021 -0.1425 -0.0443 414 HIS B NE2 
3227 N N   . ALA B 198 ? 0.9202 0.9617 1.1103 0.1310  -0.0549 0.0654  415 ALA B N   
3228 C CA  . ALA B 198 ? 0.9430 0.9028 1.1065 0.1518  -0.0311 0.0870  415 ALA B CA  
3229 C C   . ALA B 198 ? 1.0216 0.9569 1.1502 0.1574  -0.0315 0.1076  415 ALA B C   
3230 O O   . ALA B 198 ? 1.0617 0.9642 1.1761 0.1894  -0.0160 0.1400  415 ALA B O   
3231 C CB  . ALA B 198 ? 0.9357 0.8246 1.0922 0.1247  -0.0156 0.0660  415 ALA B CB  
3232 N N   . GLU B 199 ? 0.9594 0.9089 1.0742 0.1301  -0.0451 0.0923  416 GLU B N   
3233 C CA  . GLU B 199 ? 0.9774 0.9152 1.0592 0.1358  -0.0433 0.1132  416 GLU B CA  
3234 C C   . GLU B 199 ? 1.0892 1.0984 1.1591 0.1723  -0.0564 0.1373  416 GLU B C   
3235 O O   . GLU B 199 ? 1.1462 1.1378 1.1916 0.1972  -0.0438 0.1746  416 GLU B O   
3236 C CB  . GLU B 199 ? 0.9601 0.8909 1.0283 0.1019  -0.0484 0.0906  416 GLU B CB  
3237 C CG  . GLU B 199 ? 1.0614 0.9269 1.1354 0.0742  -0.0328 0.0814  416 GLU B CG  
3238 C CD  . GLU B 199 ? 1.3449 1.2017 1.4067 0.0492  -0.0309 0.0729  416 GLU B CD  
3239 O OE1 . GLU B 199 ? 1.4308 1.2740 1.4758 0.0505  -0.0218 0.0961  416 GLU B OE1 
3240 O OE2 . GLU B 199 ? 1.3368 1.1981 1.4096 0.0299  -0.0339 0.0479  416 GLU B OE2 
3241 N N   . GLU B 200 ? 1.0312 1.1260 1.1214 0.1757  -0.0806 0.1188  417 GLU B N   
3242 C CA  . GLU B 200 ? 1.0514 1.2411 1.1336 0.2102  -0.1002 0.1370  417 GLU B CA  
3243 C C   . GLU B 200 ? 1.1331 1.3283 1.2272 0.2605  -0.0844 0.1829  417 GLU B C   
3244 O O   . GLU B 200 ? 1.1812 1.4250 1.2545 0.3030  -0.0867 0.2208  417 GLU B O   
3245 C CB  . GLU B 200 ? 1.0427 1.3256 1.1510 0.1870  -0.1330 0.0959  417 GLU B CB  
3246 C CG  . GLU B 200 ? 1.1499 1.4316 1.2324 0.1499  -0.1479 0.0541  417 GLU B CG  
3247 C CD  . GLU B 200 ? 1.4813 1.8365 1.5880 0.1172  -0.1780 0.0058  417 GLU B CD  
3248 O OE1 . GLU B 200 ? 1.4213 1.8294 1.5803 0.1111  -0.1868 0.0012  417 GLU B OE1 
3249 O OE2 . GLU B 200 ? 1.4004 1.7570 1.4747 0.0961  -0.1904 -0.0287 417 GLU B OE2 
3250 N N   . ARG B 201 ? 1.1105 1.4042 1.4568 0.2612  -0.2010 0.0878  418 ARG B N   
3251 C CA  . ARG B 201 ? 1.1155 1.3975 1.4754 0.2590  -0.2035 0.0946  418 ARG B CA  
3252 C C   . ARG B 201 ? 1.1898 1.4679 1.5759 0.2588  -0.1918 0.1221  418 ARG B C   
3253 O O   . ARG B 201 ? 1.2213 1.4956 1.6136 0.2656  -0.1916 0.1390  418 ARG B O   
3254 C CB  . ARG B 201 ? 1.1061 1.3793 1.4849 0.2449  -0.2130 0.0764  418 ARG B CB  
3255 C CG  . ARG B 201 ? 1.2867 1.5616 1.6554 0.2459  -0.2237 0.0594  418 ARG B CG  
3256 C CD  . ARG B 201 ? 1.4467 1.7245 1.8340 0.2355  -0.2306 0.0455  418 ARG B CD  
3257 N NE  . ARG B 201 ? 1.6250 1.9061 2.0194 0.2373  -0.2412 0.0345  418 ARG B NE  
3258 C CZ  . ARG B 201 ? 1.8494 2.1446 2.2564 0.2322  -0.2493 0.0174  418 ARG B CZ  
3259 N NH1 . ARG B 201 ? 1.6251 1.9328 2.0345 0.2274  -0.2460 0.0136  418 ARG B NH1 
3260 N NH2 . ARG B 201 ? 1.7509 2.0519 2.1660 0.2345  -0.2613 0.0033  418 ARG B NH2 
3261 N N   . GLU B 202 ? 1.1288 1.4067 1.5367 0.2511  -0.1829 0.1266  419 GLU B N   
3262 C CA  . GLU B 202 ? 1.1339 1.4094 1.5828 0.2492  -0.1692 0.1526  419 GLU B CA  
3263 C C   . GLU B 202 ? 1.2347 1.5288 1.6620 0.2636  -0.1518 0.1858  419 GLU B C   
3264 O O   . GLU B 202 ? 1.2600 1.5511 1.7151 0.2664  -0.1418 0.2184  419 GLU B O   
3265 C CB  . GLU B 202 ? 1.1312 1.4042 1.6083 0.2398  -0.1647 0.1414  419 GLU B CB  
3266 C CG  . GLU B 202 ? 1.1858 1.4452 1.7250 0.2330  -0.1724 0.1309  419 GLU B CG  
3267 C CD  . GLU B 202 ? 1.3725 1.6272 1.9770 0.2325  -0.1634 0.1581  419 GLU B CD  
3268 O OE1 . GLU B 202 ? 1.3898 1.6519 2.0041 0.2332  -0.1420 0.1874  419 GLU B OE1 
3269 O OE2 . GLU B 202 ? 1.2441 1.4912 1.8994 0.2319  -0.1785 0.1486  419 GLU B OE2 
3270 N N   . GLU B 203 ? 1.2010 1.5187 1.5823 0.2756  -0.1502 0.1776  420 GLU B N   
3271 C CA  . GLU B 203 ? 1.2268 1.5779 1.5776 0.2977  -0.1356 0.2029  420 GLU B CA  
3272 C C   . GLU B 203 ? 1.2791 1.6337 1.6069 0.3171  -0.1360 0.2239  420 GLU B C   
3273 O O   . GLU B 203 ? 1.3088 1.6949 1.6109 0.3400  -0.1214 0.2523  420 GLU B O   
3274 C CB  . GLU B 203 ? 1.2391 1.6215 1.5542 0.3106  -0.1428 0.1763  420 GLU B CB  
3275 C CG  . GLU B 203 ? 1.4112 1.8012 1.7441 0.2986  -0.1374 0.1664  420 GLU B CG  
3276 C CD  . GLU B 203 ? 1.7874 2.1961 2.1417 0.2984  -0.1112 0.1997  420 GLU B CD  
3277 O OE1 . GLU B 203 ? 1.8752 2.3160 2.2108 0.3186  -0.0945 0.2330  420 GLU B OE1 
3278 O OE2 . GLU B 203 ? 1.6511 2.0455 2.0416 0.2803  -0.1066 0.1922  420 GLU B OE2 
3279 N N   . SER B 204 ? 1.2075 1.5340 1.5435 0.3103  -0.1528 0.2097  421 SER B N   
3280 C CA  . SER B 204 ? 1.4966 1.8192 1.8141 0.3272  -0.1587 0.2221  421 SER B CA  
3281 C C   . SER B 204 ? 1.5245 1.8138 1.8890 0.3102  -0.1682 0.2275  421 SER B C   
3282 O O   . SER B 204 ? 0.9628 1.2427 1.3772 0.2999  -0.1577 0.2571  421 SER B O   
3283 C CB  . SER B 204 ? 1.5270 1.8580 1.8036 0.3432  -0.1774 0.1838  421 SER B CB  
3284 O OG  . SER B 204 ? 1.5814 1.8926 1.8756 0.3223  -0.1932 0.1472  421 SER B OG  
3285 N N   . LYS B 222 ? 1.3145 1.6748 1.7420 0.1907  -0.2057 0.0338  439 LYS B N   
3286 C CA  . LYS B 222 ? 1.3323 1.7068 1.7855 0.1813  -0.1923 0.0525  439 LYS B CA  
3287 C C   . LYS B 222 ? 1.4206 1.7734 1.8923 0.1767  -0.1914 0.0725  439 LYS B C   
3288 O O   . LYS B 222 ? 1.4264 1.7849 1.9335 0.1677  -0.1815 0.0925  439 LYS B O   
3289 C CB  . LYS B 222 ? 1.3598 1.7419 1.8471 0.1763  -0.1905 0.0365  439 LYS B CB  
3290 C CG  . LYS B 222 ? 1.4681 1.8856 1.9763 0.1674  -0.1721 0.0536  439 LYS B CG  
3291 C CD  . LYS B 222 ? 1.5041 1.9268 2.0553 0.1619  -0.1705 0.0328  439 LYS B CD  
3292 C CE  . LYS B 222 ? 1.4991 1.9591 2.0819 0.1509  -0.1476 0.0551  439 LYS B CE  
3293 N NZ  . LYS B 222 ? 1.5134 1.9728 2.1551 0.1442  -0.1456 0.0334  439 LYS B NZ  
3294 N N   . ALA B 223 ? 1.3953 1.7256 1.8490 0.1825  -0.2021 0.0679  440 ALA B N   
3295 C CA  . ALA B 223 ? 1.4098 1.7211 1.8799 0.1802  -0.2075 0.0794  440 ALA B CA  
3296 C C   . ALA B 223 ? 1.4849 1.7981 1.9313 0.1805  -0.2018 0.1024  440 ALA B C   
3297 O O   . ALA B 223 ? 1.4751 1.7699 1.9177 0.1822  -0.2106 0.1040  440 ALA B O   
3298 C CB  . ALA B 223 ? 1.4091 1.7037 1.8717 0.1889  -0.2221 0.0588  440 ALA B CB  
3299 N N   . CYS B 224 ? 1.4618 1.8024 1.8919 0.1823  -0.1886 0.1171  441 CYS B N   
3300 C CA  . CYS B 224 ? 1.4808 1.8328 1.8829 0.1908  -0.1837 0.1358  441 CYS B CA  
3301 C C   . CYS B 224 ? 1.5640 1.9543 1.9647 0.1927  -0.1653 0.1645  441 CYS B C   
3302 O O   . CYS B 224 ? 1.5813 1.9678 2.0063 0.1849  -0.1560 0.1971  441 CYS B O   
3303 C CB  . CYS B 224 ? 1.4714 1.8271 1.8401 0.2051  -0.1924 0.1127  441 CYS B CB  
3304 S SG  . CYS B 224 ? 1.5030 1.8944 1.8651 0.2131  -0.1929 0.0896  441 CYS B SG  
3305 N N   . LYS B 225 ? 1.5235 1.9552 1.9002 0.2049  -0.1609 0.1532  442 LYS B N   
3306 C CA  . LYS B 225 ? 1.5431 2.0288 1.9103 0.2132  -0.1433 0.1753  442 LYS B CA  
3307 C C   . LYS B 225 ? 1.6249 2.1225 1.9703 0.2257  -0.1334 0.2133  442 LYS B C   
3308 O O   . LYS B 225 ? 1.6491 2.1876 1.9936 0.2297  -0.1128 0.2482  442 LYS B O   
3309 C CB  . LYS B 225 ? 1.5735 2.0708 1.9815 0.1951  -0.1285 0.1868  442 LYS B CB  
3310 C CG  . LYS B 225 ? 1.6753 2.2375 2.0742 0.2035  -0.1155 0.1855  442 LYS B CG  
3311 C CD  . LYS B 225 ? 1.7638 2.3420 2.2092 0.1854  -0.0934 0.2093  442 LYS B CD  
3312 C CE  . LYS B 225 ? 1.9246 2.5004 2.3953 0.1777  -0.0718 0.2665  442 LYS B CE  
3313 N NZ  . LYS B 225 ? 2.0737 2.7022 2.4993 0.1996  -0.0562 0.3012  442 LYS B NZ  
3314 N N   . VAL B 226 ? 1.5751 2.0399 1.9018 0.2340  -0.1477 0.2060  443 VAL B N   
3315 C CA  . VAL B 226 ? 1.6052 2.0682 1.9092 0.2476  -0.1448 0.2352  443 VAL B CA  
3316 C C   . VAL B 226 ? 1.6676 2.1913 1.9264 0.2820  -0.1390 0.2385  443 VAL B C   
3317 O O   . VAL B 226 ? 1.6375 2.1742 1.8742 0.3046  -0.1551 0.2001  443 VAL B O   
3318 C CB  . VAL B 226 ? 1.6494 2.0570 1.9530 0.2447  -0.1644 0.2204  443 VAL B CB  
3319 C CG1 . VAL B 226 ? 1.6871 2.0776 1.9901 0.2461  -0.1616 0.2604  443 VAL B CG1 
3320 C CG2 . VAL B 226 ? 1.6127 1.9786 1.9537 0.2210  -0.1755 0.1985  443 VAL B CG2 
3321 N N   . ASP B 227 ? 1.3294 1.4312 2.0583 -0.1059 0.2782  0.3334  444 ASP B N   
3322 C CA  . ASP B 227 ? 1.3963 1.5523 2.0361 -0.0639 0.3429  0.3730  444 ASP B CA  
3323 C C   . ASP B 227 ? 1.4756 1.5883 1.9752 -0.0381 0.3414  0.3787  444 ASP B C   
3324 O O   . ASP B 227 ? 1.5437 1.7004 1.9411 0.0082  0.3859  0.3945  444 ASP B O   
3325 C CB  . ASP B 227 ? 1.4743 1.7198 2.2275 -0.0740 0.4062  0.4652  444 ASP B CB  
3326 C CG  . ASP B 227 ? 1.6189 1.9379 2.4980 -0.0826 0.4199  0.4603  444 ASP B CG  
3327 O OD1 . ASP B 227 ? 1.5862 1.8884 2.4417 -0.0701 0.3860  0.3842  444 ASP B OD1 
3328 O OD2 . ASP B 227 ? 1.7126 2.1104 2.7214 -0.1009 0.4652  0.5385  444 ASP B OD2 
3329 N N   . SER B 228 ? 1.3677 1.4000 1.8590 -0.0610 0.2885  0.3625  445 SER B N   
3330 C CA  . SER B 228 ? 1.3852 1.3782 1.7588 -0.0371 0.2772  0.3657  445 SER B CA  
3331 C C   . SER B 228 ? 1.3896 1.3761 1.6298 0.0032  0.2604  0.2908  445 SER B C   
3332 O O   . SER B 228 ? 1.3156 1.2837 1.5691 -0.0035 0.2304  0.2260  445 SER B O   
3333 C CB  . SER B 228 ? 1.3886 1.3028 1.8053 -0.0675 0.2237  0.3611  445 SER B CB  
3334 O OG  . SER B 228 ? 1.4622 1.3384 1.7703 -0.0422 0.1985  0.3413  445 SER B OG  
3335 N N   . PRO B 229 ? 1.3876 1.3881 1.5038 0.0458  0.2751  0.2998  446 PRO B N   
3336 C CA  . PRO B 229 ? 1.3775 1.3651 1.3853 0.0800  0.2469  0.2224  446 PRO B CA  
3337 C C   . PRO B 229 ? 1.3572 1.2815 1.3569 0.0624  0.1834  0.1750  446 PRO B C   
3338 O O   . PRO B 229 ? 1.3256 1.2330 1.2988 0.0689  0.1527  0.1086  446 PRO B O   
3339 C CB  . PRO B 229 ? 1.5134 1.5404 1.3938 0.1341  0.2761  0.2481  446 PRO B CB  
3340 C CG  . PRO B 229 ? 1.6249 1.6905 1.5468 0.1279  0.3281  0.3511  446 PRO B CG  
3341 C CD  . PRO B 229 ? 1.4960 1.5236 1.5666 0.0664  0.3121  0.3813  446 PRO B CD  
3342 N N   . THR B 230 ? 1.2816 1.1728 1.3138 0.0419  0.1652  0.2128  447 THR B N   
3343 C CA  . THR B 230 ? 1.2202 1.0628 1.2583 0.0296  0.1121  0.1783  447 THR B CA  
3344 C C   . THR B 230 ? 1.1600 0.9844 1.2775 0.0001  0.0916  0.1341  447 THR B C   
3345 O O   . THR B 230 ? 1.1189 0.9289 1.2235 0.0004  0.0590  0.0856  447 THR B O   
3346 C CB  . THR B 230 ? 1.2640 1.0761 1.3253 0.0229  0.1037  0.2340  447 THR B CB  
3347 O OG1 . THR B 230 ? 1.3462 1.1864 1.3417 0.0508  0.1363  0.2959  447 THR B OG1 
3348 C CG2 . THR B 230 ? 1.1623 0.9391 1.2082 0.0277  0.0535  0.2013  447 THR B CG2 
3349 N N   . VAL B 231 ? 1.0770 0.9099 1.2793 -0.0235 0.1111  0.1552  448 VAL B N   
3350 C CA  . VAL B 231 ? 0.9965 0.8212 1.2684 -0.0453 0.0924  0.1192  448 VAL B CA  
3351 C C   . VAL B 231 ? 1.0289 0.8761 1.2702 -0.0314 0.0976  0.0767  448 VAL B C   
3352 O O   . VAL B 231 ? 0.9880 0.8196 1.2362 -0.0361 0.0704  0.0376  448 VAL B O   
3353 C CB  . VAL B 231 ? 1.0356 0.8700 1.4127 -0.0721 0.1040  0.1519  448 VAL B CB  
3354 C CG1 . VAL B 231 ? 0.9722 0.8089 1.4029 -0.0847 0.0807  0.1092  448 VAL B CG1 
3355 C CG2 . VAL B 231 ? 1.0661 0.8580 1.4942 -0.0899 0.0860  0.1868  448 VAL B CG2 
3356 N N   . ASN B 232 ? 1.0174 0.9017 1.2250 -0.0096 0.1339  0.0865  449 ASN B N   
3357 C CA  . ASN B 232 ? 1.0069 0.9020 1.1880 0.0100  0.1360  0.0419  449 ASN B CA  
3358 C C   . ASN B 232 ? 1.0600 0.9207 1.1847 0.0184  0.0975  -0.0046 449 ASN B C   
3359 O O   . ASN B 232 ? 1.0334 0.8802 1.1772 0.0160  0.0802  -0.0404 449 ASN B O   
3360 C CB  . ASN B 232 ? 1.0777 1.0200 1.2224 0.0439  0.1822  0.0550  449 ASN B CB  
3361 C CG  . ASN B 232 ? 1.4033 1.3973 1.6354 0.0338  0.2238  0.1009  449 ASN B CG  
3362 O OD1 . ASN B 232 ? 1.1243 1.1227 1.4434 0.0122  0.2136  0.0931  449 ASN B OD1 
3363 N ND2 . ASN B 232 ? 1.4106 1.4544 1.6239 0.0530  0.2728  0.1532  449 ASN B ND2 
3364 N N   . THR B 233 ? 1.0419 0.8902 1.1136 0.0250  0.0808  0.0024  450 THR B N   
3365 C CA  . THR B 233 ? 1.0440 0.8697 1.0837 0.0284  0.0390  -0.0361 450 THR B CA  
3366 C C   . THR B 233 ? 1.0215 0.8308 1.1276 0.0004  0.0151  -0.0430 450 THR B C   
3367 O O   . THR B 233 ? 1.0043 0.8048 1.1272 -0.0050 -0.0077 -0.0729 450 THR B O   
3368 C CB  . THR B 233 ? 1.1925 1.0203 1.1639 0.0472  0.0260  -0.0215 450 THR B CB  
3369 O OG1 . THR B 233 ? 1.3137 1.1668 1.2100 0.0818  0.0544  -0.0108 450 THR B OG1 
3370 C CG2 . THR B 233 ? 1.1309 0.9463 1.0844 0.0502  -0.0233 -0.0624 450 THR B CG2 
3371 N N   . THR B 234 ? 0.9271 0.7331 1.0731 -0.0143 0.0202  -0.0141 451 THR B N   
3372 C CA  . THR B 234 ? 0.8626 0.6600 1.0560 -0.0289 0.0012  -0.0220 451 THR B CA  
3373 C C   . THR B 234 ? 0.8742 0.6788 1.1031 -0.0361 0.0044  -0.0388 451 THR B C   
3374 O O   . THR B 234 ? 0.8442 0.6509 1.0864 -0.0387 -0.0105 -0.0523 451 THR B O   
3375 C CB  . THR B 234 ? 0.8522 0.6361 1.0764 -0.0359 0.0016  0.0025  451 THR B CB  
3376 O OG1 . THR B 234 ? 0.9271 0.7004 1.1181 -0.0257 -0.0017 0.0253  451 THR B OG1 
3377 C CG2 . THR B 234 ? 0.7429 0.5195 1.0003 -0.0385 -0.0193 -0.0143 451 THR B CG2 
3378 N N   . LEU B 235 ? 0.8162 0.6306 1.0672 -0.0377 0.0252  -0.0306 452 LEU B N   
3379 C CA  . LEU B 235 ? 0.7819 0.6055 1.0677 -0.0390 0.0278  -0.0416 452 LEU B CA  
3380 C C   . LEU B 235 ? 0.8940 0.7072 1.1633 -0.0308 0.0207  -0.0643 452 LEU B C   
3381 O O   . LEU B 235 ? 0.8822 0.6922 1.1778 -0.0355 0.0086  -0.0674 452 LEU B O   
3382 C CB  . LEU B 235 ? 0.7816 0.6284 1.0982 -0.0371 0.0533  -0.0271 452 LEU B CB  
3383 C CG  . LEU B 235 ? 0.8138 0.6699 1.1866 -0.0538 0.0515  -0.0049 452 LEU B CG  
3384 C CD1 . LEU B 235 ? 0.8097 0.7034 1.2289 -0.0541 0.0827  0.0197  452 LEU B CD1 
3385 C CD2 . LEU B 235 ? 0.8175 0.6704 1.2247 -0.0597 0.0217  -0.0215 452 LEU B CD2 
3386 N N   . ARG B 236 ? 0.9279 0.7342 1.1534 -0.0163 0.0247  -0.0791 453 ARG B N   
3387 C CA  . ARG B 236 ? 0.9754 0.7591 1.1916 -0.0078 0.0071  -0.1110 453 ARG B CA  
3388 C C   . ARG B 236 ? 1.0256 0.7983 1.2626 -0.0247 -0.0235 -0.1146 453 ARG B C   
3389 O O   . ARG B 236 ? 1.0437 0.8008 1.3230 -0.0328 -0.0374 -0.1211 453 ARG B O   
3390 C CB  . ARG B 236 ? 1.0640 0.8445 1.2154 0.0204  0.0115  -0.1361 453 ARG B CB  
3391 C CG  . ARG B 236 ? 1.1850 0.9762 1.3350 0.0456  0.0402  -0.1454 453 ARG B CG  
3392 C CD  . ARG B 236 ? 1.3202 1.1206 1.3895 0.0861  0.0523  -0.1699 453 ARG B CD  
3393 N NE  . ARG B 236 ? 1.4085 1.2574 1.4767 0.1063  0.1033  -0.1415 453 ARG B NE  
3394 C CZ  . ARG B 236 ? 1.5450 1.4344 1.5806 0.1127  0.1355  -0.0999 453 ARG B CZ  
3395 N NH1 . ARG B 236 ? 1.2265 1.1070 1.2136 0.1064  0.1187  -0.0868 453 ARG B NH1 
3396 N NH2 . ARG B 236 ? 1.3689 1.3119 1.4282 0.1269  0.1853  -0.0656 453 ARG B NH2 
3397 N N   . SER B 237 ? 0.9560 0.7409 1.1759 -0.0295 -0.0315 -0.1028 454 SER B N   
3398 C CA  . SER B 237 ? 0.9326 0.7251 1.1826 -0.0422 -0.0555 -0.1003 454 SER B CA  
3399 C C   . SER B 237 ? 0.9129 0.7232 1.2115 -0.0527 -0.0463 -0.0764 454 SER B C   
3400 O O   . SER B 237 ? 0.9019 0.7200 1.2474 -0.0636 -0.0558 -0.0690 454 SER B O   
3401 C CB  . SER B 237 ? 1.0029 0.8078 1.2211 -0.0357 -0.0656 -0.0935 454 SER B CB  
3402 O OG  . SER B 237 ? 1.2042 1.0004 1.3636 -0.0190 -0.0770 -0.1117 454 SER B OG  
3403 N N   . LEU B 238 ? 0.8439 0.6631 1.1344 -0.0478 -0.0301 -0.0628 455 LEU B N   
3404 C CA  . LEU B 238 ? 0.8141 0.6541 1.1305 -0.0466 -0.0253 -0.0473 455 LEU B CA  
3405 C C   . LEU B 238 ? 0.8822 0.7179 1.2269 -0.0495 -0.0203 -0.0399 455 LEU B C   
3406 O O   . LEU B 238 ? 0.8742 0.7301 1.2459 -0.0496 -0.0181 -0.0179 455 LEU B O   
3407 C CB  . LEU B 238 ? 0.7955 0.6383 1.0985 -0.0376 -0.0226 -0.0472 455 LEU B CB  
3408 C CG  . LEU B 238 ? 0.8346 0.7030 1.1416 -0.0234 -0.0244 -0.0417 455 LEU B CG  
3409 C CD1 . LEU B 238 ? 0.8349 0.7363 1.1492 -0.0153 -0.0215 -0.0285 455 LEU B CD1 
3410 C CD2 . LEU B 238 ? 0.8520 0.7104 1.1479 -0.0128 -0.0362 -0.0570 455 LEU B CD2 
3411 N N   . GLY B 239 ? 0.8460 0.6588 1.1860 -0.0476 -0.0163 -0.0538 456 GLY B N   
3412 C CA  . GLY B 239 ? 0.8609 0.6595 1.2307 -0.0450 -0.0148 -0.0507 456 GLY B CA  
3413 C C   . GLY B 239 ? 0.9417 0.7235 1.3492 -0.0570 -0.0294 -0.0461 456 GLY B C   
3414 O O   . GLY B 239 ? 0.9352 0.7221 1.3838 -0.0608 -0.0278 -0.0161 456 GLY B O   
3415 N N   . ALA B 240 ? 0.9261 0.6927 1.3247 -0.0632 -0.0465 -0.0708 457 ALA B N   
3416 C CA  . ALA B 240 ? 0.9479 0.6988 1.3999 -0.0804 -0.0718 -0.0731 457 ALA B CA  
3417 C C   . ALA B 240 ? 0.9813 0.7744 1.4870 -0.0955 -0.0649 -0.0266 457 ALA B C   
3418 O O   . ALA B 240 ? 1.0134 0.7992 1.5910 -0.1108 -0.0701 0.0002  457 ALA B O   
3419 C CB  . ALA B 240 ? 0.9872 0.7290 1.4097 -0.0795 -0.0980 -0.1107 457 ALA B CB  
3420 N N   . LEU B 241 ? 0.8911 0.7290 1.3657 -0.0874 -0.0507 -0.0138 458 LEU B N   
3421 C CA  . LEU B 241 ? 0.8569 0.7503 1.3665 -0.0879 -0.0358 0.0280  458 LEU B CA  
3422 C C   . LEU B 241 ? 0.8894 0.7985 1.4114 -0.0793 -0.0134 0.0686  458 LEU B C   
3423 O O   . LEU B 241 ? 0.8861 0.8311 1.4657 -0.0863 -0.0014 0.1159  458 LEU B O   
3424 C CB  . LEU B 241 ? 0.8291 0.7555 1.2891 -0.0685 -0.0278 0.0203  458 LEU B CB  
3425 C CG  . LEU B 241 ? 0.8741 0.8271 1.3556 -0.0722 -0.0423 0.0147  458 LEU B CG  
3426 C CD1 . LEU B 241 ? 0.8597 0.8278 1.2897 -0.0469 -0.0364 0.0041  458 LEU B CD1 
3427 C CD2 . LEU B 241 ? 0.8980 0.9082 1.4636 -0.0829 -0.0351 0.0549  458 LEU B CD2 
3428 N N   . TYR B 242 ? 0.8357 0.7249 1.3094 -0.0628 -0.0081 0.0561  459 TYR B N   
3429 C CA  . TYR B 242 ? 0.8420 0.7466 1.3152 -0.0476 0.0055  0.0911  459 TYR B CA  
3430 C C   . TYR B 242 ? 0.9514 0.8267 1.4933 -0.0630 0.0026  0.1228  459 TYR B C   
3431 O O   . TYR B 242 ? 0.9769 0.8807 1.5453 -0.0567 0.0183  0.1790  459 TYR B O   
3432 C CB  . TYR B 242 ? 0.8437 0.7358 1.2671 -0.0292 0.0017  0.0646  459 TYR B CB  
3433 C CG  . TYR B 242 ? 0.8440 0.7642 1.2145 -0.0109 0.0002  0.0449  459 TYR B CG  
3434 C CD1 . TYR B 242 ? 0.8868 0.8547 1.2355 0.0088  0.0094  0.0625  459 TYR B CD1 
3435 C CD2 . TYR B 242 ? 0.8326 0.7334 1.1824 -0.0096 -0.0106 0.0103  459 TYR B CD2 
3436 C CE1 . TYR B 242 ? 0.9037 0.8856 1.2041 0.0320  0.0002  0.0334  459 TYR B CE1 
3437 C CE2 . TYR B 242 ? 0.8416 0.7552 1.1598 0.0043  -0.0208 -0.0102 459 TYR B CE2 
3438 C CZ  . TYR B 242 ? 0.9216 0.8692 1.2114 0.0269  -0.0192 -0.0044 459 TYR B CZ  
3439 O OH  . TYR B 242 ? 0.8635 0.8130 1.1218 0.0468  -0.0365 -0.0352 459 TYR B OH  
3440 N N   . ARG B 243 ? 0.9331 0.7499 1.5030 -0.0793 -0.0188 0.0875  460 ARG B N   
3441 C CA  . ARG B 243 ? 0.9750 0.7404 1.6203 -0.0946 -0.0342 0.1001  460 ARG B CA  
3442 C C   . ARG B 243 ? 1.0131 0.8020 1.7468 -0.1226 -0.0355 0.1476  460 ARG B C   
3443 O O   . ARG B 243 ? 1.0440 0.8227 1.8503 -0.1324 -0.0310 0.2021  460 ARG B O   
3444 C CB  . ARG B 243 ? 1.0291 0.7330 1.6643 -0.0959 -0.0617 0.0329  460 ARG B CB  
3445 C CG  . ARG B 243 ? 1.2364 0.8691 1.9264 -0.0947 -0.0819 0.0226  460 ARG B CG  
3446 C CD  . ARG B 243 ? 1.3823 0.9740 2.0179 -0.0709 -0.0941 -0.0488 460 ARG B CD  
3447 N NE  . ARG B 243 ? 1.4896 1.1035 2.0753 -0.0421 -0.0677 -0.0476 460 ARG B NE  
3448 C CZ  . ARG B 243 ? 1.7413 1.3259 2.3511 -0.0206 -0.0663 -0.0440 460 ARG B CZ  
3449 N NH1 . ARG B 243 ? 1.6180 1.1366 2.2959 -0.0229 -0.0900 -0.0437 460 ARG B NH1 
3450 N NH2 . ARG B 243 ? 1.5747 1.1938 2.1519 0.0035  -0.0455 -0.0415 460 ARG B NH2 
3451 N N   . ARG B 244 ? 0.9443 0.7715 1.6796 -0.1340 -0.0397 0.1345  461 ARG B N   
3452 C CA  . ARG B 244 ? 0.9542 0.8277 1.7826 -0.1598 -0.0388 0.1785  461 ARG B CA  
3453 C C   . ARG B 244 ? 0.9915 0.9434 1.8309 -0.1458 0.0069  0.2593  461 ARG B C   
3454 O O   . ARG B 244 ? 1.0083 0.9943 1.9519 -0.1676 0.0184  0.3248  461 ARG B O   
3455 C CB  . ARG B 244 ? 0.9513 0.8535 1.7607 -0.1633 -0.0554 0.1370  461 ARG B CB  
3456 C CG  . ARG B 244 ? 1.1156 1.0961 2.0124 -0.1800 -0.0474 0.1816  461 ARG B CG  
3457 C CD  . ARG B 244 ? 1.2495 1.2110 2.2915 -0.2241 -0.0803 0.2004  461 ARG B CD  
3458 N NE  . ARG B 244 ? 1.3129 1.3683 2.4661 -0.2411 -0.0568 0.2723  461 ARG B NE  
3459 C CZ  . ARG B 244 ? 1.5645 1.6538 2.8149 -0.2569 -0.0260 0.3590  461 ARG B CZ  
3460 N NH1 . ARG B 244 ? 1.4105 1.4376 2.6588 -0.2577 -0.0208 0.3827  461 ARG B NH1 
3461 N NH2 . ARG B 244 ? 1.5072 1.6983 2.8638 -0.2695 0.0019  0.4290  461 ARG B NH2 
3462 N N   . GLN B 245 ? 0.9287 0.9109 1.6642 -0.1075 0.0310  0.2555  462 GLN B N   
3463 C CA  . GLN B 245 ? 0.9460 1.0050 1.6557 -0.0779 0.0714  0.3186  462 GLN B CA  
3464 C C   . GLN B 245 ? 1.0316 1.0723 1.7487 -0.0677 0.0821  0.3717  462 GLN B C   
3465 O O   . GLN B 245 ? 1.0584 1.1646 1.7492 -0.0383 0.1154  0.4337  462 GLN B O   
3466 C CB  . GLN B 245 ? 0.9418 1.0331 1.5344 -0.0367 0.0787  0.2763  462 GLN B CB  
3467 C CG  . GLN B 245 ? 1.0656 1.1900 1.6521 -0.0353 0.0763  0.2440  462 GLN B CG  
3468 C CD  . GLN B 245 ? 1.3274 1.4475 1.8126 -0.0019 0.0689  0.1881  462 GLN B CD  
3469 O OE1 . GLN B 245 ? 1.2401 1.3632 1.6561 0.0290  0.0718  0.1810  462 GLN B OE1 
3470 N NE2 . GLN B 245 ? 1.3034 1.4159 1.7850 -0.0068 0.0542  0.1486  462 GLN B NE2 
3471 N N   . GLY B 246 ? 0.9973 0.9528 1.7424 -0.0842 0.0538  0.3465  463 GLY B N   
3472 C CA  . GLY B 246 ? 1.0433 0.9687 1.8011 -0.0718 0.0567  0.3910  463 GLY B CA  
3473 C C   . GLY B 246 ? 1.0904 1.0153 1.7439 -0.0317 0.0530  0.3582  463 GLY B C   
3474 O O   . GLY B 246 ? 1.1222 1.0268 1.7776 -0.0142 0.0508  0.3899  463 GLY B O   
3475 N N   . LYS B 247 ? 1.0024 0.9485 1.5764 -0.0181 0.0479  0.2961  464 LYS B N   
3476 C CA  . LYS B 247 ? 0.9905 0.9426 1.4826 0.0131  0.0375  0.2571  464 LYS B CA  
3477 C C   . LYS B 247 ? 1.0604 0.9467 1.5670 0.0024  0.0145  0.2032  464 LYS B C   
3478 O O   . LYS B 247 ? 1.0297 0.9089 1.5028 -0.0002 0.0054  0.1468  464 LYS B O   
3479 C CB  . LYS B 247 ? 0.9819 0.9789 1.4044 0.0287  0.0395  0.2185  464 LYS B CB  
3480 C CG  . LYS B 247 ? 1.1192 1.1938 1.5032 0.0599  0.0645  0.2632  464 LYS B CG  
3481 C CD  . LYS B 247 ? 1.2266 1.3301 1.5533 0.0773  0.0616  0.2143  464 LYS B CD  
3482 C CE  . LYS B 247 ? 1.4028 1.5883 1.6750 0.1232  0.0869  0.2467  464 LYS B CE  
3483 N NZ  . LYS B 247 ? 1.5100 1.7116 1.7308 0.1457  0.0787  0.1897  464 LYS B NZ  
3484 N N   . LEU B 248 ? 1.0645 0.9045 1.6250 -0.0001 0.0077  0.2250  465 LEU B N   
3485 C CA  . LEU B 248 ? 1.0648 0.8470 1.6439 0.0002  -0.0093 0.1772  465 LEU B CA  
3486 C C   . LEU B 248 ? 1.0863 0.8913 1.6204 0.0252  -0.0146 0.1452  465 LEU B C   
3487 O O   . LEU B 248 ? 1.0640 0.8504 1.5948 0.0228  -0.0182 0.0948  465 LEU B O   
3488 C CB  . LEU B 248 ? 1.1287 0.8516 1.7817 -0.0009 -0.0183 0.2076  465 LEU B CB  
3489 C CG  . LEU B 248 ? 1.2259 0.8957 1.9490 -0.0343 -0.0300 0.2015  465 LEU B CG  
3490 C CD1 . LEU B 248 ? 1.2777 0.9380 2.0822 -0.0485 -0.0254 0.2840  465 LEU B CD1 
3491 C CD2 . LEU B 248 ? 1.3116 0.9067 2.0545 -0.0296 -0.0535 0.1359  465 LEU B CD2 
3492 N N   . GLU B 249 ? 1.0552 0.9074 1.5567 0.0507  -0.0163 0.1751  466 GLU B N   
3493 C CA  . GLU B 249 ? 1.0418 0.9235 1.5170 0.0711  -0.0312 0.1438  466 GLU B CA  
3494 C C   . GLU B 249 ? 1.0143 0.9127 1.4577 0.0562  -0.0325 0.0942  466 GLU B C   
3495 O O   . GLU B 249 ? 0.9883 0.8850 1.4484 0.0528  -0.0374 0.0588  466 GLU B O   
3496 C CB  . GLU B 249 ? 1.1074 1.0370 1.5481 0.1059  -0.0437 0.1817  466 GLU B CB  
3497 C CG  . GLU B 249 ? 1.3341 1.2967 1.7679 0.1267  -0.0719 0.1491  466 GLU B CG  
3498 C CD  . GLU B 249 ? 1.7292 1.6722 2.2275 0.1270  -0.0774 0.1277  466 GLU B CD  
3499 O OE1 . GLU B 249 ? 1.7730 1.6804 2.3114 0.1363  -0.0711 0.1551  466 GLU B OE1 
3500 O OE2 . GLU B 249 ? 1.4646 1.4297 1.9809 0.1199  -0.0872 0.0859  466 GLU B OE2 
3501 N N   . ALA B 250 ? 0.9385 0.8530 1.3469 0.0480  -0.0246 0.0976  467 ALA B N   
3502 C CA  . ALA B 250 ? 0.8910 0.8107 1.2739 0.0355  -0.0267 0.0579  467 ALA B CA  
3503 C C   . ALA B 250 ? 0.9210 0.8014 1.3293 0.0107  -0.0180 0.0329  467 ALA B C   
3504 O O   . ALA B 250 ? 0.8970 0.7758 1.3014 0.0038  -0.0201 0.0032  467 ALA B O   
3505 C CB  . ALA B 250 ? 0.9057 0.8522 1.2532 0.0406  -0.0178 0.0721  467 ALA B CB  
3506 N N   . ALA B 251 ? 0.9064 0.7553 1.3439 -0.0004 -0.0110 0.0466  468 ALA B N   
3507 C CA  . ALA B 251 ? 0.9083 0.7186 1.3576 -0.0147 -0.0099 0.0160  468 ALA B CA  
3508 C C   . ALA B 251 ? 0.9820 0.7807 1.4399 -0.0018 -0.0069 -0.0097 468 ALA B C   
3509 O O   . ALA B 251 ? 0.9575 0.7533 1.3965 -0.0042 0.0004  -0.0378 468 ALA B O   
3510 C CB  . ALA B 251 ? 0.9437 0.7187 1.4345 -0.0275 -0.0154 0.0306  468 ALA B CB  
3511 N N   . HIS B 252 ? 1.0220 0.9784 1.5518 -0.0263 -0.0724 -0.2233 469 HIS B N   
3512 C CA  . HIS B 252 ? 1.0404 0.9648 1.5617 -0.0043 -0.0798 -0.2180 469 HIS B CA  
3513 C C   . HIS B 252 ? 1.0104 0.9650 1.5558 0.0167  -0.0872 -0.2229 469 HIS B C   
3514 O O   . HIS B 252 ? 0.9891 0.9385 1.5403 0.0258  -0.0914 -0.2271 469 HIS B O   
3515 C CB  . HIS B 252 ? 1.1178 0.9901 1.5973 0.0036  -0.0795 -0.2057 469 HIS B CB  
3516 C CG  . HIS B 252 ? 1.2417 1.0627 1.6908 -0.0156 -0.0754 -0.2009 469 HIS B CG  
3517 N ND1 . HIS B 252 ? 1.3303 1.1264 1.7506 -0.0429 -0.0619 -0.1922 469 HIS B ND1 
3518 C CD2 . HIS B 252 ? 1.2972 1.0907 1.7429 -0.0135 -0.0827 -0.2054 469 HIS B CD2 
3519 C CE1 . HIS B 252 ? 1.3755 1.1214 1.7734 -0.0579 -0.0606 -0.1912 469 HIS B CE1 
3520 N NE2 . HIS B 252 ? 1.3575 1.1026 1.7725 -0.0383 -0.0750 -0.1997 469 HIS B NE2 
3521 N N   . THR B 253 ? 0.9142 0.9024 1.4740 0.0219  -0.0882 -0.2238 470 THR B N   
3522 C CA  . THR B 253 ? 0.8620 0.8775 1.4462 0.0387  -0.0943 -0.2301 470 THR B CA  
3523 C C   . THR B 253 ? 0.8821 0.9040 1.4789 0.0359  -0.0996 -0.2378 470 THR B C   
3524 O O   . THR B 253 ? 0.8671 0.8838 1.4687 0.0436  -0.1000 -0.2401 470 THR B O   
3525 C CB  . THR B 253 ? 0.8490 0.9033 1.4493 0.0449  -0.0973 -0.2317 470 THR B CB  
3526 O OG1 . THR B 253 ? 0.9098 0.9504 1.4865 0.0468  -0.0908 -0.2224 470 THR B OG1 
3527 C CG2 . THR B 253 ? 0.7463 0.8240 1.3725 0.0638  -0.1028 -0.2395 470 THR B CG2 
3528 N N   . LEU B 254 ? 0.8273 0.8595 1.4246 0.0251  -0.1029 -0.2447 471 LEU B N   
3529 C CA  . LEU B 254 ? 0.8165 0.8482 1.4139 0.0293  -0.1110 -0.2546 471 LEU B CA  
3530 C C   . LEU B 254 ? 0.9211 0.9242 1.5061 0.0287  -0.1066 -0.2529 471 LEU B C   
3531 O O   . LEU B 254 ? 0.9347 0.9230 1.5122 0.0362  -0.1087 -0.2524 471 LEU B O   
3532 C CB  . LEU B 254 ? 0.8018 0.8649 1.4034 0.0259  -0.1203 -0.2729 471 LEU B CB  
3533 C CG  . LEU B 254 ? 0.8264 0.9325 1.4432 0.0276  -0.1295 -0.2808 471 LEU B CG  
3534 C CD1 . LEU B 254 ? 0.8271 0.9686 1.4452 0.0269  -0.1418 -0.3078 471 LEU B CD1 
3535 C CD2 . LEU B 254 ? 0.8217 0.9275 1.4469 0.0442  -0.1407 -0.2777 471 LEU B CD2 
3536 N N   . GLU B 255 ? 0.9082 0.9023 1.4891 0.0187  -0.1004 -0.2523 472 GLU B N   
3537 C CA  . GLU B 255 ? 0.9252 0.8990 1.5003 0.0205  -0.0991 -0.2533 472 GLU B CA  
3538 C C   . GLU B 255 ? 0.9910 0.9487 1.5602 0.0296  -0.0986 -0.2445 472 GLU B C   
3539 O O   . GLU B 255 ? 0.9927 0.9453 1.5589 0.0356  -0.1000 -0.2470 472 GLU B O   
3540 C CB  . GLU B 255 ? 0.9625 0.9261 1.5353 0.0060  -0.0935 -0.2557 472 GLU B CB  
3541 C CG  . GLU B 255 ? 1.1126 1.1041 1.6953 -0.0069 -0.0910 -0.2747 472 GLU B CG  
3542 C CD  . GLU B 255 ? 1.3431 1.3261 1.9229 -0.0319 -0.0798 -0.2792 472 GLU B CD  
3543 O OE1 . GLU B 255 ? 1.2555 1.1977 1.8170 -0.0382 -0.0760 -0.2624 472 GLU B OE1 
3544 O OE2 . GLU B 255 ? 1.2026 1.2186 1.7944 -0.0457 -0.0753 -0.3027 472 GLU B OE2 
3545 N N   . ASP B 256 ? 0.9518 0.9088 1.5196 0.0324  -0.0968 -0.2388 473 ASP B N   
3546 C CA  . ASP B 256 ? 0.9577 0.9130 1.5228 0.0417  -0.0965 -0.2410 473 ASP B CA  
3547 C C   . ASP B 256 ? 1.0034 0.9704 1.5753 0.0410  -0.0930 -0.2441 473 ASP B C   
3548 O O   . ASP B 256 ? 0.9833 0.9518 1.5516 0.0411  -0.0898 -0.2492 473 ASP B O   
3549 C CB  . ASP B 256 ? 0.9923 0.9469 1.5520 0.0511  -0.0968 -0.2419 473 ASP B CB  
3550 C CG  . ASP B 256 ? 1.1277 1.0912 1.6859 0.0634  -0.0980 -0.2555 473 ASP B CG  
3551 O OD1 . ASP B 256 ? 1.1663 1.1207 1.7132 0.0678  -0.1044 -0.2617 473 ASP B OD1 
3552 O OD2 . ASP B 256 ? 1.1743 1.1599 1.7452 0.0693  -0.0938 -0.2646 473 ASP B OD2 
3553 N N   . CYS B 257 ? 0.9896 0.9640 1.5683 0.0392  -0.0944 -0.2428 474 CYS B N   
3554 C CA  . CYS B 257 ? 1.0185 0.9882 1.5941 0.0368  -0.0922 -0.2443 474 CYS B CA  
3555 C C   . CYS B 257 ? 1.0900 1.0373 1.6435 0.0357  -0.0932 -0.2424 474 CYS B C   
3556 O O   . CYS B 257 ? 1.0970 1.0310 1.6364 0.0298  -0.0856 -0.2414 474 CYS B O   
3557 C CB  . CYS B 257 ? 1.0359 1.0154 1.6216 0.0395  -0.0989 -0.2457 474 CYS B CB  
3558 S SG  . CYS B 257 ? 1.1273 1.0832 1.7002 0.0340  -0.0972 -0.2468 474 CYS B SG  
3559 N N   . ALA B 258 ? 1.0614 1.0071 1.6104 0.0412  -0.1007 -0.2449 475 ALA B N   
3560 C CA  . ALA B 258 ? 1.0932 1.0215 1.6209 0.0484  -0.1035 -0.2476 475 ALA B CA  
3561 C C   . ALA B 258 ? 1.2054 1.1329 1.7305 0.0470  -0.0962 -0.2449 475 ALA B C   
3562 O O   . ALA B 258 ? 1.2405 1.1531 1.7436 0.0527  -0.0952 -0.2443 475 ALA B O   
3563 C CB  . ALA B 258 ? 1.0946 1.0351 1.6267 0.0563  -0.1124 -0.2604 475 ALA B CB  
3564 N N   . SER B 259 ? 1.1552 1.0987 1.6978 0.0425  -0.0935 -0.2452 476 SER B N   
3565 C CA  . SER B 259 ? 1.1552 1.1084 1.6987 0.0440  -0.0924 -0.2490 476 SER B CA  
3566 C C   . SER B 259 ? 1.2266 1.1876 1.7618 0.0343  -0.0818 -0.2517 476 SER B C   
3567 O O   . SER B 259 ? 1.2251 1.2059 1.7613 0.0342  -0.0813 -0.2604 476 SER B O   
3568 C CB  . SER B 259 ? 1.1938 1.1537 1.7492 0.0475  -0.0990 -0.2532 476 SER B CB  
3569 O OG  . SER B 259 ? 1.3244 1.2740 1.8844 0.0479  -0.1037 -0.2512 476 SER B OG  
3570 N N   . ARG B 260 ? 1.1996 1.1486 1.7276 0.0245  -0.0739 -0.2481 477 ARG B N   
3571 C CA  . ARG B 260 ? 1.3932 1.3467 1.9131 0.0077  -0.0591 -0.2534 477 ARG B CA  
3572 C C   . ARG B 260 ? 1.7577 1.6714 2.2400 -0.0008 -0.0521 -0.2419 477 ARG B C   
3573 O O   . ARG B 260 ? 1.3228 1.2351 1.7847 -0.0142 -0.0396 -0.2428 477 ARG B O   
3574 C CB  . ARG B 260 ? 1.3624 1.3273 1.9016 0.0025  -0.0545 -0.2606 477 ARG B CB  
3575 C CG  . ARG B 260 ? 1.3881 1.3855 1.9524 0.0152  -0.0607 -0.2742 477 ARG B CG  
3576 C CD  . ARG B 260 ? 1.4577 1.4681 2.0415 0.0160  -0.0568 -0.2822 477 ARG B CD  
3577 N NE  . ARG B 260 ? 1.5559 1.5714 2.1510 0.0346  -0.0684 -0.2794 477 ARG B NE  
3578 C CZ  . ARG B 260 ? 1.6997 1.7303 2.3134 0.0426  -0.0689 -0.2845 477 ARG B CZ  
3579 N NH1 . ARG B 260 ? 1.5985 1.6415 2.2276 0.0342  -0.0597 -0.2949 477 ARG B NH1 
3580 N NH2 . ARG B 260 ? 1.3938 1.4261 2.0094 0.0583  -0.0777 -0.2797 477 ARG B NH2 
3581 N N   . THR C 22  ? 1.6004 2.4923 1.1526 0.1141  -0.2075 -0.1113 203 THR X N   
3582 C CA  . THR C 22  ? 1.6066 2.3732 1.0949 0.1349  -0.2035 -0.0747 203 THR X CA  
3583 C C   . THR C 22  ? 1.6335 2.2948 1.0948 0.1043  -0.1647 -0.0790 203 THR X C   
3584 O O   . THR C 22  ? 1.6314 2.2970 1.0981 0.0598  -0.1398 -0.1087 203 THR X O   
3585 C CB  . THR C 22  ? 1.7176 2.4707 1.1493 0.1426  -0.2328 -0.0538 203 THR X CB  
3586 O OG1 . THR C 22  ? 1.6857 2.3144 1.0576 0.1461  -0.2183 -0.0298 203 THR X OG1 
3587 C CG2 . THR C 22  ? 1.7075 2.5150 1.1261 0.0890  -0.2390 -0.0799 203 THR X CG2 
3588 N N   . ASN C 23  ? 1.5660 2.1340 0.9941 0.1286  -0.1575 -0.0507 204 ASN X N   
3589 C CA  . ASN C 23  ? 1.5334 2.0143 0.9374 0.1062  -0.1285 -0.0511 204 ASN X CA  
3590 C C   . ASN C 23  ? 1.5173 1.9252 0.8681 0.0950  -0.1270 -0.0343 204 ASN X C   
3591 O O   . ASN C 23  ? 1.5336 1.9163 0.8567 0.1174  -0.1418 -0.0132 204 ASN X O   
3592 C CB  . ASN C 23  ? 1.5904 2.0300 1.0051 0.1299  -0.1140 -0.0407 204 ASN X CB  
3593 C CG  . ASN C 23  ? 2.0255 2.5300 1.4973 0.1459  -0.1100 -0.0546 204 ASN X CG  
3594 O OD1 . ASN C 23  ? 1.9954 2.5329 1.4991 0.1186  -0.0935 -0.0849 204 ASN X OD1 
3595 N ND2 . ASN C 23  ? 1.9739 2.4950 1.4576 0.1921  -0.1204 -0.0338 204 ASN X ND2 
3596 N N   . LEU C 24  ? 1.4065 1.7760 0.7408 0.0626  -0.1046 -0.0443 205 LEU X N   
3597 C CA  . LEU C 24  ? 1.3908 1.6992 0.6864 0.0508  -0.0969 -0.0309 205 LEU X CA  
3598 C C   . LEU C 24  ? 1.4420 1.6953 0.7245 0.0703  -0.0976 -0.0104 205 LEU X C   
3599 O O   . LEU C 24  ? 1.4511 1.6966 0.7458 0.0815  -0.0935 -0.0099 205 LEU X O   
3600 C CB  . LEU C 24  ? 1.3832 1.6683 0.6657 0.0204  -0.0679 -0.0452 205 LEU X CB  
3601 C CG  . LEU C 24  ? 1.4483 1.7461 0.7098 -0.0119 -0.0539 -0.0591 205 LEU X CG  
3602 C CD1 . LEU C 24  ? 1.4479 1.8221 0.7335 -0.0303 -0.0557 -0.0885 205 LEU X CD1 
3603 C CD2 . LEU C 24  ? 1.4720 1.7121 0.7013 -0.0310 -0.0163 -0.0616 205 LEU X CD2 
3604 N N   . GLU C 25  ? 1.3938 1.6073 0.6497 0.0685  -0.0981 0.0030  206 GLU X N   
3605 C CA  . GLU C 25  ? 1.3981 1.5664 0.6402 0.0779  -0.0953 0.0160  206 GLU X CA  
3606 C C   . GLU C 25  ? 1.4552 1.6056 0.7019 0.0660  -0.0829 0.0160  206 GLU X C   
3607 O O   . GLU C 25  ? 1.4275 1.5730 0.6718 0.0538  -0.0729 0.0156  206 GLU X O   
3608 C CB  . GLU C 25  ? 1.4340 1.5697 0.6483 0.0774  -0.0969 0.0245  206 GLU X CB  
3609 C CG  . GLU C 25  ? 1.5727 1.6658 0.7650 0.0886  -0.0923 0.0315  206 GLU X CG  
3610 C CD  . GLU C 25  ? 1.9942 2.0454 1.1634 0.0771  -0.0828 0.0332  206 GLU X CD  
3611 O OE1 . GLU C 25  ? 2.0683 2.1038 1.2140 0.0757  -0.0860 0.0348  206 GLU X OE1 
3612 O OE2 . GLU C 25  ? 1.7713 1.8080 0.9465 0.0667  -0.0714 0.0309  206 GLU X OE2 
3613 N N   . TRP C 26  ? 1.4509 1.5877 0.6974 0.0708  -0.0817 0.0183  207 TRP X N   
3614 C CA  . TRP C 26  ? 1.4594 1.5847 0.7042 0.0621  -0.0768 0.0197  207 TRP X CA  
3615 C C   . TRP C 26  ? 1.5579 1.6765 0.8001 0.0573  -0.0776 0.0273  207 TRP X C   
3616 O O   . TRP C 26  ? 1.5707 1.6765 0.8043 0.0568  -0.0773 0.0281  207 TRP X O   
3617 C CB  . TRP C 26  ? 1.4560 1.5671 0.6939 0.0620  -0.0741 0.0179  207 TRP X CB  
3618 C CG  . TRP C 26  ? 1.4761 1.5761 0.7041 0.0515  -0.0721 0.0172  207 TRP X CG  
3619 C CD1 . TRP C 26  ? 1.5199 1.6160 0.7356 0.0417  -0.0769 0.0219  207 TRP X CD1 
3620 C CD2 . TRP C 26  ? 1.4820 1.5714 0.7045 0.0484  -0.0641 0.0092  207 TRP X CD2 
3621 N NE1 . TRP C 26  ? 1.5172 1.6028 0.7173 0.0365  -0.0778 0.0215  207 TRP X NE1 
3622 C CE2 . TRP C 26  ? 1.5386 1.6099 0.7378 0.0410  -0.0671 0.0136  207 TRP X CE2 
3623 C CE3 . TRP C 26  ? 1.4981 1.5925 0.7300 0.0485  -0.0528 -0.0045 207 TRP X CE3 
3624 C CZ2 . TRP C 26  ? 1.5568 1.5984 0.7314 0.0374  -0.0580 0.0077  207 TRP X CZ2 
3625 C CZ3 . TRP C 26  ? 1.5374 1.6032 0.7498 0.0404  -0.0383 -0.0150 207 TRP X CZ3 
3626 C CH2 . TRP C 26  ? 1.5689 1.6005 0.7480 0.0368  -0.0404 -0.0075 207 TRP X CH2 
3627 N N   . ASP C 27  ? 1.5411 1.6664 0.7887 0.0558  -0.0750 0.0319  208 ASP X N   
3628 C CA  . ASP C 27  ? 1.5521 1.6876 0.8108 0.0548  -0.0758 0.0389  208 ASP X CA  
3629 C C   . ASP C 27  ? 1.6542 1.8060 0.9127 0.0496  -0.0861 0.0386  208 ASP X C   
3630 O O   . ASP C 27  ? 1.6597 1.8101 0.9063 0.0527  -0.0902 0.0407  208 ASP X O   
3631 C CB  . ASP C 27  ? 1.5745 1.7105 0.8380 0.0631  -0.0644 0.0482  208 ASP X CB  
3632 C CG  . ASP C 27  ? 1.7052 1.8541 0.9909 0.0652  -0.0598 0.0555  208 ASP X CG  
3633 O OD1 . ASP C 27  ? 1.6905 1.8718 0.9943 0.0689  -0.0701 0.0587  208 ASP X OD1 
3634 O OD2 . ASP C 27  ? 1.8775 2.0066 1.1628 0.0606  -0.0451 0.0563  208 ASP X OD2 
3635 N N   . ASP C 28  ? 1.6575 1.8200 0.9215 0.0371  -0.0872 0.0330  209 ASP X N   
3636 C CA  . ASP C 28  ? 1.6924 1.8771 0.9518 0.0212  -0.0951 0.0276  209 ASP X CA  
3637 C C   . ASP C 28  ? 1.7946 2.0363 1.0838 0.0221  -0.1072 0.0314  209 ASP X C   
3638 O O   . ASP C 28  ? 1.8101 2.0852 1.0969 0.0045  -0.1176 0.0245  209 ASP X O   
3639 C CB  . ASP C 28  ? 1.7385 1.8971 0.9745 0.0004  -0.0812 0.0136  209 ASP X CB  
3640 C CG  . ASP C 28  ? 1.9013 2.0106 1.1096 0.0093  -0.0699 0.0144  209 ASP X CG  
3641 O OD1 . ASP C 28  ? 1.9083 2.0055 1.1034 0.0091  -0.0703 0.0161  209 ASP X OD1 
3642 O OD2 . ASP C 28  ? 2.0125 2.0954 1.2116 0.0180  -0.0602 0.0138  209 ASP X OD2 
3643 N N   . SER C 29  ? 1.7675 2.0231 1.0836 0.0426  -0.1043 0.0429  210 SER X N   
3644 C CA  . SER C 29  ? 1.7795 2.0951 1.1327 0.0550  -0.1134 0.0513  210 SER X CA  
3645 C C   . SER C 29  ? 1.8923 2.2371 1.2327 0.0696  -0.1350 0.0633  210 SER X C   
3646 O O   . SER C 29  ? 1.8966 2.3103 1.2617 0.0692  -0.1539 0.0638  210 SER X O   
3647 C CB  . SER C 29  ? 1.8108 2.1144 1.1841 0.0781  -0.0960 0.0654  210 SER X CB  
3648 O OG  . SER C 29  ? 1.9242 2.1857 1.2946 0.0640  -0.0762 0.0560  210 SER X OG  
3649 N N   . ALA C 30  ? 1.8960 2.1894 1.1954 0.0812  -0.1316 0.0709  211 ALA X N   
3650 C CA  . ALA C 30  ? 1.9447 2.2354 1.2106 0.0966  -0.1458 0.0821  211 ALA X CA  
3651 C C   . ALA C 30  ? 2.0363 2.3683 1.2920 0.0734  -0.1717 0.0742  211 ALA X C   
3652 O O   . ALA C 30  ? 2.0565 2.4337 1.3086 0.0894  -0.1948 0.0864  211 ALA X O   
3653 C CB  . ALA C 30  ? 1.9673 2.1826 1.1876 0.0976  -0.1285 0.0792  211 ALA X CB  
3654 N N   . ILE C 31  ? 1.9973 2.3128 1.2436 0.0358  -0.1654 0.0545  212 ILE X N   
3655 C CA  . ILE C 31  ? 2.0188 2.3587 1.2450 -0.0002 -0.1778 0.0413  212 ILE X CA  
3656 C C   . ILE C 31  ? 2.0609 2.4797 1.3304 -0.0217 -0.1836 0.0272  212 ILE X C   
3657 O O   . ILE C 31  ? 2.0778 2.5667 1.3523 -0.0357 -0.2073 0.0235  212 ILE X O   
3658 C CB  . ILE C 31  ? 2.0686 2.3339 1.2516 -0.0280 -0.1560 0.0285  212 ILE X CB  
3659 C CG1 . ILE C 31  ? 2.1139 2.3878 1.2618 -0.0730 -0.1584 0.0141  212 ILE X CG1 
3660 C CG2 . ILE C 31  ? 2.0513 2.2799 1.2489 -0.0273 -0.1299 0.0211  212 ILE X CG2 
3661 C CD1 . ILE C 31  ? 2.2441 2.4347 1.3424 -0.0972 -0.1307 0.0059  212 ILE X CD1 
3662 N N   . THR C 32  ? 1.9885 2.3974 1.2874 -0.0249 -0.1617 0.0176  213 THR X N   
3663 C CA  . THR C 32  ? 2.1707 2.6374 1.5092 -0.0480 -0.1556 -0.0020 213 THR X CA  
3664 C C   . THR C 32  ? 2.3165 2.7975 1.7061 -0.0189 -0.1471 0.0067  213 THR X C   
3665 O O   . THR C 32  ? 1.7506 2.3029 1.1869 0.0042  -0.1628 0.0179  213 THR X O   
3666 C CB  . THR C 32  ? 2.2518 2.6643 1.5548 -0.0887 -0.1242 -0.0277 213 THR X CB  
3667 O OG1 . THR C 32  ? 2.2241 2.5504 1.5030 -0.0699 -0.1043 -0.0192 213 THR X OG1 
3668 C CG2 . THR C 32  ? 2.2548 2.6583 1.5073 -0.1290 -0.1224 -0.0411 213 THR X CG2 
3669 N N   . THR D 22  ? 2.1065 1.7845 1.0389 0.0598  -0.0365 0.1941  203 THR Y N   
3670 C CA  . THR D 22  ? 2.0446 1.7663 1.0031 0.0962  -0.0181 0.1756  203 THR Y CA  
3671 C C   . THR D 22  ? 2.0234 1.8143 1.0220 0.1173  0.0194  0.1481  203 THR Y C   
3672 O O   . THR D 22  ? 2.0051 1.8290 1.0041 0.0983  0.0397  0.1436  203 THR Y O   
3673 C CB  . THR D 22  ? 2.1526 1.8813 1.0803 0.0825  -0.0195 0.1934  203 THR Y CB  
3674 O OG1 . THR D 22  ? 2.0630 1.8454 1.0206 0.1130  0.0046  0.1726  203 THR Y OG1 
3675 C CG2 . THR D 22  ? 2.1585 1.9160 1.0463 0.0291  -0.0084 0.2160  203 THR Y CG2 
3676 N N   . ASN D 23  ? 1.9327 1.7442 0.9625 0.1551  0.0261  0.1290  204 ASN Y N   
3677 C CA  . ASN D 23  ? 1.8590 1.7236 0.9224 0.1752  0.0542  0.1073  204 ASN Y CA  
3678 C C   . ASN D 23  ? 1.8558 1.7658 0.9243 0.1801  0.0760  0.1024  204 ASN Y C   
3679 O O   . ASN D 23  ? 1.8663 1.7718 0.9306 0.1875  0.0698  0.1059  204 ASN Y O   
3680 C CB  . ASN D 23  ? 1.8568 1.7185 0.9539 0.2082  0.0448  0.0878  204 ASN Y CB  
3681 C CG  . ASN D 23  ? 2.2344 2.0551 1.3368 0.2106  0.0165  0.0851  204 ASN Y CG  
3682 O OD1 . ASN D 23  ? 2.2056 1.9885 1.3085 0.2249  -0.0158 0.0812  204 ASN Y OD1 
3683 N ND2 . ASN D 23  ? 2.1365 1.9638 1.2450 0.1992  0.0247  0.0830  204 ASN Y ND2 
3684 N N   . LEU D 24  ? 1.7434 1.6963 0.8233 0.1788  0.0983  0.0906  205 LEU Y N   
3685 C CA  . LEU D 24  ? 1.6855 1.6804 0.7756 0.1854  0.1136  0.0806  205 LEU Y CA  
3686 C C   . LEU D 24  ? 1.6979 1.6930 0.8113 0.2122  0.1145  0.0736  205 LEU Y C   
3687 O O   . LEU D 24  ? 1.6987 1.6824 0.8255 0.2262  0.1109  0.0692  205 LEU Y O   
3688 C CB  . LEU D 24  ? 1.6570 1.6873 0.7531 0.1821  0.1284  0.0647  205 LEU Y CB  
3689 C CG  . LEU D 24  ? 1.7133 1.7821 0.7917 0.1559  0.1341  0.0583  205 LEU Y CG  
3690 C CD1 . LEU D 24  ? 1.7567 1.8075 0.8094 0.1252  0.1296  0.0713  205 LEU Y CD1 
3691 C CD2 . LEU D 24  ? 1.6941 1.8034 0.7856 0.1658  0.1448  0.0314  205 LEU Y CD2 
3692 N N   . GLU D 25  ? 1.6299 1.6456 0.7498 0.2173  0.1189  0.0701  206 GLU Y N   
3693 C CA  . GLU D 25  ? 1.6132 1.6318 0.7517 0.2351  0.1204  0.0647  206 GLU Y CA  
3694 C C   . GLU D 25  ? 1.6630 1.6958 0.8155 0.2424  0.1280  0.0568  206 GLU Y C   
3695 O O   . GLU D 25  ? 1.6581 1.7079 0.8115 0.2402  0.1305  0.0491  206 GLU Y O   
3696 C CB  . GLU D 25  ? 1.6288 1.6608 0.7702 0.2364  0.1193  0.0639  206 GLU Y CB  
3697 C CG  . GLU D 25  ? 1.8182 1.8459 0.9726 0.2502  0.1179  0.0602  206 GLU Y CG  
3698 C CD  . GLU D 25  ? 2.2214 2.2698 1.3892 0.2542  0.1198  0.0542  206 GLU Y CD  
3699 O OE1 . GLU D 25  ? 2.1183 2.1801 1.2811 0.2504  0.1173  0.0548  206 GLU Y OE1 
3700 O OE2 . GLU D 25  ? 2.3017 2.3547 1.4852 0.2592  0.1221  0.0492  206 GLU Y OE2 
3701 N N   . TRP D 26  ? 1.6161 1.6455 0.7782 0.2508  0.1285  0.0564  207 TRP Y N   
3702 C CA  . TRP D 26  ? 1.6073 1.6457 0.7767 0.2544  0.1327  0.0547  207 TRP Y CA  
3703 C C   . TRP D 26  ? 1.6633 1.7019 0.8374 0.2544  0.1299  0.0559  207 TRP Y C   
3704 O O   . TRP D 26  ? 1.6646 1.7034 0.8434 0.2540  0.1282  0.0569  207 TRP Y O   
3705 C CB  . TRP D 26  ? 1.5889 1.6369 0.7662 0.2581  0.1327  0.0535  207 TRP Y CB  
3706 C CG  . TRP D 26  ? 1.5966 1.6594 0.7769 0.2581  0.1369  0.0547  207 TRP Y CG  
3707 C CD1 . TRP D 26  ? 1.6389 1.7114 0.8186 0.2515  0.1368  0.0611  207 TRP Y CD1 
3708 C CD2 . TRP D 26  ? 1.5899 1.6623 0.7730 0.2628  0.1405  0.0501  207 TRP Y CD2 
3709 N NE1 . TRP D 26  ? 1.6318 1.7179 0.8100 0.2510  0.1390  0.0636  207 TRP Y NE1 
3710 C CE2 . TRP D 26  ? 1.6393 1.7281 0.8222 0.2608  0.1424  0.0547  207 TRP Y CE2 
3711 C CE3 . TRP D 26  ? 1.6049 1.6737 0.7894 0.2662  0.1419  0.0431  207 TRP Y CE3 
3712 C CZ2 . TRP D 26  ? 1.6214 1.7271 0.8075 0.2668  0.1465  0.0505  207 TRP Y CZ2 
3713 C CZ3 . TRP D 26  ? 1.6146 1.7001 0.8056 0.2723  0.1471  0.0364  207 TRP Y CZ3 
3714 C CH2 . TRP D 26  ? 1.6161 1.7218 0.8090 0.2749  0.1498  0.0390  207 TRP Y CH2 
3715 N N   . ASP D 27  ? 1.6198 1.6558 0.7932 0.2562  0.1259  0.0535  208 ASP Y N   
3716 C CA  . ASP D 27  ? 1.6325 1.6583 0.8108 0.2565  0.1151  0.0546  208 ASP Y CA  
3717 C C   . ASP D 27  ? 1.7266 1.7440 0.8997 0.2481  0.1140  0.0685  208 ASP Y C   
3718 O O   . ASP D 27  ? 1.7139 1.7337 0.8791 0.2477  0.1160  0.0722  208 ASP Y O   
3719 C CB  . ASP D 27  ? 1.6610 1.6852 0.8402 0.2649  0.1025  0.0404  208 ASP Y CB  
3720 C CG  . ASP D 27  ? 1.8121 1.8244 1.0029 0.2693  0.0830  0.0348  208 ASP Y CG  
3721 O OD1 . ASP D 27  ? 1.8480 1.8325 1.0344 0.2649  0.0715  0.0470  208 ASP Y OD1 
3722 O OD2 . ASP D 27  ? 1.8941 1.9273 1.0985 0.2754  0.0769  0.0178  208 ASP Y OD2 
3723 N N   . ASP D 28  ? 1.7211 1.7357 0.8978 0.2387  0.1115  0.0752  209 ASP Y N   
3724 C CA  . ASP D 28  ? 1.7465 1.7639 0.9146 0.2212  0.1114  0.0891  209 ASP Y CA  
3725 C C   . ASP D 28  ? 1.8660 1.8498 1.0245 0.2103  0.0925  0.1028  209 ASP Y C   
3726 O O   . ASP D 28  ? 1.8855 1.8708 1.0307 0.1876  0.0907  0.1192  209 ASP Y O   
3727 C CB  . ASP D 28  ? 1.7599 1.8031 0.9343 0.2126  0.1208  0.0850  209 ASP Y CB  
3728 C CG  . ASP D 28  ? 1.8904 1.9570 1.0716 0.2252  0.1300  0.0707  209 ASP Y CG  
3729 O OD1 . ASP D 28  ? 1.8940 1.9818 1.0743 0.2259  0.1337  0.0678  209 ASP Y OD1 
3730 O OD2 . ASP D 28  ? 1.9800 2.0428 1.1679 0.2349  0.1303  0.0618  209 ASP Y OD2 
3731 N N   . SER D 29  ? 1.8554 1.8115 1.0194 0.2247  0.0746  0.0943  210 SER Y N   
3732 C CA  . SER D 29  ? 1.9119 1.8244 1.0685 0.2201  0.0458  0.1028  210 SER Y CA  
3733 C C   . SER D 29  ? 2.0290 1.9226 1.1588 0.2105  0.0374  0.1206  210 SER Y C   
3734 O O   . SER D 29  ? 2.0692 1.9284 1.1812 0.1902  0.0182  0.1422  210 SER Y O   
3735 C CB  . SER D 29  ? 1.9593 1.8595 1.1323 0.2446  0.0243  0.0785  210 SER Y CB  
3736 O OG  . SER D 29  ? 2.0868 2.0172 1.2840 0.2540  0.0339  0.0608  210 SER Y OG  
3737 N N   . ALA D 30  ? 1.9853 1.9015 1.1113 0.2235  0.0508  0.1122  211 ALA Y N   
3738 C CA  . ALA D 30  ? 2.0155 1.9261 1.1199 0.2209  0.0468  0.1233  211 ALA Y CA  
3739 C C   . ALA D 30  ? 2.1184 2.0375 1.2023 0.1882  0.0499  0.1530  211 ALA Y C   
3740 O O   . ALA D 30  ? 2.1513 2.0381 1.2089 0.1756  0.0293  0.1733  211 ALA Y O   
3741 C CB  . ALA D 30  ? 1.9819 1.9312 1.0946 0.2379  0.0689  0.1061  211 ALA Y CB  
3742 N N   . ILE D 31  ? 2.0669 2.0322 1.1613 0.1731  0.0725  0.1534  212 ILE Y N   
3743 C CA  . ILE D 31  ? 2.5243 2.5237 1.6043 0.1387  0.0794  0.1723  212 ILE Y CA  
3744 C C   . ILE D 31  ? 2.8043 2.7760 1.8752 0.1107  0.0665  0.1881  212 ILE Y C   
3745 O O   . ILE D 31  ? 2.3063 2.2634 1.3489 0.0768  0.0531  0.2155  212 ILE Y O   
3746 C CB  . ILE D 31  ? 2.5159 2.5898 1.6156 0.1416  0.1058  0.1536  212 ILE Y CB  
3747 C CG1 . ILE D 31  ? 2.5374 2.6695 1.6253 0.1048  0.1125  0.1639  212 ILE Y CG1 
3748 C CG2 . ILE D 31  ? 2.4896 2.5680 1.6146 0.1609  0.1152  0.1305  212 ILE Y CG2 
3749 C CD1 . ILE D 31  ? 2.5918 2.8077 1.7020 0.1111  0.1301  0.1382  212 ILE Y CD1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   218 ?   ?   ?   A . n 
A 1 2   PRO 2   219 ?   ?   ?   A . n 
A 1 3   LEU 3   220 ?   ?   ?   A . n 
A 1 4   CYS 4   221 ?   ?   ?   A . n 
A 1 5   LYS 5   222 ?   ?   ?   A . n 
A 1 6   GLN 6   223 ?   ?   ?   A . n 
A 1 7   ALA 7   224 ?   ?   ?   A . n 
A 1 8   LEU 8   225 ?   ?   ?   A . n 
A 1 9   GLU 9   226 ?   ?   ?   A . n 
A 1 10  ASP 10  227 ?   ?   ?   A . n 
A 1 11  LEU 11  228 ?   ?   ?   A . n 
A 1 12  GLU 12  229 ?   ?   ?   A . n 
A 1 13  LYS 13  230 ?   ?   ?   A . n 
A 1 14  THR 14  231 ?   ?   ?   A . n 
A 1 15  SER 15  232 ?   ?   ?   A . n 
A 1 16  GLY 16  233 ?   ?   ?   A . n 
A 1 17  HIS 17  234 ?   ?   ?   A . n 
A 1 18  ASP 18  235 ?   ?   ?   A . n 
A 1 19  HIS 19  236 236 HIS HIS A . n 
A 1 20  PRO 20  237 237 PRO PRO A . n 
A 1 21  ASP 21  238 238 ASP ASP A . n 
A 1 22  VAL 22  239 239 VAL VAL A . n 
A 1 23  ALA 23  240 240 ALA ALA A . n 
A 1 24  THR 24  241 241 THR THR A . n 
A 1 25  MET 25  242 242 MET MET A . n 
A 1 26  LEU 26  243 243 LEU LEU A . n 
A 1 27  ASN 27  244 244 ASN ASN A . n 
A 1 28  ILE 28  245 245 ILE ILE A . n 
A 1 29  LEU 29  246 246 LEU LEU A . n 
A 1 30  ALA 30  247 247 ALA ALA A . n 
A 1 31  LEU 31  248 248 LEU LEU A . n 
A 1 32  VAL 32  249 249 VAL VAL A . n 
A 1 33  TYR 33  250 250 TYR TYR A . n 
A 1 34  ARG 34  251 251 ARG ARG A . n 
A 1 35  ASP 35  252 252 ASP ASP A . n 
A 1 36  GLN 36  253 253 GLN GLN A . n 
A 1 37  ASN 37  254 254 ASN ASN A . n 
A 1 38  LYS 38  255 255 LYS LYS A . n 
A 1 39  TYR 39  256 256 TYR TYR A . n 
A 1 40  LYS 40  257 257 LYS LYS A . n 
A 1 41  ASP 41  258 258 ASP ASP A . n 
A 1 42  ALA 42  259 259 ALA ALA A . n 
A 1 43  ALA 43  260 260 ALA ALA A . n 
A 1 44  HIS 44  261 261 HIS HIS A . n 
A 1 45  LEU 45  262 262 LEU LEU A . n 
A 1 46  LEU 46  263 263 LEU LEU A . n 
A 1 47  ASN 47  264 264 ASN ASN A . n 
A 1 48  ASP 48  265 265 ASP ASP A . n 
A 1 49  ALA 49  266 266 ALA ALA A . n 
A 1 50  LEU 50  267 267 LEU LEU A . n 
A 1 51  ALA 51  268 268 ALA ALA A . n 
A 1 52  ILE 52  269 269 ILE ILE A . n 
A 1 53  ARG 53  270 270 ARG ARG A . n 
A 1 54  GLU 54  271 271 GLU GLU A . n 
A 1 55  LYS 55  272 272 LYS LYS A . n 
A 1 56  THR 56  273 273 THR THR A . n 
A 1 57  LEU 57  274 274 LEU LEU A . n 
A 1 58  GLY 58  275 275 GLY GLY A . n 
A 1 59  LYS 59  276 276 LYS LYS A . n 
A 1 60  ASP 60  277 277 ASP ASP A . n 
A 1 61  HIS 61  278 278 HIS HIS A . n 
A 1 62  PRO 62  279 279 PRO PRO A . n 
A 1 63  ALA 63  280 280 ALA ALA A . n 
A 1 64  VAL 64  281 281 VAL VAL A . n 
A 1 65  ALA 65  282 282 ALA ALA A . n 
A 1 66  ALA 66  283 283 ALA ALA A . n 
A 1 67  THR 67  284 284 THR THR A . n 
A 1 68  LEU 68  285 285 LEU LEU A . n 
A 1 69  ASN 69  286 286 ASN ASN A . n 
A 1 70  ASN 70  287 287 ASN ASN A . n 
A 1 71  LEU 71  288 288 LEU LEU A . n 
A 1 72  ALA 72  289 289 ALA ALA A . n 
A 1 73  VAL 73  290 290 VAL VAL A . n 
A 1 74  LEU 74  291 291 LEU LEU A . n 
A 1 75  TYR 75  292 292 TYR TYR A . n 
A 1 76  GLY 76  293 293 GLY GLY A . n 
A 1 77  LYS 77  294 294 LYS LYS A . n 
A 1 78  ARG 78  295 295 ARG ARG A . n 
A 1 79  GLY 79  296 296 GLY GLY A . n 
A 1 80  LYS 80  297 297 LYS LYS A . n 
A 1 81  TYR 81  298 298 TYR TYR A . n 
A 1 82  LYS 82  299 299 LYS LYS A . n 
A 1 83  GLU 83  300 300 GLU GLU A . n 
A 1 84  ALA 84  301 301 ALA ALA A . n 
A 1 85  GLU 85  302 302 GLU GLU A . n 
A 1 86  PRO 86  303 303 PRO PRO A . n 
A 1 87  LEU 87  304 304 LEU LEU A . n 
A 1 88  CYS 88  305 305 CYS CYS A . n 
A 1 89  LYS 89  306 306 LYS LYS A . n 
A 1 90  ARG 90  307 307 ARG ARG A . n 
A 1 91  ALA 91  308 308 ALA ALA A . n 
A 1 92  LEU 92  309 309 LEU LEU A . n 
A 1 93  GLU 93  310 310 GLU GLU A . n 
A 1 94  ILE 94  311 311 ILE ILE A . n 
A 1 95  ARG 95  312 312 ARG ARG A . n 
A 1 96  GLU 96  313 313 GLU GLU A . n 
A 1 97  LYS 97  314 314 LYS LYS A . n 
A 1 98  VAL 98  315 315 VAL VAL A . n 
A 1 99  LEU 99  316 316 LEU LEU A . n 
A 1 100 GLY 100 317 317 GLY GLY A . n 
A 1 101 LYS 101 318 318 LYS LYS A . n 
A 1 102 PHE 102 319 319 PHE PHE A . n 
A 1 103 HIS 103 320 320 HIS HIS A . n 
A 1 104 PRO 104 321 321 PRO PRO A . n 
A 1 105 ASP 105 322 322 ASP ASP A . n 
A 1 106 VAL 106 323 323 VAL VAL A . n 
A 1 107 ALA 107 324 324 ALA ALA A . n 
A 1 108 LYS 108 325 325 LYS LYS A . n 
A 1 109 GLN 109 326 326 GLN GLN A . n 
A 1 110 LEU 110 327 327 LEU LEU A . n 
A 1 111 SER 111 328 328 SER SER A . n 
A 1 112 ASN 112 329 329 ASN ASN A . n 
A 1 113 LEU 113 330 330 LEU LEU A . n 
A 1 114 ALA 114 331 331 ALA ALA A . n 
A 1 115 LEU 115 332 332 LEU LEU A . n 
A 1 116 LEU 116 333 333 LEU LEU A . n 
A 1 117 CYS 117 334 334 CYS CYS A . n 
A 1 118 GLN 118 335 335 GLN GLN A . n 
A 1 119 ASN 119 336 336 ASN ASN A . n 
A 1 120 GLN 120 337 337 GLN GLN A . n 
A 1 121 GLY 121 338 338 GLY GLY A . n 
A 1 122 LYS 122 339 339 LYS LYS A . n 
A 1 123 ALA 123 340 340 ALA ALA A . n 
A 1 124 GLU 124 341 341 GLU GLU A . n 
A 1 125 GLU 125 342 342 GLU GLU A . n 
A 1 126 VAL 126 343 343 VAL VAL A . n 
A 1 127 GLU 127 344 344 GLU GLU A . n 
A 1 128 TYR 128 345 345 TYR TYR A . n 
A 1 129 TYR 129 346 346 TYR TYR A . n 
A 1 130 TYR 130 347 347 TYR TYR A . n 
A 1 131 ARG 131 348 348 ARG ARG A . n 
A 1 132 ARG 132 349 349 ARG ARG A . n 
A 1 133 ALA 133 350 350 ALA ALA A . n 
A 1 134 LEU 134 351 351 LEU LEU A . n 
A 1 135 GLU 135 352 352 GLU GLU A . n 
A 1 136 ILE 136 353 353 ILE ILE A . n 
A 1 137 TYR 137 354 354 TYR TYR A . n 
A 1 138 ALA 138 355 355 ALA ALA A . n 
A 1 139 THR 139 356 356 THR THR A . n 
A 1 140 ARG 140 357 357 ARG ARG A . n 
A 1 141 LEU 141 358 358 LEU LEU A . n 
A 1 142 GLY 142 359 359 GLY GLY A . n 
A 1 143 PRO 143 360 360 PRO PRO A . n 
A 1 144 ASP 144 361 361 ASP ASP A . n 
A 1 145 ASP 145 362 362 ASP ASP A . n 
A 1 146 PRO 146 363 363 PRO PRO A . n 
A 1 147 ASN 147 364 364 ASN ASN A . n 
A 1 148 VAL 148 365 365 VAL VAL A . n 
A 1 149 ALA 149 366 366 ALA ALA A . n 
A 1 150 LYS 150 367 367 LYS LYS A . n 
A 1 151 THR 151 368 368 THR THR A . n 
A 1 152 LYS 152 369 369 LYS LYS A . n 
A 1 153 ASN 153 370 370 ASN ASN A . n 
A 1 154 ASN 154 371 371 ASN ASN A . n 
A 1 155 LEU 155 372 372 LEU LEU A . n 
A 1 156 ALA 156 373 373 ALA ALA A . n 
A 1 157 SER 157 374 374 SER SER A . n 
A 1 158 CYS 158 375 375 CYS CYS A . n 
A 1 159 TYR 159 376 376 TYR TYR A . n 
A 1 160 LEU 160 377 377 LEU LEU A . n 
A 1 161 LYS 161 378 378 LYS LYS A . n 
A 1 162 GLN 162 379 379 GLN GLN A . n 
A 1 163 GLY 163 380 380 GLY GLY A . n 
A 1 164 LYS 164 381 381 LYS LYS A . n 
A 1 165 TYR 165 382 382 TYR TYR A . n 
A 1 166 GLN 166 383 383 GLN GLN A . n 
A 1 167 ASP 167 384 384 ASP ASP A . n 
A 1 168 ALA 168 385 385 ALA ALA A . n 
A 1 169 GLU 169 386 386 GLU GLU A . n 
A 1 170 THR 170 387 387 THR THR A . n 
A 1 171 LEU 171 388 388 LEU LEU A . n 
A 1 172 TYR 172 389 389 TYR TYR A . n 
A 1 173 LYS 173 390 390 LYS LYS A . n 
A 1 174 GLU 174 391 391 GLU GLU A . n 
A 1 175 ILE 175 392 392 ILE ILE A . n 
A 1 176 LEU 176 393 393 LEU LEU A . n 
A 1 177 THR 177 394 394 THR THR A . n 
A 1 178 ARG 178 395 395 ARG ARG A . n 
A 1 179 ALA 179 396 396 ALA ALA A . n 
A 1 180 HIS 180 397 397 HIS HIS A . n 
A 1 181 GLU 181 398 398 GLU GLU A . n 
A 1 182 LYS 182 399 399 LYS LYS A . n 
A 1 183 GLU 183 400 400 GLU GLU A . n 
A 1 184 PHE 184 401 401 PHE PHE A . n 
A 1 185 GLY 185 402 402 GLY GLY A . n 
A 1 186 SER 186 403 403 SER SER A . n 
A 1 187 VAL 187 404 404 VAL VAL A . n 
A 1 188 ASN 188 405 405 ASN ASN A . n 
A 1 189 GLY 189 406 406 GLY GLY A . n 
A 1 190 GLU 190 407 407 GLU GLU A . n 
A 1 191 ASN 191 408 408 ASN ASN A . n 
A 1 192 LYS 192 409 409 LYS LYS A . n 
A 1 193 PRO 193 410 410 PRO PRO A . n 
A 1 194 ILE 194 411 411 ILE ILE A . n 
A 1 195 TRP 195 412 412 TRP TRP A . n 
A 1 196 MET 196 413 413 MET MET A . n 
A 1 197 HIS 197 414 414 HIS HIS A . n 
A 1 198 ALA 198 415 415 ALA ALA A . n 
A 1 199 GLU 199 416 416 GLU GLU A . n 
A 1 200 GLU 200 417 417 GLU GLU A . n 
A 1 201 ARG 201 418 418 ARG ARG A . n 
A 1 202 GLU 202 419 419 GLU GLU A . n 
A 1 203 GLU 203 420 420 GLU GLU A . n 
A 1 204 SER 204 421 421 SER SER A . n 
A 1 205 LYS 205 422 ?   ?   ?   A . n 
A 1 206 ASP 206 423 ?   ?   ?   A . n 
A 1 207 LYS 207 424 ?   ?   ?   A . n 
A 1 208 ARG 208 425 ?   ?   ?   A . n 
A 1 209 ARG 209 426 ?   ?   ?   A . n 
A 1 210 ASP 210 427 ?   ?   ?   A . n 
A 1 211 SER 211 428 ?   ?   ?   A . n 
A 1 212 ALA 212 429 ?   ?   ?   A . n 
A 1 213 PRO 213 430 ?   ?   ?   A . n 
A 1 214 TYR 214 431 ?   ?   ?   A . n 
A 1 215 GLY 215 432 ?   ?   ?   A . n 
A 1 216 GLU 216 433 ?   ?   ?   A . n 
A 1 217 TYR 217 434 ?   ?   ?   A . n 
A 1 218 GLY 218 435 ?   ?   ?   A . n 
A 1 219 SER 219 436 ?   ?   ?   A . n 
A 1 220 TRP 220 437 ?   ?   ?   A . n 
A 1 221 TYR 221 438 ?   ?   ?   A . n 
A 1 222 LYS 222 439 ?   ?   ?   A . n 
A 1 223 ALA 223 440 440 ALA ALA A . n 
A 1 224 CYS 224 441 441 CYS CYS A . n 
A 1 225 LYS 225 442 442 LYS LYS A . n 
A 1 226 VAL 226 443 443 VAL VAL A . n 
A 1 227 ASP 227 444 444 ASP ASP A . n 
A 1 228 SER 228 445 445 SER SER A . n 
A 1 229 PRO 229 446 446 PRO PRO A . n 
A 1 230 THR 230 447 447 THR THR A . n 
A 1 231 VAL 231 448 448 VAL VAL A . n 
A 1 232 ASN 232 449 449 ASN ASN A . n 
A 1 233 THR 233 450 450 THR THR A . n 
A 1 234 THR 234 451 451 THR THR A . n 
A 1 235 LEU 235 452 452 LEU LEU A . n 
A 1 236 ARG 236 453 453 ARG ARG A . n 
A 1 237 SER 237 454 454 SER SER A . n 
A 1 238 LEU 238 455 455 LEU LEU A . n 
A 1 239 GLY 239 456 456 GLY GLY A . n 
A 1 240 ALA 240 457 457 ALA ALA A . n 
A 1 241 LEU 241 458 458 LEU LEU A . n 
A 1 242 TYR 242 459 459 TYR TYR A . n 
A 1 243 ARG 243 460 460 ARG ARG A . n 
A 1 244 ARG 244 461 461 ARG ARG A . n 
A 1 245 GLN 245 462 462 GLN GLN A . n 
A 1 246 GLY 246 463 463 GLY GLY A . n 
A 1 247 LYS 247 464 464 LYS LYS A . n 
A 1 248 LEU 248 465 465 LEU LEU A . n 
A 1 249 GLU 249 466 466 GLU GLU A . n 
A 1 250 ALA 250 467 467 ALA ALA A . n 
A 1 251 ALA 251 468 468 ALA ALA A . n 
A 1 252 HIS 252 469 469 HIS HIS A . n 
A 1 253 THR 253 470 470 THR THR A . n 
A 1 254 LEU 254 471 471 LEU LEU A . n 
A 1 255 GLU 255 472 472 GLU GLU A . n 
A 1 256 ASP 256 473 473 ASP ASP A . n 
A 1 257 CYS 257 474 474 CYS CYS A . n 
A 1 258 ALA 258 475 475 ALA ALA A . n 
A 1 259 SER 259 476 476 SER SER A . n 
A 1 260 ARG 260 477 477 ARG ARG A . n 
A 1 261 SER 261 478 478 SER SER A . n 
A 1 262 ARG 262 479 479 ARG ARG A . n 
A 1 263 LYS 263 480 ?   ?   ?   A . n 
B 1 1   VAL 1   218 ?   ?   ?   B . n 
B 1 2   PRO 2   219 ?   ?   ?   B . n 
B 1 3   LEU 3   220 ?   ?   ?   B . n 
B 1 4   CYS 4   221 ?   ?   ?   B . n 
B 1 5   LYS 5   222 ?   ?   ?   B . n 
B 1 6   GLN 6   223 ?   ?   ?   B . n 
B 1 7   ALA 7   224 ?   ?   ?   B . n 
B 1 8   LEU 8   225 ?   ?   ?   B . n 
B 1 9   GLU 9   226 ?   ?   ?   B . n 
B 1 10  ASP 10  227 ?   ?   ?   B . n 
B 1 11  LEU 11  228 ?   ?   ?   B . n 
B 1 12  GLU 12  229 ?   ?   ?   B . n 
B 1 13  LYS 13  230 ?   ?   ?   B . n 
B 1 14  THR 14  231 ?   ?   ?   B . n 
B 1 15  SER 15  232 ?   ?   ?   B . n 
B 1 16  GLY 16  233 ?   ?   ?   B . n 
B 1 17  HIS 17  234 ?   ?   ?   B . n 
B 1 18  ASP 18  235 ?   ?   ?   B . n 
B 1 19  HIS 19  236 236 HIS HIS B . n 
B 1 20  PRO 20  237 237 PRO PRO B . n 
B 1 21  ASP 21  238 238 ASP ASP B . n 
B 1 22  VAL 22  239 239 VAL VAL B . n 
B 1 23  ALA 23  240 240 ALA ALA B . n 
B 1 24  THR 24  241 241 THR THR B . n 
B 1 25  MET 25  242 242 MET MET B . n 
B 1 26  LEU 26  243 243 LEU LEU B . n 
B 1 27  ASN 27  244 244 ASN ASN B . n 
B 1 28  ILE 28  245 245 ILE ILE B . n 
B 1 29  LEU 29  246 246 LEU LEU B . n 
B 1 30  ALA 30  247 247 ALA ALA B . n 
B 1 31  LEU 31  248 248 LEU LEU B . n 
B 1 32  VAL 32  249 249 VAL VAL B . n 
B 1 33  TYR 33  250 250 TYR TYR B . n 
B 1 34  ARG 34  251 251 ARG ARG B . n 
B 1 35  ASP 35  252 252 ASP ASP B . n 
B 1 36  GLN 36  253 253 GLN GLN B . n 
B 1 37  ASN 37  254 254 ASN ASN B . n 
B 1 38  LYS 38  255 255 LYS LYS B . n 
B 1 39  TYR 39  256 256 TYR TYR B . n 
B 1 40  LYS 40  257 257 LYS LYS B . n 
B 1 41  ASP 41  258 258 ASP ASP B . n 
B 1 42  ALA 42  259 259 ALA ALA B . n 
B 1 43  ALA 43  260 260 ALA ALA B . n 
B 1 44  HIS 44  261 261 HIS HIS B . n 
B 1 45  LEU 45  262 262 LEU LEU B . n 
B 1 46  LEU 46  263 263 LEU LEU B . n 
B 1 47  ASN 47  264 264 ASN ASN B . n 
B 1 48  ASP 48  265 265 ASP ASP B . n 
B 1 49  ALA 49  266 266 ALA ALA B . n 
B 1 50  LEU 50  267 267 LEU LEU B . n 
B 1 51  ALA 51  268 268 ALA ALA B . n 
B 1 52  ILE 52  269 269 ILE ILE B . n 
B 1 53  ARG 53  270 270 ARG ARG B . n 
B 1 54  GLU 54  271 271 GLU GLU B . n 
B 1 55  LYS 55  272 272 LYS LYS B . n 
B 1 56  THR 56  273 273 THR THR B . n 
B 1 57  LEU 57  274 274 LEU LEU B . n 
B 1 58  GLY 58  275 275 GLY GLY B . n 
B 1 59  LYS 59  276 276 LYS LYS B . n 
B 1 60  ASP 60  277 277 ASP ASP B . n 
B 1 61  HIS 61  278 278 HIS HIS B . n 
B 1 62  PRO 62  279 279 PRO PRO B . n 
B 1 63  ALA 63  280 280 ALA ALA B . n 
B 1 64  VAL 64  281 281 VAL VAL B . n 
B 1 65  ALA 65  282 282 ALA ALA B . n 
B 1 66  ALA 66  283 283 ALA ALA B . n 
B 1 67  THR 67  284 284 THR THR B . n 
B 1 68  LEU 68  285 285 LEU LEU B . n 
B 1 69  ASN 69  286 286 ASN ASN B . n 
B 1 70  ASN 70  287 287 ASN ASN B . n 
B 1 71  LEU 71  288 288 LEU LEU B . n 
B 1 72  ALA 72  289 289 ALA ALA B . n 
B 1 73  VAL 73  290 290 VAL VAL B . n 
B 1 74  LEU 74  291 291 LEU LEU B . n 
B 1 75  TYR 75  292 292 TYR TYR B . n 
B 1 76  GLY 76  293 293 GLY GLY B . n 
B 1 77  LYS 77  294 294 LYS LYS B . n 
B 1 78  ARG 78  295 295 ARG ARG B . n 
B 1 79  GLY 79  296 296 GLY GLY B . n 
B 1 80  LYS 80  297 297 LYS LYS B . n 
B 1 81  TYR 81  298 298 TYR TYR B . n 
B 1 82  LYS 82  299 299 LYS LYS B . n 
B 1 83  GLU 83  300 300 GLU GLU B . n 
B 1 84  ALA 84  301 301 ALA ALA B . n 
B 1 85  GLU 85  302 302 GLU GLU B . n 
B 1 86  PRO 86  303 303 PRO PRO B . n 
B 1 87  LEU 87  304 304 LEU LEU B . n 
B 1 88  CYS 88  305 305 CYS CYS B . n 
B 1 89  LYS 89  306 306 LYS LYS B . n 
B 1 90  ARG 90  307 307 ARG ARG B . n 
B 1 91  ALA 91  308 308 ALA ALA B . n 
B 1 92  LEU 92  309 309 LEU LEU B . n 
B 1 93  GLU 93  310 310 GLU GLU B . n 
B 1 94  ILE 94  311 311 ILE ILE B . n 
B 1 95  ARG 95  312 312 ARG ARG B . n 
B 1 96  GLU 96  313 313 GLU GLU B . n 
B 1 97  LYS 97  314 314 LYS LYS B . n 
B 1 98  VAL 98  315 315 VAL VAL B . n 
B 1 99  LEU 99  316 316 LEU LEU B . n 
B 1 100 GLY 100 317 317 GLY GLY B . n 
B 1 101 LYS 101 318 318 LYS LYS B . n 
B 1 102 PHE 102 319 319 PHE PHE B . n 
B 1 103 HIS 103 320 320 HIS HIS B . n 
B 1 104 PRO 104 321 321 PRO PRO B . n 
B 1 105 ASP 105 322 322 ASP ASP B . n 
B 1 106 VAL 106 323 323 VAL VAL B . n 
B 1 107 ALA 107 324 324 ALA ALA B . n 
B 1 108 LYS 108 325 325 LYS LYS B . n 
B 1 109 GLN 109 326 326 GLN GLN B . n 
B 1 110 LEU 110 327 327 LEU LEU B . n 
B 1 111 SER 111 328 328 SER SER B . n 
B 1 112 ASN 112 329 329 ASN ASN B . n 
B 1 113 LEU 113 330 330 LEU LEU B . n 
B 1 114 ALA 114 331 331 ALA ALA B . n 
B 1 115 LEU 115 332 332 LEU LEU B . n 
B 1 116 LEU 116 333 333 LEU LEU B . n 
B 1 117 CYS 117 334 334 CYS CYS B . n 
B 1 118 GLN 118 335 335 GLN GLN B . n 
B 1 119 ASN 119 336 336 ASN ASN B . n 
B 1 120 GLN 120 337 337 GLN GLN B . n 
B 1 121 GLY 121 338 338 GLY GLY B . n 
B 1 122 LYS 122 339 339 LYS LYS B . n 
B 1 123 ALA 123 340 340 ALA ALA B . n 
B 1 124 GLU 124 341 341 GLU GLU B . n 
B 1 125 GLU 125 342 342 GLU GLU B . n 
B 1 126 VAL 126 343 343 VAL VAL B . n 
B 1 127 GLU 127 344 344 GLU GLU B . n 
B 1 128 TYR 128 345 345 TYR TYR B . n 
B 1 129 TYR 129 346 346 TYR TYR B . n 
B 1 130 TYR 130 347 347 TYR TYR B . n 
B 1 131 ARG 131 348 348 ARG ARG B . n 
B 1 132 ARG 132 349 349 ARG ARG B . n 
B 1 133 ALA 133 350 350 ALA ALA B . n 
B 1 134 LEU 134 351 351 LEU LEU B . n 
B 1 135 GLU 135 352 352 GLU GLU B . n 
B 1 136 ILE 136 353 353 ILE ILE B . n 
B 1 137 TYR 137 354 354 TYR TYR B . n 
B 1 138 ALA 138 355 355 ALA ALA B . n 
B 1 139 THR 139 356 356 THR THR B . n 
B 1 140 ARG 140 357 357 ARG ARG B . n 
B 1 141 LEU 141 358 358 LEU LEU B . n 
B 1 142 GLY 142 359 359 GLY GLY B . n 
B 1 143 PRO 143 360 360 PRO PRO B . n 
B 1 144 ASP 144 361 361 ASP ASP B . n 
B 1 145 ASP 145 362 362 ASP ASP B . n 
B 1 146 PRO 146 363 363 PRO PRO B . n 
B 1 147 ASN 147 364 364 ASN ASN B . n 
B 1 148 VAL 148 365 365 VAL VAL B . n 
B 1 149 ALA 149 366 366 ALA ALA B . n 
B 1 150 LYS 150 367 367 LYS LYS B . n 
B 1 151 THR 151 368 368 THR THR B . n 
B 1 152 LYS 152 369 369 LYS LYS B . n 
B 1 153 ASN 153 370 370 ASN ASN B . n 
B 1 154 ASN 154 371 371 ASN ASN B . n 
B 1 155 LEU 155 372 372 LEU LEU B . n 
B 1 156 ALA 156 373 373 ALA ALA B . n 
B 1 157 SER 157 374 374 SER SER B . n 
B 1 158 CYS 158 375 375 CYS CYS B . n 
B 1 159 TYR 159 376 376 TYR TYR B . n 
B 1 160 LEU 160 377 377 LEU LEU B . n 
B 1 161 LYS 161 378 378 LYS LYS B . n 
B 1 162 GLN 162 379 379 GLN GLN B . n 
B 1 163 GLY 163 380 380 GLY GLY B . n 
B 1 164 LYS 164 381 381 LYS LYS B . n 
B 1 165 TYR 165 382 382 TYR TYR B . n 
B 1 166 GLN 166 383 383 GLN GLN B . n 
B 1 167 ASP 167 384 384 ASP ASP B . n 
B 1 168 ALA 168 385 385 ALA ALA B . n 
B 1 169 GLU 169 386 386 GLU GLU B . n 
B 1 170 THR 170 387 387 THR THR B . n 
B 1 171 LEU 171 388 388 LEU LEU B . n 
B 1 172 TYR 172 389 389 TYR TYR B . n 
B 1 173 LYS 173 390 390 LYS LYS B . n 
B 1 174 GLU 174 391 391 GLU GLU B . n 
B 1 175 ILE 175 392 392 ILE ILE B . n 
B 1 176 LEU 176 393 393 LEU LEU B . n 
B 1 177 THR 177 394 394 THR THR B . n 
B 1 178 ARG 178 395 395 ARG ARG B . n 
B 1 179 ALA 179 396 396 ALA ALA B . n 
B 1 180 HIS 180 397 397 HIS HIS B . n 
B 1 181 GLU 181 398 398 GLU GLU B . n 
B 1 182 LYS 182 399 399 LYS LYS B . n 
B 1 183 GLU 183 400 400 GLU GLU B . n 
B 1 184 PHE 184 401 401 PHE PHE B . n 
B 1 185 GLY 185 402 402 GLY GLY B . n 
B 1 186 SER 186 403 403 SER SER B . n 
B 1 187 VAL 187 404 404 VAL VAL B . n 
B 1 188 ASN 188 405 405 ASN ASN B . n 
B 1 189 GLY 189 406 406 GLY GLY B . n 
B 1 190 GLU 190 407 407 GLU GLU B . n 
B 1 191 ASN 191 408 408 ASN ASN B . n 
B 1 192 LYS 192 409 409 LYS LYS B . n 
B 1 193 PRO 193 410 410 PRO PRO B . n 
B 1 194 ILE 194 411 411 ILE ILE B . n 
B 1 195 TRP 195 412 412 TRP TRP B . n 
B 1 196 MET 196 413 413 MET MET B . n 
B 1 197 HIS 197 414 414 HIS HIS B . n 
B 1 198 ALA 198 415 415 ALA ALA B . n 
B 1 199 GLU 199 416 416 GLU GLU B . n 
B 1 200 GLU 200 417 417 GLU GLU B . n 
B 1 201 ARG 201 418 418 ARG ARG B . n 
B 1 202 GLU 202 419 419 GLU GLU B . n 
B 1 203 GLU 203 420 420 GLU GLU B . n 
B 1 204 SER 204 421 421 SER SER B . n 
B 1 205 LYS 205 422 ?   ?   ?   B . n 
B 1 206 ASP 206 423 ?   ?   ?   B . n 
B 1 207 LYS 207 424 ?   ?   ?   B . n 
B 1 208 ARG 208 425 ?   ?   ?   B . n 
B 1 209 ARG 209 426 ?   ?   ?   B . n 
B 1 210 ASP 210 427 ?   ?   ?   B . n 
B 1 211 SER 211 428 ?   ?   ?   B . n 
B 1 212 ALA 212 429 ?   ?   ?   B . n 
B 1 213 PRO 213 430 ?   ?   ?   B . n 
B 1 214 TYR 214 431 ?   ?   ?   B . n 
B 1 215 GLY 215 432 ?   ?   ?   B . n 
B 1 216 GLU 216 433 ?   ?   ?   B . n 
B 1 217 TYR 217 434 ?   ?   ?   B . n 
B 1 218 GLY 218 435 ?   ?   ?   B . n 
B 1 219 SER 219 436 ?   ?   ?   B . n 
B 1 220 TRP 220 437 ?   ?   ?   B . n 
B 1 221 TYR 221 438 ?   ?   ?   B . n 
B 1 222 LYS 222 439 439 LYS LYS B . n 
B 1 223 ALA 223 440 440 ALA ALA B . n 
B 1 224 CYS 224 441 441 CYS CYS B . n 
B 1 225 LYS 225 442 442 LYS LYS B . n 
B 1 226 VAL 226 443 443 VAL VAL B . n 
B 1 227 ASP 227 444 444 ASP ASP B . n 
B 1 228 SER 228 445 445 SER SER B . n 
B 1 229 PRO 229 446 446 PRO PRO B . n 
B 1 230 THR 230 447 447 THR THR B . n 
B 1 231 VAL 231 448 448 VAL VAL B . n 
B 1 232 ASN 232 449 449 ASN ASN B . n 
B 1 233 THR 233 450 450 THR THR B . n 
B 1 234 THR 234 451 451 THR THR B . n 
B 1 235 LEU 235 452 452 LEU LEU B . n 
B 1 236 ARG 236 453 453 ARG ARG B . n 
B 1 237 SER 237 454 454 SER SER B . n 
B 1 238 LEU 238 455 455 LEU LEU B . n 
B 1 239 GLY 239 456 456 GLY GLY B . n 
B 1 240 ALA 240 457 457 ALA ALA B . n 
B 1 241 LEU 241 458 458 LEU LEU B . n 
B 1 242 TYR 242 459 459 TYR TYR B . n 
B 1 243 ARG 243 460 460 ARG ARG B . n 
B 1 244 ARG 244 461 461 ARG ARG B . n 
B 1 245 GLN 245 462 462 GLN GLN B . n 
B 1 246 GLY 246 463 463 GLY GLY B . n 
B 1 247 LYS 247 464 464 LYS LYS B . n 
B 1 248 LEU 248 465 465 LEU LEU B . n 
B 1 249 GLU 249 466 466 GLU GLU B . n 
B 1 250 ALA 250 467 467 ALA ALA B . n 
B 1 251 ALA 251 468 468 ALA ALA B . n 
B 1 252 HIS 252 469 469 HIS HIS B . n 
B 1 253 THR 253 470 470 THR THR B . n 
B 1 254 LEU 254 471 471 LEU LEU B . n 
B 1 255 GLU 255 472 472 GLU GLU B . n 
B 1 256 ASP 256 473 473 ASP ASP B . n 
B 1 257 CYS 257 474 474 CYS CYS B . n 
B 1 258 ALA 258 475 475 ALA ALA B . n 
B 1 259 SER 259 476 476 SER SER B . n 
B 1 260 ARG 260 477 477 ARG ARG B . n 
B 1 261 SER 261 478 ?   ?   ?   B . n 
B 1 262 ARG 262 479 ?   ?   ?   B . n 
B 1 263 LYS 263 480 ?   ?   ?   B . n 
C 2 1   MET 1   182 ?   ?   ?   X . n 
C 2 2   GLY 2   183 ?   ?   ?   X . n 
C 2 3   SER 3   184 ?   ?   ?   X . n 
C 2 4   SER 4   185 ?   ?   ?   X . n 
C 2 5   HIS 5   186 ?   ?   ?   X . n 
C 2 6   HIS 6   187 ?   ?   ?   X . n 
C 2 7   HIS 7   188 ?   ?   ?   X . n 
C 2 8   HIS 8   189 ?   ?   ?   X . n 
C 2 9   HIS 9   190 ?   ?   ?   X . n 
C 2 10  HIS 10  191 ?   ?   ?   X . n 
C 2 11  SER 11  192 ?   ?   ?   X . n 
C 2 12  SER 12  193 ?   ?   ?   X . n 
C 2 13  GLY 13  194 ?   ?   ?   X . n 
C 2 14  LEU 14  195 ?   ?   ?   X . n 
C 2 15  VAL 15  196 ?   ?   ?   X . n 
C 2 16  PRO 16  197 ?   ?   ?   X . n 
C 2 17  ARG 17  198 ?   ?   ?   X . n 
C 2 18  GLY 18  199 ?   ?   ?   X . n 
C 2 19  SER 19  200 ?   ?   ?   X . n 
C 2 20  HIS 20  201 ?   ?   ?   X . n 
C 2 21  MET 21  202 ?   ?   ?   X . n 
C 2 22  THR 22  203 203 THR THR X . n 
C 2 23  ASN 23  204 204 ASN ASN X . n 
C 2 24  LEU 24  205 205 LEU LEU X . n 
C 2 25  GLU 25  206 206 GLU GLU X . n 
C 2 26  TRP 26  207 207 TRP TRP X . n 
C 2 27  ASP 27  208 208 ASP ASP X . n 
C 2 28  ASP 28  209 209 ASP ASP X . n 
C 2 29  SER 29  210 210 SER SER X . n 
C 2 30  ALA 30  211 211 ALA ALA X . n 
C 2 31  ILE 31  212 212 ILE ILE X . n 
C 2 32  THR 32  213 213 THR THR X . n 
C 2 33  GLY 33  214 ?   ?   ?   X . n 
C 2 34  SER 34  215 ?   ?   ?   X . n 
C 2 35  THR 35  216 ?   ?   ?   X . n 
C 2 36  GLY 36  217 ?   ?   ?   X . n 
C 2 37  SER 37  218 ?   ?   ?   X . n 
C 2 38  THR 38  219 ?   ?   ?   X . n 
C 2 39  GLY 39  220 ?   ?   ?   X . n 
C 2 40  SER 40  221 ?   ?   ?   X . n 
C 2 41  THR 41  222 ?   ?   ?   X . n 
C 2 42  GLY 42  223 ?   ?   ?   X . n 
C 2 43  SER 43  224 ?   ?   ?   X . n 
C 2 44  HIS 44  225 ?   ?   ?   X . n 
C 2 45  MET 45  226 ?   ?   ?   X . n 
D 2 1   MET 1   182 ?   ?   ?   Y . n 
D 2 2   GLY 2   183 ?   ?   ?   Y . n 
D 2 3   SER 3   184 ?   ?   ?   Y . n 
D 2 4   SER 4   185 ?   ?   ?   Y . n 
D 2 5   HIS 5   186 ?   ?   ?   Y . n 
D 2 6   HIS 6   187 ?   ?   ?   Y . n 
D 2 7   HIS 7   188 ?   ?   ?   Y . n 
D 2 8   HIS 8   189 ?   ?   ?   Y . n 
D 2 9   HIS 9   190 ?   ?   ?   Y . n 
D 2 10  HIS 10  191 ?   ?   ?   Y . n 
D 2 11  SER 11  192 ?   ?   ?   Y . n 
D 2 12  SER 12  193 ?   ?   ?   Y . n 
D 2 13  GLY 13  194 ?   ?   ?   Y . n 
D 2 14  LEU 14  195 ?   ?   ?   Y . n 
D 2 15  VAL 15  196 ?   ?   ?   Y . n 
D 2 16  PRO 16  197 ?   ?   ?   Y . n 
D 2 17  ARG 17  198 ?   ?   ?   Y . n 
D 2 18  GLY 18  199 ?   ?   ?   Y . n 
D 2 19  SER 19  200 ?   ?   ?   Y . n 
D 2 20  HIS 20  201 ?   ?   ?   Y . n 
D 2 21  MET 21  202 ?   ?   ?   Y . n 
D 2 22  THR 22  203 203 THR THR Y . n 
D 2 23  ASN 23  204 204 ASN ASN Y . n 
D 2 24  LEU 24  205 205 LEU LEU Y . n 
D 2 25  GLU 25  206 206 GLU GLU Y . n 
D 2 26  TRP 26  207 207 TRP TRP Y . n 
D 2 27  ASP 27  208 208 ASP ASP Y . n 
D 2 28  ASP 28  209 209 ASP ASP Y . n 
D 2 29  SER 29  210 210 SER SER Y . n 
D 2 30  ALA 30  211 211 ALA ALA Y . n 
D 2 31  ILE 31  212 212 ILE ILE Y . n 
D 2 32  THR 32  213 ?   ?   ?   Y . n 
D 2 33  GLY 33  214 ?   ?   ?   Y . n 
D 2 34  SER 34  215 ?   ?   ?   Y . n 
D 2 35  THR 35  216 ?   ?   ?   Y . n 
D 2 36  GLY 36  217 ?   ?   ?   Y . n 
D 2 37  SER 37  218 ?   ?   ?   Y . n 
D 2 38  THR 38  219 ?   ?   ?   Y . n 
D 2 39  GLY 39  220 ?   ?   ?   Y . n 
D 2 40  SER 40  221 ?   ?   ?   Y . n 
D 2 41  THR 41  222 ?   ?   ?   Y . n 
D 2 42  GLY 42  223 ?   ?   ?   Y . n 
D 2 43  SER 43  224 ?   ?   ?   Y . n 
D 2 44  HIS 44  225 ?   ?   ?   Y . n 
D 2 45  MET 45  226 ?   ?   ?   Y . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1540  ? 
1 MORE         -8.0  ? 
1 'SSA (A^2)'  12170 ? 
2 'ABSA (A^2)' 1510  ? 
2 MORE         -6.8  ? 
2 'SSA (A^2)'  12050 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-04-03 
2 'Structure model' 1 1 2013-05-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined -40.2874 17.3227 50.0863 0.3632  0.5415  -0.3060 0.0350  -0.1891 -0.0602 0.5507  0.4941 2.9171  
0.7164  -1.4421 -0.9059 -0.0106 0.0599  -0.0303 0.0148  -0.0264 0.2642  0.1062  -0.1026 0.0370  
'X-RAY DIFFRACTION' 2  ? refined -29.7350 17.3827 53.4302 0.5213  0.4068  -0.5876 0.0496  0.0033  0.0942  5.8659  1.9467 11.1992 
3.5852  1.4705  1.9607  -0.0135 0.4237  -0.0085 -0.2391 0.2312  -0.0150 -0.2207 0.1745  -0.2177 
'X-RAY DIFFRACTION' 3  ? refined -31.6737 22.0029 61.8485 0.2316  0.5124  -0.4111 0.1608  0.0163  0.1433  1.3192  3.7975 10.8119 
-4.0857 3.0246  -0.6579 -0.0288 0.1465  0.1594  -0.4156 0.1630  0.0685  -0.4804 -0.1281 -0.1342 
'X-RAY DIFFRACTION' 4  ? refined -33.3418 26.6329 68.8142 0.5578  0.3336  -0.3040 0.2508  -0.0740 0.2103  0.0163  6.4804 6.1492  
1.4922  5.6036  -1.1296 -0.0158 -0.0271 0.1377  -0.1290 0.1218  -0.0961 -0.1893 -0.1405 -0.1060 
'X-RAY DIFFRACTION' 5  ? refined -32.0729 19.4641 78.6929 -0.0211 0.0209  -0.1883 0.0576  -0.0184 0.0335  5.9977  3.2813 13.6941 
-5.4581 -2.5607 -0.9009 -0.1050 0.8422  0.0782  -0.5187 0.0635  -0.0269 -0.6638 -0.6511 0.0414  
'X-RAY DIFFRACTION' 6  ? refined -27.4844 5.1196  92.1601 -0.0850 -0.0964 0.0115  0.0283  0.0085  -0.0371 5.0575  5.7196 9.3570  
-1.4021 2.8637  0.5464  -0.0271 -0.3526 -0.7182 -0.1205 0.0914  0.3816  1.0424  -0.3037 -0.0643 
'X-RAY DIFFRACTION' 7  ? refined -25.2999 -5.5573 90.3851 0.4597  0.2395  0.5561  -0.0715 -0.1730 0.1175  0.9195  6.0730 0.2193  
-5.5682 -0.2089 0.7742  -0.0503 -0.0261 -0.1925 -0.1140 0.0268  0.1131  0.1554  -0.0713 0.0235  
'X-RAY DIFFRACTION' 8  ? refined -19.8050 2.3474  88.3405 0.0214  -0.1642 0.0532  0.0558  0.0113  -0.1846 1.0585  4.4137 2.1627  
-2.1512 -4.4557 -2.5977 0.0176  0.2135  -0.1429 -0.0708 -0.1676 -0.4933 -0.1136 0.3307  0.1500  
'X-RAY DIFFRACTION' 9  ? refined -16.8604 -2.8867 91.4139 -0.0555 -0.2528 0.0788  0.1707  -0.0682 -0.0543 10.6053 9.2597 4.9743  
-5.2826 -5.5530 1.7803  -0.0397 -0.2015 0.3350  -0.2586 0.0465  -0.2539 0.3369  0.4665  -0.0068 
'X-RAY DIFFRACTION' 10 ? refined -31.8426 15.5668 40.7294 0.2803  0.5669  -0.5385 0.2449  -0.0799 0.0559  6.2662  0.1359 12.7703 
-1.6304 -2.8760 2.8247  0.0648  -0.2799 -0.0535 0.1564  0.0065  0.0544  -0.1163 -0.1027 -0.0713 
'X-RAY DIFFRACTION' 11 ? refined -24.0067 9.2723  35.1859 0.4358  0.4041  -0.5366 0.3040  -0.1811 0.1307  5.5534  4.7863 10.1433 
-5.3824 -5.1474 -0.7805 0.1175  -0.3720 -0.3699 0.0135  -0.1559 -0.4374 0.0594  0.4873  0.0384  
'X-RAY DIFFRACTION' 12 ? refined -21.1823 14.6538 25.8950 0.2019  0.5582  -0.3229 0.2410  -0.0937 0.0771  3.6129  1.5924 8.9378  
-5.1963 -0.4360 -3.2331 0.0619  -0.5617 0.0360  0.1868  -0.1780 -0.1550 -0.2168 0.6054  0.1162  
'X-RAY DIFFRACTION' 13 ? refined -25.5855 14.7447 14.7947 -0.1235 0.1169  -0.2874 0.1243  -0.0192 0.0290  3.2070  8.7504 13.3758 
-4.4780 0.4018  0.1371  -0.1296 -0.7003 0.0066  0.7223  0.0231  -0.1273 0.2946  0.6252  0.1065  
'X-RAY DIFFRACTION' 14 ? refined -33.7286 17.1256 9.1640  0.0187  0.1068  -0.0848 0.0318  0.0810  -0.0088 6.3357  2.4681 11.6809 
-4.5151 0.9665  -4.4932 -0.0592 -0.4406 -0.0666 0.1556  0.2994  0.1217  0.2216  -0.2456 -0.2401 
'X-RAY DIFFRACTION' 15 ? refined -42.8892 19.8325 -2.4837 -0.0732 -0.1780 0.1305  -0.0439 -0.0143 -0.0438 8.6556  4.3007 8.8866  
-2.2263 -2.9866 -1.9595 -0.1230 0.5162  -0.4909 -0.2866 -0.0896 0.7216  0.2057  -0.6902 0.2126  
'X-RAY DIFFRACTION' 16 ? refined -50.3508 27.4487 -3.7739 0.1557  0.4477  0.5310  0.2150  -0.2247 0.0360  7.9042  2.6206 0.3800  
-3.6524 2.0092  2.2479  0.0280  -0.1662 -0.0382 -0.0533 -0.1272 0.0632  0.0704  -0.1833 0.0992  
'X-RAY DIFFRACTION' 17 ? refined -41.6993 29.7475 2.8224  -0.1804 -0.3723 0.1492  -0.0426 -0.0088 -0.0609 13.3477 9.4846 6.9357  
-5.2883 2.8301  -1.8154 -0.0722 -0.1821 0.7678  0.5261  -0.0020 0.0451  -0.3179 -0.0114 0.0742  
'X-RAY DIFFRACTION' 18 ? refined -49.3496 31.0431 3.5278  -0.1860 -0.2168 0.3887  0.0358  -0.0969 -0.2403 2.6101  1.1613 6.2608  
-1.8207 1.3714  5.1597  0.0148  0.0896  0.1069  0.1170  0.0113  -0.0271 -0.2595 0.0807  -0.0262 
'X-RAY DIFFRACTION' 19 ? refined -32.7955 13.0120 64.2999 0.3192  0.4383  -0.4399 0.0555  -0.0777 0.0263  0.8656  5.9953 8.3155  
1.4886  -5.7296 1.6183  -0.0083 0.0494  -0.0471 -0.1059 0.1381  0.0234  0.1765  -0.0463 -0.1298 
'X-RAY DIFFRACTION' 20 ? refined -33.0868 14.6641 28.3493 0.4413  0.4817  -0.3874 0.2550  0.1330  0.0551  5.3015  0.0000 5.0765  
0.7055  3.9038  3.7950  -0.0075 -0.0496 -0.0389 -0.0629 0.0823  0.1102  -0.0092 -0.0051 -0.0748 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 236 -244'  
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 245 - 272' 
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 273 - 298' 
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 299 - 315' 
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 316 - 360' 
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 361 - 419' 
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 420 - 446' 
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 447 - 460' 
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 461 - 479' 
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? 'CHAIN B AND RESID 236 - 258' 
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? 'CHAIN B AND RESID 259 - 291' 
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? 'CHAIN B AND RESID 292 - 316' 
'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? 'CHAIN B AND RESID 317 - 355' 
'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? 'CHAIN B AND RESID 356 - 380' 
'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? 'CHAIN B AND RESID 381 - 417' 
'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? 'CHAIN B AND RESID 418 - 443' 
'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? 'CHAIN B AND RESID 444 - 468' 
'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? 'CHAIN B AND RESID 469 - 477' 
'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? 'CHAIN X AND RESID 203 - 213' 
'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? 'CHAIN Y AND RESID 203 - 212' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER refinement       2.10.0 ? 1 
XDS    'data reduction' .      ? 2 
SCALA  'data scaling'   .      ? 3 
MOLREP phasing          .      ? 4 
# 
_pdbx_entry_details.entry_id             3ZFW 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;RESIDUES MGSSHHHHHHSSGLVPRGSHM AND TGSTGSTGSTGSHM ARE
DERIVED FROM THE CLONING STRATEGY. ONLY RESIDUES
TNLEWDDSAI BELONG TO Q8IWE5
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 277 ? ? 70.82   38.02   
2 1 ASN A 405 ? ? -121.75 -138.20 
3 1 GLU A 420 ? ? -58.49  -6.26   
4 1 CYS A 441 ? ? -109.28 -76.91  
5 1 LYS A 442 ? ? 37.36   58.05   
6 1 ASP B 277 ? ? 70.99   38.22   
7 1 ASN B 405 ? ? -122.37 -137.24 
8 1 GLU B 420 ? ? -58.04  -7.66   
9 1 CYS B 441 ? ? -145.99 -91.49  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A VAL 218 ? A VAL 1   
2   1 Y 1 A PRO 219 ? A PRO 2   
3   1 Y 1 A LEU 220 ? A LEU 3   
4   1 Y 1 A CYS 221 ? A CYS 4   
5   1 Y 1 A LYS 222 ? A LYS 5   
6   1 Y 1 A GLN 223 ? A GLN 6   
7   1 Y 1 A ALA 224 ? A ALA 7   
8   1 Y 1 A LEU 225 ? A LEU 8   
9   1 Y 1 A GLU 226 ? A GLU 9   
10  1 Y 1 A ASP 227 ? A ASP 10  
11  1 Y 1 A LEU 228 ? A LEU 11  
12  1 Y 1 A GLU 229 ? A GLU 12  
13  1 Y 1 A LYS 230 ? A LYS 13  
14  1 Y 1 A THR 231 ? A THR 14  
15  1 Y 1 A SER 232 ? A SER 15  
16  1 Y 1 A GLY 233 ? A GLY 16  
17  1 Y 1 A HIS 234 ? A HIS 17  
18  1 Y 1 A ASP 235 ? A ASP 18  
19  1 Y 1 A LYS 422 ? A LYS 205 
20  1 Y 1 A ASP 423 ? A ASP 206 
21  1 Y 1 A LYS 424 ? A LYS 207 
22  1 Y 1 A ARG 425 ? A ARG 208 
23  1 Y 1 A ARG 426 ? A ARG 209 
24  1 Y 1 A ASP 427 ? A ASP 210 
25  1 Y 1 A SER 428 ? A SER 211 
26  1 Y 1 A ALA 429 ? A ALA 212 
27  1 Y 1 A PRO 430 ? A PRO 213 
28  1 Y 1 A TYR 431 ? A TYR 214 
29  1 Y 1 A GLY 432 ? A GLY 215 
30  1 Y 1 A GLU 433 ? A GLU 216 
31  1 Y 1 A TYR 434 ? A TYR 217 
32  1 Y 1 A GLY 435 ? A GLY 218 
33  1 Y 1 A SER 436 ? A SER 219 
34  1 Y 1 A TRP 437 ? A TRP 220 
35  1 Y 1 A TYR 438 ? A TYR 221 
36  1 Y 1 A LYS 439 ? A LYS 222 
37  1 Y 1 A LYS 480 ? A LYS 263 
38  1 Y 1 B VAL 218 ? B VAL 1   
39  1 Y 1 B PRO 219 ? B PRO 2   
40  1 Y 1 B LEU 220 ? B LEU 3   
41  1 Y 1 B CYS 221 ? B CYS 4   
42  1 Y 1 B LYS 222 ? B LYS 5   
43  1 Y 1 B GLN 223 ? B GLN 6   
44  1 Y 1 B ALA 224 ? B ALA 7   
45  1 Y 1 B LEU 225 ? B LEU 8   
46  1 Y 1 B GLU 226 ? B GLU 9   
47  1 Y 1 B ASP 227 ? B ASP 10  
48  1 Y 1 B LEU 228 ? B LEU 11  
49  1 Y 1 B GLU 229 ? B GLU 12  
50  1 Y 1 B LYS 230 ? B LYS 13  
51  1 Y 1 B THR 231 ? B THR 14  
52  1 Y 1 B SER 232 ? B SER 15  
53  1 Y 1 B GLY 233 ? B GLY 16  
54  1 Y 1 B HIS 234 ? B HIS 17  
55  1 Y 1 B ASP 235 ? B ASP 18  
56  1 Y 1 B LYS 422 ? B LYS 205 
57  1 Y 1 B ASP 423 ? B ASP 206 
58  1 Y 1 B LYS 424 ? B LYS 207 
59  1 Y 1 B ARG 425 ? B ARG 208 
60  1 Y 1 B ARG 426 ? B ARG 209 
61  1 Y 1 B ASP 427 ? B ASP 210 
62  1 Y 1 B SER 428 ? B SER 211 
63  1 Y 1 B ALA 429 ? B ALA 212 
64  1 Y 1 B PRO 430 ? B PRO 213 
65  1 Y 1 B TYR 431 ? B TYR 214 
66  1 Y 1 B GLY 432 ? B GLY 215 
67  1 Y 1 B GLU 433 ? B GLU 216 
68  1 Y 1 B TYR 434 ? B TYR 217 
69  1 Y 1 B GLY 435 ? B GLY 218 
70  1 Y 1 B SER 436 ? B SER 219 
71  1 Y 1 B TRP 437 ? B TRP 220 
72  1 Y 1 B TYR 438 ? B TYR 221 
73  1 Y 1 B SER 478 ? B SER 261 
74  1 Y 1 B ARG 479 ? B ARG 262 
75  1 Y 1 B LYS 480 ? B LYS 263 
76  1 Y 1 X MET 182 ? C MET 1   
77  1 Y 1 X GLY 183 ? C GLY 2   
78  1 Y 1 X SER 184 ? C SER 3   
79  1 Y 1 X SER 185 ? C SER 4   
80  1 Y 1 X HIS 186 ? C HIS 5   
81  1 Y 1 X HIS 187 ? C HIS 6   
82  1 Y 1 X HIS 188 ? C HIS 7   
83  1 Y 1 X HIS 189 ? C HIS 8   
84  1 Y 1 X HIS 190 ? C HIS 9   
85  1 Y 1 X HIS 191 ? C HIS 10  
86  1 Y 1 X SER 192 ? C SER 11  
87  1 Y 1 X SER 193 ? C SER 12  
88  1 Y 1 X GLY 194 ? C GLY 13  
89  1 Y 1 X LEU 195 ? C LEU 14  
90  1 Y 1 X VAL 196 ? C VAL 15  
91  1 Y 1 X PRO 197 ? C PRO 16  
92  1 Y 1 X ARG 198 ? C ARG 17  
93  1 Y 1 X GLY 199 ? C GLY 18  
94  1 Y 1 X SER 200 ? C SER 19  
95  1 Y 1 X HIS 201 ? C HIS 20  
96  1 Y 1 X MET 202 ? C MET 21  
97  1 Y 1 X GLY 214 ? C GLY 33  
98  1 Y 1 X SER 215 ? C SER 34  
99  1 Y 1 X THR 216 ? C THR 35  
100 1 Y 1 X GLY 217 ? C GLY 36  
101 1 Y 1 X SER 218 ? C SER 37  
102 1 Y 1 X THR 219 ? C THR 38  
103 1 Y 1 X GLY 220 ? C GLY 39  
104 1 Y 1 X SER 221 ? C SER 40  
105 1 Y 1 X THR 222 ? C THR 41  
106 1 Y 1 X GLY 223 ? C GLY 42  
107 1 Y 1 X SER 224 ? C SER 43  
108 1 Y 1 X HIS 225 ? C HIS 44  
109 1 Y 1 X MET 226 ? C MET 45  
110 1 Y 1 Y MET 182 ? D MET 1   
111 1 Y 1 Y GLY 183 ? D GLY 2   
112 1 Y 1 Y SER 184 ? D SER 3   
113 1 Y 1 Y SER 185 ? D SER 4   
114 1 Y 1 Y HIS 186 ? D HIS 5   
115 1 Y 1 Y HIS 187 ? D HIS 6   
116 1 Y 1 Y HIS 188 ? D HIS 7   
117 1 Y 1 Y HIS 189 ? D HIS 8   
118 1 Y 1 Y HIS 190 ? D HIS 9   
119 1 Y 1 Y HIS 191 ? D HIS 10  
120 1 Y 1 Y SER 192 ? D SER 11  
121 1 Y 1 Y SER 193 ? D SER 12  
122 1 Y 1 Y GLY 194 ? D GLY 13  
123 1 Y 1 Y LEU 195 ? D LEU 14  
124 1 Y 1 Y VAL 196 ? D VAL 15  
125 1 Y 1 Y PRO 197 ? D PRO 16  
126 1 Y 1 Y ARG 198 ? D ARG 17  
127 1 Y 1 Y GLY 199 ? D GLY 18  
128 1 Y 1 Y SER 200 ? D SER 19  
129 1 Y 1 Y HIS 201 ? D HIS 20  
130 1 Y 1 Y MET 202 ? D MET 21  
131 1 Y 1 Y THR 213 ? D THR 32  
132 1 Y 1 Y GLY 214 ? D GLY 33  
133 1 Y 1 Y SER 215 ? D SER 34  
134 1 Y 1 Y THR 216 ? D THR 35  
135 1 Y 1 Y GLY 217 ? D GLY 36  
136 1 Y 1 Y SER 218 ? D SER 37  
137 1 Y 1 Y THR 219 ? D THR 38  
138 1 Y 1 Y GLY 220 ? D GLY 39  
139 1 Y 1 Y SER 221 ? D SER 40  
140 1 Y 1 Y THR 222 ? D THR 41  
141 1 Y 1 Y GLY 223 ? D GLY 42  
142 1 Y 1 Y SER 224 ? D SER 43  
143 1 Y 1 Y HIS 225 ? D HIS 44  
144 1 Y 1 Y MET 226 ? D MET 45  
#