data_3ZLU
# 
_entry.id   3ZLU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ZLU         
PDBE  EBI-55714    
WWPDB D_1290055714 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 3ZLT unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE IN COMPLEX WITH RVX'                  
PDB 3ZLV unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HI-6' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ZLU 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-02-04 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Artursson, E.'   1 
'Andersson, P.O.' 2 
'Akfur, C.'       3 
'Linusson, A.'    4 
'Borjegren, S.'   5 
'Ekstrom, F.'     6 
# 
_citation.id                        primary 
_citation.title                     
;Catalytic-Site Conformational Equilibrium in Nerve-Agent Adducts of Acetylcholinesterase; Possible Implications for the Hi-6 Antidote Substrate Specificity.
;
_citation.journal_abbrev            Biochem.Pharmacol. 
_citation.journal_volume            85 
_citation.page_first                1389 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           BCPCA6 
_citation.country                   UK 
_citation.journal_id_ISSN           0006-2952 
_citation.journal_id_CSD            0725 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23376121 
_citation.pdbx_database_id_DOI      10.1016/J.BCP.2013.01.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Artursson, E.'   1 
primary 'Andersson, P.O.' 2 
primary 'Akfur, C.'       3 
primary 'Linusson, A.'    4 
primary 'Borjegren, S.'   5 
primary 'Ekstrom, F.'     6 
# 
_cell.entry_id           3ZLU 
_cell.length_a           79.987 
_cell.length_b           113.519 
_cell.length_c           227.508 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3ZLU 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                  59924.637 2   3.1.1.7 ? 'CATALYTIC DOMAIN, RESIDUES 32-574' 
'CATALYTIC SER203 PHOSPHONYLATED BY CYCLOSARIN' 
2 non-polymer syn '(2-hydroxyethoxy)acetaldehyde'       104.105   5   ?       ? ?                                   ? 
3 non-polymer syn 2,5,8,11,14,17-HEXAOXANONADECAN-19-OL 296.357   1   ?       ? ?                                   ? 
4 water       nat water                                 18.015    454 ?       ? ?                                   ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGE(GFT)AGAASVGMHILSLPSRSLFHRAVLQSGTPNGPW
ATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALI
NTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRD
AMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRL
MKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 GFT n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'HOUSE MOUSE' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ZLU A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 3ZLU B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1KA non-polymer         . '(2-hydroxyethoxy)acetaldehyde'                                       ?                         
'C4 H8 O3'       104.105 
ALA 'L-peptide linking' y ALANINE                                                               ?                         
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                              ?                         
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                            ?                         
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                       ?                         
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                              ?                         
'C3 H7 N O2 S'   121.158 
GFT 'L-peptide linking' n '(2S)-2-azanyl-3-[cyclohexyloxy(methyl)phosphoryl]oxy-propanoic acid' 'Cyclosarin bound Serine' 
'C10 H20 N O5 P' 265.243 
GLN 'L-peptide linking' y GLUTAMINE                                                             ?                         
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                       ?                         
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                               ?                         
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                             ?                         
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                 ?                         'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                            ?                         
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                               ?                         
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                ?                         
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                            ?                         
'C5 H11 N O2 S'  149.211 
P15 non-polymer         . 2,5,8,11,14,17-HEXAOXANONADECAN-19-OL                                 ?                         
'C13 H28 O7'     296.357 
PHE 'L-peptide linking' y PHENYLALANINE                                                         ?                         
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                               ?                         
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                ?                         
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                             ?                         
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                            ?                         
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                              ?                         
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                ?                         
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3ZLU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.33 
_exptl_crystal.density_percent_sol   71.58 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CCDCHESS 
_diffrn_detector.pdbx_collection_date   2010-06-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3ZLU 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.02 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   64575 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.00 
_reflns.B_iso_Wilson_estimate        55.38 
_reflns.pdbx_redundancy              6.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.72 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.50 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.00 
_reflns_shell.pdbx_redundancy        6.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3ZLU 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     64481 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.333 
_refine.ls_d_res_high                            2.600 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_R_factor_obs                          0.1763 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1755 
_refine.ls_R_factor_R_free                       0.2171 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1283 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            2.0009 
_refine.aniso_B[2][2]                            0.1511 
_refine.aniso_B[3][3]                            -2.1520 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.308 
_refine.solvent_model_param_bsol                 46.426 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.98 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.65 
_refine.pdbx_overall_phase_error                 20.60 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8356 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         55 
_refine_hist.number_atoms_solvent             454 
_refine_hist.number_atoms_total               8865 
_refine_hist.d_res_high                       2.600 
_refine_hist.d_res_low                        29.333 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 8773  'X-RAY DIFFRACTION' ? 
f_angle_d          1.139  ? ? 11957 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.463 ? ? 3206  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.082  ? ? 1280  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 1563  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.6000 2.7040  6931 0.2510 100.00 0.2879 . . 150 . . 
'X-RAY DIFFRACTION' . 2.7040 2.8270  6937 0.2620 100.00 0.3354 . . 141 . . 
'X-RAY DIFFRACTION' . 2.8270 2.9759  6951 0.2419 100.00 0.3352 . . 135 . . 
'X-RAY DIFFRACTION' . 2.9759 3.1622  6941 0.2165 100.00 0.2811 . . 158 . . 
'X-RAY DIFFRACTION' . 3.1622 3.4060  6958 0.1984 100.00 0.2129 . . 135 . . 
'X-RAY DIFFRACTION' . 3.4060 3.7481  7018 0.1798 100.00 0.2215 . . 140 . . 
'X-RAY DIFFRACTION' . 3.7481 4.2890  7035 0.1530 100.00 0.2008 . . 137 . . 
'X-RAY DIFFRACTION' . 4.2890 5.3982  7111 0.1330 100.00 0.1647 . . 140 . . 
'X-RAY DIFFRACTION' . 5.3982 29.3348 7316 0.1589 99.00  0.1845 . . 147 . . 
# 
_struct.entry_id                  3ZLU 
_struct.title                     'Crystal structure of mouse acetylcholinesterase in complex with cyclosarin' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ZLU 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, RUSSIAN VX, CYCLOSARIN, GF, TABUN, GA, HI-6, OXIME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  GFT A 203 ? LEU A 214 ? GFT A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? GLY A 256 ? SER A 240 GLY A 256 1 ? 17 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 276 ? ASN A 265 ARG A 276 1 ? 12 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? THR A 318 ? THR A 311 THR A 318 1 ? 8  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? ALA A 420 ? VAL A 407 ALA A 420 1 ? 14 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P28 28 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P29 29 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P30 30 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P31 31 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P32 32 GLY B 135 ? GLU B 142 ? GLY B 135 GLU B 142 1 ? 8  
HELX_P HELX_P33 33 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P34 34 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P35 35 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P36 36 GFT B 203 ? LEU B 214 ? GFT B 203 LEU B 214 1 ? 12 
HELX_P HELX_P37 37 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P38 38 SER B 240 ? GLY B 256 ? SER B 240 GLY B 256 1 ? 17 
HELX_P HELX_P39 39 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P40 40 PRO B 277 ? HIS B 284 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P41 41 GLU B 285 ? VAL B 288 ? GLU B 285 VAL B 288 5 ? 4  
HELX_P HELX_P42 42 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P43 43 SER B 336 ? GLY B 342 ? SER B 336 GLY B 342 5 ? 7  
HELX_P HELX_P44 44 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P45 45 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P46 46 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P47 47 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P48 48 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P49 49 GLU B 450 ? GLY B 456 ? GLU B 450 GLY B 456 1 ? 7  
HELX_P HELX_P50 50 LEU B 457 ? ASN B 464 ? LEU B 457 ASN B 464 5 ? 8  
HELX_P HELX_P51 51 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P52 52 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P53 53 ARG B 534 ? ALA B 542 ? ARG B 534 ALA B 542 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 69  SG ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.064 ? 
disulf2 disulf ? ? A CYS 257 SG ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf3 disulf ? ? A CYS 409 SG ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.074 ? 
disulf4 disulf ? ? B CYS 69  SG ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.066 ? 
disulf5 disulf ? ? B CYS 257 SG ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.058 ? 
disulf6 disulf ? ? B CYS 409 SG ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.063 ? 
covale1 covale ? ? A GFT 203 N  ? ? ? 1_555 A GLU 202 C  ? ? A GFT 203 A GLU 202 1_555 ? ? ? ? ? ? ? 1.311 ? 
covale2 covale ? ? A GFT 203 C  ? ? ? 1_555 A ALA 204 N  ? ? A GFT 203 A ALA 204 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale3 covale ? ? B GFT 203 C  ? ? ? 1_555 B ALA 204 N  ? ? B GFT 203 B ALA 204 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale4 covale ? ? B GFT 203 N  ? ? ? 1_555 B GLU 202 C  ? ? B GFT 203 B GLU 202 1_555 ? ? ? ? ? ? ? 1.317 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 1.07   
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 5.63   
3 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 -11.39 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE 1KA B 1544' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE 1KA A 1543' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE 1KA B 1545' 
AC4 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE P15 A 1544' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE 1KA A 1545' 
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE 1KA A 1546' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 TYR B 382 ? TYR B 382  . ? 1_555 ? 
2  AC1 3 ASP B 384 ? ASP B 384  . ? 1_555 ? 
3  AC1 3 HOH J .   ? HOH B 2196 . ? 1_555 ? 
4  AC2 3 VAL A 303 ? VAL A 303  . ? 1_555 ? 
5  AC2 3 ASP A 304 ? ASP A 304  . ? 1_555 ? 
6  AC2 3 GLY A 305 ? GLY A 305  . ? 1_555 ? 
7  AC3 2 SER B 309 ? SER B 309  . ? 1_555 ? 
8  AC3 2 HOH J .   ? HOH B 2197 . ? 1_555 ? 
9  AC4 9 LEU A 380 ? LEU A 380  . ? 1_555 ? 
10 AC4 9 HIS A 381 ? HIS A 381  . ? 1_555 ? 
11 AC4 9 GLN A 527 ? GLN A 527  . ? 1_555 ? 
12 AC4 9 PHE A 535 ? PHE A 535  . ? 1_555 ? 
13 AC4 9 HOH I .   ? HOH A 2198 . ? 1_555 ? 
14 AC4 9 LEU B 380 ? LEU B 380  . ? 1_555 ? 
15 AC4 9 HIS B 381 ? HIS B 381  . ? 1_555 ? 
16 AC4 9 GLN B 527 ? GLN B 527  . ? 1_555 ? 
17 AC4 9 PHE B 535 ? PHE B 535  . ? 1_555 ? 
18 AC5 3 HIS A 381 ? HIS A 381  . ? 1_555 ? 
19 AC5 3 TYR A 382 ? TYR A 382  . ? 1_555 ? 
20 AC5 3 HOH I .   ? HOH A 2252 . ? 1_555 ? 
21 AC6 2 TYR A 72  ? TYR A 72   . ? 1_555 ? 
22 AC6 2 TYR A 124 ? TYR A 124  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3ZLU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ZLU 
_atom_sites.fract_transf_matrix[1][1]   0.012502 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008809 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004395 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 32.649  14.490  55.744  1.00 89.95  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 31.216  14.773  55.655  1.00 87.20  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 30.612  15.107  57.026  1.00 83.32  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 31.335  15.237  58.023  1.00 82.19  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 30.468  13.597  54.992  1.00 83.30  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 30.751  12.204  55.591  1.00 61.94  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 30.377  11.050  54.648  1.00 72.56  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 31.252  10.655  53.829  1.00 69.18  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 29.219  10.536  54.726  1.00 60.98  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 29.288  15.247  57.071  1.00 81.69  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 28.595  15.495  58.324  1.00 63.10  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 27.356  16.340  58.137  1.00 64.11  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 26.257  15.978  58.588  1.00 56.13  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 27.534  17.460  57.440  1.00 72.50  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 26.499  18.480  57.359  1.00 74.31  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.863  18.607  55.963  1.00 71.33  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.963  19.421  55.759  1.00 75.29  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 27.080  19.822  57.837  1.00 78.99  ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 26.134  20.650  58.711  1.00 81.02  ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 25.436  19.814  59.774  1.00 75.58  ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 25.849  20.167  61.133  1.00 84.45  ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 25.102  19.970  62.220  1.00 78.27  ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 23.890  19.427  62.115  1.00 67.69  ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 25.566  20.319  63.415  1.00 76.51  ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 26.311  17.785  55.017  1.00 71.71  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.856  17.894  53.632  1.00 64.59  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.799  16.870  53.211  1.00 64.76  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 24.452  15.970  53.969  1.00 64.30  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 27.047  17.866  52.667  1.00 69.31  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 28.077  16.784  52.938  1.00 76.56  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 29.426  17.087  52.279  1.00 84.88  ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 29.507  18.064  51.494  1.00 82.57  ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 30.408  16.353  52.548  1.00 79.45  ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 24.296  17.030  51.988  1.00 65.67  ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 23.225  16.194  51.450  1.00 56.17  ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 23.693  14.749  51.286  1.00 64.20  ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 24.629  14.477  50.529  1.00 67.54  ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 22.782  16.749  50.095  1.00 51.78  ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 21.402  16.268  49.679  1.00 58.20  ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.976  15.170  50.109  1.00 59.79  ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.740  16.995  48.903  1.00 59.99  ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 23.049  13.821  52.009  1.00 66.26  ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 23.265  12.370  51.910  1.00 61.81  ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 23.182  11.814  50.482  1.00 60.08  ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 23.853  10.821  50.186  1.00 60.23  ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.102  11.794  52.725  1.00 61.91  ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 21.774  12.841  53.704  1.00 62.75  ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 22.085  14.168  53.068  1.00 62.60  ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 22.366  12.419  49.621  1.00 54.87  ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 22.168  11.864  48.281  1.00 59.12  ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 23.267  12.244  47.296  1.00 56.33  ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 23.280  11.758  46.162  1.00 61.81  ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 20.795  12.255  47.720  1.00 59.77  ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.676  11.263  48.082  1.00 68.28  ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 19.677  10.014  47.202  1.00 64.98  ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 19.895  10.096  45.988  1.00 66.33  ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 19.410  8.854   47.809  1.00 64.89  ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 24.185  13.103  47.734  1.00 52.52  ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 25.200  13.672  46.847  1.00 53.58  ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 26.591  13.095  47.084  1.00 56.75  ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 27.562  13.524  46.453  1.00 53.72  ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 25.229  15.205  46.960  1.00 48.51  ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 23.895  15.892  46.642  1.00 50.06  ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 24.031  17.399  46.702  1.00 45.15  ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 23.369  15.444  45.278  1.00 47.66  ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 26.689  12.123  47.988  1.00 59.04  ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.981  11.507  48.281  1.00 54.39  ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 28.011  10.077  47.767  1.00 54.70  ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 27.244  9.224   48.220  1.00 56.62  ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 28.291  11.572  49.774  1.00 51.24  ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 28.178  12.986  50.362  1.00 62.85  ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 28.408  13.010  51.882  1.00 61.29  ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 29.133  13.940  49.656  1.00 59.26  ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.893  9.830   46.800  1.00 50.96  ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 29.007  8.526   46.162  1.00 43.83  ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 30.490  8.107   46.128  1.00 48.06  ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 31.385  8.967   46.029  1.00 52.89  ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 28.383  8.574   44.741  1.00 44.03  ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 28.615  7.276   43.967  1.00 49.72  ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 26.900  8.839   44.841  1.00 50.18  ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 30.748  6.802   46.253  1.00 41.66  ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 32.090  6.256   46.070  1.00 43.61  ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 32.185  5.487   44.752  1.00 45.27  ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 31.315  4.658   44.432  1.00 45.34  ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 32.485  5.318   47.223  1.00 45.52  ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.824  4.596   46.976  1.00 44.61  ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 34.299  3.756   48.162  1.00 43.97  ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 34.586  4.555   49.350  1.00 40.72  ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.747  5.153   49.589  1.00 48.03  ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 36.738  5.048   48.702  1.00 44.75  ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 35.913  5.859   50.708  1.00 41.24  ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 33.240  5.759   43.990  1.00 35.75  ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 33.544  4.953   42.813  1.00 40.21  ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.959  4.366   42.949  1.00 41.32  ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 35.717  4.773   43.850  1.00 42.35  ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 33.388  5.770   41.506  1.00 39.29  ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.933  6.184   41.322  1.00 37.68  ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 34.318  7.001   41.526  1.00 32.56  ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 35.307  3.433   42.057  1.00 36.49  ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 36.566  2.666   42.140  1.00 43.45  ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.800  3.521   42.447  1.00 42.48  ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 38.733  3.062   43.105  1.00 49.28  ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.755  1.818   40.868  1.00 44.12  ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 38.118  1.148   40.655  1.00 50.25  ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 38.452  -0.011  41.616  1.00 51.21  ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 39.608  0.387   42.425  1.00 57.08  ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 40.735  -0.303  42.537  1.00 57.11  ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 40.867  -1.464  41.921  1.00 55.79  ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 41.727  0.163   43.286  1.00 53.67  ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.779  4.781   42.016  1.00 44.94  ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.928  5.656   42.166  1.00 45.56  ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.906  6.600   43.360  1.00 48.18  ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 39.907  7.275   43.635  1.00 46.87  ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 37.780  6.669   44.068  1.00 41.87  ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 37.691  7.534   45.231  1.00 43.67  ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 36.283  8.043   45.501  1.00 47.31  ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 35.296  7.539   44.935  1.00 41.90  ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 36.190  9.048   46.370  1.00 45.60  ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 34.903  9.614   46.754  1.00 47.25  ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 34.517  10.839  45.936  1.00 48.60  ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 35.372  11.669  45.594  1.00 49.51  ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 34.927  9.971   48.236  1.00 49.64  ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 34.641  8.780   49.124  1.00 55.97  ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 34.775  9.112   50.590  1.00 63.51  ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 35.779  9.700   51.008  1.00 62.30  ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 33.756  8.744   51.388  1.00 55.14  ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 33.223  10.961  45.641  1.00 45.83  ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 32.716  12.080  44.840  1.00 48.46  ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 31.643  12.843  45.593  1.00 43.50  ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.795  12.239  46.253  1.00 50.70  ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 32.094  11.560  43.535  1.00 44.79  ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.937  10.688  42.613  1.00 40.96  ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 32.058  10.068  41.549  1.00 39.97  ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 34.033  11.514  41.970  1.00 42.80  ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 31.667  14.167  45.488  1.00 46.63  ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 30.526  14.979  45.907  1.00 45.55  ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.870  15.586  44.663  1.00 46.53  ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 30.534  16.256  43.862  1.00 45.22  ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.938  16.083  46.885  1.00 45.14  ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 29.768  16.968  47.350  1.00 51.77  ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 30.202  18.031  48.365  1.00 59.79  ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 31.584  18.466  48.167  1.00 51.64  ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 32.592  18.145  48.981  1.00 60.37  ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 32.381  17.395  50.065  1.00 51.19  ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 33.820  18.571  48.709  1.00 64.33  ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 28.571  15.337  44.506  1.00 40.51  ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 27.805  15.897  43.415  1.00 39.53  ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.967  17.094  43.827  1.00 46.57  ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 27.157  17.670  44.909  1.00 48.65  ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 26.028  17.460  42.957  1.00 45.17  ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 25.221  18.655  43.141  1.00 42.89  ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 23.745  18.332  42.891  1.00 45.82  ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 23.421  17.483  42.053  1.00 49.93  ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 25.722  19.782  42.208  1.00 53.48  ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 25.067  21.122  42.557  1.00 50.39  ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 25.514  19.410  40.733  1.00 46.09  ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 25.806  22.312  41.991  1.00 40.63  ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.859  18.977  43.648  1.00 45.85  ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 21.410  18.862  43.444  1.00 47.43  ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 21.001  19.961  42.455  1.00 50.87  ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 21.253  21.144  42.699  1.00 47.45  ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 20.693  19.078  44.777  1.00 49.48  ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 19.246  18.591  44.851  1.00 53.83  ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 18.525  19.145  46.093  1.00 48.62  ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 17.382  19.970  45.705  1.00 70.77  ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 16.138  19.823  46.169  1.00 77.48  ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 15.858  18.890  47.075  1.00 76.66  ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 15.166  20.622  45.731  1.00 72.65  ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 20.398  19.588  41.331  1.00 48.53  ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 20.045  20.577  40.307  1.00 47.41  ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 18.543  20.693  40.178  1.00 49.38  ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.816  19.773  40.561  1.00 51.92  ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.635  20.204  38.941  1.00 45.79  ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 22.152  20.220  38.763  1.00 43.88  ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 22.515  19.789  37.353  1.00 48.61  ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.710  21.582  39.061  1.00 39.95  ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 18.078  21.813  39.632  1.00 51.61  ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 16.651  21.978  39.366  1.00 50.44  ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 16.292  21.617  37.941  1.00 48.22  ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.805  22.206  36.988  1.00 54.44  ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 16.183  23.410  39.654  1.00 48.39  ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 15.603  23.605  41.045  1.00 64.81  ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 14.465  22.610  41.331  1.00 77.75  ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 14.592  22.045  42.751  1.00 76.05  ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 13.294  21.543  43.300  1.00 76.10  ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 15.423  20.625  37.800  1.00 52.83  ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.733  20.393  36.536  1.00 52.45  ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 13.317  20.939  36.740  1.00 52.57  ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.899  21.149  37.886  1.00 56.07  ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.718  18.916  36.187  1.00 49.10  ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.583  21.205  35.641  1.00 59.65  ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 11.237  21.789  35.797  1.00 54.23  ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 10.288  20.990  36.709  1.00 52.53  ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 9.540   21.603  37.466  1.00 64.89  ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.697  21.815  34.364  1.00 43.08  ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.932  21.908  33.501  1.00 53.62  ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.999  21.124  34.224  1.00 51.53  ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 10.317  19.661  36.646  1.00 53.78  ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 9.419   18.849  37.457  1.00 50.13  ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.984   18.390  38.797  1.00 62.77  ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 9.381   17.541  39.470  1.00 61.50  ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 11.137  18.938  39.190  1.00 48.62  ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.766  18.557  40.443  1.00 45.52  ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 13.276  18.406  40.335  1.00 55.79  ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.848  18.610  39.261  1.00 52.17  ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.933  18.028  41.447  1.00 56.63  ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 15.400  17.974  41.484  1.00 49.79  ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.990  16.689  40.887  1.00 49.00  ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 15.305  15.655  40.849  1.00 45.28  ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 15.703  18.048  42.978  1.00 52.24  ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 14.510  17.353  43.621  1.00 48.33  ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 13.325  17.640  42.737  1.00 49.57  ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 17.240  16.783  40.416  1.00 50.06  ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 18.032  15.642  39.953  1.00 46.21  ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 19.411  15.711  40.617  1.00 44.53  ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.807  16.773  41.104  1.00 44.81  ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 18.236  15.681  38.420  1.00 47.98  ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.973  15.286  37.696  1.00 42.99  ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.683  17.070  37.986  1.00 49.26  ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 20.150  14.600  40.639  1.00 44.26  ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 21.541  14.653  41.124  1.00 44.76  ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 22.500  14.672  39.937  1.00 45.05  ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 22.336  13.907  38.966  1.00 43.71  ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.906  13.473  42.039  1.00 46.86  ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.781  12.900  42.683  1.00 57.98  ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 23.508  15.530  40.008  1.00 39.08  ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 24.499  15.587  38.939  1.00 41.18  ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.919  15.416  39.475  1.00 44.03  ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 26.305  16.057  40.461  1.00 44.18  ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 24.381  16.884  38.175  1.00 37.22  ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.688  14.543  38.828  1.00 38.62  ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 28.099  14.371  39.155  1.00 37.37  ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.894  14.725  37.918  1.00 37.43  ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.853  14.001  36.912  1.00 35.65  ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 28.378  12.929  39.604  1.00 39.57  ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 27.607  12.522  40.836  1.00 33.26  ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 26.310  12.043  40.736  1.00 37.91  ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 28.170  12.662  42.099  1.00 40.86  ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 25.591  11.685  41.876  1.00 39.34  ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 27.461  12.319  43.245  1.00 43.49  ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 26.170  11.826  43.130  1.00 43.51  ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 29.604  15.850  37.992  1.00 42.75  ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 30.173  16.479  36.802  1.00 43.41  ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 31.690  16.553  36.864  1.00 44.91  ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 32.264  16.848  37.925  1.00 42.51  ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 29.596  17.884  36.642  1.00 40.38  ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 28.067  17.966  36.670  1.00 41.11  ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 27.597  19.418  36.658  1.00 37.94  ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 27.477  17.193  35.483  1.00 40.80  ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 32.339  16.299  35.729  1.00 37.63  ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.787  16.331  35.692  1.00 40.00  ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 34.443  15.240  36.528  1.00 42.59  ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 35.375  15.510  37.290  1.00 45.95  ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.950  14.008  36.397  1.00 44.24  ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 34.580  12.846  37.021  1.00 38.05  ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.740  12.380  36.122  1.00 40.73  ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 35.545  12.109  34.932  1.00 43.04  ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 33.569  11.699  37.149  1.00 38.62  ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 32.322  12.159  37.917  1.00 37.89  ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 34.215  10.476  37.797  1.00 39.46  ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 31.178  11.107  37.936  1.00 33.84  ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.956  12.273  36.676  1.00 44.87  ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 38.056  11.894  35.771  1.00 41.55  ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 38.060  10.387  35.513  1.00 41.75  ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.884  9.617   36.453  1.00 45.84  ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 39.319  12.319  36.547  1.00 42.01  ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.818  12.841  37.929  1.00 43.25  ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 37.398  12.397  38.077  1.00 41.67  ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 38.247  9.965   34.268  1.00 40.36  ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 38.239  8.534   33.979  1.00 39.27  ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 39.583  8.050   33.442  1.00 42.40  ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.795  6.847   33.289  1.00 45.75  ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 37.074  8.139   33.042  1.00 39.63  ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 37.102  8.814   31.682  1.00 42.75  ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 36.471  10.042  31.481  1.00 36.92  ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 37.738  8.207   30.597  1.00 40.29  ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 36.484  10.655  30.224  1.00 35.42  ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 37.759  8.821   29.333  1.00 41.59  ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 37.131  10.044  29.151  1.00 38.43  ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 40.486  8.995   33.178  1.00 42.21  ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.788  8.706   32.576  1.00 42.61  ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.857  9.618   33.173  1.00 44.06  ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 42.549  10.713  33.643  1.00 44.50  ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.728  8.900   31.074  1.00 41.99  ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 44.111  9.179   33.152  1.00 43.52  ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 45.207  10.100  33.448  1.00 51.75  ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 45.277  11.176  32.356  1.00 48.69  ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 45.099  10.879  31.167  1.00 44.39  ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 46.543  9.355   33.566  1.00 48.06  ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.695  8.554   34.859  1.00 48.75  ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.721  9.437   36.096  1.00 52.87  ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 47.518  10.398  36.108  1.00 61.78  ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.944  9.184   37.052  1.00 53.42  ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 45.513  12.433  32.758  1.00 46.48  ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 45.573  13.544  31.798  1.00 44.93  ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 46.536  13.260  30.654  1.00 47.71  ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 47.722  13.054  30.905  1.00 56.24  ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 46.094  14.706  32.645  1.00 39.75  ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.633  14.389  34.024  1.00 38.58  ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.690  12.888  34.149  1.00 43.82  ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 46.028  13.248  29.410  1.00 46.92  ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.807  12.883  28.214  1.00 51.20  ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.747  13.991  27.771  1.00 46.44  ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 47.673  14.442  26.625  1.00 44.51  ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.736  12.657  27.129  1.00 46.56  ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.437  13.125  27.716  1.00 47.15  ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 44.671  13.710  29.079  1.00 37.16  ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 48.631  14.409  28.669  1.00 49.86  ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 49.500  15.554  28.414  1.00 51.80  ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.971  15.140  28.325  1.00 52.26  ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 51.328  13.993  28.642  1.00 50.68  ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 49.343  16.619  29.511  1.00 52.70  ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.883  17.090  29.597  1.00 46.14  ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.808  16.060  30.850  1.00 44.24  ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.808  16.088  27.899  1.00 45.57  ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 53.235  15.869  27.748  1.00 38.98  ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 53.535  14.672  26.870  1.00 47.01  ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 53.147  14.641  25.699  1.00 59.30  ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 54.213  13.677  27.443  1.00 53.31  ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.612  12.466  26.716  1.00 54.75  ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 53.414  11.586  26.380  1.00 50.72  ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.537  10.611  25.636  1.00 44.57  ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.599  11.663  27.557  1.00 51.24  ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 55.097  11.483  28.876  1.00 58.77  ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 52.255  11.931  26.938  1.00 52.03  ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 51.062  11.115  26.765  1.00 49.09  ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 50.220  11.557  25.570  1.00 47.86  ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 49.293  10.844  25.167  1.00 47.87  ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 50.233  11.086  28.051  1.00 54.33  ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.971  10.484  29.246  1.00 58.27  ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 50.115  9.437   29.942  1.00 79.69  ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 49.898  9.733   31.361  1.00 85.37  ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 50.446  9.049   32.366  1.00 90.09  ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 51.251  8.021   32.116  1.00 89.45  ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 50.188  9.390   33.626  1.00 84.81  ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 50.555  12.718  25.000  1.00 46.34  ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.891  13.203  23.786  1.00 46.67  ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 50.031  12.194  22.636  1.00 47.89  ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 51.128  11.670  22.390  1.00 46.94  ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 50.427  14.582  23.373  1.00 46.00  ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.761  15.175  22.117  1.00 47.94  ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 50.515  16.396  21.567  1.00 41.78  ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 50.333  17.622  22.351  1.00 40.50  ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.953  18.771  22.077  1.00 47.06  ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.784  18.840  21.038  1.00 41.04  ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.745  19.848  22.833  1.00 35.78  ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.904  11.936  21.958  1.00 45.16  ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.765  10.951  20.868  1.00 42.30  ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.674  9.505   21.350  1.00 45.16  ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 48.357  8.597   20.556  1.00 35.69  ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.857  11.062  19.793  1.00 41.54  ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 50.118  12.470  19.322  1.00 45.22  ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 49.098  13.229  18.766  1.00 42.47  ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 51.389  13.030  19.427  1.00 37.85  ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 49.330  14.527  18.330  1.00 42.31  ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.620  14.326  18.996  1.00 47.72  ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.590  15.076  18.445  1.00 43.76  ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.932  9.292   22.641  1.00 42.31  ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.921  7.937   23.215  1.00 46.28  ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 47.545  7.484   23.688  1.00 41.81  ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 46.700  8.316   24.067  1.00 40.39  ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.896  7.851   24.385  1.00 43.91  ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 51.300  8.301   24.041  1.00 53.06  ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 52.453  6.935   23.979  1.00 78.99  ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 51.713  5.919   22.721  1.00 49.37  ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 47.307  6.162   23.660  1.00 42.23  ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 46.077  5.610   24.257  1.00 45.98  ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.911  6.069   25.706  1.00 40.62  ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.899  6.325   26.405  1.00 41.84  ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 46.307  4.089   24.196  1.00 34.47  ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 47.136  3.913   22.961  1.00 35.70  ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 48.073  5.130   22.927  1.00 45.83  ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.663  6.210   26.151  1.00 41.55  ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 44.468  6.736   27.501  1.00 41.86  ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.771  5.663   28.541  1.00 43.20  ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 44.456  4.479   28.334  1.00 45.76  ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.971  7.078   27.519  1.00 39.82  ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 42.365  6.108   26.571  1.00 31.52  ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 43.392  5.855   25.496  1.00 33.02  ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 45.396  6.082   29.634  1.00 42.42  ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 45.574  5.244   30.808  1.00 51.58  ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 44.516  5.607   31.833  1.00 50.93  ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 44.287  6.795   32.097  1.00 52.65  ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.946  5.483   31.432  1.00 60.85  ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 48.092  4.835   30.693  1.00 77.96  ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 49.348  5.677   30.772  1.00 99.28  ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.825  5.929   31.905  1.00 99.73  ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.839  6.109   29.700  1.00 99.60  ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.893  4.585   32.442  1.00 57.19  ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.866  4.735   33.486  1.00 49.46  ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 43.325  5.622   34.652  1.00 47.90  ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 44.496  5.545   35.079  1.00 40.90  ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.669  3.299   33.982  1.00 38.49  ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 43.038  2.457   32.821  1.00 42.90  ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 44.205  3.167   32.183  1.00 50.01  ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 42.405  6.445   35.157  1.00 41.34  ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.719  7.412   36.207  1.00 45.13  ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 43.114  6.702   37.502  1.00 53.59  ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 42.359  5.875   38.020  1.00 51.97  ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 41.515  8.327   36.453  1.00 41.07  ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 41.625  9.220   37.672  1.00 39.96  ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 42.660  10.314  37.471  1.00 44.96  ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 42.649  11.294  38.640  1.00 40.99  ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 43.658  12.367  38.439  1.00 47.95  ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 44.302  7.014   38.016  1.00 52.24  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 44.743  6.446   39.289  1.00 53.35  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.916  7.036   40.433  1.00 51.32  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 43.482  8.191   40.350  1.00 49.22  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 46.242  6.668   39.481  1.00 52.48  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 47.061  6.042   38.342  1.00 57.78  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 48.551  6.147   38.578  1.00 62.00  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.954  7.517   38.888  1.00 74.45  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.691  8.285   38.087  1.00 82.02  ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 50.123  7.818   36.914  1.00 75.99  ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 50.003  9.524   38.464  1.00 75.23  ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 43.650  6.227   41.477  1.00 47.09  ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.760  6.644   42.573  1.00 46.28  ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 43.195  7.926   43.282  1.00 47.40  ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 44.381  8.269   43.296  1.00 46.57  ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 42.788  5.441   43.520  1.00 42.58  ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.975  4.259   42.585  1.00 48.05  ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.897  4.770   41.491  1.00 46.29  ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 42.235  8.653   43.843  1.00 47.53  ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 42.548  9.935   44.480  1.00 49.42  ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 42.242  9.870   45.965  1.00 53.04  ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 41.496  8.986   46.416  1.00 53.20  ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 41.756  11.085  43.825  1.00 48.16  ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 40.275  10.855  43.823  1.00 50.40  ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 39.385  11.159  44.819  1.00 49.77  ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 39.509  10.263  42.769  1.00 48.78  ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 38.110  10.792  44.444  1.00 46.37  ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 38.159  10.239  43.191  1.00 44.82  ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.833  9.755   41.508  1.00 43.28  ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 37.135  9.725   42.392  1.00 45.57  ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.817  9.234   40.718  1.00 46.86  ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 37.483  9.222   41.163  1.00 43.56  ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 42.807  10.791  46.741  1.00 54.08  ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 42.464  10.816  48.160  1.00 56.64  ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 41.428  11.904  48.423  1.00 55.55  ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 41.307  12.869  47.656  1.00 53.30  ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 43.702  11.012  49.037  1.00 52.60  ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 44.135  12.361  49.002  1.00 73.16  ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 40.678  11.731  49.504  1.00 53.44  ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 39.653  12.674  49.881  1.00 51.37  ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 38.441  12.636  48.968  1.00 57.64  ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 38.235  11.697  48.175  1.00 52.14  ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 37.626  13.676  49.086  1.00 49.69  ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 36.391  13.744  48.334  1.00 55.61  ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 36.593  14.705  47.181  1.00 53.54  ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 36.895  15.890  47.381  1.00 56.79  ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 35.228  14.171  49.231  1.00 57.08  ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 33.905  14.085  48.479  1.00 47.66  ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 35.210  13.286  50.469  1.00 46.43  ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 36.477  14.164  45.972  1.00 49.24  ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 36.639  14.947  44.759  1.00 50.82  ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 35.369  15.746  44.536  1.00 50.96  ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 34.257  15.205  44.613  1.00 51.95  ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.927  14.037  43.562  1.00 51.85  ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 37.186  14.696  42.204  1.00 55.06  ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 38.420  14.109  41.514  1.00 50.79  ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.965  14.534  41.319  1.00 48.91  ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 35.530  17.044  44.304  1.00 53.11  ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 34.395  17.884  43.965  1.00 54.39  ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 33.956  17.646  42.503  1.00 48.94  ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 34.722  17.866  41.549  1.00 50.88  ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 34.719  19.353  44.205  1.00 54.77  ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 33.570  20.255  43.823  1.00 68.54  ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 33.507  20.670  42.638  1.00 69.45  ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 32.711  20.519  44.702  1.00 71.57  ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 32.727  17.165  42.348  1.00 47.51  ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 32.136  16.915  41.039  1.00 47.46  ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 30.862  17.759  40.853  1.00 46.74  ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 29.783  17.233  40.570  1.00 39.20  ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 31.824  15.450  40.891  1.00 38.02  ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.989  19.072  41.013  1.00 45.62  ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 29.815  19.937  40.951  1.00 52.64  ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 29.842  20.902  39.752  1.00 48.42  ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.905  21.683  39.546  1.00 47.83  ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 29.627  20.733  42.264  1.00 51.90  ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.713  21.651  42.419  1.00 44.74  ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 29.565  19.794  43.483  1.00 41.16  ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.918  20.852  38.969  1.00 44.69  ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 31.008  21.673  37.763  1.00 47.99  ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 31.609  20.910  36.579  1.00 42.52  ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 32.361  19.952  36.753  1.00 44.95  ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.820  22.987  37.984  1.00 51.08  ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 33.187  22.672  38.261  1.00 50.22  ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 31.257  23.809  39.134  1.00 52.20  ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 31.273  21.352  35.374  1.00 45.64  ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.843  20.769  34.174  1.00 44.34  ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 33.333  21.030  34.137  1.00 43.50  ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.816  22.073  34.576  1.00 49.52  ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 31.195  21.337  32.913  1.00 33.73  ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.825  20.791  32.644  1.00 43.42  ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 29.638  19.421  32.437  1.00 35.42  ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.718  21.643  32.587  1.00 37.96  ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 28.364  18.906  32.189  1.00 39.15  ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 27.449  21.143  32.342  1.00 35.11  ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 27.267  19.769  32.143  1.00 45.83  ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 34.060  20.076  33.590  1.00 37.76  ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 35.493  20.208  33.499  1.00 39.51  ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.909  20.811  32.169  1.00 42.87  ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 35.060  21.227  31.374  1.00 40.69  ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 36.149  18.856  33.722  1.00 42.10  ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 36.551  18.652  35.146  1.00 40.24  ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.776  19.475  35.500  1.00 52.15  ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 38.319  20.220  34.660  1.00 48.17  ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 38.236  19.333  36.743  1.00 49.14  ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 37.220  20.866  31.946  1.00 44.64  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.775  21.393  30.713  1.00 36.99  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 37.195  20.739  29.469  1.00 41.37  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.762  19.583  29.490  1.00 37.04  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 39.295  21.231  30.701  1.00 38.71  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.973  22.078  31.756  1.00 46.04  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 39.541  23.209  32.043  1.00 40.76  ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 41.041  21.541  32.343  1.00 47.47  ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 37.193  21.506  28.385  1.00 40.21  ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.794  21.021  27.083  1.00 34.66  ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 38.086  20.654  26.340  1.00 35.67  ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 39.103  21.359  26.475  1.00 34.99  ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.999  22.115  26.356  1.00 32.82  ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.748  21.734  24.908  1.00 34.55  ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.702  22.368  27.085  1.00 33.70  ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 38.067  19.554  25.584  1.00 31.00  ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 39.281  19.086  24.904  1.00 34.16  ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.782  20.107  23.895  1.00 41.87  ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.978  20.786  23.240  1.00 38.70  ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 39.038  17.740  24.233  1.00 36.92  ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.912  16.377  25.450  1.00 49.31  ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 41.101  20.243  23.783  1.00 40.51  ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.667  21.301  22.943  1.00 40.92  ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 41.179  21.201  21.494  1.00 42.06  ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 41.234  20.118  20.895  1.00 39.51  ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 43.195  21.301  22.989  1.00 42.20  ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.732  22.705  23.012  1.00 44.20  ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.869  23.442  21.834  1.00 46.22  ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 44.053  23.318  24.214  1.00 45.17  ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.331  24.750  21.861  1.00 46.27  ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 44.524  24.624  24.252  1.00 45.21  ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.660  25.334  23.080  1.00 49.93  ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 45.125  26.633  23.126  1.00 64.18  ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.695  22.317  20.938  1.00 42.58  ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 40.046  22.275  19.617  1.00 42.70  ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.944  23.606  18.874  1.00 45.69  ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 40.056  24.682  19.474  1.00 42.48  ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.630  21.673  19.746  1.00 38.71  ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.696  22.469  20.647  1.00 39.32  ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 36.416  21.709  20.980  1.00 39.90  ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 35.356  21.973  20.411  1.00 39.12  ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 36.511  20.763  21.914  1.00 39.68  ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.718  23.508  17.563  1.00 49.18  ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 39.383  24.655  16.715  1.00 50.28  ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 38.107  25.332  17.222  1.00 55.10  ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 37.127  24.654  17.557  1.00 57.88  ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 39.188  24.170  15.271  1.00 55.21  ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.908  25.256  14.251  1.00 73.02  ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 39.941  26.049  13.755  1.00 68.73  ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 37.612  25.472  13.757  1.00 66.00  ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 39.695  27.042  12.815  1.00 76.59  ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 37.358  26.464  12.814  1.00 73.35  ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 38.404  27.247  12.347  1.00 81.29  ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 38.171  28.234  11.414  1.00 82.23  ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 38.116  26.659  17.315  1.00 59.34  ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.902  27.387  17.685  1.00 56.47  ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 36.321  28.133  16.483  1.00 62.85  ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 37.041  28.800  15.736  1.00 67.44  ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 37.137  28.350  18.850  1.00 54.27  ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.902  29.213  19.078  1.00 53.42  ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 37.482  27.571  20.108  1.00 53.80  ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 35.014  28.008  16.287  1.00 68.02  ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 34.407  28.545  15.077  1.00 64.80  ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 34.233  30.059  15.131  1.00 65.01  ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.906  30.642  16.173  1.00 57.20  ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 33.084  27.862  14.751  1.00 55.88  ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 32.567  28.240  13.382  1.00 65.84  ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 33.245  27.890  12.389  1.00 76.76  ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.502  28.899  13.297  1.00 67.88  ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.445  30.676  13.976  1.00 67.99  ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 34.564  32.120  13.867  1.00 73.86  ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.789  32.659  12.664  1.00 68.36  ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 33.821  33.862  12.392  1.00 71.01  ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 36.046  32.511  13.743  1.00 71.21  ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.750  31.484  13.022  1.00 68.69  ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 36.670  32.685  15.130  1.00 63.40  ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 33.084  31.764  11.968  1.00 60.86  ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.363  32.107  10.747  1.00 57.96  ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.329  33.214  10.952  1.00 61.48  ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.260  34.160  10.164  1.00 62.67  ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.689  30.870  10.146  1.00 56.00  ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 31.039  31.116  8.776   1.00 66.68  ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 32.092  31.599  7.786   1.00 56.16  ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 30.304  29.883  8.237   1.00 54.09  ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.520  33.099  12.001  1.00 59.47  ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.506  34.116  12.271  1.00 55.76  ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.574  34.608  13.712  1.00 56.52  ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.789  34.185  14.558  1.00 57.96  ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 28.110  33.579  11.969  1.00 50.57  ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.851  33.259  10.511  1.00 53.15  ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.843  34.263  9.548   1.00 46.88  ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.590  31.955  10.100  1.00 49.42  ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.594  33.977  8.215   1.00 51.09  ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.332  31.660  8.762   1.00 56.77  ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.340  32.673  7.825   1.00 55.78  ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 27.085  32.386  6.501   1.00 53.35  ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.527  35.507  13.994  1.00 68.44  ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.760  36.060  15.340  1.00 67.26  ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 29.504  36.655  15.994  1.00 68.34  ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.893  37.579  15.442  1.00 76.01  ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 31.792  37.160  15.078  1.00 62.47  ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 32.559  36.647  13.870  1.00 63.59  ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 31.519  35.991  13.011  1.00 59.68  ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 29.126  36.127  17.156  1.00 61.41  ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.972  36.638  17.879  1.00 63.94  ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.695  35.839  17.666  1.00 66.23  ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.737  35.960  18.443  1.00 56.53  ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.697  35.007  16.623  1.00 59.09  ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.499  34.320  16.138  1.00 54.16  ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 25.202  33.026  16.891  1.00 51.76  ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 26.025  32.114  16.888  1.00 54.28  ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.684  34.028  14.643  1.00 52.04  ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.549  33.268  14.015  1.00 48.09  ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 23.256  33.759  14.070  1.00 46.24  ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.780  32.070  13.347  1.00 48.86  ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 22.203  33.066  13.476  1.00 50.72  ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.733  31.368  12.750  1.00 47.32  ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.440  31.872  12.815  1.00 49.25  ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 24.017  32.942  17.497  1.00 49.63  ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.606  31.785  18.296  1.00 48.34  ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.728  30.452  17.549  1.00 53.34  ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 24.164  29.450  18.115  1.00 54.76  ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 22.160  31.969  18.778  1.00 59.91  ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.586  30.808  19.594  1.00 74.39  ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.631  31.065  21.100  1.00 97.83  ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 21.126  32.130  21.544  1.00 93.06  ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 22.170  30.200  21.838  1.00 99.99  ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.342  30.447  16.278  1.00 49.66  ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.318  29.228  15.489  1.00 46.17  ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.652  28.503  15.428  1.00 46.81  ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.680  27.277  15.364  1.00 46.08  ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.754  29.255  15.448  1.00 46.71  ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 27.091  28.662  15.511  1.00 45.95  ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.652  28.588  16.950  1.00 51.77  ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 28.350  27.632  17.293  1.00 47.42  ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 28.109  29.396  14.589  1.00 42.68  ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 28.069  30.801  14.852  1.00 48.98  ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.814  29.145  13.112  1.00 44.80  ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 27.345  29.587  17.782  1.00 52.58  ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.972  29.702  19.100  1.00 53.18  ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.583  28.563  20.032  1.00 54.52  ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 28.391  28.148  20.867  1.00 50.73  ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.643  31.040  19.780  1.00 59.84  ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 28.133  32.312  19.065  1.00 67.88  ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.620  32.570  19.215  1.00 77.79  ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 30.279  31.861  20.022  1.00 91.42  ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 30.130  33.493  18.528  1.00 67.70  ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 26.353  28.065  19.890  1.00 53.62  ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.852  26.970  20.730  1.00 46.15  ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.728  25.704  20.649  1.00 50.73  ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 26.703  24.858  21.548  1.00 48.81  ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 24.422  26.626  20.354  1.00 48.20  ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 24.286  26.169  18.900  1.00 49.04  ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 22.575  25.826  18.465  1.00 53.31  ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 22.297  24.386  19.500  1.00 46.84  ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 27.496  25.586  19.569  1.00 36.71  ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 28.370  24.447  19.368  1.00 43.73  ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.799  24.732  19.857  1.00 45.40  ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 30.604  23.816  20.015  1.00 44.78  ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 28.351  24.019  17.889  1.00 39.61  ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.956  23.771  17.378  1.00 47.21  ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 26.280  24.514  16.456  1.00 51.39  ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 26.058  22.722  17.780  1.00 40.36  ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 25.026  23.989  16.247  1.00 42.18  ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.867  22.886  17.042  1.00 42.54  ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 26.156  21.645  18.672  1.00 42.86  ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.769  22.017  17.176  1.00 46.83  ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 25.064  20.778  18.803  1.00 37.36  ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.888  20.973  18.059  1.00 36.03  ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 30.103  26.003  20.097  1.00 44.11  ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 31.410  26.416  20.605  1.00 46.58  ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.675  25.969  22.046  1.00 44.48  ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.734  25.831  22.831  1.00 45.91  ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.553  27.940  20.488  1.00 48.26  ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 32.026  28.373  19.116  1.00 55.20  ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 32.573  27.569  18.343  1.00 51.68  ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.833  29.651  18.809  1.00 57.53  ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.961  25.760  22.396  1.00 46.46  ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 33.340  25.309  23.753  1.00 43.24  ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.836  26.260  24.848  1.00 45.58  ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.958  27.476  24.695  1.00 47.55  ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.884  25.304  23.715  1.00 34.36  ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 35.231  25.139  22.254  1.00 41.49  ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 34.123  25.853  21.482  1.00 42.46  ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 32.287  25.722  25.936  1.00 43.53  ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.718  26.574  26.977  1.00 42.78  ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 32.479  26.485  28.306  1.00 48.14  ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.972  26.879  29.364  1.00 46.74  ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 30.219  26.307  27.156  1.00 41.19  ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.916  24.912  27.705  1.00 45.55  ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.712  23.977  27.564  1.00 42.12  ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.739  24.768  28.330  1.00 45.39  ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 33.698  25.952  28.222  1.00 45.89  ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 34.625  25.827  29.349  1.00 43.12  ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 36.031  25.986  28.771  1.00 42.68  ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 36.221  25.939  27.551  1.00 43.04  ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 34.500  24.463  30.047  1.00 39.96  ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 33.232  24.254  30.883  1.00 41.95  ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 33.256  25.139  32.128  1.00 47.87  ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 32.062  24.974  32.944  1.00 55.51  ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 30.897  25.579  32.695  1.00 71.40  ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 30.776  26.397  31.650  1.00 68.80  ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 29.844  25.366  33.484  1.00 63.01  ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 37.005  26.185  29.647  1.00 37.84  ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 38.383  26.360  29.233  1.00 41.95  ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.888  25.223  28.320  1.00 48.24  ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 38.597  24.032  28.565  1.00 41.61  ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 39.263  26.419  30.468  1.00 41.10  ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 40.722  26.679  30.146  1.00 54.79  ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 41.609  26.558  31.373  1.00 60.25  ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 41.065  26.574  32.503  1.00 55.40  ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 42.846  26.434  31.205  1.00 64.39  ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 39.622  25.584  27.263  1.00 39.18  ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 40.285  24.580  26.431  1.00 42.80  ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 41.540  24.077  27.141  1.00 45.94  ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 42.295  24.860  27.732  1.00 48.09  ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 40.658  25.140  25.054  1.00 41.96  ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 39.498  25.537  24.139  1.00 47.00  ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.999  25.827  22.724  1.00 44.63  ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 38.441  24.433  24.116  1.00 47.54  ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 41.751  22.766  27.087  1.00 44.31  ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.895  22.138  27.732  1.00 41.20  ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 43.079  20.720  27.196  1.00 43.56  ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 42.102  20.063  26.813  1.00 44.99  ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 42.677  22.101  29.255  1.00 44.09  ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 43.771  21.490  29.918  1.00 40.90  ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 44.323  20.249  27.160  1.00 43.97  ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 44.590  18.852  26.833  1.00 38.94  ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 44.204  17.942  27.999  1.00 40.82  ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.962  16.740  27.823  1.00 41.47  ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 46.052  18.654  26.450  1.00 40.58  ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 46.404  19.143  25.064  1.00 40.22  ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.830  18.759  24.660  1.00 53.41  ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 48.027  17.635  24.136  1.00 48.97  ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.759  19.580  24.876  1.00 50.01  ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 44.154  18.528  29.192  1.00 39.88  ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 43.664  17.844  30.383  1.00 39.38  ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 42.143  17.964  30.345  1.00 43.42  ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 41.562  18.904  30.923  1.00 38.97  ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 44.213  18.534  31.636  1.00 36.03  ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 43.738  17.888  32.935  1.00 45.15  ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.940  16.913  32.919  1.00 41.52  ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 44.175  18.381  33.992  1.00 50.00  ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 41.499  17.006  29.679  1.00 42.04  ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 40.078  17.116  29.374  1.00 40.49  ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 39.307  15.809  29.509  1.00 39.69  ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 38.115  15.750  29.189  1.00 43.68  ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.928  17.617  27.935  1.00 39.76  ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 40.556  16.422  26.697  1.00 42.49  ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.972  14.752  29.951  1.00 37.89  ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 39.302  13.458  30.002  1.00 39.23  ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 38.464  13.262  31.289  1.00 42.55  ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 38.893  12.610  32.256  1.00 40.91  ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 40.299  12.321  29.776  1.00 35.76  ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.955  12.335  28.388  1.00 40.03  ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.713  11.015  28.121  1.00 30.23  ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 39.927  12.622  27.277  1.00 34.41  ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 37.262  13.844  31.274  1.00 40.70  ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 36.300  13.756  32.376  1.00 38.13  ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.931  13.333  31.834  1.00 36.00  ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 34.644  13.543  30.652  1.00 39.84  ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 36.195  15.107  33.100  1.00 39.23  ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 37.537  15.614  33.585  1.00 45.97  ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 38.438  16.205  32.703  1.00 40.89  ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 37.916  15.479  34.923  1.00 45.23  ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 39.675  16.649  33.134  1.00 45.59  ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 39.151  15.930  35.364  1.00 41.72  ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 40.022  16.512  34.464  1.00 46.27  ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 41.252  16.955  34.878  1.00 46.20  ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 34.098  12.724  32.678  1.00 37.03  ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 32.751  12.354  32.264  1.00 32.65  ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 31.707  12.892  33.245  1.00 39.83  ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 32.057  13.346  34.346  1.00 37.91  ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 32.624  10.838  32.062  1.00 38.05  ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 32.971  9.841   33.194  1.00 40.03  ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 31.996  9.883   34.355  1.00 32.38  ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 33.019  8.430   32.642  1.00 29.46  ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 30.433  12.826  32.849  1.00 35.50  ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 29.343  13.347  33.673  1.00 34.52  ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 28.203  12.344  33.887  1.00 35.70  ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.908  11.528  33.007  1.00 39.36  ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 28.790  14.636  33.052  1.00 40.61  ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 29.891  15.561  32.542  1.00 35.46  ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 30.645  16.142  33.338  1.00 33.51  ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.986  15.708  31.211  1.00 29.42  ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 27.564  12.407  35.055  1.00 34.60  ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 26.445  11.520  35.366  1.00 37.36  ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 25.247  12.304  35.926  1.00 40.52  ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 25.400  13.088  36.877  1.00 37.54  ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 26.844  10.415  36.401  1.00 38.81  ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 25.627  9.605   36.812  1.00 37.50  ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.916  9.498   35.848  1.00 35.92  ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 24.066  12.084  35.341  1.00 36.88  ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 22.808  12.591  35.898  1.00 39.58  ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.951  11.421  36.339  1.00 42.02  ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 21.744  10.468  35.571  1.00 41.35  ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 22.004  13.384  34.864  1.00 36.53  ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 22.547  14.729  34.533  1.00 39.10  ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 22.235  15.926  35.140  1.00 44.52  ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 23.491  15.042  33.500  1.00 36.77  ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.939  16.959  34.547  1.00 40.33  ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 23.712  16.444  33.537  1.00 38.90  ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 24.174  14.276  32.548  1.00 39.09  ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 24.588  17.093  32.650  1.00 44.47  ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 25.045  14.921  31.660  1.00 40.72  ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 25.244  16.319  31.720  1.00 37.40  ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 21.425  11.503  37.559  1.00 39.85  ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 20.501  10.482  38.062  1.00 41.18  ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 19.333  11.166  38.729  1.00 41.57  ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 19.449  12.339  39.131  1.00 47.81  ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 21.167  9.525   39.104  1.00 44.87  ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 21.572  10.269  40.257  1.00 46.65  ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 22.378  8.841   38.520  1.00 44.83  ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 18.202  10.444  38.854  1.00 40.47  ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 17.032  10.884  39.631  1.00 41.27  ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 17.383  11.298  41.077  1.00 47.38  ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 18.431  10.908  41.616  1.00 47.78  ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 16.133  9.650   39.618  1.00 40.73  ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 16.410  9.039   38.265  1.00 45.75  ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 17.903  9.241   38.049  1.00 45.04  ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 16.530  12.119  41.687  1.00 49.06  ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.745  12.534  43.069  1.00 49.23  ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 15.477  12.266  43.854  1.00 52.80  ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 14.438  12.870  43.588  1.00 59.03  ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 17.127  14.007  43.148  1.00 45.39  ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 17.528  14.502  44.521  1.00 48.80  ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 16.582  14.678  45.529  1.00 55.40  ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 18.844  14.854  44.798  1.00 49.51  ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 16.943  15.161  46.788  1.00 49.61  ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 19.214  15.339  46.058  1.00 52.79  ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 18.255  15.489  47.040  1.00 49.51  ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 18.614  15.963  48.278  1.00 49.76  ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 15.552  11.352  44.827  1.00 56.60  ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.763  10.607  45.209  1.00 58.12  ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 17.047  9.460   44.235  1.00 54.35  ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 16.131  9.076   43.491  1.00 52.63  ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 16.393  10.050  46.586  1.00 58.84  ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.907  9.819   46.485  1.00 50.70  ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 14.366  10.916  45.591  1.00 53.99  ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 18.280  8.942   44.234  1.00 60.20  ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.686  7.858   43.321  1.00 57.26  ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.798  6.635   43.509  1.00 63.34  ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 17.426  6.308   44.647  1.00 70.13  ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 20.160  7.474   43.523  1.00 51.66  ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 21.164  8.635   43.323  1.00 64.88  ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 22.611  8.154   43.455  1.00 61.93  ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.786  7.251   44.597  1.00 63.45  ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 23.353  7.601   45.752  1.00 65.20  ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 23.819  8.832   45.913  1.00 58.39  ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 23.462  6.722   46.747  1.00 63.22  ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 17.465  5.950   42.393  1.00 72.30  ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 16.578  4.768   42.362  1.00 69.33  ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 17.102  3.597   43.215  1.00 72.74  ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 18.311  3.305   43.170  1.00 70.05  ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.612  4.337   40.885  1.00 74.18  ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 17.236  5.463   40.120  1.00 62.73  ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 18.094  6.216   41.081  1.00 60.47  ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 16.224  2.926   43.963  1.00 75.47  ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 16.626  1.704   44.679  1.00 81.08  ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 16.771  0.511   43.726  1.00 76.74  ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 17.776  -0.200  43.777  1.00 72.33  ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 15.662  1.377   45.806  1.00 73.51  ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 15.774  0.286   42.866  1.00 66.63  ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 15.919  -0.713  41.804  1.00 70.48  ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.825  -0.155  40.691  1.00 75.66  ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.752  1.033   40.361  1.00 71.53  ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 14.558  -1.115  41.234  1.00 65.84  ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 14.027  -0.086  40.412  1.00 83.59  ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.698  -1.006  40.121  1.00 77.63  ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 18.646  -0.565  39.083  1.00 68.77  ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 17.945  -0.035  37.827  1.00 64.59  ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.900  -0.556  37.423  1.00 70.73  ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 19.439  -1.841  38.753  1.00 60.51  ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 19.265  -2.717  39.939  1.00 63.83  ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 17.877  -2.429  40.456  1.00 72.23  ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 18.549  0.974   37.207  1.00 57.88  ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.916  1.768   36.157  1.00 53.60  ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 18.744  1.735   34.863  1.00 53.19  ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.977  1.725   34.913  1.00 51.14  ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 17.734  3.224   36.659  1.00 57.24  ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 16.607  3.282   37.540  1.00 70.09  ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 17.519  4.195   35.516  1.00 51.96  ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 18.070  1.686   33.700  1.00 52.67  ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 18.762  1.661   32.401  1.00 55.31  ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 19.614  2.914   32.126  1.00 49.90  ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 19.215  4.042   32.435  1.00 47.03  ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 17.612  1.546   31.392  1.00 50.62  ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 16.548  0.835   32.153  1.00 61.24  ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 16.630  1.425   33.547  1.00 57.55  ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 20.787  2.691   31.538  1.00 43.84  ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 21.786  3.728   31.363  1.00 49.26  ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 21.863  4.211   29.907  1.00 48.77  ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 21.951  3.404   28.975  1.00 47.88  ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 23.170  3.220   31.838  1.00 46.36  ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 24.256  4.276   31.606  1.00 40.95  ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 23.099  2.823   33.313  1.00 40.58  ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 21.823  5.529   29.718  1.00 47.02  ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 22.010  6.129   28.393  1.00 40.07  ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 23.358  6.830   28.348  1.00 36.18  ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 23.636  7.707   29.182  1.00 42.09  ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.909  7.148   28.122  1.00 38.64  ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 19.549  6.570   27.733  1.00 50.29  ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 18.494  7.653   27.668  1.00 44.84  ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 19.669  5.885   26.386  1.00 57.33  ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 24.204  6.460   27.392  1.00 35.32  ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 25.498  7.141   27.257  1.00 35.83  ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 25.580  8.001   25.989  1.00 33.29  ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 25.478  7.485   24.872  1.00 35.25  ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 26.675  6.161   27.298  1.00 34.01  ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 26.568  5.245   28.526  1.00 39.53  ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.985  6.922   27.307  1.00 30.09  ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 27.763  4.325   28.716  1.00 36.44  ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.752  9.312   26.169  1.00 34.91  ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.818  10.241  25.042  1.00 34.41  ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 27.243  10.420  24.534  1.00 38.22  ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 28.155  10.655  25.329  1.00 34.49  ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 25.227  11.606  25.422  1.00 37.38  ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 25.356  12.679  24.334  1.00 43.10  ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 26.209  13.756  24.336  1.00 36.27  ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 24.603  12.770  23.111  1.00 36.54  ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 26.035  14.504  23.190  1.00 34.52  ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 25.053  13.926  22.424  1.00 39.04  ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.591  11.990  22.532  1.00 34.45  ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 24.526  14.319  21.177  1.00 35.70  ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 23.070  12.377  21.298  1.00 39.67  ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 23.542  13.532  20.634  1.00 41.91  ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 27.429  10.305  23.217  1.00 39.52  ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.693  10.663  22.578  1.00 34.56  ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 28.496  11.828  21.596  1.00 36.04  ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.821  11.668  20.572  1.00 37.26  ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 29.282  9.482   21.814  1.00 34.52  ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 29.404  8.258   22.728  1.00 33.12  ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.647  9.871   21.236  1.00 32.65  ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 30.044  7.062   22.056  1.00 30.49  ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 29.086  12.991  21.892  1.00 31.19  ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.835  14.177  21.064  1.00 33.39  ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 29.448  14.100  19.669  1.00 38.00  ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 30.396  13.344  19.439  1.00 33.07  ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 29.297  15.465  21.752  1.00 32.24  ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.759  15.498  22.151  1.00 36.44  ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.775  15.684  21.196  1.00 31.76  ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 31.125  15.383  23.491  1.00 29.25  ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 33.118  15.736  21.575  1.00 29.11  ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 32.448  15.416  23.880  1.00 30.06  ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 33.444  15.593  22.933  1.00 36.97  ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.757  15.620  23.365  1.00 32.06  ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.895  14.896  18.750  1.00 35.55  ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.489  15.098  17.444  1.00 29.73  ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 30.313  16.382  17.366  1.00 42.02  ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.583  17.044  18.389  1.00 41.07  ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.702  16.747  16.145  1.00 40.79  ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.625  17.846  15.929  1.00 37.49  ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.727  17.458  14.953  1.00 38.69  ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.847  18.000  15.020  1.00 31.70  ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 32.409  16.506  14.069  1.00 31.51  ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 33.251  16.167  12.934  1.00 30.54  ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.598  15.586  13.316  1.00 39.58  ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.495  15.502  12.462  1.00 37.84  ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.726  15.174  14.585  1.00 38.53  ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.975  14.643  15.162  1.00 35.00  ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 37.042  15.715  15.389  1.00 35.19  ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 38.178  15.385  15.739  1.00 37.00  ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 36.562  13.476  14.347  1.00 34.36  ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.697  12.245  14.322  1.00 32.97  ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 35.504  11.483  15.475  1.00 40.76  ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 35.099  11.827  13.139  1.00 33.76  ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.702  10.326  15.448  1.00 34.23  ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 34.308  10.680  13.097  1.00 29.67  ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 34.109  9.934   14.251  1.00 37.77  ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.666  16.986  15.220  1.00 35.57  ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.576  18.107  15.461  1.00 35.87  ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 37.044  19.049  16.548  1.00 35.06  ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.743  19.955  17.002  1.00 41.45  ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.844  18.889  14.158  1.00 36.16  ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.631  19.627  13.641  1.00 40.54  ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.293  20.891  14.140  1.00 36.83  ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.818  19.067  12.651  1.00 39.30  ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 35.178  21.571  13.679  1.00 38.47  ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.696  19.749  12.173  1.00 41.10  ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.382  21.001  12.695  1.00 43.06  ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.265  21.678  12.245  1.00 48.27  ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.799  18.854  16.953  1.00 33.30  ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 35.215  19.700  17.992  1.00 38.92  ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 34.195  18.923  18.823  1.00 35.88  ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.916  17.749  18.541  1.00 32.06  ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.541  20.940  17.371  1.00 41.36  ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.542  20.570  16.422  1.00 37.94  ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 33.619  19.594  19.822  1.00 33.79  ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 32.607  18.981  20.667  1.00 36.15  ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.985  18.962  22.141  1.00 32.67  ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 34.151  19.154  22.507  1.00 36.10  ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.994  18.715  22.991  1.00 29.94  ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 32.156  18.809  24.448  1.00 35.56  ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.865  18.289  25.076  1.00 38.67  ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.786  18.492  24.519  1.00 40.91  ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 32.422  20.259  24.869  1.00 31.44  ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.961  17.609  26.215  1.00 39.07  ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.767  17.012  26.816  1.00 34.88  ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 29.018  18.020  27.689  1.00 36.30  ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.944  17.719  28.235  1.00 41.96  ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 30.129  15.768  27.612  1.00 34.28  ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 29.579  19.219  27.799  1.00 34.12  ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 29.038  20.265  28.679  1.00 42.20  ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 28.140  21.305  27.975  1.00 41.41  ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 27.627  22.223  28.628  1.00 39.56  ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 30.189  20.984  29.389  1.00 32.75  ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 31.167  21.401  28.453  1.00 34.23  ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.967  21.179  26.656  1.00 32.41  ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 27.104  22.101  25.911  1.00 36.33  ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 25.664  22.018  26.431  1.00 39.67  ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 25.228  20.959  26.909  1.00 40.23  ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 27.153  21.793  24.410  1.00 35.43  ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 28.540  21.852  23.760  1.00 38.95  ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 28.465  21.582  22.268  1.00 39.22  ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 29.188  23.202  24.042  1.00 38.86  ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.926  23.122  26.353  1.00 41.20  ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 23.560  23.161  26.890  1.00 40.36  ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 22.619  22.129  26.255  1.00 42.31  ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 21.759  21.584  26.945  1.00 45.94  ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.950  24.554  26.771  1.00 36.98  ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 23.620  25.582  27.684  1.00 56.33  ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 24.420  25.196  28.574  1.00 53.07  ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 23.330  26.794  27.511  1.00 62.20  ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.797  21.830  24.966  1.00 38.11  ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.902  20.880  24.300  1.00 38.89  ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 22.105  19.433  24.735  1.00 42.56  ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 21.315  18.550  24.366  1.00 44.01  ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 21.967  20.965  22.749  1.00 40.04  ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 21.453  22.317  22.277  1.00 44.36  ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 23.376  20.708  22.259  1.00 35.38  ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 23.158  19.181  25.512  1.00 41.15  ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 23.410  17.827  26.020  1.00 39.75  ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 23.102  17.718  27.518  1.00 38.93  ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 23.615  16.826  28.192  1.00 44.45  ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.859  17.390  25.749  1.00 37.71  ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 25.370  17.590  24.338  1.00 34.23  ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 24.527  17.484  23.231  1.00 32.41  ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.711  17.874  24.112  1.00 36.81  ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 25.018  17.655  21.926  1.00 33.70  ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 27.210  18.058  22.817  1.00 35.83  ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 26.362  17.951  21.731  1.00 39.41  ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 26.867  18.138  20.456  1.00 30.13  ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 22.281  18.637  28.028  1.00 38.88  ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.915  18.661  29.445  1.00 42.05  ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 21.074  17.428  29.835  1.00 42.94  ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.920  17.285  29.422  1.00 37.82  ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 21.145  19.944  29.765  1.00 41.79  ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.963  20.174  31.272  1.00 46.53  ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.978  19.205  32.067  1.00 44.48  ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 20.789  21.349  31.659  1.00 50.09  ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 21.656  16.549  30.647  1.00 37.33  ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.986  15.320  31.013  1.00 39.73  ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 19.854  15.446  32.029  1.00 39.83  ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 19.154  14.469  32.277  1.00 40.01  ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 19.657  16.629  32.609  1.00 40.50  ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 18.711  16.759  33.722  1.00 45.33  ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 17.278  16.330  33.359  1.00 48.21  ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 16.632  15.643  34.148  1.00 44.39  ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 18.756  18.157  34.392  1.00 42.55  ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.856  19.238  33.771  1.00 44.15  ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 18.053  20.605  34.434  1.00 47.26  ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 19.438  21.080  34.318  1.00 50.63  ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 20.004  21.997  35.110  1.00 53.18  ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 19.312  22.565  36.099  1.00 49.99  ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 21.273  22.351  34.920  1.00 50.74  ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 16.803  16.683  32.163  1.00 44.27  ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 15.416  16.385  31.787  1.00 41.94  ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 15.121  14.882  31.619  1.00 43.28  ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 14.080  14.395  32.083  1.00 45.39  ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.995  17.167  30.538  1.00 36.90  ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 15.371  18.613  30.585  1.00 43.96  ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 14.595  19.521  31.282  1.00 43.47  ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 16.516  19.071  29.943  1.00 43.60  ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.951  20.861  31.335  1.00 43.64  ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 16.870  20.411  29.996  1.00 39.46  ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 16.090  21.303  30.694  1.00 40.85  ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 16.018  14.157  30.949  1.00 39.73  ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 15.856  12.714  30.790  1.00 42.81  ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.983  12.009  32.147  1.00 45.50  ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 15.244  11.068  32.437  1.00 42.45  ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 16.866  12.157  29.785  1.00 43.71  ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 16.554  12.392  28.303  1.00 48.24  ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 17.720  11.995  27.396  1.00 36.14  ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 15.303  11.632  27.892  1.00 37.08  ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 16.914  12.478  32.977  1.00 41.83  ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 17.045  11.983  34.348  1.00 46.16  ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 15.761  12.207  35.180  1.00 49.88  ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 15.256  11.288  35.824  1.00 51.82  ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 18.240  12.631  35.028  1.00 40.36  ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 15.231  13.426  35.140  1.00 50.68  ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 14.060  13.795  35.928  1.00 48.96  ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 12.734  13.189  35.422  1.00 53.91  ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 11.988  12.587  36.204  1.00 55.61  ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 13.950  15.327  36.033  1.00 43.89  ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 13.176  15.809  37.243  1.00 43.32  ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 11.667  15.638  37.072  1.00 58.50  ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 11.100  16.026  36.041  1.00 64.82  ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 11.011  15.045  38.075  1.00 49.46  ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 12.443  13.356  34.131  1.00 49.42  ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 11.147  12.956  33.571  1.00 45.67  ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 11.044  11.460  33.294  1.00 53.22  ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.985   10.860  33.492  1.00 53.91  ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 10.822  13.724  32.269  1.00 44.13  ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 9.534   13.210  31.621  1.00 45.60  ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 10.723  15.219  32.539  1.00 39.56  ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 12.139  10.853  32.844  1.00 49.63  ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 12.101  9.456   32.426  1.00 47.79  ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 12.815  8.524   33.396  1.00 48.51  ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 12.903  7.325   33.150  1.00 49.57  ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 12.699  9.289   31.024  1.00 45.34  ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.870  9.923   29.918  1.00 50.43  ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 10.504  9.267   29.739  1.00 60.53  ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 10.310  8.091   30.158  1.00 61.40  ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 9.620   9.936   29.155  1.00 63.19  ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 13.342  9.077   34.484  1.00 45.38  ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 14.013  8.275   35.491  1.00 47.45  ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 15.311  7.625   35.036  1.00 50.64  ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.769  6.666   35.657  1.00 55.18  ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.913  8.152   33.970  1.00 45.81  ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 17.103  7.544   33.365  1.00 45.82  ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 18.395  7.925   34.088  1.00 43.93  ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 18.495  9.001   34.691  1.00 42.72  ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 17.199  7.934   31.896  1.00 44.68  ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 19.387  7.046   34.025  1.00 37.34  ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 20.747  7.447   34.380  1.00 40.28  ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 21.439  7.833   33.066  1.00 44.60  ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 21.437  7.072   32.080  1.00 44.89  ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 21.519  6.341   35.180  1.00 42.33  ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 23.014  6.660   35.295  1.00 37.73  ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 20.911  6.168   36.568  1.00 38.68  ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.992  9.036   33.033  1.00 38.29  ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 22.564  9.538   31.801  1.00 36.63  ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 24.037  9.871   32.003  1.00 37.14  ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 24.416  10.538  32.984  1.00 38.50  ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.777  10.756  31.283  1.00 39.95  ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 22.091  11.046  29.805  1.00 49.47  ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.837  11.314  28.986  1.00 44.28  ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 23.087  12.205  29.683  1.00 43.95  ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.866  9.382   31.082  1.00 33.69  ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 26.310  9.588   31.160  1.00 33.66  ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.815  10.184  29.860  1.00 37.96  ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 26.398  9.775   28.771  1.00 39.14  ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 27.058  8.258   31.409  1.00 38.11  ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 28.566  8.479   31.365  1.00 35.85  ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 26.639  7.646   32.739  1.00 33.04  ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 27.713  11.153  29.969  1.00 34.60  ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 28.384  11.709  28.795  1.00 34.51  ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.851  11.951  29.129  1.00 38.65  ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 30.195  12.310  30.280  1.00 35.04  ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 27.732  13.025  28.368  1.00 38.38  ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.933  14.026  29.360  1.00 39.39  ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 30.719  11.753  28.136  1.00 35.78  ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 32.153  11.930  28.355  1.00 34.72  ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.758  12.889  27.348  1.00 37.75  ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 32.205  13.076  26.251  1.00 39.70  ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.874  10.581  28.263  1.00 33.82  ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 33.208  10.117  26.825  1.00 38.53  ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 31.795  9.625   25.799  1.00 43.44  ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 31.516  7.926   26.327  1.00 37.16  ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.880  13.503  27.727  1.00 32.50  ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 34.764  14.128  26.742  1.00 36.73  ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 35.710  13.087  26.144  1.00 39.32  ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 36.176  12.171  26.835  1.00 39.72  ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 35.587  15.283  27.336  1.00 32.90  ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 34.727  16.434  27.832  1.00 38.46  ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 33.514  16.500  27.570  1.00 39.40  ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 35.357  17.364  28.543  1.00 36.27  ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 36.004  13.236  24.861  1.00 34.40  ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 36.993  12.390  24.224  1.00 33.12  ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.846  13.303  23.354  1.00 39.77  ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 37.335  14.301  22.829  1.00 40.28  ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 36.319  11.274  23.400  1.00 35.82  ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 35.446  11.765  22.258  1.00 33.19  ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 35.984  11.982  20.992  1.00 31.66  ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 34.091  12.023  22.447  1.00 33.36  ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 35.196  12.437  19.940  1.00 36.36  ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 33.289  12.476  21.394  1.00 36.25  ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.852  12.682  20.141  1.00 38.46  ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 33.067  13.131  19.093  1.00 32.78  ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 39.134  12.985  23.210  1.00 36.85  ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 40.039  13.835  22.427  1.00 36.81  ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 39.633  13.955  20.961  1.00 37.63  ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 39.314  12.952  20.299  1.00 37.78  ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 41.494  13.369  22.545  1.00 42.26  ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 42.160  13.761  23.871  1.00 41.32  ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 43.464  13.022  24.077  1.00 43.09  ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 43.268  11.582  24.253  1.00 45.17  ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 44.253  10.683  24.242  1.00 45.46  ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 45.509  11.079  24.056  1.00 39.95  ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.979  9.391   24.423  1.00 37.60  ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 39.637  15.195  20.464  1.00 38.42  ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 39.292  15.468  19.065  1.00 39.86  ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 40.488  16.065  18.320  1.00 38.70  ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 41.521  16.373  18.935  1.00 39.96  ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 38.084  16.419  18.955  1.00 37.28  ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.829  15.730  19.418  1.00 35.70  ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 38.318  17.684  19.764  1.00 32.71  ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 40.340  16.227  17.003  1.00 38.20  ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 41.390  16.781  16.161  1.00 38.55  ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.637  15.919  16.157  1.00 42.79  ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.545  14.684  16.288  1.00 39.52  ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.799  16.560  16.006  1.00 41.62  ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 45.084  15.853  16.070  1.00 44.04  ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 45.242  15.050  17.368  1.00 40.85  ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.616  13.877  17.330  1.00 41.72  ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 46.293  16.812  15.916  1.00 43.10  ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 46.179  17.914  16.833  1.00 37.86  ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 46.382  17.335  14.492  1.00 40.14  ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.944  15.683  18.501  1.00 38.25  ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 45.157  15.074  19.815  1.00 42.12  ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 44.461  13.730  19.926  1.00 40.82  ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.994  12.793  20.517  1.00 42.10  ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 44.669  16.014  20.925  1.00 43.20  ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 45.145  17.415  20.757  1.00 44.59  ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 46.372  17.805  21.269  1.00 48.00  ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 44.389  18.338  20.042  1.00 41.33  ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.832  19.109  21.094  1.00 46.47  ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.841  19.630  19.860  1.00 40.29  ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 46.064  20.018  20.385  1.00 49.66  ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 43.276  13.638  19.333  1.00 37.93  ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 42.538  12.397  19.348  1.00 34.88  ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.748  11.485  18.154  1.00 34.77  ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 42.501  10.279  18.269  1.00 32.86  ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 43.183  12.031  17.011  1.00 34.11  ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 43.113  11.253  15.768  1.00 31.35  ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 44.303  11.273  14.803  1.00 34.51  ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 44.349  10.487  13.847  1.00 39.06  ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.772  11.490  15.051  1.00 29.91  ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 40.592  11.008  15.847  1.00 37.15  ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 40.258  9.651   15.874  1.00 34.86  ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.847  11.897  16.618  1.00 29.42  ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 39.185  9.205   16.630  1.00 34.74  ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.770  11.451  17.387  1.00 29.62  ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 38.436  10.118  17.393  1.00 34.68  ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 45.271  12.142  15.052  1.00 35.46  ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 46.526  12.070  14.307  1.00 38.60  ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 47.191  10.694  14.499  1.00 37.63  ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 47.375  10.226  15.622  1.00 41.16  ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 47.481  13.198  14.732  1.00 40.32  ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.842  13.272  14.023  1.00 47.15  ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 49.326  14.743  13.876  1.00 37.73  ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.896  12.416  14.768  1.00 39.72  ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 47.571  10.065  13.393  1.00 43.98  ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 48.109  8.714   13.434  1.00 42.26  ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 49.273  8.512   12.473  1.00 49.07  ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 49.213  8.914   11.305  1.00 48.34  ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 47.020  7.722   13.113  1.00 45.28  ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 50.332  7.882   12.972  1.00 54.75  ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 51.332  7.250   12.112  1.00 52.47  ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 51.121  5.750   12.248  1.00 49.29  ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 51.738  5.115   13.114  1.00 47.89  ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 52.733  7.652   12.550  1.00 46.47  ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.914  9.149   12.299  1.00 55.97  ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 54.053  9.712   13.089  1.00 57.27  ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 53.132  9.390   10.807  1.00 53.66  ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 50.215  5.188   11.418  1.00 45.22  ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.768  3.798   11.619  1.00 55.47  ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 50.955  2.842   11.664  1.00 58.39  ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.841  2.918   10.798  1.00 53.96  ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.887  3.515   10.388  1.00 46.76  ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 48.433  4.874   9.915   1.00 43.24  ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 49.567  5.822   10.255  1.00 45.59  ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.985  1.976   12.674  1.00 60.41  ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 52.102  1.070   12.850  1.00 49.97  ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 52.990  1.445   14.021  1.00 54.22  ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 53.516  0.566   14.704  1.00 67.35  ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 53.166  2.744   14.253  1.00 48.21  ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 54.044  3.211   15.321  1.00 50.85  ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 53.488  2.916   16.715  1.00 59.08  ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 52.307  2.585   16.883  1.00 54.31  ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 54.296  4.712   15.193  1.00 55.26  ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 53.181  5.457   15.648  1.00 54.91  ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 54.360  3.049   17.706  1.00 55.03  ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 54.001  2.842   19.093  1.00 62.38  ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 53.452  4.147   19.672  1.00 65.67  ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 52.533  4.117   20.497  1.00 58.98  ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 55.253  2.416   19.881  1.00 73.39  ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 55.016  1.458   21.039  1.00 79.13  ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 56.052  1.653   22.142  1.00 87.00  ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 55.708  2.790   23.001  1.00 98.85  ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 56.538  3.785   23.311  1.00 101.17 ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 57.783  3.791   22.838  1.00 96.71  ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 56.122  4.773   24.098  1.00 87.27  ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 53.996  5.283   19.212  1.00 57.36  ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.773  6.582   19.856  1.00 52.07  ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 52.615  7.422   19.278  1.00 54.67  ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 52.231  8.456   19.853  1.00 51.05  ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 55.069  7.399   19.876  1.00 57.53  ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 56.307  6.602   20.263  1.00 68.00  ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 57.073  6.058   19.045  1.00 82.06  ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 56.443  5.514   18.099  1.00 69.82  ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 58.320  6.173   19.038  1.00 80.36  ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 52.062  6.978   18.150  1.00 48.67  ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.867  7.600   17.574  1.00 49.98  ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 50.056  6.592   16.778  1.00 42.90  ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 49.972  6.691   15.554  1.00 53.26  ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 51.248  8.800   16.687  1.00 43.42  ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 49.448  5.623   17.471  1.00 45.99  ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.809  4.477   16.792  1.00 42.63  ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 47.486  4.814   16.092  1.00 48.80  ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 47.035  4.036   15.242  1.00 49.64  ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 48.558  3.497   17.939  1.00 38.02  ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 48.391  4.400   19.177  1.00 38.89  ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 49.329  5.558   18.945  1.00 45.45  ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 46.872  5.947   16.448  1.00 50.87  ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 45.599  6.339   15.866  1.00 45.08  ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 44.392  5.895   16.677  1.00 49.39  ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 44.522  5.091   17.621  1.00 46.33  ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 43.226  6.438   16.313  1.00 43.94  ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 41.960  6.146   16.983  1.00 38.06  ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 41.952  6.342   18.512  1.00 41.16  ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 41.116  5.741   19.192  1.00 40.30  ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 41.494  4.711   16.665  1.00 36.01  ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 41.244  4.480   15.188  1.00 41.34  ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.774  5.365   14.470  1.00 44.15  ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.557  3.282   14.727  1.00 41.26  ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.848  7.162   19.068  1.00 38.80  ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.900  7.251   20.531  1.00 35.96  ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 41.713  7.994   21.132  1.00 40.40  ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 41.361  7.758   22.301  1.00 36.53  ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 44.250  7.768   21.106  1.00 38.18  ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 45.412  6.993   20.500  1.00 35.99  ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 44.405  9.277   20.919  1.00 36.05  ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 41.079  8.865   20.340  1.00 39.70  ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.825  9.483   20.756  1.00 31.25  ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 38.730  8.434   20.929  1.00 36.75  ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 37.900  8.533   21.844  1.00 32.18  ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 38.715  7.436   20.042  1.00 33.15  ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 37.791  6.308   20.164  1.00 34.41  ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 38.086  5.477   21.425  1.00 41.65  ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 37.170  4.970   22.088  1.00 41.29  ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.853  5.424   18.915  1.00 35.33  ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 37.211  6.039   17.670  1.00 39.51  ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 37.378  5.133   16.446  1.00 32.59  ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 35.737  6.343   17.935  1.00 34.63  ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 39.370  5.363   21.752  1.00 41.44  ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.813  4.695   22.966  1.00 35.94  ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 39.417  5.437   24.238  1.00 37.81  ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 39.107  4.793   25.242  1.00 42.66  ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 41.327  4.469   22.936  1.00 34.08  ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 41.748  3.446   21.875  1.00 40.16  ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 43.258  3.280   21.840  1.00 32.87  ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 41.040  2.110   22.104  1.00 33.98  ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 39.449  6.773   24.211  1.00 37.04  ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.920  7.581   25.328  1.00 34.09  ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 37.455  7.235   25.617  1.00 38.36  ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 37.041  7.083   26.786  1.00 36.09  ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 39.008  9.069   25.016  1.00 33.96  ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 40.442  9.552   24.790  1.00 43.40  ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 41.398  8.884   25.263  1.00 38.86  ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 40.601  10.617  24.136  1.00 42.78  ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 36.681  7.102   24.542  1.00 34.46  ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 35.290  6.689   24.636  1.00 35.28  ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 35.150  5.288   25.277  1.00 40.53  ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 34.354  5.100   26.199  1.00 33.99  ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 34.602  6.752   23.260  1.00 31.88  ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 34.489  8.172   22.635  1.00 32.81  ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 33.982  8.135   21.178  1.00 44.84  ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 33.461  7.101   20.709  1.00 38.89  ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 34.142  9.258   20.455  1.00 39.87  ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 35.922  4.315   24.786  1.00 43.22  ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.898  2.949   25.327  1.00 39.75  ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 36.272  2.891   26.823  1.00 41.15  ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 35.659  2.156   27.597  1.00 38.98  ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 36.828  2.034   24.531  1.00 40.87  ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 36.774  0.576   24.964  1.00 44.69  ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 37.717  -0.259  24.148  1.00 41.65  ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 37.097  -0.692  22.891  1.00 48.31  ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 37.772  -1.098  21.812  1.00 46.89  ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 39.107  -1.118  21.821  1.00 39.44  ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 37.110  -1.473  20.719  1.00 43.94  ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 37.259  3.688   27.222  1.00 36.12  ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 37.645  3.779   28.620  1.00 34.11  ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 36.470  4.222   29.503  1.00 41.78  ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 36.270  3.685   30.600  1.00 45.44  ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 38.846  4.714   28.787  1.00 31.55  ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 39.422  4.774   30.204  1.00 42.83  ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 39.709  3.363   30.717  1.00 41.43  ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 40.679  5.639   30.237  1.00 39.07  ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 35.694  5.184   29.007  1.00 40.87  ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 34.511  5.677   29.706  1.00 35.66  ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 33.412  4.620   29.768  1.00 38.56  ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 32.674  4.552   30.769  1.00 41.20  ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 33.983  6.974   29.055  1.00 34.15  ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 33.291  3.812   28.706  1.00 36.46  ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 32.322  2.706   28.689  1.00 39.67  ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 32.692  1.664   29.765  1.00 47.66  ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 31.812  1.146   30.467  1.00 39.85  ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 32.229  2.048   27.306  1.00 38.23  ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 31.771  2.939   26.139  1.00 45.15  ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 31.308  2.132   24.929  1.00 41.38  ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 30.689  3.910   26.555  1.00 42.75  ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 33.996  1.394   29.896  1.00 39.81  ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 34.515  0.504   30.921  1.00 42.04  ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 34.274  1.088   32.305  1.00 45.73  ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 33.919  0.361   33.241  1.00 45.16  ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 36.003  0.215   30.686  1.00 39.55  ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 36.226  -0.597  29.403  1.00 44.85  ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 37.699  -0.687  28.961  1.00 51.38  ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 38.571  0.091   29.395  1.00 47.43  ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 37.970  -1.634  28.073  1.00 42.88  ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 34.480  2.398   32.432  1.00 39.32  ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 34.205  3.096   33.683  1.00 36.50  ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 32.719  2.984   34.040  1.00 41.42  ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 32.363  2.920   35.213  1.00 39.68  ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 34.597  4.578   33.585  1.00 42.76  ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 34.466  5.332   34.903  1.00 39.04  ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 35.476  5.620   35.777  1.00 38.56  ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 33.264  5.889   35.483  1.00 34.05  ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 34.984  6.315   36.863  1.00 44.31  ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 33.633  6.496   36.705  1.00 37.09  ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 31.918  5.930   35.089  1.00 37.56  ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 32.702  7.130   37.543  1.00 36.37  ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 30.993  6.562   35.920  1.00 36.67  ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 31.390  7.146   37.138  1.00 34.75  ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 31.842  2.975   33.038  1.00 41.46  ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 30.426  2.842   33.354  1.00 41.75  ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 30.133  1.426   33.879  1.00 43.11  ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 29.469  1.275   34.902  1.00 40.00  ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 29.500  3.242   32.179  1.00 37.32  ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 28.096  2.693   32.392  1.00 35.27  ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 29.460  4.765   32.034  1.00 35.66  ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 30.655  0.408   33.195  1.00 41.17  ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 30.507  -0.989  33.618  1.00 47.26  ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.878  -1.204  35.083  1.00 47.76  ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 30.113  -1.814  35.840  1.00 44.42  ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 31.365  -1.917  32.745  1.00 42.72  ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 30.811  -2.138  31.358  1.00 43.94  ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 29.454  -2.833  31.367  1.00 53.86  ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 29.365  -4.064  31.495  1.00 64.58  ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 28.388  -2.049  31.206  1.00 45.96  ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 32.042  -0.704  35.483  1.00 40.29  ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 32.491  -0.919  36.844  1.00 43.58  ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 31.763  -0.069  37.896  1.00 49.05  ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 31.521  -0.529  39.023  1.00 48.19  ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 34.016  -0.728  36.974  1.00 43.86  ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 34.466  -0.577  38.431  1.00 48.76  ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 35.886  -1.064  38.698  1.00 65.32  ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 36.792  -0.755  37.872  1.00 58.45  ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 36.096  -1.731  39.755  1.00 57.52  ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 31.415  1.168   37.550  1.00 47.56  ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 31.010  2.117   38.585  1.00 37.72  ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 29.551  2.575   38.586  1.00 38.52  ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 29.081  3.097   39.599  1.00 41.67  ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 31.922  3.347   38.568  1.00 35.20  ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 33.378  3.001   38.758  1.00 42.02  ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 33.826  2.704   39.876  1.00 49.77  ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 34.143  3.081   37.677  1.00 40.25  ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 28.835  2.400   37.474  1.00 40.60  ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 27.503  3.008   37.351  1.00 37.98  ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 26.468  2.490   38.365  1.00 43.89  ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 25.509  3.204   38.686  1.00 47.28  ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 26.931  2.949   35.903  1.00 38.59  ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 25.907  4.078   35.692  1.00 43.10  ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 26.320  1.577   35.593  1.00 31.90  ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 26.503  5.492   35.827  1.00 34.24  ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 26.662  1.272   38.883  1.00 47.47  ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 25.753  0.739   39.912  1.00 46.62  ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 25.812  1.542   41.225  1.00 47.96  ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 24.841  1.573   41.987  1.00 53.10  ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 26.003  -0.729  40.162  1.00 36.22  ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 26.935  2.211   41.474  1.00 43.66  ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 27.021  3.152   42.589  1.00 41.40  ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 26.035  4.319   42.475  1.00 44.73  ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 25.825  5.048   43.443  1.00 60.53  ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 28.447  3.677   42.738  1.00 39.29  ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 25.439  4.510   41.301  1.00 46.76  ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 24.519  5.632   41.076  1.00 44.21  ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 23.118  5.110   40.822  1.00 48.55  ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 22.201  5.889   40.557  1.00 52.75  ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 24.967  6.488   39.876  1.00 43.98  ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 26.332  7.114   40.040  1.00 45.76  ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 27.481  6.398   39.752  1.00 43.43  ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 26.466  8.422   40.490  1.00 44.62  ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 28.750  6.982   39.903  1.00 44.18  ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 27.725  9.003   40.646  1.00 39.34  ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 28.862  8.284   40.345  1.00 39.28  ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 22.953  3.790   40.887  1.00 43.67  ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 21.649  3.185   40.662  1.00 40.56  ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 21.455  2.761   39.219  1.00 48.33  ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 20.354  2.379   38.821  1.00 52.27  ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 22.529  2.820   38.435  1.00 46.01  ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 22.457  2.432   37.041  1.00 46.97  ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 22.677  0.943   36.847  1.00 48.37  ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 23.428  0.323   37.601  1.00 53.47  ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 22.039  0.377   35.826  1.00 44.35  ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 22.166  -1.037  35.510  1.00 46.49  ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 23.162  -1.269  34.373  1.00 45.95  ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 22.838  -1.043  33.206  1.00 44.95  ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 20.787  -1.575  35.113  1.00 56.32  ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 20.807  -3.051  34.716  1.00 53.25  ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 21.863  -3.722  34.842  1.00 53.70  ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 19.733  -3.545  34.296  1.00 51.93  ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 24.361  -1.776  34.705  1.00 48.71  ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 25.415  -2.015  33.701  1.00 43.68  ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 25.016  -3.042  32.632  1.00 50.28  ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 25.685  -3.127  31.600  1.00 50.40  ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 26.600  -2.557  34.522  1.00 45.09  ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 26.192  -2.490  35.964  1.00 44.09  ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 24.703  -2.323  36.029  1.00 44.03  ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.955  -3.809  32.875  1.00 51.84  ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 23.482  -4.789  31.897  1.00 50.92  ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 22.423  -4.209  30.968  1.00 51.23  ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.904  -4.903  30.089  1.00 53.44  ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.968  -6.050  32.596  1.00 53.74  ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 24.096  -6.877  33.200  1.00 62.15  ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 23.589  -8.437  33.945  1.00 83.05  ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 25.105  -9.383  33.739  1.00 73.77  ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 22.106  -2.933  31.167  1.00 49.33  ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 21.196  -2.221  30.280  1.00 49.08  ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 21.811  -0.871  29.910  1.00 53.28  ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 21.404  0.178   30.440  1.00 49.83  ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 19.845  -2.008  30.958  1.00 48.05  ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 18.855  -1.620  30.018  1.00 56.81  ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 22.797  -0.904  29.012  1.00 45.83  ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 23.521  0.304   28.582  1.00 42.80  ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 23.259  0.594   27.097  1.00 39.65  ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 23.557  -0.234  26.226  1.00 40.58  ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 25.065  0.177   28.837  1.00 45.18  ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 25.851  1.302   28.153  1.00 35.93  ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 25.381  0.102   30.342  1.00 36.35  ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 22.679  1.755   26.811  1.00 39.21  ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 22.419  2.174   25.429  1.00 40.61  ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 23.361  3.326   25.023  1.00 44.76  ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 23.419  4.360   25.715  1.00 43.70  ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 20.946  2.618   25.252  1.00 43.29  ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 20.072  1.511   25.510  1.00 44.20  ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 20.692  3.135   23.840  1.00 49.02  ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 24.121  3.146   23.937  1.00 34.53  ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.890  4.263   23.372  1.00 40.96  ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 23.999  5.105   22.442  1.00 43.14  ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 23.234  4.548   21.644  1.00 41.33  ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 26.089  3.762   22.573  1.00 39.02  ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 27.078  2.803   23.249  1.00 41.35  ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 28.249  2.489   22.302  1.00 30.41  ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 27.580  3.362   24.585  1.00 37.73  ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 24.074  6.432   22.548  1.00 36.70  ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 23.491  7.291   21.507  1.00 37.47  ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 24.358  8.510   21.213  1.00 41.54  ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 24.985  9.072   22.120  1.00 40.76  ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 22.021  7.673   21.781  1.00 34.50  ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.812  8.679   22.903  1.00 34.71  ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 22.474  8.562   24.120  1.00 38.37  ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 20.886  9.721   22.752  1.00 35.88  ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 22.234  9.477   25.165  1.00 36.52  ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 20.643  10.640  23.787  1.00 32.24  ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 21.321  10.514  24.996  1.00 34.67  ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 24.379  8.919   19.947  1.00 36.98  ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 25.217  10.023  19.529  1.00 36.11  ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.749  10.602  18.210  1.00 40.94  ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 23.965  9.988   17.481  1.00 36.56  ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 25.239  11.792  17.892  1.00 38.12  ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 24.771  12.494  16.715  1.00 38.80  ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 25.964  12.994  15.909  1.00 38.50  ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 27.045  13.236  16.459  1.00 42.17  ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 23.836  13.641  17.142  1.00 40.76  ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 23.206  14.416  15.997  1.00 42.79  ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 24.163  15.437  15.397  1.00 50.99  ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 25.144  15.834  16.088  1.00 47.77  ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 23.939  15.833  14.233  1.00 46.80  ? 202  GLU A OE2 1 
HETATM 1569 N N   . GFT A 1 203 ? 26.112  12.542  14.687  1.00 45.38  ? 203  GFT A N   1 
HETATM 1570 C CA  . GFT A 1 203 ? 26.890  12.875  13.481  1.00 45.60  ? 203  GFT A CA  1 
HETATM 1571 C C   . GFT A 1 203 ? 28.397  12.383  13.622  1.00 40.39  ? 203  GFT A C   1 
HETATM 1572 O O   . GFT A 1 203 ? 28.435  10.992  13.453  1.00 37.81  ? 203  GFT A O   1 
HETATM 1573 C CB  . GFT A 1 203 ? 26.926  14.457  13.345  1.00 51.12  ? 203  GFT A CB  1 
HETATM 1574 O OG  . GFT A 1 203 ? 27.848  14.921  12.394  1.00 52.38  ? 203  GFT A OG  1 
HETATM 1575 C CAA . GFT A 1 203 ? 29.523  16.521  10.922  1.00 46.52  ? 203  GFT A CAA 1 
HETATM 1576 O OAC . GFT A 1 203 ? 30.038  15.566  13.426  1.00 44.47  ? 203  GFT A OAC 1 
HETATM 1577 C CAD . GFT A 1 203 ? 27.414  20.879  15.014  1.00 61.59  ? 203  GFT A CAD 1 
HETATM 1578 C CAE . GFT A 1 203 ? 28.684  20.751  14.146  1.00 65.72  ? 203  GFT A CAE 1 
HETATM 1579 C CAF . GFT A 1 203 ? 26.861  19.510  15.440  1.00 53.86  ? 203  GFT A CAF 1 
HETATM 1580 C CAG . GFT A 1 203 ? 28.477  19.854  12.914  1.00 66.06  ? 203  GFT A CAG 1 
HETATM 1581 C CAH . GFT A 1 203 ? 26.525  18.649  14.224  1.00 50.24  ? 203  GFT A CAH 1 
HETATM 1582 O OAI . GFT A 1 203 ? 28.462  17.432  13.376  1.00 52.46  ? 203  GFT A OAI 1 
HETATM 1583 C CAJ . GFT A 1 203 ? 27.640  18.539  13.139  1.00 57.58  ? 203  GFT A CAJ 1 
HETATM 1584 P PAK . GFT A 1 203 ? 28.918  16.156  12.497  1.00 47.78  ? 203  GFT A PAK 1 
ATOM   1585 N N   . ALA A 1 204 ? 29.529  12.831  14.129  1.00 39.17  ? 204  ALA A N   1 
ATOM   1586 C CA  . ALA A 1 204 ? 30.661  11.979  14.460  1.00 39.44  ? 204  ALA A CA  1 
ATOM   1587 C C   . ALA A 1 204 ? 30.400  11.176  15.751  1.00 40.47  ? 204  ALA A C   1 
ATOM   1588 O O   . ALA A 1 204 ? 31.072  10.166  16.015  1.00 36.67  ? 204  ALA A O   1 
ATOM   1589 C CB  . ALA A 1 204 ? 31.934  12.815  14.589  1.00 32.29  ? 204  ALA A CB  1 
ATOM   1590 N N   . GLY A 1 205 ? 29.433  11.626  16.550  1.00 36.15  ? 205  GLY A N   1 
ATOM   1591 C CA  . GLY A 1 205 ? 28.993  10.851  17.692  1.00 36.75  ? 205  GLY A CA  1 
ATOM   1592 C C   . GLY A 1 205 ? 28.297  9.579   17.225  1.00 35.73  ? 205  GLY A C   1 
ATOM   1593 O O   . GLY A 1 205 ? 28.537  8.494   17.754  1.00 38.33  ? 205  GLY A O   1 
ATOM   1594 N N   . ALA A 1 206 ? 27.423  9.714   16.234  1.00 33.82  ? 206  ALA A N   1 
ATOM   1595 C CA  . ALA A 1 206 ? 26.725  8.562   15.671  1.00 38.15  ? 206  ALA A CA  1 
ATOM   1596 C C   . ALA A 1 206 ? 27.745  7.610   15.043  1.00 42.34  ? 206  ALA A C   1 
ATOM   1597 O O   . ALA A 1 206 ? 27.712  6.401   15.293  1.00 44.53  ? 206  ALA A O   1 
ATOM   1598 C CB  . ALA A 1 206 ? 25.680  9.004   14.648  1.00 32.99  ? 206  ALA A CB  1 
ATOM   1599 N N   . ALA A 1 207 ? 28.654  8.166   14.244  1.00 34.45  ? 207  ALA A N   1 
ATOM   1600 C CA  . ALA A 1 207 ? 29.700  7.388   13.616  1.00 35.11  ? 207  ALA A CA  1 
ATOM   1601 C C   . ALA A 1 207 ? 30.556  6.689   14.670  1.00 37.74  ? 207  ALA A C   1 
ATOM   1602 O O   . ALA A 1 207 ? 30.947  5.533   14.495  1.00 41.01  ? 207  ALA A O   1 
ATOM   1603 C CB  . ALA A 1 207 ? 30.558  8.276   12.731  1.00 36.04  ? 207  ALA A CB  1 
ATOM   1604 N N   . SER A 1 208 ? 30.850  7.399   15.758  1.00 35.98  ? 208  SER A N   1 
ATOM   1605 C CA  . SER A 1 208 ? 31.516  6.800   16.920  1.00 40.86  ? 208  SER A CA  1 
ATOM   1606 C C   . SER A 1 208 ? 30.764  5.569   17.437  1.00 40.51  ? 208  SER A C   1 
ATOM   1607 O O   . SER A 1 208 ? 31.354  4.486   17.562  1.00 36.78  ? 208  SER A O   1 
ATOM   1608 C CB  . SER A 1 208 ? 31.675  7.826   18.050  1.00 34.29  ? 208  SER A CB  1 
ATOM   1609 O OG  . SER A 1 208 ? 32.779  8.678   17.795  1.00 38.11  ? 208  SER A OG  1 
ATOM   1610 N N   . VAL A 1 209 ? 29.475  5.743   17.735  1.00 32.98  ? 209  VAL A N   1 
ATOM   1611 C CA  . VAL A 1 209 ? 28.635  4.638   18.176  1.00 36.53  ? 209  VAL A CA  1 
ATOM   1612 C C   . VAL A 1 209 ? 28.755  3.458   17.213  1.00 39.68  ? 209  VAL A C   1 
ATOM   1613 O O   . VAL A 1 209 ? 28.936  2.319   17.643  1.00 41.01  ? 209  VAL A O   1 
ATOM   1614 C CB  . VAL A 1 209 ? 27.154  5.066   18.310  1.00 39.02  ? 209  VAL A CB  1 
ATOM   1615 C CG1 . VAL A 1 209 ? 26.260  3.860   18.488  1.00 29.55  ? 209  VAL A CG1 1 
ATOM   1616 C CG2 . VAL A 1 209 ? 26.988  6.041   19.470  1.00 39.64  ? 209  VAL A CG2 1 
ATOM   1617 N N   . GLY A 1 210 ? 28.684  3.742   15.912  1.00 42.92  ? 210  GLY A N   1 
ATOM   1618 C CA  . GLY A 1 210 ? 28.797  2.720   14.882  1.00 39.63  ? 210  GLY A CA  1 
ATOM   1619 C C   . GLY A 1 210 ? 30.119  1.971   14.927  1.00 41.36  ? 210  GLY A C   1 
ATOM   1620 O O   . GLY A 1 210 ? 30.178  0.770   14.672  1.00 42.30  ? 210  GLY A O   1 
ATOM   1621 N N   . MET A 1 211 ? 31.190  2.665   15.274  1.00 37.41  ? 211  MET A N   1 
ATOM   1622 C CA  . MET A 1 211 ? 32.477  1.996   15.363  1.00 40.54  ? 211  MET A CA  1 
ATOM   1623 C C   . MET A 1 211 ? 32.619  1.102   16.594  1.00 48.60  ? 211  MET A C   1 
ATOM   1624 O O   . MET A 1 211 ? 33.377  0.125   16.572  1.00 46.09  ? 211  MET A O   1 
ATOM   1625 C CB  . MET A 1 211 ? 33.610  3.009   15.250  1.00 43.02  ? 211  MET A CB  1 
ATOM   1626 C CG  . MET A 1 211 ? 33.836  3.360   13.787  1.00 49.98  ? 211  MET A CG  1 
ATOM   1627 S SD  . MET A 1 211 ? 34.735  4.857   13.604  1.00 54.02  ? 211  MET A SD  1 
ATOM   1628 C CE  . MET A 1 211 ? 34.056  5.457   12.064  1.00 52.00  ? 211  MET A CE  1 
ATOM   1629 N N   . HIS A 1 212 ? 31.875  1.421   17.651  1.00 42.20  ? 212  HIS A N   1 
ATOM   1630 C CA  . HIS A 1 212 ? 31.871  0.569   18.823  1.00 42.36  ? 212  HIS A CA  1 
ATOM   1631 C C   . HIS A 1 212 ? 31.167  -0.759  18.516  1.00 45.81  ? 212  HIS A C   1 
ATOM   1632 O O   . HIS A 1 212 ? 31.599  -1.817  18.970  1.00 46.20  ? 212  HIS A O   1 
ATOM   1633 C CB  . HIS A 1 212 ? 31.274  1.299   20.032  1.00 39.79  ? 212  HIS A CB  1 
ATOM   1634 C CG  . HIS A 1 212 ? 32.161  2.374   20.568  1.00 35.71  ? 212  HIS A CG  1 
ATOM   1635 N ND1 . HIS A 1 212 ? 33.440  2.125   21.015  1.00 37.68  ? 212  HIS A ND1 1 
ATOM   1636 C CD2 . HIS A 1 212 ? 31.969  3.710   20.702  1.00 35.55  ? 212  HIS A CD2 1 
ATOM   1637 C CE1 . HIS A 1 212 ? 33.994  3.255   21.423  1.00 37.57  ? 212  HIS A CE1 1 
ATOM   1638 N NE2 . HIS A 1 212 ? 33.121  4.231   21.243  1.00 38.20  ? 212  HIS A NE2 1 
ATOM   1639 N N   . ILE A 1 213 ? 30.091  -0.692  17.739  1.00 42.35  ? 213  ILE A N   1 
ATOM   1640 C CA  . ILE A 1 213 ? 29.435  -1.881  17.196  1.00 45.36  ? 213  ILE A CA  1 
ATOM   1641 C C   . ILE A 1 213 ? 30.391  -2.776  16.387  1.00 47.79  ? 213  ILE A C   1 
ATOM   1642 O O   . ILE A 1 213 ? 30.336  -4.001  16.486  1.00 55.71  ? 213  ILE A O   1 
ATOM   1643 C CB  . ILE A 1 213 ? 28.242  -1.466  16.300  1.00 44.42  ? 213  ILE A CB  1 
ATOM   1644 C CG1 . ILE A 1 213 ? 27.189  -0.745  17.143  1.00 38.95  ? 213  ILE A CG1 1 
ATOM   1645 C CG2 . ILE A 1 213 ? 27.630  -2.671  15.571  1.00 43.41  ? 213  ILE A CG2 1 
ATOM   1646 C CD1 . ILE A 1 213 ? 25.934  -0.386  16.373  1.00 40.36  ? 213  ILE A CD1 1 
ATOM   1647 N N   . LEU A 1 214 ? 31.269  -2.160  15.597  1.00 46.25  ? 214  LEU A N   1 
ATOM   1648 C CA  . LEU A 1 214 ? 32.133  -2.890  14.666  1.00 49.03  ? 214  LEU A CA  1 
ATOM   1649 C C   . LEU A 1 214 ? 33.440  -3.341  15.304  1.00 44.17  ? 214  LEU A C   1 
ATOM   1650 O O   . LEU A 1 214 ? 34.281  -3.966  14.652  1.00 51.28  ? 214  LEU A O   1 
ATOM   1651 C CB  . LEU A 1 214 ? 32.452  -2.022  13.440  1.00 43.72  ? 214  LEU A CB  1 
ATOM   1652 C CG  . LEU A 1 214 ? 31.216  -1.593  12.656  1.00 50.40  ? 214  LEU A CG  1 
ATOM   1653 C CD1 . LEU A 1 214 ? 31.585  -0.838  11.381  1.00 42.42  ? 214  LEU A CD1 1 
ATOM   1654 C CD2 . LEU A 1 214 ? 30.372  -2.823  12.348  1.00 49.10  ? 214  LEU A CD2 1 
ATOM   1655 N N   . SER A 1 215 ? 33.615  -3.018  16.575  1.00 40.63  ? 215  SER A N   1 
ATOM   1656 C CA  . SER A 1 215 ? 34.881  -3.276  17.245  1.00 43.43  ? 215  SER A CA  1 
ATOM   1657 C C   . SER A 1 215 ? 34.616  -4.159  18.452  1.00 48.16  ? 215  SER A C   1 
ATOM   1658 O O   . SER A 1 215 ? 33.978  -3.732  19.410  1.00 52.36  ? 215  SER A O   1 
ATOM   1659 C CB  . SER A 1 215 ? 35.528  -1.961  17.676  1.00 43.76  ? 215  SER A CB  1 
ATOM   1660 O OG  . SER A 1 215 ? 36.848  -2.166  18.133  1.00 43.69  ? 215  SER A OG  1 
ATOM   1661 N N   . LEU A 1 216 ? 35.098  -5.398  18.389  1.00 62.49  ? 216  LEU A N   1 
ATOM   1662 C CA  . LEU A 1 216 ? 34.791  -6.425  19.391  1.00 56.86  ? 216  LEU A CA  1 
ATOM   1663 C C   . LEU A 1 216 ? 34.993  -6.032  20.866  1.00 53.81  ? 216  LEU A C   1 
ATOM   1664 O O   . LEU A 1 216 ? 34.100  -6.269  21.692  1.00 46.39  ? 216  LEU A O   1 
ATOM   1665 C CB  . LEU A 1 216 ? 35.554  -7.721  19.080  1.00 65.82  ? 216  LEU A CB  1 
ATOM   1666 C CG  . LEU A 1 216 ? 34.628  -8.929  18.957  1.00 72.54  ? 216  LEU A CG  1 
ATOM   1667 C CD1 . LEU A 1 216 ? 34.794  -9.572  17.582  1.00 73.64  ? 216  LEU A CD1 1 
ATOM   1668 C CD2 . LEU A 1 216 ? 34.894  -9.921  20.081  1.00 66.18  ? 216  LEU A CD2 1 
ATOM   1669 N N   . PRO A 1 217 ? 36.157  -5.436  21.206  1.00 46.51  ? 217  PRO A N   1 
ATOM   1670 C CA  . PRO A 1 217 ? 36.360  -5.083  22.616  1.00 42.55  ? 217  PRO A CA  1 
ATOM   1671 C C   . PRO A 1 217 ? 35.353  -4.065  23.179  1.00 47.88  ? 217  PRO A C   1 
ATOM   1672 O O   . PRO A 1 217 ? 35.320  -3.881  24.398  1.00 53.72  ? 217  PRO A O   1 
ATOM   1673 C CB  . PRO A 1 217 ? 37.775  -4.491  22.628  1.00 42.44  ? 217  PRO A CB  1 
ATOM   1674 C CG  . PRO A 1 217 ? 38.450  -5.092  21.447  1.00 42.99  ? 217  PRO A CG  1 
ATOM   1675 C CD  . PRO A 1 217 ? 37.366  -5.174  20.405  1.00 39.66  ? 217  PRO A CD  1 
ATOM   1676 N N   . SER A 1 218 ? 34.567  -3.412  22.326  1.00 44.41  ? 218  SER A N   1 
ATOM   1677 C CA  . SER A 1 218 ? 33.587  -2.429  22.796  1.00 47.36  ? 218  SER A CA  1 
ATOM   1678 C C   . SER A 1 218 ? 32.225  -3.067  22.936  1.00 48.30  ? 218  SER A C   1 
ATOM   1679 O O   . SER A 1 218 ? 31.369  -2.555  23.657  1.00 48.80  ? 218  SER A O   1 
ATOM   1680 C CB  . SER A 1 218 ? 33.507  -1.207  21.863  1.00 43.26  ? 218  SER A CB  1 
ATOM   1681 O OG  . SER A 1 218 ? 34.655  -0.386  22.010  1.00 48.22  ? 218  SER A OG  1 
ATOM   1682 N N   . ARG A 1 219 ? 32.046  -4.201  22.261  1.00 50.96  ? 219  ARG A N   1 
ATOM   1683 C CA  . ARG A 1 219 ? 30.749  -4.871  22.176  1.00 51.61  ? 219  ARG A CA  1 
ATOM   1684 C C   . ARG A 1 219 ? 30.241  -5.384  23.521  1.00 52.45  ? 219  ARG A C   1 
ATOM   1685 O O   . ARG A 1 219 ? 29.034  -5.347  23.793  1.00 50.71  ? 219  ARG A O   1 
ATOM   1686 C CB  . ARG A 1 219 ? 30.792  -5.982  21.129  1.00 45.57  ? 219  ARG A CB  1 
ATOM   1687 C CG  . ARG A 1 219 ? 30.652  -5.434  19.717  1.00 51.76  ? 219  ARG A CG  1 
ATOM   1688 C CD  . ARG A 1 219 ? 29.321  -4.682  19.564  1.00 49.37  ? 219  ARG A CD  1 
ATOM   1689 N NE  . ARG A 1 219 ? 28.177  -5.596  19.458  1.00 55.87  ? 219  ARG A NE  1 
ATOM   1690 C CZ  . ARG A 1 219 ? 27.846  -6.257  18.342  1.00 70.77  ? 219  ARG A CZ  1 
ATOM   1691 N NH1 . ARG A 1 219 ? 28.569  -6.110  17.231  1.00 65.94  ? 219  ARG A NH1 1 
ATOM   1692 N NH2 . ARG A 1 219 ? 26.795  -7.072  18.327  1.00 75.65  ? 219  ARG A NH2 1 
ATOM   1693 N N   . SER A 1 220 ? 31.161  -5.831  24.371  1.00 50.27  ? 220  SER A N   1 
ATOM   1694 C CA  . SER A 1 220 ? 30.790  -6.272  25.711  1.00 47.89  ? 220  SER A CA  1 
ATOM   1695 C C   . SER A 1 220 ? 30.365  -5.131  26.640  1.00 50.00  ? 220  SER A C   1 
ATOM   1696 O O   . SER A 1 220 ? 29.871  -5.393  27.740  1.00 56.74  ? 220  SER A O   1 
ATOM   1697 C CB  . SER A 1 220 ? 31.937  -7.065  26.356  1.00 50.70  ? 220  SER A CB  1 
ATOM   1698 O OG  . SER A 1 220 ? 33.178  -6.381  26.270  1.00 55.33  ? 220  SER A OG  1 
ATOM   1699 N N   . LEU A 1 221 ? 30.552  -3.879  26.207  1.00 50.12  ? 221  LEU A N   1 
ATOM   1700 C CA  . LEU A 1 221 ? 30.343  -2.722  27.090  1.00 40.60  ? 221  LEU A CA  1 
ATOM   1701 C C   . LEU A 1 221 ? 28.972  -2.058  26.935  1.00 42.78  ? 221  LEU A C   1 
ATOM   1702 O O   . LEU A 1 221 ? 28.646  -1.116  27.668  1.00 42.98  ? 221  LEU A O   1 
ATOM   1703 C CB  . LEU A 1 221 ? 31.462  -1.692  26.911  1.00 42.95  ? 221  LEU A CB  1 
ATOM   1704 C CG  . LEU A 1 221 ? 32.901  -2.208  27.043  1.00 47.73  ? 221  LEU A CG  1 
ATOM   1705 C CD1 . LEU A 1 221 ? 33.903  -1.158  26.577  1.00 44.99  ? 221  LEU A CD1 1 
ATOM   1706 C CD2 . LEU A 1 221 ? 33.189  -2.605  28.481  1.00 43.87  ? 221  LEU A CD2 1 
ATOM   1707 N N   . PHE A 1 222 ? 28.159  -2.546  25.999  1.00 36.77  ? 222  PHE A N   1 
ATOM   1708 C CA  . PHE A 1 222 ? 26.817  -1.967  25.798  1.00 43.92  ? 222  PHE A CA  1 
ATOM   1709 C C   . PHE A 1 222 ? 25.884  -2.965  25.108  1.00 42.54  ? 222  PHE A C   1 
ATOM   1710 O O   . PHE A 1 222 ? 26.327  -3.987  24.570  1.00 45.36  ? 222  PHE A O   1 
ATOM   1711 C CB  . PHE A 1 222 ? 26.894  -0.660  24.982  1.00 42.92  ? 222  PHE A CB  1 
ATOM   1712 C CG  . PHE A 1 222 ? 27.283  -0.876  23.537  1.00 41.32  ? 222  PHE A CG  1 
ATOM   1713 C CD1 . PHE A 1 222 ? 28.617  -1.095  23.182  1.00 40.66  ? 222  PHE A CD1 1 
ATOM   1714 C CD2 . PHE A 1 222 ? 26.318  -0.893  22.536  1.00 39.33  ? 222  PHE A CD2 1 
ATOM   1715 C CE1 . PHE A 1 222 ? 28.979  -1.310  21.853  1.00 39.42  ? 222  PHE A CE1 1 
ATOM   1716 C CE2 . PHE A 1 222 ? 26.682  -1.120  21.205  1.00 43.39  ? 222  PHE A CE2 1 
ATOM   1717 C CZ  . PHE A 1 222 ? 28.011  -1.324  20.872  1.00 40.10  ? 222  PHE A CZ  1 
ATOM   1718 N N   . HIS A 1 223 ? 24.598  -2.646  25.084  1.00 40.79  ? 223  HIS A N   1 
ATOM   1719 C CA  . HIS A 1 223 ? 23.600  -3.616  24.657  1.00 44.08  ? 223  HIS A CA  1 
ATOM   1720 C C   . HIS A 1 223 ? 22.746  -3.149  23.477  1.00 49.85  ? 223  HIS A C   1 
ATOM   1721 O O   . HIS A 1 223 ? 22.349  -3.960  22.633  1.00 66.64  ? 223  HIS A O   1 
ATOM   1722 C CB  . HIS A 1 223 ? 22.766  -4.013  25.885  1.00 50.83  ? 223  HIS A CB  1 
ATOM   1723 C CG  . HIS A 1 223 ? 23.616  -4.335  27.083  1.00 58.55  ? 223  HIS A CG  1 
ATOM   1724 N ND1 . HIS A 1 223 ? 24.169  -5.585  27.294  1.00 58.01  ? 223  HIS A ND1 1 
ATOM   1725 C CD2 . HIS A 1 223 ? 24.060  -3.552  28.102  1.00 49.41  ? 223  HIS A CD2 1 
ATOM   1726 C CE1 . HIS A 1 223 ? 24.893  -5.566  28.402  1.00 51.22  ? 223  HIS A CE1 1 
ATOM   1727 N NE2 . HIS A 1 223 ? 24.840  -4.345  28.911  1.00 62.47  ? 223  HIS A NE2 1 
ATOM   1728 N N   . ARG A 1 224 ? 22.498  -1.842  23.405  1.00 46.23  ? 224  ARG A N   1 
ATOM   1729 C CA  . ARG A 1 224 ? 21.662  -1.233  22.363  1.00 42.66  ? 224  ARG A CA  1 
ATOM   1730 C C   . ARG A 1 224 ? 22.326  0.053   21.846  1.00 43.34  ? 224  ARG A C   1 
ATOM   1731 O O   . ARG A 1 224 ? 23.155  0.645   22.532  1.00 42.32  ? 224  ARG A O   1 
ATOM   1732 C CB  . ARG A 1 224 ? 20.294  -0.879  22.946  1.00 48.84  ? 224  ARG A CB  1 
ATOM   1733 C CG  . ARG A 1 224 ? 19.241  -1.954  22.836  1.00 56.41  ? 224  ARG A CG  1 
ATOM   1734 C CD  . ARG A 1 224 ? 18.104  -1.670  23.797  1.00 57.84  ? 224  ARG A CD  1 
ATOM   1735 N NE  . ARG A 1 224 ? 18.542  -1.889  25.174  1.00 67.44  ? 224  ARG A NE  1 
ATOM   1736 C CZ  . ARG A 1 224 ? 18.515  -3.073  25.778  1.00 68.56  ? 224  ARG A CZ  1 
ATOM   1737 N NH1 . ARG A 1 224 ? 18.060  -4.138  25.124  1.00 76.87  ? 224  ARG A NH1 1 
ATOM   1738 N NH2 . ARG A 1 224 ? 18.941  -3.195  27.030  1.00 71.36  ? 224  ARG A NH2 1 
ATOM   1739 N N   . ALA A 1 225 ? 21.960  0.507   20.654  1.00 42.07  ? 225  ALA A N   1 
ATOM   1740 C CA  . ALA A 1 225 ? 22.600  1.703   20.101  1.00 41.94  ? 225  ALA A CA  1 
ATOM   1741 C C   . ALA A 1 225 ? 21.666  2.630   19.295  1.00 42.60  ? 225  ALA A C   1 
ATOM   1742 O O   . ALA A 1 225 ? 20.807  2.168   18.533  1.00 38.85  ? 225  ALA A O   1 
ATOM   1743 C CB  . ALA A 1 225 ? 23.823  1.312   19.270  1.00 41.86  ? 225  ALA A CB  1 
ATOM   1744 N N   . VAL A 1 226 ? 21.844  3.937   19.474  1.00 38.01  ? 226  VAL A N   1 
ATOM   1745 C CA  . VAL A 1 226 ? 21.181  4.921   18.623  1.00 40.17  ? 226  VAL A CA  1 
ATOM   1746 C C   . VAL A 1 226 ? 22.186  5.735   17.804  1.00 43.96  ? 226  VAL A C   1 
ATOM   1747 O O   . VAL A 1 226 ? 23.173  6.259   18.335  1.00 42.01  ? 226  VAL A O   1 
ATOM   1748 C CB  . VAL A 1 226 ? 20.316  5.887   19.424  1.00 41.15  ? 226  VAL A CB  1 
ATOM   1749 C CG1 . VAL A 1 226 ? 19.568  6.834   18.465  1.00 42.02  ? 226  VAL A CG1 1 
ATOM   1750 C CG2 . VAL A 1 226 ? 19.352  5.116   20.308  1.00 36.29  ? 226  VAL A CG2 1 
ATOM   1751 N N   . LEU A 1 227 ? 21.924  5.835   16.507  1.00 41.66  ? 227  LEU A N   1 
ATOM   1752 C CA  . LEU A 1 227 ? 22.769  6.605   15.610  1.00 37.63  ? 227  LEU A CA  1 
ATOM   1753 C C   . LEU A 1 227 ? 21.929  7.688   14.940  1.00 38.58  ? 227  LEU A C   1 
ATOM   1754 O O   . LEU A 1 227 ? 21.098  7.406   14.065  1.00 34.20  ? 227  LEU A O   1 
ATOM   1755 C CB  . LEU A 1 227 ? 23.398  5.704   14.540  1.00 38.96  ? 227  LEU A CB  1 
ATOM   1756 C CG  . LEU A 1 227 ? 24.453  4.674   14.969  1.00 43.62  ? 227  LEU A CG  1 
ATOM   1757 C CD1 . LEU A 1 227 ? 23.825  3.491   15.704  1.00 39.88  ? 227  LEU A CD1 1 
ATOM   1758 C CD2 . LEU A 1 227 ? 25.239  4.178   13.759  1.00 35.16  ? 227  LEU A CD2 1 
ATOM   1759 N N   . GLN A 1 228 ? 22.145  8.931   15.343  1.00 40.21  ? 228  GLN A N   1 
ATOM   1760 C CA  . GLN A 1 228 ? 21.421  10.055  14.746  1.00 39.51  ? 228  GLN A CA  1 
ATOM   1761 C C   . GLN A 1 228 ? 22.303  10.770  13.725  1.00 42.75  ? 228  GLN A C   1 
ATOM   1762 O O   . GLN A 1 228 ? 23.363  11.322  14.077  1.00 39.39  ? 228  GLN A O   1 
ATOM   1763 C CB  . GLN A 1 228 ? 20.966  11.024  15.845  1.00 38.17  ? 228  GLN A CB  1 
ATOM   1764 C CG  . GLN A 1 228 ? 20.294  10.303  17.022  1.00 32.44  ? 228  GLN A CG  1 
ATOM   1765 C CD  . GLN A 1 228 ? 20.082  11.180  18.223  1.00 40.59  ? 228  GLN A CD  1 
ATOM   1766 O OE1 . GLN A 1 228 ? 19.948  10.685  19.349  1.00 44.41  ? 228  GLN A OE1 1 
ATOM   1767 N NE2 . GLN A 1 228 ? 20.053  12.499  18.004  1.00 46.85  ? 228  GLN A NE2 1 
ATOM   1768 N N   . SER A 1 229 ? 21.873  10.725  12.461  1.00 40.70  ? 229  SER A N   1 
ATOM   1769 C CA  . SER A 1 229 ? 22.529  11.446  11.363  1.00 37.63  ? 229  SER A CA  1 
ATOM   1770 C C   . SER A 1 229 ? 24.033  11.185  11.269  1.00 43.61  ? 229  SER A C   1 
ATOM   1771 O O   . SER A 1 229 ? 24.839  12.126  11.183  1.00 45.75  ? 229  SER A O   1 
ATOM   1772 C CB  . SER A 1 229 ? 22.294  12.951  11.473  1.00 38.82  ? 229  SER A CB  1 
ATOM   1773 O OG  . SER A 1 229 ? 20.931  13.230  11.716  1.00 42.68  ? 229  SER A OG  1 
ATOM   1774 N N   . GLY A 1 230 ? 24.413  9.915   11.256  1.00 36.79  ? 230  GLY A N   1 
ATOM   1775 C CA  . GLY A 1 230 ? 25.821  9.579   11.228  1.00 41.30  ? 230  GLY A CA  1 
ATOM   1776 C C   . GLY A 1 230 ? 26.057  8.087   11.163  1.00 42.21  ? 230  GLY A C   1 
ATOM   1777 O O   . GLY A 1 230 ? 25.287  7.290   11.721  1.00 41.91  ? 230  GLY A O   1 
ATOM   1778 N N   . THR A 1 231 ? 27.122  7.701   10.468  1.00 38.99  ? 231  THR A N   1 
ATOM   1779 C CA  . THR A 1 231 ? 27.436  6.289   10.268  1.00 41.64  ? 231  THR A CA  1 
ATOM   1780 C C   . THR A 1 231 ? 28.940  6.047   10.281  1.00 38.61  ? 231  THR A C   1 
ATOM   1781 O O   . THR A 1 231 ? 29.716  6.910   9.894   1.00 43.93  ? 231  THR A O   1 
ATOM   1782 C CB  . THR A 1 231 ? 26.850  5.758   8.929   1.00 42.10  ? 231  THR A CB  1 
ATOM   1783 O OG1 . THR A 1 231 ? 27.291  6.580   7.843   1.00 42.31  ? 231  THR A OG1 1 
ATOM   1784 C CG2 . THR A 1 231 ? 25.333  5.748   8.957   1.00 39.47  ? 231  THR A CG2 1 
ATOM   1785 N N   . PRO A 1 232 ? 29.365  4.859   10.721  1.00 46.19  ? 232  PRO A N   1 
ATOM   1786 C CA  . PRO A 1 232 ? 30.809  4.602   10.630  1.00 37.69  ? 232  PRO A CA  1 
ATOM   1787 C C   . PRO A 1 232 ? 31.251  4.453   9.160   1.00 42.12  ? 232  PRO A C   1 
ATOM   1788 O O   . PRO A 1 232 ? 32.392  4.779   8.829   1.00 42.25  ? 232  PRO A O   1 
ATOM   1789 C CB  . PRO A 1 232 ? 30.983  3.297   11.421  1.00 37.58  ? 232  PRO A CB  1 
ATOM   1790 C CG  . PRO A 1 232 ? 29.638  2.621   11.346  1.00 35.38  ? 232  PRO A CG  1 
ATOM   1791 C CD  . PRO A 1 232 ? 28.607  3.716   11.267  1.00 41.27  ? 232  PRO A CD  1 
ATOM   1792 N N   . ASN A 1 233 ? 30.349  3.973   8.300   1.00 41.27  ? 233  ASN A N   1 
ATOM   1793 C CA  . ASN A 1 233 ? 30.603  3.898   6.862   1.00 39.89  ? 233  ASN A CA  1 
ATOM   1794 C C   . ASN A 1 233 ? 30.360  5.267   6.238   1.00 46.59  ? 233  ASN A C   1 
ATOM   1795 O O   . ASN A 1 233 ? 29.847  6.177   6.902   1.00 45.14  ? 233  ASN A O   1 
ATOM   1796 C CB  . ASN A 1 233 ? 29.698  2.858   6.191   1.00 38.10  ? 233  ASN A CB  1 
ATOM   1797 C CG  . ASN A 1 233 ? 28.223  3.087   6.500   1.00 39.99  ? 233  ASN A CG  1 
ATOM   1798 O OD1 . ASN A 1 233 ? 27.827  3.114   7.670   1.00 43.05  ? 233  ASN A OD1 1 
ATOM   1799 N ND2 . ASN A 1 233 ? 27.406  3.277   5.459   1.00 35.12  ? 233  ASN A ND2 1 
ATOM   1800 N N   . GLY A 1 234 ? 30.720  5.424   4.967   1.00 46.17  ? 234  GLY A N   1 
ATOM   1801 C CA  . GLY A 1 234 ? 30.572  6.716   4.306   1.00 52.52  ? 234  GLY A CA  1 
ATOM   1802 C C   . GLY A 1 234 ? 31.883  7.458   4.073   1.00 44.55  ? 234  GLY A C   1 
ATOM   1803 O O   . GLY A 1 234 ? 32.955  6.998   4.472   1.00 55.61  ? 234  GLY A O   1 
ATOM   1804 N N   . PRO A 1 235 ? 31.801  8.631   3.445   1.00 42.94  ? 235  PRO A N   1 
ATOM   1805 C CA  . PRO A 1 235 ? 32.971  9.287   2.845   1.00 43.78  ? 235  PRO A CA  1 
ATOM   1806 C C   . PRO A 1 235 ? 33.854  10.107  3.804   1.00 43.34  ? 235  PRO A C   1 
ATOM   1807 O O   . PRO A 1 235 ? 34.999  10.421  3.461   1.00 48.06  ? 235  PRO A O   1 
ATOM   1808 C CB  . PRO A 1 235 ? 32.342  10.207  1.779   1.00 41.54  ? 235  PRO A CB  1 
ATOM   1809 C CG  . PRO A 1 235 ? 30.823  10.207  2.044   1.00 39.53  ? 235  PRO A CG  1 
ATOM   1810 C CD  . PRO A 1 235 ? 30.574  9.433   3.302   1.00 43.73  ? 235  PRO A CD  1 
ATOM   1811 N N   . TRP A 1 236 ? 33.347  10.449  4.982   1.00 38.62  ? 236  TRP A N   1 
ATOM   1812 C CA  . TRP A 1 236 ? 34.083  11.358  5.873   1.00 44.30  ? 236  TRP A CA  1 
ATOM   1813 C C   . TRP A 1 236 ? 34.543  10.768  7.220   1.00 40.08  ? 236  TRP A C   1 
ATOM   1814 O O   . TRP A 1 236 ? 35.402  11.344  7.874   1.00 38.21  ? 236  TRP A O   1 
ATOM   1815 C CB  . TRP A 1 236 ? 33.226  12.606  6.149   1.00 37.85  ? 236  TRP A CB  1 
ATOM   1816 C CG  . TRP A 1 236 ? 31.864  12.246  6.701   1.00 41.12  ? 236  TRP A CG  1 
ATOM   1817 C CD1 . TRP A 1 236 ? 30.710  12.047  5.986   1.00 41.92  ? 236  TRP A CD1 1 
ATOM   1818 C CD2 . TRP A 1 236 ? 31.522  12.018  8.078   1.00 41.69  ? 236  TRP A CD2 1 
ATOM   1819 N NE1 . TRP A 1 236 ? 29.669  11.740  6.836   1.00 36.51  ? 236  TRP A NE1 1 
ATOM   1820 C CE2 . TRP A 1 236 ? 30.142  11.705  8.123   1.00 40.10  ? 236  TRP A CE2 1 
ATOM   1821 C CE3 . TRP A 1 236 ? 32.242  12.073  9.280   1.00 40.00  ? 236  TRP A CE3 1 
ATOM   1822 C CZ2 . TRP A 1 236 ? 29.473  11.431  9.322   1.00 42.00  ? 236  TRP A CZ2 1 
ATOM   1823 C CZ3 . TRP A 1 236 ? 31.577  11.802  10.469  1.00 42.74  ? 236  TRP A CZ3 1 
ATOM   1824 C CH2 . TRP A 1 236 ? 30.208  11.483  10.482  1.00 41.01  ? 236  TRP A CH2 1 
ATOM   1825 N N   . ALA A 1 237 ? 33.968  9.643   7.641   1.00 40.12  ? 237  ALA A N   1 
ATOM   1826 C CA  . ALA A 1 237 ? 34.151  9.164   9.018   1.00 43.47  ? 237  ALA A CA  1 
ATOM   1827 C C   . ALA A 1 237 ? 35.429  8.365   9.265   1.00 45.13  ? 237  ALA A C   1 
ATOM   1828 O O   . ALA A 1 237 ? 35.814  8.180   10.418  1.00 44.45  ? 237  ALA A O   1 
ATOM   1829 C CB  . ALA A 1 237 ? 32.928  8.366   9.496   1.00 39.23  ? 237  ALA A CB  1 
ATOM   1830 N N   . THR A 1 238 ? 36.078  7.889   8.199   1.00 41.75  ? 238  THR A N   1 
ATOM   1831 C CA  . THR A 1 238 ? 37.380  7.212   8.323   1.00 39.85  ? 238  THR A CA  1 
ATOM   1832 C C   . THR A 1 238 ? 38.345  7.582   7.202   1.00 40.30  ? 238  THR A C   1 
ATOM   1833 O O   . THR A 1 238 ? 37.931  7.984   6.113   1.00 47.66  ? 238  THR A O   1 
ATOM   1834 C CB  . THR A 1 238 ? 37.251  5.664   8.332   1.00 44.50  ? 238  THR A CB  1 
ATOM   1835 O OG1 . THR A 1 238 ? 36.577  5.226   7.143   1.00 42.02  ? 238  THR A OG1 1 
ATOM   1836 C CG2 . THR A 1 238 ? 36.487  5.174   9.554   1.00 42.89  ? 238  THR A CG2 1 
ATOM   1837 N N   . VAL A 1 239 ? 39.636  7.422   7.463   1.00 45.50  ? 239  VAL A N   1 
ATOM   1838 C CA  . VAL A 1 239 ? 40.635  7.461   6.388   1.00 44.19  ? 239  VAL A CA  1 
ATOM   1839 C C   . VAL A 1 239 ? 41.425  6.136   6.364   1.00 43.94  ? 239  VAL A C   1 
ATOM   1840 O O   . VAL A 1 239 ? 41.503  5.433   7.378   1.00 40.03  ? 239  VAL A O   1 
ATOM   1841 C CB  . VAL A 1 239 ? 41.596  8.679   6.524   1.00 40.48  ? 239  VAL A CB  1 
ATOM   1842 C CG1 . VAL A 1 239 ? 40.857  9.978   6.210   1.00 34.36  ? 239  VAL A CG1 1 
ATOM   1843 C CG2 . VAL A 1 239 ? 42.225  8.723   7.933   1.00 37.08  ? 239  VAL A CG2 1 
ATOM   1844 N N   . SER A 1 240 ? 41.988  5.785   5.208   1.00 42.44  ? 240  SER A N   1 
ATOM   1845 C CA  . SER A 1 240 ? 42.952  4.678   5.139   1.00 44.09  ? 240  SER A CA  1 
ATOM   1846 C C   . SER A 1 240 ? 44.208  5.012   5.961   1.00 40.50  ? 240  SER A C   1 
ATOM   1847 O O   . SER A 1 240 ? 44.457  6.182   6.290   1.00 42.40  ? 240  SER A O   1 
ATOM   1848 C CB  . SER A 1 240 ? 43.357  4.403   3.688   1.00 35.12  ? 240  SER A CB  1 
ATOM   1849 O OG  . SER A 1 240 ? 44.017  5.531   3.117   1.00 42.94  ? 240  SER A OG  1 
ATOM   1850 N N   . ALA A 1 241 ? 44.983  3.985   6.302   1.00 45.24  ? 241  ALA A N   1 
ATOM   1851 C CA  . ALA A 1 241 ? 46.282  4.164   6.952   1.00 45.79  ? 241  ALA A CA  1 
ATOM   1852 C C   . ALA A 1 241 ? 47.190  5.105   6.157   1.00 45.85  ? 241  ALA A C   1 
ATOM   1853 O O   . ALA A 1 241 ? 47.799  6.028   6.721   1.00 44.60  ? 241  ALA A O   1 
ATOM   1854 C CB  . ALA A 1 241 ? 46.953  2.831   7.127   1.00 41.48  ? 241  ALA A CB  1 
ATOM   1855 N N   . GLY A 1 242 ? 47.284  4.867   4.848   1.00 48.31  ? 242  GLY A N   1 
ATOM   1856 C CA  . GLY A 1 242 ? 48.108  5.699   3.981   1.00 44.47  ? 242  GLY A CA  1 
ATOM   1857 C C   . GLY A 1 242 ? 47.730  7.165   4.043   1.00 48.80  ? 242  GLY A C   1 
ATOM   1858 O O   . GLY A 1 242 ? 48.601  8.051   4.186   1.00 46.53  ? 242  GLY A O   1 
ATOM   1859 N N   . GLU A 1 243 ? 46.424  7.419   3.948   1.00 42.66  ? 243  GLU A N   1 
ATOM   1860 C CA  . GLU A 1 243 ? 45.913  8.779   3.978   1.00 41.08  ? 243  GLU A CA  1 
ATOM   1861 C C   . GLU A 1 243 ? 46.154  9.437   5.348   1.00 46.68  ? 243  GLU A C   1 
ATOM   1862 O O   . GLU A 1 243 ? 46.542  10.618  5.415   1.00 46.54  ? 243  GLU A O   1 
ATOM   1863 C CB  . GLU A 1 243 ? 44.437  8.809   3.524   1.00 44.66  ? 243  GLU A CB  1 
ATOM   1864 C CG  . GLU A 1 243 ? 43.772  10.188  3.477   1.00 43.55  ? 243  GLU A CG  1 
ATOM   1865 C CD  . GLU A 1 243 ? 44.457  11.224  2.547   1.00 53.36  ? 243  GLU A CD  1 
ATOM   1866 O OE1 . GLU A 1 243 ? 45.387  10.882  1.768   1.00 60.10  ? 243  GLU A OE1 1 
ATOM   1867 O OE2 . GLU A 1 243 ? 44.044  12.411  2.596   1.00 50.32  ? 243  GLU A OE2 1 
ATOM   1868 N N   . ALA A 1 244 ? 45.973  8.677   6.431   1.00 40.93  ? 244  ALA A N   1 
ATOM   1869 C CA  . ALA A 1 244 ? 46.265  9.214   7.766   1.00 44.12  ? 244  ALA A CA  1 
ATOM   1870 C C   . ALA A 1 244 ? 47.753  9.540   7.912   1.00 46.28  ? 244  ALA A C   1 
ATOM   1871 O O   . ALA A 1 244 ? 48.121  10.590  8.442   1.00 44.37  ? 244  ALA A O   1 
ATOM   1872 C CB  . ALA A 1 244 ? 45.824  8.256   8.843   1.00 42.23  ? 244  ALA A CB  1 
ATOM   1873 N N   . ARG A 1 245 ? 48.602  8.636   7.431   1.00 45.76  ? 245  ARG A N   1 
ATOM   1874 C CA  . ARG A 1 245 ? 50.043  8.835   7.478   1.00 46.15  ? 245  ARG A CA  1 
ATOM   1875 C C   . ARG A 1 245 ? 50.434  10.116  6.757   1.00 46.87  ? 245  ARG A C   1 
ATOM   1876 O O   . ARG A 1 245 ? 51.205  10.924  7.285   1.00 45.44  ? 245  ARG A O   1 
ATOM   1877 C CB  . ARG A 1 245 ? 50.777  7.643   6.855   1.00 53.55  ? 245  ARG A CB  1 
ATOM   1878 C CG  . ARG A 1 245 ? 52.311  7.820   6.773   1.00 45.70  ? 245  ARG A CG  1 
ATOM   1879 C CD  . ARG A 1 245 ? 53.051  6.464   6.626   1.00 58.87  ? 245  ARG A CD  1 
ATOM   1880 N NE  . ARG A 1 245 ? 53.011  5.625   7.839   1.00 52.58  ? 245  ARG A NE  1 
ATOM   1881 C CZ  . ARG A 1 245 ? 53.812  5.799   8.892   1.00 52.99  ? 245  ARG A CZ  1 
ATOM   1882 N NH1 . ARG A 1 245 ? 54.713  6.781   8.898   1.00 50.54  ? 245  ARG A NH1 1 
ATOM   1883 N NH2 . ARG A 1 245 ? 53.709  4.999   9.945   1.00 53.71  ? 245  ARG A NH2 1 
ATOM   1884 N N   . ARG A 1 246 ? 49.886  10.292  5.557   1.00 44.06  ? 246  ARG A N   1 
ATOM   1885 C CA  . ARG A 1 246 ? 50.151  11.463  4.726   1.00 44.57  ? 246  ARG A CA  1 
ATOM   1886 C C   . ARG A 1 246 ? 49.745  12.779  5.413   1.00 47.62  ? 246  ARG A C   1 
ATOM   1887 O O   . ARG A 1 246 ? 50.540  13.730  5.472   1.00 46.86  ? 246  ARG A O   1 
ATOM   1888 C CB  . ARG A 1 246 ? 49.404  11.305  3.411   1.00 48.11  ? 246  ARG A CB  1 
ATOM   1889 C CG  . ARG A 1 246 ? 49.758  12.302  2.350   1.00 47.12  ? 246  ARG A CG  1 
ATOM   1890 C CD  . ARG A 1 246 ? 48.544  12.562  1.464   1.00 46.95  ? 246  ARG A CD  1 
ATOM   1891 N NE  . ARG A 1 246 ? 48.237  13.990  1.480   1.00 52.08  ? 246  ARG A NE  1 
ATOM   1892 C CZ  . ARG A 1 246 ? 47.092  14.521  1.895   1.00 51.26  ? 246  ARG A CZ  1 
ATOM   1893 N NH1 . ARG A 1 246 ? 46.100  13.750  2.319   1.00 52.96  ? 246  ARG A NH1 1 
ATOM   1894 N NH2 . ARG A 1 246 ? 46.937  15.833  1.872   1.00 57.58  ? 246  ARG A NH2 1 
ATOM   1895 N N   . ARG A 1 247 ? 48.516  12.833  5.930   1.00 47.44  ? 247  ARG A N   1 
ATOM   1896 C CA  . ARG A 1 247 ? 48.045  14.025  6.629   1.00 40.57  ? 247  ARG A CA  1 
ATOM   1897 C C   . ARG A 1 247 ? 48.866  14.321  7.869   1.00 40.72  ? 247  ARG A C   1 
ATOM   1898 O O   . ARG A 1 247 ? 49.105  15.485  8.192   1.00 42.28  ? 247  ARG A O   1 
ATOM   1899 C CB  . ARG A 1 247 ? 46.581  13.883  7.022   1.00 40.14  ? 247  ARG A CB  1 
ATOM   1900 C CG  . ARG A 1 247 ? 45.652  13.871  5.844   1.00 41.33  ? 247  ARG A CG  1 
ATOM   1901 C CD  . ARG A 1 247 ? 44.274  13.485  6.278   1.00 41.20  ? 247  ARG A CD  1 
ATOM   1902 N NE  . ARG A 1 247 ? 43.379  13.343  5.144   1.00 43.76  ? 247  ARG A NE  1 
ATOM   1903 C CZ  . ARG A 1 247 ? 42.059  13.451  5.231   1.00 51.01  ? 247  ARG A CZ  1 
ATOM   1904 N NH1 . ARG A 1 247 ? 41.486  13.707  6.407   1.00 48.86  ? 247  ARG A NH1 1 
ATOM   1905 N NH2 . ARG A 1 247 ? 41.316  13.313  4.146   1.00 48.86  ? 247  ARG A NH2 1 
ATOM   1906 N N   . ALA A 1 248 ? 49.282  13.273  8.576   1.00 42.62  ? 248  ALA A N   1 
ATOM   1907 C CA  . ALA A 1 248 ? 50.062  13.449  9.795   1.00 40.07  ? 248  ALA A CA  1 
ATOM   1908 C C   . ALA A 1 248 ? 51.451  13.987  9.466   1.00 44.53  ? 248  ALA A C   1 
ATOM   1909 O O   . ALA A 1 248 ? 51.940  14.914  10.132  1.00 44.05  ? 248  ALA A O   1 
ATOM   1910 C CB  . ALA A 1 248 ? 50.155  12.142  10.569  1.00 41.14  ? 248  ALA A CB  1 
ATOM   1911 N N   . THR A 1 249 ? 52.086  13.418  8.438   1.00 45.93  ? 249  THR A N   1 
ATOM   1912 C CA  . THR A 1 249 ? 53.434  13.851  8.098   1.00 52.20  ? 249  THR A CA  1 
ATOM   1913 C C   . THR A 1 249 ? 53.437  15.305  7.588   1.00 50.43  ? 249  THR A C   1 
ATOM   1914 O O   . THR A 1 249 ? 54.273  16.123  8.016   1.00 52.92  ? 249  THR A O   1 
ATOM   1915 C CB  . THR A 1 249 ? 54.215  12.846  7.175   1.00 46.96  ? 249  THR A CB  1 
ATOM   1916 O OG1 . THR A 1 249 ? 55.367  13.508  6.646   1.00 56.82  ? 249  THR A OG1 1 
ATOM   1917 C CG2 . THR A 1 249 ? 53.394  12.395  6.005   1.00 58.19  ? 249  THR A CG2 1 
ATOM   1918 N N   . LEU A 1 250 ? 52.480  15.625  6.716   1.00 47.96  ? 250  LEU A N   1 
ATOM   1919 C CA  . LEU A 1 250 ? 52.283  16.996  6.247   1.00 47.55  ? 250  LEU A CA  1 
ATOM   1920 C C   . LEU A 1 250 ? 52.065  17.999  7.386   1.00 45.70  ? 250  LEU A C   1 
ATOM   1921 O O   . LEU A 1 250 ? 52.656  19.090  7.394   1.00 47.90  ? 250  LEU A O   1 
ATOM   1922 C CB  . LEU A 1 250 ? 51.110  17.072  5.261   1.00 42.99  ? 250  LEU A CB  1 
ATOM   1923 C CG  . LEU A 1 250 ? 50.808  18.497  4.754   1.00 52.10  ? 250  LEU A CG  1 
ATOM   1924 C CD1 . LEU A 1 250 ? 52.089  19.207  4.243   1.00 41.06  ? 250  LEU A CD1 1 
ATOM   1925 C CD2 . LEU A 1 250 ? 49.738  18.492  3.660   1.00 34.23  ? 250  LEU A CD2 1 
ATOM   1926 N N   . LEU A 1 251 ? 51.209  17.654  8.341   1.00 42.99  ? 251  LEU A N   1 
ATOM   1927 C CA  . LEU A 1 251 ? 50.957  18.569  9.443   1.00 43.13  ? 251  LEU A CA  1 
ATOM   1928 C C   . LEU A 1 251 ? 52.243  18.844  10.224  1.00 47.36  ? 251  LEU A C   1 
ATOM   1929 O O   . LEU A 1 251 ? 52.475  19.975  10.677  1.00 45.30  ? 251  LEU A O   1 
ATOM   1930 C CB  . LEU A 1 251 ? 49.863  18.046  10.375  1.00 43.11  ? 251  LEU A CB  1 
ATOM   1931 C CG  . LEU A 1 251 ? 49.702  19.031  11.542  1.00 43.40  ? 251  LEU A CG  1 
ATOM   1932 C CD1 . LEU A 1 251 ? 48.390  19.787  11.482  1.00 51.31  ? 251  LEU A CD1 1 
ATOM   1933 C CD2 . LEU A 1 251 ? 49.893  18.354  12.884  1.00 44.20  ? 251  LEU A CD2 1 
ATOM   1934 N N   . ALA A 1 252 ? 53.072  17.808  10.373  1.00 47.94  ? 252  ALA A N   1 
ATOM   1935 C CA  . ALA A 1 252 ? 54.363  17.931  11.062  1.00 49.28  ? 252  ALA A CA  1 
ATOM   1936 C C   . ALA A 1 252 ? 55.274  18.932  10.356  1.00 49.76  ? 252  ALA A C   1 
ATOM   1937 O O   . ALA A 1 252 ? 55.812  19.854  10.994  1.00 45.56  ? 252  ALA A O   1 
ATOM   1938 C CB  . ALA A 1 252 ? 55.045  16.581  11.155  1.00 54.01  ? 252  ALA A CB  1 
ATOM   1939 N N   . ARG A 1 253 ? 55.453  18.733  9.048   1.00 45.19  ? 253  ARG A N   1 
ATOM   1940 C CA  . ARG A 1 253 ? 56.158  19.706  8.208   1.00 49.54  ? 253  ARG A CA  1 
ATOM   1941 C C   . ARG A 1 253 ? 55.700  21.140  8.490   1.00 50.48  ? 253  ARG A C   1 
ATOM   1942 O O   . ARG A 1 253 ? 56.520  22.003  8.820   1.00 48.35  ? 253  ARG A O   1 
ATOM   1943 C CB  . ARG A 1 253 ? 55.979  19.371  6.728   1.00 42.89  ? 253  ARG A CB  1 
ATOM   1944 C CG  . ARG A 1 253 ? 57.098  18.532  6.151   1.00 55.42  ? 253  ARG A CG  1 
ATOM   1945 C CD  . ARG A 1 253 ? 56.900  18.271  4.682   1.00 62.63  ? 253  ARG A CD  1 
ATOM   1946 N NE  . ARG A 1 253 ? 56.206  16.999  4.485   1.00 84.95  ? 253  ARG A NE  1 
ATOM   1947 C CZ  . ARG A 1 253 ? 55.371  16.740  3.480   1.00 84.53  ? 253  ARG A CZ  1 
ATOM   1948 N NH1 . ARG A 1 253 ? 55.118  17.677  2.562   1.00 79.24  ? 253  ARG A NH1 1 
ATOM   1949 N NH2 . ARG A 1 253 ? 54.783  15.544  3.401   1.00 72.33  ? 253  ARG A NH2 1 
ATOM   1950 N N   . LEU A 1 254 ? 54.388  21.367  8.403   1.00 47.02  ? 254  LEU A N   1 
ATOM   1951 C CA  . LEU A 1 254 ? 53.801  22.689  8.651   1.00 50.47  ? 254  LEU A CA  1 
ATOM   1952 C C   . LEU A 1 254 ? 54.183  23.333  9.992   1.00 52.08  ? 254  LEU A C   1 
ATOM   1953 O O   . LEU A 1 254 ? 54.243  24.563  10.086  1.00 52.77  ? 254  LEU A O   1 
ATOM   1954 C CB  . LEU A 1 254 ? 52.270  22.656  8.464   1.00 42.44  ? 254  LEU A CB  1 
ATOM   1955 C CG  . LEU A 1 254 ? 51.872  22.345  7.011   1.00 50.18  ? 254  LEU A CG  1 
ATOM   1956 C CD1 . LEU A 1 254 ? 50.390  22.086  6.839   1.00 42.18  ? 254  LEU A CD1 1 
ATOM   1957 C CD2 . LEU A 1 254 ? 52.338  23.465  6.091   1.00 40.79  ? 254  LEU A CD2 1 
ATOM   1958 N N   . VAL A 1 255 ? 54.449  22.523  11.019  1.00 49.01  ? 255  VAL A N   1 
ATOM   1959 C CA  . VAL A 1 255 ? 54.785  23.081  12.341  1.00 56.45  ? 255  VAL A CA  1 
ATOM   1960 C C   . VAL A 1 255 ? 56.291  23.038  12.682  1.00 64.09  ? 255  VAL A C   1 
ATOM   1961 O O   . VAL A 1 255 ? 56.734  23.645  13.674  1.00 67.50  ? 255  VAL A O   1 
ATOM   1962 C CB  . VAL A 1 255 ? 53.925  22.464  13.491  1.00 49.96  ? 255  VAL A CB  1 
ATOM   1963 C CG1 . VAL A 1 255 ? 52.466  22.889  13.347  1.00 45.13  ? 255  VAL A CG1 1 
ATOM   1964 C CG2 . VAL A 1 255 ? 54.049  20.942  13.513  1.00 49.25  ? 255  VAL A CG2 1 
ATOM   1965 N N   . GLY A 1 256 ? 57.060  22.327  11.855  1.00 55.69  ? 256  GLY A N   1 
ATOM   1966 C CA  . GLY A 1 256 ? 58.509  22.302  11.966  1.00 61.84  ? 256  GLY A CA  1 
ATOM   1967 C C   . GLY A 1 256 ? 59.123  20.950  12.296  1.00 63.06  ? 256  GLY A C   1 
ATOM   1968 O O   . GLY A 1 256 ? 59.945  20.866  13.202  1.00 68.03  ? 256  GLY A O   1 
ATOM   1969 N N   . CYS A 1 257 ? 58.754  19.900  11.560  1.00 60.44  ? 257  CYS A N   1 
ATOM   1970 C CA  . CYS A 1 257 ? 59.121  18.538  11.946  1.00 61.84  ? 257  CYS A CA  1 
ATOM   1971 C C   . CYS A 1 257 ? 59.402  17.592  10.772  1.00 68.71  ? 257  CYS A C   1 
ATOM   1972 O O   . CYS A 1 257 ? 60.462  16.942  10.719  1.00 67.38  ? 257  CYS A O   1 
ATOM   1973 C CB  . CYS A 1 257 ? 58.044  17.940  12.880  1.00 62.38  ? 257  CYS A CB  1 
ATOM   1974 S SG  . CYS A 1 257 ? 57.762  18.858  14.466  1.00 71.36  ? 257  CYS A SG  1 
ATOM   1975 N N   . ASN A 1 265 ? 61.959  8.195   10.275  1.00 68.33  ? 265  ASN A N   1 
ATOM   1976 C CA  . ASN A 1 265 ? 61.696  7.585   11.583  1.00 74.22  ? 265  ASN A CA  1 
ATOM   1977 C C   . ASN A 1 265 ? 60.517  8.237   12.338  1.00 70.90  ? 265  ASN A C   1 
ATOM   1978 O O   . ASN A 1 265 ? 60.546  9.440   12.653  1.00 65.65  ? 265  ASN A O   1 
ATOM   1979 C CB  . ASN A 1 265 ? 62.968  7.614   12.436  1.00 80.42  ? 265  ASN A CB  1 
ATOM   1980 C CG  . ASN A 1 265 ? 62.786  6.951   13.793  1.00 82.74  ? 265  ASN A CG  1 
ATOM   1981 O OD1 . ASN A 1 265 ? 62.874  7.610   14.838  1.00 79.12  ? 265  ASN A OD1 1 
ATOM   1982 N ND2 . ASN A 1 265 ? 62.541  5.638   13.785  1.00 75.49  ? 265  ASN A ND2 1 
ATOM   1983 N N   . ASP A 1 266 ? 59.489  7.436   12.632  1.00 58.74  ? 266  ASP A N   1 
ATOM   1984 C CA  . ASP A 1 266 ? 58.287  7.933   13.302  1.00 56.17  ? 266  ASP A CA  1 
ATOM   1985 C C   . ASP A 1 266 ? 58.559  8.540   14.684  1.00 63.84  ? 266  ASP A C   1 
ATOM   1986 O O   . ASP A 1 266 ? 58.009  9.594   15.031  1.00 62.86  ? 266  ASP A O   1 
ATOM   1987 C CB  . ASP A 1 266 ? 57.231  6.827   13.427  1.00 52.53  ? 266  ASP A CB  1 
ATOM   1988 C CG  . ASP A 1 266 ? 56.523  6.529   12.104  1.00 62.56  ? 266  ASP A CG  1 
ATOM   1989 O OD1 . ASP A 1 266 ? 56.624  7.354   11.162  1.00 64.25  ? 266  ASP A OD1 1 
ATOM   1990 O OD2 . ASP A 1 266 ? 55.847  5.471   12.009  1.00 61.50  ? 266  ASP A OD2 1 
ATOM   1991 N N   . THR A 1 267 ? 59.398  7.868   15.469  1.00 65.05  ? 267  THR A N   1 
ATOM   1992 C CA  . THR A 1 267 ? 59.705  8.298   16.833  1.00 62.88  ? 267  THR A CA  1 
ATOM   1993 C C   . THR A 1 267 ? 60.154  9.762   16.908  1.00 59.13  ? 267  THR A C   1 
ATOM   1994 O O   . THR A 1 267 ? 59.604  10.550  17.679  1.00 57.43  ? 267  THR A O   1 
ATOM   1995 C CB  . THR A 1 267 ? 60.782  7.383   17.477  1.00 65.93  ? 267  THR A CB  1 
ATOM   1996 O OG1 . THR A 1 267 ? 60.300  6.033   17.517  1.00 63.84  ? 267  THR A OG1 1 
ATOM   1997 C CG2 . THR A 1 267 ? 61.124  7.838   18.893  1.00 53.64  ? 267  THR A CG2 1 
ATOM   1998 N N   . GLU A 1 268 ? 61.141  10.128  16.101  1.00 64.45  ? 268  GLU A N   1 
ATOM   1999 C CA  . GLU A 1 268 ? 61.685  11.481  16.156  1.00 71.58  ? 268  GLU A CA  1 
ATOM   2000 C C   . GLU A 1 268 ? 60.631  12.509  15.729  1.00 61.07  ? 268  GLU A C   1 
ATOM   2001 O O   . GLU A 1 268 ? 60.580  13.629  16.254  1.00 55.82  ? 268  GLU A O   1 
ATOM   2002 C CB  . GLU A 1 268 ? 62.942  11.574  15.286  1.00 74.15  ? 268  GLU A CB  1 
ATOM   2003 C CG  . GLU A 1 268 ? 64.057  10.626  15.731  1.00 84.70  ? 268  GLU A CG  1 
ATOM   2004 C CD  . GLU A 1 268 ? 65.038  10.296  14.609  1.00 106.48 ? 268  GLU A CD  1 
ATOM   2005 O OE1 . GLU A 1 268 ? 64.635  10.343  13.420  1.00 99.73  ? 268  GLU A OE1 1 
ATOM   2006 O OE2 . GLU A 1 268 ? 66.210  9.979   14.921  1.00 106.89 ? 268  GLU A OE2 1 
ATOM   2007 N N   . LEU A 1 269 ? 59.785  12.108  14.785  1.00 54.10  ? 269  LEU A N   1 
ATOM   2008 C CA  . LEU A 1 269 ? 58.710  12.956  14.301  1.00 52.92  ? 269  LEU A CA  1 
ATOM   2009 C C   . LEU A 1 269 ? 57.722  13.312  15.420  1.00 60.06  ? 269  LEU A C   1 
ATOM   2010 O O   . LEU A 1 269 ? 57.472  14.495  15.701  1.00 52.07  ? 269  LEU A O   1 
ATOM   2011 C CB  . LEU A 1 269 ? 57.969  12.245  13.174  1.00 54.61  ? 269  LEU A CB  1 
ATOM   2012 C CG  . LEU A 1 269 ? 56.990  13.145  12.425  1.00 58.02  ? 269  LEU A CG  1 
ATOM   2013 C CD1 . LEU A 1 269 ? 57.759  14.058  11.489  1.00 61.63  ? 269  LEU A CD1 1 
ATOM   2014 C CD2 . LEU A 1 269 ? 55.996  12.319  11.662  1.00 56.80  ? 269  LEU A CD2 1 
ATOM   2015 N N   . ILE A 1 270 ? 57.179  12.271  16.054  1.00 51.77  ? 270  ILE A N   1 
ATOM   2016 C CA  . ILE A 1 270 ? 56.200  12.417  17.120  1.00 50.06  ? 270  ILE A CA  1 
ATOM   2017 C C   . ILE A 1 270 ? 56.780  13.156  18.325  1.00 55.20  ? 270  ILE A C   1 
ATOM   2018 O O   . ILE A 1 270 ? 56.119  14.029  18.912  1.00 53.13  ? 270  ILE A O   1 
ATOM   2019 C CB  . ILE A 1 270 ? 55.652  11.041  17.526  1.00 50.59  ? 270  ILE A CB  1 
ATOM   2020 C CG1 . ILE A 1 270 ? 55.049  10.367  16.300  1.00 51.61  ? 270  ILE A CG1 1 
ATOM   2021 C CG2 . ILE A 1 270 ? 54.603  11.158  18.614  1.00 43.95  ? 270  ILE A CG2 1 
ATOM   2022 C CD1 . ILE A 1 270 ? 54.938  8.875   16.417  1.00 60.35  ? 270  ILE A CD1 1 
ATOM   2023 N N   . ALA A 1 271 ? 58.016  12.815  18.681  1.00 49.27  ? 271  ALA A N   1 
ATOM   2024 C CA  . ALA A 1 271 ? 58.699  13.487  19.773  1.00 50.26  ? 271  ALA A CA  1 
ATOM   2025 C C   . ALA A 1 271 ? 58.739  14.996  19.532  1.00 51.37  ? 271  ALA A C   1 
ATOM   2026 O O   . ALA A 1 271 ? 58.576  15.791  20.463  1.00 53.54  ? 271  ALA A O   1 
ATOM   2027 C CB  . ALA A 1 271 ? 60.092  12.937  19.928  1.00 47.98  ? 271  ALA A CB  1 
ATOM   2028 N N   . CYS A 1 272 ? 58.954  15.392  18.280  1.00 51.67  ? 272  CYS A N   1 
ATOM   2029 C CA  . CYS A 1 272 ? 58.964  16.813  17.937  1.00 57.10  ? 272  CYS A CA  1 
ATOM   2030 C C   . CYS A 1 272 ? 57.553  17.413  18.064  1.00 52.08  ? 272  CYS A C   1 
ATOM   2031 O O   . CYS A 1 272 ? 57.360  18.421  18.765  1.00 46.71  ? 272  CYS A O   1 
ATOM   2032 C CB  . CYS A 1 272 ? 59.557  17.028  16.538  1.00 54.95  ? 272  CYS A CB  1 
ATOM   2033 S SG  . CYS A 1 272 ? 59.293  18.686  15.838  1.00 87.66  ? 272  CYS A SG  1 
ATOM   2034 N N   . LEU A 1 273 ? 56.580  16.778  17.403  1.00 46.23  ? 273  LEU A N   1 
ATOM   2035 C CA  . LEU A 1 273 ? 55.160  17.113  17.574  1.00 48.96  ? 273  LEU A CA  1 
ATOM   2036 C C   . LEU A 1 273 ? 54.738  17.313  19.043  1.00 49.63  ? 273  LEU A C   1 
ATOM   2037 O O   . LEU A 1 273 ? 53.981  18.242  19.342  1.00 48.92  ? 273  LEU A O   1 
ATOM   2038 C CB  . LEU A 1 273 ? 54.263  16.070  16.888  1.00 41.84  ? 273  LEU A CB  1 
ATOM   2039 C CG  . LEU A 1 273 ? 54.039  16.317  15.393  1.00 47.05  ? 273  LEU A CG  1 
ATOM   2040 C CD1 . LEU A 1 273 ? 53.353  15.139  14.666  1.00 44.25  ? 273  LEU A CD1 1 
ATOM   2041 C CD2 . LEU A 1 273 ? 53.244  17.593  15.226  1.00 52.63  ? 273  LEU A CD2 1 
ATOM   2042 N N   . ARG A 1 274 ? 55.243  16.469  19.950  1.00 46.95  ? 274  ARG A N   1 
ATOM   2043 C CA  . ARG A 1 274 ? 54.931  16.591  21.379  1.00 45.95  ? 274  ARG A CA  1 
ATOM   2044 C C   . ARG A 1 274 ? 55.519  17.847  22.055  1.00 49.22  ? 274  ARG A C   1 
ATOM   2045 O O   . ARG A 1 274 ? 55.045  18.275  23.117  1.00 51.84  ? 274  ARG A O   1 
ATOM   2046 C CB  . ARG A 1 274 ? 55.335  15.325  22.140  1.00 43.26  ? 274  ARG A CB  1 
ATOM   2047 C CG  . ARG A 1 274 ? 54.469  14.106  21.800  1.00 48.13  ? 274  ARG A CG  1 
ATOM   2048 C CD  . ARG A 1 274 ? 54.651  13.001  22.835  1.00 52.87  ? 274  ARG A CD  1 
ATOM   2049 N NE  . ARG A 1 274 ? 56.067  12.685  23.000  1.00 63.59  ? 274  ARG A NE  1 
ATOM   2050 C CZ  . ARG A 1 274 ? 56.675  11.641  22.438  1.00 64.62  ? 274  ARG A CZ  1 
ATOM   2051 N NH1 . ARG A 1 274 ? 55.976  10.785  21.690  1.00 56.80  ? 274  ARG A NH1 1 
ATOM   2052 N NH2 . ARG A 1 274 ? 57.982  11.447  22.633  1.00 54.56  ? 274  ARG A NH2 1 
ATOM   2053 N N   . THR A 1 275 ? 56.535  18.441  21.434  1.00 47.28  ? 275  THR A N   1 
ATOM   2054 C CA  . THR A 1 275 ? 57.140  19.668  21.952  1.00 52.29  ? 275  THR A CA  1 
ATOM   2055 C C   . THR A 1 275 ? 56.372  20.907  21.486  1.00 54.10  ? 275  THR A C   1 
ATOM   2056 O O   . THR A 1 275 ? 56.583  22.001  22.007  1.00 57.50  ? 275  THR A O   1 
ATOM   2057 C CB  . THR A 1 275 ? 58.611  19.821  21.499  1.00 51.77  ? 275  THR A CB  1 
ATOM   2058 O OG1 . THR A 1 275 ? 58.643  20.158  20.106  1.00 55.87  ? 275  THR A OG1 1 
ATOM   2059 C CG2 . THR A 1 275 ? 59.381  18.535  21.719  1.00 41.53  ? 275  THR A CG2 1 
ATOM   2060 N N   . ARG A 1 276 ? 55.494  20.743  20.499  1.00 47.81  ? 276  ARG A N   1 
ATOM   2061 C CA  . ARG A 1 276 ? 54.738  21.875  19.966  1.00 49.80  ? 276  ARG A CA  1 
ATOM   2062 C C   . ARG A 1 276 ? 53.581  22.238  20.887  1.00 50.92  ? 276  ARG A C   1 
ATOM   2063 O O   . ARG A 1 276 ? 52.972  21.352  21.496  1.00 55.61  ? 276  ARG A O   1 
ATOM   2064 C CB  . ARG A 1 276 ? 54.210  21.543  18.571  1.00 53.47  ? 276  ARG A CB  1 
ATOM   2065 C CG  . ARG A 1 276 ? 55.307  21.260  17.563  1.00 50.99  ? 276  ARG A CG  1 
ATOM   2066 C CD  . ARG A 1 276 ? 55.972  22.550  17.112  1.00 60.92  ? 276  ARG A CD  1 
ATOM   2067 N NE  . ARG A 1 276 ? 57.196  22.264  16.368  1.00 73.21  ? 276  ARG A NE  1 
ATOM   2068 C CZ  . ARG A 1 276 ? 58.395  22.160  16.934  1.00 71.39  ? 276  ARG A CZ  1 
ATOM   2069 N NH1 . ARG A 1 276 ? 58.515  22.333  18.250  1.00 61.64  ? 276  ARG A NH1 1 
ATOM   2070 N NH2 . ARG A 1 276 ? 59.465  21.888  16.190  1.00 57.50  ? 276  ARG A NH2 1 
ATOM   2071 N N   . PRO A 1 277 ? 53.278  23.543  21.007  1.00 55.19  ? 277  PRO A N   1 
ATOM   2072 C CA  . PRO A 1 277 ? 52.101  23.934  21.800  1.00 55.14  ? 277  PRO A CA  1 
ATOM   2073 C C   . PRO A 1 277 ? 50.815  23.410  21.136  1.00 57.26  ? 277  PRO A C   1 
ATOM   2074 O O   . PRO A 1 277 ? 50.800  23.204  19.910  1.00 54.10  ? 277  PRO A O   1 
ATOM   2075 C CB  . PRO A 1 277 ? 52.127  25.475  21.757  1.00 53.16  ? 277  PRO A CB  1 
ATOM   2076 C CG  . PRO A 1 277 ? 53.472  25.852  21.216  1.00 51.36  ? 277  PRO A CG  1 
ATOM   2077 C CD  . PRO A 1 277 ? 53.931  24.698  20.364  1.00 53.04  ? 277  PRO A CD  1 
ATOM   2078 N N   . ALA A 1 278 ? 49.766  23.183  21.926  1.00 49.98  ? 278  ALA A N   1 
ATOM   2079 C CA  . ALA A 1 278 ? 48.496  22.730  21.370  1.00 50.00  ? 278  ALA A CA  1 
ATOM   2080 C C   . ALA A 1 278 ? 48.007  23.674  20.258  1.00 48.70  ? 278  ALA A C   1 
ATOM   2081 O O   . ALA A 1 278 ? 47.653  23.222  19.159  1.00 48.51  ? 278  ALA A O   1 
ATOM   2082 C CB  . ALA A 1 278 ? 47.433  22.567  22.472  1.00 38.74  ? 278  ALA A CB  1 
ATOM   2083 N N   . GLN A 1 279 ? 48.029  24.977  20.535  1.00 50.00  ? 279  GLN A N   1 
ATOM   2084 C CA  . GLN A 1 279 ? 47.479  25.963  19.609  1.00 46.93  ? 279  GLN A CA  1 
ATOM   2085 C C   . GLN A 1 279 ? 48.145  25.975  18.230  1.00 49.60  ? 279  GLN A C   1 
ATOM   2086 O O   . GLN A 1 279 ? 47.475  26.257  17.239  1.00 52.56  ? 279  GLN A O   1 
ATOM   2087 C CB  . GLN A 1 279 ? 47.481  27.362  20.225  1.00 50.41  ? 279  GLN A CB  1 
ATOM   2088 C CG  . GLN A 1 279 ? 46.541  28.342  19.524  1.00 49.78  ? 279  GLN A CG  1 
ATOM   2089 C CD  . GLN A 1 279 ? 45.098  27.870  19.532  1.00 54.56  ? 279  GLN A CD  1 
ATOM   2090 O OE1 . GLN A 1 279 ? 44.488  27.702  20.598  1.00 52.47  ? 279  GLN A OE1 1 
ATOM   2091 N NE2 . GLN A 1 279 ? 44.549  27.632  18.341  1.00 47.72  ? 279  GLN A NE2 1 
ATOM   2092 N N   . ASP A 1 280 ? 49.440  25.655  18.157  1.00 51.52  ? 280  ASP A N   1 
ATOM   2093 C CA  . ASP A 1 280 ? 50.134  25.508  16.866  1.00 52.82  ? 280  ASP A CA  1 
ATOM   2094 C C   . ASP A 1 280 ? 49.534  24.401  15.994  1.00 51.54  ? 280  ASP A C   1 
ATOM   2095 O O   . ASP A 1 280 ? 49.470  24.533  14.765  1.00 56.76  ? 280  ASP A O   1 
ATOM   2096 C CB  . ASP A 1 280 ? 51.628  25.206  17.062  1.00 57.92  ? 280  ASP A CB  1 
ATOM   2097 C CG  . ASP A 1 280 ? 52.435  26.420  17.537  1.00 78.39  ? 280  ASP A CG  1 
ATOM   2098 O OD1 . ASP A 1 280 ? 51.837  27.472  17.900  1.00 71.20  ? 280  ASP A OD1 1 
ATOM   2099 O OD2 . ASP A 1 280 ? 53.686  26.299  17.557  1.00 79.62  ? 280  ASP A OD2 1 
ATOM   2100 N N   . LEU A 1 281 ? 49.111  23.308  16.626  1.00 43.83  ? 281  LEU A N   1 
ATOM   2101 C CA  . LEU A 1 281 ? 48.545  22.179  15.887  1.00 50.21  ? 281  LEU A CA  1 
ATOM   2102 C C   . LEU A 1 281 ? 47.139  22.531  15.386  1.00 49.65  ? 281  LEU A C   1 
ATOM   2103 O O   . LEU A 1 281 ? 46.808  22.273  14.227  1.00 47.63  ? 281  LEU A O   1 
ATOM   2104 C CB  . LEU A 1 281 ? 48.524  20.891  16.736  1.00 51.22  ? 281  LEU A CB  1 
ATOM   2105 C CG  . LEU A 1 281 ? 49.822  20.405  17.410  1.00 56.22  ? 281  LEU A CG  1 
ATOM   2106 C CD1 . LEU A 1 281 ? 49.596  19.146  18.262  1.00 46.72  ? 281  LEU A CD1 1 
ATOM   2107 C CD2 . LEU A 1 281 ? 50.941  20.165  16.401  1.00 50.64  ? 281  LEU A CD2 1 
ATOM   2108 N N   . VAL A 1 282 ? 46.318  23.123  16.255  1.00 45.23  ? 282  VAL A N   1 
ATOM   2109 C CA  . VAL A 1 282 ? 45.007  23.614  15.836  1.00 49.22  ? 282  VAL A CA  1 
ATOM   2110 C C   . VAL A 1 282 ? 45.135  24.604  14.655  1.00 49.30  ? 282  VAL A C   1 
ATOM   2111 O O   . VAL A 1 282 ? 44.342  24.552  13.711  1.00 51.07  ? 282  VAL A O   1 
ATOM   2112 C CB  . VAL A 1 282 ? 44.233  24.239  17.024  1.00 45.77  ? 282  VAL A CB  1 
ATOM   2113 C CG1 . VAL A 1 282 ? 42.933  24.850  16.556  1.00 43.92  ? 282  VAL A CG1 1 
ATOM   2114 C CG2 . VAL A 1 282 ? 43.972  23.179  18.088  1.00 45.30  ? 282  VAL A CG2 1 
ATOM   2115 N N   . ASP A 1 283 ? 46.155  25.467  14.694  1.00 47.47  ? 283  ASP A N   1 
ATOM   2116 C CA  . ASP A 1 283 ? 46.377  26.477  13.644  1.00 47.45  ? 283  ASP A CA  1 
ATOM   2117 C C   . ASP A 1 283 ? 46.670  25.930  12.233  1.00 51.08  ? 283  ASP A C   1 
ATOM   2118 O O   . ASP A 1 283 ? 46.469  26.641  11.248  1.00 59.21  ? 283  ASP A O   1 
ATOM   2119 C CB  . ASP A 1 283 ? 47.460  27.497  14.056  1.00 43.14  ? 283  ASP A CB  1 
ATOM   2120 C CG  . ASP A 1 283 ? 46.996  28.446  15.185  1.00 55.48  ? 283  ASP A CG  1 
ATOM   2121 O OD1 . ASP A 1 283 ? 45.774  28.512  15.482  1.00 53.57  ? 283  ASP A OD1 1 
ATOM   2122 O OD2 . ASP A 1 283 ? 47.863  29.135  15.779  1.00 58.09  ? 283  ASP A OD2 1 
ATOM   2123 N N   . HIS A 1 284 ? 47.124  24.682  12.124  1.00 48.44  ? 284  HIS A N   1 
ATOM   2124 C CA  . HIS A 1 284 ? 47.453  24.110  10.810  1.00 50.67  ? 284  HIS A CA  1 
ATOM   2125 C C   . HIS A 1 284 ? 46.609  22.897  10.443  1.00 48.67  ? 284  HIS A C   1 
ATOM   2126 O O   . HIS A 1 284 ? 46.740  22.345  9.347   1.00 42.05  ? 284  HIS A O   1 
ATOM   2127 C CB  . HIS A 1 284 ? 48.948  23.775  10.701  1.00 49.21  ? 284  HIS A CB  1 
ATOM   2128 C CG  . HIS A 1 284 ? 49.830  24.981  10.753  1.00 54.88  ? 284  HIS A CG  1 
ATOM   2129 N ND1 . HIS A 1 284 ? 50.325  25.493  11.937  1.00 58.56  ? 284  HIS A ND1 1 
ATOM   2130 C CD2 . HIS A 1 284 ? 50.268  25.808  9.773   1.00 54.25  ? 284  HIS A CD2 1 
ATOM   2131 C CE1 . HIS A 1 284 ? 51.046  26.571  11.681  1.00 55.98  ? 284  HIS A CE1 1 
ATOM   2132 N NE2 . HIS A 1 284 ? 51.026  26.784  10.376  1.00 59.79  ? 284  HIS A NE2 1 
ATOM   2133 N N   . GLU A 1 285 ? 45.733  22.518  11.368  1.00 48.65  ? 285  GLU A N   1 
ATOM   2134 C CA  . GLU A 1 285 ? 44.816  21.390  11.214  1.00 50.20  ? 285  GLU A CA  1 
ATOM   2135 C C   . GLU A 1 285 ? 44.072  21.349  9.869   1.00 47.94  ? 285  GLU A C   1 
ATOM   2136 O O   . GLU A 1 285 ? 43.936  20.289  9.270   1.00 45.57  ? 285  GLU A O   1 
ATOM   2137 C CB  . GLU A 1 285 ? 43.792  21.438  12.344  1.00 48.58  ? 285  GLU A CB  1 
ATOM   2138 C CG  . GLU A 1 285 ? 43.409  20.098  12.900  1.00 58.48  ? 285  GLU A CG  1 
ATOM   2139 C CD  . GLU A 1 285 ? 42.142  20.163  13.745  1.00 56.79  ? 285  GLU A CD  1 
ATOM   2140 O OE1 . GLU A 1 285 ? 41.973  21.142  14.505  1.00 56.53  ? 285  GLU A OE1 1 
ATOM   2141 O OE2 . GLU A 1 285 ? 41.308  19.237  13.631  1.00 60.39  ? 285  GLU A OE2 1 
ATOM   2142 N N   . TRP A 1 286 ? 43.601  22.497  9.385   1.00 50.30  ? 286  TRP A N   1 
ATOM   2143 C CA  . TRP A 1 286 ? 42.773  22.513  8.171   1.00 49.10  ? 286  TRP A CA  1 
ATOM   2144 C C   . TRP A 1 286 ? 43.548  22.551  6.851   1.00 53.31  ? 286  TRP A C   1 
ATOM   2145 O O   . TRP A 1 286 ? 42.959  22.492  5.765   1.00 61.35  ? 286  TRP A O   1 
ATOM   2146 C CB  . TRP A 1 286 ? 41.752  23.649  8.238   1.00 47.95  ? 286  TRP A CB  1 
ATOM   2147 C CG  . TRP A 1 286 ? 40.707  23.391  9.293   1.00 62.31  ? 286  TRP A CG  1 
ATOM   2148 C CD1 . TRP A 1 286 ? 40.652  23.931  10.554  1.00 62.88  ? 286  TRP A CD1 1 
ATOM   2149 C CD2 . TRP A 1 286 ? 39.593  22.488  9.195   1.00 64.87  ? 286  TRP A CD2 1 
ATOM   2150 N NE1 . TRP A 1 286 ? 39.565  23.433  11.236  1.00 61.39  ? 286  TRP A NE1 1 
ATOM   2151 C CE2 . TRP A 1 286 ? 38.897  22.549  10.427  1.00 64.63  ? 286  TRP A CE2 1 
ATOM   2152 C CE3 . TRP A 1 286 ? 39.112  21.639  8.182   1.00 55.66  ? 286  TRP A CE3 1 
ATOM   2153 C CZ2 . TRP A 1 286 ? 37.745  21.793  10.672  1.00 61.75  ? 286  TRP A CZ2 1 
ATOM   2154 C CZ3 . TRP A 1 286 ? 37.967  20.897  8.420   1.00 55.42  ? 286  TRP A CZ3 1 
ATOM   2155 C CH2 . TRP A 1 286 ? 37.295  20.978  9.660   1.00 61.74  ? 286  TRP A CH2 1 
ATOM   2156 N N   . HIS A 1 287 ? 44.869  22.613  6.946   1.00 52.17  ? 287  HIS A N   1 
ATOM   2157 C CA  . HIS A 1 287 ? 45.708  22.732  5.765   1.00 47.18  ? 287  HIS A CA  1 
ATOM   2158 C C   . HIS A 1 287 ? 46.173  21.399  5.191   1.00 47.78  ? 287  HIS A C   1 
ATOM   2159 O O   . HIS A 1 287 ? 46.966  21.388  4.253   1.00 53.23  ? 287  HIS A O   1 
ATOM   2160 C CB  . HIS A 1 287 ? 46.924  23.601  6.084   1.00 50.70  ? 287  HIS A CB  1 
ATOM   2161 C CG  . HIS A 1 287 ? 46.575  24.999  6.485   1.00 54.84  ? 287  HIS A CG  1 
ATOM   2162 N ND1 . HIS A 1 287 ? 47.117  25.615  7.594   1.00 61.60  ? 287  HIS A ND1 1 
ATOM   2163 C CD2 . HIS A 1 287 ? 45.745  25.907  5.920   1.00 62.59  ? 287  HIS A CD2 1 
ATOM   2164 C CE1 . HIS A 1 287 ? 46.630  26.837  7.698   1.00 60.11  ? 287  HIS A CE1 1 
ATOM   2165 N NE2 . HIS A 1 287 ? 45.794  27.039  6.694   1.00 66.34  ? 287  HIS A NE2 1 
ATOM   2166 N N   . VAL A 1 288 ? 45.681  20.281  5.721   1.00 48.38  ? 288  VAL A N   1 
ATOM   2167 C CA  . VAL A 1 288 ? 46.192  18.976  5.270   1.00 46.35  ? 288  VAL A CA  1 
ATOM   2168 C C   . VAL A 1 288 ? 45.223  18.186  4.373   1.00 47.39  ? 288  VAL A C   1 
ATOM   2169 O O   . VAL A 1 288 ? 45.552  17.074  3.924   1.00 43.04  ? 288  VAL A O   1 
ATOM   2170 C CB  . VAL A 1 288 ? 46.709  18.090  6.461   1.00 42.20  ? 288  VAL A CB  1 
ATOM   2171 C CG1 . VAL A 1 288 ? 47.731  18.863  7.293   1.00 39.67  ? 288  VAL A CG1 1 
ATOM   2172 C CG2 . VAL A 1 288 ? 45.535  17.624  7.349   1.00 42.43  ? 288  VAL A CG2 1 
ATOM   2173 N N   . LEU A 1 289 ? 44.038  18.749  4.108   1.00 47.94  ? 289  LEU A N   1 
ATOM   2174 C CA  . LEU A 1 289 ? 43.055  18.068  3.246   1.00 46.20  ? 289  LEU A CA  1 
ATOM   2175 C C   . LEU A 1 289 ? 43.500  18.094  1.781   1.00 46.39  ? 289  LEU A C   1 
ATOM   2176 O O   . LEU A 1 289 ? 44.027  19.110  1.308   1.00 50.05  ? 289  LEU A O   1 
ATOM   2177 C CB  . LEU A 1 289 ? 41.659  18.690  3.399   1.00 48.74  ? 289  LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 289 ? 40.934  18.496  4.735   1.00 51.94  ? 289  LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 289 ? 39.743  19.451  4.824   1.00 47.97  ? 289  LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 289 ? 40.485  17.040  4.916   1.00 45.09  ? 289  LEU A CD2 1 
ATOM   2181 N N   . PRO A 1 290 ? 43.272  16.983  1.055   1.00 50.40  ? 290  PRO A N   1 
ATOM   2182 C CA  . PRO A 1 290 ? 43.739  16.770  -0.329  1.00 48.75  ? 290  PRO A CA  1 
ATOM   2183 C C   . PRO A 1 290 ? 43.066  17.688  -1.354  1.00 55.50  ? 290  PRO A C   1 
ATOM   2184 O O   . PRO A 1 290 ? 43.708  18.092  -2.324  1.00 56.80  ? 290  PRO A O   1 
ATOM   2185 C CB  . PRO A 1 290 ? 43.328  15.316  -0.632  1.00 46.64  ? 290  PRO A CB  1 
ATOM   2186 C CG  . PRO A 1 290 ? 42.777  14.753  0.638   1.00 51.57  ? 290  PRO A CG  1 
ATOM   2187 C CD  . PRO A 1 290 ? 42.394  15.891  1.513   1.00 51.71  ? 290  PRO A CD  1 
ATOM   2188 N N   . GLN A 1 291 ? 41.780  17.980  -1.151  1.00 58.25  ? 291  GLN A N   1 
ATOM   2189 C CA  . GLN A 1 291 ? 41.023  18.830  -2.061  1.00 53.15  ? 291  GLN A CA  1 
ATOM   2190 C C   . GLN A 1 291 ? 40.262  19.881  -1.272  1.00 55.38  ? 291  GLN A C   1 
ATOM   2191 O O   . GLN A 1 291 ? 40.082  19.752  -0.057  1.00 65.32  ? 291  GLN A O   1 
ATOM   2192 C CB  . GLN A 1 291 ? 40.031  18.002  -2.896  1.00 47.59  ? 291  GLN A CB  1 
ATOM   2193 C CG  . GLN A 1 291 ? 40.639  16.781  -3.599  1.00 48.10  ? 291  GLN A CG  1 
ATOM   2194 C CD  . GLN A 1 291 ? 40.463  15.490  -2.800  1.00 57.99  ? 291  GLN A CD  1 
ATOM   2195 O OE1 . GLN A 1 291 ? 39.711  15.455  -1.817  1.00 64.63  ? 291  GLN A OE1 1 
ATOM   2196 N NE2 . GLN A 1 291 ? 41.154  14.421  -3.220  1.00 56.60  ? 291  GLN A NE2 1 
ATOM   2197 N N   . GLU A 1 292 ? 39.831  20.928  -1.969  1.00 54.03  ? 292  GLU A N   1 
ATOM   2198 C CA  . GLU A 1 292 ? 38.876  21.894  -1.433  1.00 53.28  ? 292  GLU A CA  1 
ATOM   2199 C C   . GLU A 1 292 ? 37.547  21.153  -1.216  1.00 47.99  ? 292  GLU A C   1 
ATOM   2200 O O   . GLU A 1 292 ? 37.067  20.446  -2.111  1.00 45.15  ? 292  GLU A O   1 
ATOM   2201 C CB  . GLU A 1 292 ? 38.692  23.030  -2.436  1.00 53.96  ? 292  GLU A CB  1 
ATOM   2202 C CG  . GLU A 1 292 ? 37.851  24.199  -1.943  1.00 62.46  ? 292  GLU A CG  1 
ATOM   2203 C CD  . GLU A 1 292 ? 37.395  25.104  -3.084  1.00 74.33  ? 292  GLU A CD  1 
ATOM   2204 O OE1 . GLU A 1 292 ? 37.747  24.814  -4.256  1.00 76.53  ? 292  GLU A OE1 1 
ATOM   2205 O OE2 . GLU A 1 292 ? 36.675  26.095  -2.808  1.00 74.61  ? 292  GLU A OE2 1 
ATOM   2206 N N   . SER A 1 293 ? 36.952  21.292  -0.038  1.00 43.09  ? 293  SER A N   1 
ATOM   2207 C CA  . SER A 1 293 ? 35.830  20.415  0.302   1.00 49.50  ? 293  SER A CA  1 
ATOM   2208 C C   . SER A 1 293 ? 34.935  20.938  1.423   1.00 38.03  ? 293  SER A C   1 
ATOM   2209 O O   . SER A 1 293 ? 35.305  21.850  2.158   1.00 32.76  ? 293  SER A O   1 
ATOM   2210 C CB  . SER A 1 293 ? 36.376  19.032  0.700   1.00 43.16  ? 293  SER A CB  1 
ATOM   2211 O OG  . SER A 1 293 ? 37.285  19.145  1.777   1.00 49.29  ? 293  SER A OG  1 
ATOM   2212 N N   . ILE A 1 294 ? 33.735  20.375  1.521   1.00 42.12  ? 294  ILE A N   1 
ATOM   2213 C CA  . ILE A 1 294 ? 32.938  20.489  2.746   1.00 40.72  ? 294  ILE A CA  1 
ATOM   2214 C C   . ILE A 1 294 ? 32.616  19.083  3.241   1.00 36.62  ? 294  ILE A C   1 
ATOM   2215 O O   . ILE A 1 294 ? 32.704  18.127  2.465   1.00 43.58  ? 294  ILE A O   1 
ATOM   2216 C CB  . ILE A 1 294 ? 31.656  21.333  2.563   1.00 46.69  ? 294  ILE A CB  1 
ATOM   2217 C CG1 . ILE A 1 294 ? 30.798  20.793  1.413   1.00 41.69  ? 294  ILE A CG1 1 
ATOM   2218 C CG2 . ILE A 1 294 ? 32.013  22.805  2.353   1.00 40.54  ? 294  ILE A CG2 1 
ATOM   2219 C CD1 . ILE A 1 294 ? 29.369  21.313  1.484   1.00 42.91  ? 294  ILE A CD1 1 
ATOM   2220 N N   . PHE A 1 295 ? 32.281  18.950  4.523   1.00 36.50  ? 295  PHE A N   1 
ATOM   2221 C CA  . PHE A 1 295 ? 31.984  17.637  5.095   1.00 39.49  ? 295  PHE A CA  1 
ATOM   2222 C C   . PHE A 1 295 ? 33.175  16.655  4.935   1.00 36.78  ? 295  PHE A C   1 
ATOM   2223 O O   . PHE A 1 295 ? 32.998  15.454  4.701   1.00 37.51  ? 295  PHE A O   1 
ATOM   2224 C CB  . PHE A 1 295 ? 30.692  17.062  4.483   1.00 41.99  ? 295  PHE A CB  1 
ATOM   2225 C CG  . PHE A 1 295 ? 29.746  16.473  5.496   1.00 47.93  ? 295  PHE A CG  1 
ATOM   2226 C CD1 . PHE A 1 295 ? 30.208  15.591  6.474   1.00 42.34  ? 295  PHE A CD1 1 
ATOM   2227 C CD2 . PHE A 1 295 ? 28.390  16.812  5.482   1.00 42.48  ? 295  PHE A CD2 1 
ATOM   2228 C CE1 . PHE A 1 295 ? 29.332  15.046  7.417   1.00 39.63  ? 295  PHE A CE1 1 
ATOM   2229 C CE2 . PHE A 1 295 ? 27.512  16.269  6.424   1.00 43.96  ? 295  PHE A CE2 1 
ATOM   2230 C CZ  . PHE A 1 295 ? 27.984  15.389  7.393   1.00 43.17  ? 295  PHE A CZ  1 
ATOM   2231 N N   . ARG A 1 296 ? 34.385  17.198  5.034   1.00 36.61  ? 296  ARG A N   1 
ATOM   2232 C CA  . ARG A 1 296 ? 35.601  16.406  5.211   1.00 43.15  ? 296  ARG A CA  1 
ATOM   2233 C C   . ARG A 1 296 ? 36.399  17.019  6.363   1.00 44.54  ? 296  ARG A C   1 
ATOM   2234 O O   . ARG A 1 296 ? 36.476  18.253  6.506   1.00 41.93  ? 296  ARG A O   1 
ATOM   2235 C CB  . ARG A 1 296 ? 36.456  16.364  3.937   1.00 36.99  ? 296  ARG A CB  1 
ATOM   2236 C CG  . ARG A 1 296 ? 35.795  15.715  2.753   1.00 29.11  ? 296  ARG A CG  1 
ATOM   2237 C CD  . ARG A 1 296 ? 35.525  14.233  2.969   1.00 37.96  ? 296  ARG A CD  1 
ATOM   2238 N NE  . ARG A 1 296 ? 34.979  13.615  1.754   1.00 43.71  ? 296  ARG A NE  1 
ATOM   2239 C CZ  . ARG A 1 296 ? 33.682  13.540  1.472   1.00 40.69  ? 296  ARG A CZ  1 
ATOM   2240 N NH1 . ARG A 1 296 ? 32.783  14.036  2.313   1.00 39.54  ? 296  ARG A NH1 1 
ATOM   2241 N NH2 . ARG A 1 296 ? 33.285  12.962  0.349   1.00 42.71  ? 296  ARG A NH2 1 
ATOM   2242 N N   . PHE A 1 297 ? 36.991  16.161  7.186   1.00 40.38  ? 297  PHE A N   1 
ATOM   2243 C CA  . PHE A 1 297 ? 37.677  16.631  8.384   1.00 43.13  ? 297  PHE A CA  1 
ATOM   2244 C C   . PHE A 1 297 ? 39.054  15.988  8.429   1.00 42.03  ? 297  PHE A C   1 
ATOM   2245 O O   . PHE A 1 297 ? 39.218  14.845  7.994   1.00 38.40  ? 297  PHE A O   1 
ATOM   2246 C CB  . PHE A 1 297 ? 36.824  16.306  9.618   1.00 43.03  ? 297  PHE A CB  1 
ATOM   2247 C CG  . PHE A 1 297 ? 35.354  16.531  9.390   1.00 40.63  ? 297  PHE A CG  1 
ATOM   2248 C CD1 . PHE A 1 297 ? 34.827  17.832  9.343   1.00 37.75  ? 297  PHE A CD1 1 
ATOM   2249 C CD2 . PHE A 1 297 ? 34.501  15.455  9.161   1.00 35.72  ? 297  PHE A CD2 1 
ATOM   2250 C CE1 . PHE A 1 297 ? 33.466  18.050  9.099   1.00 37.65  ? 297  PHE A CE1 1 
ATOM   2251 C CE2 . PHE A 1 297 ? 33.126  15.670  8.915   1.00 39.24  ? 297  PHE A CE2 1 
ATOM   2252 C CZ  . PHE A 1 297 ? 32.612  16.966  8.891   1.00 37.65  ? 297  PHE A CZ  1 
ATOM   2253 N N   . SER A 1 298 ? 40.041  16.726  8.927   1.00 42.58  ? 298  SER A N   1 
ATOM   2254 C CA  . SER A 1 298 ? 41.435  16.330  8.745   1.00 42.78  ? 298  SER A CA  1 
ATOM   2255 C C   . SER A 1 298 ? 41.822  15.062  9.507   1.00 43.88  ? 298  SER A C   1 
ATOM   2256 O O   . SER A 1 298 ? 42.497  14.174  8.969   1.00 42.43  ? 298  SER A O   1 
ATOM   2257 C CB  . SER A 1 298 ? 42.355  17.477  9.138   1.00 39.03  ? 298  SER A CB  1 
ATOM   2258 O OG  . SER A 1 298 ? 42.298  18.506  8.175   1.00 51.78  ? 298  SER A OG  1 
ATOM   2259 N N   . PHE A 1 299 ? 41.370  14.968  10.752  1.00 37.48  ? 299  PHE A N   1 
ATOM   2260 C CA  . PHE A 1 299 ? 41.818  13.898  11.625  1.00 39.90  ? 299  PHE A CA  1 
ATOM   2261 C C   . PHE A 1 299 ? 40.649  13.096  12.172  1.00 41.31  ? 299  PHE A C   1 
ATOM   2262 O O   . PHE A 1 299 ? 39.940  13.530  13.097  1.00 41.22  ? 299  PHE A O   1 
ATOM   2263 C CB  . PHE A 1 299 ? 42.755  14.463  12.701  1.00 34.49  ? 299  PHE A CB  1 
ATOM   2264 C CG  . PHE A 1 299 ? 44.032  14.995  12.119  1.00 37.37  ? 299  PHE A CG  1 
ATOM   2265 C CD1 . PHE A 1 299 ? 45.056  14.122  11.761  1.00 42.44  ? 299  PHE A CD1 1 
ATOM   2266 C CD2 . PHE A 1 299 ? 44.181  16.353  11.830  1.00 39.95  ? 299  PHE A CD2 1 
ATOM   2267 C CE1 . PHE A 1 299 ? 46.245  14.598  11.180  1.00 43.96  ? 299  PHE A CE1 1 
ATOM   2268 C CE2 . PHE A 1 299 ? 45.360  16.841  11.242  1.00 44.13  ? 299  PHE A CE2 1 
ATOM   2269 C CZ  . PHE A 1 299 ? 46.397  15.963  10.923  1.00 42.20  ? 299  PHE A CZ  1 
ATOM   2270 N N   . VAL A 1 300 ? 40.436  11.935  11.551  1.00 33.26  ? 300  VAL A N   1 
ATOM   2271 C CA  . VAL A 1 300 ? 39.271  11.104  11.829  1.00 35.02  ? 300  VAL A CA  1 
ATOM   2272 C C   . VAL A 1 300 ? 39.710  9.660   12.169  1.00 37.53  ? 300  VAL A C   1 
ATOM   2273 O O   . VAL A 1 300 ? 40.907  9.363   12.115  1.00 40.35  ? 300  VAL A O   1 
ATOM   2274 C CB  . VAL A 1 300 ? 38.215  11.214  10.674  1.00 34.73  ? 300  VAL A CB  1 
ATOM   2275 C CG1 . VAL A 1 300 ? 37.871  12.695  10.398  1.00 34.07  ? 300  VAL A CG1 1 
ATOM   2276 C CG2 . VAL A 1 300 ? 38.691  10.515  9.395   1.00 33.96  ? 300  VAL A CG2 1 
ATOM   2277 N N   . PRO A 1 301 ? 38.768  8.775   12.573  1.00 37.61  ? 301  PRO A N   1 
ATOM   2278 C CA  . PRO A 1 301 ? 39.209  7.389   12.814  1.00 37.87  ? 301  PRO A CA  1 
ATOM   2279 C C   . PRO A 1 301 ? 39.913  6.749   11.603  1.00 40.92  ? 301  PRO A C   1 
ATOM   2280 O O   . PRO A 1 301 ? 39.480  6.918   10.452  1.00 39.17  ? 301  PRO A O   1 
ATOM   2281 C CB  . PRO A 1 301 ? 37.892  6.652   13.124  1.00 37.63  ? 301  PRO A CB  1 
ATOM   2282 C CG  . PRO A 1 301 ? 37.040  7.703   13.772  1.00 39.10  ? 301  PRO A CG  1 
ATOM   2283 C CD  . PRO A 1 301 ? 37.373  8.991   13.019  1.00 37.90  ? 301  PRO A CD  1 
ATOM   2284 N N   . VAL A 1 302 ? 40.996  6.025   11.861  1.00 42.94  ? 302  VAL A N   1 
ATOM   2285 C CA  . VAL A 1 302 ? 41.741  5.370   10.785  1.00 41.33  ? 302  VAL A CA  1 
ATOM   2286 C C   . VAL A 1 302 ? 41.485  3.846   10.760  1.00 50.66  ? 302  VAL A C   1 
ATOM   2287 O O   . VAL A 1 302 ? 41.268  3.223   11.820  1.00 43.33  ? 302  VAL A O   1 
ATOM   2288 C CB  . VAL A 1 302 ? 43.259  5.716   10.869  1.00 39.08  ? 302  VAL A CB  1 
ATOM   2289 C CG1 . VAL A 1 302 ? 43.794  5.461   12.265  1.00 41.54  ? 302  VAL A CG1 1 
ATOM   2290 C CG2 . VAL A 1 302 ? 44.078  4.961   9.819   1.00 44.97  ? 302  VAL A CG2 1 
ATOM   2291 N N   . VAL A 1 303 ? 41.476  3.260   9.555   1.00 47.57  ? 303  VAL A N   1 
ATOM   2292 C CA  . VAL A 1 303 ? 41.408  1.803   9.399   1.00 47.10  ? 303  VAL A CA  1 
ATOM   2293 C C   . VAL A 1 303 ? 42.781  1.190   9.732   1.00 49.76  ? 303  VAL A C   1 
ATOM   2294 O O   . VAL A 1 303 ? 43.667  1.065   8.863   1.00 47.23  ? 303  VAL A O   1 
ATOM   2295 C CB  . VAL A 1 303 ? 40.936  1.408   7.979   1.00 43.04  ? 303  VAL A CB  1 
ATOM   2296 C CG1 . VAL A 1 303 ? 40.884  -0.095  7.830   1.00 44.99  ? 303  VAL A CG1 1 
ATOM   2297 C CG2 . VAL A 1 303 ? 39.563  2.009   7.693   1.00 47.90  ? 303  VAL A CG2 1 
ATOM   2298 N N   . ASP A 1 304 ? 42.951  0.814   10.998  1.00 49.13  ? 304  ASP A N   1 
ATOM   2299 C CA  . ASP A 1 304 ? 44.272  0.440   11.512  1.00 54.20  ? 304  ASP A CA  1 
ATOM   2300 C C   . ASP A 1 304 ? 44.552  -1.064  11.529  1.00 55.40  ? 304  ASP A C   1 
ATOM   2301 O O   . ASP A 1 304 ? 45.690  -1.469  11.748  1.00 60.95  ? 304  ASP A O   1 
ATOM   2302 C CB  . ASP A 1 304 ? 44.526  1.063   12.906  1.00 51.52  ? 304  ASP A CB  1 
ATOM   2303 C CG  . ASP A 1 304 ? 43.414  0.741   13.937  1.00 57.14  ? 304  ASP A CG  1 
ATOM   2304 O OD1 . ASP A 1 304 ? 42.317  0.241   13.566  1.00 46.36  ? 304  ASP A OD1 1 
ATOM   2305 O OD2 . ASP A 1 304 ? 43.640  1.011   15.143  1.00 59.51  ? 304  ASP A OD2 1 
ATOM   2306 N N   . GLY A 1 305 ? 43.530  -1.883  11.274  1.00 56.90  ? 305  GLY A N   1 
ATOM   2307 C CA  . GLY A 1 305 ? 43.642  -3.324  11.449  1.00 53.56  ? 305  GLY A CA  1 
ATOM   2308 C C   . GLY A 1 305 ? 43.678  -3.689  12.930  1.00 60.02  ? 305  GLY A C   1 
ATOM   2309 O O   . GLY A 1 305 ? 44.140  -4.767  13.295  1.00 69.57  ? 305  GLY A O   1 
ATOM   2310 N N   . ASP A 1 306 ? 43.201  -2.780  13.783  1.00 61.34  ? 306  ASP A N   1 
ATOM   2311 C CA  . ASP A 1 306 ? 43.153  -2.993  15.235  1.00 59.30  ? 306  ASP A CA  1 
ATOM   2312 C C   . ASP A 1 306 ? 41.753  -2.680  15.768  1.00 60.34  ? 306  ASP A C   1 
ATOM   2313 O O   . ASP A 1 306 ? 40.880  -3.565  15.799  1.00 61.57  ? 306  ASP A O   1 
ATOM   2314 C CB  . ASP A 1 306 ? 44.187  -2.120  15.953  1.00 56.25  ? 306  ASP A CB  1 
ATOM   2315 C CG  . ASP A 1 306 ? 44.418  -2.551  17.406  1.00 66.52  ? 306  ASP A CG  1 
ATOM   2316 O OD1 . ASP A 1 306 ? 43.716  -3.473  17.896  1.00 58.92  ? 306  ASP A OD1 1 
ATOM   2317 O OD2 . ASP A 1 306 ? 45.305  -1.959  18.060  1.00 66.28  ? 306  ASP A OD2 1 
ATOM   2318 N N   . PHE A 1 307 ? 41.550  -1.430  16.195  1.00 51.96  ? 307  PHE A N   1 
ATOM   2319 C CA  . PHE A 1 307 ? 40.209  -0.950  16.524  1.00 48.05  ? 307  PHE A CA  1 
ATOM   2320 C C   . PHE A 1 307 ? 39.253  -1.304  15.380  1.00 46.86  ? 307  PHE A C   1 
ATOM   2321 O O   . PHE A 1 307 ? 38.190  -1.875  15.600  1.00 48.44  ? 307  PHE A O   1 
ATOM   2322 C CB  . PHE A 1 307 ? 40.205  0.563   16.764  1.00 44.20  ? 307  PHE A CB  1 
ATOM   2323 C CG  . PHE A 1 307 ? 39.046  1.032   17.599  1.00 39.37  ? 307  PHE A CG  1 
ATOM   2324 C CD1 . PHE A 1 307 ? 37.752  1.056   17.077  1.00 34.97  ? 307  PHE A CD1 1 
ATOM   2325 C CD2 . PHE A 1 307 ? 39.243  1.428   18.921  1.00 41.59  ? 307  PHE A CD2 1 
ATOM   2326 C CE1 . PHE A 1 307 ? 36.678  1.466   17.854  1.00 36.75  ? 307  PHE A CE1 1 
ATOM   2327 C CE2 . PHE A 1 307 ? 38.166  1.844   19.709  1.00 40.72  ? 307  PHE A CE2 1 
ATOM   2328 C CZ  . PHE A 1 307 ? 36.884  1.864   19.173  1.00 34.49  ? 307  PHE A CZ  1 
ATOM   2329 N N   . LEU A 1 308 ? 39.648  -0.958  14.159  1.00 49.87  ? 308  LEU A N   1 
ATOM   2330 C CA  . LEU A 1 308 ? 38.911  -1.359  12.971  1.00 49.47  ? 308  LEU A CA  1 
ATOM   2331 C C   . LEU A 1 308 ? 39.711  -2.407  12.185  1.00 53.78  ? 308  LEU A C   1 
ATOM   2332 O O   . LEU A 1 308 ? 40.768  -2.111  11.629  1.00 55.00  ? 308  LEU A O   1 
ATOM   2333 C CB  . LEU A 1 308 ? 38.604  -0.143  12.098  1.00 46.61  ? 308  LEU A CB  1 
ATOM   2334 C CG  . LEU A 1 308 ? 37.604  0.842   12.696  1.00 47.06  ? 308  LEU A CG  1 
ATOM   2335 C CD1 . LEU A 1 308 ? 37.406  2.021   11.754  1.00 48.72  ? 308  LEU A CD1 1 
ATOM   2336 C CD2 . LEU A 1 308 ? 36.280  0.125   12.973  1.00 45.02  ? 308  LEU A CD2 1 
ATOM   2337 N N   . SER A 1 309 ? 39.204  -3.634  12.150  1.00 55.64  ? 309  SER A N   1 
ATOM   2338 C CA  . SER A 1 309 ? 39.929  -4.744  11.539  1.00 57.72  ? 309  SER A CA  1 
ATOM   2339 C C   . SER A 1 309 ? 39.936  -4.651  10.008  1.00 55.73  ? 309  SER A C   1 
ATOM   2340 O O   . SER A 1 309 ? 40.868  -5.123  9.350   1.00 57.71  ? 309  SER A O   1 
ATOM   2341 C CB  . SER A 1 309 ? 39.361  -6.085  12.021  1.00 50.30  ? 309  SER A CB  1 
ATOM   2342 O OG  . SER A 1 309 ? 37.974  -6.189  11.739  1.00 58.14  ? 309  SER A OG  1 
ATOM   2343 N N   . ASP A 1 310 ? 38.898  -4.030  9.457   1.00 56.63  ? 310  ASP A N   1 
ATOM   2344 C CA  . ASP A 1 310 ? 38.787  -3.782  8.024   1.00 57.36  ? 310  ASP A CA  1 
ATOM   2345 C C   . ASP A 1 310 ? 38.021  -2.464  7.851   1.00 51.15  ? 310  ASP A C   1 
ATOM   2346 O O   . ASP A 1 310 ? 37.694  -1.821  8.843   1.00 51.04  ? 310  ASP A O   1 
ATOM   2347 C CB  . ASP A 1 310 ? 38.035  -4.936  7.349   1.00 55.86  ? 310  ASP A CB  1 
ATOM   2348 C CG  . ASP A 1 310 ? 38.378  -5.078  5.863   1.00 68.51  ? 310  ASP A CG  1 
ATOM   2349 O OD1 . ASP A 1 310 ? 38.904  -4.108  5.253   1.00 62.74  ? 310  ASP A OD1 1 
ATOM   2350 O OD2 . ASP A 1 310 ? 38.106  -6.165  5.303   1.00 74.20  ? 310  ASP A OD2 1 
ATOM   2351 N N   . THR A 1 311 ? 37.728  -2.053  6.618   1.00 49.55  ? 311  THR A N   1 
ATOM   2352 C CA  . THR A 1 311 ? 36.889  -0.869  6.415   1.00 47.88  ? 311  THR A CA  1 
ATOM   2353 C C   . THR A 1 311 ? 35.498  -1.103  6.996   1.00 52.81  ? 311  THR A C   1 
ATOM   2354 O O   . THR A 1 311 ? 35.026  -2.249  7.028   1.00 55.78  ? 311  THR A O   1 
ATOM   2355 C CB  . THR A 1 311 ? 36.764  -0.474  4.917   1.00 50.48  ? 311  THR A CB  1 
ATOM   2356 O OG1 . THR A 1 311 ? 35.962  -1.436  4.209   1.00 53.20  ? 311  THR A OG1 1 
ATOM   2357 C CG2 . THR A 1 311 ? 38.139  -0.379  4.291   1.00 39.59  ? 311  THR A CG2 1 
ATOM   2358 N N   . PRO A 1 312 ? 34.844  -0.026  7.476   1.00 51.80  ? 312  PRO A N   1 
ATOM   2359 C CA  . PRO A 1 312 ? 33.462  -0.149  7.965   1.00 51.43  ? 312  PRO A CA  1 
ATOM   2360 C C   . PRO A 1 312 ? 32.505  -0.730  6.921   1.00 46.86  ? 312  PRO A C   1 
ATOM   2361 O O   . PRO A 1 312 ? 31.599  -1.488  7.291   1.00 55.17  ? 312  PRO A O   1 
ATOM   2362 C CB  . PRO A 1 312 ? 33.087  1.297   8.330   1.00 41.03  ? 312  PRO A CB  1 
ATOM   2363 C CG  . PRO A 1 312 ? 34.390  1.885   8.761   1.00 46.07  ? 312  PRO A CG  1 
ATOM   2364 C CD  . PRO A 1 312 ? 35.412  1.300   7.786   1.00 47.88  ? 312  PRO A CD  1 
ATOM   2365 N N   . GLU A 1 313 ? 32.704  -0.381  5.652   1.00 53.48  ? 313  GLU A N   1 
ATOM   2366 C CA  . GLU A 1 313 ? 31.930  -0.955  4.544   1.00 59.85  ? 313  GLU A CA  1 
ATOM   2367 C C   . GLU A 1 313 ? 32.024  -2.487  4.571   1.00 60.26  ? 313  GLU A C   1 
ATOM   2368 O O   . GLU A 1 313 ? 31.006  -3.185  4.535   1.00 58.70  ? 313  GLU A O   1 
ATOM   2369 C CB  . GLU A 1 313 ? 32.437  -0.401  3.207   1.00 64.44  ? 313  GLU A CB  1 
ATOM   2370 C CG  . GLU A 1 313 ? 31.621  -0.801  1.971   1.00 80.77  ? 313  GLU A CG  1 
ATOM   2371 C CD  . GLU A 1 313 ? 32.492  -0.936  0.712   1.00 96.40  ? 313  GLU A CD  1 
ATOM   2372 O OE1 . GLU A 1 313 ? 33.630  -1.461  0.818   1.00 90.99  ? 313  GLU A OE1 1 
ATOM   2373 O OE2 . GLU A 1 313 ? 32.039  -0.522  -0.384  1.00 94.32  ? 313  GLU A OE2 1 
ATOM   2374 N N   . ALA A 1 314 ? 33.250  -2.997  4.671   1.00 56.80  ? 314  ALA A N   1 
ATOM   2375 C CA  . ALA A 1 314 ? 33.494  -4.433  4.731   1.00 52.15  ? 314  ALA A CA  1 
ATOM   2376 C C   . ALA A 1 314 ? 32.909  -5.091  5.986   1.00 60.03  ? 314  ALA A C   1 
ATOM   2377 O O   . ALA A 1 314 ? 32.298  -6.157  5.900   1.00 63.73  ? 314  ALA A O   1 
ATOM   2378 C CB  . ALA A 1 314 ? 34.987  -4.720  4.625   1.00 53.13  ? 314  ALA A CB  1 
ATOM   2379 N N   . LEU A 1 315 ? 33.096  -4.457  7.145   1.00 60.14  ? 315  LEU A N   1 
ATOM   2380 C CA  . LEU A 1 315 ? 32.602  -4.992  8.424   1.00 56.13  ? 315  LEU A CA  1 
ATOM   2381 C C   . LEU A 1 315 ? 31.077  -5.095  8.524   1.00 56.75  ? 315  LEU A C   1 
ATOM   2382 O O   . LEU A 1 315 ? 30.560  -5.920  9.268   1.00 66.95  ? 315  LEU A O   1 
ATOM   2383 C CB  . LEU A 1 315 ? 33.148  -4.182  9.610   1.00 50.72  ? 315  LEU A CB  1 
ATOM   2384 C CG  . LEU A 1 315 ? 34.667  -4.267  9.772   1.00 52.21  ? 315  LEU A CG  1 
ATOM   2385 C CD1 . LEU A 1 315 ? 35.135  -3.508  10.991  1.00 49.03  ? 315  LEU A CD1 1 
ATOM   2386 C CD2 . LEU A 1 315 ? 35.090  -5.719  9.853   1.00 47.16  ? 315  LEU A CD2 1 
ATOM   2387 N N   . ILE A 1 316 ? 30.355  -4.258  7.792   1.00 58.12  ? 316  ILE A N   1 
ATOM   2388 C CA  . ILE A 1 316 ? 28.898  -4.322  7.838   1.00 64.54  ? 316  ILE A CA  1 
ATOM   2389 C C   . ILE A 1 316 ? 28.321  -5.244  6.768   1.00 68.09  ? 316  ILE A C   1 
ATOM   2390 O O   . ILE A 1 316 ? 27.171  -5.671  6.879   1.00 76.33  ? 316  ILE A O   1 
ATOM   2391 C CB  . ILE A 1 316 ? 28.219  -2.914  7.755   1.00 57.41  ? 316  ILE A CB  1 
ATOM   2392 C CG1 . ILE A 1 316 ? 28.313  -2.330  6.348   1.00 55.59  ? 316  ILE A CG1 1 
ATOM   2393 C CG2 . ILE A 1 316 ? 28.811  -1.964  8.776   1.00 57.68  ? 316  ILE A CG2 1 
ATOM   2394 C CD1 . ILE A 1 316 ? 27.620  -0.980  6.209   1.00 56.12  ? 316  ILE A CD1 1 
ATOM   2395 N N   . ASN A 1 317 ? 29.104  -5.538  5.730   1.00 68.86  ? 317  ASN A N   1 
ATOM   2396 C CA  . ASN A 1 317 ? 28.671  -6.486  4.702   1.00 74.58  ? 317  ASN A CA  1 
ATOM   2397 C C   . ASN A 1 317 ? 28.716  -7.917  5.233   1.00 76.58  ? 317  ASN A C   1 
ATOM   2398 O O   . ASN A 1 317 ? 27.886  -8.748  4.873   1.00 81.72  ? 317  ASN A O   1 
ATOM   2399 C CB  . ASN A 1 317 ? 29.535  -6.366  3.441   1.00 70.81  ? 317  ASN A CB  1 
ATOM   2400 C CG  . ASN A 1 317 ? 29.324  -5.045  2.706   1.00 83.04  ? 317  ASN A CG  1 
ATOM   2401 O OD1 . ASN A 1 317 ? 28.357  -4.316  2.970   1.00 75.84  ? 317  ASN A OD1 1 
ATOM   2402 N ND2 . ASN A 1 317 ? 30.232  -4.731  1.774   1.00 78.10  ? 317  ASN A ND2 1 
ATOM   2403 N N   . THR A 1 318 ? 29.671  -8.172  6.124   1.00 69.04  ? 318  THR A N   1 
ATOM   2404 C CA  . THR A 1 318 ? 30.003  -9.519  6.559   1.00 68.37  ? 318  THR A CA  1 
ATOM   2405 C C   . THR A 1 318 ? 29.867  -9.702  8.071   1.00 73.58  ? 318  THR A C   1 
ATOM   2406 O O   . THR A 1 318 ? 30.551  -10.537 8.672   1.00 79.74  ? 318  THR A O   1 
ATOM   2407 C CB  . THR A 1 318 ? 31.462  -9.861  6.186   1.00 73.10  ? 318  THR A CB  1 
ATOM   2408 O OG1 . THR A 1 318 ? 32.351  -9.326  7.182   1.00 66.56  ? 318  THR A OG1 1 
ATOM   2409 C CG2 . THR A 1 318 ? 31.821  -9.294  4.797   1.00 72.07  ? 318  THR A CG2 1 
ATOM   2410 N N   . GLY A 1 319 ? 28.986  -8.935  8.696   1.00 72.61  ? 319  GLY A N   1 
ATOM   2411 C CA  . GLY A 1 319 ? 28.916  -8.941  10.147  1.00 69.25  ? 319  GLY A CA  1 
ATOM   2412 C C   . GLY A 1 319 ? 27.723  -9.678  10.722  1.00 71.53  ? 319  GLY A C   1 
ATOM   2413 O O   . GLY A 1 319 ? 26.625  -9.677  10.143  1.00 64.42  ? 319  GLY A O   1 
ATOM   2414 N N   . ASP A 1 320 ? 27.936  -10.308 11.873  1.00 70.61  ? 320  ASP A N   1 
ATOM   2415 C CA  . ASP A 1 320 ? 26.839  -10.945 12.586  1.00 73.60  ? 320  ASP A CA  1 
ATOM   2416 C C   . ASP A 1 320 ? 26.249  -9.985  13.632  1.00 72.46  ? 320  ASP A C   1 
ATOM   2417 O O   . ASP A 1 320 ? 26.898  -9.646  14.642  1.00 68.85  ? 320  ASP A O   1 
ATOM   2418 C CB  . ASP A 1 320 ? 27.305  -12.244 13.247  1.00 83.40  ? 320  ASP A CB  1 
ATOM   2419 C CG  . ASP A 1 320 ? 26.145  -13.158 13.623  1.00 85.56  ? 320  ASP A CG  1 
ATOM   2420 O OD1 . ASP A 1 320 ? 25.082  -13.089 12.955  1.00 84.13  ? 320  ASP A OD1 1 
ATOM   2421 O OD2 . ASP A 1 320 ? 26.297  -13.948 14.583  1.00 85.41  ? 320  ASP A OD2 1 
ATOM   2422 N N   . PHE A 1 321 ? 25.016  -9.549  13.380  1.00 71.32  ? 321  PHE A N   1 
ATOM   2423 C CA  . PHE A 1 321 ? 24.348  -8.583  14.249  1.00 72.75  ? 321  PHE A CA  1 
ATOM   2424 C C   . PHE A 1 321 ? 23.047  -9.162  14.789  1.00 73.19  ? 321  PHE A C   1 
ATOM   2425 O O   . PHE A 1 321 ? 22.033  -8.465  14.870  1.00 68.75  ? 321  PHE A O   1 
ATOM   2426 C CB  . PHE A 1 321 ? 24.102  -7.265  13.493  1.00 66.55  ? 321  PHE A CB  1 
ATOM   2427 C CG  . PHE A 1 321 ? 25.347  -6.699  12.867  1.00 63.18  ? 321  PHE A CG  1 
ATOM   2428 C CD1 . PHE A 1 321 ? 26.409  -6.286  13.663  1.00 59.84  ? 321  PHE A CD1 1 
ATOM   2429 C CD2 . PHE A 1 321 ? 25.472  -6.608  11.486  1.00 68.25  ? 321  PHE A CD2 1 
ATOM   2430 C CE1 . PHE A 1 321 ? 27.569  -5.787  13.099  1.00 57.51  ? 321  PHE A CE1 1 
ATOM   2431 C CE2 . PHE A 1 321 ? 26.633  -6.103  10.912  1.00 65.97  ? 321  PHE A CE2 1 
ATOM   2432 C CZ  . PHE A 1 321 ? 27.681  -5.692  11.724  1.00 63.47  ? 321  PHE A CZ  1 
ATOM   2433 N N   . GLN A 1 322 ? 23.092  -10.437 15.171  1.00 75.64  ? 322  GLN A N   1 
ATOM   2434 C CA  . GLN A 1 322 ? 21.912  -11.133 15.663  1.00 80.44  ? 322  GLN A CA  1 
ATOM   2435 C C   . GLN A 1 322 ? 21.388  -10.515 16.962  1.00 81.93  ? 322  GLN A C   1 
ATOM   2436 O O   . GLN A 1 322 ? 20.180  -10.284 17.111  1.00 74.60  ? 322  GLN A O   1 
ATOM   2437 C CB  . GLN A 1 322 ? 22.222  -12.617 15.881  1.00 89.40  ? 322  GLN A CB  1 
ATOM   2438 C CG  . GLN A 1 322 ? 21.040  -13.543 15.610  1.00 95.14  ? 322  GLN A CG  1 
ATOM   2439 C CD  . GLN A 1 322 ? 20.846  -13.813 14.126  1.00 104.05 ? 322  GLN A CD  1 
ATOM   2440 O OE1 . GLN A 1 322 ? 21.808  -14.115 13.410  1.00 100.88 ? 322  GLN A OE1 1 
ATOM   2441 N NE2 . GLN A 1 322 ? 19.599  -13.701 13.654  1.00 94.37  ? 322  GLN A NE2 1 
ATOM   2442 N N   . ASP A 1 323 ? 22.299  -10.232 17.891  1.00 72.73  ? 323  ASP A N   1 
ATOM   2443 C CA  . ASP A 1 323 ? 21.911  -9.731  19.210  1.00 85.72  ? 323  ASP A CA  1 
ATOM   2444 C C   . ASP A 1 323 ? 21.822  -8.204  19.302  1.00 82.20  ? 323  ASP A C   1 
ATOM   2445 O O   . ASP A 1 323 ? 22.015  -7.625  20.375  1.00 84.06  ? 323  ASP A O   1 
ATOM   2446 C CB  . ASP A 1 323 ? 22.877  -10.252 20.280  1.00 96.36  ? 323  ASP A CB  1 
ATOM   2447 C CG  . ASP A 1 323 ? 22.380  -11.529 20.949  1.00 113.16 ? 323  ASP A CG  1 
ATOM   2448 O OD1 . ASP A 1 323 ? 22.647  -12.633 20.416  1.00 111.98 ? 323  ASP A OD1 1 
ATOM   2449 O OD2 . ASP A 1 323 ? 21.728  -11.430 22.015  1.00 113.16 ? 323  ASP A OD2 1 
ATOM   2450 N N   . LEU A 1 324 ? 21.507  -7.546  18.194  1.00 79.38  ? 324  LEU A N   1 
ATOM   2451 C CA  . LEU A 1 324 ? 21.647  -6.094  18.148  1.00 72.46  ? 324  LEU A CA  1 
ATOM   2452 C C   . LEU A 1 324 ? 20.345  -5.353  17.868  1.00 59.70  ? 324  LEU A C   1 
ATOM   2453 O O   . LEU A 1 324 ? 19.682  -5.585  16.842  1.00 56.52  ? 324  LEU A O   1 
ATOM   2454 C CB  . LEU A 1 324 ? 22.696  -5.704  17.103  1.00 67.82  ? 324  LEU A CB  1 
ATOM   2455 C CG  . LEU A 1 324 ? 23.211  -4.269  17.181  1.00 62.32  ? 324  LEU A CG  1 
ATOM   2456 C CD1 . LEU A 1 324 ? 23.873  -4.000  18.529  1.00 61.67  ? 324  LEU A CD1 1 
ATOM   2457 C CD2 . LEU A 1 324 ? 24.177  -4.008  16.055  1.00 60.34  ? 324  LEU A CD2 1 
ATOM   2458 N N   . GLN A 1 325 ? 19.979  -4.471  18.792  1.00 47.36  ? 325  GLN A N   1 
ATOM   2459 C CA  . GLN A 1 325 ? 18.888  -3.543  18.542  1.00 54.20  ? 325  GLN A CA  1 
ATOM   2460 C C   . GLN A 1 325 ? 19.426  -2.125  18.316  1.00 54.65  ? 325  GLN A C   1 
ATOM   2461 O O   . GLN A 1 325 ? 20.285  -1.625  19.067  1.00 45.30  ? 325  GLN A O   1 
ATOM   2462 C CB  . GLN A 1 325 ? 17.861  -3.572  19.659  1.00 54.65  ? 325  GLN A CB  1 
ATOM   2463 C CG  . GLN A 1 325 ? 17.347  -4.966  19.983  1.00 59.19  ? 325  GLN A CG  1 
ATOM   2464 C CD  . GLN A 1 325 ? 17.679  -5.368  21.400  1.00 67.47  ? 325  GLN A CD  1 
ATOM   2465 O OE1 . GLN A 1 325 ? 17.126  -4.822  22.361  1.00 70.81  ? 325  GLN A OE1 1 
ATOM   2466 N NE2 . GLN A 1 325 ? 18.610  -6.308  21.544  1.00 74.48  ? 325  GLN A NE2 1 
ATOM   2467 N N   . VAL A 1 326 ? 18.908  -1.486  17.272  1.00 45.43  ? 326  VAL A N   1 
ATOM   2468 C CA  . VAL A 1 326 ? 19.488  -0.256  16.776  1.00 45.83  ? 326  VAL A CA  1 
ATOM   2469 C C   . VAL A 1 326 ? 18.399  0.681   16.296  1.00 45.74  ? 326  VAL A C   1 
ATOM   2470 O O   . VAL A 1 326 ? 17.484  0.278   15.584  1.00 47.65  ? 326  VAL A O   1 
ATOM   2471 C CB  . VAL A 1 326 ? 20.501  -0.540  15.626  1.00 46.51  ? 326  VAL A CB  1 
ATOM   2472 C CG1 . VAL A 1 326 ? 20.705  0.659   14.756  1.00 45.61  ? 326  VAL A CG1 1 
ATOM   2473 C CG2 . VAL A 1 326 ? 21.822  -0.976  16.184  1.00 49.98  ? 326  VAL A CG2 1 
ATOM   2474 N N   . LEU A 1 327 ? 18.506  1.939   16.696  1.00 45.37  ? 327  LEU A N   1 
ATOM   2475 C CA  . LEU A 1 327 ? 17.638  2.983   16.193  1.00 46.53  ? 327  LEU A CA  1 
ATOM   2476 C C   . LEU A 1 327 ? 18.507  3.958   15.383  1.00 43.32  ? 327  LEU A C   1 
ATOM   2477 O O   . LEU A 1 327 ? 19.544  4.432   15.865  1.00 45.27  ? 327  LEU A O   1 
ATOM   2478 C CB  . LEU A 1 327 ? 16.962  3.682   17.374  1.00 46.49  ? 327  LEU A CB  1 
ATOM   2479 C CG  . LEU A 1 327 ? 16.194  4.969   17.074  1.00 48.60  ? 327  LEU A CG  1 
ATOM   2480 C CD1 . LEU A 1 327 ? 15.045  4.679   16.139  1.00 49.68  ? 327  LEU A CD1 1 
ATOM   2481 C CD2 . LEU A 1 327 ? 15.697  5.607   18.351  1.00 49.60  ? 327  LEU A CD2 1 
ATOM   2482 N N   . VAL A 1 328 ? 18.105  4.231   14.148  1.00 42.77  ? 328  VAL A N   1 
ATOM   2483 C CA  . VAL A 1 328 ? 18.856  5.134   13.270  1.00 43.30  ? 328  VAL A CA  1 
ATOM   2484 C C   . VAL A 1 328 ? 17.928  6.125   12.607  1.00 40.22  ? 328  VAL A C   1 
ATOM   2485 O O   . VAL A 1 328 ? 16.752  5.839   12.390  1.00 47.63  ? 328  VAL A O   1 
ATOM   2486 C CB  . VAL A 1 328 ? 19.616  4.385   12.138  1.00 42.09  ? 328  VAL A CB  1 
ATOM   2487 C CG1 . VAL A 1 328 ? 20.593  3.417   12.720  1.00 42.99  ? 328  VAL A CG1 1 
ATOM   2488 C CG2 . VAL A 1 328 ? 18.641  3.653   11.212  1.00 34.75  ? 328  VAL A CG2 1 
ATOM   2489 N N   . GLY A 1 329 ? 18.455  7.289   12.258  1.00 43.22  ? 329  GLY A N   1 
ATOM   2490 C CA  . GLY A 1 329 ? 17.661  8.249   11.515  1.00 42.83  ? 329  GLY A CA  1 
ATOM   2491 C C   . GLY A 1 329 ? 18.440  9.437   11.000  1.00 38.08  ? 329  GLY A C   1 
ATOM   2492 O O   . GLY A 1 329 ? 19.662  9.501   11.137  1.00 42.84  ? 329  GLY A O   1 
ATOM   2493 N N   . VAL A 1 330 ? 17.719  10.378  10.396  1.00 38.71  ? 330  VAL A N   1 
ATOM   2494 C CA  . VAL A 1 330 ? 18.309  11.571  9.796   1.00 36.19  ? 330  VAL A CA  1 
ATOM   2495 C C   . VAL A 1 330 ? 17.336  12.734  9.949   1.00 41.47  ? 330  VAL A C   1 
ATOM   2496 O O   . VAL A 1 330 ? 16.150  12.520  10.250  1.00 38.19  ? 330  VAL A O   1 
ATOM   2497 C CB  . VAL A 1 330 ? 18.595  11.364  8.299   1.00 37.69  ? 330  VAL A CB  1 
ATOM   2498 C CG1 . VAL A 1 330 ? 19.624  10.239  8.078   1.00 43.31  ? 330  VAL A CG1 1 
ATOM   2499 C CG2 . VAL A 1 330 ? 17.305  11.062  7.552   1.00 36.20  ? 330  VAL A CG2 1 
ATOM   2500 N N   . VAL A 1 331 ? 17.833  13.958  9.759   1.00 39.15  ? 331  VAL A N   1 
ATOM   2501 C CA  . VAL A 1 331 ? 16.972  15.150  9.747   1.00 39.11  ? 331  VAL A CA  1 
ATOM   2502 C C   . VAL A 1 331 ? 16.564  15.455  8.307   1.00 43.46  ? 331  VAL A C   1 
ATOM   2503 O O   . VAL A 1 331 ? 17.191  14.958  7.363   1.00 42.94  ? 331  VAL A O   1 
ATOM   2504 C CB  . VAL A 1 331 ? 17.673  16.385  10.384  1.00 40.07  ? 331  VAL A CB  1 
ATOM   2505 C CG1 . VAL A 1 331 ? 17.979  16.113  11.835  1.00 37.60  ? 331  VAL A CG1 1 
ATOM   2506 C CG2 . VAL A 1 331 ? 18.973  16.743  9.613   1.00 34.43  ? 331  VAL A CG2 1 
ATOM   2507 N N   . LYS A 1 332 ? 15.519  16.262  8.138   1.00 45.09  ? 332  LYS A N   1 
ATOM   2508 C CA  . LYS A 1 332 ? 15.010  16.605  6.809   1.00 45.21  ? 332  LYS A CA  1 
ATOM   2509 C C   . LYS A 1 332 ? 16.086  17.199  5.887   1.00 44.11  ? 332  LYS A C   1 
ATOM   2510 O O   . LYS A 1 332 ? 16.154  16.845  4.709   1.00 42.15  ? 332  LYS A O   1 
ATOM   2511 C CB  . LYS A 1 332 ? 13.812  17.556  6.927   1.00 45.11  ? 332  LYS A CB  1 
ATOM   2512 C CG  . LYS A 1 332 ? 13.069  17.828  5.611   1.00 43.98  ? 332  LYS A CG  1 
ATOM   2513 C CD  . LYS A 1 332 ? 11.698  18.498  5.901   1.00 56.16  ? 332  LYS A CD  1 
ATOM   2514 C CE  . LYS A 1 332 ? 11.537  19.879  5.252   1.00 69.56  ? 332  LYS A CE  1 
ATOM   2515 N NZ  . LYS A 1 332 ? 12.294  20.993  5.938   1.00 58.63  ? 332  LYS A NZ  1 
ATOM   2516 N N   . ASP A 1 333 ? 16.947  18.065  6.423   1.00 41.81  ? 333  ASP A N   1 
ATOM   2517 C CA  . ASP A 1 333 ? 17.964  18.741  5.591   1.00 40.81  ? 333  ASP A CA  1 
ATOM   2518 C C   . ASP A 1 333 ? 19.405  18.537  6.070   1.00 41.46  ? 333  ASP A C   1 
ATOM   2519 O O   . ASP A 1 333 ? 20.041  19.447  6.605   1.00 40.87  ? 333  ASP A O   1 
ATOM   2520 C CB  . ASP A 1 333 ? 17.626  20.233  5.443   1.00 41.47  ? 333  ASP A CB  1 
ATOM   2521 C CG  . ASP A 1 333 ? 16.186  20.450  4.958   1.00 47.62  ? 333  ASP A CG  1 
ATOM   2522 O OD1 . ASP A 1 333 ? 15.264  20.433  5.803   1.00 45.42  ? 333  ASP A OD1 1 
ATOM   2523 O OD2 . ASP A 1 333 ? 15.978  20.614  3.736   1.00 49.34  ? 333  ASP A OD2 1 
ATOM   2524 N N   . GLU A 1 334 ? 19.910  17.327  5.859   1.00 44.27  ? 334  GLU A N   1 
ATOM   2525 C CA  . GLU A 1 334 ? 21.250  16.941  6.280   1.00 34.86  ? 334  GLU A CA  1 
ATOM   2526 C C   . GLU A 1 334 ? 22.372  17.784  5.653   1.00 43.08  ? 334  GLU A C   1 
ATOM   2527 O O   . GLU A 1 334 ? 23.436  17.973  6.259   1.00 45.11  ? 334  GLU A O   1 
ATOM   2528 C CB  . GLU A 1 334 ? 21.478  15.455  5.938   1.00 41.79  ? 334  GLU A CB  1 
ATOM   2529 C CG  . GLU A 1 334 ? 20.671  14.449  6.790   1.00 40.33  ? 334  GLU A CG  1 
ATOM   2530 C CD  . GLU A 1 334 ? 21.092  14.463  8.273   1.00 46.98  ? 334  GLU A CD  1 
ATOM   2531 O OE1 . GLU A 1 334 ? 22.103  15.121  8.607   1.00 45.95  ? 334  GLU A OE1 1 
ATOM   2532 O OE2 . GLU A 1 334 ? 20.416  13.820  9.113   1.00 47.45  ? 334  GLU A OE2 1 
ATOM   2533 N N   . GLY A 1 335 ? 22.131  18.297  4.447   1.00 39.50  ? 335  GLY A N   1 
ATOM   2534 C CA  . GLY A 1 335 ? 23.183  18.927  3.676   1.00 35.49  ? 335  GLY A CA  1 
ATOM   2535 C C   . GLY A 1 335 ? 23.326  20.427  3.825   1.00 42.27  ? 335  GLY A C   1 
ATOM   2536 O O   . GLY A 1 335 ? 24.345  21.004  3.429   1.00 47.84  ? 335  GLY A O   1 
ATOM   2537 N N   . SER A 1 336 ? 22.322  21.070  4.411   1.00 40.89  ? 336  SER A N   1 
ATOM   2538 C CA  . SER A 1 336 ? 22.251  22.525  4.351   1.00 44.93  ? 336  SER A CA  1 
ATOM   2539 C C   . SER A 1 336 ? 23.315  23.251  5.199   1.00 44.04  ? 336  SER A C   1 
ATOM   2540 O O   . SER A 1 336 ? 23.864  24.264  4.762   1.00 48.45  ? 336  SER A O   1 
ATOM   2541 C CB  . SER A 1 336 ? 20.844  23.006  4.702   1.00 45.65  ? 336  SER A CB  1 
ATOM   2542 O OG  . SER A 1 336 ? 20.611  22.851  6.087   1.00 50.45  ? 336  SER A OG  1 
ATOM   2543 N N   . TYR A 1 337 ? 23.607  22.726  6.391   1.00 45.02  ? 337  TYR A N   1 
ATOM   2544 C CA  . TYR A 1 337 ? 24.505  23.379  7.357   1.00 46.47  ? 337  TYR A CA  1 
ATOM   2545 C C   . TYR A 1 337 ? 25.874  23.735  6.788   1.00 43.49  ? 337  TYR A C   1 
ATOM   2546 O O   . TYR A 1 337 ? 26.367  24.845  6.965   1.00 45.07  ? 337  TYR A O   1 
ATOM   2547 C CB  . TYR A 1 337 ? 24.698  22.477  8.595   1.00 47.77  ? 337  TYR A CB  1 
ATOM   2548 C CG  . TYR A 1 337 ? 25.394  23.138  9.779   1.00 49.41  ? 337  TYR A CG  1 
ATOM   2549 C CD1 . TYR A 1 337 ? 26.791  23.167  9.878   1.00 50.24  ? 337  TYR A CD1 1 
ATOM   2550 C CD2 . TYR A 1 337 ? 24.656  23.709  10.815  1.00 42.92  ? 337  TYR A CD2 1 
ATOM   2551 C CE1 . TYR A 1 337 ? 27.437  23.777  10.971  1.00 48.59  ? 337  TYR A CE1 1 
ATOM   2552 C CE2 . TYR A 1 337 ? 25.287  24.316  11.916  1.00 49.72  ? 337  TYR A CE2 1 
ATOM   2553 C CZ  . TYR A 1 337 ? 26.678  24.346  11.991  1.00 57.63  ? 337  TYR A CZ  1 
ATOM   2554 O OH  . TYR A 1 337 ? 27.303  24.945  13.085  1.00 53.65  ? 337  TYR A OH  1 
ATOM   2555 N N   A PHE A 1 338 ? 26.461  22.791  6.069   0.35 46.81  ? 338  PHE A N   1 
ATOM   2556 N N   B PHE A 1 338 ? 26.497  22.779  6.111   0.65 46.44  ? 338  PHE A N   1 
ATOM   2557 C CA  A PHE A 1 338 ? 27.850  22.904  5.658   0.35 49.50  ? 338  PHE A CA  1 
ATOM   2558 C CA  B PHE A 1 338 ? 27.883  22.944  5.695   0.65 48.63  ? 338  PHE A CA  1 
ATOM   2559 C C   A PHE A 1 338 ? 28.053  23.756  4.419   0.35 50.65  ? 338  PHE A C   1 
ATOM   2560 C C   B PHE A 1 338 ? 28.068  23.705  4.382   0.65 50.91  ? 338  PHE A C   1 
ATOM   2561 O O   A PHE A 1 338 ? 29.176  24.171  4.122   0.35 49.88  ? 338  PHE A O   1 
ATOM   2562 O O   B PHE A 1 338 ? 29.205  24.006  3.994   0.65 50.03  ? 338  PHE A O   1 
ATOM   2563 C CB  A PHE A 1 338 ? 28.435  21.505  5.463   0.35 50.36  ? 338  PHE A CB  1 
ATOM   2564 C CB  B PHE A 1 338 ? 28.604  21.584  5.655   0.65 50.95  ? 338  PHE A CB  1 
ATOM   2565 C CG  A PHE A 1 338 ? 28.382  20.667  6.704   0.35 50.84  ? 338  PHE A CG  1 
ATOM   2566 C CG  B PHE A 1 338 ? 29.130  21.133  7.007   0.65 50.98  ? 338  PHE A CG  1 
ATOM   2567 C CD1 A PHE A 1 338 ? 27.261  19.901  6.993   0.35 51.22  ? 338  PHE A CD1 1 
ATOM   2568 C CD1 B PHE A 1 338 ? 29.876  21.999  7.805   0.65 50.51  ? 338  PHE A CD1 1 
ATOM   2569 C CD2 A PHE A 1 338 ? 29.438  20.671  7.603   0.35 49.60  ? 338  PHE A CD2 1 
ATOM   2570 C CD2 B PHE A 1 338 ? 28.863  19.854  7.484   0.65 48.74  ? 338  PHE A CD2 1 
ATOM   2571 C CE1 A PHE A 1 338 ? 27.200  19.140  8.144   0.35 47.13  ? 338  PHE A CE1 1 
ATOM   2572 C CE1 B PHE A 1 338 ? 30.361  21.601  9.053   0.65 48.72  ? 338  PHE A CE1 1 
ATOM   2573 C CE2 A PHE A 1 338 ? 29.385  19.910  8.756   0.35 50.52  ? 338  PHE A CE2 1 
ATOM   2574 C CE2 B PHE A 1 338 ? 29.339  19.446  8.728   0.65 50.48  ? 338  PHE A CE2 1 
ATOM   2575 C CZ  A PHE A 1 338 ? 28.262  19.142  9.026   0.35 48.33  ? 338  PHE A CZ  1 
ATOM   2576 C CZ  B PHE A 1 338 ? 30.093  20.328  9.518   0.65 50.22  ? 338  PHE A CZ  1 
ATOM   2577 N N   . LEU A 1 339 ? 26.966  24.021  3.704   1.00 47.11  ? 339  LEU A N   1 
ATOM   2578 C CA  . LEU A 1 339 ? 27.049  24.797  2.474   1.00 44.47  ? 339  LEU A CA  1 
ATOM   2579 C C   . LEU A 1 339 ? 27.565  26.212  2.737   1.00 47.25  ? 339  LEU A C   1 
ATOM   2580 O O   . LEU A 1 339 ? 28.252  26.783  1.889   1.00 45.01  ? 339  LEU A O   1 
ATOM   2581 C CB  . LEU A 1 339 ? 25.702  24.854  1.766   1.00 50.15  ? 339  LEU A CB  1 
ATOM   2582 C CG  . LEU A 1 339 ? 25.101  23.514  1.358   1.00 44.37  ? 339  LEU A CG  1 
ATOM   2583 C CD1 . LEU A 1 339 ? 23.774  23.733  0.628   1.00 40.31  ? 339  LEU A CD1 1 
ATOM   2584 C CD2 . LEU A 1 339 ? 26.088  22.727  0.504   1.00 42.57  ? 339  LEU A CD2 1 
ATOM   2585 N N   . VAL A 1 340 ? 27.250  26.774  3.907   1.00 46.13  ? 340  VAL A N   1 
ATOM   2586 C CA  . VAL A 1 340 ? 27.700  28.138  4.213   1.00 48.69  ? 340  VAL A CA  1 
ATOM   2587 C C   . VAL A 1 340 ? 29.163  28.174  4.633   1.00 51.04  ? 340  VAL A C   1 
ATOM   2588 O O   . VAL A 1 340 ? 29.732  29.250  4.815   1.00 51.52  ? 340  VAL A O   1 
ATOM   2589 C CB  . VAL A 1 340 ? 26.832  28.842  5.283   1.00 49.57  ? 340  VAL A CB  1 
ATOM   2590 C CG1 . VAL A 1 340 ? 25.402  28.914  4.812   1.00 47.83  ? 340  VAL A CG1 1 
ATOM   2591 C CG2 . VAL A 1 340 ? 26.929  28.133  6.652   1.00 48.35  ? 340  VAL A CG2 1 
ATOM   2592 N N   . TYR A 1 341 ? 29.769  26.997  4.772   1.00 50.64  ? 341  TYR A N   1 
ATOM   2593 C CA  . TYR A 1 341 ? 31.188  26.900  5.114   1.00 54.04  ? 341  TYR A CA  1 
ATOM   2594 C C   . TYR A 1 341 ? 32.088  26.665  3.897   1.00 60.04  ? 341  TYR A C   1 
ATOM   2595 O O   . TYR A 1 341 ? 33.174  26.088  4.030   1.00 70.38  ? 341  TYR A O   1 
ATOM   2596 C CB  . TYR A 1 341 ? 31.433  25.787  6.141   1.00 52.88  ? 341  TYR A CB  1 
ATOM   2597 C CG  . TYR A 1 341 ? 31.000  26.141  7.533   1.00 52.11  ? 341  TYR A CG  1 
ATOM   2598 C CD1 . TYR A 1 341 ? 29.678  25.948  7.949   1.00 44.00  ? 341  TYR A CD1 1 
ATOM   2599 C CD2 . TYR A 1 341 ? 31.908  26.663  8.440   1.00 52.75  ? 341  TYR A CD2 1 
ATOM   2600 C CE1 . TYR A 1 341 ? 29.281  26.275  9.240   1.00 47.75  ? 341  TYR A CE1 1 
ATOM   2601 C CE2 . TYR A 1 341 ? 31.526  26.990  9.735   1.00 54.53  ? 341  TYR A CE2 1 
ATOM   2602 C CZ  . TYR A 1 341 ? 30.216  26.801  10.131  1.00 56.14  ? 341  TYR A CZ  1 
ATOM   2603 O OH  . TYR A 1 341 ? 29.852  27.135  11.419  1.00 59.48  ? 341  TYR A OH  1 
ATOM   2604 N N   . GLY A 1 342 ? 31.647  27.081  2.715   1.00 54.98  ? 342  GLY A N   1 
ATOM   2605 C CA  . GLY A 1 342 ? 32.559  27.084  1.591   1.00 56.86  ? 342  GLY A CA  1 
ATOM   2606 C C   . GLY A 1 342 ? 32.075  26.570  0.250   1.00 57.36  ? 342  GLY A C   1 
ATOM   2607 O O   . GLY A 1 342 ? 32.896  26.168  -0.598  1.00 58.21  ? 342  GLY A O   1 
ATOM   2608 N N   . VAL A 1 343 ? 30.761  26.553  0.050   1.00 48.28  ? 343  VAL A N   1 
ATOM   2609 C CA  . VAL A 1 343 ? 30.245  26.537  -1.306  1.00 44.97  ? 343  VAL A CA  1 
ATOM   2610 C C   . VAL A 1 343 ? 29.927  27.991  -1.666  1.00 49.86  ? 343  VAL A C   1 
ATOM   2611 O O   . VAL A 1 343 ? 29.133  28.654  -0.984  1.00 51.29  ? 343  VAL A O   1 
ATOM   2612 C CB  . VAL A 1 343 ? 29.039  25.607  -1.467  1.00 48.32  ? 343  VAL A CB  1 
ATOM   2613 C CG1 . VAL A 1 343 ? 28.583  25.581  -2.931  1.00 45.63  ? 343  VAL A CG1 1 
ATOM   2614 C CG2 . VAL A 1 343 ? 29.402  24.193  -0.993  1.00 52.36  ? 343  VAL A CG2 1 
ATOM   2615 N N   . PRO A 1 344 ? 30.606  28.516  -2.700  1.00 54.25  ? 344  PRO A N   1 
ATOM   2616 C CA  . PRO A 1 344 ? 30.347  29.916  -3.075  1.00 50.77  ? 344  PRO A CA  1 
ATOM   2617 C C   . PRO A 1 344 ? 28.892  30.102  -3.522  1.00 50.92  ? 344  PRO A C   1 
ATOM   2618 O O   . PRO A 1 344 ? 28.374  29.286  -4.304  1.00 44.32  ? 344  PRO A O   1 
ATOM   2619 C CB  . PRO A 1 344 ? 31.315  30.145  -4.244  1.00 47.28  ? 344  PRO A CB  1 
ATOM   2620 C CG  . PRO A 1 344 ? 32.449  29.166  -3.969  1.00 44.60  ? 344  PRO A CG  1 
ATOM   2621 C CD  . PRO A 1 344 ? 31.750  27.940  -3.438  1.00 44.39  ? 344  PRO A CD  1 
ATOM   2622 N N   . GLY A 1 345 ? 28.238  31.149  -3.018  1.00 52.02  ? 345  GLY A N   1 
ATOM   2623 C CA  . GLY A 1 345 ? 26.832  31.371  -3.300  1.00 39.87  ? 345  GLY A CA  1 
ATOM   2624 C C   . GLY A 1 345 ? 25.976  31.267  -2.057  1.00 45.82  ? 345  GLY A C   1 
ATOM   2625 O O   . GLY A 1 345 ? 24.925  31.906  -1.977  1.00 53.11  ? 345  GLY A O   1 
ATOM   2626 N N   . PHE A 1 346 ? 26.426  30.478  -1.079  1.00 47.50  ? 346  PHE A N   1 
ATOM   2627 C CA  . PHE A 1 346 ? 25.615  30.201  0.115   1.00 45.85  ? 346  PHE A CA  1 
ATOM   2628 C C   . PHE A 1 346 ? 26.001  31.061  1.307   1.00 48.72  ? 346  PHE A C   1 
ATOM   2629 O O   . PHE A 1 346 ? 27.179  31.351  1.530   1.00 50.43  ? 346  PHE A O   1 
ATOM   2630 C CB  . PHE A 1 346 ? 25.663  28.716  0.477   1.00 38.39  ? 346  PHE A CB  1 
ATOM   2631 C CG  . PHE A 1 346 ? 25.076  27.833  -0.582  1.00 40.95  ? 346  PHE A CG  1 
ATOM   2632 C CD1 . PHE A 1 346 ? 25.847  27.405  -1.656  1.00 40.74  ? 346  PHE A CD1 1 
ATOM   2633 C CD2 . PHE A 1 346 ? 23.742  27.459  -0.526  1.00 35.31  ? 346  PHE A CD2 1 
ATOM   2634 C CE1 . PHE A 1 346 ? 25.299  26.611  -2.649  1.00 39.11  ? 346  PHE A CE1 1 
ATOM   2635 C CE2 . PHE A 1 346 ? 23.188  26.668  -1.508  1.00 35.49  ? 346  PHE A CE2 1 
ATOM   2636 C CZ  . PHE A 1 346 ? 23.963  26.242  -2.579  1.00 41.95  ? 346  PHE A CZ  1 
ATOM   2637 N N   . SER A 1 347 ? 24.983  31.466  2.057   1.00 46.09  ? 347  SER A N   1 
ATOM   2638 C CA  . SER A 1 347 ? 25.141  32.316  3.227   1.00 51.55  ? 347  SER A CA  1 
ATOM   2639 C C   . SER A 1 347 ? 23.914  32.189  4.119   1.00 54.32  ? 347  SER A C   1 
ATOM   2640 O O   . SER A 1 347 ? 22.816  31.875  3.638   1.00 56.82  ? 347  SER A O   1 
ATOM   2641 C CB  . SER A 1 347 ? 25.296  33.787  2.811   1.00 52.41  ? 347  SER A CB  1 
ATOM   2642 O OG  . SER A 1 347 ? 25.313  34.619  3.958   1.00 56.85  ? 347  SER A OG  1 
ATOM   2643 N N   . LYS A 1 348 ? 24.086  32.445  5.412   1.00 49.07  ? 348  LYS A N   1 
ATOM   2644 C CA  . LYS A 1 348 ? 22.931  32.535  6.293   1.00 47.51  ? 348  LYS A CA  1 
ATOM   2645 C C   . LYS A 1 348 ? 22.186  33.856  6.050   1.00 50.71  ? 348  LYS A C   1 
ATOM   2646 O O   . LYS A 1 348 ? 21.003  33.982  6.389   1.00 47.00  ? 348  LYS A O   1 
ATOM   2647 C CB  . LYS A 1 348 ? 23.344  32.412  7.775   1.00 48.37  ? 348  LYS A CB  1 
ATOM   2648 C CG  . LYS A 1 348 ? 23.896  33.709  8.384   1.00 51.65  ? 348  LYS A CG  1 
ATOM   2649 C CD  . LYS A 1 348 ? 24.224  33.579  9.879   1.00 49.94  ? 348  LYS A CD  1 
ATOM   2650 C CE  . LYS A 1 348 ? 24.354  34.970  10.526  1.00 60.58  ? 348  LYS A CE  1 
ATOM   2651 N NZ  . LYS A 1 348 ? 23.032  35.667  10.758  1.00 56.50  ? 348  LYS A NZ  1 
ATOM   2652 N N   . ASP A 1 349 ? 22.866  34.840  5.457   1.00 46.78  ? 349  ASP A N   1 
ATOM   2653 C CA  . ASP A 1 349 ? 22.294  36.200  5.400   1.00 56.67  ? 349  ASP A CA  1 
ATOM   2654 C C   . ASP A 1 349 ? 21.429  36.531  4.174   1.00 52.33  ? 349  ASP A C   1 
ATOM   2655 O O   . ASP A 1 349 ? 20.856  37.615  4.096   1.00 50.12  ? 349  ASP A O   1 
ATOM   2656 C CB  . ASP A 1 349 ? 23.376  37.261  5.600   1.00 42.48  ? 349  ASP A CB  1 
ATOM   2657 C CG  . ASP A 1 349 ? 24.010  37.188  6.976   1.00 57.59  ? 349  ASP A CG  1 
ATOM   2658 O OD1 . ASP A 1 349 ? 23.268  37.118  7.994   1.00 50.67  ? 349  ASP A OD1 1 
ATOM   2659 O OD2 . ASP A 1 349 ? 25.265  37.196  7.032   1.00 64.74  ? 349  ASP A OD2 1 
ATOM   2660 N N   . ASN A 1 350 ? 21.355  35.609  3.220   1.00 48.42  ? 350  ASN A N   1 
ATOM   2661 C CA  . ASN A 1 350 ? 20.419  35.743  2.117   1.00 48.74  ? 350  ASN A CA  1 
ATOM   2662 C C   . ASN A 1 350 ? 19.780  34.397  1.772   1.00 53.18  ? 350  ASN A C   1 
ATOM   2663 O O   . ASN A 1 350 ? 19.957  33.423  2.493   1.00 53.21  ? 350  ASN A O   1 
ATOM   2664 C CB  . ASN A 1 350 ? 21.049  36.445  0.896   1.00 39.35  ? 350  ASN A CB  1 
ATOM   2665 C CG  . ASN A 1 350 ? 22.224  35.681  0.294   1.00 58.61  ? 350  ASN A CG  1 
ATOM   2666 O OD1 . ASN A 1 350 ? 22.174  34.451  0.130   1.00 55.45  ? 350  ASN A OD1 1 
ATOM   2667 N ND2 . ASN A 1 350 ? 23.290  36.427  -0.067  1.00 66.21  ? 350  ASN A ND2 1 
ATOM   2668 N N   . GLU A 1 351 ? 19.033  34.351  0.677   1.00 56.22  ? 351  GLU A N   1 
ATOM   2669 C CA  . GLU A 1 351 ? 18.268  33.165  0.302   1.00 52.12  ? 351  GLU A CA  1 
ATOM   2670 C C   . GLU A 1 351 ? 19.113  32.125  -0.426  1.00 45.20  ? 351  GLU A C   1 
ATOM   2671 O O   . GLU A 1 351 ? 18.631  31.027  -0.745  1.00 46.01  ? 351  GLU A O   1 
ATOM   2672 C CB  . GLU A 1 351 ? 17.094  33.582  -0.580  1.00 59.68  ? 351  GLU A CB  1 
ATOM   2673 C CG  . GLU A 1 351 ? 16.193  34.609  0.078   1.00 64.01  ? 351  GLU A CG  1 
ATOM   2674 C CD  . GLU A 1 351 ? 15.308  33.985  1.141   1.00 79.42  ? 351  GLU A CD  1 
ATOM   2675 O OE1 . GLU A 1 351 ? 15.275  32.731  1.243   1.00 72.95  ? 351  GLU A OE1 1 
ATOM   2676 O OE2 . GLU A 1 351 ? 14.637  34.748  1.872   1.00 96.66  ? 351  GLU A OE2 1 
ATOM   2677 N N   . SER A 1 352 ? 20.362  32.498  -0.692  1.00 43.66  ? 352  SER A N   1 
ATOM   2678 C CA  . SER A 1 352 ? 21.336  31.651  -1.365  1.00 47.61  ? 352  SER A CA  1 
ATOM   2679 C C   . SER A 1 352 ? 20.789  31.019  -2.636  1.00 48.85  ? 352  SER A C   1 
ATOM   2680 O O   . SER A 1 352 ? 20.979  29.824  -2.869  1.00 47.67  ? 352  SER A O   1 
ATOM   2681 C CB  . SER A 1 352 ? 21.877  30.571  -0.414  1.00 45.29  ? 352  SER A CB  1 
ATOM   2682 O OG  . SER A 1 352 ? 22.245  31.129  0.838   1.00 44.84  ? 352  SER A OG  1 
ATOM   2683 N N   . LEU A 1 353 ? 20.092  31.812  -3.444  1.00 42.01  ? 353  LEU A N   1 
ATOM   2684 C CA  . LEU A 1 353 ? 19.737  31.362  -4.785  1.00 48.49  ? 353  LEU A CA  1 
ATOM   2685 C C   . LEU A 1 353 ? 21.011  31.377  -5.644  1.00 47.36  ? 353  LEU A C   1 
ATOM   2686 O O   . LEU A 1 353 ? 21.666  32.405  -5.784  1.00 60.02  ? 353  LEU A O   1 
ATOM   2687 C CB  . LEU A 1 353 ? 18.646  32.250  -5.387  1.00 43.80  ? 353  LEU A CB  1 
ATOM   2688 C CG  . LEU A 1 353 ? 17.345  32.335  -4.577  1.00 51.51  ? 353  LEU A CG  1 
ATOM   2689 C CD1 . LEU A 1 353 ? 16.335  33.272  -5.234  1.00 51.33  ? 353  LEU A CD1 1 
ATOM   2690 C CD2 . LEU A 1 353 ? 16.723  30.953  -4.357  1.00 47.66  ? 353  LEU A CD2 1 
ATOM   2691 N N   . ILE A 1 354 ? 21.388  30.228  -6.185  1.00 46.77  ? 354  ILE A N   1 
ATOM   2692 C CA  . ILE A 1 354 ? 22.642  30.126  -6.923  1.00 41.42  ? 354  ILE A CA  1 
ATOM   2693 C C   . ILE A 1 354 ? 22.426  29.891  -8.413  1.00 38.53  ? 354  ILE A C   1 
ATOM   2694 O O   . ILE A 1 354 ? 21.333  29.510  -8.864  1.00 45.88  ? 354  ILE A O   1 
ATOM   2695 C CB  . ILE A 1 354 ? 23.537  28.983  -6.386  1.00 40.68  ? 354  ILE A CB  1 
ATOM   2696 C CG1 . ILE A 1 354 ? 22.774  27.652  -6.394  1.00 36.16  ? 354  ILE A CG1 1 
ATOM   2697 C CG2 . ILE A 1 354 ? 24.064  29.316  -4.997  1.00 42.52  ? 354  ILE A CG2 1 
ATOM   2698 C CD1 . ILE A 1 354 ? 23.660  26.444  -6.646  1.00 43.36  ? 354  ILE A CD1 1 
ATOM   2699 N N   . SER A 1 355 ? 23.484  30.102  -9.178  1.00 34.72  ? 355  SER A N   1 
ATOM   2700 C CA  . SER A 1 355 ? 23.438  29.877  -10.615 1.00 37.99  ? 355  SER A CA  1 
ATOM   2701 C C   . SER A 1 355 ? 23.781  28.420  -10.929 1.00 42.70  ? 355  SER A C   1 
ATOM   2702 O O   . SER A 1 355 ? 24.241  27.672  -10.065 1.00 48.58  ? 355  SER A O   1 
ATOM   2703 C CB  . SER A 1 355 ? 24.453  30.775  -11.302 1.00 41.72  ? 355  SER A CB  1 
ATOM   2704 O OG  . SER A 1 355 ? 25.774  30.288  -11.088 1.00 46.33  ? 355  SER A OG  1 
ATOM   2705 N N   . ARG A 1 356 ? 23.576  28.025  -12.174 1.00 42.30  ? 356  ARG A N   1 
ATOM   2706 C CA  . ARG A 1 356 ? 23.935  26.691  -12.605 1.00 43.22  ? 356  ARG A CA  1 
ATOM   2707 C C   . ARG A 1 356 ? 25.450  26.483  -12.513 1.00 47.05  ? 356  ARG A C   1 
ATOM   2708 O O   . ARG A 1 356 ? 25.913  25.378  -12.201 1.00 48.22  ? 356  ARG A O   1 
ATOM   2709 C CB  . ARG A 1 356 ? 23.435  26.448  -14.030 1.00 44.68  ? 356  ARG A CB  1 
ATOM   2710 C CG  . ARG A 1 356 ? 23.859  25.125  -14.576 1.00 51.28  ? 356  ARG A CG  1 
ATOM   2711 C CD  . ARG A 1 356 ? 22.770  24.460  -15.374 1.00 48.74  ? 356  ARG A CD  1 
ATOM   2712 N NE  . ARG A 1 356 ? 23.121  23.059  -15.591 1.00 54.38  ? 356  ARG A NE  1 
ATOM   2713 C CZ  . ARG A 1 356 ? 22.617  22.036  -14.903 1.00 52.98  ? 356  ARG A CZ  1 
ATOM   2714 N NH1 . ARG A 1 356 ? 21.699  22.236  -13.952 1.00 49.20  ? 356  ARG A NH1 1 
ATOM   2715 N NH2 . ARG A 1 356 ? 23.019  20.806  -15.186 1.00 44.62  ? 356  ARG A NH2 1 
ATOM   2716 N N   . ALA A 1 357 ? 26.217  27.543  -12.770 1.00 43.82  ? 357  ALA A N   1 
ATOM   2717 C CA  . ALA A 1 357 ? 27.675  27.449  -12.689 1.00 49.53  ? 357  ALA A CA  1 
ATOM   2718 C C   . ALA A 1 357 ? 28.112  27.193  -11.241 1.00 48.00  ? 357  ALA A C   1 
ATOM   2719 O O   . ALA A 1 357 ? 28.950  26.321  -10.981 1.00 41.31  ? 357  ALA A O   1 
ATOM   2720 C CB  . ALA A 1 357 ? 28.335  28.703  -13.243 1.00 36.70  ? 357  ALA A CB  1 
ATOM   2721 N N   . GLN A 1 358 ? 27.537  27.949  -10.308 1.00 39.02  ? 358  GLN A N   1 
ATOM   2722 C CA  . GLN A 1 358 ? 27.822  27.750  -8.894  1.00 41.31  ? 358  GLN A CA  1 
ATOM   2723 C C   . GLN A 1 358 ? 27.441  26.341  -8.431  1.00 44.34  ? 358  GLN A C   1 
ATOM   2724 O O   . GLN A 1 358 ? 28.091  25.785  -7.549  1.00 48.11  ? 358  GLN A O   1 
ATOM   2725 C CB  . GLN A 1 358 ? 27.124  28.808  -8.037  1.00 36.79  ? 358  GLN A CB  1 
ATOM   2726 C CG  . GLN A 1 358 ? 27.565  30.235  -8.346  1.00 36.30  ? 358  GLN A CG  1 
ATOM   2727 C CD  . GLN A 1 358 ? 26.837  31.269  -7.520  1.00 43.09  ? 358  GLN A CD  1 
ATOM   2728 O OE1 . GLN A 1 358 ? 25.606  31.431  -7.626  1.00 44.20  ? 358  GLN A OE1 1 
ATOM   2729 N NE2 . GLN A 1 358 ? 27.591  31.982  -6.677  1.00 41.28  ? 358  GLN A NE2 1 
ATOM   2730 N N   . PHE A 1 359 ? 26.399  25.766  -9.031  1.00 41.30  ? 359  PHE A N   1 
ATOM   2731 C CA  . PHE A 1 359 ? 25.985  24.403  -8.714  1.00 36.47  ? 359  PHE A CA  1 
ATOM   2732 C C   . PHE A 1 359 ? 27.030  23.387  -9.187  1.00 40.23  ? 359  PHE A C   1 
ATOM   2733 O O   . PHE A 1 359 ? 27.444  22.512  -8.424  1.00 38.36  ? 359  PHE A O   1 
ATOM   2734 C CB  . PHE A 1 359 ? 24.609  24.112  -9.321  1.00 36.53  ? 359  PHE A CB  1 
ATOM   2735 C CG  . PHE A 1 359 ? 24.160  22.680  -9.177  1.00 38.15  ? 359  PHE A CG  1 
ATOM   2736 C CD1 . PHE A 1 359 ? 23.827  22.154  -7.929  1.00 41.39  ? 359  PHE A CD1 1 
ATOM   2737 C CD2 . PHE A 1 359 ? 24.042  21.865  -10.292 1.00 36.98  ? 359  PHE A CD2 1 
ATOM   2738 C CE1 . PHE A 1 359 ? 23.414  20.835  -7.800  1.00 40.16  ? 359  PHE A CE1 1 
ATOM   2739 C CE2 . PHE A 1 359 ? 23.616  20.538  -10.170 1.00 41.10  ? 359  PHE A CE2 1 
ATOM   2740 C CZ  . PHE A 1 359 ? 23.306  20.028  -8.922  1.00 41.35  ? 359  PHE A CZ  1 
ATOM   2741 N N   . LEU A 1 360 ? 27.458  23.511  -10.442 1.00 41.73  ? 360  LEU A N   1 
ATOM   2742 C CA  . LEU A 1 360 ? 28.542  22.682  -10.964 1.00 40.91  ? 360  LEU A CA  1 
ATOM   2743 C C   . LEU A 1 360 ? 29.807  22.767  -10.089 1.00 43.68  ? 360  LEU A C   1 
ATOM   2744 O O   . LEU A 1 360 ? 30.386  21.735  -9.730  1.00 44.88  ? 360  LEU A O   1 
ATOM   2745 C CB  . LEU A 1 360 ? 28.851  23.048  -12.420 1.00 45.06  ? 360  LEU A CB  1 
ATOM   2746 C CG  . LEU A 1 360 ? 27.664  22.953  -13.395 1.00 53.71  ? 360  LEU A CG  1 
ATOM   2747 C CD1 . LEU A 1 360 ? 28.043  23.355  -14.820 1.00 54.25  ? 360  LEU A CD1 1 
ATOM   2748 C CD2 . LEU A 1 360 ? 27.054  21.565  -13.400 1.00 48.43  ? 360  LEU A CD2 1 
ATOM   2749 N N   . ALA A 1 361 ? 30.227  23.985  -9.743  1.00 42.53  ? 361  ALA A N   1 
ATOM   2750 C CA  . ALA A 1 361 ? 31.359  24.183  -8.831  1.00 41.72  ? 361  ALA A CA  1 
ATOM   2751 C C   . ALA A 1 361 ? 31.072  23.561  -7.465  1.00 41.31  ? 361  ALA A C   1 
ATOM   2752 O O   . ALA A 1 361 ? 31.946  22.900  -6.890  1.00 43.67  ? 361  ALA A O   1 
ATOM   2753 C CB  . ALA A 1 361 ? 31.690  25.668  -8.675  1.00 30.58  ? 361  ALA A CB  1 
ATOM   2754 N N   . GLY A 1 362 ? 29.856  23.782  -6.952  1.00 38.91  ? 362  GLY A N   1 
ATOM   2755 C CA  . GLY A 1 362 ? 29.435  23.245  -5.664  1.00 33.93  ? 362  GLY A CA  1 
ATOM   2756 C C   . GLY A 1 362 ? 29.569  21.727  -5.596  1.00 43.38  ? 362  GLY A C   1 
ATOM   2757 O O   . GLY A 1 362 ? 29.978  21.168  -4.575  1.00 40.30  ? 362  GLY A O   1 
ATOM   2758 N N   . VAL A 1 363 ? 29.237  21.058  -6.699  1.00 40.66  ? 363  VAL A N   1 
ATOM   2759 C CA  . VAL A 1 363 ? 29.274  19.607  -6.757  1.00 39.26  ? 363  VAL A CA  1 
ATOM   2760 C C   . VAL A 1 363 ? 30.699  19.074  -6.648  1.00 45.26  ? 363  VAL A C   1 
ATOM   2761 O O   . VAL A 1 363 ? 30.922  18.017  -6.048  1.00 48.40  ? 363  VAL A O   1 
ATOM   2762 C CB  . VAL A 1 363 ? 28.561  19.069  -8.025  1.00 41.76  ? 363  VAL A CB  1 
ATOM   2763 C CG1 . VAL A 1 363 ? 28.974  17.624  -8.328  1.00 40.00  ? 363  VAL A CG1 1 
ATOM   2764 C CG2 . VAL A 1 363 ? 27.037  19.170  -7.866  1.00 41.94  ? 363  VAL A CG2 1 
ATOM   2765 N N   . ARG A 1 364 ? 31.660  19.801  -7.217  1.00 45.41  ? 364  ARG A N   1 
ATOM   2766 C CA  . ARG A 1 364 ? 33.072  19.421  -7.106  1.00 49.28  ? 364  ARG A CA  1 
ATOM   2767 C C   . ARG A 1 364 ? 33.567  19.542  -5.667  1.00 47.19  ? 364  ARG A C   1 
ATOM   2768 O O   . ARG A 1 364 ? 34.341  18.712  -5.204  1.00 45.83  ? 364  ARG A O   1 
ATOM   2769 C CB  . ARG A 1 364 ? 33.950  20.281  -8.018  1.00 49.04  ? 364  ARG A CB  1 
ATOM   2770 C CG  . ARG A 1 364 ? 33.664  20.110  -9.483  1.00 51.99  ? 364  ARG A CG  1 
ATOM   2771 C CD  . ARG A 1 364 ? 33.279  18.675  -9.806  1.00 57.70  ? 364  ARG A CD  1 
ATOM   2772 N NE  . ARG A 1 364 ? 34.405  17.744  -9.759  1.00 68.02  ? 364  ARG A NE  1 
ATOM   2773 C CZ  . ARG A 1 364 ? 35.138  17.401  -10.818 1.00 65.08  ? 364  ARG A CZ  1 
ATOM   2774 N NH1 . ARG A 1 364 ? 34.873  17.930  -12.011 1.00 59.30  ? 364  ARG A NH1 1 
ATOM   2775 N NH2 . ARG A 1 364 ? 36.139  16.535  -10.683 1.00 57.31  ? 364  ARG A NH2 1 
ATOM   2776 N N   . ILE A 1 365 ? 33.121  20.586  -4.973  1.00 42.13  ? 365  ILE A N   1 
ATOM   2777 C CA  . ILE A 1 365 ? 33.520  20.826  -3.595  1.00 42.37  ? 365  ILE A CA  1 
ATOM   2778 C C   . ILE A 1 365 ? 32.830  19.857  -2.622  1.00 43.18  ? 365  ILE A C   1 
ATOM   2779 O O   . ILE A 1 365 ? 33.445  19.380  -1.663  1.00 44.01  ? 365  ILE A O   1 
ATOM   2780 C CB  . ILE A 1 365 ? 33.244  22.297  -3.201  1.00 44.96  ? 365  ILE A CB  1 
ATOM   2781 C CG1 . ILE A 1 365 ? 34.064  23.232  -4.093  1.00 44.02  ? 365  ILE A CG1 1 
ATOM   2782 C CG2 . ILE A 1 365 ? 33.556  22.554  -1.729  1.00 40.33  ? 365  ILE A CG2 1 
ATOM   2783 C CD1 . ILE A 1 365 ? 33.737  24.691  -3.892  1.00 44.26  ? 365  ILE A CD1 1 
ATOM   2784 N N   . GLY A 1 366 ? 31.560  19.560  -2.885  1.00 39.72  ? 366  GLY A N   1 
ATOM   2785 C CA  . GLY A 1 366 ? 30.771  18.689  -2.030  1.00 43.48  ? 366  GLY A CA  1 
ATOM   2786 C C   . GLY A 1 366 ? 31.014  17.201  -2.240  1.00 46.78  ? 366  GLY A C   1 
ATOM   2787 O O   . GLY A 1 366 ? 30.745  16.391  -1.346  1.00 47.68  ? 366  GLY A O   1 
ATOM   2788 N N   . VAL A 1 367 ? 31.505  16.836  -3.423  1.00 44.73  ? 367  VAL A N   1 
ATOM   2789 C CA  . VAL A 1 367 ? 31.920  15.465  -3.708  1.00 42.05  ? 367  VAL A CA  1 
ATOM   2790 C C   . VAL A 1 367 ? 33.380  15.528  -4.144  1.00 45.02  ? 367  VAL A C   1 
ATOM   2791 O O   . VAL A 1 367 ? 33.690  15.298  -5.320  1.00 45.05  ? 367  VAL A O   1 
ATOM   2792 C CB  . VAL A 1 367 ? 31.079  14.842  -4.854  1.00 45.61  ? 367  VAL A CB  1 
ATOM   2793 C CG1 . VAL A 1 367 ? 31.223  13.328  -4.860  1.00 38.12  ? 367  VAL A CG1 1 
ATOM   2794 C CG2 . VAL A 1 367 ? 29.595  15.244  -4.745  1.00 34.80  ? 367  VAL A CG2 1 
ATOM   2795 N N   . PRO A 1 368 ? 34.288  15.854  -3.201  1.00 45.69  ? 368  PRO A N   1 
ATOM   2796 C CA  . PRO A 1 368 ? 35.665  16.196  -3.605  1.00 44.63  ? 368  PRO A CA  1 
ATOM   2797 C C   . PRO A 1 368 ? 36.482  15.029  -4.167  1.00 43.59  ? 368  PRO A C   1 
ATOM   2798 O O   . PRO A 1 368 ? 37.551  15.236  -4.731  1.00 50.93  ? 368  PRO A O   1 
ATOM   2799 C CB  . PRO A 1 368 ? 36.292  16.744  -2.321  1.00 43.69  ? 368  PRO A CB  1 
ATOM   2800 C CG  . PRO A 1 368 ? 35.439  16.174  -1.191  1.00 42.91  ? 368  PRO A CG  1 
ATOM   2801 C CD  . PRO A 1 368 ? 34.062  16.019  -1.751  1.00 38.89  ? 368  PRO A CD  1 
ATOM   2802 N N   A GLN A 1 369 ? 35.969  13.817  -4.017  0.43 48.02  ? 369  GLN A N   1 
ATOM   2803 N N   B GLN A 1 369 ? 35.966  13.810  -4.034  0.57 48.17  ? 369  GLN A N   1 
ATOM   2804 C CA  A GLN A 1 369 ? 36.667  12.638  -4.515  0.43 50.23  ? 369  GLN A CA  1 
ATOM   2805 C CA  B GLN A 1 369 ? 36.660  12.621  -4.548  0.57 50.26  ? 369  GLN A CA  1 
ATOM   2806 C C   A GLN A 1 369 ? 36.120  12.140  -5.868  0.43 51.95  ? 369  GLN A C   1 
ATOM   2807 C C   B GLN A 1 369 ? 36.151  12.158  -5.909  0.57 52.01  ? 369  GLN A C   1 
ATOM   2808 O O   A GLN A 1 369 ? 36.513  11.074  -6.334  0.43 55.13  ? 369  GLN A O   1 
ATOM   2809 O O   B GLN A 1 369 ? 36.575  11.120  -6.408  0.57 55.19  ? 369  GLN A O   1 
ATOM   2810 C CB  A GLN A 1 369 ? 36.658  11.514  -3.458  0.43 45.69  ? 369  GLN A CB  1 
ATOM   2811 C CB  B GLN A 1 369 ? 36.574  11.442  -3.562  0.57 45.55  ? 369  GLN A CB  1 
ATOM   2812 C CG  A GLN A 1 369 ? 37.777  11.606  -2.384  0.43 47.56  ? 369  GLN A CG  1 
ATOM   2813 C CG  B GLN A 1 369 ? 35.714  11.689  -2.324  0.57 50.83  ? 369  GLN A CG  1 
ATOM   2814 C CD  A GLN A 1 369 ? 37.463  12.542  -1.207  0.43 45.41  ? 369  GLN A CD  1 
ATOM   2815 C CD  B GLN A 1 369 ? 34.225  11.583  -2.591  0.57 43.04  ? 369  GLN A CD  1 
ATOM   2816 O OE1 A GLN A 1 369 ? 36.627  12.238  -0.349  0.43 42.37  ? 369  GLN A OE1 1 
ATOM   2817 O OE1 B GLN A 1 369 ? 33.477  12.514  -2.323  0.57 38.85  ? 369  GLN A OE1 1 
ATOM   2818 N NE2 A GLN A 1 369 ? 38.155  13.670  -1.155  0.43 41.80  ? 369  GLN A NE2 1 
ATOM   2819 N NE2 B GLN A 1 369 ? 33.789  10.442  -3.113  0.57 42.97  ? 369  GLN A NE2 1 
ATOM   2820 N N   . ALA A 1 370 ? 35.233  12.909  -6.503  1.00 52.85  ? 370  ALA A N   1 
ATOM   2821 C CA  . ALA A 1 370 ? 34.689  12.520  -7.812  1.00 54.61  ? 370  ALA A CA  1 
ATOM   2822 C C   . ALA A 1 370 ? 35.603  12.888  -8.988  1.00 57.33  ? 370  ALA A C   1 
ATOM   2823 O O   . ALA A 1 370 ? 36.161  13.993  -9.046  1.00 52.66  ? 370  ALA A O   1 
ATOM   2824 C CB  . ALA A 1 370 ? 33.297  13.094  -8.029  1.00 43.71  ? 370  ALA A CB  1 
ATOM   2825 N N   . SER A 1 371 ? 35.748  11.939  -9.915  1.00 54.82  ? 371  SER A N   1 
ATOM   2826 C CA  . SER A 1 371 ? 36.324  12.199  -11.229 1.00 54.31  ? 371  SER A CA  1 
ATOM   2827 C C   . SER A 1 371 ? 35.387  13.129  -11.997 1.00 56.48  ? 371  SER A C   1 
ATOM   2828 O O   . SER A 1 371 ? 34.289  13.438  -11.525 1.00 60.14  ? 371  SER A O   1 
ATOM   2829 C CB  . SER A 1 371 ? 36.489  10.892  -12.004 1.00 59.27  ? 371  SER A CB  1 
ATOM   2830 O OG  . SER A 1 371 ? 35.235  10.272  -12.271 1.00 55.81  ? 371  SER A OG  1 
ATOM   2831 N N   . ASP A 1 372 ? 35.810  13.581  -13.173 1.00 54.32  ? 372  ASP A N   1 
ATOM   2832 C CA  . ASP A 1 372 ? 34.971  14.481  -13.955 1.00 59.66  ? 372  ASP A CA  1 
ATOM   2833 C C   . ASP A 1 372 ? 33.692  13.766  -14.361 1.00 57.64  ? 372  ASP A C   1 
ATOM   2834 O O   . ASP A 1 372 ? 32.597  14.339  -14.311 1.00 56.52  ? 372  ASP A O   1 
ATOM   2835 C CB  . ASP A 1 372 ? 35.717  15.002  -15.184 1.00 57.45  ? 372  ASP A CB  1 
ATOM   2836 C CG  . ASP A 1 372 ? 36.790  16.009  -14.826 1.00 64.99  ? 372  ASP A CG  1 
ATOM   2837 O OD1 . ASP A 1 372 ? 37.461  15.824  -13.786 1.00 75.79  ? 372  ASP A OD1 1 
ATOM   2838 O OD2 . ASP A 1 372 ? 36.964  16.987  -15.580 1.00 79.20  ? 372  ASP A OD2 1 
ATOM   2839 N N   . LEU A 1 373 ? 33.840  12.499  -14.733 1.00 53.77  ? 373  LEU A N   1 
ATOM   2840 C CA  . LEU A 1 373 ? 32.703  11.680  -15.125 1.00 55.38  ? 373  LEU A CA  1 
ATOM   2841 C C   . LEU A 1 373 ? 31.716  11.448  -13.968 1.00 58.70  ? 373  LEU A C   1 
ATOM   2842 O O   . LEU A 1 373 ? 30.506  11.611  -14.147 1.00 58.20  ? 373  LEU A O   1 
ATOM   2843 C CB  . LEU A 1 373 ? 33.187  10.354  -15.706 1.00 51.81  ? 373  LEU A CB  1 
ATOM   2844 C CG  . LEU A 1 373 ? 32.115  9.399   -16.230 1.00 61.62  ? 373  LEU A CG  1 
ATOM   2845 C CD1 . LEU A 1 373 ? 31.348  10.012  -17.393 1.00 60.66  ? 373  LEU A CD1 1 
ATOM   2846 C CD2 . LEU A 1 373 ? 32.730  8.063   -16.621 1.00 65.43  ? 373  LEU A CD2 1 
ATOM   2847 N N   . ALA A 1 374 ? 32.219  11.079  -12.789 1.00 58.68  ? 374  ALA A N   1 
ATOM   2848 C CA  . ALA A 1 374 ? 31.341  10.877  -11.630 1.00 55.98  ? 374  ALA A CA  1 
ATOM   2849 C C   . ALA A 1 374 ? 30.602  12.164  -11.233 1.00 52.00  ? 374  ALA A C   1 
ATOM   2850 O O   . ALA A 1 374 ? 29.421  12.122  -10.868 1.00 46.30  ? 374  ALA A O   1 
ATOM   2851 C CB  . ALA A 1 374 ? 32.113  10.309  -10.448 1.00 50.12  ? 374  ALA A CB  1 
ATOM   2852 N N   . ALA A 1 375 ? 31.290  13.304  -11.305 1.00 50.28  ? 375  ALA A N   1 
ATOM   2853 C CA  . ALA A 1 375 ? 30.649  14.588  -11.014 1.00 44.55  ? 375  ALA A CA  1 
ATOM   2854 C C   . ALA A 1 375 ? 29.594  14.903  -12.071 1.00 52.05  ? 375  ALA A C   1 
ATOM   2855 O O   . ALA A 1 375 ? 28.590  15.550  -11.779 1.00 56.29  ? 375  ALA A O   1 
ATOM   2856 C CB  . ALA A 1 375 ? 31.673  15.701  -10.934 1.00 43.62  ? 375  ALA A CB  1 
ATOM   2857 N N   . GLU A 1 376 ? 29.827  14.448  -13.299 1.00 55.08  ? 376  GLU A N   1 
ATOM   2858 C CA  . GLU A 1 376 ? 28.844  14.600  -14.363 1.00 54.09  ? 376  GLU A CA  1 
ATOM   2859 C C   . GLU A 1 376 ? 27.585  13.801  -14.012 1.00 50.92  ? 376  GLU A C   1 
ATOM   2860 O O   . GLU A 1 376 ? 26.466  14.314  -14.123 1.00 49.23  ? 376  GLU A O   1 
ATOM   2861 C CB  . GLU A 1 376 ? 29.428  14.136  -15.701 1.00 64.32  ? 376  GLU A CB  1 
ATOM   2862 C CG  . GLU A 1 376 ? 28.813  14.791  -16.930 1.00 79.26  ? 376  GLU A CG  1 
ATOM   2863 C CD  . GLU A 1 376 ? 29.134  16.274  -17.022 1.00 95.26  ? 376  GLU A CD  1 
ATOM   2864 O OE1 . GLU A 1 376 ? 30.277  16.608  -17.417 1.00 96.66  ? 376  GLU A OE1 1 
ATOM   2865 O OE2 . GLU A 1 376 ? 28.243  17.102  -16.696 1.00 90.69  ? 376  GLU A OE2 1 
ATOM   2866 N N   . ALA A 1 377 ? 27.774  12.556  -13.572 1.00 45.74  ? 377  ALA A N   1 
ATOM   2867 C CA  . ALA A 1 377 ? 26.656  11.723  -13.121 1.00 50.23  ? 377  ALA A CA  1 
ATOM   2868 C C   . ALA A 1 377 ? 25.844  12.367  -11.981 1.00 50.95  ? 377  ALA A C   1 
ATOM   2869 O O   . ALA A 1 377 ? 24.604  12.387  -12.041 1.00 45.46  ? 377  ALA A O   1 
ATOM   2870 C CB  . ALA A 1 377 ? 27.136  10.324  -12.726 1.00 41.15  ? 377  ALA A CB  1 
ATOM   2871 N N   . VAL A 1 378 ? 26.532  12.890  -10.957 1.00 47.39  ? 378  VAL A N   1 
ATOM   2872 C CA  . VAL A 1 378 ? 25.843  13.594  -9.868  1.00 48.68  ? 378  VAL A CA  1 
ATOM   2873 C C   . VAL A 1 378 ? 24.987  14.722  -10.429 1.00 43.10  ? 378  VAL A C   1 
ATOM   2874 O O   . VAL A 1 378 ? 23.788  14.807  -10.146 1.00 46.59  ? 378  VAL A O   1 
ATOM   2875 C CB  . VAL A 1 378 ? 26.808  14.212  -8.817  1.00 48.70  ? 378  VAL A CB  1 
ATOM   2876 C CG1 . VAL A 1 378 ? 26.022  15.073  -7.816  1.00 41.75  ? 378  VAL A CG1 1 
ATOM   2877 C CG2 . VAL A 1 378 ? 27.590  13.130  -8.079  1.00 34.73  ? 378  VAL A CG2 1 
ATOM   2878 N N   . VAL A 1 379 ? 25.609  15.580  -11.230 1.00 42.32  ? 379  VAL A N   1 
ATOM   2879 C CA  . VAL A 1 379 ? 24.923  16.729  -11.817 1.00 47.67  ? 379  VAL A CA  1 
ATOM   2880 C C   . VAL A 1 379 ? 23.731  16.311  -12.673 1.00 43.99  ? 379  VAL A C   1 
ATOM   2881 O O   . VAL A 1 379 ? 22.673  16.934  -12.631 1.00 45.03  ? 379  VAL A O   1 
ATOM   2882 C CB  . VAL A 1 379 ? 25.901  17.601  -12.633 1.00 43.86  ? 379  VAL A CB  1 
ATOM   2883 C CG1 . VAL A 1 379 ? 25.146  18.521  -13.570 1.00 34.03  ? 379  VAL A CG1 1 
ATOM   2884 C CG2 . VAL A 1 379 ? 26.791  18.400  -11.684 1.00 41.56  ? 379  VAL A CG2 1 
ATOM   2885 N N   . LEU A 1 380 ? 23.906  15.235  -13.428 1.00 47.18  ? 380  LEU A N   1 
ATOM   2886 C CA  . LEU A 1 380 ? 22.841  14.705  -14.267 1.00 51.69  ? 380  LEU A CA  1 
ATOM   2887 C C   . LEU A 1 380 ? 21.635  14.264  -13.439 1.00 48.34  ? 380  LEU A C   1 
ATOM   2888 O O   . LEU A 1 380 ? 20.499  14.637  -13.733 1.00 50.93  ? 380  LEU A O   1 
ATOM   2889 C CB  . LEU A 1 380 ? 23.374  13.545  -15.112 1.00 60.24  ? 380  LEU A CB  1 
ATOM   2890 C CG  . LEU A 1 380 ? 23.761  13.935  -16.539 1.00 68.23  ? 380  LEU A CG  1 
ATOM   2891 C CD1 . LEU A 1 380 ? 22.505  13.929  -17.398 1.00 63.79  ? 380  LEU A CD1 1 
ATOM   2892 C CD2 . LEU A 1 380 ? 24.468  15.310  -16.595 1.00 55.25  ? 380  LEU A CD2 1 
ATOM   2893 N N   . HIS A 1 381 ? 21.900  13.495  -12.389 1.00 48.38  ? 381  HIS A N   1 
ATOM   2894 C CA  . HIS A 1 381 ? 20.857  12.982  -11.507 1.00 49.76  ? 381  HIS A CA  1 
ATOM   2895 C C   . HIS A 1 381 ? 20.094  14.078  -10.745 1.00 53.07  ? 381  HIS A C   1 
ATOM   2896 O O   . HIS A 1 381 ? 18.863  14.019  -10.622 1.00 50.60  ? 381  HIS A O   1 
ATOM   2897 C CB  . HIS A 1 381 ? 21.473  11.983  -10.525 1.00 50.59  ? 381  HIS A CB  1 
ATOM   2898 C CG  . HIS A 1 381 ? 20.474  11.287  -9.659  1.00 53.56  ? 381  HIS A CG  1 
ATOM   2899 N ND1 . HIS A 1 381 ? 19.951  10.051  -9.974  1.00 64.74  ? 381  HIS A ND1 1 
ATOM   2900 C CD2 . HIS A 1 381 ? 19.903  11.650  -8.485  1.00 55.26  ? 381  HIS A CD2 1 
ATOM   2901 C CE1 . HIS A 1 381 ? 19.103  9.681   -9.030  1.00 64.19  ? 381  HIS A CE1 1 
ATOM   2902 N NE2 . HIS A 1 381 ? 19.059  10.632  -8.113  1.00 59.42  ? 381  HIS A NE2 1 
ATOM   2903 N N   . TYR A 1 382 ? 20.821  15.083  -10.255 1.00 44.52  ? 382  TYR A N   1 
ATOM   2904 C CA  . TYR A 1 382 ? 20.222  16.114  -9.405  1.00 43.16  ? 382  TYR A CA  1 
ATOM   2905 C C   . TYR A 1 382 ? 19.693  17.355  -10.147 1.00 49.33  ? 382  TYR A C   1 
ATOM   2906 O O   . TYR A 1 382 ? 18.968  18.161  -9.556  1.00 48.76  ? 382  TYR A O   1 
ATOM   2907 C CB  . TYR A 1 382 ? 21.194  16.533  -8.299  1.00 42.23  ? 382  TYR A CB  1 
ATOM   2908 C CG  . TYR A 1 382 ? 21.284  15.528  -7.173  1.00 43.58  ? 382  TYR A CG  1 
ATOM   2909 C CD1 . TYR A 1 382 ? 22.186  14.467  -7.229  1.00 40.21  ? 382  TYR A CD1 1 
ATOM   2910 C CD2 . TYR A 1 382 ? 20.459  15.632  -6.051  1.00 43.93  ? 382  TYR A CD2 1 
ATOM   2911 C CE1 . TYR A 1 382 ? 22.264  13.535  -6.206  1.00 38.04  ? 382  TYR A CE1 1 
ATOM   2912 C CE2 . TYR A 1 382 ? 20.534  14.708  -5.017  1.00 41.34  ? 382  TYR A CE2 1 
ATOM   2913 C CZ  . TYR A 1 382 ? 21.441  13.661  -5.102  1.00 44.20  ? 382  TYR A CZ  1 
ATOM   2914 O OH  . TYR A 1 382 ? 21.533  12.746  -4.077  1.00 47.51  ? 382  TYR A OH  1 
ATOM   2915 N N   . THR A 1 383 ? 20.044  17.519  -11.423 1.00 45.25  ? 383  THR A N   1 
ATOM   2916 C CA  . THR A 1 383 ? 19.416  18.562  -12.229 1.00 41.97  ? 383  THR A CA  1 
ATOM   2917 C C   . THR A 1 383 ? 17.939  18.221  -12.455 1.00 42.29  ? 383  THR A C   1 
ATOM   2918 O O   . THR A 1 383 ? 17.597  17.058  -12.674 1.00 42.79  ? 383  THR A O   1 
ATOM   2919 C CB  . THR A 1 383 ? 20.138  18.756  -13.587 1.00 41.45  ? 383  THR A CB  1 
ATOM   2920 O OG1 . THR A 1 383 ? 21.464  19.229  -13.351 1.00 50.08  ? 383  THR A OG1 1 
ATOM   2921 C CG2 . THR A 1 383 ? 19.420  19.777  -14.462 1.00 42.82  ? 383  THR A CG2 1 
ATOM   2922 N N   . ASP A 1 384 ? 17.072  19.228  -12.354 1.00 42.28  ? 384  ASP A N   1 
ATOM   2923 C CA  . ASP A 1 384 ? 15.690  19.118  -12.797 1.00 46.74  ? 384  ASP A CA  1 
ATOM   2924 C C   . ASP A 1 384 ? 15.644  19.580  -14.265 1.00 52.51  ? 384  ASP A C   1 
ATOM   2925 O O   . ASP A 1 384 ? 15.763  20.778  -14.556 1.00 50.83  ? 384  ASP A O   1 
ATOM   2926 C CB  . ASP A 1 384 ? 14.785  19.981  -11.915 1.00 48.25  ? 384  ASP A CB  1 
ATOM   2927 C CG  . ASP A 1 384 ? 13.367  20.159  -12.485 1.00 60.14  ? 384  ASP A CG  1 
ATOM   2928 O OD1 . ASP A 1 384 ? 12.971  19.449  -13.441 1.00 58.63  ? 384  ASP A OD1 1 
ATOM   2929 O OD2 . ASP A 1 384 ? 12.640  21.027  -11.945 1.00 65.96  ? 384  ASP A OD2 1 
ATOM   2930 N N   . TRP A 1 385 ? 15.461  18.637  -15.191 1.00 48.64  ? 385  TRP A N   1 
ATOM   2931 C CA  . TRP A 1 385 ? 15.588  18.969  -16.611 1.00 49.16  ? 385  TRP A CA  1 
ATOM   2932 C C   . TRP A 1 385 ? 14.429  19.769  -17.228 1.00 51.18  ? 385  TRP A C   1 
ATOM   2933 O O   . TRP A 1 385 ? 14.554  20.267  -18.342 1.00 54.76  ? 385  TRP A O   1 
ATOM   2934 C CB  . TRP A 1 385 ? 15.988  17.748  -17.422 1.00 43.18  ? 385  TRP A CB  1 
ATOM   2935 C CG  . TRP A 1 385 ? 17.323  17.278  -16.977 1.00 45.10  ? 385  TRP A CG  1 
ATOM   2936 C CD1 . TRP A 1 385 ? 17.588  16.283  -16.083 1.00 44.75  ? 385  TRP A CD1 1 
ATOM   2937 C CD2 . TRP A 1 385 ? 18.587  17.815  -17.369 1.00 42.49  ? 385  TRP A CD2 1 
ATOM   2938 N NE1 . TRP A 1 385 ? 18.946  16.160  -15.902 1.00 42.13  ? 385  TRP A NE1 1 
ATOM   2939 C CE2 . TRP A 1 385 ? 19.583  17.089  -16.681 1.00 40.77  ? 385  TRP A CE2 1 
ATOM   2940 C CE3 . TRP A 1 385 ? 18.976  18.847  -18.231 1.00 46.07  ? 385  TRP A CE3 1 
ATOM   2941 C CZ2 . TRP A 1 385 ? 20.944  17.358  -16.827 1.00 47.35  ? 385  TRP A CZ2 1 
ATOM   2942 C CZ3 . TRP A 1 385 ? 20.328  19.116  -18.381 1.00 42.43  ? 385  TRP A CZ3 1 
ATOM   2943 C CH2 . TRP A 1 385 ? 21.297  18.373  -17.681 1.00 49.42  ? 385  TRP A CH2 1 
ATOM   2944 N N   . LEU A 1 386 ? 13.327  19.923  -16.497 1.00 48.99  ? 386  LEU A N   1 
ATOM   2945 C CA  . LEU A 1 386 ? 12.328  20.938  -16.850 1.00 57.89  ? 386  LEU A CA  1 
ATOM   2946 C C   . LEU A 1 386 ? 12.814  22.362  -16.566 1.00 58.88  ? 386  LEU A C   1 
ATOM   2947 O O   . LEU A 1 386 ? 12.580  23.274  -17.364 1.00 69.11  ? 386  LEU A O   1 
ATOM   2948 C CB  . LEU A 1 386 ? 11.026  20.709  -16.092 1.00 61.45  ? 386  LEU A CB  1 
ATOM   2949 C CG  . LEU A 1 386 ? 10.161  19.608  -16.682 1.00 64.67  ? 386  LEU A CG  1 
ATOM   2950 C CD1 . LEU A 1 386 ? 9.724   18.644  -15.586 1.00 62.45  ? 386  LEU A CD1 1 
ATOM   2951 C CD2 . LEU A 1 386 ? 8.971   20.228  -17.388 1.00 66.54  ? 386  LEU A CD2 1 
ATOM   2952 N N   . HIS A 1 387 ? 13.479  22.546  -15.426 1.00 56.99  ? 387  HIS A N   1 
ATOM   2953 C CA  . HIS A 1 387 ? 13.976  23.858  -15.012 1.00 58.61  ? 387  HIS A CA  1 
ATOM   2954 C C   . HIS A 1 387 ? 15.459  23.837  -14.605 1.00 55.49  ? 387  HIS A C   1 
ATOM   2955 O O   . HIS A 1 387 ? 15.780  24.157  -13.457 1.00 56.18  ? 387  HIS A O   1 
ATOM   2956 C CB  . HIS A 1 387 ? 13.147  24.375  -13.826 1.00 61.18  ? 387  HIS A CB  1 
ATOM   2957 C CG  . HIS A 1 387 ? 11.664  24.228  -14.001 1.00 66.26  ? 387  HIS A CG  1 
ATOM   2958 N ND1 . HIS A 1 387 ? 10.959  23.149  -13.508 1.00 62.15  ? 387  HIS A ND1 1 
ATOM   2959 C CD2 . HIS A 1 387 ? 10.749  25.030  -14.602 1.00 70.52  ? 387  HIS A CD2 1 
ATOM   2960 C CE1 . HIS A 1 387 ? 9.678   23.290  -13.800 1.00 65.97  ? 387  HIS A CE1 1 
ATOM   2961 N NE2 . HIS A 1 387 ? 9.523   24.422  -14.466 1.00 69.07  ? 387  HIS A NE2 1 
ATOM   2962 N N   . PRO A 1 388 ? 16.360  23.490  -15.548 1.00 52.71  ? 388  PRO A N   1 
ATOM   2963 C CA  . PRO A 1 388 ? 17.796  23.253  -15.314 1.00 50.38  ? 388  PRO A CA  1 
ATOM   2964 C C   . PRO A 1 388 ? 18.540  24.448  -14.740 1.00 46.88  ? 388  PRO A C   1 
ATOM   2965 O O   . PRO A 1 388 ? 19.658  24.265  -14.243 1.00 51.13  ? 388  PRO A O   1 
ATOM   2966 C CB  . PRO A 1 388 ? 18.350  22.984  -16.728 1.00 47.79  ? 388  PRO A CB  1 
ATOM   2967 C CG  . PRO A 1 388 ? 17.174  22.635  -17.557 1.00 44.86  ? 388  PRO A CG  1 
ATOM   2968 C CD  . PRO A 1 388 ? 16.026  23.405  -16.982 1.00 52.20  ? 388  PRO A CD  1 
ATOM   2969 N N   . GLU A 1 389 ? 17.953  25.643  -14.833 1.00 47.22  ? 389  GLU A N   1 
ATOM   2970 C CA  . GLU A 1 389 ? 18.649  26.876  -14.456 1.00 49.50  ? 389  GLU A CA  1 
ATOM   2971 C C   . GLU A 1 389 ? 17.945  27.617  -13.332 1.00 45.91  ? 389  GLU A C   1 
ATOM   2972 O O   . GLU A 1 389 ? 18.334  28.734  -12.988 1.00 50.17  ? 389  GLU A O   1 
ATOM   2973 C CB  . GLU A 1 389 ? 18.782  27.830  -15.653 1.00 47.03  ? 389  GLU A CB  1 
ATOM   2974 C CG  . GLU A 1 389 ? 19.375  27.219  -16.924 1.00 56.82  ? 389  GLU A CG  1 
ATOM   2975 C CD  . GLU A 1 389 ? 20.891  27.392  -17.040 1.00 75.14  ? 389  GLU A CD  1 
ATOM   2976 O OE1 . GLU A 1 389 ? 21.458  28.305  -16.382 1.00 73.83  ? 389  GLU A OE1 1 
ATOM   2977 O OE2 . GLU A 1 389 ? 21.517  26.616  -17.806 1.00 74.75  ? 389  GLU A OE2 1 
ATOM   2978 N N   . ASP A 1 390 ? 16.902  27.004  -12.779 1.00 44.48  ? 390  ASP A N   1 
ATOM   2979 C CA  . ASP A 1 390 ? 16.112  27.625  -11.720 1.00 47.45  ? 390  ASP A CA  1 
ATOM   2980 C C   . ASP A 1 390 ? 16.893  27.690  -10.387 1.00 47.19  ? 390  ASP A C   1 
ATOM   2981 O O   . ASP A 1 390 ? 17.251  26.653  -9.800  1.00 41.31  ? 390  ASP A O   1 
ATOM   2982 C CB  . ASP A 1 390 ? 14.784  26.878  -11.538 1.00 44.99  ? 390  ASP A CB  1 
ATOM   2983 C CG  . ASP A 1 390 ? 13.953  27.452  -10.408 1.00 47.68  ? 390  ASP A CG  1 
ATOM   2984 O OD1 . ASP A 1 390 ? 13.468  28.592  -10.539 1.00 53.78  ? 390  ASP A OD1 1 
ATOM   2985 O OD2 . ASP A 1 390 ? 13.796  26.779  -9.379  1.00 55.26  ? 390  ASP A OD2 1 
ATOM   2986 N N   . PRO A 1 391 ? 17.157  28.916  -9.913  1.00 45.56  ? 391  PRO A N   1 
ATOM   2987 C CA  . PRO A 1 391 ? 18.004  29.196  -8.742  1.00 47.89  ? 391  PRO A CA  1 
ATOM   2988 C C   . PRO A 1 391 ? 17.521  28.517  -7.463  1.00 47.92  ? 391  PRO A C   1 
ATOM   2989 O O   . PRO A 1 391 ? 18.361  28.075  -6.681  1.00 49.62  ? 391  PRO A O   1 
ATOM   2990 C CB  . PRO A 1 391 ? 17.909  30.721  -8.590  1.00 45.96  ? 391  PRO A CB  1 
ATOM   2991 C CG  . PRO A 1 391 ? 17.542  31.218  -9.958  1.00 48.05  ? 391  PRO A CG  1 
ATOM   2992 C CD  . PRO A 1 391 ? 16.652  30.149  -10.541 1.00 41.60  ? 391  PRO A CD  1 
ATOM   2993 N N   . THR A 1 392 ? 16.207  28.445  -7.246  1.00 48.94  ? 392  THR A N   1 
ATOM   2994 C CA  . THR A 1 392 ? 15.677  27.769  -6.062  1.00 43.42  ? 392  THR A CA  1 
ATOM   2995 C C   . THR A 1 392 ? 15.885  26.243  -6.108  1.00 46.70  ? 392  THR A C   1 
ATOM   2996 O O   . THR A 1 392 ? 16.249  25.638  -5.092  1.00 42.13  ? 392  THR A O   1 
ATOM   2997 C CB  . THR A 1 392 ? 14.204  28.120  -5.800  1.00 44.56  ? 392  THR A CB  1 
ATOM   2998 O OG1 . THR A 1 392 ? 14.110  29.493  -5.399  1.00 51.17  ? 392  THR A OG1 1 
ATOM   2999 C CG2 . THR A 1 392 ? 13.642  27.271  -4.678  1.00 47.30  ? 392  THR A CG2 1 
ATOM   3000 N N   A HIS A 1 393 ? 15.668  25.624  -7.267  0.54 44.90  ? 393  HIS A N   1 
ATOM   3001 N N   B HIS A 1 393 ? 15.687  25.581  -7.228  0.46 44.91  ? 393  HIS A N   1 
ATOM   3002 C CA  A HIS A 1 393 ? 15.931  24.194  -7.371  0.54 43.60  ? 393  HIS A CA  1 
ATOM   3003 C CA  B HIS A 1 393 ? 16.006  24.205  -7.367  0.46 43.63  ? 393  HIS A CA  1 
ATOM   3004 C C   A HIS A 1 393 ? 17.404  23.891  -7.217  0.54 45.17  ? 393  HIS A C   1 
ATOM   3005 C C   B HIS A 1 393 ? 17.421  23.984  -7.133  0.46 45.16  ? 393  HIS A C   1 
ATOM   3006 O O   A HIS A 1 393 ? 17.769  22.950  -6.516  0.54 48.17  ? 393  HIS A O   1 
ATOM   3007 O O   B HIS A 1 393 ? 17.739  22.935  -6.670  0.46 48.11  ? 393  HIS A O   1 
ATOM   3008 C CB  A HIS A 1 393 ? 15.465  23.578  -8.683  0.54 44.11  ? 393  HIS A CB  1 
ATOM   3009 C CB  B HIS A 1 393 ? 15.685  23.701  -8.747  0.46 44.05  ? 393  HIS A CB  1 
ATOM   3010 C CG  A HIS A 1 393 ? 15.819  22.129  -8.795  0.54 45.34  ? 393  HIS A CG  1 
ATOM   3011 C CG  B HIS A 1 393 ? 14.231  23.420  -8.968  0.46 47.99  ? 393  HIS A CG  1 
ATOM   3012 N ND1 A HIS A 1 393 ? 15.052  21.131  -8.228  0.54 50.84  ? 393  HIS A ND1 1 
ATOM   3013 N ND1 B HIS A 1 393 ? 13.422  24.278  -9.572  0.46 51.43  ? 393  HIS A ND1 1 
ATOM   3014 C CD2 A HIS A 1 393 ? 16.892  21.510  -9.343  0.54 42.04  ? 393  HIS A CD2 1 
ATOM   3015 C CD2 B HIS A 1 393 ? 13.449  22.318  -8.636  0.46 47.99  ? 393  HIS A CD2 1 
ATOM   3016 C CE1 A HIS A 1 393 ? 15.617  19.959  -8.458  0.54 51.36  ? 393  HIS A CE1 1 
ATOM   3017 C CE1 B HIS A 1 393 ? 12.187  23.760  -9.630  0.46 42.28  ? 393  HIS A CE1 1 
ATOM   3018 N NE2 A HIS A 1 393 ? 16.737  20.162  -9.132  0.54 48.09  ? 393  HIS A NE2 1 
ATOM   3019 N NE2 B HIS A 1 393 ? 12.211  22.564  -9.055  0.46 47.08  ? 393  HIS A NE2 1 
ATOM   3020 N N   . LEU A 1 394 ? 18.244  24.670  -7.895  1.00 43.31  ? 394  LEU A N   1 
ATOM   3021 C CA  . LEU A 1 394 ? 19.691  24.467  -7.831  1.00 39.67  ? 394  LEU A CA  1 
ATOM   3022 C C   . LEU A 1 394 ? 20.217  24.595  -6.392  1.00 46.45  ? 394  LEU A C   1 
ATOM   3023 O O   . LEU A 1 394 ? 21.016  23.766  -5.938  1.00 36.43  ? 394  LEU A O   1 
ATOM   3024 C CB  . LEU A 1 394 ? 20.412  25.435  -8.775  1.00 36.31  ? 394  LEU A CB  1 
ATOM   3025 C CG  . LEU A 1 394 ? 20.207  25.118  -10.263 1.00 43.36  ? 394  LEU A CG  1 
ATOM   3026 C CD1 . LEU A 1 394 ? 20.698  26.256  -11.166 1.00 36.63  ? 394  LEU A CD1 1 
ATOM   3027 C CD2 . LEU A 1 394 ? 20.878  23.791  -10.637 1.00 34.48  ? 394  LEU A CD2 1 
ATOM   3028 N N   . ARG A 1 395 ? 19.748  25.619  -5.677  1.00 43.84  ? 395  ARG A N   1 
ATOM   3029 C CA  . ARG A 1 395 ? 20.085  25.777  -4.271  1.00 40.15  ? 395  ARG A CA  1 
ATOM   3030 C C   . ARG A 1 395 ? 19.688  24.516  -3.479  1.00 44.96  ? 395  ARG A C   1 
ATOM   3031 O O   . ARG A 1 395 ? 20.508  23.948  -2.763  1.00 44.61  ? 395  ARG A O   1 
ATOM   3032 C CB  . ARG A 1 395 ? 19.433  27.038  -3.697  1.00 38.97  ? 395  ARG A CB  1 
ATOM   3033 C CG  . ARG A 1 395 ? 19.527  27.184  -2.173  1.00 39.27  ? 395  ARG A CG  1 
ATOM   3034 C CD  . ARG A 1 395 ? 18.152  27.045  -1.554  1.00 41.73  ? 395  ARG A CD  1 
ATOM   3035 N NE  . ARG A 1 395 ? 17.453  28.308  -1.323  1.00 49.20  ? 395  ARG A NE  1 
ATOM   3036 C CZ  . ARG A 1 395 ? 16.134  28.411  -1.152  1.00 47.03  ? 395  ARG A CZ  1 
ATOM   3037 N NH1 . ARG A 1 395 ? 15.360  27.329  -1.211  1.00 35.98  ? 395  ARG A NH1 1 
ATOM   3038 N NH2 . ARG A 1 395 ? 15.586  29.604  -0.934  1.00 50.45  ? 395  ARG A NH2 1 
ATOM   3039 N N   . ASP A 1 396 ? 18.454  24.047  -3.648  1.00 44.00  ? 396  ASP A N   1 
ATOM   3040 C CA  . ASP A 1 396 ? 17.984  22.886  -2.894  1.00 41.85  ? 396  ASP A CA  1 
ATOM   3041 C C   . ASP A 1 396 ? 18.646  21.591  -3.345  1.00 41.07  ? 396  ASP A C   1 
ATOM   3042 O O   . ASP A 1 396 ? 18.818  20.670  -2.555  1.00 44.95  ? 396  ASP A O   1 
ATOM   3043 C CB  . ASP A 1 396 ? 16.457  22.769  -2.958  1.00 42.27  ? 396  ASP A CB  1 
ATOM   3044 C CG  . ASP A 1 396 ? 15.759  23.954  -2.297  1.00 51.15  ? 396  ASP A CG  1 
ATOM   3045 O OD1 . ASP A 1 396 ? 16.413  24.624  -1.457  1.00 48.03  ? 396  ASP A OD1 1 
ATOM   3046 O OD2 . ASP A 1 396 ? 14.573  24.221  -2.612  1.00 49.20  ? 396  ASP A OD2 1 
ATOM   3047 N N   . ALA A 1 397 ? 19.037  21.526  -4.610  1.00 40.08  ? 397  ALA A N   1 
ATOM   3048 C CA  . ALA A 1 397 ? 19.695  20.331  -5.114  1.00 44.38  ? 397  ALA A CA  1 
ATOM   3049 C C   . ALA A 1 397 ? 21.103  20.224  -4.537  1.00 45.57  ? 397  ALA A C   1 
ATOM   3050 O O   . ALA A 1 397 ? 21.572  19.124  -4.230  1.00 43.70  ? 397  ALA A O   1 
ATOM   3051 C CB  . ALA A 1 397 ? 19.724  20.320  -6.638  1.00 38.84  ? 397  ALA A CB  1 
ATOM   3052 N N   . MET A 1 398 ? 21.768  21.366  -4.377  1.00 42.51  ? 398  MET A N   1 
ATOM   3053 C CA  . MET A 1 398 ? 23.111  21.391  -3.809  1.00 41.46  ? 398  MET A CA  1 
ATOM   3054 C C   . MET A 1 398 ? 23.079  20.867  -2.368  1.00 43.89  ? 398  MET A C   1 
ATOM   3055 O O   . MET A 1 398 ? 23.944  20.086  -1.962  1.00 38.67  ? 398  MET A O   1 
ATOM   3056 C CB  . MET A 1 398 ? 23.700  22.809  -3.845  1.00 38.88  ? 398  MET A CB  1 
ATOM   3057 C CG  . MET A 1 398 ? 25.176  22.868  -3.455  1.00 36.10  ? 398  MET A CG  1 
ATOM   3058 S SD  . MET A 1 398 ? 26.229  22.031  -4.646  1.00 43.41  ? 398  MET A SD  1 
ATOM   3059 C CE  . MET A 1 398 ? 26.800  20.624  -3.707  1.00 37.75  ? 398  MET A CE  1 
ATOM   3060 N N   . SER A 1 399 ? 22.071  21.298  -1.610  1.00 39.52  ? 399  SER A N   1 
ATOM   3061 C CA  . SER A 1 399 ? 21.861  20.795  -0.259  1.00 44.03  ? 399  SER A CA  1 
ATOM   3062 C C   . SER A 1 399 ? 21.613  19.282  -0.256  1.00 38.93  ? 399  SER A C   1 
ATOM   3063 O O   . SER A 1 399 ? 22.194  18.548  0.544   1.00 39.35  ? 399  SER A O   1 
ATOM   3064 C CB  . SER A 1 399 ? 20.700  21.529  0.405   1.00 42.83  ? 399  SER A CB  1 
ATOM   3065 O OG  . SER A 1 399 ? 20.373  20.951  1.656   1.00 45.62  ? 399  SER A OG  1 
ATOM   3066 N N   . ALA A 1 400 ? 20.766  18.821  -1.168  1.00 42.27  ? 400  ALA A N   1 
ATOM   3067 C CA  . ALA A 1 400 ? 20.452  17.396  -1.278  1.00 43.08  ? 400  ALA A CA  1 
ATOM   3068 C C   . ALA A 1 400 ? 21.687  16.564  -1.627  1.00 40.40  ? 400  ALA A C   1 
ATOM   3069 O O   . ALA A 1 400 ? 21.881  15.486  -1.073  1.00 36.98  ? 400  ALA A O   1 
ATOM   3070 C CB  . ALA A 1 400 ? 19.328  17.162  -2.290  1.00 34.60  ? 400  ALA A CB  1 
ATOM   3071 N N   . VAL A 1 401 ? 22.520  17.069  -2.537  1.00 39.51  ? 401  VAL A N   1 
ATOM   3072 C CA  . VAL A 1 401 ? 23.755  16.375  -2.916  1.00 41.55  ? 401  VAL A CA  1 
ATOM   3073 C C   . VAL A 1 401 ? 24.661  16.122  -1.704  1.00 39.13  ? 401  VAL A C   1 
ATOM   3074 O O   . VAL A 1 401 ? 25.149  15.011  -1.515  1.00 41.57  ? 401  VAL A O   1 
ATOM   3075 C CB  . VAL A 1 401 ? 24.540  17.148  -4.014  1.00 41.99  ? 401  VAL A CB  1 
ATOM   3076 C CG1 . VAL A 1 401 ? 25.984  16.648  -4.108  1.00 30.87  ? 401  VAL A CG1 1 
ATOM   3077 C CG2 . VAL A 1 401 ? 23.831  17.026  -5.362  1.00 37.82  ? 401  VAL A CG2 1 
ATOM   3078 N N   . VAL A 1 402 ? 24.859  17.152  -0.885  1.00 37.11  ? 402  VAL A N   1 
ATOM   3079 C CA  . VAL A 1 402 ? 25.713  17.051  0.286   1.00 37.63  ? 402  VAL A CA  1 
ATOM   3080 C C   . VAL A 1 402 ? 25.110  16.123  1.352   1.00 42.28  ? 402  VAL A C   1 
ATOM   3081 O O   . VAL A 1 402 ? 25.791  15.225  1.865   1.00 38.49  ? 402  VAL A O   1 
ATOM   3082 C CB  . VAL A 1 402 ? 26.018  18.451  0.846   1.00 42.15  ? 402  VAL A CB  1 
ATOM   3083 C CG1 . VAL A 1 402 ? 26.582  18.383  2.264   1.00 37.56  ? 402  VAL A CG1 1 
ATOM   3084 C CG2 . VAL A 1 402 ? 26.964  19.169  -0.093  1.00 39.31  ? 402  VAL A CG2 1 
ATOM   3085 N N   . GLY A 1 403 ? 23.826  16.315  1.645   1.00 38.89  ? 403  GLY A N   1 
ATOM   3086 C CA  . GLY A 1 403 ? 23.137  15.499  2.630   1.00 38.37  ? 403  GLY A CA  1 
ATOM   3087 C C   . GLY A 1 403 ? 23.059  14.028  2.283   1.00 43.08  ? 403  GLY A C   1 
ATOM   3088 O O   . GLY A 1 403 ? 23.334  13.174  3.134   1.00 47.69  ? 403  GLY A O   1 
ATOM   3089 N N   . ASP A 1 404 ? 22.685  13.727  1.040   1.00 41.85  ? 404  ASP A N   1 
ATOM   3090 C CA  . ASP A 1 404 ? 22.539  12.347  0.587   1.00 38.14  ? 404  ASP A CA  1 
ATOM   3091 C C   . ASP A 1 404 ? 23.878  11.625  0.571   1.00 46.52  ? 404  ASP A C   1 
ATOM   3092 O O   . ASP A 1 404 ? 23.987  10.484  1.022   1.00 45.15  ? 404  ASP A O   1 
ATOM   3093 C CB  . ASP A 1 404 ? 21.953  12.292  -0.827  1.00 40.67  ? 404  ASP A CB  1 
ATOM   3094 C CG  . ASP A 1 404 ? 20.551  12.846  -0.906  1.00 44.98  ? 404  ASP A CG  1 
ATOM   3095 O OD1 . ASP A 1 404 ? 19.906  13.027  0.159   1.00 44.01  ? 404  ASP A OD1 1 
ATOM   3096 O OD2 . ASP A 1 404 ? 20.093  13.098  -2.044  1.00 47.06  ? 404  ASP A OD2 1 
ATOM   3097 N N   . HIS A 1 405 ? 24.893  12.290  0.027   1.00 43.65  ? 405  HIS A N   1 
ATOM   3098 C CA  . HIS A 1 405 ? 26.214  11.696  -0.086  1.00 39.50  ? 405  HIS A CA  1 
ATOM   3099 C C   . HIS A 1 405 ? 26.823  11.406  1.299   1.00 41.95  ? 405  HIS A C   1 
ATOM   3100 O O   . HIS A 1 405 ? 27.468  10.364  1.513   1.00 37.44  ? 405  HIS A O   1 
ATOM   3101 C CB  . HIS A 1 405 ? 27.125  12.632  -0.881  1.00 37.11  ? 405  HIS A CB  1 
ATOM   3102 C CG  . HIS A 1 405 ? 28.531  12.141  -1.021  1.00 40.53  ? 405  HIS A CG  1 
ATOM   3103 N ND1 . HIS A 1 405 ? 28.837  10.833  -1.335  1.00 34.30  ? 405  HIS A ND1 1 
ATOM   3104 C CD2 . HIS A 1 405 ? 29.717  12.791  -0.903  1.00 37.31  ? 405  HIS A CD2 1 
ATOM   3105 C CE1 . HIS A 1 405 ? 30.150  10.699  -1.412  1.00 37.21  ? 405  HIS A CE1 1 
ATOM   3106 N NE2 . HIS A 1 405 ? 30.706  11.872  -1.157  1.00 37.01  ? 405  HIS A NE2 1 
ATOM   3107 N N   . ASN A 1 406 ? 26.611  12.315  2.247   1.00 40.19  ? 406  ASN A N   1 
ATOM   3108 C CA  . ASN A 1 406 ? 27.328  12.223  3.519   1.00 38.73  ? 406  ASN A CA  1 
ATOM   3109 C C   . ASN A 1 406 ? 26.574  11.513  4.642   1.00 39.58  ? 406  ASN A C   1 
ATOM   3110 O O   . ASN A 1 406 ? 27.185  10.928  5.527   1.00 35.55  ? 406  ASN A O   1 
ATOM   3111 C CB  . ASN A 1 406 ? 27.782  13.604  3.975   1.00 36.68  ? 406  ASN A CB  1 
ATOM   3112 C CG  . ASN A 1 406 ? 28.896  14.157  3.116   1.00 37.10  ? 406  ASN A CG  1 
ATOM   3113 O OD1 . ASN A 1 406 ? 29.943  13.532  2.960   1.00 42.05  ? 406  ASN A OD1 1 
ATOM   3114 N ND2 . ASN A 1 406 ? 28.668  15.329  2.536   1.00 40.17  ? 406  ASN A ND2 1 
ATOM   3115 N N   . VAL A 1 407 ? 25.247  11.559  4.606   1.00 40.07  ? 407  VAL A N   1 
ATOM   3116 C CA  . VAL A 1 407 ? 24.460  11.046  5.721   1.00 38.88  ? 407  VAL A CA  1 
ATOM   3117 C C   . VAL A 1 407 ? 23.363  10.085  5.265   1.00 43.63  ? 407  VAL A C   1 
ATOM   3118 O O   . VAL A 1 407 ? 23.434  8.889   5.574   1.00 38.01  ? 407  VAL A O   1 
ATOM   3119 C CB  . VAL A 1 407 ? 23.843  12.196  6.574   1.00 36.18  ? 407  VAL A CB  1 
ATOM   3120 C CG1 . VAL A 1 407 ? 23.072  11.637  7.765   1.00 31.97  ? 407  VAL A CG1 1 
ATOM   3121 C CG2 . VAL A 1 407 ? 24.936  13.166  7.040   1.00 33.09  ? 407  VAL A CG2 1 
ATOM   3122 N N   . VAL A 1 408 ? 22.374  10.604  4.523   1.00 44.73  ? 408  VAL A N   1 
ATOM   3123 C CA  . VAL A 1 408 ? 21.163  9.841   4.192   1.00 42.76  ? 408  VAL A CA  1 
ATOM   3124 C C   . VAL A 1 408 ? 21.465  8.525   3.491   1.00 47.08  ? 408  VAL A C   1 
ATOM   3125 O O   . VAL A 1 408 ? 20.931  7.481   3.868   1.00 48.39  ? 408  VAL A O   1 
ATOM   3126 C CB  . VAL A 1 408 ? 20.164  10.636  3.330   1.00 44.15  ? 408  VAL A CB  1 
ATOM   3127 C CG1 . VAL A 1 408 ? 18.879  9.834   3.149   1.00 43.09  ? 408  VAL A CG1 1 
ATOM   3128 C CG2 . VAL A 1 408 ? 19.856  12.003  3.958   1.00 40.77  ? 408  VAL A CG2 1 
ATOM   3129 N N   . CYS A 1 409 ? 22.337  8.551   2.492   1.00 38.08  ? 409  CYS A N   1 
ATOM   3130 C CA  . CYS A 1 409 ? 22.656  7.296   1.818   1.00 39.80  ? 409  CYS A CA  1 
ATOM   3131 C C   . CYS A 1 409 ? 23.564  6.341   2.611   1.00 46.00  ? 409  CYS A C   1 
ATOM   3132 O O   . CYS A 1 409 ? 23.313  5.140   2.628   1.00 48.19  ? 409  CYS A O   1 
ATOM   3133 C CB  . CYS A 1 409 ? 23.095  7.524   0.367   1.00 43.20  ? 409  CYS A CB  1 
ATOM   3134 S SG  . CYS A 1 409 ? 21.688  8.184   -0.604  1.00 47.47  ? 409  CYS A SG  1 
ATOM   3135 N N   . PRO A 1 410 ? 24.599  6.867   3.290   1.00 46.39  ? 410  PRO A N   1 
ATOM   3136 C CA  . PRO A 1 410 ? 25.302  6.017   4.266   1.00 44.16  ? 410  PRO A CA  1 
ATOM   3137 C C   . PRO A 1 410 ? 24.387  5.372   5.329   1.00 38.68  ? 410  PRO A C   1 
ATOM   3138 O O   . PRO A 1 410 ? 24.599  4.210   5.689   1.00 40.84  ? 410  PRO A O   1 
ATOM   3139 C CB  . PRO A 1 410 ? 26.270  6.995   4.922   1.00 37.34  ? 410  PRO A CB  1 
ATOM   3140 C CG  . PRO A 1 410 ? 26.617  7.941   3.801   1.00 40.43  ? 410  PRO A CG  1 
ATOM   3141 C CD  . PRO A 1 410 ? 25.342  8.113   3.013   1.00 37.77  ? 410  PRO A CD  1 
ATOM   3142 N N   . VAL A 1 411 ? 23.388  6.106   5.811   1.00 42.72  ? 411  VAL A N   1 
ATOM   3143 C CA  . VAL A 1 411 ? 22.454  5.587   6.820   1.00 38.70  ? 411  VAL A CA  1 
ATOM   3144 C C   . VAL A 1 411 ? 21.544  4.491   6.237   1.00 47.13  ? 411  VAL A C   1 
ATOM   3145 O O   . VAL A 1 411 ? 21.359  3.434   6.850   1.00 49.32  ? 411  VAL A O   1 
ATOM   3146 C CB  . VAL A 1 411 ? 21.620  6.732   7.466   1.00 37.78  ? 411  VAL A CB  1 
ATOM   3147 C CG1 . VAL A 1 411 ? 20.445  6.189   8.234   1.00 36.33  ? 411  VAL A CG1 1 
ATOM   3148 C CG2 . VAL A 1 411 ? 22.494  7.610   8.365   1.00 37.93  ? 411  VAL A CG2 1 
ATOM   3149 N N   . ALA A 1 412 ? 20.990  4.737   5.050   1.00 43.74  ? 412  ALA A N   1 
ATOM   3150 C CA  . ALA A 1 412 ? 20.214  3.712   4.341   1.00 46.73  ? 412  ALA A CA  1 
ATOM   3151 C C   . ALA A 1 412 ? 21.028  2.430   4.091   1.00 45.17  ? 412  ALA A C   1 
ATOM   3152 O O   . ALA A 1 412 ? 20.535  1.318   4.300   1.00 46.66  ? 412  ALA A O   1 
ATOM   3153 C CB  . ALA A 1 412 ? 19.678  4.259   3.039   1.00 43.61  ? 412  ALA A CB  1 
ATOM   3154 N N   . GLN A 1 413 ? 22.266  2.600   3.638   1.00 42.03  ? 413  GLN A N   1 
ATOM   3155 C CA  . GLN A 1 413 ? 23.194  1.489   3.451   1.00 42.90  ? 413  GLN A CA  1 
ATOM   3156 C C   . GLN A 1 413 ? 23.377  0.705   4.761   1.00 52.21  ? 413  GLN A C   1 
ATOM   3157 O O   . GLN A 1 413 ? 23.202  -0.515  4.796   1.00 47.81  ? 413  GLN A O   1 
ATOM   3158 C CB  . GLN A 1 413 ? 24.538  2.022   2.940   1.00 44.43  ? 413  GLN A CB  1 
ATOM   3159 C CG  . GLN A 1 413 ? 25.675  1.019   2.907   1.00 50.47  ? 413  GLN A CG  1 
ATOM   3160 C CD  . GLN A 1 413 ? 25.932  0.492   1.516   1.00 72.67  ? 413  GLN A CD  1 
ATOM   3161 O OE1 . GLN A 1 413 ? 25.176  -0.347  0.998   1.00 73.03  ? 413  GLN A OE1 1 
ATOM   3162 N NE2 . GLN A 1 413 ? 27.000  0.990   0.887   1.00 76.45  ? 413  GLN A NE2 1 
ATOM   3163 N N   . LEU A 1 414 ? 23.706  1.416   5.839   1.00 53.89  ? 414  LEU A N   1 
ATOM   3164 C CA  . LEU A 1 414 ? 23.877  0.792   7.149   1.00 48.88  ? 414  LEU A CA  1 
ATOM   3165 C C   . LEU A 1 414 ? 22.609  0.079   7.661   1.00 48.72  ? 414  LEU A C   1 
ATOM   3166 O O   . LEU A 1 414 ? 22.706  -1.037  8.178   1.00 53.48  ? 414  LEU A O   1 
ATOM   3167 C CB  . LEU A 1 414 ? 24.376  1.815   8.183   1.00 45.25  ? 414  LEU A CB  1 
ATOM   3168 C CG  . LEU A 1 414 ? 24.429  1.352   9.649   1.00 39.75  ? 414  LEU A CG  1 
ATOM   3169 C CD1 . LEU A 1 414 ? 25.650  0.499   9.898   1.00 42.84  ? 414  LEU A CD1 1 
ATOM   3170 C CD2 . LEU A 1 414 ? 24.394  2.528   10.607  1.00 46.48  ? 414  LEU A CD2 1 
ATOM   3171 N N   . ALA A 1 415 ? 21.440  0.716   7.534   1.00 44.53  ? 415  ALA A N   1 
ATOM   3172 C CA  . ALA A 1 415 ? 20.177  0.119   8.009   1.00 47.91  ? 415  ALA A CA  1 
ATOM   3173 C C   . ALA A 1 415 ? 19.854  -1.212  7.296   1.00 55.82  ? 415  ALA A C   1 
ATOM   3174 O O   . ALA A 1 415 ? 19.465  -2.211  7.928   1.00 51.73  ? 415  ALA A O   1 
ATOM   3175 C CB  . ALA A 1 415 ? 19.016  1.105   7.857   1.00 34.86  ? 415  ALA A CB  1 
ATOM   3176 N N   . GLY A 1 416 ? 20.012  -1.213  5.977   1.00 51.90  ? 416  GLY A N   1 
ATOM   3177 C CA  . GLY A 1 416 ? 19.775  -2.403  5.191   1.00 57.95  ? 416  GLY A CA  1 
ATOM   3178 C C   . GLY A 1 416 ? 20.739  -3.524  5.525   1.00 57.38  ? 416  GLY A C   1 
ATOM   3179 O O   . GLY A 1 416 ? 20.319  -4.671  5.669   1.00 59.48  ? 416  GLY A O   1 
ATOM   3180 N N   . ARG A 1 417 ? 22.025  -3.209  5.649   1.00 53.91  ? 417  ARG A N   1 
ATOM   3181 C CA  . ARG A 1 417 ? 23.011  -4.255  5.914   1.00 59.61  ? 417  ARG A CA  1 
ATOM   3182 C C   . ARG A 1 417 ? 22.853  -4.840  7.323   1.00 60.27  ? 417  ARG A C   1 
ATOM   3183 O O   . ARG A 1 417 ? 23.094  -6.029  7.539   1.00 61.03  ? 417  ARG A O   1 
ATOM   3184 C CB  . ARG A 1 417 ? 24.443  -3.771  5.645   1.00 52.06  ? 417  ARG A CB  1 
ATOM   3185 C CG  . ARG A 1 417 ? 24.717  -3.410  4.181   1.00 65.72  ? 417  ARG A CG  1 
ATOM   3186 C CD  . ARG A 1 417 ? 23.980  -4.332  3.201   1.00 77.21  ? 417  ARG A CD  1 
ATOM   3187 N NE  . ARG A 1 417 ? 24.502  -5.697  3.235   1.00 92.49  ? 417  ARG A NE  1 
ATOM   3188 C CZ  . ARG A 1 417 ? 25.404  -6.177  2.379   1.00 98.95  ? 417  ARG A CZ  1 
ATOM   3189 N NH1 . ARG A 1 417 ? 25.879  -5.403  1.404   1.00 94.07  ? 417  ARG A NH1 1 
ATOM   3190 N NH2 . ARG A 1 417 ? 25.830  -7.433  2.498   1.00 94.03  ? 417  ARG A NH2 1 
ATOM   3191 N N   . LEU A 1 418 ? 22.421  -4.010  8.269   1.00 56.74  ? 418  LEU A N   1 
ATOM   3192 C CA  . LEU A 1 418 ? 22.150  -4.479  9.623   1.00 54.27  ? 418  LEU A CA  1 
ATOM   3193 C C   . LEU A 1 418 ? 20.910  -5.381  9.680   1.00 57.04  ? 418  LEU A C   1 
ATOM   3194 O O   . LEU A 1 418 ? 20.949  -6.461  10.279  1.00 54.82  ? 418  LEU A O   1 
ATOM   3195 C CB  . LEU A 1 418 ? 21.986  -3.300  10.583  1.00 51.43  ? 418  LEU A CB  1 
ATOM   3196 C CG  . LEU A 1 418 ? 23.153  -2.957  11.512  1.00 53.27  ? 418  LEU A CG  1 
ATOM   3197 C CD1 . LEU A 1 418 ? 24.483  -3.291  10.869  1.00 55.31  ? 418  LEU A CD1 1 
ATOM   3198 C CD2 . LEU A 1 418 ? 23.086  -1.476  11.881  1.00 46.12  ? 418  LEU A CD2 1 
ATOM   3199 N N   . ALA A 1 419 ? 19.818  -4.938  9.060   1.00 52.83  ? 419  ALA A N   1 
ATOM   3200 C CA  . ALA A 1 419 ? 18.577  -5.711  9.048   1.00 51.44  ? 419  ALA A CA  1 
ATOM   3201 C C   . ALA A 1 419 ? 18.775  -7.095  8.381   1.00 66.30  ? 419  ALA A C   1 
ATOM   3202 O O   . ALA A 1 419 ? 18.318  -8.134  8.892   1.00 63.93  ? 419  ALA A O   1 
ATOM   3203 C CB  . ALA A 1 419 ? 17.470  -4.921  8.354   1.00 49.89  ? 419  ALA A CB  1 
ATOM   3204 N N   . ALA A 1 420 ? 19.479  -7.102  7.252   1.00 60.99  ? 420  ALA A N   1 
ATOM   3205 C CA  . ALA A 1 420 ? 19.733  -8.330  6.516   1.00 59.04  ? 420  ALA A CA  1 
ATOM   3206 C C   . ALA A 1 420 ? 20.652  -9.289  7.275   1.00 63.56  ? 420  ALA A C   1 
ATOM   3207 O O   . ALA A 1 420 ? 20.813  -10.436 6.865   1.00 70.70  ? 420  ALA A O   1 
ATOM   3208 C CB  . ALA A 1 420 ? 20.309  -8.020  5.122   1.00 55.71  ? 420  ALA A CB  1 
ATOM   3209 N N   . GLN A 1 421 ? 21.255  -8.835  8.371   1.00 62.78  ? 421  GLN A N   1 
ATOM   3210 C CA  . GLN A 1 421 ? 22.236  -9.664  9.069   1.00 58.11  ? 421  GLN A CA  1 
ATOM   3211 C C   . GLN A 1 421 ? 21.950  -9.855  10.554  1.00 61.34  ? 421  GLN A C   1 
ATOM   3212 O O   . GLN A 1 421 ? 22.874  -10.030 11.364  1.00 59.46  ? 421  GLN A O   1 
ATOM   3213 C CB  . GLN A 1 421 ? 23.659  -9.157  8.808   1.00 57.47  ? 421  GLN A CB  1 
ATOM   3214 C CG  . GLN A 1 421 ? 24.063  -9.367  7.344   1.00 67.38  ? 421  GLN A CG  1 
ATOM   3215 C CD  . GLN A 1 421 ? 25.255  -8.541  6.915   1.00 80.73  ? 421  GLN A CD  1 
ATOM   3216 O OE1 . GLN A 1 421 ? 26.178  -8.305  7.701   1.00 84.05  ? 421  GLN A OE1 1 
ATOM   3217 N NE2 . GLN A 1 421 ? 25.249  -8.098  5.652   1.00 80.33  ? 421  GLN A NE2 1 
ATOM   3218 N N   . GLY A 1 422 ? 20.662  -9.835  10.896  1.00 61.08  ? 422  GLY A N   1 
ATOM   3219 C CA  . GLY A 1 422 ? 20.222  -10.188 12.231  1.00 63.30  ? 422  GLY A CA  1 
ATOM   3220 C C   . GLY A 1 422 ? 19.603  -9.082  13.062  1.00 65.90  ? 422  GLY A C   1 
ATOM   3221 O O   . GLY A 1 422 ? 18.831  -9.357  13.976  1.00 71.83  ? 422  GLY A O   1 
ATOM   3222 N N   . ALA A 1 423 ? 19.933  -7.831  12.764  1.00 62.63  ? 423  ALA A N   1 
ATOM   3223 C CA  . ALA A 1 423 ? 19.639  -6.755  13.704  1.00 53.87  ? 423  ALA A CA  1 
ATOM   3224 C C   . ALA A 1 423 ? 18.185  -6.350  13.686  1.00 46.94  ? 423  ALA A C   1 
ATOM   3225 O O   . ALA A 1 423 ? 17.543  -6.398  12.641  1.00 51.42  ? 423  ALA A O   1 
ATOM   3226 C CB  . ALA A 1 423 ? 20.538  -5.551  13.450  1.00 57.44  ? 423  ALA A CB  1 
ATOM   3227 N N   . ARG A 1 424 ? 17.669  -5.981  14.859  1.00 51.33  ? 424  ARG A N   1 
ATOM   3228 C CA  . ARG A 1 424 ? 16.393  -5.277  14.951  1.00 48.09  ? 424  ARG A CA  1 
ATOM   3229 C C   . ARG A 1 424 ? 16.692  -3.787  14.728  1.00 48.66  ? 424  ARG A C   1 
ATOM   3230 O O   . ARG A 1 424 ? 17.424  -3.162  15.515  1.00 49.29  ? 424  ARG A O   1 
ATOM   3231 C CB  . ARG A 1 424 ? 15.726  -5.512  16.315  1.00 49.18  ? 424  ARG A CB  1 
ATOM   3232 C CG  . ARG A 1 424 ? 14.276  -5.005  16.405  1.00 55.84  ? 424  ARG A CG  1 
ATOM   3233 C CD  . ARG A 1 424 ? 13.338  -6.060  16.999  1.00 72.31  ? 424  ARG A CD  1 
ATOM   3234 N NE  . ARG A 1 424 ? 12.785  -5.669  18.301  1.00 79.86  ? 424  ARG A NE  1 
ATOM   3235 C CZ  . ARG A 1 424 ? 13.200  -6.151  19.477  1.00 85.03  ? 424  ARG A CZ  1 
ATOM   3236 N NH1 . ARG A 1 424 ? 14.185  -7.049  19.527  1.00 78.58  ? 424  ARG A NH1 1 
ATOM   3237 N NH2 . ARG A 1 424 ? 12.629  -5.739  20.609  1.00 75.79  ? 424  ARG A NH2 1 
ATOM   3238 N N   . VAL A 1 425 ? 16.151  -3.230  13.645  1.00 49.16  ? 425  VAL A N   1 
ATOM   3239 C CA  . VAL A 1 425 ? 16.434  -1.849  13.251  1.00 46.25  ? 425  VAL A CA  1 
ATOM   3240 C C   . VAL A 1 425 ? 15.149  -1.032  13.229  1.00 45.15  ? 425  VAL A C   1 
ATOM   3241 O O   . VAL A 1 425 ? 14.145  -1.487  12.679  1.00 51.65  ? 425  VAL A O   1 
ATOM   3242 C CB  . VAL A 1 425 ? 17.108  -1.787  11.849  1.00 46.85  ? 425  VAL A CB  1 
ATOM   3243 C CG1 . VAL A 1 425 ? 17.339  -0.345  11.415  1.00 41.66  ? 425  VAL A CG1 1 
ATOM   3244 C CG2 . VAL A 1 425 ? 18.421  -2.570  11.845  1.00 47.79  ? 425  VAL A CG2 1 
ATOM   3245 N N   . TYR A 1 426 ? 15.180  0.157   13.839  1.00 44.61  ? 426  TYR A N   1 
ATOM   3246 C CA  . TYR A 1 426 ? 14.082  1.133   13.756  1.00 44.27  ? 426  TYR A CA  1 
ATOM   3247 C C   . TYR A 1 426 ? 14.615  2.400   13.102  1.00 46.18  ? 426  TYR A C   1 
ATOM   3248 O O   . TYR A 1 426 ? 15.714  2.842   13.425  1.00 52.90  ? 426  TYR A O   1 
ATOM   3249 C CB  . TYR A 1 426 ? 13.514  1.469   15.140  1.00 41.31  ? 426  TYR A CB  1 
ATOM   3250 C CG  . TYR A 1 426 ? 12.786  0.327   15.811  1.00 51.02  ? 426  TYR A CG  1 
ATOM   3251 C CD1 . TYR A 1 426 ? 13.468  -0.578  16.619  1.00 49.20  ? 426  TYR A CD1 1 
ATOM   3252 C CD2 . TYR A 1 426 ? 11.414  0.150   15.635  1.00 48.31  ? 426  TYR A CD2 1 
ATOM   3253 C CE1 . TYR A 1 426 ? 12.805  -1.635  17.231  1.00 56.60  ? 426  TYR A CE1 1 
ATOM   3254 C CE2 . TYR A 1 426 ? 10.745  -0.900  16.237  1.00 51.00  ? 426  TYR A CE2 1 
ATOM   3255 C CZ  . TYR A 1 426 ? 11.443  -1.791  17.036  1.00 58.43  ? 426  TYR A CZ  1 
ATOM   3256 O OH  . TYR A 1 426 ? 10.782  -2.834  17.643  1.00 61.05  ? 426  TYR A OH  1 
ATOM   3257 N N   . ALA A 1 427 ? 13.837  2.992   12.203  1.00 40.91  ? 427  ALA A N   1 
ATOM   3258 C CA  . ALA A 1 427 ? 14.337  4.086   11.369  1.00 42.08  ? 427  ALA A CA  1 
ATOM   3259 C C   . ALA A 1 427 ? 13.391  5.281   11.401  1.00 40.51  ? 427  ALA A C   1 
ATOM   3260 O O   . ALA A 1 427 ? 12.171  5.113   11.481  1.00 50.74  ? 427  ALA A O   1 
ATOM   3261 C CB  . ALA A 1 427 ? 14.568  3.603   9.917   1.00 35.91  ? 427  ALA A CB  1 
ATOM   3262 N N   . TYR A 1 428 ? 13.942  6.490   11.350  1.00 39.85  ? 428  TYR A N   1 
ATOM   3263 C CA  . TYR A 1 428 ? 13.112  7.705   11.375  1.00 43.32  ? 428  TYR A CA  1 
ATOM   3264 C C   . TYR A 1 428 ? 13.693  8.792   10.465  1.00 44.05  ? 428  TYR A C   1 
ATOM   3265 O O   . TYR A 1 428 ? 14.873  8.750   10.096  1.00 41.68  ? 428  TYR A O   1 
ATOM   3266 C CB  . TYR A 1 428 ? 12.978  8.263   12.812  1.00 38.12  ? 428  TYR A CB  1 
ATOM   3267 C CG  . TYR A 1 428 ? 14.289  8.812   13.363  1.00 43.73  ? 428  TYR A CG  1 
ATOM   3268 C CD1 . TYR A 1 428 ? 14.701  10.112  13.075  1.00 43.23  ? 428  TYR A CD1 1 
ATOM   3269 C CD2 . TYR A 1 428 ? 15.118  8.032   14.160  1.00 45.79  ? 428  TYR A CD2 1 
ATOM   3270 C CE1 . TYR A 1 428 ? 15.894  10.610  13.555  1.00 43.72  ? 428  TYR A CE1 1 
ATOM   3271 C CE2 . TYR A 1 428 ? 16.320  8.531   14.654  1.00 43.30  ? 428  TYR A CE2 1 
ATOM   3272 C CZ  . TYR A 1 428 ? 16.699  9.819   14.348  1.00 43.66  ? 428  TYR A CZ  1 
ATOM   3273 O OH  . TYR A 1 428 ? 17.886  10.329  14.831  1.00 46.50  ? 428  TYR A OH  1 
ATOM   3274 N N   . ILE A 1 429 ? 12.853  9.761   10.113  1.00 42.70  ? 429  ILE A N   1 
ATOM   3275 C CA  . ILE A 1 429 ? 13.312  11.029  9.579   1.00 37.19  ? 429  ILE A CA  1 
ATOM   3276 C C   . ILE A 1 429 ? 12.695  12.118  10.461  1.00 41.32  ? 429  ILE A C   1 
ATOM   3277 O O   . ILE A 1 429 ? 11.485  12.144  10.677  1.00 45.40  ? 429  ILE A O   1 
ATOM   3278 C CB  . ILE A 1 429 ? 12.955  11.197  8.074   1.00 47.60  ? 429  ILE A CB  1 
ATOM   3279 C CG1 . ILE A 1 429 ? 13.361  12.578  7.546   1.00 41.94  ? 429  ILE A CG1 1 
ATOM   3280 C CG2 . ILE A 1 429 ? 11.462  10.956  7.833   1.00 49.69  ? 429  ILE A CG2 1 
ATOM   3281 C CD1 . ILE A 1 429 ? 13.066  12.738  6.058   1.00 45.07  ? 429  ILE A CD1 1 
ATOM   3282 N N   . PHE A 1 430 ? 13.542  12.988  11.004  1.00 44.76  ? 430  PHE A N   1 
ATOM   3283 C CA  . PHE A 1 430 ? 13.099  14.081  11.865  1.00 44.04  ? 430  PHE A CA  1 
ATOM   3284 C C   . PHE A 1 430 ? 12.780  15.308  11.002  1.00 42.77  ? 430  PHE A C   1 
ATOM   3285 O O   . PHE A 1 430 ? 13.633  15.766  10.242  1.00 45.65  ? 430  PHE A O   1 
ATOM   3286 C CB  . PHE A 1 430 ? 14.204  14.408  12.877  1.00 42.59  ? 430  PHE A CB  1 
ATOM   3287 C CG  . PHE A 1 430 ? 13.799  15.397  13.927  1.00 35.48  ? 430  PHE A CG  1 
ATOM   3288 C CD1 . PHE A 1 430 ? 13.868  16.760  13.685  1.00 37.61  ? 430  PHE A CD1 1 
ATOM   3289 C CD2 . PHE A 1 430 ? 13.368  14.960  15.169  1.00 41.76  ? 430  PHE A CD2 1 
ATOM   3290 C CE1 . PHE A 1 430 ? 13.497  17.680  14.662  1.00 39.94  ? 430  PHE A CE1 1 
ATOM   3291 C CE2 . PHE A 1 430 ? 13.002  15.872  16.158  1.00 42.36  ? 430  PHE A CE2 1 
ATOM   3292 C CZ  . PHE A 1 430 ? 13.066  17.233  15.900  1.00 44.12  ? 430  PHE A CZ  1 
ATOM   3293 N N   . GLU A 1 431 ? 11.571  15.851  11.119  1.00 45.06  ? 431  GLU A N   1 
ATOM   3294 C CA  . GLU A 1 431 ? 11.138  16.863  10.162  1.00 45.22  ? 431  GLU A CA  1 
ATOM   3295 C C   . GLU A 1 431 ? 10.658  18.165  10.776  1.00 47.23  ? 431  GLU A C   1 
ATOM   3296 O O   . GLU A 1 431 ? 10.130  19.027  10.080  1.00 44.18  ? 431  GLU A O   1 
ATOM   3297 C CB  . GLU A 1 431 ? 10.013  16.305  9.295   1.00 50.19  ? 431  GLU A CB  1 
ATOM   3298 C CG  . GLU A 1 431 ? 10.452  15.289  8.277   1.00 52.56  ? 431  GLU A CG  1 
ATOM   3299 C CD  . GLU A 1 431 ? 9.287   14.789  7.439   1.00 65.28  ? 431  GLU A CD  1 
ATOM   3300 O OE1 . GLU A 1 431 ? 8.122   14.980  7.862   1.00 64.37  ? 431  GLU A OE1 1 
ATOM   3301 O OE2 . GLU A 1 431 ? 9.533   14.209  6.356   1.00 69.03  ? 431  GLU A OE2 1 
ATOM   3302 N N   . HIS A 1 432 ? 10.809  18.319  12.079  1.00 49.09  ? 432  HIS A N   1 
ATOM   3303 C CA  . HIS A 1 432 ? 10.291  19.525  12.702  1.00 46.61  ? 432  HIS A CA  1 
ATOM   3304 C C   . HIS A 1 432 ? 11.365  20.608  12.894  1.00 47.01  ? 432  HIS A C   1 
ATOM   3305 O O   . HIS A 1 432 ? 12.377  20.398  13.562  1.00 44.59  ? 432  HIS A O   1 
ATOM   3306 C CB  . HIS A 1 432 ? 9.628   19.202  14.035  1.00 46.51  ? 432  HIS A CB  1 
ATOM   3307 C CG  . HIS A 1 432 ? 9.249   20.422  14.808  1.00 50.32  ? 432  HIS A CG  1 
ATOM   3308 N ND1 . HIS A 1 432 ? 8.282   21.304  14.372  1.00 52.60  ? 432  HIS A ND1 1 
ATOM   3309 C CD2 . HIS A 1 432 ? 9.738   20.935  15.959  1.00 50.49  ? 432  HIS A CD2 1 
ATOM   3310 C CE1 . HIS A 1 432 ? 8.174   22.294  15.240  1.00 52.00  ? 432  HIS A CE1 1 
ATOM   3311 N NE2 . HIS A 1 432 ? 9.046   22.098  16.211  1.00 53.12  ? 432  HIS A NE2 1 
ATOM   3312 N N   . ARG A 1 433 ? 11.142  21.770  12.299  1.00 51.91  ? 433  ARG A N   1 
ATOM   3313 C CA  . ARG A 1 433 ? 12.056  22.891  12.483  1.00 47.39  ? 433  ARG A CA  1 
ATOM   3314 C C   . ARG A 1 433 ? 11.651  23.684  13.729  1.00 49.90  ? 433  ARG A C   1 
ATOM   3315 O O   . ARG A 1 433 ? 10.531  24.207  13.816  1.00 52.65  ? 433  ARG A O   1 
ATOM   3316 C CB  . ARG A 1 433 ? 12.061  23.788  11.242  1.00 41.71  ? 433  ARG A CB  1 
ATOM   3317 C CG  . ARG A 1 433 ? 12.610  25.179  11.481  1.00 48.42  ? 433  ARG A CG  1 
ATOM   3318 C CD  . ARG A 1 433 ? 12.508  26.009  10.221  1.00 47.09  ? 433  ARG A CD  1 
ATOM   3319 N NE  . ARG A 1 433 ? 13.795  26.583  9.828   1.00 52.11  ? 433  ARG A NE  1 
ATOM   3320 C CZ  . ARG A 1 433 ? 14.199  27.792  10.190  1.00 50.73  ? 433  ARG A CZ  1 
ATOM   3321 N NH1 . ARG A 1 433 ? 13.420  28.544  10.955  1.00 55.84  ? 433  ARG A NH1 1 
ATOM   3322 N NH2 . ARG A 1 433 ? 15.378  28.243  9.798   1.00 54.89  ? 433  ARG A NH2 1 
ATOM   3323 N N   . ALA A 1 434 ? 12.561  23.770  14.694  1.00 48.49  ? 434  ALA A N   1 
ATOM   3324 C CA  . ALA A 1 434 ? 12.252  24.410  15.967  1.00 49.50  ? 434  ALA A CA  1 
ATOM   3325 C C   . ALA A 1 434 ? 11.829  25.866  15.770  1.00 49.50  ? 434  ALA A C   1 
ATOM   3326 O O   . ALA A 1 434 ? 12.367  26.571  14.910  1.00 49.78  ? 434  ALA A O   1 
ATOM   3327 C CB  . ALA A 1 434 ? 13.439  24.301  16.928  1.00 45.44  ? 434  ALA A CB  1 
ATOM   3328 N N   . SER A 1 435 ? 10.849  26.303  16.558  1.00 52.20  ? 435  SER A N   1 
ATOM   3329 C CA  . SER A 1 435 ? 10.387  27.692  16.520  1.00 53.19  ? 435  SER A CA  1 
ATOM   3330 C C   . SER A 1 435 ? 11.528  28.656  16.862  1.00 49.72  ? 435  SER A C   1 
ATOM   3331 O O   . SER A 1 435 ? 11.520  29.811  16.445  1.00 50.01  ? 435  SER A O   1 
ATOM   3332 C CB  . SER A 1 435 ? 9.211   27.893  17.486  1.00 46.30  ? 435  SER A CB  1 
ATOM   3333 O OG  . SER A 1 435 ? 9.649   28.100  18.826  1.00 49.22  ? 435  SER A OG  1 
ATOM   3334 N N   . THR A 1 436 ? 12.515  28.146  17.599  1.00 49.60  ? 436  THR A N   1 
ATOM   3335 C CA  . THR A 1 436 ? 13.635  28.936  18.123  1.00 53.81  ? 436  THR A CA  1 
ATOM   3336 C C   . THR A 1 436 ? 14.843  29.055  17.190  1.00 49.76  ? 436  THR A C   1 
ATOM   3337 O O   . THR A 1 436 ? 15.810  29.748  17.514  1.00 59.08  ? 436  THR A O   1 
ATOM   3338 C CB  . THR A 1 436 ? 14.169  28.301  19.424  1.00 52.93  ? 436  THR A CB  1 
ATOM   3339 O OG1 . THR A 1 436 ? 14.599  26.953  19.155  1.00 61.46  ? 436  THR A OG1 1 
ATOM   3340 C CG2 . THR A 1 436 ? 13.087  28.283  20.492  1.00 62.00  ? 436  THR A CG2 1 
ATOM   3341 N N   . LEU A 1 437 ? 14.809  28.353  16.062  1.00 47.31  ? 437  LEU A N   1 
ATOM   3342 C CA  . LEU A 1 437 ? 15.977  28.236  15.185  1.00 50.98  ? 437  LEU A CA  1 
ATOM   3343 C C   . LEU A 1 437 ? 16.453  29.603  14.674  1.00 47.78  ? 437  LEU A C   1 
ATOM   3344 O O   . LEU A 1 437 ? 15.641  30.465  14.344  1.00 47.33  ? 437  LEU A O   1 
ATOM   3345 C CB  . LEU A 1 437 ? 15.645  27.300  14.017  1.00 49.44  ? 437  LEU A CB  1 
ATOM   3346 C CG  . LEU A 1 437 ? 16.783  26.604  13.268  1.00 50.40  ? 437  LEU A CG  1 
ATOM   3347 C CD1 . LEU A 1 437 ? 17.878  26.239  14.215  1.00 48.81  ? 437  LEU A CD1 1 
ATOM   3348 C CD2 . LEU A 1 437 ? 16.263  25.352  12.607  1.00 52.21  ? 437  LEU A CD2 1 
ATOM   3349 N N   . THR A 1 438 ? 17.763  29.807  14.616  1.00 45.08  ? 438  THR A N   1 
ATOM   3350 C CA  . THR A 1 438 ? 18.297  31.103  14.196  1.00 47.35  ? 438  THR A CA  1 
ATOM   3351 C C   . THR A 1 438 ? 18.809  31.095  12.754  1.00 50.38  ? 438  THR A C   1 
ATOM   3352 O O   . THR A 1 438 ? 19.020  32.154  12.151  1.00 48.20  ? 438  THR A O   1 
ATOM   3353 C CB  . THR A 1 438 ? 19.401  31.632  15.157  1.00 50.54  ? 438  THR A CB  1 
ATOM   3354 O OG1 . THR A 1 438 ? 20.320  30.581  15.469  1.00 55.96  ? 438  THR A OG1 1 
ATOM   3355 C CG2 . THR A 1 438 ? 18.786  32.127  16.443  1.00 44.17  ? 438  THR A CG2 1 
ATOM   3356 N N   . TRP A 1 439 ? 19.006  29.900  12.205  1.00 49.00  ? 439  TRP A N   1 
ATOM   3357 C CA  . TRP A 1 439 ? 19.339  29.756  10.792  1.00 42.58  ? 439  TRP A CA  1 
ATOM   3358 C C   . TRP A 1 439 ? 18.137  30.130  9.925   1.00 44.49  ? 439  TRP A C   1 
ATOM   3359 O O   . TRP A 1 439 ? 16.989  30.074  10.393  1.00 42.77  ? 439  TRP A O   1 
ATOM   3360 C CB  . TRP A 1 439 ? 19.783  28.325  10.503  1.00 42.62  ? 439  TRP A CB  1 
ATOM   3361 C CG  . TRP A 1 439 ? 21.004  27.934  11.247  1.00 42.44  ? 439  TRP A CG  1 
ATOM   3362 C CD1 . TRP A 1 439 ? 21.058  27.210  12.402  1.00 47.40  ? 439  TRP A CD1 1 
ATOM   3363 C CD2 . TRP A 1 439 ? 22.359  28.248  10.907  1.00 44.83  ? 439  TRP A CD2 1 
ATOM   3364 N NE1 . TRP A 1 439 ? 22.363  27.053  12.805  1.00 41.67  ? 439  TRP A NE1 1 
ATOM   3365 C CE2 . TRP A 1 439 ? 23.185  27.676  11.906  1.00 43.29  ? 439  TRP A CE2 1 
ATOM   3366 C CE3 . TRP A 1 439 ? 22.959  28.958  9.859   1.00 40.94  ? 439  TRP A CE3 1 
ATOM   3367 C CZ2 . TRP A 1 439 ? 24.576  27.784  11.885  1.00 39.68  ? 439  TRP A CZ2 1 
ATOM   3368 C CZ3 . TRP A 1 439 ? 24.345  29.062  9.831   1.00 40.98  ? 439  TRP A CZ3 1 
ATOM   3369 C CH2 . TRP A 1 439 ? 25.137  28.477  10.841  1.00 48.11  ? 439  TRP A CH2 1 
ATOM   3370 N N   . PRO A 1 440 ? 18.393  30.515  8.656   1.00 48.09  ? 440  PRO A N   1 
ATOM   3371 C CA  . PRO A 1 440 ? 17.320  30.933  7.744   1.00 39.82  ? 440  PRO A CA  1 
ATOM   3372 C C   . PRO A 1 440 ? 16.395  29.786  7.395   1.00 46.82  ? 440  PRO A C   1 
ATOM   3373 O O   . PRO A 1 440 ? 16.767  28.608  7.559   1.00 45.26  ? 440  PRO A O   1 
ATOM   3374 C CB  . PRO A 1 440 ? 18.065  31.340  6.461   1.00 48.36  ? 440  PRO A CB  1 
ATOM   3375 C CG  . PRO A 1 440 ? 19.478  31.374  6.784   1.00 47.34  ? 440  PRO A CG  1 
ATOM   3376 C CD  . PRO A 1 440 ? 19.714  30.552  8.003   1.00 47.91  ? 440  PRO A CD  1 
ATOM   3377 N N   . LEU A 1 441 ? 15.214  30.138  6.892   1.00 44.58  ? 441  LEU A N   1 
ATOM   3378 C CA  . LEU A 1 441 ? 14.236  29.161  6.460   1.00 42.04  ? 441  LEU A CA  1 
ATOM   3379 C C   . LEU A 1 441 ? 14.738  28.236  5.373   1.00 44.63  ? 441  LEU A C   1 
ATOM   3380 O O   . LEU A 1 441 ? 14.317  27.077  5.317   1.00 51.37  ? 441  LEU A O   1 
ATOM   3381 C CB  . LEU A 1 441 ? 12.962  29.860  5.998   1.00 50.76  ? 441  LEU A CB  1 
ATOM   3382 C CG  . LEU A 1 441 ? 12.116  30.302  7.190   1.00 65.76  ? 441  LEU A CG  1 
ATOM   3383 C CD1 . LEU A 1 441 ? 11.347  31.577  6.856   1.00 60.27  ? 441  LEU A CD1 1 
ATOM   3384 C CD2 . LEU A 1 441 ? 11.183  29.158  7.638   1.00 56.93  ? 441  LEU A CD2 1 
ATOM   3385 N N   . TRP A 1 442 ? 15.623  28.723  4.504   1.00 42.27  ? 442  TRP A N   1 
ATOM   3386 C CA  . TRP A 1 442 ? 16.020  27.882  3.371   1.00 51.84  ? 442  TRP A CA  1 
ATOM   3387 C C   . TRP A 1 442 ? 16.819  26.651  3.832   1.00 47.05  ? 442  TRP A C   1 
ATOM   3388 O O   . TRP A 1 442 ? 16.814  25.610  3.160   1.00 44.35  ? 442  TRP A O   1 
ATOM   3389 C CB  . TRP A 1 442 ? 16.726  28.661  2.238   1.00 39.77  ? 442  TRP A CB  1 
ATOM   3390 C CG  . TRP A 1 442 ? 18.111  29.133  2.576   1.00 47.80  ? 442  TRP A CG  1 
ATOM   3391 C CD1 . TRP A 1 442 ? 18.463  30.388  2.994   1.00 47.72  ? 442  TRP A CD1 1 
ATOM   3392 C CD2 . TRP A 1 442 ? 19.333  28.372  2.520   1.00 40.36  ? 442  TRP A CD2 1 
ATOM   3393 N NE1 . TRP A 1 442 ? 19.818  30.454  3.209   1.00 45.06  ? 442  TRP A NE1 1 
ATOM   3394 C CE2 . TRP A 1 442 ? 20.379  29.236  2.928   1.00 44.08  ? 442  TRP A CE2 1 
ATOM   3395 C CE3 . TRP A 1 442 ? 19.646  27.053  2.163   1.00 39.35  ? 442  TRP A CE3 1 
ATOM   3396 C CZ2 . TRP A 1 442 ? 21.721  28.818  3.006   1.00 34.57  ? 442  TRP A CZ2 1 
ATOM   3397 C CZ3 . TRP A 1 442 ? 20.981  26.640  2.236   1.00 42.34  ? 442  TRP A CZ3 1 
ATOM   3398 C CH2 . TRP A 1 442 ? 22.001  27.528  2.656   1.00 39.93  ? 442  TRP A CH2 1 
ATOM   3399 N N   . MET A 1 443 ? 17.469  26.756  4.990   1.00 42.73  ? 443  MET A N   1 
ATOM   3400 C CA  . MET A 1 443 ? 18.220  25.621  5.525   1.00 43.56  ? 443  MET A CA  1 
ATOM   3401 C C   . MET A 1 443 ? 17.339  24.546  6.130   1.00 41.90  ? 443  MET A C   1 
ATOM   3402 O O   . MET A 1 443 ? 17.851  23.498  6.530   1.00 43.23  ? 443  MET A O   1 
ATOM   3403 C CB  . MET A 1 443 ? 19.265  26.059  6.545   1.00 44.89  ? 443  MET A CB  1 
ATOM   3404 C CG  . MET A 1 443 ? 20.328  26.960  5.961   1.00 40.98  ? 443  MET A CG  1 
ATOM   3405 S SD  . MET A 1 443 ? 21.673  27.200  7.114   1.00 50.22  ? 443  MET A SD  1 
ATOM   3406 C CE  . MET A 1 443 ? 22.354  28.713  6.478   1.00 53.06  ? 443  MET A CE  1 
ATOM   3407 N N   . GLY A 1 444 ? 16.027  24.785  6.176   1.00 42.52  ? 444  GLY A N   1 
ATOM   3408 C CA  . GLY A 1 444 ? 15.075  23.787  6.654   1.00 45.19  ? 444  GLY A CA  1 
ATOM   3409 C C   . GLY A 1 444 ? 15.360  23.283  8.065   1.00 45.71  ? 444  GLY A C   1 
ATOM   3410 O O   . GLY A 1 444 ? 15.431  24.084  9.013   1.00 44.82  ? 444  GLY A O   1 
ATOM   3411 N N   . VAL A 1 445 ? 15.528  21.962  8.197   1.00 36.58  ? 445  VAL A N   1 
ATOM   3412 C CA  . VAL A 1 445 ? 15.900  21.328  9.466   1.00 44.40  ? 445  VAL A CA  1 
ATOM   3413 C C   . VAL A 1 445 ? 17.330  20.810  9.337   1.00 45.19  ? 445  VAL A C   1 
ATOM   3414 O O   . VAL A 1 445 ? 17.560  19.708  8.832   1.00 44.83  ? 445  VAL A O   1 
ATOM   3415 C CB  . VAL A 1 445 ? 14.970  20.121  9.821   1.00 46.65  ? 445  VAL A CB  1 
ATOM   3416 C CG1 . VAL A 1 445 ? 15.278  19.597  11.218  1.00 42.25  ? 445  VAL A CG1 1 
ATOM   3417 C CG2 . VAL A 1 445 ? 13.502  20.495  9.694   1.00 42.93  ? 445  VAL A CG2 1 
ATOM   3418 N N   . PRO A 1 446 ? 18.305  21.608  9.785   1.00 39.95  ? 446  PRO A N   1 
ATOM   3419 C CA  . PRO A 1 446 ? 19.705  21.217  9.590   1.00 38.45  ? 446  PRO A CA  1 
ATOM   3420 C C   . PRO A 1 446 ? 20.168  20.162  10.614  1.00 41.17  ? 446  PRO A C   1 
ATOM   3421 O O   . PRO A 1 446 ? 19.512  19.972  11.645  1.00 41.15  ? 446  PRO A O   1 
ATOM   3422 C CB  . PRO A 1 446 ? 20.475  22.533  9.809   1.00 34.71  ? 446  PRO A CB  1 
ATOM   3423 C CG  . PRO A 1 446 ? 19.409  23.613  9.972   1.00 38.39  ? 446  PRO A CG  1 
ATOM   3424 C CD  . PRO A 1 446 ? 18.175  22.924  10.432  1.00 36.95  ? 446  PRO A CD  1 
ATOM   3425 N N   A HIS A 1 447 ? 21.282  19.502  10.297  0.35 41.67  ? 447  HIS A N   1 
ATOM   3426 N N   B HIS A 1 447 ? 21.276  19.479  10.326  0.65 40.71  ? 447  HIS A N   1 
ATOM   3427 C CA  A HIS A 1 447 ? 22.038  18.638  11.205  0.35 43.67  ? 447  HIS A CA  1 
ATOM   3428 C CA  B HIS A 1 447 ? 21.734  18.413  11.217  0.65 43.97  ? 447  HIS A CA  1 
ATOM   3429 C C   A HIS A 1 447 ? 22.012  19.131  12.656  0.35 43.36  ? 447  HIS A C   1 
ATOM   3430 C C   B HIS A 1 447 ? 22.204  18.939  12.577  0.65 43.57  ? 447  HIS A C   1 
ATOM   3431 O O   A HIS A 1 447 ? 22.204  20.326  12.905  0.35 40.78  ? 447  HIS A O   1 
ATOM   3432 O O   B HIS A 1 447 ? 22.910  19.953  12.678  0.65 40.66  ? 447  HIS A O   1 
ATOM   3433 C CB  A HIS A 1 447 ? 23.498  18.632  10.741  0.35 44.70  ? 447  HIS A CB  1 
ATOM   3434 C CB  B HIS A 1 447 ? 22.763  17.474  10.563  0.65 40.22  ? 447  HIS A CB  1 
ATOM   3435 C CG  A HIS A 1 447 ? 24.133  17.278  10.717  0.35 44.36  ? 447  HIS A CG  1 
ATOM   3436 C CG  B HIS A 1 447 ? 24.035  18.141  10.140  0.65 44.66  ? 447  HIS A CG  1 
ATOM   3437 N ND1 A HIS A 1 447 ? 23.919  16.374  9.701   0.35 44.50  ? 447  HIS A ND1 1 
ATOM   3438 N ND1 B HIS A 1 447 ? 24.671  19.102  10.900  0.65 44.73  ? 447  HIS A ND1 1 
ATOM   3439 C CD2 A HIS A 1 447 ? 25.002  16.688  11.570  0.35 45.00  ? 447  HIS A CD2 1 
ATOM   3440 C CD2 B HIS A 1 447 ? 24.811  17.958  9.043   0.65 44.34  ? 447  HIS A CD2 1 
ATOM   3441 C CE1 A HIS A 1 447 ? 24.620  15.278  9.936   0.35 44.91  ? 447  HIS A CE1 1 
ATOM   3442 C CE1 B HIS A 1 447 ? 25.773  19.491  10.283  0.65 46.70  ? 447  HIS A CE1 1 
ATOM   3443 N NE2 A HIS A 1 447 ? 25.283  15.444  11.063  0.35 45.07  ? 447  HIS A NE2 1 
ATOM   3444 N NE2 B HIS A 1 447 ? 25.881  18.810  9.154   0.65 45.98  ? 447  HIS A NE2 1 
ATOM   3445 N N   . GLY A 1 448 ? 21.766  18.233  13.611  1.00 41.95  ? 448  GLY A N   1 
ATOM   3446 C CA  . GLY A 1 448 ? 21.973  18.601  14.996  1.00 39.66  ? 448  GLY A CA  1 
ATOM   3447 C C   . GLY A 1 448 ? 20.797  19.305  15.634  1.00 37.71  ? 448  GLY A C   1 
ATOM   3448 O O   . GLY A 1 448 ? 20.800  19.530  16.844  1.00 38.68  ? 448  GLY A O   1 
ATOM   3449 N N   . TYR A 1 449 ? 19.776  19.640  14.850  1.00 41.57  ? 449  TYR A N   1 
ATOM   3450 C CA  . TYR A 1 449 ? 18.638  20.374  15.429  1.00 44.02  ? 449  TYR A CA  1 
ATOM   3451 C C   . TYR A 1 449 ? 17.474  19.497  15.914  1.00 43.57  ? 449  TYR A C   1 
ATOM   3452 O O   . TYR A 1 449 ? 16.417  19.994  16.297  1.00 45.48  ? 449  TYR A O   1 
ATOM   3453 C CB  . TYR A 1 449 ? 18.227  21.570  14.552  1.00 38.14  ? 449  TYR A CB  1 
ATOM   3454 C CG  . TYR A 1 449 ? 19.305  22.617  14.656  1.00 43.58  ? 449  TYR A CG  1 
ATOM   3455 C CD1 . TYR A 1 449 ? 19.287  23.557  15.683  1.00 43.34  ? 449  TYR A CD1 1 
ATOM   3456 C CD2 . TYR A 1 449 ? 20.401  22.604  13.797  1.00 40.90  ? 449  TYR A CD2 1 
ATOM   3457 C CE1 . TYR A 1 449 ? 20.305  24.500  15.810  1.00 41.78  ? 449  TYR A CE1 1 
ATOM   3458 C CE2 . TYR A 1 449 ? 21.427  23.534  13.923  1.00 36.30  ? 449  TYR A CE2 1 
ATOM   3459 C CZ  . TYR A 1 449 ? 21.364  24.479  14.929  1.00 41.46  ? 449  TYR A CZ  1 
ATOM   3460 O OH  . TYR A 1 449 ? 22.376  25.393  15.049  1.00 48.21  ? 449  TYR A OH  1 
ATOM   3461 N N   . GLU A 1 450 ? 17.704  18.188  15.939  1.00 41.51  ? 450  GLU A N   1 
ATOM   3462 C CA  . GLU A 1 450 ? 16.807  17.276  16.634  1.00 40.77  ? 450  GLU A CA  1 
ATOM   3463 C C   . GLU A 1 450 ? 17.211  17.119  18.106  1.00 40.74  ? 450  GLU A C   1 
ATOM   3464 O O   . GLU A 1 450 ? 16.368  16.846  18.957  1.00 45.28  ? 450  GLU A O   1 
ATOM   3465 C CB  . GLU A 1 450 ? 16.777  15.908  15.936  1.00 35.97  ? 450  GLU A CB  1 
ATOM   3466 C CG  . GLU A 1 450 ? 17.920  14.956  16.296  1.00 43.28  ? 450  GLU A CG  1 
ATOM   3467 C CD  . GLU A 1 450 ? 19.215  15.228  15.521  1.00 47.96  ? 450  GLU A CD  1 
ATOM   3468 O OE1 . GLU A 1 450 ? 19.515  16.405  15.192  1.00 45.40  ? 450  GLU A OE1 1 
ATOM   3469 O OE2 . GLU A 1 450 ? 19.947  14.246  15.252  1.00 48.24  ? 450  GLU A OE2 1 
ATOM   3470 N N   . ILE A 1 451 ? 18.494  17.330  18.393  1.00 42.41  ? 451  ILE A N   1 
ATOM   3471 C CA  . ILE A 1 451 ? 19.096  16.990  19.687  1.00 40.21  ? 451  ILE A CA  1 
ATOM   3472 C C   . ILE A 1 451 ? 18.387  17.611  20.880  1.00 41.96  ? 451  ILE A C   1 
ATOM   3473 O O   . ILE A 1 451 ? 18.125  16.922  21.883  1.00 44.40  ? 451  ILE A O   1 
ATOM   3474 C CB  . ILE A 1 451 ? 20.598  17.387  19.728  1.00 39.58  ? 451  ILE A CB  1 
ATOM   3475 C CG1 . ILE A 1 451 ? 21.375  16.669  18.609  1.00 41.88  ? 451  ILE A CG1 1 
ATOM   3476 C CG2 . ILE A 1 451 ? 21.213  17.096  21.096  1.00 36.90  ? 451  ILE A CG2 1 
ATOM   3477 C CD1 . ILE A 1 451 ? 22.851  17.062  18.531  1.00 38.04  ? 451  ILE A CD1 1 
ATOM   3478 N N   . GLU A 1 452 ? 18.083  18.905  20.771  1.00 37.35  ? 452  GLU A N   1 
ATOM   3479 C CA  . GLU A 1 452 ? 17.427  19.641  21.853  1.00 41.46  ? 452  GLU A CA  1 
ATOM   3480 C C   . GLU A 1 452 ? 16.071  19.026  22.225  1.00 48.10  ? 452  GLU A C   1 
ATOM   3481 O O   . GLU A 1 452 ? 15.654  19.094  23.386  1.00 44.95  ? 452  GLU A O   1 
ATOM   3482 C CB  . GLU A 1 452 ? 17.274  21.124  21.493  1.00 42.87  ? 452  GLU A CB  1 
ATOM   3483 C CG  . GLU A 1 452 ? 16.775  21.365  20.065  1.00 54.18  ? 452  GLU A CG  1 
ATOM   3484 C CD  . GLU A 1 452 ? 16.872  22.823  19.633  1.00 57.06  ? 452  GLU A CD  1 
ATOM   3485 O OE1 . GLU A 1 452 ? 17.931  23.223  19.097  1.00 66.19  ? 452  GLU A OE1 1 
ATOM   3486 O OE2 . GLU A 1 452 ? 15.888  23.571  19.827  1.00 58.14  ? 452  GLU A OE2 1 
ATOM   3487 N N   . PHE A 1 453 ? 15.403  18.408  21.250  1.00 39.99  ? 453  PHE A N   1 
ATOM   3488 C CA  . PHE A 1 453 ? 14.135  17.737  21.519  1.00 40.88  ? 453  PHE A CA  1 
ATOM   3489 C C   . PHE A 1 453 ? 14.302  16.397  22.237  1.00 43.61  ? 453  PHE A C   1 
ATOM   3490 O O   . PHE A 1 453 ? 13.594  16.130  23.208  1.00 47.51  ? 453  PHE A O   1 
ATOM   3491 C CB  . PHE A 1 453 ? 13.304  17.598  20.237  1.00 42.36  ? 453  PHE A CB  1 
ATOM   3492 C CG  . PHE A 1 453 ? 12.805  18.921  19.706  1.00 48.09  ? 453  PHE A CG  1 
ATOM   3493 C CD1 . PHE A 1 453 ? 11.640  19.492  20.214  1.00 40.02  ? 453  PHE A CD1 1 
ATOM   3494 C CD2 . PHE A 1 453 ? 13.521  19.617  18.730  1.00 42.70  ? 453  PHE A CD2 1 
ATOM   3495 C CE1 . PHE A 1 453 ? 11.193  20.716  19.745  1.00 44.54  ? 453  PHE A CE1 1 
ATOM   3496 C CE2 . PHE A 1 453 ? 13.074  20.855  18.257  1.00 43.48  ? 453  PHE A CE2 1 
ATOM   3497 C CZ  . PHE A 1 453 ? 11.910  21.401  18.761  1.00 45.10  ? 453  PHE A CZ  1 
ATOM   3498 N N   . ILE A 1 454 ? 15.239  15.569  21.778  1.00 40.67  ? 454  ILE A N   1 
ATOM   3499 C CA  . ILE A 1 454 ? 15.540  14.311  22.460  1.00 38.40  ? 454  ILE A CA  1 
ATOM   3500 C C   . ILE A 1 454 ? 15.936  14.535  23.934  1.00 41.78  ? 454  ILE A C   1 
ATOM   3501 O O   . ILE A 1 454 ? 15.561  13.753  24.805  1.00 43.93  ? 454  ILE A O   1 
ATOM   3502 C CB  . ILE A 1 454 ? 16.706  13.550  21.799  1.00 39.41  ? 454  ILE A CB  1 
ATOM   3503 C CG1 . ILE A 1 454 ? 16.648  13.627  20.269  1.00 42.17  ? 454  ILE A CG1 1 
ATOM   3504 C CG2 . ILE A 1 454 ? 16.771  12.119  22.322  1.00 39.71  ? 454  ILE A CG2 1 
ATOM   3505 C CD1 . ILE A 1 454 ? 15.736  12.672  19.649  1.00 43.14  ? 454  ILE A CD1 1 
ATOM   3506 N N   . PHE A 1 455 ? 16.712  15.581  24.212  1.00 42.45  ? 455  PHE A N   1 
ATOM   3507 C CA  . PHE A 1 455 ? 17.147  15.850  25.587  1.00 45.21  ? 455  PHE A CA  1 
ATOM   3508 C C   . PHE A 1 455 ? 16.086  16.602  26.387  1.00 43.48  ? 455  PHE A C   1 
ATOM   3509 O O   . PHE A 1 455 ? 16.259  16.834  27.588  1.00 43.00  ? 455  PHE A O   1 
ATOM   3510 C CB  . PHE A 1 455 ? 18.454  16.640  25.613  1.00 37.46  ? 455  PHE A CB  1 
ATOM   3511 C CG  . PHE A 1 455 ? 19.671  15.791  25.483  1.00 39.69  ? 455  PHE A CG  1 
ATOM   3512 C CD1 . PHE A 1 455 ? 20.065  15.293  24.242  1.00 39.05  ? 455  PHE A CD1 1 
ATOM   3513 C CD2 . PHE A 1 455 ? 20.435  15.490  26.602  1.00 38.48  ? 455  PHE A CD2 1 
ATOM   3514 C CE1 . PHE A 1 455 ? 21.202  14.490  24.121  1.00 37.10  ? 455  PHE A CE1 1 
ATOM   3515 C CE2 . PHE A 1 455 ? 21.575  14.690  26.497  1.00 37.62  ? 455  PHE A CE2 1 
ATOM   3516 C CZ  . PHE A 1 455 ? 21.955  14.188  25.248  1.00 42.74  ? 455  PHE A CZ  1 
ATOM   3517 N N   . GLY A 1 456 ? 15.014  17.000  25.703  1.00 40.24  ? 456  GLY A N   1 
ATOM   3518 C CA  . GLY A 1 456 ? 13.874  17.643  26.330  1.00 37.84  ? 456  GLY A CA  1 
ATOM   3519 C C   . GLY A 1 456 ? 14.068  19.060  26.847  1.00 42.20  ? 456  GLY A C   1 
ATOM   3520 O O   . GLY A 1 456 ? 13.442  19.446  27.840  1.00 45.27  ? 456  GLY A O   1 
ATOM   3521 N N   . LEU A 1 457 ? 14.928  19.839  26.194  1.00 42.81  ? 457  LEU A N   1 
ATOM   3522 C CA  . LEU A 1 457 ? 15.040  21.271  26.504  1.00 45.94  ? 457  LEU A CA  1 
ATOM   3523 C C   . LEU A 1 457 ? 13.714  22.050  26.464  1.00 45.66  ? 457  LEU A C   1 
ATOM   3524 O O   . LEU A 1 457 ? 13.514  22.925  27.306  1.00 53.35  ? 457  LEU A O   1 
ATOM   3525 C CB  . LEU A 1 457 ? 16.115  21.985  25.661  1.00 41.56  ? 457  LEU A CB  1 
ATOM   3526 C CG  . LEU A 1 457 ? 17.561  21.907  26.181  1.00 42.70  ? 457  LEU A CG  1 
ATOM   3527 C CD1 . LEU A 1 457 ? 18.102  20.486  26.129  1.00 39.28  ? 457  LEU A CD1 1 
ATOM   3528 C CD2 . LEU A 1 457 ? 18.486  22.850  25.408  1.00 41.05  ? 457  LEU A CD2 1 
ATOM   3529 N N   . PRO A 1 458 ? 12.810  21.749  25.503  1.00 42.94  ? 458  PRO A N   1 
ATOM   3530 C CA  . PRO A 1 458 ? 11.530  22.476  25.499  1.00 47.69  ? 458  PRO A CA  1 
ATOM   3531 C C   . PRO A 1 458 ? 10.738  22.438  26.818  1.00 52.92  ? 458  PRO A C   1 
ATOM   3532 O O   . PRO A 1 458 ? 9.900   23.320  27.026  1.00 57.46  ? 458  PRO A O   1 
ATOM   3533 C CB  . PRO A 1 458 ? 10.748  21.783  24.373  1.00 48.71  ? 458  PRO A CB  1 
ATOM   3534 C CG  . PRO A 1 458 ? 11.813  21.394  23.404  1.00 45.67  ? 458  PRO A CG  1 
ATOM   3535 C CD  . PRO A 1 458 ? 12.964  20.941  24.275  1.00 43.26  ? 458  PRO A CD  1 
ATOM   3536 N N   . LEU A 1 459 ? 11.005  21.458  27.683  1.00 48.42  ? 459  LEU A N   1 
ATOM   3537 C CA  . LEU A 1 459 ? 10.386  21.399  29.013  1.00 50.54  ? 459  LEU A CA  1 
ATOM   3538 C C   . LEU A 1 459 ? 10.790  22.577  29.917  1.00 57.00  ? 459  LEU A C   1 
ATOM   3539 O O   . LEU A 1 459 ? 10.122  22.857  30.920  1.00 58.34  ? 459  LEU A O   1 
ATOM   3540 C CB  . LEU A 1 459 ? 10.716  20.080  29.714  1.00 47.01  ? 459  LEU A CB  1 
ATOM   3541 C CG  . LEU A 1 459 ? 9.801   18.878  29.462  1.00 49.53  ? 459  LEU A CG  1 
ATOM   3542 C CD1 . LEU A 1 459 ? 9.470   18.718  27.997  1.00 53.03  ? 459  LEU A CD1 1 
ATOM   3543 C CD2 . LEU A 1 459 ? 10.474  17.620  29.954  1.00 49.64  ? 459  LEU A CD2 1 
ATOM   3544 N N   . ASP A 1 460 ? 11.880  23.256  29.563  1.00 54.14  ? 460  ASP A N   1 
ATOM   3545 C CA  . ASP A 1 460 ? 12.320  24.446  30.290  1.00 58.73  ? 460  ASP A CA  1 
ATOM   3546 C C   . ASP A 1 460 ? 11.523  25.680  29.820  1.00 64.38  ? 460  ASP A C   1 
ATOM   3547 O O   . ASP A 1 460 ? 11.690  26.155  28.686  1.00 59.96  ? 460  ASP A O   1 
ATOM   3548 C CB  . ASP A 1 460 ? 13.820  24.659  30.087  1.00 59.63  ? 460  ASP A CB  1 
ATOM   3549 C CG  . ASP A 1 460 ? 14.415  25.627  31.093  1.00 65.61  ? 460  ASP A CG  1 
ATOM   3550 O OD1 . ASP A 1 460 ? 13.654  26.417  31.691  1.00 67.01  ? 460  ASP A OD1 1 
ATOM   3551 O OD2 . ASP A 1 460 ? 15.651  25.600  31.285  1.00 70.47  ? 460  ASP A OD2 1 
ATOM   3552 N N   . PRO A 1 461 ? 10.649  26.203  30.698  1.00 70.22  ? 461  PRO A N   1 
ATOM   3553 C CA  . PRO A 1 461 ? 9.709   27.274  30.324  1.00 65.74  ? 461  PRO A CA  1 
ATOM   3554 C C   . PRO A 1 461 ? 10.431  28.558  29.893  1.00 69.08  ? 461  PRO A C   1 
ATOM   3555 O O   . PRO A 1 461 ? 9.927   29.300  29.041  1.00 72.24  ? 461  PRO A O   1 
ATOM   3556 C CB  . PRO A 1 461 ? 8.909   27.504  31.609  1.00 65.71  ? 461  PRO A CB  1 
ATOM   3557 C CG  . PRO A 1 461 ? 9.124   26.256  32.443  1.00 66.10  ? 461  PRO A CG  1 
ATOM   3558 C CD  . PRO A 1 461 ? 10.516  25.814  32.114  1.00 68.37  ? 461  PRO A CD  1 
ATOM   3559 N N   . SER A 1 462 ? 11.614  28.793  30.455  1.00 60.49  ? 462  SER A N   1 
ATOM   3560 C CA  . SER A 1 462 ? 12.449  29.931  30.063  1.00 65.54  ? 462  SER A CA  1 
ATOM   3561 C C   . SER A 1 462 ? 13.002  29.921  28.623  1.00 66.95  ? 462  SER A C   1 
ATOM   3562 O O   . SER A 1 462 ? 13.635  30.895  28.206  1.00 66.80  ? 462  SER A O   1 
ATOM   3563 C CB  . SER A 1 462 ? 13.610  30.089  31.052  1.00 57.10  ? 462  SER A CB  1 
ATOM   3564 O OG  . SER A 1 462 ? 14.051  28.824  31.504  1.00 68.15  ? 462  SER A OG  1 
ATOM   3565 N N   . LEU A 1 463 ? 12.771  28.853  27.860  1.00 66.58  ? 463  LEU A N   1 
ATOM   3566 C CA  . LEU A 1 463 ? 13.384  28.750  26.530  1.00 60.73  ? 463  LEU A CA  1 
ATOM   3567 C C   . LEU A 1 463 ? 12.504  29.169  25.340  1.00 62.84  ? 463  LEU A C   1 
ATOM   3568 O O   . LEU A 1 463 ? 12.990  29.264  24.202  1.00 63.19  ? 463  LEU A O   1 
ATOM   3569 C CB  . LEU A 1 463 ? 13.994  27.359  26.319  1.00 54.99  ? 463  LEU A CB  1 
ATOM   3570 C CG  . LEU A 1 463 ? 15.183  27.120  27.258  1.00 62.87  ? 463  LEU A CG  1 
ATOM   3571 C CD1 . LEU A 1 463 ? 15.767  25.711  27.125  1.00 50.74  ? 463  LEU A CD1 1 
ATOM   3572 C CD2 . LEU A 1 463 ? 16.260  28.183  27.036  1.00 49.88  ? 463  LEU A CD2 1 
ATOM   3573 N N   . ASN A 1 464 ? 11.226  29.426  25.606  1.00 63.61  ? 464  ASN A N   1 
ATOM   3574 C CA  . ASN A 1 464 ? 10.310  29.988  24.597  1.00 73.08  ? 464  ASN A CA  1 
ATOM   3575 C C   . ASN A 1 464 ? 9.936   29.031  23.454  1.00 69.72  ? 464  ASN A C   1 
ATOM   3576 O O   . ASN A 1 464 ? 9.613   29.473  22.345  1.00 78.19  ? 464  ASN A O   1 
ATOM   3577 C CB  . ASN A 1 464 ? 10.807  31.350  24.048  1.00 73.13  ? 464  ASN A CB  1 
ATOM   3578 C CG  . ASN A 1 464 ? 11.072  32.383  25.156  1.00 82.77  ? 464  ASN A CG  1 
ATOM   3579 O OD1 . ASN A 1 464 ? 10.530  32.285  26.268  1.00 77.14  ? 464  ASN A OD1 1 
ATOM   3580 N ND2 . ASN A 1 464 ? 11.908  33.382  24.843  1.00 85.96  ? 464  ASN A ND2 1 
ATOM   3581 N N   . TYR A 1 465 ? 9.980   27.727  23.729  1.00 58.02  ? 465  TYR A N   1 
ATOM   3582 C CA  . TYR A 1 465 ? 9.371   26.740  22.842  1.00 55.16  ? 465  TYR A CA  1 
ATOM   3583 C C   . TYR A 1 465 ? 7.853   26.769  23.003  1.00 58.90  ? 465  TYR A C   1 
ATOM   3584 O O   . TYR A 1 465 ? 7.343   27.056  24.094  1.00 59.30  ? 465  TYR A O   1 
ATOM   3585 C CB  . TYR A 1 465 ? 9.874   25.341  23.179  1.00 51.62  ? 465  TYR A CB  1 
ATOM   3586 C CG  . TYR A 1 465 ? 11.330  25.128  22.867  1.00 57.59  ? 465  TYR A CG  1 
ATOM   3587 C CD1 . TYR A 1 465 ? 12.312  25.406  23.815  1.00 49.99  ? 465  TYR A CD1 1 
ATOM   3588 C CD2 . TYR A 1 465 ? 11.726  24.647  21.624  1.00 48.65  ? 465  TYR A CD2 1 
ATOM   3589 C CE1 . TYR A 1 465 ? 13.636  25.212  23.536  1.00 49.56  ? 465  TYR A CE1 1 
ATOM   3590 C CE2 . TYR A 1 465 ? 13.052  24.452  21.331  1.00 52.18  ? 465  TYR A CE2 1 
ATOM   3591 C CZ  . TYR A 1 465 ? 14.006  24.736  22.288  1.00 55.93  ? 465  TYR A CZ  1 
ATOM   3592 O OH  . TYR A 1 465 ? 15.336  24.541  21.999  1.00 49.02  ? 465  TYR A OH  1 
ATOM   3593 N N   . THR A 1 466 ? 7.138   26.453  21.925  1.00 55.65  ? 466  THR A N   1 
ATOM   3594 C CA  . THR A 1 466 ? 5.675   26.356  21.960  1.00 51.61  ? 466  THR A CA  1 
ATOM   3595 C C   . THR A 1 466 ? 5.208   25.123  22.737  1.00 54.32  ? 466  THR A C   1 
ATOM   3596 O O   . THR A 1 466 ? 5.974   24.179  22.958  1.00 56.61  ? 466  THR A O   1 
ATOM   3597 C CB  . THR A 1 466 ? 5.073   26.291  20.539  1.00 52.39  ? 466  THR A CB  1 
ATOM   3598 O OG1 . THR A 1 466 ? 5.167   24.951  20.026  1.00 55.66  ? 466  THR A OG1 1 
ATOM   3599 C CG2 . THR A 1 466 ? 5.801   27.262  19.604  1.00 38.94  ? 466  THR A CG2 1 
ATOM   3600 N N   . THR A 1 467 ? 3.940   25.129  23.135  1.00 58.75  ? 467  THR A N   1 
ATOM   3601 C CA  . THR A 1 467 ? 3.379   24.034  23.919  1.00 55.07  ? 467  THR A CA  1 
ATOM   3602 C C   . THR A 1 467 ? 3.357   22.724  23.131  1.00 54.16  ? 467  THR A C   1 
ATOM   3603 O O   . THR A 1 467 ? 3.567   21.648  23.692  1.00 61.64  ? 467  THR A O   1 
ATOM   3604 C CB  . THR A 1 467 ? 1.965   24.377  24.437  1.00 57.79  ? 467  THR A CB  1 
ATOM   3605 O OG1 . THR A 1 467 ? 1.976   25.697  24.994  1.00 67.63  ? 467  THR A OG1 1 
ATOM   3606 C CG2 . THR A 1 467 ? 1.536   23.389  25.518  1.00 66.95  ? 467  THR A CG2 1 
ATOM   3607 N N   . GLU A 1 468 ? 3.115   22.813  21.830  1.00 51.52  ? 468  GLU A N   1 
ATOM   3608 C CA  . GLU A 1 468 ? 3.168   21.627  20.989  1.00 59.44  ? 468  GLU A CA  1 
ATOM   3609 C C   . GLU A 1 468 ? 4.594   21.062  20.944  1.00 53.77  ? 468  GLU A C   1 
ATOM   3610 O O   . GLU A 1 468 ? 4.786   19.839  20.885  1.00 56.10  ? 468  GLU A O   1 
ATOM   3611 C CB  . GLU A 1 468 ? 2.633   21.930  19.582  1.00 62.41  ? 468  GLU A CB  1 
ATOM   3612 C CG  . GLU A 1 468 ? 1.306   22.690  19.579  1.00 78.18  ? 468  GLU A CG  1 
ATOM   3613 C CD  . GLU A 1 468 ? 1.494   24.204  19.445  1.00 89.40  ? 468  GLU A CD  1 
ATOM   3614 O OE1 . GLU A 1 468 ? 1.791   24.651  18.308  1.00 92.26  ? 468  GLU A OE1 1 
ATOM   3615 O OE2 . GLU A 1 468 ? 1.351   24.942  20.460  1.00 70.29  ? 468  GLU A OE2 1 
ATOM   3616 N N   . GLU A 1 469 ? 5.582   21.958  20.983  1.00 52.08  ? 469  GLU A N   1 
ATOM   3617 C CA  . GLU A 1 469 ? 6.984   21.562  21.044  1.00 50.74  ? 469  GLU A CA  1 
ATOM   3618 C C   . GLU A 1 469 ? 7.323   20.894  22.381  1.00 51.57  ? 469  GLU A C   1 
ATOM   3619 O O   . GLU A 1 469 ? 8.151   19.977  22.431  1.00 48.01  ? 469  GLU A O   1 
ATOM   3620 C CB  . GLU A 1 469 ? 7.908   22.750  20.739  1.00 47.76  ? 469  GLU A CB  1 
ATOM   3621 C CG  . GLU A 1 469 ? 8.013   23.056  19.250  1.00 48.37  ? 469  GLU A CG  1 
ATOM   3622 C CD  . GLU A 1 469 ? 8.893   24.262  18.937  1.00 52.97  ? 469  GLU A CD  1 
ATOM   3623 O OE1 . GLU A 1 469 ? 8.799   25.294  19.659  1.00 46.49  ? 469  GLU A OE1 1 
ATOM   3624 O OE2 . GLU A 1 469 ? 9.676   24.177  17.957  1.00 46.19  ? 469  GLU A OE2 1 
ATOM   3625 N N   . ARG A 1 470 ? 6.666   21.334  23.455  1.00 51.28  ? 470  ARG A N   1 
ATOM   3626 C CA  . ARG A 1 470 ? 6.816   20.691  24.766  1.00 53.46  ? 470  ARG A CA  1 
ATOM   3627 C C   . ARG A 1 470 ? 6.258   19.255  24.761  1.00 53.84  ? 470  ARG A C   1 
ATOM   3628 O O   . ARG A 1 470 ? 6.877   18.332  25.290  1.00 54.48  ? 470  ARG A O   1 
ATOM   3629 C CB  . ARG A 1 470 ? 6.146   21.532  25.847  1.00 61.27  ? 470  ARG A CB  1 
ATOM   3630 C CG  . ARG A 1 470 ? 6.698   21.299  27.241  1.00 74.18  ? 470  ARG A CG  1 
ATOM   3631 C CD  . ARG A 1 470 ? 5.752   20.472  28.141  1.00 82.43  ? 470  ARG A CD  1 
ATOM   3632 N NE  . ARG A 1 470 ? 4.509   21.181  28.468  1.00 92.14  ? 470  ARG A NE  1 
ATOM   3633 C CZ  . ARG A 1 470 ? 3.286   20.743  28.162  1.00 93.40  ? 470  ARG A CZ  1 
ATOM   3634 N NH1 . ARG A 1 470 ? 3.125   19.582  27.530  1.00 79.46  ? 470  ARG A NH1 1 
ATOM   3635 N NH2 . ARG A 1 470 ? 2.219   21.462  28.493  1.00 94.19  ? 470  ARG A NH2 1 
ATOM   3636 N N   . ILE A 1 471 ? 5.103   19.064  24.133  1.00 56.16  ? 471  ILE A N   1 
ATOM   3637 C CA  . ILE A 1 471 ? 4.484   17.740  24.023  1.00 54.33  ? 471  ILE A CA  1 
ATOM   3638 C C   . ILE A 1 471 ? 5.291   16.820  23.100  1.00 53.37  ? 471  ILE A C   1 
ATOM   3639 O O   . ILE A 1 471 ? 5.421   15.608  23.333  1.00 47.84  ? 471  ILE A O   1 
ATOM   3640 C CB  . ILE A 1 471 ? 3.043   17.871  23.488  1.00 55.34  ? 471  ILE A CB  1 
ATOM   3641 C CG1 . ILE A 1 471 ? 2.159   18.547  24.542  1.00 60.24  ? 471  ILE A CG1 1 
ATOM   3642 C CG2 . ILE A 1 471 ? 2.479   16.508  23.093  1.00 42.25  ? 471  ILE A CG2 1 
ATOM   3643 C CD1 . ILE A 1 471 ? 1.054   19.375  23.962  1.00 56.27  ? 471  ILE A CD1 1 
ATOM   3644 N N   . PHE A 1 472 ? 5.823   17.419  22.041  1.00 49.96  ? 472  PHE A N   1 
ATOM   3645 C CA  . PHE A 1 472 ? 6.605   16.701  21.053  1.00 47.79  ? 472  PHE A CA  1 
ATOM   3646 C C   . PHE A 1 472 ? 7.897   16.195  21.694  1.00 48.27  ? 472  PHE A C   1 
ATOM   3647 O O   . PHE A 1 472 ? 8.281   15.034  21.499  1.00 45.65  ? 472  PHE A O   1 
ATOM   3648 C CB  . PHE A 1 472 ? 6.886   17.641  19.882  1.00 43.64  ? 472  PHE A CB  1 
ATOM   3649 C CG  . PHE A 1 472 ? 7.750   17.051  18.812  1.00 45.61  ? 472  PHE A CG  1 
ATOM   3650 C CD1 . PHE A 1 472 ? 7.420   15.836  18.230  1.00 41.34  ? 472  PHE A CD1 1 
ATOM   3651 C CD2 . PHE A 1 472 ? 8.881   17.739  18.353  1.00 39.80  ? 472  PHE A CD2 1 
ATOM   3652 C CE1 . PHE A 1 472 ? 8.215   15.293  17.214  1.00 46.22  ? 472  PHE A CE1 1 
ATOM   3653 C CE2 . PHE A 1 472 ? 9.674   17.211  17.348  1.00 41.22  ? 472  PHE A CE2 1 
ATOM   3654 C CZ  . PHE A 1 472 ? 9.343   15.985  16.771  1.00 46.51  ? 472  PHE A CZ  1 
ATOM   3655 N N   . ALA A 1 473 ? 8.553   17.070  22.463  1.00 45.80  ? 473  ALA A N   1 
ATOM   3656 C CA  . ALA A 1 473 ? 9.778   16.711  23.178  1.00 44.11  ? 473  ALA A CA  1 
ATOM   3657 C C   . ALA A 1 473 ? 9.551   15.489  24.079  1.00 46.15  ? 473  ALA A C   1 
ATOM   3658 O O   . ALA A 1 473 ? 10.326  14.535  24.047  1.00 43.52  ? 473  ALA A O   1 
ATOM   3659 C CB  . ALA A 1 473 ? 10.291  17.894  23.984  1.00 44.77  ? 473  ALA A CB  1 
ATOM   3660 N N   . GLN A 1 474 ? 8.475   15.519  24.864  1.00 50.24  ? 474  GLN A N   1 
ATOM   3661 C CA  . GLN A 1 474 ? 8.090   14.388  25.715  1.00 51.57  ? 474  GLN A CA  1 
ATOM   3662 C C   . GLN A 1 474 ? 7.850   13.105  24.924  1.00 46.82  ? 474  GLN A C   1 
ATOM   3663 O O   . GLN A 1 474 ? 8.196   12.005  25.373  1.00 51.16  ? 474  GLN A O   1 
ATOM   3664 C CB  . GLN A 1 474 ? 6.843   14.741  26.532  1.00 49.00  ? 474  GLN A CB  1 
ATOM   3665 C CG  . GLN A 1 474 ? 7.057   15.935  27.459  1.00 53.55  ? 474  GLN A CG  1 
ATOM   3666 C CD  . GLN A 1 474 ? 5.813   16.318  28.235  1.00 63.95  ? 474  GLN A CD  1 
ATOM   3667 O OE1 . GLN A 1 474 ? 4.992   17.116  27.772  1.00 67.72  ? 474  GLN A OE1 1 
ATOM   3668 N NE2 . GLN A 1 474 ? 5.671   15.753  29.432  1.00 71.80  ? 474  GLN A NE2 1 
ATOM   3669 N N   . ARG A 1 475 ? 7.255   13.247  23.748  1.00 43.87  ? 475  ARG A N   1 
ATOM   3670 C CA  . ARG A 1 475 ? 7.006   12.100  22.899  1.00 48.18  ? 475  ARG A CA  1 
ATOM   3671 C C   . ARG A 1 475 ? 8.320   11.413  22.518  1.00 52.02  ? 475  ARG A C   1 
ATOM   3672 O O   . ARG A 1 475 ? 8.456   10.182  22.646  1.00 49.35  ? 475  ARG A O   1 
ATOM   3673 C CB  . ARG A 1 475 ? 6.234   12.533  21.649  1.00 52.46  ? 475  ARG A CB  1 
ATOM   3674 C CG  . ARG A 1 475 ? 5.067   11.630  21.330  1.00 54.12  ? 475  ARG A CG  1 
ATOM   3675 C CD  . ARG A 1 475 ? 4.235   12.170  20.196  1.00 50.65  ? 475  ARG A CD  1 
ATOM   3676 N NE  . ARG A 1 475 ? 4.697   11.655  18.912  1.00 59.70  ? 475  ARG A NE  1 
ATOM   3677 C CZ  . ARG A 1 475 ? 4.716   12.368  17.793  1.00 50.92  ? 475  ARG A CZ  1 
ATOM   3678 N NH1 . ARG A 1 475 ? 4.290   13.633  17.804  1.00 44.02  ? 475  ARG A NH1 1 
ATOM   3679 N NH2 . ARG A 1 475 ? 5.159   11.813  16.667  1.00 55.05  ? 475  ARG A NH2 1 
ATOM   3680 N N   . LEU A 1 476 ? 9.285   12.221  22.067  1.00 49.47  ? 476  LEU A N   1 
ATOM   3681 C CA  . LEU A 1 476 ? 10.607  11.734  21.661  1.00 40.96  ? 476  LEU A CA  1 
ATOM   3682 C C   . LEU A 1 476 ? 11.407  11.138  22.816  1.00 43.05  ? 476  LEU A C   1 
ATOM   3683 O O   . LEU A 1 476 ? 12.029  10.081  22.650  1.00 43.78  ? 476  LEU A O   1 
ATOM   3684 C CB  . LEU A 1 476 ? 11.406  12.853  20.986  1.00 46.65  ? 476  LEU A CB  1 
ATOM   3685 C CG  . LEU A 1 476 ? 10.767  13.395  19.704  1.00 47.08  ? 476  LEU A CG  1 
ATOM   3686 C CD1 . LEU A 1 476 ? 11.557  14.556  19.154  1.00 41.74  ? 476  LEU A CD1 1 
ATOM   3687 C CD2 . LEU A 1 476 ? 10.667  12.288  18.668  1.00 42.93  ? 476  LEU A CD2 1 
ATOM   3688 N N   . MET A 1 477 ? 11.399  11.807  23.975  1.00 39.54  ? 477  MET A N   1 
ATOM   3689 C CA  . MET A 1 477 ? 12.058  11.270  25.168  1.00 43.65  ? 477  MET A CA  1 
ATOM   3690 C C   . MET A 1 477 ? 11.518  9.886   25.498  1.00 46.99  ? 477  MET A C   1 
ATOM   3691 O O   . MET A 1 477 ? 12.275  9.019   25.932  1.00 46.81  ? 477  MET A O   1 
ATOM   3692 C CB  . MET A 1 477 ? 11.863  12.182  26.385  1.00 44.48  ? 477  MET A CB  1 
ATOM   3693 C CG  . MET A 1 477 ? 12.702  13.431  26.370  1.00 46.65  ? 477  MET A CG  1 
ATOM   3694 S SD  . MET A 1 477 ? 12.038  14.692  27.463  1.00 51.33  ? 477  MET A SD  1 
ATOM   3695 C CE  . MET A 1 477 ? 12.950  14.384  28.972  1.00 43.57  ? 477  MET A CE  1 
ATOM   3696 N N   . LYS A 1 478 ? 10.211  9.695   25.305  1.00 44.05  ? 478  LYS A N   1 
ATOM   3697 C CA  . LYS A 1 478 ? 9.578   8.401   25.537  1.00 49.43  ? 478  LYS A CA  1 
ATOM   3698 C C   . LYS A 1 478 ? 10.077  7.354   24.545  1.00 50.34  ? 478  LYS A C   1 
ATOM   3699 O O   . LYS A 1 478 ? 10.428  6.238   24.952  1.00 46.96  ? 478  LYS A O   1 
ATOM   3700 C CB  . LYS A 1 478 ? 8.052   8.513   25.465  1.00 59.04  ? 478  LYS A CB  1 
ATOM   3701 C CG  . LYS A 1 478 ? 7.377   8.750   26.806  1.00 65.17  ? 478  LYS A CG  1 
ATOM   3702 C CD  . LYS A 1 478 ? 7.370   7.489   27.676  1.00 71.81  ? 478  LYS A CD  1 
ATOM   3703 C CE  . LYS A 1 478 ? 6.859   7.797   29.081  1.00 69.85  ? 478  LYS A CE  1 
ATOM   3704 N NZ  . LYS A 1 478 ? 6.390   9.218   29.201  1.00 70.47  ? 478  LYS A NZ  1 
ATOM   3705 N N   . TYR A 1 479 ? 10.097  7.709   23.255  1.00 44.73  ? 479  TYR A N   1 
ATOM   3706 C CA  . TYR A 1 479 ? 10.601  6.811   22.209  1.00 46.49  ? 479  TYR A CA  1 
ATOM   3707 C C   . TYR A 1 479 ? 12.001  6.321   22.542  1.00 44.34  ? 479  TYR A C   1 
ATOM   3708 O O   . TYR A 1 479 ? 12.276  5.110   22.529  1.00 43.33  ? 479  TYR A O   1 
ATOM   3709 C CB  . TYR A 1 479 ? 10.662  7.525   20.857  1.00 43.46  ? 479  TYR A CB  1 
ATOM   3710 C CG  . TYR A 1 479 ? 9.326   7.787   20.217  1.00 44.53  ? 479  TYR A CG  1 
ATOM   3711 C CD1 . TYR A 1 479 ? 8.306   6.844   20.274  1.00 46.66  ? 479  TYR A CD1 1 
ATOM   3712 C CD2 . TYR A 1 479 ? 9.088   8.969   19.529  1.00 45.16  ? 479  TYR A CD2 1 
ATOM   3713 C CE1 . TYR A 1 479 ? 7.073   7.077   19.665  1.00 43.17  ? 479  TYR A CE1 1 
ATOM   3714 C CE2 . TYR A 1 479 ? 7.859   9.218   18.924  1.00 48.72  ? 479  TYR A CE2 1 
ATOM   3715 C CZ  . TYR A 1 479 ? 6.854   8.265   18.995  1.00 52.80  ? 479  TYR A CZ  1 
ATOM   3716 O OH  . TYR A 1 479 ? 5.630   8.502   18.402  1.00 56.70  ? 479  TYR A OH  1 
ATOM   3717 N N   . TRP A 1 480 ? 12.879  7.281   22.828  1.00 43.26  ? 480  TRP A N   1 
ATOM   3718 C CA  . TRP A 1 480 ? 14.279  6.997   23.115  1.00 47.11  ? 480  TRP A CA  1 
ATOM   3719 C C   . TRP A 1 480 ? 14.462  6.130   24.377  1.00 48.15  ? 480  TRP A C   1 
ATOM   3720 O O   . TRP A 1 480 ? 15.187  5.120   24.345  1.00 38.85  ? 480  TRP A O   1 
ATOM   3721 C CB  . TRP A 1 480 ? 15.075  8.310   23.221  1.00 40.67  ? 480  TRP A CB  1 
ATOM   3722 C CG  . TRP A 1 480 ? 15.877  8.671   21.968  1.00 46.17  ? 480  TRP A CG  1 
ATOM   3723 C CD1 . TRP A 1 480 ? 17.244  8.827   21.879  1.00 45.14  ? 480  TRP A CD1 1 
ATOM   3724 C CD2 . TRP A 1 480 ? 15.365  8.918   20.640  1.00 45.39  ? 480  TRP A CD2 1 
ATOM   3725 N NE1 . TRP A 1 480 ? 17.601  9.153   20.585  1.00 39.83  ? 480  TRP A NE1 1 
ATOM   3726 C CE2 . TRP A 1 480 ? 16.471  9.217   19.810  1.00 39.26  ? 480  TRP A CE2 1 
ATOM   3727 C CE3 . TRP A 1 480 ? 14.084  8.909   20.074  1.00 43.43  ? 480  TRP A CE3 1 
ATOM   3728 C CZ2 . TRP A 1 480 ? 16.331  9.499   18.450  1.00 45.52  ? 480  TRP A CZ2 1 
ATOM   3729 C CZ3 . TRP A 1 480 ? 13.948  9.191   18.729  1.00 44.69  ? 480  TRP A CZ3 1 
ATOM   3730 C CH2 . TRP A 1 480 ? 15.062  9.486   17.930  1.00 45.36  ? 480  TRP A CH2 1 
ATOM   3731 N N   . THR A 1 481 ? 13.803  6.508   25.476  1.00 44.10  ? 481  THR A N   1 
ATOM   3732 C CA  . THR A 1 481 ? 13.911  5.742   26.730  1.00 43.58  ? 481  THR A CA  1 
ATOM   3733 C C   . THR A 1 481 ? 13.174  4.387   26.685  1.00 48.19  ? 481  THR A C   1 
ATOM   3734 O O   . THR A 1 481 ? 13.610  3.431   27.327  1.00 49.44  ? 481  THR A O   1 
ATOM   3735 C CB  . THR A 1 481 ? 13.475  6.556   27.969  1.00 45.92  ? 481  THR A CB  1 
ATOM   3736 O OG1 . THR A 1 481 ? 12.107  6.961   27.821  1.00 55.02  ? 481  THR A OG1 1 
ATOM   3737 C CG2 . THR A 1 481 ? 14.353  7.799   28.154  1.00 42.60  ? 481  THR A CG2 1 
ATOM   3738 N N   . ASN A 1 482 ? 12.073  4.287   25.939  1.00 45.80  ? 482  ASN A N   1 
ATOM   3739 C CA  . ASN A 1 482 ? 11.489  2.965   25.695  1.00 47.58  ? 482  ASN A CA  1 
ATOM   3740 C C   . ASN A 1 482 ? 12.487  2.077   24.975  1.00 50.70  ? 482  ASN A C   1 
ATOM   3741 O O   . ASN A 1 482 ? 12.727  0.935   25.383  1.00 54.34  ? 482  ASN A O   1 
ATOM   3742 C CB  . ASN A 1 482 ? 10.187  3.026   24.893  1.00 46.77  ? 482  ASN A CB  1 
ATOM   3743 C CG  . ASN A 1 482 ? 9.022   3.544   25.705  1.00 51.93  ? 482  ASN A CG  1 
ATOM   3744 O OD1 . ASN A 1 482 ? 9.113   3.694   26.927  1.00 57.31  ? 482  ASN A OD1 1 
ATOM   3745 N ND2 . ASN A 1 482 ? 7.915   3.822   25.030  1.00 53.37  ? 482  ASN A ND2 1 
ATOM   3746 N N   . PHE A 1 483 ? 13.075  2.610   23.907  1.00 48.44  ? 483  PHE A N   1 
ATOM   3747 C CA  . PHE A 1 483 ? 14.087  1.871   23.166  1.00 44.27  ? 483  PHE A CA  1 
ATOM   3748 C C   . PHE A 1 483 ? 15.256  1.423   24.060  1.00 47.88  ? 483  PHE A C   1 
ATOM   3749 O O   . PHE A 1 483 ? 15.702  0.270   23.983  1.00 50.44  ? 483  PHE A O   1 
ATOM   3750 C CB  . PHE A 1 483 ? 14.593  2.657   21.947  1.00 45.55  ? 483  PHE A CB  1 
ATOM   3751 C CG  . PHE A 1 483 ? 15.689  1.952   21.220  1.00 40.22  ? 483  PHE A CG  1 
ATOM   3752 C CD1 . PHE A 1 483 ? 15.395  0.944   20.303  1.00 43.27  ? 483  PHE A CD1 1 
ATOM   3753 C CD2 . PHE A 1 483 ? 17.016  2.234   21.502  1.00 32.72  ? 483  PHE A CD2 1 
ATOM   3754 C CE1 . PHE A 1 483 ? 16.407  0.251   19.650  1.00 44.12  ? 483  PHE A CE1 1 
ATOM   3755 C CE2 . PHE A 1 483 ? 18.038  1.539   20.858  1.00 43.84  ? 483  PHE A CE2 1 
ATOM   3756 C CZ  . PHE A 1 483 ? 17.732  0.549   19.924  1.00 46.36  ? 483  PHE A CZ  1 
ATOM   3757 N N   . ALA A 1 484 ? 15.758  2.325   24.901  1.00 51.02  ? 484  ALA A N   1 
ATOM   3758 C CA  . ALA A 1 484 ? 16.838  1.972   25.830  1.00 53.27  ? 484  ALA A CA  1 
ATOM   3759 C C   . ALA A 1 484 ? 16.432  0.820   26.760  1.00 52.60  ? 484  ALA A C   1 
ATOM   3760 O O   . ALA A 1 484 ? 17.219  -0.102  26.995  1.00 54.80  ? 484  ALA A O   1 
ATOM   3761 C CB  . ALA A 1 484 ? 17.275  3.181   26.635  1.00 47.52  ? 484  ALA A CB  1 
ATOM   3762 N N   . ARG A 1 485 ? 15.203  0.874   27.271  1.00 53.00  ? 485  ARG A N   1 
ATOM   3763 C CA  . ARG A 1 485 ? 14.681  -0.172  28.155  1.00 54.32  ? 485  ARG A CA  1 
ATOM   3764 C C   . ARG A 1 485 ? 14.456  -1.526  27.478  1.00 52.32  ? 485  ARG A C   1 
ATOM   3765 O O   . ARG A 1 485 ? 14.877  -2.552  27.997  1.00 60.97  ? 485  ARG A O   1 
ATOM   3766 C CB  . ARG A 1 485 ? 13.359  0.270   28.796  1.00 54.67  ? 485  ARG A CB  1 
ATOM   3767 C CG  . ARG A 1 485 ? 13.509  1.224   29.979  1.00 65.34  ? 485  ARG A CG  1 
ATOM   3768 C CD  . ARG A 1 485 ? 12.148  1.526   30.622  1.00 69.34  ? 485  ARG A CD  1 
ATOM   3769 N NE  . ARG A 1 485 ? 11.378  2.520   29.865  1.00 68.74  ? 485  ARG A NE  1 
ATOM   3770 C CZ  . ARG A 1 485 ? 11.484  3.838   30.044  1.00 72.72  ? 485  ARG A CZ  1 
ATOM   3771 N NH1 . ARG A 1 485 ? 12.332  4.309   30.961  1.00 62.92  ? 485  ARG A NH1 1 
ATOM   3772 N NH2 . ARG A 1 485 ? 10.750  4.687   29.311  1.00 62.16  ? 485  ARG A NH2 1 
ATOM   3773 N N   . THR A 1 486 ? 13.806  -1.520  26.317  1.00 51.16  ? 486  THR A N   1 
ATOM   3774 C CA  . THR A 1 486 ? 13.228  -2.740  25.760  1.00 48.54  ? 486  THR A CA  1 
ATOM   3775 C C   . THR A 1 486 ? 13.731  -3.127  24.379  1.00 53.67  ? 486  THR A C   1 
ATOM   3776 O O   . THR A 1 486 ? 13.475  -4.241  23.916  1.00 58.47  ? 486  THR A O   1 
ATOM   3777 C CB  . THR A 1 486 ? 11.712  -2.594  25.630  1.00 46.38  ? 486  THR A CB  1 
ATOM   3778 O OG1 . THR A 1 486 ? 11.420  -1.754  24.509  1.00 50.94  ? 486  THR A OG1 1 
ATOM   3779 C CG2 . THR A 1 486 ? 11.108  -1.970  26.897  1.00 40.27  ? 486  THR A CG2 1 
ATOM   3780 N N   . GLY A 1 487 ? 14.427  -2.211  23.711  1.00 56.97  ? 487  GLY A N   1 
ATOM   3781 C CA  . GLY A 1 487 ? 14.788  -2.387  22.308  1.00 53.25  ? 487  GLY A CA  1 
ATOM   3782 C C   . GLY A 1 487 ? 13.634  -2.067  21.358  1.00 52.31  ? 487  GLY A C   1 
ATOM   3783 O O   . GLY A 1 487 ? 13.673  -2.431  20.182  1.00 50.71  ? 487  GLY A O   1 
ATOM   3784 N N   . ASP A 1 488 ? 12.620  -1.367  21.870  1.00 48.93  ? 488  ASP A N   1 
ATOM   3785 C CA  . ASP A 1 488 ? 11.406  -1.070  21.123  1.00 51.25  ? 488  ASP A CA  1 
ATOM   3786 C C   . ASP A 1 488 ? 10.939  0.332   21.505  1.00 51.75  ? 488  ASP A C   1 
ATOM   3787 O O   . ASP A 1 488 ? 10.627  0.579   22.671  1.00 53.31  ? 488  ASP A O   1 
ATOM   3788 C CB  . ASP A 1 488 ? 10.325  -2.097  21.495  1.00 52.66  ? 488  ASP A CB  1 
ATOM   3789 C CG  . ASP A 1 488 ? 9.118   -2.060  20.571  1.00 60.89  ? 488  ASP A CG  1 
ATOM   3790 O OD1 . ASP A 1 488 ? 8.673   -0.955  20.175  1.00 61.14  ? 488  ASP A OD1 1 
ATOM   3791 O OD2 . ASP A 1 488 ? 8.600   -3.153  20.245  1.00 65.58  ? 488  ASP A OD2 1 
ATOM   3792 N N   . PRO A 1 489 ? 10.878  1.252   20.521  1.00 54.54  ? 489  PRO A N   1 
ATOM   3793 C CA  . PRO A 1 489 ? 10.446  2.635   20.789  1.00 53.52  ? 489  PRO A CA  1 
ATOM   3794 C C   . PRO A 1 489 ? 8.977   2.731   21.227  1.00 51.59  ? 489  PRO A C   1 
ATOM   3795 O O   . PRO A 1 489 ? 8.614   3.723   21.857  1.00 56.53  ? 489  PRO A O   1 
ATOM   3796 C CB  . PRO A 1 489 ? 10.624  3.350   19.434  1.00 49.24  ? 489  PRO A CB  1 
ATOM   3797 C CG  . PRO A 1 489 ? 11.292  2.367   18.524  1.00 49.53  ? 489  PRO A CG  1 
ATOM   3798 C CD  . PRO A 1 489 ? 11.107  0.998   19.086  1.00 45.83  ? 489  PRO A CD  1 
ATOM   3799 N N   . ASN A 1 490 ? 8.158   1.730   20.910  1.00 51.84  ? 490  ASN A N   1 
ATOM   3800 C CA  . ASN A 1 490 ? 6.717   1.793   21.197  1.00 61.80  ? 490  ASN A CA  1 
ATOM   3801 C C   . ASN A 1 490 ? 6.388   1.563   22.676  1.00 66.78  ? 490  ASN A C   1 
ATOM   3802 O O   . ASN A 1 490 ? 7.152   0.910   23.399  1.00 67.55  ? 490  ASN A O   1 
ATOM   3803 C CB  . ASN A 1 490 ? 5.944   0.762   20.358  1.00 61.68  ? 490  ASN A CB  1 
ATOM   3804 C CG  . ASN A 1 490 ? 6.176   0.912   18.857  1.00 58.75  ? 490  ASN A CG  1 
ATOM   3805 O OD1 . ASN A 1 490 ? 5.548   1.754   18.204  1.00 52.68  ? 490  ASN A OD1 1 
ATOM   3806 N ND2 . ASN A 1 490 ? 7.056   0.070   18.298  1.00 43.91  ? 490  ASN A ND2 1 
ATOM   3807 N N   . ASP A 1 491 ? 5.247   2.092   23.115  1.00 79.38  ? 491  ASP A N   1 
ATOM   3808 C CA  . ASP A 1 491 ? 4.704   1.778   24.438  1.00 88.84  ? 491  ASP A CA  1 
ATOM   3809 C C   . ASP A 1 491 ? 3.780   0.549   24.362  1.00 100.72 ? 491  ASP A C   1 
ATOM   3810 O O   . ASP A 1 491 ? 2.833   0.527   23.563  1.00 92.36  ? 491  ASP A O   1 
ATOM   3811 C CB  . ASP A 1 491 ? 3.925   2.977   24.989  1.00 99.16  ? 491  ASP A CB  1 
ATOM   3812 C CG  . ASP A 1 491 ? 3.664   2.871   26.487  1.00 110.75 ? 491  ASP A CG  1 
ATOM   3813 O OD1 . ASP A 1 491 ? 4.418   2.148   27.177  1.00 109.62 ? 491  ASP A OD1 1 
ATOM   3814 O OD2 . ASP A 1 491 ? 2.708   3.517   26.978  1.00 113.52 ? 491  ASP A OD2 1 
ATOM   3815 N N   . PRO A 1 492 ? 4.063   -0.490  25.176  1.00 106.94 ? 492  PRO A N   1 
ATOM   3816 C CA  . PRO A 1 492 ? 3.180   -1.667  25.233  1.00 109.58 ? 492  PRO A CA  1 
ATOM   3817 C C   . PRO A 1 492 ? 1.778   -1.309  25.735  1.00 111.12 ? 492  PRO A C   1 
ATOM   3818 O O   . PRO A 1 492 ? 0.791   -1.915  25.300  1.00 112.91 ? 492  PRO A O   1 
ATOM   3819 C CB  . PRO A 1 492 ? 3.885   -2.586  26.238  1.00 97.95  ? 492  PRO A CB  1 
ATOM   3820 C CG  . PRO A 1 492 ? 5.318   -2.195  26.156  1.00 98.41  ? 492  PRO A CG  1 
ATOM   3821 C CD  . PRO A 1 492 ? 5.302   -0.698  25.946  1.00 96.93  ? 492  PRO A CD  1 
ATOM   3822 N N   . ARG A 1 493 ? 1.709   -0.330  26.638  1.00 111.58 ? 493  ARG A N   1 
ATOM   3823 C CA  . ARG A 1 493 ? 0.447   0.187   27.158  1.00 114.93 ? 493  ARG A CA  1 
ATOM   3824 C C   . ARG A 1 493 ? -0.401  0.779   26.033  1.00 119.07 ? 493  ARG A C   1 
ATOM   3825 O O   . ARG A 1 493 ? -1.268  0.101   25.473  1.00 122.65 ? 493  ARG A O   1 
ATOM   3826 C CB  . ARG A 1 493 ? 0.711   1.254   28.227  1.00 115.34 ? 493  ARG A CB  1 
ATOM   3827 C CG  . ARG A 1 493 ? 1.729   0.846   29.288  1.00 115.41 ? 493  ARG A CG  1 
ATOM   3828 C CD  . ARG A 1 493 ? 1.282   -0.402  30.026  1.00 119.33 ? 493  ARG A CD  1 
ATOM   3829 N NE  . ARG A 1 493 ? 1.395   -0.245  31.473  1.00 130.52 ? 493  ARG A NE  1 
ATOM   3830 C CZ  . ARG A 1 493 ? 0.686   -0.938  32.360  1.00 134.26 ? 493  ARG A CZ  1 
ATOM   3831 N NH1 . ARG A 1 493 ? -0.196  -1.841  31.951  1.00 126.71 ? 493  ARG A NH1 1 
ATOM   3832 N NH2 . ARG A 1 493 ? 0.853   -0.725  33.660  1.00 132.49 ? 493  ARG A NH2 1 
ATOM   3833 N N   . ASP A 1 494 ? -0.148  2.046   25.712  1.00 120.83 ? 494  ASP A N   1 
ATOM   3834 C CA  . ASP A 1 494 ? -0.823  2.723   24.601  1.00 122.03 ? 494  ASP A CA  1 
ATOM   3835 C C   . ASP A 1 494 ? -0.580  2.010   23.261  1.00 118.13 ? 494  ASP A C   1 
ATOM   3836 O O   . ASP A 1 494 ? 0.544   1.977   22.755  1.00 117.82 ? 494  ASP A O   1 
ATOM   3837 C CB  . ASP A 1 494 ? -0.373  4.178   24.526  1.00 118.28 ? 494  ASP A CB  1 
ATOM   3838 C CG  . ASP A 1 494 ? -0.562  4.771   23.149  1.00 127.94 ? 494  ASP A CG  1 
ATOM   3839 O OD1 . ASP A 1 494 ? -1.719  4.817   22.679  1.00 127.86 ? 494  ASP A OD1 1 
ATOM   3840 O OD2 . ASP A 1 494 ? 0.444   5.190   22.537  1.00 129.23 ? 494  ASP A OD2 1 
ATOM   3841 N N   . SER A 1 495 ? -1.648  1.464   22.682  1.00 119.39 ? 495  SER A N   1 
ATOM   3842 C CA  . SER A 1 495 ? -1.535  0.480   21.604  1.00 119.91 ? 495  SER A CA  1 
ATOM   3843 C C   . SER A 1 495 ? -2.263  0.859   20.316  1.00 118.03 ? 495  SER A C   1 
ATOM   3844 O O   . SER A 1 495 ? -2.178  0.134   19.315  1.00 111.24 ? 495  SER A O   1 
ATOM   3845 C CB  . SER A 1 495 ? -2.109  -0.859  22.079  1.00 119.93 ? 495  SER A CB  1 
ATOM   3846 O OG  . SER A 1 495 ? -3.524  -0.791  22.115  1.00 119.09 ? 495  SER A OG  1 
ATOM   3847 N N   . LYS A 1 496 ? -2.999  1.969   20.349  1.00 117.70 ? 496  LYS A N   1 
ATOM   3848 C CA  . LYS A 1 496 ? -3.802  2.399   19.201  1.00 115.52 ? 496  LYS A CA  1 
ATOM   3849 C C   . LYS A 1 496 ? -3.185  3.612   18.505  1.00 119.65 ? 496  LYS A C   1 
ATOM   3850 O O   . LYS A 1 496 ? -3.387  3.815   17.299  1.00 111.69 ? 496  LYS A O   1 
ATOM   3851 C CB  . LYS A 1 496 ? -5.236  2.703   19.630  1.00 108.38 ? 496  LYS A CB  1 
ATOM   3852 N N   . SER A 1 497 ? -2.461  4.428   19.276  1.00 121.97 ? 497  SER A N   1 
ATOM   3853 C CA  . SER A 1 497 ? -1.572  5.434   18.701  1.00 108.63 ? 497  SER A CA  1 
ATOM   3854 C C   . SER A 1 497 ? -0.607  4.651   17.829  1.00 103.49 ? 497  SER A C   1 
ATOM   3855 O O   . SER A 1 497 ? -0.067  3.625   18.270  1.00 101.67 ? 497  SER A O   1 
ATOM   3856 C CB  . SER A 1 497 ? -0.804  6.180   19.785  1.00 106.41 ? 497  SER A CB  1 
ATOM   3857 O OG  . SER A 1 497 ? -1.639  6.504   20.880  1.00 122.51 ? 497  SER A OG  1 
ATOM   3858 N N   . PRO A 1 498 ? -0.383  5.130   16.593  1.00 93.24  ? 498  PRO A N   1 
ATOM   3859 C CA  . PRO A 1 498 ? 0.179   4.269   15.542  1.00 84.04  ? 498  PRO A CA  1 
ATOM   3860 C C   . PRO A 1 498 ? 1.515   3.675   15.964  1.00 78.32  ? 498  PRO A C   1 
ATOM   3861 O O   . PRO A 1 498 ? 2.276   4.335   16.684  1.00 72.46  ? 498  PRO A O   1 
ATOM   3862 C CB  . PRO A 1 498 ? 0.371   5.225   14.357  1.00 80.22  ? 498  PRO A CB  1 
ATOM   3863 C CG  . PRO A 1 498 ? -0.420  6.462   14.693  1.00 76.46  ? 498  PRO A CG  1 
ATOM   3864 C CD  . PRO A 1 498 ? -0.441  6.545   16.183  1.00 82.31  ? 498  PRO A CD  1 
ATOM   3865 N N   . GLN A 1 499 ? 1.781   2.443   15.539  1.00 74.14  ? 499  GLN A N   1 
ATOM   3866 C CA  . GLN A 1 499 ? 2.999   1.742   15.931  1.00 65.09  ? 499  GLN A CA  1 
ATOM   3867 C C   . GLN A 1 499 ? 4.161   2.097   15.014  1.00 64.80  ? 499  GLN A C   1 
ATOM   3868 O O   . GLN A 1 499 ? 3.964   2.546   13.880  1.00 59.76  ? 499  GLN A O   1 
ATOM   3869 C CB  . GLN A 1 499 ? 2.769   0.226   15.927  1.00 62.68  ? 499  GLN A CB  1 
ATOM   3870 C CG  . GLN A 1 499 ? 1.708   -0.229  16.910  1.00 70.73  ? 499  GLN A CG  1 
ATOM   3871 C CD  . GLN A 1 499 ? 2.053   0.145   18.341  1.00 73.25  ? 499  GLN A CD  1 
ATOM   3872 O OE1 . GLN A 1 499 ? 2.854   -0.534  18.989  1.00 68.97  ? 499  GLN A OE1 1 
ATOM   3873 N NE2 . GLN A 1 499 ? 1.460   1.236   18.839  1.00 73.08  ? 499  GLN A NE2 1 
ATOM   3874 N N   . TRP A 1 500 ? 5.373   1.898   15.518  1.00 58.65  ? 500  TRP A N   1 
ATOM   3875 C CA  . TRP A 1 500 ? 6.578   2.126   14.741  1.00 51.18  ? 500  TRP A CA  1 
ATOM   3876 C C   . TRP A 1 500 ? 7.113   0.745   14.351  1.00 50.68  ? 500  TRP A C   1 
ATOM   3877 O O   . TRP A 1 500 ? 7.593   -0.005  15.211  1.00 57.67  ? 500  TRP A O   1 
ATOM   3878 C CB  . TRP A 1 500 ? 7.571   2.943   15.595  1.00 55.94  ? 500  TRP A CB  1 
ATOM   3879 C CG  . TRP A 1 500 ? 8.904   3.364   14.973  1.00 52.27  ? 500  TRP A CG  1 
ATOM   3880 C CD1 . TRP A 1 500 ? 9.506   2.853   13.851  1.00 47.67  ? 500  TRP A CD1 1 
ATOM   3881 C CD2 . TRP A 1 500 ? 9.798   4.365   15.485  1.00 46.53  ? 500  TRP A CD2 1 
ATOM   3882 N NE1 . TRP A 1 500 ? 10.712  3.481   13.635  1.00 47.15  ? 500  TRP A NE1 1 
ATOM   3883 C CE2 . TRP A 1 500 ? 10.913  4.416   14.619  1.00 46.87  ? 500  TRP A CE2 1 
ATOM   3884 C CE3 . TRP A 1 500 ? 9.758   5.229   16.589  1.00 44.16  ? 500  TRP A CE3 1 
ATOM   3885 C CZ2 . TRP A 1 500 ? 11.980  5.300   14.822  1.00 44.75  ? 500  TRP A CZ2 1 
ATOM   3886 C CZ3 . TRP A 1 500 ? 10.817  6.114   16.786  1.00 38.37  ? 500  TRP A CZ3 1 
ATOM   3887 C CH2 . TRP A 1 500 ? 11.912  6.138   15.910  1.00 44.02  ? 500  TRP A CH2 1 
ATOM   3888 N N   . PRO A 1 501 ? 6.997   0.396   13.052  1.00 48.35  ? 501  PRO A N   1 
ATOM   3889 C CA  . PRO A 1 501 ? 7.460   -0.879  12.495  1.00 45.91  ? 501  PRO A CA  1 
ATOM   3890 C C   . PRO A 1 501 ? 8.967   -0.895  12.401  1.00 49.53  ? 501  PRO A C   1 
ATOM   3891 O O   . PRO A 1 501 ? 9.547   0.137   12.050  1.00 56.87  ? 501  PRO A O   1 
ATOM   3892 C CB  . PRO A 1 501 ? 6.907   -0.871  11.054  1.00 46.86  ? 501  PRO A CB  1 
ATOM   3893 C CG  . PRO A 1 501 ? 6.132   0.395   10.892  1.00 49.14  ? 501  PRO A CG  1 
ATOM   3894 C CD  . PRO A 1 501 ? 6.499   1.310   12.010  1.00 51.15  ? 501  PRO A CD  1 
ATOM   3895 N N   . PRO A 1 502 ? 9.595   -2.037  12.701  1.00 50.87  ? 502  PRO A N   1 
ATOM   3896 C CA  . PRO A 1 502 ? 11.007  -2.243  12.345  1.00 51.42  ? 502  PRO A CA  1 
ATOM   3897 C C   . PRO A 1 502 ? 11.296  -2.014  10.847  1.00 52.95  ? 502  PRO A C   1 
ATOM   3898 O O   . PRO A 1 502 ? 10.456  -2.280  9.985   1.00 54.00  ? 502  PRO A O   1 
ATOM   3899 C CB  . PRO A 1 502 ? 11.243  -3.716  12.703  1.00 44.90  ? 502  PRO A CB  1 
ATOM   3900 C CG  . PRO A 1 502 ? 10.316  -3.958  13.846  1.00 47.26  ? 502  PRO A CG  1 
ATOM   3901 C CD  . PRO A 1 502 ? 9.090   -3.082  13.606  1.00 44.06  ? 502  PRO A CD  1 
ATOM   3902 N N   . TYR A 1 503 ? 12.486  -1.498  10.557  1.00 54.38  ? 503  TYR A N   1 
ATOM   3903 C CA  . TYR A 1 503 ? 12.954  -1.366  9.192   1.00 53.33  ? 503  TYR A CA  1 
ATOM   3904 C C   . TYR A 1 503 ? 13.425  -2.739  8.687   1.00 58.09  ? 503  TYR A C   1 
ATOM   3905 O O   . TYR A 1 503 ? 14.219  -3.424  9.347   1.00 56.87  ? 503  TYR A O   1 
ATOM   3906 C CB  . TYR A 1 503 ? 14.101  -0.345  9.122   1.00 51.53  ? 503  TYR A CB  1 
ATOM   3907 C CG  . TYR A 1 503 ? 14.705  -0.151  7.742   1.00 50.90  ? 503  TYR A CG  1 
ATOM   3908 C CD1 . TYR A 1 503 ? 15.748  -0.966  7.288   1.00 47.43  ? 503  TYR A CD1 1 
ATOM   3909 C CD2 . TYR A 1 503 ? 14.248  0.858   6.899   1.00 44.57  ? 503  TYR A CD2 1 
ATOM   3910 C CE1 . TYR A 1 503 ? 16.298  -0.789  6.030   1.00 46.77  ? 503  TYR A CE1 1 
ATOM   3911 C CE2 . TYR A 1 503 ? 14.802  1.043   5.638   1.00 47.32  ? 503  TYR A CE2 1 
ATOM   3912 C CZ  . TYR A 1 503 ? 15.825  0.216   5.213   1.00 49.98  ? 503  TYR A CZ  1 
ATOM   3913 O OH  . TYR A 1 503 ? 16.377  0.399   3.968   1.00 60.55  ? 503  TYR A OH  1 
ATOM   3914 N N   . THR A 1 504 ? 12.938  -3.131  7.512   1.00 54.84  ? 504  THR A N   1 
ATOM   3915 C CA  . THR A 1 504 ? 13.286  -4.418  6.909   1.00 56.32  ? 504  THR A CA  1 
ATOM   3916 C C   . THR A 1 504 ? 13.721  -4.227  5.460   1.00 57.21  ? 504  THR A C   1 
ATOM   3917 O O   . THR A 1 504 ? 13.232  -3.327  4.774   1.00 56.92  ? 504  THR A O   1 
ATOM   3918 C CB  . THR A 1 504 ? 12.075  -5.369  6.916   1.00 59.51  ? 504  THR A CB  1 
ATOM   3919 O OG1 . THR A 1 504 ? 10.962  -4.735  6.255   1.00 57.62  ? 504  THR A OG1 1 
ATOM   3920 C CG2 . THR A 1 504 ? 11.688  -5.717  8.348   1.00 47.84  ? 504  THR A CG2 1 
ATOM   3921 N N   . THR A 1 505 ? 14.630  -5.082  4.999   1.00 59.95  ? 505  THR A N   1 
ATOM   3922 C CA  . THR A 1 505 ? 15.061  -5.074  3.602   1.00 60.96  ? 505  THR A CA  1 
ATOM   3923 C C   . THR A 1 505 ? 13.871  -5.221  2.650   1.00 61.96  ? 505  THR A C   1 
ATOM   3924 O O   . THR A 1 505 ? 13.820  -4.576  1.606   1.00 61.09  ? 505  THR A O   1 
ATOM   3925 C CB  . THR A 1 505 ? 16.079  -6.189  3.323   1.00 62.18  ? 505  THR A CB  1 
ATOM   3926 O OG1 . THR A 1 505 ? 15.498  -7.457  3.649   1.00 68.81  ? 505  THR A OG1 1 
ATOM   3927 C CG2 . THR A 1 505 ? 17.346  -5.980  4.157   1.00 60.80  ? 505  THR A CG2 1 
ATOM   3928 N N   . ALA A 1 506 ? 12.914  -6.062  3.030   1.00 66.63  ? 506  ALA A N   1 
ATOM   3929 C CA  . ALA A 1 506 ? 11.675  -6.229  2.272   1.00 64.53  ? 506  ALA A CA  1 
ATOM   3930 C C   . ALA A 1 506 ? 10.851  -4.943  2.147   1.00 63.01  ? 506  ALA A C   1 
ATOM   3931 O O   . ALA A 1 506 ? 10.633  -4.452  1.041   1.00 77.65  ? 506  ALA A O   1 
ATOM   3932 C CB  . ALA A 1 506 ? 10.822  -7.333  2.893   1.00 69.07  ? 506  ALA A CB  1 
ATOM   3933 N N   . ALA A 1 507 ? 10.399  -4.403  3.281   1.00 56.77  ? 507  ALA A N   1 
ATOM   3934 C CA  . ALA A 1 507 ? 9.421   -3.309  3.286   1.00 62.57  ? 507  ALA A CA  1 
ATOM   3935 C C   . ALA A 1 507 ? 9.998   -1.896  3.444   1.00 59.07  ? 507  ALA A C   1 
ATOM   3936 O O   . ALA A 1 507 ? 9.318   -0.915  3.141   1.00 63.24  ? 507  ALA A O   1 
ATOM   3937 C CB  . ALA A 1 507 ? 8.339   -3.561  4.357   1.00 55.97  ? 507  ALA A CB  1 
ATOM   3938 N N   . GLN A 1 508 ? 11.227  -1.800  3.948   1.00 56.10  ? 508  GLN A N   1 
ATOM   3939 C CA  . GLN A 1 508 ? 11.915  -0.517  4.152   1.00 56.19  ? 508  GLN A CA  1 
ATOM   3940 C C   . GLN A 1 508 ? 11.090  0.562   4.850   1.00 56.46  ? 508  GLN A C   1 
ATOM   3941 O O   . GLN A 1 508 ? 11.030  1.712   4.387   1.00 56.79  ? 508  GLN A O   1 
ATOM   3942 C CB  . GLN A 1 508 ? 12.431  0.030   2.820   1.00 57.62  ? 508  GLN A CB  1 
ATOM   3943 C CG  . GLN A 1 508 ? 13.291  -0.951  2.059   1.00 62.32  ? 508  GLN A CG  1 
ATOM   3944 C CD  . GLN A 1 508 ? 13.841  -0.362  0.784   1.00 70.58  ? 508  GLN A CD  1 
ATOM   3945 O OE1 . GLN A 1 508 ? 14.368  0.756   0.776   1.00 74.16  ? 508  GLN A OE1 1 
ATOM   3946 N NE2 . GLN A 1 508 ? 13.709  -1.105  -0.313  1.00 70.38  ? 508  GLN A NE2 1 
ATOM   3947 N N   . GLN A 1 509 ? 10.461  0.210   5.963   1.00 51.68  ? 509  GLN A N   1 
ATOM   3948 C CA  . GLN A 1 509 ? 9.652   1.194   6.677   1.00 55.77  ? 509  GLN A CA  1 
ATOM   3949 C C   . GLN A 1 509 ? 10.432  2.014   7.707   1.00 55.49  ? 509  GLN A C   1 
ATOM   3950 O O   . GLN A 1 509 ? 11.365  1.512   8.372   1.00 48.82  ? 509  GLN A O   1 
ATOM   3951 C CB  . GLN A 1 509 ? 8.458   0.529   7.351   1.00 53.52  ? 509  GLN A CB  1 
ATOM   3952 C CG  . GLN A 1 509 ? 7.627   -0.316  6.410   1.00 62.18  ? 509  GLN A CG  1 
ATOM   3953 C CD  . GLN A 1 509 ? 6.646   -1.188  7.159   1.00 59.94  ? 509  GLN A CD  1 
ATOM   3954 O OE1 . GLN A 1 509 ? 6.995   -2.289  7.606   1.00 56.80  ? 509  GLN A OE1 1 
ATOM   3955 N NE2 . GLN A 1 509 ? 5.417   -0.693  7.325   1.00 44.59  ? 509  GLN A NE2 1 
ATOM   3956 N N   . TYR A 1 510 ? 10.022  3.277   7.820   1.00 47.06  ? 510  TYR A N   1 
ATOM   3957 C CA  . TYR A 1 510 ? 10.572  4.236   8.766   1.00 45.46  ? 510  TYR A CA  1 
ATOM   3958 C C   . TYR A 1 510 ? 9.442   5.199   9.093   1.00 50.93  ? 510  TYR A C   1 
ATOM   3959 O O   . TYR A 1 510 ? 8.465   5.275   8.345   1.00 56.01  ? 510  TYR A O   1 
ATOM   3960 C CB  . TYR A 1 510 ? 11.776  4.987   8.164   1.00 48.63  ? 510  TYR A CB  1 
ATOM   3961 C CG  . TYR A 1 510 ? 11.478  5.891   6.973   1.00 51.87  ? 510  TYR A CG  1 
ATOM   3962 C CD1 . TYR A 1 510 ? 11.397  5.374   5.676   1.00 52.14  ? 510  TYR A CD1 1 
ATOM   3963 C CD2 . TYR A 1 510 ? 11.314  7.264   7.139   1.00 43.62  ? 510  TYR A CD2 1 
ATOM   3964 C CE1 . TYR A 1 510 ? 11.134  6.199   4.580   1.00 48.19  ? 510  TYR A CE1 1 
ATOM   3965 C CE2 . TYR A 1 510 ? 11.046  8.095   6.048   1.00 47.52  ? 510  TYR A CE2 1 
ATOM   3966 C CZ  . TYR A 1 510 ? 10.961  7.557   4.771   1.00 55.65  ? 510  TYR A CZ  1 
ATOM   3967 O OH  . TYR A 1 510 ? 10.702  8.379   3.687   1.00 55.07  ? 510  TYR A OH  1 
ATOM   3968 N N   . VAL A 1 511 ? 9.540   5.923   10.203  1.00 45.82  ? 511  VAL A N   1 
ATOM   3969 C CA  . VAL A 1 511 ? 8.465   6.851   10.548  1.00 47.12  ? 511  VAL A CA  1 
ATOM   3970 C C   . VAL A 1 511 ? 8.904   8.307   10.409  1.00 44.86  ? 511  VAL A C   1 
ATOM   3971 O O   . VAL A 1 511 ? 10.093  8.603   10.440  1.00 47.97  ? 511  VAL A O   1 
ATOM   3972 C CB  . VAL A 1 511 ? 7.901   6.591   11.970  1.00 50.53  ? 511  VAL A CB  1 
ATOM   3973 C CG1 . VAL A 1 511 ? 7.316   5.189   12.054  1.00 49.20  ? 511  VAL A CG1 1 
ATOM   3974 C CG2 . VAL A 1 511 ? 8.982   6.794   13.028  1.00 42.92  ? 511  VAL A CG2 1 
ATOM   3975 N N   . SER A 1 512 ? 7.947   9.213   10.247  1.00 46.55  ? 512  SER A N   1 
ATOM   3976 C CA  . SER A 1 512 ? 8.246   10.639  10.311  1.00 52.62  ? 512  SER A CA  1 
ATOM   3977 C C   . SER A 1 512 ? 8.058   11.132  11.747  1.00 55.08  ? 512  SER A C   1 
ATOM   3978 O O   . SER A 1 512 ? 7.133   10.702  12.448  1.00 52.00  ? 512  SER A O   1 
ATOM   3979 C CB  . SER A 1 512 ? 7.373   11.452  9.340   1.00 51.70  ? 512  SER A CB  1 
ATOM   3980 O OG  . SER A 1 512 ? 5.999   11.403  9.704   1.00 65.40  ? 512  SER A OG  1 
ATOM   3981 N N   . LEU A 1 513 ? 8.954   12.017  12.181  1.00 53.31  ? 513  LEU A N   1 
ATOM   3982 C CA  . LEU A 1 513 ? 8.874   12.626  13.502  1.00 45.70  ? 513  LEU A CA  1 
ATOM   3983 C C   . LEU A 1 513 ? 8.593   14.119  13.340  1.00 49.74  ? 513  LEU A C   1 
ATOM   3984 O O   . LEU A 1 513 ? 9.465   14.887  12.896  1.00 48.43  ? 513  LEU A O   1 
ATOM   3985 C CB  . LEU A 1 513 ? 10.176  12.387  14.302  1.00 45.32  ? 513  LEU A CB  1 
ATOM   3986 C CG  . LEU A 1 513 ? 10.561  10.937  14.652  1.00 41.36  ? 513  LEU A CG  1 
ATOM   3987 C CD1 . LEU A 1 513 ? 11.896  10.851  15.386  1.00 41.70  ? 513  LEU A CD1 1 
ATOM   3988 C CD2 . LEU A 1 513 ? 9.489   10.272  15.483  1.00 42.23  ? 513  LEU A CD2 1 
ATOM   3989 N N   . ASN A 1 514 ? 7.360   14.515  13.667  1.00 51.83  ? 514  ASN A N   1 
ATOM   3990 C CA  . ASN A 1 514 ? 6.942   15.927  13.698  1.00 51.07  ? 514  ASN A CA  1 
ATOM   3991 C C   . ASN A 1 514 ? 5.796   16.129  14.682  1.00 56.37  ? 514  ASN A C   1 
ATOM   3992 O O   . ASN A 1 514 ? 5.542   15.259  15.527  1.00 58.60  ? 514  ASN A O   1 
ATOM   3993 C CB  . ASN A 1 514 ? 6.556   16.453  12.311  1.00 56.01  ? 514  ASN A CB  1 
ATOM   3994 C CG  . ASN A 1 514 ? 5.855   15.412  11.476  1.00 61.27  ? 514  ASN A CG  1 
ATOM   3995 O OD1 . ASN A 1 514 ? 4.812   14.876  11.876  1.00 64.63  ? 514  ASN A OD1 1 
ATOM   3996 N ND2 . ASN A 1 514 ? 6.427   15.104  10.309  1.00 55.95  ? 514  ASN A ND2 1 
ATOM   3997 N N   . LEU A 1 515 ? 5.106   17.264  14.587  1.00 57.26  ? 515  LEU A N   1 
ATOM   3998 C CA  . LEU A 1 515 ? 4.043   17.555  15.549  1.00 56.65  ? 515  LEU A CA  1 
ATOM   3999 C C   . LEU A 1 515 ? 2.847   16.619  15.357  1.00 59.13  ? 515  LEU A C   1 
ATOM   4000 O O   . LEU A 1 515 ? 2.117   16.333  16.303  1.00 62.63  ? 515  LEU A O   1 
ATOM   4001 C CB  . LEU A 1 515 ? 3.615   19.015  15.454  1.00 61.33  ? 515  LEU A CB  1 
ATOM   4002 C CG  . LEU A 1 515 ? 4.758   20.015  15.617  1.00 56.85  ? 515  LEU A CG  1 
ATOM   4003 C CD1 . LEU A 1 515 ? 4.281   21.437  15.390  1.00 48.42  ? 515  LEU A CD1 1 
ATOM   4004 C CD2 . LEU A 1 515 ? 5.399   19.878  16.991  1.00 51.88  ? 515  LEU A CD2 1 
ATOM   4005 N N   . LYS A 1 516 ? 2.669   16.125  14.134  1.00 62.07  ? 516  LYS A N   1 
ATOM   4006 C CA  . LYS A 1 516 ? 1.600   15.171  13.835  1.00 59.34  ? 516  LYS A CA  1 
ATOM   4007 C C   . LYS A 1 516 ? 1.953   13.788  14.400  1.00 57.58  ? 516  LYS A C   1 
ATOM   4008 O O   . LYS A 1 516 ? 3.121   13.507  14.694  1.00 56.45  ? 516  LYS A O   1 
ATOM   4009 C CB  . LYS A 1 516 ? 1.358   15.084  12.315  1.00 59.14  ? 516  LYS A CB  1 
ATOM   4010 C CG  . LYS A 1 516 ? 1.365   16.429  11.550  1.00 71.29  ? 516  LYS A CG  1 
ATOM   4011 C CD  . LYS A 1 516 ? 0.262   17.412  11.991  1.00 74.89  ? 516  LYS A CD  1 
ATOM   4012 C CE  . LYS A 1 516 ? 0.820   18.654  12.728  1.00 79.02  ? 516  LYS A CE  1 
ATOM   4013 N NZ  . LYS A 1 516 ? 1.755   19.536  11.930  1.00 74.16  ? 516  LYS A NZ  1 
ATOM   4014 N N   . PRO A 1 517 ? 0.944   12.919  14.571  1.00 62.82  ? 517  PRO A N   1 
ATOM   4015 C CA  . PRO A 1 517 ? 1.252   11.550  15.017  1.00 57.03  ? 517  PRO A CA  1 
ATOM   4016 C C   . PRO A 1 517 ? 2.095   10.811  13.986  1.00 59.98  ? 517  PRO A C   1 
ATOM   4017 O O   . PRO A 1 517 ? 2.120   11.220  12.820  1.00 64.38  ? 517  PRO A O   1 
ATOM   4018 C CB  . PRO A 1 517 ? -0.129  10.891  15.115  1.00 57.11  ? 517  PRO A CB  1 
ATOM   4019 C CG  . PRO A 1 517 ? -1.080  12.039  15.339  1.00 54.73  ? 517  PRO A CG  1 
ATOM   4020 C CD  . PRO A 1 517 ? -0.507  13.196  14.563  1.00 57.14  ? 517  PRO A CD  1 
ATOM   4021 N N   . LEU A 1 518 ? 2.771   9.748   14.418  1.00 55.77  ? 518  LEU A N   1 
ATOM   4022 C CA  . LEU A 1 518 ? 3.602   8.933   13.540  1.00 55.93  ? 518  LEU A CA  1 
ATOM   4023 C C   . LEU A 1 518 ? 2.947   8.574   12.214  1.00 59.42  ? 518  LEU A C   1 
ATOM   4024 O O   . LEU A 1 518 ? 1.849   8.020   12.183  1.00 61.41  ? 518  LEU A O   1 
ATOM   4025 C CB  . LEU A 1 518 ? 3.974   7.621   14.233  1.00 58.91  ? 518  LEU A CB  1 
ATOM   4026 C CG  . LEU A 1 518 ? 5.065   7.641   15.291  1.00 52.05  ? 518  LEU A CG  1 
ATOM   4027 C CD1 . LEU A 1 518 ? 5.554   6.221   15.527  1.00 54.56  ? 518  LEU A CD1 1 
ATOM   4028 C CD2 . LEU A 1 518 ? 6.196   8.548   14.859  1.00 53.27  ? 518  LEU A CD2 1 
ATOM   4029 N N   . GLU A 1 519 ? 3.639   8.879   11.123  1.00 61.69  ? 519  GLU A N   1 
ATOM   4030 C CA  . GLU A 1 519 ? 3.258   8.392   9.801   1.00 59.41  ? 519  GLU A CA  1 
ATOM   4031 C C   . GLU A 1 519 ? 4.321   7.384   9.345   1.00 59.10  ? 519  GLU A C   1 
ATOM   4032 O O   . GLU A 1 519 ? 5.519   7.643   9.504   1.00 60.22  ? 519  GLU A O   1 
ATOM   4033 C CB  . GLU A 1 519 ? 3.153   9.565   8.826   1.00 56.20  ? 519  GLU A CB  1 
ATOM   4034 C CG  . GLU A 1 519 ? 3.046   9.179   7.356   1.00 68.67  ? 519  GLU A CG  1 
ATOM   4035 C CD  . GLU A 1 519 ? 3.020   10.404  6.449   1.00 74.54  ? 519  GLU A CD  1 
ATOM   4036 O OE1 . GLU A 1 519 ? 2.608   11.481  6.938   1.00 86.83  ? 519  GLU A OE1 1 
ATOM   4037 O OE2 . GLU A 1 519 ? 3.416   10.296  5.261   1.00 72.17  ? 519  GLU A OE2 1 
ATOM   4038 N N   . VAL A 1 520 ? 3.901   6.231   8.818   1.00 50.93  ? 520  VAL A N   1 
ATOM   4039 C CA  . VAL A 1 520 ? 4.859   5.241   8.306   1.00 47.40  ? 520  VAL A CA  1 
ATOM   4040 C C   . VAL A 1 520 ? 5.128   5.457   6.814   1.00 53.32  ? 520  VAL A C   1 
ATOM   4041 O O   . VAL A 1 520 ? 4.211   5.745   6.032   1.00 51.71  ? 520  VAL A O   1 
ATOM   4042 C CB  . VAL A 1 520 ? 4.403   3.790   8.571   1.00 49.80  ? 520  VAL A CB  1 
ATOM   4043 C CG1 . VAL A 1 520 ? 5.344   2.784   7.900   1.00 50.07  ? 520  VAL A CG1 1 
ATOM   4044 C CG2 . VAL A 1 520 ? 4.332   3.519   10.077  1.00 42.49  ? 520  VAL A CG2 1 
ATOM   4045 N N   . ARG A 1 521 ? 6.394   5.340   6.425   1.00 50.77  ? 521  ARG A N   1 
ATOM   4046 C CA  . ARG A 1 521 ? 6.792   5.594   5.045   1.00 47.33  ? 521  ARG A CA  1 
ATOM   4047 C C   . ARG A 1 521 ? 7.667   4.469   4.547   1.00 49.75  ? 521  ARG A C   1 
ATOM   4048 O O   . ARG A 1 521 ? 8.222   3.702   5.342   1.00 50.53  ? 521  ARG A O   1 
ATOM   4049 C CB  . ARG A 1 521 ? 7.520   6.937   4.926   1.00 46.69  ? 521  ARG A CB  1 
ATOM   4050 C CG  . ARG A 1 521 ? 6.641   8.117   5.298   1.00 46.09  ? 521  ARG A CG  1 
ATOM   4051 C CD  . ARG A 1 521 ? 7.305   9.453   5.027   1.00 50.66  ? 521  ARG A CD  1 
ATOM   4052 N NE  . ARG A 1 521 ? 6.585   10.533  5.705   1.00 50.41  ? 521  ARG A NE  1 
ATOM   4053 C CZ  . ARG A 1 521 ? 7.024   11.781  5.823   1.00 49.18  ? 521  ARG A CZ  1 
ATOM   4054 N NH1 . ARG A 1 521 ? 8.197   12.126  5.310   1.00 56.62  ? 521  ARG A NH1 1 
ATOM   4055 N NH2 . ARG A 1 521 ? 6.295   12.684  6.468   1.00 53.92  ? 521  ARG A NH2 1 
ATOM   4056 N N   . ARG A 1 522 ? 7.789   4.351   3.231   1.00 45.99  ? 522  ARG A N   1 
ATOM   4057 C CA  . ARG A 1 522 ? 8.571   3.253   2.684   1.00 58.53  ? 522  ARG A CA  1 
ATOM   4058 C C   . ARG A 1 522 ? 9.635   3.773   1.731   1.00 56.62  ? 522  ARG A C   1 
ATOM   4059 O O   . ARG A 1 522 ? 9.361   4.612   0.862   1.00 56.19  ? 522  ARG A O   1 
ATOM   4060 C CB  . ARG A 1 522 ? 7.668   2.212   1.995   1.00 62.68  ? 522  ARG A CB  1 
ATOM   4061 C CG  . ARG A 1 522 ? 6.550   1.644   2.883   1.00 63.18  ? 522  ARG A CG  1 
ATOM   4062 C CD  . ARG A 1 522 ? 5.788   0.513   2.198   1.00 69.74  ? 522  ARG A CD  1 
ATOM   4063 N NE  . ARG A 1 522 ? 6.692   -0.528  1.697   1.00 89.56  ? 522  ARG A NE  1 
ATOM   4064 C CZ  . ARG A 1 522 ? 6.899   -0.796  0.404   1.00 95.99  ? 522  ARG A CZ  1 
ATOM   4065 N NH1 . ARG A 1 522 ? 6.248   -0.108  -0.536  1.00 91.46  ? 522  ARG A NH1 1 
ATOM   4066 N NH2 . ARG A 1 522 ? 7.753   -1.761  0.048   1.00 81.60  ? 522  ARG A NH2 1 
ATOM   4067 N N   . GLY A 1 523 ? 10.855  3.281   1.914   1.00 55.45  ? 523  GLY A N   1 
ATOM   4068 C CA  . GLY A 1 523 ? 11.951  3.624   1.034   1.00 55.26  ? 523  GLY A CA  1 
ATOM   4069 C C   . GLY A 1 523 ? 12.683  4.863   1.488   1.00 57.40  ? 523  GLY A C   1 
ATOM   4070 O O   . GLY A 1 523 ? 12.149  5.981   1.437   1.00 62.71  ? 523  GLY A O   1 
ATOM   4071 N N   . LEU A 1 524 ? 13.911  4.664   1.947   1.00 56.69  ? 524  LEU A N   1 
ATOM   4072 C CA  . LEU A 1 524 ? 14.727  5.776   2.407   1.00 57.21  ? 524  LEU A CA  1 
ATOM   4073 C C   . LEU A 1 524 ? 15.519  6.341   1.231   1.00 52.11  ? 524  LEU A C   1 
ATOM   4074 O O   . LEU A 1 524 ? 16.645  5.888   0.962   1.00 56.48  ? 524  LEU A O   1 
ATOM   4075 C CB  . LEU A 1 524 ? 15.669  5.307   3.518   1.00 60.12  ? 524  LEU A CB  1 
ATOM   4076 C CG  . LEU A 1 524 ? 15.937  6.341   4.619   1.00 71.07  ? 524  LEU A CG  1 
ATOM   4077 C CD1 . LEU A 1 524 ? 15.094  7.616   4.406   1.00 58.81  ? 524  LEU A CD1 1 
ATOM   4078 C CD2 . LEU A 1 524 ? 15.654  5.721   5.990   1.00 61.61  ? 524  LEU A CD2 1 
ATOM   4079 N N   . ARG A 1 525 ? 14.930  7.321   0.540   1.00 50.01  ? 525  ARG A N   1 
ATOM   4080 C CA  . ARG A 1 525 ? 15.473  7.840   -0.726  1.00 52.34  ? 525  ARG A CA  1 
ATOM   4081 C C   . ARG A 1 525 ? 15.942  6.701   -1.627  1.00 54.10  ? 525  ARG A C   1 
ATOM   4082 O O   . ARG A 1 525 ? 17.073  6.735   -2.124  1.00 53.79  ? 525  ARG A O   1 
ATOM   4083 C CB  . ARG A 1 525 ? 16.670  8.763   -0.473  1.00 56.21  ? 525  ARG A CB  1 
ATOM   4084 C CG  . ARG A 1 525 ? 16.390  9.951   0.410   1.00 59.03  ? 525  ARG A CG  1 
ATOM   4085 C CD  . ARG A 1 525 ? 16.005  11.143  -0.411  1.00 55.92  ? 525  ARG A CD  1 
ATOM   4086 N NE  . ARG A 1 525 ? 16.762  12.326  -0.001  1.00 68.12  ? 525  ARG A NE  1 
ATOM   4087 C CZ  . ARG A 1 525 ? 16.347  13.207  0.909   1.00 62.84  ? 525  ARG A CZ  1 
ATOM   4088 N NH1 . ARG A 1 525 ? 15.170  13.044  1.519   1.00 60.41  ? 525  ARG A NH1 1 
ATOM   4089 N NH2 . ARG A 1 525 ? 17.109  14.255  1.205   1.00 57.59  ? 525  ARG A NH2 1 
ATOM   4090 N N   . ALA A 1 526 ? 15.096  5.693   -1.833  1.00 53.06  ? 526  ALA A N   1 
ATOM   4091 C CA  . ALA A 1 526 ? 15.569  4.444   -2.435  1.00 52.60  ? 526  ALA A CA  1 
ATOM   4092 C C   . ALA A 1 526 ? 16.222  4.605   -3.815  1.00 50.79  ? 526  ALA A C   1 
ATOM   4093 O O   . ALA A 1 526 ? 17.317  4.085   -4.020  1.00 53.76  ? 526  ALA A O   1 
ATOM   4094 C CB  . ALA A 1 526 ? 14.472  3.377   -2.449  1.00 47.35  ? 526  ALA A CB  1 
ATOM   4095 N N   . GLN A 1 527 ? 15.584  5.327   -4.742  1.00 47.65  ? 527  GLN A N   1 
ATOM   4096 C CA  . GLN A 1 527 ? 16.174  5.510   -6.078  1.00 51.55  ? 527  GLN A CA  1 
ATOM   4097 C C   . GLN A 1 527 ? 17.521  6.193   -5.994  1.00 49.74  ? 527  GLN A C   1 
ATOM   4098 O O   . GLN A 1 527 ? 18.522  5.661   -6.476  1.00 54.68  ? 527  GLN A O   1 
ATOM   4099 C CB  . GLN A 1 527 ? 15.257  6.297   -7.029  1.00 51.72  ? 527  GLN A CB  1 
ATOM   4100 C CG  . GLN A 1 527 ? 14.091  5.493   -7.619  1.00 54.44  ? 527  GLN A CG  1 
ATOM   4101 C CD  . GLN A 1 527 ? 14.515  4.177   -8.272  1.00 60.29  ? 527  GLN A CD  1 
ATOM   4102 O OE1 . GLN A 1 527 ? 14.226  3.093   -7.753  1.00 64.54  ? 527  GLN A OE1 1 
ATOM   4103 N NE2 . GLN A 1 527 ? 15.180  4.266   -9.423  1.00 61.01  ? 527  GLN A NE2 1 
ATOM   4104 N N   . THR A 1 528 ? 17.536  7.362   -5.358  1.00 48.96  ? 528  THR A N   1 
ATOM   4105 C CA  . THR A 1 528 ? 18.752  8.156   -5.179  1.00 48.66  ? 528  THR A CA  1 
ATOM   4106 C C   . THR A 1 528 ? 19.875  7.396   -4.458  1.00 47.03  ? 528  THR A C   1 
ATOM   4107 O O   . THR A 1 528 ? 21.040  7.505   -4.835  1.00 48.49  ? 528  THR A O   1 
ATOM   4108 C CB  . THR A 1 528 ? 18.436  9.463   -4.418  1.00 58.97  ? 528  THR A CB  1 
ATOM   4109 O OG1 . THR A 1 528 ? 17.652  10.326  -5.255  1.00 57.29  ? 528  THR A OG1 1 
ATOM   4110 C CG2 . THR A 1 528 ? 19.726  10.177  -3.974  1.00 45.42  ? 528  THR A CG2 1 
ATOM   4111 N N   . CYS A 1 529 ? 19.538  6.616   -3.436  1.00 43.68  ? 529  CYS A N   1 
ATOM   4112 C CA  . CYS A 1 529 ? 20.575  5.874   -2.720  1.00 44.30  ? 529  CYS A CA  1 
ATOM   4113 C C   . CYS A 1 529 ? 21.178  4.711   -3.528  1.00 47.49  ? 529  CYS A C   1 
ATOM   4114 O O   . CYS A 1 529 ? 22.350  4.358   -3.333  1.00 45.46  ? 529  CYS A O   1 
ATOM   4115 C CB  . CYS A 1 529 ? 20.118  5.470   -1.305  1.00 43.84  ? 529  CYS A CB  1 
ATOM   4116 S SG  . CYS A 1 529 ? 20.128  6.896   -0.149  1.00 61.53  ? 529  CYS A SG  1 
ATOM   4117 N N   . ALA A 1 530 ? 20.405  4.151   -4.459  1.00 44.49  ? 530  ALA A N   1 
ATOM   4118 C CA  . ALA A 1 530 ? 20.958  3.180   -5.408  1.00 47.07  ? 530  ALA A CA  1 
ATOM   4119 C C   . ALA A 1 530 ? 22.096  3.821   -6.204  1.00 54.42  ? 530  ALA A C   1 
ATOM   4120 O O   . ALA A 1 530 ? 23.132  3.189   -6.459  1.00 54.17  ? 530  ALA A O   1 
ATOM   4121 C CB  . ALA A 1 530 ? 19.884  2.663   -6.345  1.00 48.86  ? 530  ALA A CB  1 
ATOM   4122 N N   . PHE A 1 531 ? 21.900  5.081   -6.586  1.00 44.23  ? 531  PHE A N   1 
ATOM   4123 C CA  . PHE A 1 531 ? 22.933  5.824   -7.287  1.00 50.20  ? 531  PHE A CA  1 
ATOM   4124 C C   . PHE A 1 531 ? 24.230  5.927   -6.472  1.00 52.02  ? 531  PHE A C   1 
ATOM   4125 O O   . PHE A 1 531 ? 25.293  5.567   -6.967  1.00 51.73  ? 531  PHE A O   1 
ATOM   4126 C CB  . PHE A 1 531 ? 22.423  7.213   -7.682  1.00 56.03  ? 531  PHE A CB  1 
ATOM   4127 C CG  . PHE A 1 531 ? 23.490  8.120   -8.215  1.00 56.03  ? 531  PHE A CG  1 
ATOM   4128 C CD1 . PHE A 1 531 ? 24.032  7.912   -9.476  1.00 55.27  ? 531  PHE A CD1 1 
ATOM   4129 C CD2 . PHE A 1 531 ? 23.949  9.183   -7.456  1.00 49.64  ? 531  PHE A CD2 1 
ATOM   4130 C CE1 . PHE A 1 531 ? 25.013  8.745   -9.968  1.00 59.20  ? 531  PHE A CE1 1 
ATOM   4131 C CE2 . PHE A 1 531 ? 24.936  10.029  -7.947  1.00 52.38  ? 531  PHE A CE2 1 
ATOM   4132 C CZ  . PHE A 1 531 ? 25.469  9.808   -9.202  1.00 61.73  ? 531  PHE A CZ  1 
ATOM   4133 N N   . TRP A 1 532 ? 24.140  6.399   -5.228  1.00 48.99  ? 532  TRP A N   1 
ATOM   4134 C CA  . TRP A 1 532 ? 25.334  6.588   -4.402  1.00 45.64  ? 532  TRP A CA  1 
ATOM   4135 C C   . TRP A 1 532 ? 25.958  5.285   -3.935  1.00 45.66  ? 532  TRP A C   1 
ATOM   4136 O O   . TRP A 1 532 ? 27.180  5.143   -3.942  1.00 49.13  ? 532  TRP A O   1 
ATOM   4137 C CB  . TRP A 1 532 ? 25.027  7.440   -3.170  1.00 43.02  ? 532  TRP A CB  1 
ATOM   4138 C CG  . TRP A 1 532 ? 24.637  8.834   -3.501  1.00 43.74  ? 532  TRP A CG  1 
ATOM   4139 C CD1 . TRP A 1 532 ? 23.373  9.356   -3.512  1.00 39.10  ? 532  TRP A CD1 1 
ATOM   4140 C CD2 . TRP A 1 532 ? 25.516  9.901   -3.876  1.00 41.17  ? 532  TRP A CD2 1 
ATOM   4141 N NE1 . TRP A 1 532 ? 23.412  10.683  -3.871  1.00 36.29  ? 532  TRP A NE1 1 
ATOM   4142 C CE2 . TRP A 1 532 ? 24.714  11.043  -4.104  1.00 36.63  ? 532  TRP A CE2 1 
ATOM   4143 C CE3 . TRP A 1 532 ? 26.903  10.001  -4.049  1.00 38.40  ? 532  TRP A CE3 1 
ATOM   4144 C CZ2 . TRP A 1 532 ? 25.255  12.273  -4.493  1.00 37.87  ? 532  TRP A CZ2 1 
ATOM   4145 C CZ3 . TRP A 1 532 ? 27.436  11.225  -4.434  1.00 30.76  ? 532  TRP A CZ3 1 
ATOM   4146 C CH2 . TRP A 1 532 ? 26.613  12.342  -4.650  1.00 34.64  ? 532  TRP A CH2 1 
ATOM   4147 N N   . ASN A 1 533 ? 25.125  4.340   -3.510  1.00 46.83  ? 533  ASN A N   1 
ATOM   4148 C CA  . ASN A 1 533 ? 25.641  3.133   -2.869  1.00 50.92  ? 533  ASN A CA  1 
ATOM   4149 C C   . ASN A 1 533 ? 25.979  1.985   -3.832  1.00 48.91  ? 533  ASN A C   1 
ATOM   4150 O O   . ASN A 1 533 ? 26.849  1.169   -3.543  1.00 44.87  ? 533  ASN A O   1 
ATOM   4151 C CB  . ASN A 1 533 ? 24.702  2.657   -1.749  1.00 47.32  ? 533  ASN A CB  1 
ATOM   4152 C CG  . ASN A 1 533 ? 24.453  3.726   -0.689  1.00 44.62  ? 533  ASN A CG  1 
ATOM   4153 O OD1 . ASN A 1 533 ? 25.326  4.550   -0.385  1.00 58.91  ? 533  ASN A OD1 1 
ATOM   4154 N ND2 . ASN A 1 533 ? 23.250  3.717   -0.120  1.00 43.17  ? 533  ASN A ND2 1 
ATOM   4155 N N   . ARG A 1 534 ? 25.311  1.928   -4.977  1.00 47.86  ? 534  ARG A N   1 
ATOM   4156 C CA  . ARG A 1 534 ? 25.580  0.854   -5.933  1.00 53.57  ? 534  ARG A CA  1 
ATOM   4157 C C   . ARG A 1 534 ? 26.381  1.314   -7.140  1.00 57.24  ? 534  ARG A C   1 
ATOM   4158 O O   . ARG A 1 534 ? 27.406  0.720   -7.473  1.00 66.77  ? 534  ARG A O   1 
ATOM   4159 C CB  . ARG A 1 534 ? 24.279  0.214   -6.410  1.00 45.68  ? 534  ARG A CB  1 
ATOM   4160 C CG  . ARG A 1 534 ? 23.438  -0.312  -5.281  1.00 45.83  ? 534  ARG A CG  1 
ATOM   4161 C CD  . ARG A 1 534 ? 22.066  -0.703  -5.770  1.00 53.64  ? 534  ARG A CD  1 
ATOM   4162 N NE  . ARG A 1 534 ? 21.245  -1.239  -4.684  1.00 67.03  ? 534  ARG A NE  1 
ATOM   4163 C CZ  . ARG A 1 534 ? 21.223  -2.522  -4.325  1.00 70.15  ? 534  ARG A CZ  1 
ATOM   4164 N NH1 . ARG A 1 534 ? 21.983  -3.413  -4.969  1.00 57.10  ? 534  ARG A NH1 1 
ATOM   4165 N NH2 . ARG A 1 534 ? 20.440  -2.911  -3.321  1.00 53.43  ? 534  ARG A NH2 1 
ATOM   4166 N N   . PHE A 1 535 ? 25.910  2.368   -7.797  1.00 53.87  ? 535  PHE A N   1 
ATOM   4167 C CA  . PHE A 1 535 ? 26.499  2.769   -9.062  1.00 53.55  ? 535  PHE A CA  1 
ATOM   4168 C C   . PHE A 1 535 ? 27.801  3.561   -8.930  1.00 56.41  ? 535  PHE A C   1 
ATOM   4169 O O   . PHE A 1 535 ? 28.773  3.275   -9.627  1.00 62.28  ? 535  PHE A O   1 
ATOM   4170 C CB  . PHE A 1 535 ? 25.488  3.544   -9.905  1.00 53.54  ? 535  PHE A CB  1 
ATOM   4171 C CG  . PHE A 1 535 ? 26.027  3.963   -11.236 1.00 56.35  ? 535  PHE A CG  1 
ATOM   4172 C CD1 . PHE A 1 535 ? 26.395  3.006   -12.184 1.00 57.30  ? 535  PHE A CD1 1 
ATOM   4173 C CD2 . PHE A 1 535 ? 26.189  5.309   -11.541 1.00 49.29  ? 535  PHE A CD2 1 
ATOM   4174 C CE1 . PHE A 1 535 ? 26.912  3.390   -13.416 1.00 47.33  ? 535  PHE A CE1 1 
ATOM   4175 C CE2 . PHE A 1 535 ? 26.695  5.698   -12.771 1.00 61.66  ? 535  PHE A CE2 1 
ATOM   4176 C CZ  . PHE A 1 535 ? 27.059  4.734   -13.711 1.00 59.93  ? 535  PHE A CZ  1 
ATOM   4177 N N   . LEU A 1 536 ? 27.817  4.548   -8.041  1.00 52.29  ? 536  LEU A N   1 
ATOM   4178 C CA  . LEU A 1 536 ? 28.974  5.428   -7.878  1.00 56.22  ? 536  LEU A CA  1 
ATOM   4179 C C   . LEU A 1 536 ? 30.325  4.736   -7.609  1.00 68.94  ? 536  LEU A C   1 
ATOM   4180 O O   . LEU A 1 536 ? 31.344  5.172   -8.153  1.00 67.97  ? 536  LEU A O   1 
ATOM   4181 C CB  . LEU A 1 536 ? 28.702  6.497   -6.820  1.00 60.74  ? 536  LEU A CB  1 
ATOM   4182 C CG  . LEU A 1 536 ? 29.045  7.944   -7.194  1.00 68.73  ? 536  LEU A CG  1 
ATOM   4183 C CD1 . LEU A 1 536 ? 30.215  8.471   -6.364  1.00 64.45  ? 536  LEU A CD1 1 
ATOM   4184 C CD2 . LEU A 1 536 ? 29.331  8.077   -8.693  1.00 75.29  ? 536  LEU A CD2 1 
ATOM   4185 N N   . PRO A 1 537 ? 30.349  3.681   -6.761  1.00 68.87  ? 537  PRO A N   1 
ATOM   4186 C CA  . PRO A 1 537 ? 31.619  2.948   -6.626  1.00 72.11  ? 537  PRO A CA  1 
ATOM   4187 C C   . PRO A 1 537 ? 32.130  2.373   -7.954  1.00 73.58  ? 537  PRO A C   1 
ATOM   4188 O O   . PRO A 1 537 ? 33.330  2.486   -8.221  1.00 80.75  ? 537  PRO A O   1 
ATOM   4189 C CB  . PRO A 1 537 ? 31.270  1.819   -5.652  1.00 67.85  ? 537  PRO A CB  1 
ATOM   4190 C CG  . PRO A 1 537 ? 30.183  2.389   -4.819  1.00 64.01  ? 537  PRO A CG  1 
ATOM   4191 C CD  . PRO A 1 537 ? 29.362  3.245   -5.752  1.00 58.62  ? 537  PRO A CD  1 
ATOM   4192 N N   . LYS A 1 538 ? 31.247  1.785   -8.765  1.00 69.06  ? 538  LYS A N   1 
ATOM   4193 C CA  . LYS A 1 538 ? 31.637  1.242   -10.075 1.00 71.00  ? 538  LYS A CA  1 
ATOM   4194 C C   . LYS A 1 538 ? 32.259  2.311   -10.983 1.00 72.19  ? 538  LYS A C   1 
ATOM   4195 O O   . LYS A 1 538 ? 33.135  2.018   -11.791 1.00 79.31  ? 538  LYS A O   1 
ATOM   4196 C CB  . LYS A 1 538 ? 30.437  0.614   -10.785 1.00 62.27  ? 538  LYS A CB  1 
ATOM   4197 C CG  . LYS A 1 538 ? 29.567  -0.294  -9.919  1.00 64.44  ? 538  LYS A CG  1 
ATOM   4198 C CD  . LYS A 1 538 ? 30.011  -1.753  -9.973  1.00 75.29  ? 538  LYS A CD  1 
ATOM   4199 C CE  . LYS A 1 538 ? 28.891  -2.687  -9.511  1.00 83.80  ? 538  LYS A CE  1 
ATOM   4200 N NZ  . LYS A 1 538 ? 29.288  -4.128  -9.553  1.00 80.92  ? 538  LYS A NZ  1 
ATOM   4201 N N   . LEU A 1 539 ? 31.804  3.550   -10.837 1.00 74.42  ? 539  LEU A N   1 
ATOM   4202 C CA  . LEU A 1 539 ? 32.287  4.660   -11.656 1.00 73.81  ? 539  LEU A CA  1 
ATOM   4203 C C   . LEU A 1 539 ? 33.651  5.160   -11.194 1.00 87.68  ? 539  LEU A C   1 
ATOM   4204 O O   . LEU A 1 539 ? 34.365  5.836   -11.946 1.00 91.88  ? 539  LEU A O   1 
ATOM   4205 C CB  . LEU A 1 539 ? 31.292  5.809   -11.597 1.00 75.58  ? 539  LEU A CB  1 
ATOM   4206 C CG  . LEU A 1 539 ? 31.238  6.641   -12.864 1.00 72.57  ? 539  LEU A CG  1 
ATOM   4207 C CD1 . LEU A 1 539 ? 31.059  5.695   -14.039 1.00 73.94  ? 539  LEU A CD1 1 
ATOM   4208 C CD2 . LEU A 1 539 ? 30.102  7.647   -12.779 1.00 66.20  ? 539  LEU A CD2 1 
ATOM   4209 N N   . LEU A 1 540 ? 33.987  4.847   -9.942  1.00 94.55  ? 540  LEU A N   1 
ATOM   4210 C CA  . LEU A 1 540 ? 35.299  5.147   -9.370  1.00 97.62  ? 540  LEU A CA  1 
ATOM   4211 C C   . LEU A 1 540 ? 36.359  4.204   -9.949  1.00 102.28 ? 540  LEU A C   1 
ATOM   4212 O O   . LEU A 1 540 ? 37.525  4.585   -10.102 1.00 111.85 ? 540  LEU A O   1 
ATOM   4213 C CB  . LEU A 1 540 ? 35.251  5.029   -7.840  1.00 94.88  ? 540  LEU A CB  1 
ATOM   4214 C CG  . LEU A 1 540 ? 36.180  4.027   -7.133  1.00 98.66  ? 540  LEU A CG  1 
ATOM   4215 C CD1 . LEU A 1 540 ? 37.497  4.685   -6.702  1.00 100.95 ? 540  LEU A CD1 1 
ATOM   4216 C CD2 . LEU A 1 540 ? 35.482  3.349   -5.943  1.00 86.14  ? 540  LEU A CD2 1 
ATOM   4217 N N   . SER A 1 541 ? 35.943  2.981   -10.282 1.00 91.90  ? 541  SER A N   1 
ATOM   4218 C CA  . SER A 1 541 ? 36.837  1.983   -10.869 1.00 93.82  ? 541  SER A CA  1 
ATOM   4219 C C   . SER A 1 541 ? 37.097  2.216   -12.370 1.00 99.46  ? 541  SER A C   1 
ATOM   4220 O O   . SER A 1 541 ? 37.664  1.353   -13.050 1.00 103.02 ? 541  SER A O   1 
ATOM   4221 C CB  . SER A 1 541 ? 36.292  0.568   -10.636 1.00 93.36  ? 541  SER A CB  1 
ATOM   4222 O OG  . SER A 1 541 ? 35.980  0.356   -9.268  1.00 84.32  ? 541  SER A OG  1 
ATOM   4223 N N   . ALA A 1 542 ? 36.674  3.372   -12.881 1.00 94.88  ? 542  ALA A N   1 
ATOM   4224 C CA  . ALA A 1 542 ? 37.052  3.802   -14.225 1.00 95.26  ? 542  ALA A CA  1 
ATOM   4225 C C   . ALA A 1 542 ? 37.760  5.158   -14.174 1.00 90.28  ? 542  ALA A C   1 
ATOM   4226 O O   . ALA A 1 542 ? 38.747  5.337   -13.450 1.00 86.46  ? 542  ALA A O   1 
ATOM   4227 C CB  . ALA A 1 542 ? 35.840  3.861   -15.141 1.00 74.93  ? 542  ALA A CB  1 
ATOM   4228 N N   . GLU B 1 4   ? -17.311 5.530   -70.073 1.00 105.87 ? 4    GLU B N   1 
ATOM   4229 C CA  . GLU B 1 4   ? -16.237 5.816   -69.128 1.00 106.56 ? 4    GLU B CA  1 
ATOM   4230 C C   . GLU B 1 4   ? -16.527 7.034   -68.248 1.00 98.73  ? 4    GLU B C   1 
ATOM   4231 O O   . GLU B 1 4   ? -16.970 8.079   -68.738 1.00 93.27  ? 4    GLU B O   1 
ATOM   4232 C CB  . GLU B 1 4   ? -14.908 6.026   -69.867 1.00 105.18 ? 4    GLU B CB  1 
ATOM   4233 C CG  . GLU B 1 4   ? -13.998 4.799   -69.882 1.00 112.23 ? 4    GLU B CG  1 
ATOM   4234 C CD  . GLU B 1 4   ? -12.528 5.161   -70.077 1.00 114.89 ? 4    GLU B CD  1 
ATOM   4235 O OE1 . GLU B 1 4   ? -12.222 5.926   -71.020 1.00 112.26 ? 4    GLU B OE1 1 
ATOM   4236 O OE2 . GLU B 1 4   ? -11.679 4.683   -69.286 1.00 100.58 ? 4    GLU B OE2 1 
ATOM   4237 N N   . ASP B 1 5   ? -16.274 6.883   -66.948 1.00 90.84  ? 5    ASP B N   1 
ATOM   4238 C CA  . ASP B 1 5   ? -16.290 7.997   -66.000 1.00 84.76  ? 5    ASP B CA  1 
ATOM   4239 C C   . ASP B 1 5   ? -15.100 8.927   -66.280 1.00 80.73  ? 5    ASP B C   1 
ATOM   4240 O O   . ASP B 1 5   ? -13.949 8.477   -66.315 1.00 83.30  ? 5    ASP B O   1 
ATOM   4241 C CB  . ASP B 1 5   ? -16.207 7.451   -64.574 1.00 81.85  ? 5    ASP B CB  1 
ATOM   4242 C CG  . ASP B 1 5   ? -16.750 8.415   -63.545 1.00 76.48  ? 5    ASP B CG  1 
ATOM   4243 O OD1 . ASP B 1 5   ? -16.634 9.646   -63.764 1.00 70.92  ? 5    ASP B OD1 1 
ATOM   4244 O OD2 . ASP B 1 5   ? -17.291 7.930   -62.516 1.00 63.27  ? 5    ASP B OD2 1 
ATOM   4245 N N   . PRO B 1 6   ? -15.372 10.223  -66.517 1.00 77.65  ? 6    PRO B N   1 
ATOM   4246 C CA  . PRO B 1 6   ? -14.297 11.168  -66.864 1.00 77.30  ? 6    PRO B CA  1 
ATOM   4247 C C   . PRO B 1 6   ? -13.526 11.630  -65.628 1.00 77.44  ? 6    PRO B C   1 
ATOM   4248 O O   . PRO B 1 6   ? -12.413 12.158  -65.755 1.00 73.26  ? 6    PRO B O   1 
ATOM   4249 C CB  . PRO B 1 6   ? -15.051 12.355  -67.486 1.00 77.69  ? 6    PRO B CB  1 
ATOM   4250 C CG  . PRO B 1 6   ? -16.482 11.878  -67.684 1.00 77.13  ? 6    PRO B CG  1 
ATOM   4251 C CD  . PRO B 1 6   ? -16.702 10.843  -66.631 1.00 77.36  ? 6    PRO B CD  1 
ATOM   4252 N N   . GLN B 1 7   ? -14.136 11.440  -64.457 1.00 74.56  ? 7    GLN B N   1 
ATOM   4253 C CA  . GLN B 1 7   ? -13.500 11.707  -63.169 1.00 74.27  ? 7    GLN B CA  1 
ATOM   4254 C C   . GLN B 1 7   ? -12.382 10.715  -62.903 1.00 74.33  ? 7    GLN B C   1 
ATOM   4255 O O   . GLN B 1 7   ? -11.480 10.989  -62.106 1.00 68.85  ? 7    GLN B O   1 
ATOM   4256 C CB  . GLN B 1 7   ? -14.528 11.603  -62.033 1.00 75.56  ? 7    GLN B CB  1 
ATOM   4257 C CG  . GLN B 1 7   ? -15.366 12.857  -61.831 1.00 78.10  ? 7    GLN B CG  1 
ATOM   4258 C CD  . GLN B 1 7   ? -14.526 14.034  -61.378 1.00 73.88  ? 7    GLN B CD  1 
ATOM   4259 O OE1 . GLN B 1 7   ? -13.854 13.958  -60.353 1.00 86.86  ? 7    GLN B OE1 1 
ATOM   4260 N NE2 . GLN B 1 7   ? -14.539 15.116  -62.148 1.00 72.85  ? 7    GLN B NE2 1 
ATOM   4261 N N   . LEU B 1 8   ? -12.462 9.560   -63.563 1.00 72.57  ? 8    LEU B N   1 
ATOM   4262 C CA  . LEU B 1 8   ? -11.516 8.471   -63.345 1.00 66.19  ? 8    LEU B CA  1 
ATOM   4263 C C   . LEU B 1 8   ? -10.441 8.422   -64.424 1.00 62.67  ? 8    LEU B C   1 
ATOM   4264 O O   . LEU B 1 8   ? -9.673  7.469   -64.496 1.00 59.57  ? 8    LEU B O   1 
ATOM   4265 C CB  . LEU B 1 8   ? -12.246 7.131   -63.259 1.00 58.41  ? 8    LEU B CB  1 
ATOM   4266 C CG  . LEU B 1 8   ? -13.253 7.068   -62.117 1.00 61.58  ? 8    LEU B CG  1 
ATOM   4267 C CD1 . LEU B 1 8   ? -13.892 5.693   -62.030 1.00 57.53  ? 8    LEU B CD1 1 
ATOM   4268 C CD2 . LEU B 1 8   ? -12.556 7.428   -60.815 1.00 65.00  ? 8    LEU B CD2 1 
ATOM   4269 N N   . LEU B 1 9   ? -10.380 9.464   -65.245 1.00 60.53  ? 9    LEU B N   1 
ATOM   4270 C CA  . LEU B 1 9   ? -9.366  9.560   -66.285 1.00 62.49  ? 9    LEU B CA  1 
ATOM   4271 C C   . LEU B 1 9   ? -8.436  10.739  -66.062 1.00 61.39  ? 9    LEU B C   1 
ATOM   4272 O O   . LEU B 1 9   ? -8.889  11.877  -65.945 1.00 64.32  ? 9    LEU B O   1 
ATOM   4273 C CB  . LEU B 1 9   ? -10.027 9.701   -67.655 1.00 72.48  ? 9    LEU B CB  1 
ATOM   4274 C CG  . LEU B 1 9   ? -10.194 8.417   -68.454 1.00 75.24  ? 9    LEU B CG  1 
ATOM   4275 C CD1 . LEU B 1 9   ? -11.181 8.661   -69.579 1.00 83.56  ? 9    LEU B CD1 1 
ATOM   4276 C CD2 . LEU B 1 9   ? -8.838  7.974   -68.997 1.00 67.72  ? 9    LEU B CD2 1 
ATOM   4277 N N   . VAL B 1 10  ? -7.133  10.462  -66.020 1.00 60.45  ? 10   VAL B N   1 
ATOM   4278 C CA  . VAL B 1 10  ? -6.131  11.496  -65.776 1.00 55.90  ? 10   VAL B CA  1 
ATOM   4279 C C   . VAL B 1 10  ? -4.978  11.358  -66.772 1.00 57.87  ? 10   VAL B C   1 
ATOM   4280 O O   . VAL B 1 10  ? -4.565  10.246  -67.103 1.00 61.35  ? 10   VAL B O   1 
ATOM   4281 C CB  . VAL B 1 10  ? -5.578  11.415  -64.318 1.00 55.65  ? 10   VAL B CB  1 
ATOM   4282 C CG1 . VAL B 1 10  ? -4.575  12.526  -64.036 1.00 56.12  ? 10   VAL B CG1 1 
ATOM   4283 C CG2 . VAL B 1 10  ? -6.697  11.504  -63.326 1.00 60.28  ? 10   VAL B CG2 1 
ATOM   4284 N N   . ARG B 1 11  ? -4.475  12.488  -67.259 1.00 54.33  ? 11   ARG B N   1 
ATOM   4285 C CA  . ARG B 1 11  ? -3.236  12.493  -68.012 1.00 55.52  ? 11   ARG B CA  1 
ATOM   4286 C C   . ARG B 1 11  ? -2.089  13.076  -67.182 1.00 58.26  ? 11   ARG B C   1 
ATOM   4287 O O   . ARG B 1 11  ? -2.035  14.284  -66.889 1.00 62.66  ? 11   ARG B O   1 
ATOM   4288 C CB  . ARG B 1 11  ? -3.372  13.230  -69.355 1.00 54.62  ? 11   ARG B CB  1 
ATOM   4289 C CG  . ARG B 1 11  ? -2.026  13.639  -69.954 1.00 55.64  ? 11   ARG B CG  1 
ATOM   4290 C CD  . ARG B 1 11  ? -2.101  13.952  -71.446 1.00 81.01  ? 11   ARG B CD  1 
ATOM   4291 N NE  . ARG B 1 11  ? -1.796  12.776  -72.263 1.00 88.82  ? 11   ARG B NE  1 
ATOM   4292 C CZ  . ARG B 1 11  ? -2.699  12.100  -72.972 1.00 93.59  ? 11   ARG B CZ  1 
ATOM   4293 N NH1 . ARG B 1 11  ? -3.971  12.489  -72.975 1.00 88.89  ? 11   ARG B NH1 1 
ATOM   4294 N NH2 . ARG B 1 11  ? -2.332  11.036  -73.682 1.00 87.86  ? 11   ARG B NH2 1 
ATOM   4295 N N   . VAL B 1 12  ? -1.176  12.193  -66.800 1.00 56.63  ? 12   VAL B N   1 
ATOM   4296 C CA  . VAL B 1 12  ? 0.067   12.581  -66.157 1.00 55.09  ? 12   VAL B CA  1 
ATOM   4297 C C   . VAL B 1 12  ? 1.151   12.656  -67.241 1.00 53.69  ? 12   VAL B C   1 
ATOM   4298 O O   . VAL B 1 12  ? 0.879   12.314  -68.392 1.00 60.50  ? 12   VAL B O   1 
ATOM   4299 C CB  . VAL B 1 12  ? 0.414   11.587  -65.029 1.00 55.53  ? 12   VAL B CB  1 
ATOM   4300 C CG1 . VAL B 1 12  ? -0.715  11.571  -63.994 1.00 49.74  ? 12   VAL B CG1 1 
ATOM   4301 C CG2 . VAL B 1 12  ? 0.615   10.186  -65.589 1.00 49.83  ? 12   VAL B CG2 1 
ATOM   4302 N N   . ARG B 1 13  ? 2.356   13.109  -66.893 1.00 54.71  ? 13   ARG B N   1 
ATOM   4303 C CA  . ARG B 1 13  ? 3.419   13.307  -67.884 1.00 50.78  ? 13   ARG B CA  1 
ATOM   4304 C C   . ARG B 1 13  ? 3.796   12.065  -68.710 1.00 52.92  ? 13   ARG B C   1 
ATOM   4305 O O   . ARG B 1 13  ? 4.254   12.193  -69.843 1.00 56.71  ? 13   ARG B O   1 
ATOM   4306 C CB  . ARG B 1 13  ? 4.674   13.889  -67.234 1.00 50.61  ? 13   ARG B CB  1 
ATOM   4307 C CG  . ARG B 1 13  ? 4.607   15.384  -66.969 1.00 63.86  ? 13   ARG B CG  1 
ATOM   4308 C CD  . ARG B 1 13  ? 5.977   15.908  -66.590 1.00 73.01  ? 13   ARG B CD  1 
ATOM   4309 N NE  . ARG B 1 13  ? 5.939   17.265  -66.055 1.00 82.55  ? 13   ARG B NE  1 
ATOM   4310 C CZ  . ARG B 1 13  ? 7.007   17.909  -65.580 1.00 91.81  ? 13   ARG B CZ  1 
ATOM   4311 N NH1 . ARG B 1 13  ? 8.198   17.313  -65.577 1.00 87.60  ? 13   ARG B NH1 1 
ATOM   4312 N NH2 . ARG B 1 13  ? 6.890   19.148  -65.105 1.00 80.03  ? 13   ARG B NH2 1 
ATOM   4313 N N   . GLY B 1 14  ? 3.608   10.873  -68.151 1.00 52.37  ? 14   GLY B N   1 
ATOM   4314 C CA  . GLY B 1 14  ? 3.944   9.653   -68.863 1.00 51.10  ? 14   GLY B CA  1 
ATOM   4315 C C   . GLY B 1 14  ? 2.799   9.054   -69.667 1.00 53.74  ? 14   GLY B C   1 
ATOM   4316 O O   . GLY B 1 14  ? 2.965   8.007   -70.307 1.00 51.36  ? 14   GLY B O   1 
ATOM   4317 N N   . GLY B 1 15  ? 1.633   9.699   -69.630 1.00 51.72  ? 15   GLY B N   1 
ATOM   4318 C CA  . GLY B 1 15  ? 0.477   9.199   -70.355 1.00 53.53  ? 15   GLY B CA  1 
ATOM   4319 C C   . GLY B 1 15  ? -0.784  9.085   -69.525 1.00 55.77  ? 15   GLY B C   1 
ATOM   4320 O O   . GLY B 1 15  ? -0.893  9.673   -68.445 1.00 60.54  ? 15   GLY B O   1 
ATOM   4321 N N   . GLN B 1 16  ? -1.743  8.313   -70.014 1.00 53.81  ? 16   GLN B N   1 
ATOM   4322 C CA  . GLN B 1 16  ? -3.059  8.295   -69.393 1.00 52.49  ? 16   GLN B CA  1 
ATOM   4323 C C   . GLN B 1 16  ? -3.262  7.171   -68.408 1.00 49.77  ? 16   GLN B C   1 
ATOM   4324 O O   . GLN B 1 16  ? -2.681  6.095   -68.549 1.00 56.59  ? 16   GLN B O   1 
ATOM   4325 C CB  . GLN B 1 16  ? -4.147  8.245   -70.458 1.00 61.54  ? 16   GLN B CB  1 
ATOM   4326 C CG  . GLN B 1 16  ? -4.155  9.474   -71.329 1.00 71.49  ? 16   GLN B CG  1 
ATOM   4327 C CD  . GLN B 1 16  ? -5.489  9.690   -71.998 1.00 90.71  ? 16   GLN B CD  1 
ATOM   4328 O OE1 . GLN B 1 16  ? -5.916  8.894   -72.848 1.00 81.95  ? 16   GLN B OE1 1 
ATOM   4329 N NE2 . GLN B 1 16  ? -6.167  10.772  -71.615 1.00 89.07  ? 16   GLN B NE2 1 
ATOM   4330 N N   . LEU B 1 17  ? -4.113  7.440   -67.420 1.00 46.23  ? 17   LEU B N   1 
ATOM   4331 C CA  . LEU B 1 17  ? -4.404  6.513   -66.340 1.00 47.37  ? 17   LEU B CA  1 
ATOM   4332 C C   . LEU B 1 17  ? -5.907  6.412   -66.180 1.00 52.32  ? 17   LEU B C   1 
ATOM   4333 O O   . LEU B 1 17  ? -6.628  7.392   -66.408 1.00 55.35  ? 17   LEU B O   1 
ATOM   4334 C CB  . LEU B 1 17  ? -3.830  7.054   -65.018 1.00 51.79  ? 17   LEU B CB  1 
ATOM   4335 C CG  . LEU B 1 17  ? -2.340  7.354   -64.935 1.00 54.94  ? 17   LEU B CG  1 
ATOM   4336 C CD1 . LEU B 1 17  ? -2.046  8.133   -63.675 1.00 55.41  ? 17   LEU B CD1 1 
ATOM   4337 C CD2 . LEU B 1 17  ? -1.532  6.059   -64.962 1.00 55.62  ? 17   LEU B CD2 1 
ATOM   4338 N N   . ARG B 1 18  ? -6.380  5.242   -65.769 1.00 48.67  ? 18   ARG B N   1 
ATOM   4339 C CA  . ARG B 1 18  ? -7.775  5.085   -65.398 1.00 51.64  ? 18   ARG B CA  1 
ATOM   4340 C C   . ARG B 1 18  ? -7.873  4.574   -63.961 1.00 56.41  ? 18   ARG B C   1 
ATOM   4341 O O   . ARG B 1 18  ? -7.460  3.447   -63.646 1.00 49.56  ? 18   ARG B O   1 
ATOM   4342 C CB  . ARG B 1 18  ? -8.520  4.156   -66.364 1.00 58.96  ? 18   ARG B CB  1 
ATOM   4343 C CG  . ARG B 1 18  ? -9.933  3.793   -65.906 1.00 66.82  ? 18   ARG B CG  1 
ATOM   4344 C CD  . ARG B 1 18  ? -10.580 2.765   -66.815 1.00 78.88  ? 18   ARG B CD  1 
ATOM   4345 N NE  . ARG B 1 18  ? -9.624  1.780   -67.317 1.00 80.79  ? 18   ARG B NE  1 
ATOM   4346 C CZ  . ARG B 1 18  ? -9.244  1.693   -68.592 1.00 86.24  ? 18   ARG B CZ  1 
ATOM   4347 N NH1 . ARG B 1 18  ? -9.750  2.530   -69.500 1.00 78.76  ? 18   ARG B NH1 1 
ATOM   4348 N NH2 . ARG B 1 18  ? -8.360  0.770   -68.962 1.00 83.77  ? 18   ARG B NH2 1 
ATOM   4349 N N   . GLY B 1 19  ? -8.416  5.421   -63.090 1.00 57.55  ? 19   GLY B N   1 
ATOM   4350 C CA  . GLY B 1 19  ? -8.591  5.071   -61.697 1.00 54.27  ? 19   GLY B CA  1 
ATOM   4351 C C   . GLY B 1 19  ? -9.882  4.315   -61.485 1.00 55.60  ? 19   GLY B C   1 
ATOM   4352 O O   . GLY B 1 19  ? -10.468 3.775   -62.418 1.00 58.88  ? 19   GLY B O   1 
ATOM   4353 N N   . ILE B 1 20  ? -10.338 4.286   -60.247 1.00 53.13  ? 20   ILE B N   1 
ATOM   4354 C CA  . ILE B 1 20  ? -11.531 3.540   -59.909 1.00 57.11  ? 20   ILE B CA  1 
ATOM   4355 C C   . ILE B 1 20  ? -12.309 4.296   -58.829 1.00 61.74  ? 20   ILE B C   1 
ATOM   4356 O O   . ILE B 1 20  ? -11.709 4.859   -57.915 1.00 63.64  ? 20   ILE B O   1 
ATOM   4357 C CB  . ILE B 1 20  ? -11.148 2.136   -59.424 1.00 55.72  ? 20   ILE B CB  1 
ATOM   4358 C CG1 . ILE B 1 20  ? -12.349 1.432   -58.799 1.00 56.67  ? 20   ILE B CG1 1 
ATOM   4359 C CG2 . ILE B 1 20  ? -10.002 2.212   -58.425 1.00 49.59  ? 20   ILE B CG2 1 
ATOM   4360 C CD1 . ILE B 1 20  ? -12.204 -0.064  -58.764 1.00 39.17  ? 20   ILE B CD1 1 
ATOM   4361 N N   . ARG B 1 21  ? -13.636 4.341   -58.953 1.00 68.32  ? 21   ARG B N   1 
ATOM   4362 C CA  . ARG B 1 21  ? -14.486 4.957   -57.935 1.00 62.89  ? 21   ARG B CA  1 
ATOM   4363 C C   . ARG B 1 21  ? -14.610 4.010   -56.744 1.00 61.11  ? 21   ARG B C   1 
ATOM   4364 O O   . ARG B 1 21  ? -14.973 2.840   -56.906 1.00 57.81  ? 21   ARG B O   1 
ATOM   4365 C CB  . ARG B 1 21  ? -15.864 5.289   -58.506 1.00 66.19  ? 21   ARG B CB  1 
ATOM   4366 C CG  . ARG B 1 21  ? -16.678 6.271   -57.662 1.00 77.50  ? 21   ARG B CG  1 
ATOM   4367 C CD  . ARG B 1 21  ? -18.052 6.530   -58.281 1.00 80.08  ? 21   ARG B CD  1 
ATOM   4368 N NE  . ARG B 1 21  ? -18.859 5.311   -58.306 1.00 87.53  ? 21   ARG B NE  1 
ATOM   4369 C CZ  . ARG B 1 21  ? -19.909 5.082   -57.521 1.00 96.77  ? 21   ARG B CZ  1 
ATOM   4370 N NH1 . ARG B 1 21  ? -20.308 6.002   -56.648 1.00 89.00  ? 21   ARG B NH1 1 
ATOM   4371 N NH2 . ARG B 1 21  ? -20.573 3.934   -57.619 1.00 99.22  ? 21   ARG B NH2 1 
ATOM   4372 N N   . LEU B 1 22  ? -14.285 4.511   -55.553 1.00 58.75  ? 22   LEU B N   1 
ATOM   4373 C CA  . LEU B 1 22  ? -14.293 3.677   -54.359 1.00 61.22  ? 22   LEU B CA  1 
ATOM   4374 C C   . LEU B 1 22  ? -15.340 4.131   -53.354 1.00 64.67  ? 22   LEU B C   1 
ATOM   4375 O O   . LEU B 1 22  ? -15.789 5.282   -53.372 1.00 64.48  ? 22   LEU B O   1 
ATOM   4376 C CB  . LEU B 1 22  ? -12.911 3.660   -53.700 1.00 63.26  ? 22   LEU B CB  1 
ATOM   4377 C CG  . LEU B 1 22  ? -11.814 2.802   -54.328 1.00 62.51  ? 22   LEU B CG  1 
ATOM   4378 C CD1 . LEU B 1 22  ? -10.572 2.818   -53.440 1.00 65.98  ? 22   LEU B CD1 1 
ATOM   4379 C CD2 . LEU B 1 22  ? -12.304 1.379   -54.545 1.00 61.06  ? 22   LEU B CD2 1 
ATOM   4380 N N   . LYS B 1 23  ? -15.719 3.223   -52.466 1.00 69.26  ? 23   LYS B N   1 
ATOM   4381 C CA  . LYS B 1 23  ? -16.745 3.531   -51.481 1.00 73.86  ? 23   LYS B CA  1 
ATOM   4382 C C   . LYS B 1 23  ? -16.161 3.945   -50.131 1.00 71.64  ? 23   LYS B C   1 
ATOM   4383 O O   . LYS B 1 23  ? -15.503 3.144   -49.448 1.00 70.99  ? 23   LYS B O   1 
ATOM   4384 C CB  . LYS B 1 23  ? -17.682 2.328   -51.294 1.00 70.15  ? 23   LYS B CB  1 
ATOM   4385 C CG  . LYS B 1 23  ? -19.082 2.705   -50.860 1.00 75.99  ? 23   LYS B CG  1 
ATOM   4386 C CD  . LYS B 1 23  ? -19.666 3.733   -51.821 1.00 89.28  ? 23   LYS B CD  1 
ATOM   4387 C CE  . LYS B 1 23  ? -20.400 4.845   -51.069 1.00 89.99  ? 23   LYS B CE  1 
ATOM   4388 N NZ  . LYS B 1 23  ? -20.770 5.976   -51.978 1.00 86.71  ? 23   LYS B NZ  1 
ATOM   4389 N N   . ALA B 1 24  ? -16.395 5.201   -49.761 1.00 68.24  ? 24   ALA B N   1 
ATOM   4390 C CA  . ALA B 1 24  ? -16.217 5.651   -48.379 1.00 67.11  ? 24   ALA B CA  1 
ATOM   4391 C C   . ALA B 1 24  ? -17.604 5.909   -47.770 1.00 72.47  ? 24   ALA B C   1 
ATOM   4392 O O   . ALA B 1 24  ? -18.535 6.296   -48.493 1.00 72.42  ? 24   ALA B O   1 
ATOM   4393 C CB  . ALA B 1 24  ? -15.351 6.904   -48.327 1.00 62.35  ? 24   ALA B CB  1 
ATOM   4394 N N   . PRO B 1 25  ? -17.752 5.701   -46.443 1.00 75.39  ? 25   PRO B N   1 
ATOM   4395 C CA  . PRO B 1 25  ? -19.065 5.737   -45.770 1.00 74.49  ? 25   PRO B CA  1 
ATOM   4396 C C   . PRO B 1 25  ? -19.871 7.021   -45.989 1.00 69.61  ? 25   PRO B C   1 
ATOM   4397 O O   . PRO B 1 25  ? -21.093 7.003   -45.865 1.00 74.13  ? 25   PRO B O   1 
ATOM   4398 C CB  . PRO B 1 25  ? -18.704 5.602   -44.285 1.00 65.54  ? 25   PRO B CB  1 
ATOM   4399 C CG  . PRO B 1 25  ? -17.416 4.879   -44.282 1.00 71.95  ? 25   PRO B CG  1 
ATOM   4400 C CD  . PRO B 1 25  ? -16.669 5.391   -45.493 1.00 72.64  ? 25   PRO B CD  1 
ATOM   4401 N N   . GLY B 1 26  ? -19.199 8.118   -46.312 1.00 65.07  ? 26   GLY B N   1 
ATOM   4402 C CA  . GLY B 1 26  ? -19.894 9.367   -46.554 1.00 65.00  ? 26   GLY B CA  1 
ATOM   4403 C C   . GLY B 1 26  ? -20.022 9.729   -48.023 1.00 69.76  ? 26   GLY B C   1 
ATOM   4404 O O   . GLY B 1 26  ? -20.528 10.807  -48.353 1.00 71.17  ? 26   GLY B O   1 
ATOM   4405 N N   . GLY B 1 27  ? -19.565 8.842   -48.907 1.00 69.52  ? 27   GLY B N   1 
ATOM   4406 C CA  . GLY B 1 27  ? -19.634 9.101   -50.337 1.00 69.11  ? 27   GLY B CA  1 
ATOM   4407 C C   . GLY B 1 27  ? -18.459 8.536   -51.108 1.00 72.09  ? 27   GLY B C   1 
ATOM   4408 O O   . GLY B 1 27  ? -17.570 7.923   -50.518 1.00 69.70  ? 27   GLY B O   1 
ATOM   4409 N N   . PRO B 1 28  ? -18.447 8.744   -52.434 1.00 74.55  ? 28   PRO B N   1 
ATOM   4410 C CA  . PRO B 1 28  ? -17.415 8.181   -53.313 1.00 78.52  ? 28   PRO B CA  1 
ATOM   4411 C C   . PRO B 1 28  ? -16.068 8.913   -53.237 1.00 68.63  ? 28   PRO B C   1 
ATOM   4412 O O   . PRO B 1 28  ? -16.043 10.124  -52.979 1.00 65.38  ? 28   PRO B O   1 
ATOM   4413 C CB  . PRO B 1 28  ? -18.024 8.367   -54.712 1.00 72.77  ? 28   PRO B CB  1 
ATOM   4414 C CG  . PRO B 1 28  ? -18.862 9.587   -54.580 1.00 65.71  ? 28   PRO B CG  1 
ATOM   4415 C CD  . PRO B 1 28  ? -19.464 9.494   -53.194 1.00 66.89  ? 28   PRO B CD  1 
ATOM   4416 N N   . VAL B 1 29  ? -14.977 8.171   -53.456 1.00 63.76  ? 29   VAL B N   1 
ATOM   4417 C CA  . VAL B 1 29  ? -13.648 8.742   -53.724 1.00 63.40  ? 29   VAL B CA  1 
ATOM   4418 C C   . VAL B 1 29  ? -13.075 8.147   -55.018 1.00 61.38  ? 29   VAL B C   1 
ATOM   4419 O O   . VAL B 1 29  ? -13.356 6.993   -55.348 1.00 60.40  ? 29   VAL B O   1 
ATOM   4420 C CB  . VAL B 1 29  ? -12.651 8.477   -52.564 1.00 61.83  ? 29   VAL B CB  1 
ATOM   4421 C CG1 . VAL B 1 29  ? -12.991 9.325   -51.353 1.00 64.42  ? 29   VAL B CG1 1 
ATOM   4422 C CG2 . VAL B 1 29  ? -12.653 7.006   -52.179 1.00 66.12  ? 29   VAL B CG2 1 
ATOM   4423 N N   . SER B 1 30  ? -12.295 8.936   -55.757 1.00 56.07  ? 30   SER B N   1 
ATOM   4424 C CA  . SER B 1 30  ? -11.550 8.432   -56.912 1.00 52.80  ? 30   SER B CA  1 
ATOM   4425 C C   . SER B 1 30  ? -10.194 7.870   -56.455 1.00 56.96  ? 30   SER B C   1 
ATOM   4426 O O   . SER B 1 30  ? -9.415  8.582   -55.824 1.00 63.44  ? 30   SER B O   1 
ATOM   4427 C CB  . SER B 1 30  ? -11.272 9.560   -57.914 1.00 58.12  ? 30   SER B CB  1 
ATOM   4428 O OG  . SER B 1 30  ? -12.327 10.498  -57.988 1.00 65.54  ? 30   SER B OG  1 
ATOM   4429 N N   . ALA B 1 31  ? -9.876  6.619   -56.776 1.00 54.30  ? 31   ALA B N   1 
ATOM   4430 C CA  . ALA B 1 31  ? -8.538  6.104   -56.445 1.00 52.28  ? 31   ALA B CA  1 
ATOM   4431 C C   . ALA B 1 31  ? -7.695  5.732   -57.670 1.00 49.90  ? 31   ALA B C   1 
ATOM   4432 O O   . ALA B 1 31  ? -8.186  5.123   -58.620 1.00 55.33  ? 31   ALA B O   1 
ATOM   4433 C CB  . ALA B 1 31  ? -8.632  4.927   -55.480 1.00 44.60  ? 31   ALA B CB  1 
ATOM   4434 N N   . PHE B 1 32  ? -6.418  6.096   -57.646 1.00 54.68  ? 32   PHE B N   1 
ATOM   4435 C CA  . PHE B 1 32  ? -5.484  5.653   -58.684 1.00 47.85  ? 32   PHE B CA  1 
ATOM   4436 C C   . PHE B 1 32  ? -4.374  4.809   -58.047 1.00 50.26  ? 32   PHE B C   1 
ATOM   4437 O O   . PHE B 1 32  ? -3.426  5.343   -57.471 1.00 52.22  ? 32   PHE B O   1 
ATOM   4438 C CB  . PHE B 1 32  ? -4.918  6.850   -59.459 1.00 41.31  ? 32   PHE B CB  1 
ATOM   4439 C CG  . PHE B 1 32  ? -5.981  7.741   -60.037 1.00 53.45  ? 32   PHE B CG  1 
ATOM   4440 C CD1 . PHE B 1 32  ? -6.638  8.674   -59.239 1.00 56.46  ? 32   PHE B CD1 1 
ATOM   4441 C CD2 . PHE B 1 32  ? -6.352  7.633   -61.371 1.00 62.96  ? 32   PHE B CD2 1 
ATOM   4442 C CE1 . PHE B 1 32  ? -7.632  9.490   -59.764 1.00 53.93  ? 32   PHE B CE1 1 
ATOM   4443 C CE2 . PHE B 1 32  ? -7.356  8.451   -61.903 1.00 59.97  ? 32   PHE B CE2 1 
ATOM   4444 C CZ  . PHE B 1 32  ? -7.991  9.375   -61.090 1.00 56.43  ? 32   PHE B CZ  1 
ATOM   4445 N N   . LEU B 1 33  ? -4.509  3.490   -58.148 1.00 48.26  ? 33   LEU B N   1 
ATOM   4446 C CA  . LEU B 1 33  ? -3.579  2.570   -57.512 1.00 45.70  ? 33   LEU B CA  1 
ATOM   4447 C C   . LEU B 1 33  ? -2.604  1.948   -58.516 1.00 49.22  ? 33   LEU B C   1 
ATOM   4448 O O   . LEU B 1 33  ? -2.977  1.646   -59.647 1.00 57.04  ? 33   LEU B O   1 
ATOM   4449 C CB  . LEU B 1 33  ? -4.359  1.467   -56.802 1.00 42.66  ? 33   LEU B CB  1 
ATOM   4450 C CG  . LEU B 1 33  ? -5.576  1.936   -56.006 1.00 45.59  ? 33   LEU B CG  1 
ATOM   4451 C CD1 . LEU B 1 33  ? -6.347  0.751   -55.448 1.00 41.23  ? 33   LEU B CD1 1 
ATOM   4452 C CD2 . LEU B 1 33  ? -5.141  2.860   -54.878 1.00 46.82  ? 33   LEU B CD2 1 
ATOM   4453 N N   . GLY B 1 34  ? -1.358  1.747   -58.099 1.00 45.78  ? 34   GLY B N   1 
ATOM   4454 C CA  . GLY B 1 34  ? -0.384  1.076   -58.937 1.00 45.23  ? 34   GLY B CA  1 
ATOM   4455 C C   . GLY B 1 34  ? 0.173   1.916   -60.073 1.00 47.35  ? 34   GLY B C   1 
ATOM   4456 O O   . GLY B 1 34  ? 0.463   1.397   -61.154 1.00 55.44  ? 34   GLY B O   1 
ATOM   4457 N N   . ILE B 1 35  ? 0.329   3.215   -59.846 1.00 40.43  ? 35   ILE B N   1 
ATOM   4458 C CA  . ILE B 1 35  ? 0.972   4.063   -60.840 1.00 42.93  ? 35   ILE B CA  1 
ATOM   4459 C C   . ILE B 1 35  ? 2.495   3.896   -60.780 1.00 44.90  ? 35   ILE B C   1 
ATOM   4460 O O   . ILE B 1 35  ? 3.118   4.086   -59.736 1.00 50.88  ? 35   ILE B O   1 
ATOM   4461 C CB  . ILE B 1 35  ? 0.624   5.547   -60.629 1.00 46.10  ? 35   ILE B CB  1 
ATOM   4462 C CG1 . ILE B 1 35  ? -0.886  5.719   -60.443 1.00 44.72  ? 35   ILE B CG1 1 
ATOM   4463 C CG2 . ILE B 1 35  ? 1.147   6.389   -61.787 1.00 35.74  ? 35   ILE B CG2 1 
ATOM   4464 C CD1 . ILE B 1 35  ? -1.296  7.111   -59.938 1.00 41.28  ? 35   ILE B CD1 1 
ATOM   4465 N N   . PRO B 1 36  ? 3.110   3.539   -61.908 1.00 49.07  ? 36   PRO B N   1 
ATOM   4466 C CA  . PRO B 1 36  ? 4.569   3.392   -61.889 1.00 49.11  ? 36   PRO B CA  1 
ATOM   4467 C C   . PRO B 1 36  ? 5.267   4.751   -61.874 1.00 44.30  ? 36   PRO B C   1 
ATOM   4468 O O   . PRO B 1 36  ? 4.936   5.619   -62.695 1.00 44.32  ? 36   PRO B O   1 
ATOM   4469 C CB  . PRO B 1 36  ? 4.854   2.657   -63.205 1.00 48.74  ? 36   PRO B CB  1 
ATOM   4470 C CG  . PRO B 1 36  ? 3.738   3.121   -64.128 1.00 50.84  ? 36   PRO B CG  1 
ATOM   4471 C CD  . PRO B 1 36  ? 2.526   3.254   -63.235 1.00 49.58  ? 36   PRO B CD  1 
ATOM   4472 N N   . PHE B 1 37  ? 6.225   4.937   -60.968 1.00 44.12  ? 37   PHE B N   1 
ATOM   4473 C CA  . PHE B 1 37  ? 6.972   6.198   -60.953 1.00 45.06  ? 37   PHE B CA  1 
ATOM   4474 C C   . PHE B 1 37  ? 8.440   6.002   -61.324 1.00 45.25  ? 37   PHE B C   1 
ATOM   4475 O O   . PHE B 1 37  ? 9.200   6.973   -61.439 1.00 49.87  ? 37   PHE B O   1 
ATOM   4476 C CB  . PHE B 1 37  ? 6.822   6.926   -59.603 1.00 44.16  ? 37   PHE B CB  1 
ATOM   4477 C CG  . PHE B 1 37  ? 7.396   6.175   -58.431 1.00 37.61  ? 37   PHE B CG  1 
ATOM   4478 C CD1 . PHE B 1 37  ? 8.748   6.282   -58.104 1.00 35.97  ? 37   PHE B CD1 1 
ATOM   4479 C CD2 . PHE B 1 37  ? 6.582   5.378   -57.639 1.00 35.70  ? 37   PHE B CD2 1 
ATOM   4480 C CE1 . PHE B 1 37  ? 9.273   5.587   -57.007 1.00 37.98  ? 37   PHE B CE1 1 
ATOM   4481 C CE2 . PHE B 1 37  ? 7.100   4.685   -56.544 1.00 33.19  ? 37   PHE B CE2 1 
ATOM   4482 C CZ  . PHE B 1 37  ? 8.444   4.788   -56.233 1.00 33.60  ? 37   PHE B CZ  1 
ATOM   4483 N N   . ALA B 1 38  ? 8.828   4.745   -61.523 1.00 44.02  ? 38   ALA B N   1 
ATOM   4484 C CA  . ALA B 1 38  ? 10.199  4.420   -61.904 1.00 46.26  ? 38   ALA B CA  1 
ATOM   4485 C C   . ALA B 1 38  ? 10.257  3.181   -62.804 1.00 41.13  ? 38   ALA B C   1 
ATOM   4486 O O   . ALA B 1 38  ? 9.399   2.298   -62.705 1.00 43.47  ? 38   ALA B O   1 
ATOM   4487 C CB  . ALA B 1 38  ? 11.049  4.205   -60.659 1.00 40.24  ? 38   ALA B CB  1 
ATOM   4488 N N   . GLU B 1 39  ? 11.263  3.135   -63.679 1.00 38.60  ? 39   GLU B N   1 
ATOM   4489 C CA  . GLU B 1 39  ? 11.683  1.898   -64.334 1.00 45.38  ? 39   GLU B CA  1 
ATOM   4490 C C   . GLU B 1 39  ? 11.903  0.807   -63.297 1.00 49.27  ? 39   GLU B C   1 
ATOM   4491 O O   . GLU B 1 39  ? 12.550  1.050   -62.270 1.00 54.14  ? 39   GLU B O   1 
ATOM   4492 C CB  . GLU B 1 39  ? 12.994  2.110   -65.077 1.00 38.74  ? 39   GLU B CB  1 
ATOM   4493 C CG  . GLU B 1 39  ? 12.857  3.002   -66.275 1.00 52.31  ? 39   GLU B CG  1 
ATOM   4494 C CD  . GLU B 1 39  ? 11.977  2.383   -67.337 1.00 51.82  ? 39   GLU B CD  1 
ATOM   4495 O OE1 . GLU B 1 39  ? 12.486  1.525   -68.094 1.00 58.13  ? 39   GLU B OE1 1 
ATOM   4496 O OE2 . GLU B 1 39  ? 10.781  2.751   -67.412 1.00 50.98  ? 39   GLU B OE2 1 
ATOM   4497 N N   . PRO B 1 40  ? 11.366  -0.401  -63.554 1.00 46.25  ? 40   PRO B N   1 
ATOM   4498 C CA  . PRO B 1 40  ? 11.518  -1.507  -62.594 1.00 44.97  ? 40   PRO B CA  1 
ATOM   4499 C C   . PRO B 1 40  ? 12.997  -1.783  -62.291 1.00 50.11  ? 40   PRO B C   1 
ATOM   4500 O O   . PRO B 1 40  ? 13.792  -1.997  -63.210 1.00 56.22  ? 40   PRO B O   1 
ATOM   4501 C CB  . PRO B 1 40  ? 10.879  -2.691  -63.321 1.00 42.99  ? 40   PRO B CB  1 
ATOM   4502 C CG  . PRO B 1 40  ? 9.883   -2.056  -64.260 1.00 47.01  ? 40   PRO B CG  1 
ATOM   4503 C CD  . PRO B 1 40  ? 10.538  -0.777  -64.717 1.00 43.65  ? 40   PRO B CD  1 
ATOM   4504 N N   . PRO B 1 41  ? 13.371  -1.758  -61.003 1.00 52.52  ? 41   PRO B N   1 
ATOM   4505 C CA  . PRO B 1 41  ? 14.784  -1.804  -60.592 1.00 54.41  ? 41   PRO B CA  1 
ATOM   4506 C C   . PRO B 1 41  ? 15.339  -3.230  -60.537 1.00 53.71  ? 41   PRO B C   1 
ATOM   4507 O O   . PRO B 1 41  ? 15.831  -3.662  -59.492 1.00 51.55  ? 41   PRO B O   1 
ATOM   4508 C CB  . PRO B 1 41  ? 14.741  -1.200  -59.189 1.00 43.39  ? 41   PRO B CB  1 
ATOM   4509 C CG  . PRO B 1 41  ? 13.385  -1.631  -58.662 1.00 44.97  ? 41   PRO B CG  1 
ATOM   4510 C CD  . PRO B 1 41  ? 12.453  -1.679  -59.847 1.00 41.98  ? 41   PRO B CD  1 
ATOM   4511 N N   . VAL B 1 42  ? 15.269  -3.933  -61.665 1.00 57.88  ? 42   VAL B N   1 
ATOM   4512 C CA  . VAL B 1 42  ? 15.585  -5.359  -61.735 1.00 51.91  ? 42   VAL B CA  1 
ATOM   4513 C C   . VAL B 1 42  ? 16.802  -5.606  -62.616 1.00 53.87  ? 42   VAL B C   1 
ATOM   4514 O O   . VAL B 1 42  ? 17.245  -4.716  -63.356 1.00 50.74  ? 42   VAL B O   1 
ATOM   4515 C CB  . VAL B 1 42  ? 14.401  -6.144  -62.317 1.00 55.91  ? 42   VAL B CB  1 
ATOM   4516 C CG1 . VAL B 1 42  ? 13.159  -5.998  -61.411 1.00 42.65  ? 42   VAL B CG1 1 
ATOM   4517 C CG2 . VAL B 1 42  ? 14.106  -5.666  -63.747 1.00 42.57  ? 42   VAL B CG2 1 
ATOM   4518 N N   . GLY B 1 43  ? 17.340  -6.819  -62.540 1.00 54.70  ? 43   GLY B N   1 
ATOM   4519 C CA  . GLY B 1 43  ? 18.506  -7.174  -63.329 1.00 51.08  ? 43   GLY B CA  1 
ATOM   4520 C C   . GLY B 1 43  ? 19.743  -6.379  -62.952 1.00 56.86  ? 43   GLY B C   1 
ATOM   4521 O O   . GLY B 1 43  ? 20.211  -6.452  -61.810 1.00 62.66  ? 43   GLY B O   1 
ATOM   4522 N N   . SER B 1 44  ? 20.277  -5.621  -63.907 1.00 55.69  ? 44   SER B N   1 
ATOM   4523 C CA  . SER B 1 44  ? 21.494  -4.847  -63.675 1.00 60.52  ? 44   SER B CA  1 
ATOM   4524 C C   . SER B 1 44  ? 21.185  -3.599  -62.835 1.00 64.18  ? 44   SER B C   1 
ATOM   4525 O O   . SER B 1 44  ? 22.089  -2.837  -62.442 1.00 58.23  ? 44   SER B O   1 
ATOM   4526 C CB  . SER B 1 44  ? 22.134  -4.451  -65.012 1.00 65.50  ? 44   SER B CB  1 
ATOM   4527 O OG  . SER B 1 44  ? 21.588  -3.239  -65.523 1.00 66.42  ? 44   SER B OG  1 
ATOM   4528 N N   . ARG B 1 45  ? 19.895  -3.402  -62.568 1.00 62.50  ? 45   ARG B N   1 
ATOM   4529 C CA  . ARG B 1 45  ? 19.416  -2.225  -61.861 1.00 57.50  ? 45   ARG B CA  1 
ATOM   4530 C C   . ARG B 1 45  ? 19.104  -2.532  -60.391 1.00 57.14  ? 45   ARG B C   1 
ATOM   4531 O O   . ARG B 1 45  ? 18.628  -1.663  -59.658 1.00 60.44  ? 45   ARG B O   1 
ATOM   4532 C CB  . ARG B 1 45  ? 18.211  -1.614  -62.590 1.00 48.83  ? 45   ARG B CB  1 
ATOM   4533 C CG  . ARG B 1 45  ? 18.602  -0.550  -63.605 1.00 52.05  ? 45   ARG B CG  1 
ATOM   4534 C CD  . ARG B 1 45  ? 19.213  0.649   -62.882 1.00 74.90  ? 45   ARG B CD  1 
ATOM   4535 N NE  . ARG B 1 45  ? 20.128  1.444   -63.701 1.00 83.14  ? 45   ARG B NE  1 
ATOM   4536 C CZ  . ARG B 1 45  ? 20.584  2.652   -63.356 1.00 91.20  ? 45   ARG B CZ  1 
ATOM   4537 N NH1 . ARG B 1 45  ? 20.204  3.211   -62.207 1.00 74.88  ? 45   ARG B NH1 1 
ATOM   4538 N NH2 . ARG B 1 45  ? 21.416  3.309   -64.161 1.00 87.63  ? 45   ARG B NH2 1 
ATOM   4539 N N   . ARG B 1 46  ? 19.378  -3.766  -59.966 1.00 49.15  ? 46   ARG B N   1 
ATOM   4540 C CA  . ARG B 1 46  ? 19.384  -4.098  -58.543 1.00 50.51  ? 46   ARG B CA  1 
ATOM   4541 C C   . ARG B 1 46  ? 20.483  -3.285  -57.847 1.00 54.52  ? 46   ARG B C   1 
ATOM   4542 O O   . ARG B 1 46  ? 21.572  -3.079  -58.421 1.00 50.44  ? 46   ARG B O   1 
ATOM   4543 C CB  . ARG B 1 46  ? 19.627  -5.594  -58.341 1.00 48.55  ? 46   ARG B CB  1 
ATOM   4544 C CG  . ARG B 1 46  ? 19.419  -6.094  -56.919 1.00 47.52  ? 46   ARG B CG  1 
ATOM   4545 C CD  . ARG B 1 46  ? 19.800  -7.569  -56.803 1.00 46.90  ? 46   ARG B CD  1 
ATOM   4546 N NE  . ARG B 1 46  ? 18.643  -8.462  -56.813 1.00 46.83  ? 46   ARG B NE  1 
ATOM   4547 C CZ  . ARG B 1 46  ? 18.727  -9.788  -56.898 1.00 49.77  ? 46   ARG B CZ  1 
ATOM   4548 N NH1 . ARG B 1 46  ? 19.918  -10.362 -56.997 1.00 54.20  ? 46   ARG B NH1 1 
ATOM   4549 N NH2 . ARG B 1 46  ? 17.629  -10.538 -56.885 1.00 45.30  ? 46   ARG B NH2 1 
ATOM   4550 N N   . PHE B 1 47  ? 20.173  -2.799  -56.638 1.00 49.20  ? 47   PHE B N   1 
ATOM   4551 C CA  . PHE B 1 47  ? 21.094  -2.006  -55.810 1.00 43.92  ? 47   PHE B CA  1 
ATOM   4552 C C   . PHE B 1 47  ? 21.360  -0.600  -56.366 1.00 44.42  ? 47   PHE B C   1 
ATOM   4553 O O   . PHE B 1 47  ? 22.108  0.179   -55.778 1.00 47.49  ? 47   PHE B O   1 
ATOM   4554 C CB  . PHE B 1 47  ? 22.427  -2.753  -55.581 1.00 45.58  ? 47   PHE B CB  1 
ATOM   4555 C CG  . PHE B 1 47  ? 22.258  -4.162  -55.062 1.00 48.38  ? 47   PHE B CG  1 
ATOM   4556 C CD1 . PHE B 1 47  ? 21.426  -4.423  -53.973 1.00 44.86  ? 47   PHE B CD1 1 
ATOM   4557 C CD2 . PHE B 1 47  ? 22.925  -5.230  -55.666 1.00 46.24  ? 47   PHE B CD2 1 
ATOM   4558 C CE1 . PHE B 1 47  ? 21.266  -5.733  -53.479 1.00 47.47  ? 47   PHE B CE1 1 
ATOM   4559 C CE2 . PHE B 1 47  ? 22.764  -6.542  -55.188 1.00 46.96  ? 47   PHE B CE2 1 
ATOM   4560 C CZ  . PHE B 1 47  ? 21.927  -6.792  -54.092 1.00 49.17  ? 47   PHE B CZ  1 
ATOM   4561 N N   . MET B 1 48  ? 20.738  -0.266  -57.488 1.00 47.69  ? 48   MET B N   1 
ATOM   4562 C CA  . MET B 1 48  ? 21.029  1.002   -58.150 1.00 49.00  ? 48   MET B CA  1 
ATOM   4563 C C   . MET B 1 48  ? 19.943  2.051   -57.923 1.00 49.08  ? 48   MET B C   1 
ATOM   4564 O O   . MET B 1 48  ? 18.780  1.702   -57.655 1.00 41.46  ? 48   MET B O   1 
ATOM   4565 C CB  . MET B 1 48  ? 21.228  0.763   -59.646 1.00 57.00  ? 48   MET B CB  1 
ATOM   4566 C CG  . MET B 1 48  ? 22.398  -0.157  -59.956 1.00 67.44  ? 48   MET B CG  1 
ATOM   4567 S SD  . MET B 1 48  ? 23.562  0.599   -61.105 1.00 88.05  ? 48   MET B SD  1 
ATOM   4568 C CE  . MET B 1 48  ? 24.304  1.833   -60.062 1.00 53.04  ? 48   MET B CE  1 
ATOM   4569 N N   . PRO B 1 49  ? 20.324  3.342   -58.013 1.00 50.16  ? 49   PRO B N   1 
ATOM   4570 C CA  . PRO B 1 49  ? 19.332  4.424   -57.925 1.00 50.36  ? 49   PRO B CA  1 
ATOM   4571 C C   . PRO B 1 49  ? 18.230  4.214   -58.962 1.00 52.68  ? 49   PRO B C   1 
ATOM   4572 O O   . PRO B 1 49  ? 18.498  3.676   -60.044 1.00 54.42  ? 49   PRO B O   1 
ATOM   4573 C CB  . PRO B 1 49  ? 20.148  5.685   -58.268 1.00 42.22  ? 49   PRO B CB  1 
ATOM   4574 C CG  . PRO B 1 49  ? 21.530  5.349   -57.864 1.00 46.80  ? 49   PRO B CG  1 
ATOM   4575 C CD  . PRO B 1 49  ? 21.700  3.861   -58.143 1.00 48.66  ? 49   PRO B CD  1 
ATOM   4576 N N   . PRO B 1 50  ? 16.994  4.615   -58.629 1.00 56.27  ? 50   PRO B N   1 
ATOM   4577 C CA  . PRO B 1 50  ? 15.871  4.447   -59.552 1.00 44.75  ? 50   PRO B CA  1 
ATOM   4578 C C   . PRO B 1 50  ? 15.995  5.412   -60.730 1.00 46.18  ? 50   PRO B C   1 
ATOM   4579 O O   . PRO B 1 50  ? 16.509  6.521   -60.572 1.00 48.69  ? 50   PRO B O   1 
ATOM   4580 C CB  . PRO B 1 50  ? 14.665  4.824   -58.693 1.00 44.51  ? 50   PRO B CB  1 
ATOM   4581 C CG  . PRO B 1 50  ? 15.209  5.803   -57.702 1.00 40.39  ? 50   PRO B CG  1 
ATOM   4582 C CD  . PRO B 1 50  ? 16.596  5.315   -57.392 1.00 48.17  ? 50   PRO B CD  1 
ATOM   4583 N N   . GLU B 1 51  ? 15.565  4.971   -61.908 1.00 52.05  ? 51   GLU B N   1 
ATOM   4584 C CA  . GLU B 1 51  ? 15.457  5.846   -63.064 1.00 47.67  ? 51   GLU B CA  1 
ATOM   4585 C C   . GLU B 1 51  ? 13.976  6.125   -63.296 1.00 43.20  ? 51   GLU B C   1 
ATOM   4586 O O   . GLU B 1 51  ? 13.128  5.257   -63.055 1.00 45.06  ? 51   GLU B O   1 
ATOM   4587 C CB  . GLU B 1 51  ? 16.056  5.181   -64.302 1.00 55.85  ? 51   GLU B CB  1 
ATOM   4588 C CG  . GLU B 1 51  ? 17.537  4.835   -64.214 1.00 64.95  ? 51   GLU B CG  1 
ATOM   4589 C CD  . GLU B 1 51  ? 17.959  3.853   -65.310 1.00 89.51  ? 51   GLU B CD  1 
ATOM   4590 O OE1 . GLU B 1 51  ? 17.180  2.914   -65.617 1.00 85.12  ? 51   GLU B OE1 1 
ATOM   4591 O OE2 . GLU B 1 51  ? 19.064  4.027   -65.871 1.00 98.42  ? 51   GLU B OE2 1 
ATOM   4592 N N   . PRO B 1 52  ? 13.654  7.331   -63.776 1.00 44.17  ? 52   PRO B N   1 
ATOM   4593 C CA  . PRO B 1 52  ? 12.245  7.677   -64.033 1.00 43.70  ? 52   PRO B CA  1 
ATOM   4594 C C   . PRO B 1 52  ? 11.568  6.738   -65.058 1.00 45.59  ? 52   PRO B C   1 
ATOM   4595 O O   . PRO B 1 52  ? 12.188  6.396   -66.084 1.00 41.72  ? 52   PRO B O   1 
ATOM   4596 C CB  . PRO B 1 52  ? 12.326  9.100   -64.613 1.00 39.53  ? 52   PRO B CB  1 
ATOM   4597 C CG  . PRO B 1 52  ? 13.727  9.602   -64.281 1.00 46.70  ? 52   PRO B CG  1 
ATOM   4598 C CD  . PRO B 1 52  ? 14.596  8.390   -64.193 1.00 47.97  ? 52   PRO B CD  1 
ATOM   4599 N N   . LYS B 1 53  ? 10.321  6.341   -64.777 1.00 45.52  ? 53   LYS B N   1 
ATOM   4600 C CA  . LYS B 1 53  ? 9.519   5.517   -65.687 1.00 45.58  ? 53   LYS B CA  1 
ATOM   4601 C C   . LYS B 1 53  ? 9.441   6.092   -67.105 1.00 51.49  ? 53   LYS B C   1 
ATOM   4602 O O   . LYS B 1 53  ? 9.269   7.304   -67.285 1.00 49.40  ? 53   LYS B O   1 
ATOM   4603 C CB  . LYS B 1 53  ? 8.100   5.354   -65.145 1.00 43.95  ? 53   LYS B CB  1 
ATOM   4604 C CG  . LYS B 1 53  ? 7.172   4.548   -66.045 1.00 47.50  ? 53   LYS B CG  1 
ATOM   4605 C CD  . LYS B 1 53  ? 7.501   3.055   -65.992 1.00 51.20  ? 53   LYS B CD  1 
ATOM   4606 C CE  . LYS B 1 53  ? 6.434   2.205   -66.700 1.00 47.60  ? 53   LYS B CE  1 
ATOM   4607 N NZ  . LYS B 1 53  ? 6.353   2.544   -68.149 1.00 51.65  ? 53   LYS B NZ  1 
ATOM   4608 N N   . ARG B 1 54  ? 9.579   5.221   -68.108 1.00 58.34  ? 54   ARG B N   1 
ATOM   4609 C CA  . ARG B 1 54  ? 9.382   5.613   -69.506 1.00 51.72  ? 54   ARG B CA  1 
ATOM   4610 C C   . ARG B 1 54  ? 7.882   5.816   -69.796 1.00 47.74  ? 54   ARG B C   1 
ATOM   4611 O O   . ARG B 1 54  ? 7.018   5.126   -69.215 1.00 42.23  ? 54   ARG B O   1 
ATOM   4612 C CB  . ARG B 1 54  ? 9.979   4.557   -70.460 1.00 52.14  ? 54   ARG B CB  1 
ATOM   4613 C CG  . ARG B 1 54  ? 11.518  4.455   -70.428 1.00 49.15  ? 54   ARG B CG  1 
ATOM   4614 C CD  . ARG B 1 54  ? 12.075  3.234   -71.197 1.00 47.57  ? 54   ARG B CD  1 
ATOM   4615 N NE  . ARG B 1 54  ? 11.385  1.980   -70.858 1.00 49.94  ? 54   ARG B NE  1 
ATOM   4616 C CZ  . ARG B 1 54  ? 10.577  1.325   -71.694 1.00 56.45  ? 54   ARG B CZ  1 
ATOM   4617 N NH1 . ARG B 1 54  ? 10.381  1.783   -72.931 1.00 52.26  ? 54   ARG B NH1 1 
ATOM   4618 N NH2 . ARG B 1 54  ? 9.975   0.208   -71.301 1.00 54.67  ? 54   ARG B NH2 1 
ATOM   4619 N N   . PRO B 1 55  ? 7.569   6.772   -70.688 1.00 47.03  ? 55   PRO B N   1 
ATOM   4620 C CA  . PRO B 1 55  ? 6.199   7.046   -71.150 1.00 47.08  ? 55   PRO B CA  1 
ATOM   4621 C C   . PRO B 1 55  ? 5.526   5.784   -71.685 1.00 51.24  ? 55   PRO B C   1 
ATOM   4622 O O   . PRO B 1 55  ? 6.214   4.884   -72.193 1.00 55.75  ? 55   PRO B O   1 
ATOM   4623 C CB  . PRO B 1 55  ? 6.413   8.030   -72.299 1.00 50.84  ? 55   PRO B CB  1 
ATOM   4624 C CG  . PRO B 1 55  ? 7.670   8.757   -71.934 1.00 51.53  ? 55   PRO B CG  1 
ATOM   4625 C CD  . PRO B 1 55  ? 8.542   7.738   -71.231 1.00 49.90  ? 55   PRO B CD  1 
ATOM   4626 N N   . TRP B 1 56  ? 4.203   5.712   -71.571 1.00 45.88  ? 56   TRP B N   1 
ATOM   4627 C CA  . TRP B 1 56  ? 3.477   4.542   -72.036 1.00 43.12  ? 56   TRP B CA  1 
ATOM   4628 C C   . TRP B 1 56  ? 2.347   4.942   -72.984 1.00 54.76  ? 56   TRP B C   1 
ATOM   4629 O O   . TRP B 1 56  ? 1.864   6.085   -72.961 1.00 56.03  ? 56   TRP B O   1 
ATOM   4630 C CB  . TRP B 1 56  ? 2.920   3.750   -70.852 1.00 45.71  ? 56   TRP B CB  1 
ATOM   4631 C CG  . TRP B 1 56  ? 2.006   4.561   -70.015 1.00 54.73  ? 56   TRP B CG  1 
ATOM   4632 C CD1 . TRP B 1 56  ? 0.673   4.787   -70.231 1.00 53.85  ? 56   TRP B CD1 1 
ATOM   4633 C CD2 . TRP B 1 56  ? 2.351   5.279   -68.825 1.00 57.46  ? 56   TRP B CD2 1 
ATOM   4634 N NE1 . TRP B 1 56  ? 0.168   5.599   -69.242 1.00 60.38  ? 56   TRP B NE1 1 
ATOM   4635 C CE2 . TRP B 1 56  ? 1.176   5.915   -68.365 1.00 60.58  ? 56   TRP B CE2 1 
ATOM   4636 C CE3 . TRP B 1 56  ? 3.539   5.439   -68.099 1.00 51.58  ? 56   TRP B CE3 1 
ATOM   4637 C CZ2 . TRP B 1 56  ? 1.153   6.703   -67.206 1.00 52.38  ? 56   TRP B CZ2 1 
ATOM   4638 C CZ3 . TRP B 1 56  ? 3.516   6.224   -66.955 1.00 56.18  ? 56   TRP B CZ3 1 
ATOM   4639 C CH2 . TRP B 1 56  ? 2.326   6.848   -66.520 1.00 51.40  ? 56   TRP B CH2 1 
ATOM   4640 N N   . SER B 1 57  ? 1.932   3.987   -73.812 1.00 51.03  ? 57   SER B N   1 
ATOM   4641 C CA  . SER B 1 57  ? 0.910   4.214   -74.824 1.00 53.22  ? 57   SER B CA  1 
ATOM   4642 C C   . SER B 1 57  ? -0.456  3.877   -74.240 1.00 54.42  ? 57   SER B C   1 
ATOM   4643 O O   . SER B 1 57  ? -0.539  3.079   -73.304 1.00 52.77  ? 57   SER B O   1 
ATOM   4644 C CB  . SER B 1 57  ? 1.176   3.315   -76.032 1.00 55.34  ? 57   SER B CB  1 
ATOM   4645 O OG  . SER B 1 57  ? 1.005   1.935   -75.698 1.00 55.62  ? 57   SER B OG  1 
ATOM   4646 N N   . GLY B 1 58  ? -1.524  4.471   -74.781 1.00 46.20  ? 58   GLY B N   1 
ATOM   4647 C CA  . GLY B 1 58  ? -2.874  4.130   -74.349 1.00 44.99  ? 58   GLY B CA  1 
ATOM   4648 C C   . GLY B 1 58  ? -3.231  4.477   -72.902 1.00 55.58  ? 58   GLY B C   1 
ATOM   4649 O O   . GLY B 1 58  ? -2.639  5.389   -72.292 1.00 47.62  ? 58   GLY B O   1 
ATOM   4650 N N   . VAL B 1 59  ? -4.217  3.758   -72.360 1.00 53.16  ? 59   VAL B N   1 
ATOM   4651 C CA  . VAL B 1 59  ? -4.680  3.995   -70.996 1.00 49.17  ? 59   VAL B CA  1 
ATOM   4652 C C   . VAL B 1 59  ? -4.190  2.924   -70.023 1.00 57.53  ? 59   VAL B C   1 
ATOM   4653 O O   . VAL B 1 59  ? -4.651  1.769   -70.053 1.00 56.89  ? 59   VAL B O   1 
ATOM   4654 C CB  . VAL B 1 59  ? -6.216  4.108   -70.922 1.00 58.16  ? 59   VAL B CB  1 
ATOM   4655 C CG1 . VAL B 1 59  ? -6.684  4.344   -69.473 1.00 52.06  ? 59   VAL B CG1 1 
ATOM   4656 C CG2 . VAL B 1 59  ? -6.697  5.230   -71.842 1.00 51.28  ? 59   VAL B CG2 1 
ATOM   4657 N N   . LEU B 1 60  ? -3.249  3.326   -69.165 1.00 58.00  ? 60   LEU B N   1 
ATOM   4658 C CA  . LEU B 1 60  ? -2.705  2.458   -68.129 1.00 51.66  ? 60   LEU B CA  1 
ATOM   4659 C C   . LEU B 1 60  ? -3.757  2.198   -67.069 1.00 45.92  ? 60   LEU B C   1 
ATOM   4660 O O   . LEU B 1 60  ? -4.375  3.122   -66.546 1.00 52.45  ? 60   LEU B O   1 
ATOM   4661 C CB  . LEU B 1 60  ? -1.459  3.084   -67.499 1.00 58.42  ? 60   LEU B CB  1 
ATOM   4662 C CG  . LEU B 1 60  ? -0.625  2.165   -66.599 1.00 63.17  ? 60   LEU B CG  1 
ATOM   4663 C CD1 . LEU B 1 60  ? -0.470  0.793   -67.250 1.00 63.86  ? 60   LEU B CD1 1 
ATOM   4664 C CD2 . LEU B 1 60  ? 0.748   2.776   -66.342 1.00 58.71  ? 60   LEU B CD2 1 
ATOM   4665 N N   . ASP B 1 61  ? -3.970  0.930   -66.761 1.00 49.03  ? 61   ASP B N   1 
ATOM   4666 C CA  . ASP B 1 61  ? -4.945  0.578   -65.754 1.00 50.39  ? 61   ASP B CA  1 
ATOM   4667 C C   . ASP B 1 61  ? -4.382  0.830   -64.350 1.00 57.65  ? 61   ASP B C   1 
ATOM   4668 O O   . ASP B 1 61  ? -3.363  0.251   -63.955 1.00 63.68  ? 61   ASP B O   1 
ATOM   4669 C CB  . ASP B 1 61  ? -5.357  -0.879  -65.897 1.00 50.86  ? 61   ASP B CB  1 
ATOM   4670 C CG  . ASP B 1 61  ? -6.105  -1.382  -64.676 1.00 69.21  ? 61   ASP B CG  1 
ATOM   4671 O OD1 . ASP B 1 61  ? -7.314  -1.069  -64.577 1.00 70.32  ? 61   ASP B OD1 1 
ATOM   4672 O OD2 . ASP B 1 61  ? -5.485  -2.065  -63.815 1.00 68.28  ? 61   ASP B OD2 1 
ATOM   4673 N N   . ALA B 1 62  ? -5.048  1.704   -63.601 1.00 58.18  ? 62   ALA B N   1 
ATOM   4674 C CA  . ALA B 1 62  ? -4.606  2.067   -62.251 1.00 55.24  ? 62   ALA B CA  1 
ATOM   4675 C C   . ALA B 1 62  ? -5.744  1.881   -61.270 1.00 50.85  ? 62   ALA B C   1 
ATOM   4676 O O   . ALA B 1 62  ? -6.154  2.832   -60.608 1.00 53.21  ? 62   ALA B O   1 
ATOM   4677 C CB  . ALA B 1 62  ? -4.107  3.515   -62.206 1.00 42.94  ? 62   ALA B CB  1 
ATOM   4678 N N   . THR B 1 63  ? -6.255  0.658   -61.181 1.00 47.90  ? 63   THR B N   1 
ATOM   4679 C CA  . THR B 1 63  ? -7.458  0.399   -60.394 1.00 48.73  ? 63   THR B CA  1 
ATOM   4680 C C   . THR B 1 63  ? -7.168  -0.617  -59.313 1.00 50.03  ? 63   THR B C   1 
ATOM   4681 O O   . THR B 1 63  ? -8.061  -0.983  -58.531 1.00 53.69  ? 63   THR B O   1 
ATOM   4682 C CB  . THR B 1 63  ? -8.640  -0.115  -61.271 1.00 57.10  ? 63   THR B CB  1 
ATOM   4683 O OG1 . THR B 1 63  ? -8.360  -1.441  -61.753 1.00 50.89  ? 63   THR B OG1 1 
ATOM   4684 C CG2 . THR B 1 63  ? -8.889  0.824   -62.456 1.00 52.72  ? 63   THR B CG2 1 
ATOM   4685 N N   . THR B 1 64  ? -5.913  -1.060  -59.262 1.00 49.18  ? 64   THR B N   1 
ATOM   4686 C CA  . THR B 1 64  ? -5.521  -2.109  -58.337 1.00 49.15  ? 64   THR B CA  1 
ATOM   4687 C C   . THR B 1 64  ? -4.103  -1.878  -57.785 1.00 48.22  ? 64   THR B C   1 
ATOM   4688 O O   . THR B 1 64  ? -3.254  -1.273  -58.448 1.00 48.68  ? 64   THR B O   1 
ATOM   4689 C CB  . THR B 1 64  ? -5.648  -3.495  -59.021 1.00 53.95  ? 64   THR B CB  1 
ATOM   4690 O OG1 . THR B 1 64  ? -5.522  -4.534  -58.045 1.00 64.11  ? 64   THR B OG1 1 
ATOM   4691 C CG2 . THR B 1 64  ? -4.579  -3.664  -60.096 1.00 51.23  ? 64   THR B CG2 1 
ATOM   4692 N N   . PHE B 1 65  ? -3.865  -2.342  -56.560 1.00 45.78  ? 65   PHE B N   1 
ATOM   4693 C CA  . PHE B 1 65  ? -2.550  -2.253  -55.939 1.00 49.72  ? 65   PHE B CA  1 
ATOM   4694 C C   . PHE B 1 65  ? -1.533  -3.094  -56.675 1.00 50.41  ? 65   PHE B C   1 
ATOM   4695 O O   . PHE B 1 65  ? -1.797  -4.241  -57.047 1.00 51.09  ? 65   PHE B O   1 
ATOM   4696 C CB  . PHE B 1 65  ? -2.613  -2.727  -54.486 1.00 50.84  ? 65   PHE B CB  1 
ATOM   4697 C CG  . PHE B 1 65  ? -3.113  -1.685  -53.547 1.00 52.86  ? 65   PHE B CG  1 
ATOM   4698 C CD1 . PHE B 1 65  ? -2.554  -0.409  -53.557 1.00 48.49  ? 65   PHE B CD1 1 
ATOM   4699 C CD2 . PHE B 1 65  ? -4.166  -1.957  -52.676 1.00 48.02  ? 65   PHE B CD2 1 
ATOM   4700 C CE1 . PHE B 1 65  ? -3.026  0.575   -52.703 1.00 46.32  ? 65   PHE B CE1 1 
ATOM   4701 C CE2 . PHE B 1 65  ? -4.639  -0.981  -51.809 1.00 47.68  ? 65   PHE B CE2 1 
ATOM   4702 C CZ  . PHE B 1 65  ? -4.070  0.287   -51.826 1.00 50.82  ? 65   PHE B CZ  1 
ATOM   4703 N N   . GLN B 1 66  ? -0.352  -2.537  -56.872 1.00 50.51  ? 66   GLN B N   1 
ATOM   4704 C CA  . GLN B 1 66  ? 0.713   -3.310  -57.488 1.00 50.65  ? 66   GLN B CA  1 
ATOM   4705 C C   . GLN B 1 66  ? 1.473   -4.202  -56.486 1.00 48.22  ? 66   GLN B C   1 
ATOM   4706 O O   . GLN B 1 66  ? 1.060   -4.358  -55.335 1.00 45.49  ? 66   GLN B O   1 
ATOM   4707 C CB  . GLN B 1 66  ? 1.643   -2.385  -58.255 1.00 44.02  ? 66   GLN B CB  1 
ATOM   4708 C CG  . GLN B 1 66  ? 1.248   -2.244  -59.692 1.00 54.99  ? 66   GLN B CG  1 
ATOM   4709 C CD  . GLN B 1 66  ? 1.683   -3.453  -60.503 1.00 62.58  ? 66   GLN B CD  1 
ATOM   4710 O OE1 . GLN B 1 66  ? 2.204   -4.435  -59.954 1.00 64.87  ? 66   GLN B OE1 1 
ATOM   4711 N NE2 . GLN B 1 66  ? 1.491   -3.384  -61.812 1.00 49.70  ? 66   GLN B NE2 1 
ATOM   4712 N N   . ASN B 1 67  ? 2.569   -4.802  -56.937 1.00 52.69  ? 67   ASN B N   1 
ATOM   4713 C CA  . ASN B 1 67  ? 3.302   -5.752  -56.109 1.00 46.36  ? 67   ASN B CA  1 
ATOM   4714 C C   . ASN B 1 67  ? 4.031   -5.109  -54.929 1.00 46.01  ? 67   ASN B C   1 
ATOM   4715 O O   . ASN B 1 67  ? 4.491   -3.963  -55.003 1.00 47.66  ? 67   ASN B O   1 
ATOM   4716 C CB  . ASN B 1 67  ? 4.302   -6.550  -56.957 1.00 53.00  ? 67   ASN B CB  1 
ATOM   4717 C CG  . ASN B 1 67  ? 3.627   -7.587  -57.845 1.00 60.59  ? 67   ASN B CG  1 
ATOM   4718 O OD1 . ASN B 1 67  ? 2.530   -8.076  -57.538 1.00 53.21  ? 67   ASN B OD1 1 
ATOM   4719 N ND2 . ASN B 1 67  ? 4.289   -7.938  -58.945 1.00 58.64  ? 67   ASN B ND2 1 
ATOM   4720 N N   . VAL B 1 68  ? 4.123   -5.865  -53.843 1.00 40.33  ? 68   VAL B N   1 
ATOM   4721 C CA  . VAL B 1 68  ? 4.878   -5.476  -52.669 1.00 42.44  ? 68   VAL B CA  1 
ATOM   4722 C C   . VAL B 1 68  ? 6.363   -5.698  -52.947 1.00 43.34  ? 68   VAL B C   1 
ATOM   4723 O O   . VAL B 1 68  ? 6.744   -6.743  -53.499 1.00 42.49  ? 68   VAL B O   1 
ATOM   4724 C CB  . VAL B 1 68  ? 4.420   -6.324  -51.464 1.00 41.98  ? 68   VAL B CB  1 
ATOM   4725 C CG1 . VAL B 1 68  ? 5.326   -6.133  -50.282 1.00 44.20  ? 68   VAL B CG1 1 
ATOM   4726 C CG2 . VAL B 1 68  ? 2.991   -5.979  -51.109 1.00 43.92  ? 68   VAL B CG2 1 
ATOM   4727 N N   . CYS B 1 69  ? 7.195   -4.721  -52.580 1.00 41.47  ? 69   CYS B N   1 
ATOM   4728 C CA  . CYS B 1 69  ? 8.652   -4.824  -52.748 1.00 39.58  ? 69   CYS B CA  1 
ATOM   4729 C C   . CYS B 1 69  ? 9.197   -6.049  -52.032 1.00 42.55  ? 69   CYS B C   1 
ATOM   4730 O O   . CYS B 1 69  ? 8.791   -6.342  -50.902 1.00 44.22  ? 69   CYS B O   1 
ATOM   4731 C CB  . CYS B 1 69  ? 9.339   -3.570  -52.209 1.00 42.65  ? 69   CYS B CB  1 
ATOM   4732 S SG  . CYS B 1 69  ? 9.265   -2.155  -53.332 1.00 52.81  ? 69   CYS B SG  1 
ATOM   4733 N N   . TYR B 1 70  ? 10.121  -6.758  -52.678 1.00 47.47  ? 70   TYR B N   1 
ATOM   4734 C CA  . TYR B 1 70  ? 10.604  -8.033  -52.137 1.00 48.74  ? 70   TYR B CA  1 
ATOM   4735 C C   . TYR B 1 70  ? 11.210  -7.896  -50.727 1.00 45.08  ? 70   TYR B C   1 
ATOM   4736 O O   . TYR B 1 70  ? 12.121  -7.083  -50.503 1.00 42.40  ? 70   TYR B O   1 
ATOM   4737 C CB  . TYR B 1 70  ? 11.586  -8.732  -53.101 1.00 53.11  ? 70   TYR B CB  1 
ATOM   4738 C CG  . TYR B 1 70  ? 11.510  -10.237 -52.954 1.00 54.20  ? 70   TYR B CG  1 
ATOM   4739 C CD1 . TYR B 1 70  ? 10.597  -10.977 -53.695 1.00 54.69  ? 70   TYR B CD1 1 
ATOM   4740 C CD2 . TYR B 1 70  ? 12.305  -10.910 -52.030 1.00 52.15  ? 70   TYR B CD2 1 
ATOM   4741 C CE1 . TYR B 1 70  ? 10.492  -12.351 -53.543 1.00 57.92  ? 70   TYR B CE1 1 
ATOM   4742 C CE2 . TYR B 1 70  ? 12.206  -12.284 -51.869 1.00 60.47  ? 70   TYR B CE2 1 
ATOM   4743 C CZ  . TYR B 1 70  ? 11.294  -13.000 -52.629 1.00 59.94  ? 70   TYR B CZ  1 
ATOM   4744 O OH  . TYR B 1 70  ? 11.181  -14.366 -52.474 1.00 54.33  ? 70   TYR B OH  1 
ATOM   4745 N N   . GLN B 1 71  ? 10.704  -8.694  -49.787 1.00 47.86  ? 71   GLN B N   1 
ATOM   4746 C CA  . GLN B 1 71  ? 11.061  -8.528  -48.373 1.00 49.84  ? 71   GLN B CA  1 
ATOM   4747 C C   . GLN B 1 71  ? 10.856  -9.802  -47.539 1.00 55.63  ? 71   GLN B C   1 
ATOM   4748 O O   . GLN B 1 71  ? 10.064  -10.677 -47.918 1.00 50.35  ? 71   GLN B O   1 
ATOM   4749 C CB  . GLN B 1 71  ? 10.210  -7.401  -47.767 1.00 44.66  ? 71   GLN B CB  1 
ATOM   4750 C CG  . GLN B 1 71  ? 8.728   -7.752  -47.672 1.00 45.98  ? 71   GLN B CG  1 
ATOM   4751 C CD  . GLN B 1 71  ? 7.856   -6.539  -47.412 1.00 47.53  ? 71   GLN B CD  1 
ATOM   4752 O OE1 . GLN B 1 71  ? 7.181   -6.458  -46.389 1.00 45.54  ? 71   GLN B OE1 1 
ATOM   4753 N NE2 . GLN B 1 71  ? 7.864   -5.589  -48.344 1.00 44.94  ? 71   GLN B NE2 1 
ATOM   4754 N N   . TYR B 1 72  ? 11.552  -9.890  -46.400 1.00 49.85  ? 72   TYR B N   1 
ATOM   4755 C CA  . TYR B 1 72  ? 11.279  -10.918 -45.391 1.00 51.88  ? 72   TYR B CA  1 
ATOM   4756 C C   . TYR B 1 72  ? 9.781   -10.928 -45.013 1.00 49.64  ? 72   TYR B C   1 
ATOM   4757 O O   . TYR B 1 72  ? 9.142   -9.874  -44.957 1.00 58.75  ? 72   TYR B O   1 
ATOM   4758 C CB  . TYR B 1 72  ? 12.162  -10.672 -44.147 1.00 60.69  ? 72   TYR B CB  1 
ATOM   4759 C CG  . TYR B 1 72  ? 11.891  -11.595 -42.966 1.00 69.41  ? 72   TYR B CG  1 
ATOM   4760 C CD1 . TYR B 1 72  ? 12.561  -12.811 -42.835 1.00 63.54  ? 72   TYR B CD1 1 
ATOM   4761 C CD2 . TYR B 1 72  ? 10.970  -11.243 -41.973 1.00 64.38  ? 72   TYR B CD2 1 
ATOM   4762 C CE1 . TYR B 1 72  ? 12.317  -13.658 -41.747 1.00 66.42  ? 72   TYR B CE1 1 
ATOM   4763 C CE2 . TYR B 1 72  ? 10.719  -12.081 -40.892 1.00 67.10  ? 72   TYR B CE2 1 
ATOM   4764 C CZ  . TYR B 1 72  ? 11.396  -13.285 -40.780 1.00 68.75  ? 72   TYR B CZ  1 
ATOM   4765 O OH  . TYR B 1 72  ? 11.132  -14.109 -39.703 1.00 79.98  ? 72   TYR B OH  1 
ATOM   4766 N N   . VAL B 1 73  ? 9.217   -12.110 -44.774 1.00 55.70  ? 73   VAL B N   1 
ATOM   4767 C CA  . VAL B 1 73  ? 7.823   -12.228 -44.318 1.00 56.52  ? 73   VAL B CA  1 
ATOM   4768 C C   . VAL B 1 73  ? 7.749   -12.887 -42.937 1.00 63.35  ? 73   VAL B C   1 
ATOM   4769 O O   . VAL B 1 73  ? 8.294   -13.977 -42.741 1.00 67.95  ? 73   VAL B O   1 
ATOM   4770 C CB  . VAL B 1 73  ? 6.955   -13.053 -45.293 1.00 55.45  ? 73   VAL B CB  1 
ATOM   4771 C CG1 . VAL B 1 73  ? 5.559   -13.236 -44.725 1.00 51.76  ? 73   VAL B CG1 1 
ATOM   4772 C CG2 . VAL B 1 73  ? 6.903   -12.400 -46.667 1.00 54.31  ? 73   VAL B CG2 1 
ATOM   4773 N N   . ASP B 1 74  ? 7.057   -12.243 -41.992 1.00 73.50  ? 74   ASP B N   1 
ATOM   4774 C CA  . ASP B 1 74  ? 7.048   -12.703 -40.601 1.00 64.77  ? 74   ASP B CA  1 
ATOM   4775 C C   . ASP B 1 74  ? 6.321   -14.027 -40.373 1.00 62.45  ? 74   ASP B C   1 
ATOM   4776 O O   . ASP B 1 74  ? 5.220   -14.243 -40.870 1.00 66.62  ? 74   ASP B O   1 
ATOM   4777 C CB  . ASP B 1 74  ? 6.486   -11.643 -39.651 1.00 67.63  ? 74   ASP B CB  1 
ATOM   4778 C CG  . ASP B 1 74  ? 6.685   -12.024 -38.197 1.00 71.36  ? 74   ASP B CG  1 
ATOM   4779 O OD1 . ASP B 1 74  ? 7.858   -12.006 -37.755 1.00 69.86  ? 74   ASP B OD1 1 
ATOM   4780 O OD2 . ASP B 1 74  ? 5.689   -12.379 -37.516 1.00 73.42  ? 74   ASP B OD2 1 
ATOM   4781 N N   . THR B 1 75  ? 6.949   -14.897 -39.590 1.00 69.74  ? 75   THR B N   1 
ATOM   4782 C CA  . THR B 1 75  ? 6.445   -16.248 -39.361 1.00 71.53  ? 75   THR B CA  1 
ATOM   4783 C C   . THR B 1 75  ? 6.352   -16.592 -37.872 1.00 68.42  ? 75   THR B C   1 
ATOM   4784 O O   . THR B 1 75  ? 6.057   -17.733 -37.515 1.00 68.18  ? 75   THR B O   1 
ATOM   4785 C CB  . THR B 1 75  ? 7.329   -17.289 -40.085 1.00 65.76  ? 75   THR B CB  1 
ATOM   4786 O OG1 . THR B 1 75  ? 8.714   -17.042 -39.784 1.00 67.01  ? 75   THR B OG1 1 
ATOM   4787 C CG2 . THR B 1 75  ? 7.112   -17.212 -41.607 1.00 56.47  ? 75   THR B CG2 1 
ATOM   4788 N N   . LEU B 1 76  ? 6.581   -15.593 -37.019 1.00 68.47  ? 76   LEU B N   1 
ATOM   4789 C CA  . LEU B 1 76  ? 6.584   -15.783 -35.569 1.00 70.73  ? 76   LEU B CA  1 
ATOM   4790 C C   . LEU B 1 76  ? 5.256   -16.326 -35.019 1.00 73.51  ? 76   LEU B C   1 
ATOM   4791 O O   . LEU B 1 76  ? 5.239   -17.339 -34.314 1.00 76.30  ? 76   LEU B O   1 
ATOM   4792 C CB  . LEU B 1 76  ? 6.945   -14.476 -34.859 1.00 71.17  ? 76   LEU B CB  1 
ATOM   4793 C CG  . LEU B 1 76  ? 7.187   -14.568 -33.345 1.00 77.10  ? 76   LEU B CG  1 
ATOM   4794 C CD1 . LEU B 1 76  ? 8.488   -15.315 -33.058 1.00 69.19  ? 76   LEU B CD1 1 
ATOM   4795 C CD2 . LEU B 1 76  ? 7.203   -13.186 -32.703 1.00 67.97  ? 76   LEU B CD2 1 
ATOM   4796 N N   . TYR B 1 77  ? 4.153   -15.648 -35.318 1.00 63.59  ? 77   TYR B N   1 
ATOM   4797 C CA  . TYR B 1 77  ? 2.844   -16.114 -34.865 1.00 63.50  ? 77   TYR B CA  1 
ATOM   4798 C C   . TYR B 1 77  ? 1.923   -16.358 -36.063 1.00 69.40  ? 77   TYR B C   1 
ATOM   4799 O O   . TYR B 1 77  ? 1.056   -15.527 -36.369 1.00 65.74  ? 77   TYR B O   1 
ATOM   4800 C CB  . TYR B 1 77  ? 2.195   -15.110 -33.909 1.00 68.04  ? 77   TYR B CB  1 
ATOM   4801 C CG  . TYR B 1 77  ? 2.900   -14.925 -32.581 1.00 71.38  ? 77   TYR B CG  1 
ATOM   4802 C CD1 . TYR B 1 77  ? 2.820   -15.892 -31.587 1.00 72.44  ? 77   TYR B CD1 1 
ATOM   4803 C CD2 . TYR B 1 77  ? 3.622   -13.764 -32.307 1.00 73.84  ? 77   TYR B CD2 1 
ATOM   4804 C CE1 . TYR B 1 77  ? 3.459   -15.720 -30.357 1.00 76.07  ? 77   TYR B CE1 1 
ATOM   4805 C CE2 . TYR B 1 77  ? 4.259   -13.578 -31.078 1.00 72.72  ? 77   TYR B CE2 1 
ATOM   4806 C CZ  . TYR B 1 77  ? 4.177   -14.561 -30.112 1.00 79.70  ? 77   TYR B CZ  1 
ATOM   4807 O OH  . TYR B 1 77  ? 4.803   -14.391 -28.898 1.00 73.36  ? 77   TYR B OH  1 
ATOM   4808 N N   . PRO B 1 78  ? 2.109   -17.507 -36.739 1.00 73.09  ? 78   PRO B N   1 
ATOM   4809 C CA  . PRO B 1 78  ? 1.419   -17.844 -37.992 1.00 70.63  ? 78   PRO B CA  1 
ATOM   4810 C C   . PRO B 1 78  ? -0.097  -17.867 -37.818 1.00 65.90  ? 78   PRO B C   1 
ATOM   4811 O O   . PRO B 1 78  ? -0.587  -18.594 -36.951 1.00 67.70  ? 78   PRO B O   1 
ATOM   4812 C CB  . PRO B 1 78  ? 1.947   -19.252 -38.309 1.00 69.05  ? 78   PRO B CB  1 
ATOM   4813 C CG  . PRO B 1 78  ? 3.279   -19.338 -37.586 1.00 66.58  ? 78   PRO B CG  1 
ATOM   4814 C CD  . PRO B 1 78  ? 3.026   -18.583 -36.311 1.00 69.76  ? 78   PRO B CD  1 
ATOM   4815 N N   . GLY B 1 79  ? -0.818  -17.069 -38.609 1.00 63.28  ? 79   GLY B N   1 
ATOM   4816 C CA  . GLY B 1 79  ? -2.269  -16.993 -38.505 1.00 65.56  ? 79   GLY B CA  1 
ATOM   4817 C C   . GLY B 1 79  ? -2.823  -15.970 -37.520 1.00 70.85  ? 79   GLY B C   1 
ATOM   4818 O O   . GLY B 1 79  ? -4.042  -15.805 -37.415 1.00 62.75  ? 79   GLY B O   1 
ATOM   4819 N N   . PHE B 1 80  ? -1.927  -15.295 -36.797 1.00 70.50  ? 80   PHE B N   1 
ATOM   4820 C CA  . PHE B 1 80  ? -2.283  -14.266 -35.817 1.00 64.72  ? 80   PHE B CA  1 
ATOM   4821 C C   . PHE B 1 80  ? -2.424  -12.920 -36.520 1.00 65.10  ? 80   PHE B C   1 
ATOM   4822 O O   . PHE B 1 80  ? -1.527  -12.505 -37.255 1.00 69.69  ? 80   PHE B O   1 
ATOM   4823 C CB  . PHE B 1 80  ? -1.188  -14.195 -34.745 1.00 66.54  ? 80   PHE B CB  1 
ATOM   4824 C CG  . PHE B 1 80  ? -1.421  -13.158 -33.678 1.00 63.92  ? 80   PHE B CG  1 
ATOM   4825 C CD1 . PHE B 1 80  ? -2.659  -13.030 -33.063 1.00 69.81  ? 80   PHE B CD1 1 
ATOM   4826 C CD2 . PHE B 1 80  ? -0.385  -12.337 -33.258 1.00 67.27  ? 80   PHE B CD2 1 
ATOM   4827 C CE1 . PHE B 1 80  ? -2.866  -12.086 -32.062 1.00 61.93  ? 80   PHE B CE1 1 
ATOM   4828 C CE2 . PHE B 1 80  ? -0.584  -11.395 -32.260 1.00 64.91  ? 80   PHE B CE2 1 
ATOM   4829 C CZ  . PHE B 1 80  ? -1.829  -11.274 -31.660 1.00 63.38  ? 80   PHE B CZ  1 
ATOM   4830 N N   . GLU B 1 81  ? -3.536  -12.229 -36.300 1.00 62.61  ? 81   GLU B N   1 
ATOM   4831 C CA  . GLU B 1 81  ? -3.805  -11.024 -37.081 1.00 69.68  ? 81   GLU B CA  1 
ATOM   4832 C C   . GLU B 1 81  ? -2.963  -9.831  -36.628 1.00 71.23  ? 81   GLU B C   1 
ATOM   4833 O O   . GLU B 1 81  ? -2.739  -8.893  -37.393 1.00 73.92  ? 81   GLU B O   1 
ATOM   4834 C CB  . GLU B 1 81  ? -5.298  -10.690 -37.073 1.00 68.41  ? 81   GLU B CB  1 
ATOM   4835 C CG  . GLU B 1 81  ? -5.707  -9.685  -36.019 1.00 83.14  ? 81   GLU B CG  1 
ATOM   4836 C CD  . GLU B 1 81  ? -5.968  -8.303  -36.606 1.00 98.07  ? 81   GLU B CD  1 
ATOM   4837 O OE1 . GLU B 1 81  ? -6.368  -8.232  -37.794 1.00 104.16 ? 81   GLU B OE1 1 
ATOM   4838 O OE2 . GLU B 1 81  ? -5.783  -7.294  -35.881 1.00 90.28  ? 81   GLU B OE2 1 
ATOM   4839 N N   . GLY B 1 82  ? -2.488  -9.881  -35.387 1.00 68.60  ? 82   GLY B N   1 
ATOM   4840 C CA  . GLY B 1 82  ? -1.633  -8.838  -34.853 1.00 65.51  ? 82   GLY B CA  1 
ATOM   4841 C C   . GLY B 1 82  ? -0.289  -8.738  -35.555 1.00 63.05  ? 82   GLY B C   1 
ATOM   4842 O O   . GLY B 1 82  ? 0.277   -7.648  -35.633 1.00 60.64  ? 82   GLY B O   1 
ATOM   4843 N N   . THR B 1 83  ? 0.231   -9.865  -36.048 1.00 62.30  ? 83   THR B N   1 
ATOM   4844 C CA  . THR B 1 83  ? 1.476   -9.859  -36.821 1.00 62.70  ? 83   THR B CA  1 
ATOM   4845 C C   . THR B 1 83  ? 1.225   -9.786  -38.329 1.00 61.74  ? 83   THR B C   1 
ATOM   4846 O O   . THR B 1 83  ? 2.031   -9.221  -39.080 1.00 62.23  ? 83   THR B O   1 
ATOM   4847 C CB  . THR B 1 83  ? 2.377   -11.097 -36.539 1.00 66.87  ? 83   THR B CB  1 
ATOM   4848 O OG1 . THR B 1 83  ? 1.593   -12.300 -36.568 1.00 68.54  ? 83   THR B OG1 1 
ATOM   4849 C CG2 . THR B 1 83  ? 3.073   -10.971 -35.199 1.00 64.56  ? 83   THR B CG2 1 
ATOM   4850 N N   . GLU B 1 84  ? 0.115   -10.364 -38.774 1.00 62.25  ? 84   GLU B N   1 
ATOM   4851 C CA  . GLU B 1 84  ? -0.091  -10.555 -40.207 1.00 68.70  ? 84   GLU B CA  1 
ATOM   4852 C C   . GLU B 1 84  ? -0.745  -9.359  -40.867 1.00 62.99  ? 84   GLU B C   1 
ATOM   4853 O O   . GLU B 1 84  ? -0.882  -9.308  -42.088 1.00 62.83  ? 84   GLU B O   1 
ATOM   4854 C CB  . GLU B 1 84  ? -0.859  -11.849 -40.492 1.00 64.81  ? 84   GLU B CB  1 
ATOM   4855 C CG  . GLU B 1 84  ? -0.105  -13.078 -40.015 1.00 72.14  ? 84   GLU B CG  1 
ATOM   4856 C CD  . GLU B 1 84  ? -0.398  -14.314 -40.839 1.00 84.18  ? 84   GLU B CD  1 
ATOM   4857 O OE1 . GLU B 1 84  ? -0.734  -14.155 -42.034 1.00 95.92  ? 84   GLU B OE1 1 
ATOM   4858 O OE2 . GLU B 1 84  ? -0.279  -15.440 -40.298 1.00 74.26  ? 84   GLU B OE2 1 
ATOM   4859 N N   . MET B 1 85  ? -1.137  -8.387  -40.052 1.00 64.56  ? 85   MET B N   1 
ATOM   4860 C CA  . MET B 1 85  ? -1.681  -7.134  -40.568 1.00 56.74  ? 85   MET B CA  1 
ATOM   4861 C C   . MET B 1 85  ? -0.548  -6.302  -41.175 1.00 58.61  ? 85   MET B C   1 
ATOM   4862 O O   . MET B 1 85  ? -0.796  -5.345  -41.935 1.00 52.44  ? 85   MET B O   1 
ATOM   4863 C CB  . MET B 1 85  ? -2.376  -6.365  -39.446 1.00 59.37  ? 85   MET B CB  1 
ATOM   4864 C CG  . MET B 1 85  ? -1.446  -5.981  -38.299 1.00 60.29  ? 85   MET B CG  1 
ATOM   4865 S SD  . MET B 1 85  ? -2.310  -5.148  -36.952 1.00 64.84  ? 85   MET B SD  1 
ATOM   4866 C CE  . MET B 1 85  ? -2.910  -3.678  -37.772 1.00 46.74  ? 85   MET B CE  1 
ATOM   4867 N N   . TRP B 1 86  ? 0.689   -6.688  -40.839 1.00 50.86  ? 86   TRP B N   1 
ATOM   4868 C CA  . TRP B 1 86  ? 1.885   -6.012  -41.325 1.00 54.57  ? 86   TRP B CA  1 
ATOM   4869 C C   . TRP B 1 86  ? 2.560   -6.798  -42.451 1.00 53.21  ? 86   TRP B C   1 
ATOM   4870 O O   . TRP B 1 86  ? 3.497   -6.303  -43.085 1.00 48.70  ? 86   TRP B O   1 
ATOM   4871 C CB  . TRP B 1 86  ? 2.871   -5.771  -40.172 1.00 47.42  ? 86   TRP B CB  1 
ATOM   4872 C CG  . TRP B 1 86  ? 2.241   -5.110  -38.976 1.00 55.10  ? 86   TRP B CG  1 
ATOM   4873 C CD1 . TRP B 1 86  ? 1.979   -5.686  -37.766 1.00 52.05  ? 86   TRP B CD1 1 
ATOM   4874 C CD2 . TRP B 1 86  ? 1.778   -3.750  -38.880 1.00 50.60  ? 86   TRP B CD2 1 
ATOM   4875 N NE1 . TRP B 1 86  ? 1.389   -4.771  -36.924 1.00 51.53  ? 86   TRP B NE1 1 
ATOM   4876 C CE2 . TRP B 1 86  ? 1.257   -3.575  -37.580 1.00 52.69  ? 86   TRP B CE2 1 
ATOM   4877 C CE3 . TRP B 1 86  ? 1.761   -2.664  -39.764 1.00 48.84  ? 86   TRP B CE3 1 
ATOM   4878 C CZ2 . TRP B 1 86  ? 0.719   -2.354  -37.140 1.00 57.11  ? 86   TRP B CZ2 1 
ATOM   4879 C CZ3 . TRP B 1 86  ? 1.231   -1.444  -39.326 1.00 48.21  ? 86   TRP B CZ3 1 
ATOM   4880 C CH2 . TRP B 1 86  ? 0.716   -1.304  -38.027 1.00 48.28  ? 86   TRP B CH2 1 
ATOM   4881 N N   . ASN B 1 87  ? 2.101   -8.027  -42.685 1.00 55.92  ? 87   ASN B N   1 
ATOM   4882 C CA  . ASN B 1 87  ? 2.658   -8.862  -43.751 1.00 51.96  ? 87   ASN B CA  1 
ATOM   4883 C C   . ASN B 1 87  ? 2.176   -8.411  -45.132 1.00 47.86  ? 87   ASN B C   1 
ATOM   4884 O O   . ASN B 1 87  ? 1.127   -7.765  -45.237 1.00 49.54  ? 87   ASN B O   1 
ATOM   4885 C CB  . ASN B 1 87  ? 2.302   -10.325 -43.509 1.00 53.26  ? 87   ASN B CB  1 
ATOM   4886 C CG  . ASN B 1 87  ? 3.300   -11.031 -42.607 1.00 60.48  ? 87   ASN B CG  1 
ATOM   4887 O OD1 . ASN B 1 87  ? 4.499   -10.711 -42.599 1.00 54.94  ? 87   ASN B OD1 1 
ATOM   4888 N ND2 . ASN B 1 87  ? 2.810   -12.011 -41.847 1.00 63.49  ? 87   ASN B ND2 1 
ATOM   4889 N N   . PRO B 1 88  ? 2.951   -8.722  -46.193 1.00 49.71  ? 88   PRO B N   1 
ATOM   4890 C CA  . PRO B 1 88  ? 2.513   -8.348  -47.550 1.00 53.12  ? 88   PRO B CA  1 
ATOM   4891 C C   . PRO B 1 88  ? 1.112   -8.879  -47.886 1.00 52.76  ? 88   PRO B C   1 
ATOM   4892 O O   . PRO B 1 88  ? 0.799   -10.034 -47.569 1.00 53.93  ? 88   PRO B O   1 
ATOM   4893 C CB  . PRO B 1 88  ? 3.566   -9.002  -48.456 1.00 45.27  ? 88   PRO B CB  1 
ATOM   4894 C CG  . PRO B 1 88  ? 4.806   -9.073  -47.606 1.00 45.40  ? 88   PRO B CG  1 
ATOM   4895 C CD  . PRO B 1 88  ? 4.297   -9.338  -46.195 1.00 58.21  ? 88   PRO B CD  1 
ATOM   4896 N N   . ASN B 1 89  ? 0.279   -8.028  -48.484 1.00 52.25  ? 89   ASN B N   1 
ATOM   4897 C CA  . ASN B 1 89  ? -1.076  -8.413  -48.867 1.00 43.59  ? 89   ASN B CA  1 
ATOM   4898 C C   . ASN B 1 89  ? -1.219  -8.431  -50.395 1.00 50.81  ? 89   ASN B C   1 
ATOM   4899 O O   . ASN B 1 89  ? -2.332  -8.421  -50.918 1.00 54.51  ? 89   ASN B O   1 
ATOM   4900 C CB  . ASN B 1 89  ? -2.141  -7.522  -48.187 1.00 42.93  ? 89   ASN B CB  1 
ATOM   4901 C CG  . ASN B 1 89  ? -2.110  -6.054  -48.662 1.00 51.69  ? 89   ASN B CG  1 
ATOM   4902 O OD1 . ASN B 1 89  ? -1.135  -5.590  -49.272 1.00 44.37  ? 89   ASN B OD1 1 
ATOM   4903 N ND2 . ASN B 1 89  ? -3.192  -5.313  -48.361 1.00 49.90  ? 89   ASN B ND2 1 
ATOM   4904 N N   . ARG B 1 90  ? -0.072  -8.437  -51.086 1.00 44.14  ? 90   ARG B N   1 
ATOM   4905 C CA  . ARG B 1 90  ? 0.029   -8.631  -52.536 1.00 45.44  ? 90   ARG B CA  1 
ATOM   4906 C C   . ARG B 1 90  ? 1.275   -9.469  -52.833 1.00 50.64  ? 90   ARG B C   1 
ATOM   4907 O O   . ARG B 1 90  ? 2.091   -9.705  -51.936 1.00 49.16  ? 90   ARG B O   1 
ATOM   4908 C CB  . ARG B 1 90  ? 0.128   -7.300  -53.277 1.00 45.65  ? 90   ARG B CB  1 
ATOM   4909 C CG  . ARG B 1 90  ? -1.123  -6.467  -53.206 1.00 48.72  ? 90   ARG B CG  1 
ATOM   4910 C CD  . ARG B 1 90  ? -2.285  -7.238  -53.782 1.00 53.70  ? 90   ARG B CD  1 
ATOM   4911 N NE  . ARG B 1 90  ? -3.476  -6.410  -53.922 1.00 56.29  ? 90   ARG B NE  1 
ATOM   4912 C CZ  . ARG B 1 90  ? -4.379  -6.223  -52.965 1.00 58.50  ? 90   ARG B CZ  1 
ATOM   4913 N NH1 . ARG B 1 90  ? -4.231  -6.797  -51.778 1.00 53.40  ? 90   ARG B NH1 1 
ATOM   4914 N NH2 . ARG B 1 90  ? -5.435  -5.451  -53.198 1.00 58.53  ? 90   ARG B NH2 1 
ATOM   4915 N N   . GLU B 1 91  ? 1.427   -9.920  -54.079 1.00 54.87  ? 91   GLU B N   1 
ATOM   4916 C CA  . GLU B 1 91  ? 2.600   -10.725 -54.451 1.00 59.96  ? 91   GLU B CA  1 
ATOM   4917 C C   . GLU B 1 91  ? 3.913   -9.936  -54.315 1.00 53.16  ? 91   GLU B C   1 
ATOM   4918 O O   . GLU B 1 91  ? 3.966   -8.736  -54.603 1.00 50.89  ? 91   GLU B O   1 
ATOM   4919 C CB  . GLU B 1 91  ? 2.467   -11.302 -55.876 1.00 62.07  ? 91   GLU B CB  1 
ATOM   4920 C CG  . GLU B 1 91  ? 1.389   -12.391 -56.049 1.00 72.99  ? 91   GLU B CG  1 
ATOM   4921 C CD  . GLU B 1 91  ? 1.749   -13.707 -55.359 1.00 84.29  ? 91   GLU B CD  1 
ATOM   4922 O OE1 . GLU B 1 91  ? 2.741   -14.343 -55.780 1.00 88.03  ? 91   GLU B OE1 1 
ATOM   4923 O OE2 . GLU B 1 91  ? 1.043   -14.108 -54.400 1.00 82.18  ? 91   GLU B OE2 1 
ATOM   4924 N N   . LEU B 1 92  ? 4.962   -10.614 -53.857 1.00 46.38  ? 92   LEU B N   1 
ATOM   4925 C CA  . LEU B 1 92  ? 6.286   -10.013 -53.766 1.00 48.16  ? 92   LEU B CA  1 
ATOM   4926 C C   . LEU B 1 92  ? 6.925   -9.964  -55.141 1.00 48.68  ? 92   LEU B C   1 
ATOM   4927 O O   . LEU B 1 92  ? 6.668   -10.827 -55.970 1.00 55.14  ? 92   LEU B O   1 
ATOM   4928 C CB  . LEU B 1 92  ? 7.170   -10.849 -52.852 1.00 45.07  ? 92   LEU B CB  1 
ATOM   4929 C CG  . LEU B 1 92  ? 6.653   -11.088 -51.440 1.00 48.33  ? 92   LEU B CG  1 
ATOM   4930 C CD1 . LEU B 1 92  ? 7.697   -11.873 -50.661 1.00 43.37  ? 92   LEU B CD1 1 
ATOM   4931 C CD2 . LEU B 1 92  ? 6.357   -9.759  -50.761 1.00 49.40  ? 92   LEU B CD2 1 
ATOM   4932 N N   . SER B 1 93  ? 7.778   -8.973  -55.366 1.00 48.96  ? 93   SER B N   1 
ATOM   4933 C CA  . SER B 1 93  ? 8.504   -8.831  -56.628 1.00 46.33  ? 93   SER B CA  1 
ATOM   4934 C C   . SER B 1 93  ? 9.500   -7.676  -56.525 1.00 46.38  ? 93   SER B C   1 
ATOM   4935 O O   . SER B 1 93  ? 9.218   -6.669  -55.871 1.00 48.47  ? 93   SER B O   1 
ATOM   4936 C CB  . SER B 1 93  ? 7.527   -8.559  -57.785 1.00 42.54  ? 93   SER B CB  1 
ATOM   4937 O OG  . SER B 1 93  ? 8.179   -7.947  -58.889 1.00 42.46  ? 93   SER B OG  1 
ATOM   4938 N N   . GLU B 1 94  ? 10.658  -7.798  -57.166 1.00 43.01  ? 94   GLU B N   1 
ATOM   4939 C CA  . GLU B 1 94  ? 11.547  -6.645  -57.254 1.00 43.29  ? 94   GLU B CA  1 
ATOM   4940 C C   . GLU B 1 94  ? 10.988  -5.535  -58.141 1.00 39.93  ? 94   GLU B C   1 
ATOM   4941 O O   . GLU B 1 94  ? 11.484  -4.395  -58.121 1.00 46.33  ? 94   GLU B O   1 
ATOM   4942 C CB  . GLU B 1 94  ? 12.938  -7.052  -57.722 1.00 42.14  ? 94   GLU B CB  1 
ATOM   4943 C CG  . GLU B 1 94  ? 13.728  -7.815  -56.685 1.00 44.67  ? 94   GLU B CG  1 
ATOM   4944 C CD  . GLU B 1 94  ? 15.123  -8.163  -57.190 1.00 54.84  ? 94   GLU B CD  1 
ATOM   4945 O OE1 . GLU B 1 94  ? 16.010  -7.275  -57.139 1.00 48.81  ? 94   GLU B OE1 1 
ATOM   4946 O OE2 . GLU B 1 94  ? 15.322  -9.316  -57.658 1.00 49.49  ? 94   GLU B OE2 1 
ATOM   4947 N N   . ASP B 1 95  ? 9.988   -5.886  -58.948 1.00 40.95  ? 95   ASP B N   1 
ATOM   4948 C CA  . ASP B 1 95  ? 9.265   -4.909  -59.761 1.00 48.27  ? 95   ASP B CA  1 
ATOM   4949 C C   . ASP B 1 95  ? 8.124   -4.341  -58.895 1.00 48.15  ? 95   ASP B C   1 
ATOM   4950 O O   . ASP B 1 95  ? 7.012   -4.898  -58.858 1.00 41.50  ? 95   ASP B O   1 
ATOM   4951 C CB  . ASP B 1 95  ? 8.726   -5.593  -61.018 1.00 45.65  ? 95   ASP B CB  1 
ATOM   4952 C CG  . ASP B 1 95  ? 7.998   -4.640  -61.948 1.00 47.96  ? 95   ASP B CG  1 
ATOM   4953 O OD1 . ASP B 1 95  ? 7.884   -3.438  -61.626 1.00 50.45  ? 95   ASP B OD1 1 
ATOM   4954 O OD2 . ASP B 1 95  ? 7.534   -5.104  -63.012 1.00 49.08  ? 95   ASP B OD2 1 
ATOM   4955 N N   . CYS B 1 96  ? 8.404   -3.236  -58.197 1.00 45.37  ? 96   CYS B N   1 
ATOM   4956 C CA  . CYS B 1 96  ? 7.499   -2.751  -57.147 1.00 45.26  ? 96   CYS B CA  1 
ATOM   4957 C C   . CYS B 1 96  ? 7.424   -1.235  -56.990 1.00 44.13  ? 96   CYS B C   1 
ATOM   4958 O O   . CYS B 1 96  ? 6.675   -0.738  -56.142 1.00 40.31  ? 96   CYS B O   1 
ATOM   4959 C CB  . CYS B 1 96  ? 7.924   -3.339  -55.799 1.00 44.97  ? 96   CYS B CB  1 
ATOM   4960 S SG  . CYS B 1 96  ? 9.623   -2.816  -55.256 1.00 48.65  ? 96   CYS B SG  1 
ATOM   4961 N N   . LEU B 1 97  ? 8.210   -0.503  -57.773 1.00 38.32  ? 97   LEU B N   1 
ATOM   4962 C CA  . LEU B 1 97  ? 8.200   0.952   -57.671 1.00 37.93  ? 97   LEU B CA  1 
ATOM   4963 C C   . LEU B 1 97  ? 6.899   1.613   -58.202 1.00 40.31  ? 97   LEU B C   1 
ATOM   4964 O O   . LEU B 1 97  ? 6.861   2.168   -59.318 1.00 41.46  ? 97   LEU B O   1 
ATOM   4965 C CB  . LEU B 1 97  ? 9.469   1.539   -58.312 1.00 30.09  ? 97   LEU B CB  1 
ATOM   4966 C CG  . LEU B 1 97  ? 10.747  1.127   -57.539 1.00 42.06  ? 97   LEU B CG  1 
ATOM   4967 C CD1 . LEU B 1 97  ? 12.027  1.818   -58.050 1.00 31.47  ? 97   LEU B CD1 1 
ATOM   4968 C CD2 . LEU B 1 97  ? 10.588  1.335   -56.007 1.00 30.72  ? 97   LEU B CD2 1 
ATOM   4969 N N   . TYR B 1 98  ? 5.843   1.546   -57.387 1.00 39.13  ? 98   TYR B N   1 
ATOM   4970 C CA  . TYR B 1 98  ? 4.528   2.109   -57.728 1.00 40.12  ? 98   TYR B CA  1 
ATOM   4971 C C   . TYR B 1 98  ? 3.975   2.995   -56.607 1.00 45.27  ? 98   TYR B C   1 
ATOM   4972 O O   . TYR B 1 98  ? 4.210   2.743   -55.413 1.00 43.80  ? 98   TYR B O   1 
ATOM   4973 C CB  . TYR B 1 98  ? 3.519   0.987   -58.023 1.00 42.58  ? 98   TYR B CB  1 
ATOM   4974 C CG  . TYR B 1 98  ? 3.951   0.087   -59.155 1.00 55.52  ? 98   TYR B CG  1 
ATOM   4975 C CD1 . TYR B 1 98  ? 3.671   0.419   -60.477 1.00 53.29  ? 98   TYR B CD1 1 
ATOM   4976 C CD2 . TYR B 1 98  ? 4.666   -1.082  -58.906 1.00 49.93  ? 98   TYR B CD2 1 
ATOM   4977 C CE1 . TYR B 1 98  ? 4.083   -0.388  -61.520 1.00 54.61  ? 98   TYR B CE1 1 
ATOM   4978 C CE2 . TYR B 1 98  ? 5.081   -1.899  -59.942 1.00 53.44  ? 98   TYR B CE2 1 
ATOM   4979 C CZ  . TYR B 1 98  ? 4.787   -1.545  -61.248 1.00 58.55  ? 98   TYR B CZ  1 
ATOM   4980 O OH  . TYR B 1 98  ? 5.204   -2.345  -62.280 1.00 58.07  ? 98   TYR B OH  1 
ATOM   4981 N N   . LEU B 1 99  ? 3.229   4.023   -56.989 1.00 41.54  ? 99   LEU B N   1 
ATOM   4982 C CA  . LEU B 1 99  ? 2.548   4.835   -55.999 1.00 43.34  ? 99   LEU B CA  1 
ATOM   4983 C C   . LEU B 1 99  ? 1.015   4.848   -56.150 1.00 51.46  ? 99   LEU B C   1 
ATOM   4984 O O   . LEU B 1 99  ? 0.460   4.358   -57.139 1.00 46.51  ? 99   LEU B O   1 
ATOM   4985 C CB  . LEU B 1 99  ? 3.138   6.248   -55.945 1.00 40.22  ? 99   LEU B CB  1 
ATOM   4986 C CG  . LEU B 1 99  ? 3.211   7.113   -57.209 1.00 46.91  ? 99   LEU B CG  1 
ATOM   4987 C CD1 . LEU B 1 99  ? 1.849   7.739   -57.558 1.00 39.12  ? 99   LEU B CD1 1 
ATOM   4988 C CD2 . LEU B 1 99  ? 4.304   8.185   -57.046 1.00 30.22  ? 99   LEU B CD2 1 
ATOM   4989 N N   . ASN B 1 100 ? 0.348   5.409   -55.144 1.00 52.70  ? 100  ASN B N   1 
ATOM   4990 C CA  . ASN B 1 100 ? -1.103  5.454   -55.091 1.00 44.83  ? 100  ASN B CA  1 
ATOM   4991 C C   . ASN B 1 100 ? -1.584  6.850   -54.725 1.00 48.09  ? 100  ASN B C   1 
ATOM   4992 O O   . ASN B 1 100 ? -0.929  7.568   -53.972 1.00 48.16  ? 100  ASN B O   1 
ATOM   4993 C CB  . ASN B 1 100 ? -1.625  4.453   -54.072 1.00 43.36  ? 100  ASN B CB  1 
ATOM   4994 C CG  . ASN B 1 100 ? -0.902  3.125   -54.147 1.00 42.72  ? 100  ASN B CG  1 
ATOM   4995 O OD1 . ASN B 1 100 ? -0.962  2.435   -55.163 1.00 48.93  ? 100  ASN B OD1 1 
ATOM   4996 N ND2 . ASN B 1 100 ? -0.216  2.757   -53.068 1.00 40.01  ? 100  ASN B ND2 1 
ATOM   4997 N N   . VAL B 1 101 ? -2.735  7.224   -55.269 1.00 50.41  ? 101  VAL B N   1 
ATOM   4998 C CA  . VAL B 1 101 ? -3.324  8.536   -55.061 1.00 47.38  ? 101  VAL B CA  1 
ATOM   4999 C C   . VAL B 1 101 ? -4.803  8.349   -54.759 1.00 50.14  ? 101  VAL B C   1 
ATOM   5000 O O   . VAL B 1 101 ? -5.493  7.634   -55.492 1.00 50.53  ? 101  VAL B O   1 
ATOM   5001 C CB  . VAL B 1 101 ? -3.202  9.399   -56.333 1.00 46.52  ? 101  VAL B CB  1 
ATOM   5002 C CG1 . VAL B 1 101 ? -3.893  10.737  -56.138 1.00 46.32  ? 101  VAL B CG1 1 
ATOM   5003 C CG2 . VAL B 1 101 ? -1.738  9.593   -56.720 1.00 43.80  ? 101  VAL B CG2 1 
ATOM   5004 N N   . TRP B 1 102 ? -5.288  8.966   -53.680 1.00 50.63  ? 102  TRP B N   1 
ATOM   5005 C CA  . TRP B 1 102 ? -6.730  9.053   -53.418 1.00 46.89  ? 102  TRP B CA  1 
ATOM   5006 C C   . TRP B 1 102 ? -7.154  10.520  -53.486 1.00 50.16  ? 102  TRP B C   1 
ATOM   5007 O O   . TRP B 1 102 ? -6.543  11.366  -52.840 1.00 48.95  ? 102  TRP B O   1 
ATOM   5008 C CB  . TRP B 1 102 ? -7.063  8.532   -52.030 1.00 41.29  ? 102  TRP B CB  1 
ATOM   5009 C CG  . TRP B 1 102 ? -6.973  7.051   -51.812 1.00 52.29  ? 102  TRP B CG  1 
ATOM   5010 C CD1 . TRP B 1 102 ? -8.009  6.150   -51.848 1.00 55.38  ? 102  TRP B CD1 1 
ATOM   5011 C CD2 . TRP B 1 102 ? -5.799  6.296   -51.454 1.00 48.84  ? 102  TRP B CD2 1 
ATOM   5012 N NE1 . TRP B 1 102 ? -7.548  4.884   -51.552 1.00 50.46  ? 102  TRP B NE1 1 
ATOM   5013 C CE2 . TRP B 1 102 ? -6.197  4.943   -51.313 1.00 46.76  ? 102  TRP B CE2 1 
ATOM   5014 C CE3 . TRP B 1 102 ? -4.454  6.630   -51.250 1.00 46.65  ? 102  TRP B CE3 1 
ATOM   5015 C CZ2 . TRP B 1 102 ? -5.291  3.921   -50.977 1.00 43.36  ? 102  TRP B CZ2 1 
ATOM   5016 C CZ3 . TRP B 1 102 ? -3.552  5.617   -50.912 1.00 46.65  ? 102  TRP B CZ3 1 
ATOM   5017 C CH2 . TRP B 1 102 ? -3.979  4.276   -50.779 1.00 47.00  ? 102  TRP B CH2 1 
ATOM   5018 N N   . THR B 1 103 ? -8.186  10.830  -54.266 1.00 54.11  ? 103  THR B N   1 
ATOM   5019 C CA  . THR B 1 103 ? -8.745  12.191  -54.295 1.00 56.64  ? 103  THR B CA  1 
ATOM   5020 C C   . THR B 1 103 ? -10.229 12.168  -53.969 1.00 56.89  ? 103  THR B C   1 
ATOM   5021 O O   . THR B 1 103 ? -10.849 11.105  -53.986 1.00 57.84  ? 103  THR B O   1 
ATOM   5022 C CB  . THR B 1 103 ? -8.574  12.890  -55.666 1.00 56.96  ? 103  THR B CB  1 
ATOM   5023 O OG1 . THR B 1 103 ? -9.108  12.058  -56.704 1.00 66.63  ? 103  THR B OG1 1 
ATOM   5024 C CG2 . THR B 1 103 ? -7.123  13.168  -55.943 1.00 59.92  ? 103  THR B CG2 1 
ATOM   5025 N N   . PRO B 1 104 ? -10.804 13.344  -53.658 1.00 69.03  ? 104  PRO B N   1 
ATOM   5026 C CA  . PRO B 1 104 ? -12.267 13.462  -53.567 1.00 71.86  ? 104  PRO B CA  1 
ATOM   5027 C C   . PRO B 1 104 ? -12.994 13.147  -54.893 1.00 69.13  ? 104  PRO B C   1 
ATOM   5028 O O   . PRO B 1 104 ? -12.467 13.396  -55.990 1.00 67.09  ? 104  PRO B O   1 
ATOM   5029 C CB  . PRO B 1 104 ? -12.464 14.932  -53.190 1.00 63.41  ? 104  PRO B CB  1 
ATOM   5030 C CG  . PRO B 1 104 ? -11.223 15.279  -52.434 1.00 62.66  ? 104  PRO B CG  1 
ATOM   5031 C CD  . PRO B 1 104 ? -10.123 14.548  -53.140 1.00 63.44  ? 104  PRO B CD  1 
ATOM   5032 N N   . TYR B 1 105 ? -14.185 12.562  -54.777 1.00 72.11  ? 105  TYR B N   1 
ATOM   5033 C CA  . TYR B 1 105 ? -15.083 12.417  -55.917 1.00 75.82  ? 105  TYR B CA  1 
ATOM   5034 C C   . TYR B 1 105 ? -16.241 13.413  -55.743 1.00 73.97  ? 105  TYR B C   1 
ATOM   5035 O O   . TYR B 1 105 ? -17.105 13.229  -54.874 1.00 79.67  ? 105  TYR B O   1 
ATOM   5036 C CB  . TYR B 1 105 ? -15.611 10.980  -56.025 1.00 70.39  ? 105  TYR B CB  1 
ATOM   5037 C CG  . TYR B 1 105 ? -16.251 10.669  -57.358 1.00 76.80  ? 105  TYR B CG  1 
ATOM   5038 C CD1 . TYR B 1 105 ? -17.507 11.168  -57.679 1.00 82.23  ? 105  TYR B CD1 1 
ATOM   5039 C CD2 . TYR B 1 105 ? -15.602 9.877   -58.299 1.00 80.75  ? 105  TYR B CD2 1 
ATOM   5040 C CE1 . TYR B 1 105 ? -18.100 10.898  -58.896 1.00 84.56  ? 105  TYR B CE1 1 
ATOM   5041 C CE2 . TYR B 1 105 ? -16.189 9.595   -59.525 1.00 85.39  ? 105  TYR B CE2 1 
ATOM   5042 C CZ  . TYR B 1 105 ? -17.441 10.111  -59.815 1.00 93.21  ? 105  TYR B CZ  1 
ATOM   5043 O OH  . TYR B 1 105 ? -18.043 9.846   -61.024 1.00 85.67  ? 105  TYR B OH  1 
ATOM   5044 N N   . PRO B 1 106 ? -16.286 14.462  -56.583 1.00 71.15  ? 106  PRO B N   1 
ATOM   5045 C CA  . PRO B 1 106 ? -15.411 14.713  -57.736 1.00 77.93  ? 106  PRO B CA  1 
ATOM   5046 C C   . PRO B 1 106 ? -14.129 15.497  -57.438 1.00 72.84  ? 106  PRO B C   1 
ATOM   5047 O O   . PRO B 1 106 ? -13.983 16.098  -56.372 1.00 67.92  ? 106  PRO B O   1 
ATOM   5048 C CB  . PRO B 1 106 ? -16.297 15.568  -58.644 1.00 79.18  ? 106  PRO B CB  1 
ATOM   5049 C CG  . PRO B 1 106 ? -17.096 16.388  -57.667 1.00 66.02  ? 106  PRO B CG  1 
ATOM   5050 C CD  . PRO B 1 106 ? -17.362 15.471  -56.484 1.00 69.00  ? 106  PRO B CD  1 
ATOM   5051 N N   . ARG B 1 107 ? -13.229 15.490  -58.422 1.00 77.96  ? 107  ARG B N   1 
ATOM   5052 C CA  . ARG B 1 107 ? -11.928 16.159  -58.372 1.00 76.38  ? 107  ARG B CA  1 
ATOM   5053 C C   . ARG B 1 107 ? -12.022 17.605  -57.890 1.00 76.97  ? 107  ARG B C   1 
ATOM   5054 O O   . ARG B 1 107 ? -12.671 18.434  -58.533 1.00 80.17  ? 107  ARG B O   1 
ATOM   5055 C CB  . ARG B 1 107 ? -11.277 16.116  -59.762 1.00 69.09  ? 107  ARG B CB  1 
ATOM   5056 C CG  . ARG B 1 107 ? -9.813  16.538  -59.804 1.00 74.51  ? 107  ARG B CG  1 
ATOM   5057 C CD  . ARG B 1 107 ? -9.203  16.239  -61.172 1.00 71.15  ? 107  ARG B CD  1 
ATOM   5058 N NE  . ARG B 1 107 ? -9.514  14.872  -61.608 1.00 79.08  ? 107  ARG B NE  1 
ATOM   5059 C CZ  . ARG B 1 107 ? -9.513  14.466  -62.879 1.00 83.52  ? 107  ARG B CZ  1 
ATOM   5060 N NH1 . ARG B 1 107 ? -9.210  15.321  -63.854 1.00 79.09  ? 107  ARG B NH1 1 
ATOM   5061 N NH2 . ARG B 1 107 ? -9.821  13.205  -63.179 1.00 71.11  ? 107  ARG B NH2 1 
ATOM   5062 N N   . PRO B 1 108 ? -11.349 17.907  -56.768 1.00 72.82  ? 108  PRO B N   1 
ATOM   5063 C CA  . PRO B 1 108 ? -11.318 19.207  -56.082 1.00 80.15  ? 108  PRO B CA  1 
ATOM   5064 C C   . PRO B 1 108 ? -11.266 20.414  -57.028 1.00 82.10  ? 108  PRO B C   1 
ATOM   5065 O O   . PRO B 1 108 ? -10.516 20.393  -58.016 1.00 77.28  ? 108  PRO B O   1 
ATOM   5066 C CB  . PRO B 1 108 ? -10.029 19.122  -55.262 1.00 78.27  ? 108  PRO B CB  1 
ATOM   5067 C CG  . PRO B 1 108 ? -9.929  17.674  -54.918 1.00 76.00  ? 108  PRO B CG  1 
ATOM   5068 C CD  . PRO B 1 108 ? -10.455 16.928  -56.120 1.00 76.62  ? 108  PRO B CD  1 
ATOM   5069 N N   . ALA B 1 109 ? -12.061 21.443  -56.725 1.00 78.76  ? 109  ALA B N   1 
ATOM   5070 C CA  . ALA B 1 109 ? -12.113 22.656  -57.544 1.00 80.21  ? 109  ALA B CA  1 
ATOM   5071 C C   . ALA B 1 109 ? -10.841 23.475  -57.367 1.00 83.19  ? 109  ALA B C   1 
ATOM   5072 O O   . ALA B 1 109 ? -10.154 23.817  -58.342 1.00 73.50  ? 109  ALA B O   1 
ATOM   5073 C CB  . ALA B 1 109 ? -13.327 23.490  -57.173 1.00 76.26  ? 109  ALA B CB  1 
ATOM   5074 N N   . SER B 1 110 ? -10.548 23.802  -56.111 1.00 79.63  ? 110  SER B N   1 
ATOM   5075 C CA  . SER B 1 110 ? -9.307  24.477  -55.767 1.00 79.22  ? 110  SER B CA  1 
ATOM   5076 C C   . SER B 1 110 ? -8.181  23.452  -55.560 1.00 76.23  ? 110  SER B C   1 
ATOM   5077 O O   . SER B 1 110 ? -8.443  22.285  -55.223 1.00 70.74  ? 110  SER B O   1 
ATOM   5078 C CB  . SER B 1 110 ? -9.506  25.324  -54.507 1.00 75.69  ? 110  SER B CB  1 
ATOM   5079 O OG  . SER B 1 110 ? -10.414 24.697  -53.618 1.00 77.79  ? 110  SER B OG  1 
ATOM   5080 N N   . PRO B 1 111 ? -6.927  23.878  -55.800 1.00 65.60  ? 111  PRO B N   1 
ATOM   5081 C CA  . PRO B 1 111 ? -5.729  23.123  -55.406 1.00 63.67  ? 111  PRO B CA  1 
ATOM   5082 C C   . PRO B 1 111 ? -5.745  22.734  -53.924 1.00 62.45  ? 111  PRO B C   1 
ATOM   5083 O O   . PRO B 1 111 ? -5.603  23.599  -53.051 1.00 64.03  ? 111  PRO B O   1 
ATOM   5084 C CB  . PRO B 1 111 ? -4.600  24.116  -55.679 1.00 62.15  ? 111  PRO B CB  1 
ATOM   5085 C CG  . PRO B 1 111 ? -5.098  24.885  -56.883 1.00 57.83  ? 111  PRO B CG  1 
ATOM   5086 C CD  . PRO B 1 111 ? -6.592  25.042  -56.644 1.00 66.61  ? 111  PRO B CD  1 
ATOM   5087 N N   . THR B 1 112 ? -5.909  21.439  -53.658 1.00 61.12  ? 112  THR B N   1 
ATOM   5088 C CA  . THR B 1 112 ? -6.052  20.921  -52.300 1.00 60.22  ? 112  THR B CA  1 
ATOM   5089 C C   . THR B 1 112 ? -4.707  20.404  -51.743 1.00 59.73  ? 112  THR B C   1 
ATOM   5090 O O   . THR B 1 112 ? -3.880  19.889  -52.497 1.00 60.69  ? 112  THR B O   1 
ATOM   5091 C CB  . THR B 1 112 ? -7.168  19.840  -52.255 1.00 63.22  ? 112  THR B CB  1 
ATOM   5092 O OG1 . THR B 1 112 ? -8.301  20.353  -51.539 1.00 79.83  ? 112  THR B OG1 1 
ATOM   5093 C CG2 . THR B 1 112 ? -6.689  18.569  -51.580 1.00 59.85  ? 112  THR B CG2 1 
ATOM   5094 N N   . PRO B 1 113 ? -4.471  20.570  -50.427 1.00 57.48  ? 113  PRO B N   1 
ATOM   5095 C CA  . PRO B 1 113 ? -3.202  20.171  -49.799 1.00 56.28  ? 113  PRO B CA  1 
ATOM   5096 C C   . PRO B 1 113 ? -2.927  18.681  -49.945 1.00 50.20  ? 113  PRO B C   1 
ATOM   5097 O O   . PRO B 1 113 ? -3.883  17.889  -49.934 1.00 52.86  ? 113  PRO B O   1 
ATOM   5098 C CB  . PRO B 1 113 ? -3.421  20.515  -48.320 1.00 54.86  ? 113  PRO B CB  1 
ATOM   5099 C CG  . PRO B 1 113 ? -4.444  21.572  -48.334 1.00 60.13  ? 113  PRO B CG  1 
ATOM   5100 C CD  . PRO B 1 113 ? -5.366  21.230  -49.465 1.00 55.04  ? 113  PRO B CD  1 
ATOM   5101 N N   . VAL B 1 114 ? -1.653  18.302  -50.067 1.00 42.06  ? 114  VAL B N   1 
ATOM   5102 C CA  . VAL B 1 114 ? -1.304  16.898  -50.280 1.00 40.24  ? 114  VAL B CA  1 
ATOM   5103 C C   . VAL B 1 114 ? -0.615  16.271  -49.084 1.00 40.23  ? 114  VAL B C   1 
ATOM   5104 O O   . VAL B 1 114 ? 0.355   16.819  -48.573 1.00 46.44  ? 114  VAL B O   1 
ATOM   5105 C CB  . VAL B 1 114 ? -0.370  16.735  -51.485 1.00 45.17  ? 114  VAL B CB  1 
ATOM   5106 C CG1 . VAL B 1 114 ? -0.131  15.253  -51.770 1.00 44.52  ? 114  VAL B CG1 1 
ATOM   5107 C CG2 . VAL B 1 114 ? -0.948  17.438  -52.707 1.00 40.82  ? 114  VAL B CG2 1 
ATOM   5108 N N   . LEU B 1 115 ? -1.106  15.118  -48.634 1.00 44.65  ? 115  LEU B N   1 
ATOM   5109 C CA  . LEU B 1 115 ? -0.387  14.339  -47.615 1.00 40.94  ? 115  LEU B CA  1 
ATOM   5110 C C   . LEU B 1 115 ? 0.316   13.136  -48.262 1.00 47.94  ? 115  LEU B C   1 
ATOM   5111 O O   . LEU B 1 115 ? -0.329  12.331  -48.946 1.00 44.54  ? 115  LEU B O   1 
ATOM   5112 C CB  . LEU B 1 115 ? -1.337  13.838  -46.537 1.00 45.60  ? 115  LEU B CB  1 
ATOM   5113 C CG  . LEU B 1 115 ? -2.001  14.833  -45.590 1.00 45.92  ? 115  LEU B CG  1 
ATOM   5114 C CD1 . LEU B 1 115 ? -3.181  14.156  -44.938 1.00 50.03  ? 115  LEU B CD1 1 
ATOM   5115 C CD2 . LEU B 1 115 ? -1.022  15.265  -44.523 1.00 49.38  ? 115  LEU B CD2 1 
ATOM   5116 N N   . ILE B 1 116 ? 1.629   13.011  -48.062 1.00 43.57  ? 116  ILE B N   1 
ATOM   5117 C CA  . ILE B 1 116 ? 2.328   11.840  -48.574 1.00 35.36  ? 116  ILE B CA  1 
ATOM   5118 C C   . ILE B 1 116 ? 2.761   10.887  -47.461 1.00 36.23  ? 116  ILE B C   1 
ATOM   5119 O O   . ILE B 1 116 ? 3.553   11.245  -46.580 1.00 42.98  ? 116  ILE B O   1 
ATOM   5120 C CB  . ILE B 1 116 ? 3.549   12.207  -49.417 1.00 45.04  ? 116  ILE B CB  1 
ATOM   5121 C CG1 . ILE B 1 116 ? 3.191   13.259  -50.473 1.00 40.83  ? 116  ILE B CG1 1 
ATOM   5122 C CG2 . ILE B 1 116 ? 4.102   10.956  -50.088 1.00 40.45  ? 116  ILE B CG2 1 
ATOM   5123 C CD1 . ILE B 1 116 ? 4.382   13.644  -51.354 1.00 34.30  ? 116  ILE B CD1 1 
ATOM   5124 N N   . TRP B 1 117 ? 2.249   9.666   -47.520 1.00 30.03  ? 117  TRP B N   1 
ATOM   5125 C CA  . TRP B 1 117 ? 2.531   8.657   -46.511 1.00 36.72  ? 117  TRP B CA  1 
ATOM   5126 C C   . TRP B 1 117 ? 3.751   7.827   -46.876 1.00 39.49  ? 117  TRP B C   1 
ATOM   5127 O O   . TRP B 1 117 ? 3.927   7.465   -48.042 1.00 40.81  ? 117  TRP B O   1 
ATOM   5128 C CB  . TRP B 1 117 ? 1.325   7.735   -46.347 1.00 35.94  ? 117  TRP B CB  1 
ATOM   5129 C CG  . TRP B 1 117 ? 1.568   6.569   -45.431 1.00 43.13  ? 117  TRP B CG  1 
ATOM   5130 C CD1 . TRP B 1 117 ? 1.698   5.251   -45.791 1.00 41.58  ? 117  TRP B CD1 1 
ATOM   5131 C CD2 . TRP B 1 117 ? 1.697   6.609   -43.999 1.00 43.36  ? 117  TRP B CD2 1 
ATOM   5132 N NE1 . TRP B 1 117 ? 1.892   4.472   -44.669 1.00 41.14  ? 117  TRP B NE1 1 
ATOM   5133 C CE2 . TRP B 1 117 ? 1.897   5.278   -43.558 1.00 38.82  ? 117  TRP B CE2 1 
ATOM   5134 C CE3 . TRP B 1 117 ? 1.653   7.641   -43.045 1.00 39.60  ? 117  TRP B CE3 1 
ATOM   5135 C CZ2 . TRP B 1 117 ? 2.065   4.952   -42.203 1.00 41.25  ? 117  TRP B CZ2 1 
ATOM   5136 C CZ3 . TRP B 1 117 ? 1.814   7.314   -41.700 1.00 38.12  ? 117  TRP B CZ3 1 
ATOM   5137 C CH2 . TRP B 1 117 ? 2.023   5.979   -41.295 1.00 40.97  ? 117  TRP B CH2 1 
ATOM   5138 N N   . ILE B 1 118 ? 4.582   7.528   -45.877 1.00 37.48  ? 118  ILE B N   1 
ATOM   5139 C CA  . ILE B 1 118 ? 5.764   6.678   -46.048 1.00 38.51  ? 118  ILE B CA  1 
ATOM   5140 C C   . ILE B 1 118 ? 5.722   5.575   -44.981 1.00 41.19  ? 118  ILE B C   1 
ATOM   5141 O O   . ILE B 1 118 ? 6.014   5.836   -43.812 1.00 43.99  ? 118  ILE B O   1 
ATOM   5142 C CB  . ILE B 1 118 ? 7.077   7.480   -45.867 1.00 36.35  ? 118  ILE B CB  1 
ATOM   5143 C CG1 . ILE B 1 118 ? 7.159   8.663   -46.836 1.00 34.28  ? 118  ILE B CG1 1 
ATOM   5144 C CG2 . ILE B 1 118 ? 8.273   6.588   -46.050 1.00 34.90  ? 118  ILE B CG2 1 
ATOM   5145 C CD1 . ILE B 1 118 ? 8.502   9.339   -46.810 1.00 34.73  ? 118  ILE B CD1 1 
ATOM   5146 N N   . TYR B 1 119 ? 5.367   4.351   -45.369 1.00 39.89  ? 119  TYR B N   1 
ATOM   5147 C CA  . TYR B 1 119 ? 5.212   3.257   -44.398 1.00 40.71  ? 119  TYR B CA  1 
ATOM   5148 C C   . TYR B 1 119 ? 6.469   2.943   -43.587 1.00 39.43  ? 119  TYR B C   1 
ATOM   5149 O O   . TYR B 1 119 ? 7.589   3.294   -43.980 1.00 38.61  ? 119  TYR B O   1 
ATOM   5150 C CB  . TYR B 1 119 ? 4.695   1.954   -45.061 1.00 41.78  ? 119  TYR B CB  1 
ATOM   5151 C CG  . TYR B 1 119 ? 5.536   1.415   -46.209 1.00 40.18  ? 119  TYR B CG  1 
ATOM   5152 C CD1 . TYR B 1 119 ? 6.735   0.716   -45.979 1.00 42.27  ? 119  TYR B CD1 1 
ATOM   5153 C CD2 . TYR B 1 119 ? 5.115   1.572   -47.526 1.00 34.47  ? 119  TYR B CD2 1 
ATOM   5154 C CE1 . TYR B 1 119 ? 7.502   0.205   -47.053 1.00 36.32  ? 119  TYR B CE1 1 
ATOM   5155 C CE2 . TYR B 1 119 ? 5.864   1.071   -48.594 1.00 38.47  ? 119  TYR B CE2 1 
ATOM   5156 C CZ  . TYR B 1 119 ? 7.054   0.389   -48.357 1.00 40.26  ? 119  TYR B CZ  1 
ATOM   5157 O OH  . TYR B 1 119 ? 7.783   -0.090  -49.431 1.00 34.36  ? 119  TYR B OH  1 
ATOM   5158 N N   . GLY B 1 120 ? 6.261   2.256   -42.463 1.00 39.76  ? 120  GLY B N   1 
ATOM   5159 C CA  . GLY B 1 120 ? 7.349   1.727   -41.659 1.00 38.03  ? 120  GLY B CA  1 
ATOM   5160 C C   . GLY B 1 120 ? 7.608   0.262   -41.947 1.00 45.38  ? 120  GLY B C   1 
ATOM   5161 O O   . GLY B 1 120 ? 7.088   -0.294  -42.929 1.00 45.58  ? 120  GLY B O   1 
ATOM   5162 N N   . GLY B 1 121 ? 8.423   -0.367  -41.102 1.00 44.85  ? 121  GLY B N   1 
ATOM   5163 C CA  . GLY B 1 121 ? 8.834   -1.740  -41.318 1.00 38.25  ? 121  GLY B CA  1 
ATOM   5164 C C   . GLY B 1 121 ? 10.320  -1.985  -41.092 1.00 44.62  ? 121  GLY B C   1 
ATOM   5165 O O   . GLY B 1 121 ? 10.879  -2.961  -41.615 1.00 46.31  ? 121  GLY B O   1 
ATOM   5166 N N   . GLY B 1 122 ? 10.964  -1.112  -40.316 1.00 42.51  ? 122  GLY B N   1 
ATOM   5167 C CA  . GLY B 1 122 ? 12.364  -1.290  -39.956 1.00 40.63  ? 122  GLY B CA  1 
ATOM   5168 C C   . GLY B 1 122 ? 13.320  -1.259  -41.139 1.00 45.13  ? 122  GLY B C   1 
ATOM   5169 O O   . GLY B 1 122 ? 14.443  -1.774  -41.053 1.00 43.97  ? 122  GLY B O   1 
ATOM   5170 N N   . PHE B 1 123 ? 12.873  -0.653  -42.239 1.00 42.54  ? 123  PHE B N   1 
ATOM   5171 C CA  . PHE B 1 123 ? 13.608  -0.655  -43.513 1.00 45.61  ? 123  PHE B CA  1 
ATOM   5172 C C   . PHE B 1 123 ? 13.784  -2.039  -44.128 1.00 41.71  ? 123  PHE B C   1 
ATOM   5173 O O   . PHE B 1 123 ? 14.520  -2.171  -45.104 1.00 45.47  ? 123  PHE B O   1 
ATOM   5174 C CB  . PHE B 1 123 ? 14.977  0.030   -43.395 1.00 43.61  ? 123  PHE B CB  1 
ATOM   5175 C CG  . PHE B 1 123 ? 14.901  1.485   -43.044 1.00 42.79  ? 123  PHE B CG  1 
ATOM   5176 C CD1 . PHE B 1 123 ? 14.545  2.436   -44.004 1.00 45.80  ? 123  PHE B CD1 1 
ATOM   5177 C CD2 . PHE B 1 123 ? 15.187  1.912   -41.758 1.00 44.57  ? 123  PHE B CD2 1 
ATOM   5178 C CE1 . PHE B 1 123 ? 14.468  3.787   -43.676 1.00 41.18  ? 123  PHE B CE1 1 
ATOM   5179 C CE2 . PHE B 1 123 ? 15.126  3.263   -41.425 1.00 40.86  ? 123  PHE B CE2 1 
ATOM   5180 C CZ  . PHE B 1 123 ? 14.767  4.197   -42.384 1.00 43.48  ? 123  PHE B CZ  1 
ATOM   5181 N N   . TYR B 1 124 ? 13.109  -3.051  -43.575 1.00 40.46  ? 124  TYR B N   1 
ATOM   5182 C CA  . TYR B 1 124 ? 13.190  -4.419  -44.105 1.00 47.15  ? 124  TYR B CA  1 
ATOM   5183 C C   . TYR B 1 124 ? 11.825  -4.970  -44.570 1.00 47.37  ? 124  TYR B C   1 
ATOM   5184 O O   . TYR B 1 124 ? 11.748  -6.040  -45.176 1.00 48.36  ? 124  TYR B O   1 
ATOM   5185 C CB  . TYR B 1 124 ? 13.831  -5.376  -43.082 1.00 45.70  ? 124  TYR B CB  1 
ATOM   5186 C CG  . TYR B 1 124 ? 12.937  -5.699  -41.903 1.00 46.75  ? 124  TYR B CG  1 
ATOM   5187 C CD1 . TYR B 1 124 ? 11.951  -6.679  -41.995 1.00 45.50  ? 124  TYR B CD1 1 
ATOM   5188 C CD2 . TYR B 1 124 ? 13.077  -5.025  -40.695 1.00 45.19  ? 124  TYR B CD2 1 
ATOM   5189 C CE1 . TYR B 1 124 ? 11.121  -6.969  -40.926 1.00 47.49  ? 124  TYR B CE1 1 
ATOM   5190 C CE2 . TYR B 1 124 ? 12.252  -5.311  -39.611 1.00 44.77  ? 124  TYR B CE2 1 
ATOM   5191 C CZ  . TYR B 1 124 ? 11.278  -6.287  -39.733 1.00 47.28  ? 124  TYR B CZ  1 
ATOM   5192 O OH  . TYR B 1 124 ? 10.458  -6.581  -38.662 1.00 52.59  ? 124  TYR B OH  1 
ATOM   5193 N N   . SER B 1 125 ? 10.747  -4.258  -44.266 1.00 45.06  ? 125  SER B N   1 
ATOM   5194 C CA  . SER B 1 125 ? 9.413   -4.723  -44.636 1.00 42.52  ? 125  SER B CA  1 
ATOM   5195 C C   . SER B 1 125 ? 8.491   -3.542  -44.894 1.00 44.69  ? 125  SER B C   1 
ATOM   5196 O O   . SER B 1 125 ? 8.925   -2.392  -44.841 1.00 44.93  ? 125  SER B O   1 
ATOM   5197 C CB  . SER B 1 125 ? 8.832   -5.632  -43.544 1.00 47.28  ? 125  SER B CB  1 
ATOM   5198 O OG  . SER B 1 125 ? 8.850   -5.009  -42.266 1.00 43.87  ? 125  SER B OG  1 
ATOM   5199 N N   . GLY B 1 126 ? 7.226   -3.826  -45.188 1.00 48.91  ? 126  GLY B N   1 
ATOM   5200 C CA  . GLY B 1 126 ? 6.253   -2.782  -45.453 1.00 38.67  ? 126  GLY B CA  1 
ATOM   5201 C C   . GLY B 1 126 ? 5.782   -2.694  -46.896 1.00 43.47  ? 126  GLY B C   1 
ATOM   5202 O O   . GLY B 1 126 ? 6.449   -3.171  -47.818 1.00 47.87  ? 126  GLY B O   1 
ATOM   5203 N N   . ALA B 1 127 ? 4.621   -2.069  -47.086 1.00 41.65  ? 127  ALA B N   1 
ATOM   5204 C CA  . ALA B 1 127 ? 3.989   -1.936  -48.396 1.00 47.22  ? 127  ALA B CA  1 
ATOM   5205 C C   . ALA B 1 127 ? 2.954   -0.837  -48.271 1.00 42.09  ? 127  ALA B C   1 
ATOM   5206 O O   . ALA B 1 127 ? 2.383   -0.654  -47.185 1.00 41.77  ? 127  ALA B O   1 
ATOM   5207 C CB  . ALA B 1 127 ? 3.311   -3.254  -48.805 1.00 44.86  ? 127  ALA B CB  1 
ATOM   5208 N N   . ALA B 1 128 ? 2.699   -0.103  -49.356 1.00 32.59  ? 128  ALA B N   1 
ATOM   5209 C CA  . ALA B 1 128 ? 1.718   0.991   -49.276 1.00 39.66  ? 128  ALA B CA  1 
ATOM   5210 C C   . ALA B 1 128 ? 0.292   0.483   -49.429 1.00 41.89  ? 128  ALA B C   1 
ATOM   5211 O O   . ALA B 1 128 ? -0.650  1.277   -49.454 1.00 45.74  ? 128  ALA B O   1 
ATOM   5212 C CB  . ALA B 1 128 ? 2.010   2.087   -50.298 1.00 32.46  ? 128  ALA B CB  1 
ATOM   5213 N N   . SER B 1 129 ? 0.141   -0.842  -49.507 1.00 43.04  ? 129  SER B N   1 
ATOM   5214 C CA  . SER B 1 129 ? -1.140  -1.464  -49.851 1.00 45.13  ? 129  SER B CA  1 
ATOM   5215 C C   . SER B 1 129 ? -1.871  -2.067  -48.656 1.00 43.97  ? 129  SER B C   1 
ATOM   5216 O O   . SER B 1 129 ? -3.037  -2.471  -48.788 1.00 43.42  ? 129  SER B O   1 
ATOM   5217 C CB  . SER B 1 129 ? -0.937  -2.527  -50.934 1.00 44.29  ? 129  SER B CB  1 
ATOM   5218 O OG  . SER B 1 129 ? -0.031  -3.526  -50.501 1.00 43.72  ? 129  SER B OG  1 
ATOM   5219 N N   . LEU B 1 130 ? -1.192  -2.132  -47.505 1.00 35.53  ? 130  LEU B N   1 
ATOM   5220 C CA  . LEU B 1 130 ? -1.806  -2.640  -46.273 1.00 42.20  ? 130  LEU B CA  1 
ATOM   5221 C C   . LEU B 1 130 ? -3.086  -1.863  -45.945 1.00 49.88  ? 130  LEU B C   1 
ATOM   5222 O O   . LEU B 1 130 ? -3.236  -0.694  -46.339 1.00 47.03  ? 130  LEU B O   1 
ATOM   5223 C CB  . LEU B 1 130 ? -0.826  -2.564  -45.101 1.00 41.54  ? 130  LEU B CB  1 
ATOM   5224 C CG  . LEU B 1 130 ? 0.551   -3.195  -45.357 1.00 50.96  ? 130  LEU B CG  1 
ATOM   5225 C CD1 . LEU B 1 130 ? 1.471   -3.009  -44.154 1.00 46.45  ? 130  LEU B CD1 1 
ATOM   5226 C CD2 . LEU B 1 130 ? 0.425   -4.676  -45.702 1.00 47.98  ? 130  LEU B CD2 1 
ATOM   5227 N N   . ASP B 1 131 ? -4.008  -2.515  -45.237 1.00 50.07  ? 131  ASP B N   1 
ATOM   5228 C CA  . ASP B 1 131 ? -5.313  -1.923  -44.917 1.00 56.03  ? 131  ASP B CA  1 
ATOM   5229 C C   . ASP B 1 131 ? -5.217  -0.651  -44.078 1.00 54.71  ? 131  ASP B C   1 
ATOM   5230 O O   . ASP B 1 131 ? -5.943  0.318   -44.333 1.00 55.10  ? 131  ASP B O   1 
ATOM   5231 C CB  . ASP B 1 131 ? -6.213  -2.928  -44.181 1.00 57.49  ? 131  ASP B CB  1 
ATOM   5232 C CG  . ASP B 1 131 ? -6.714  -4.044  -45.081 1.00 62.26  ? 131  ASP B CG  1 
ATOM   5233 O OD1 . ASP B 1 131 ? -6.632  -3.904  -46.328 1.00 63.75  ? 131  ASP B OD1 1 
ATOM   5234 O OD2 . ASP B 1 131 ? -7.202  -5.062  -44.531 1.00 61.81  ? 131  ASP B OD2 1 
ATOM   5235 N N   . VAL B 1 132 ? -4.332  -0.658  -43.079 1.00 49.12  ? 132  VAL B N   1 
ATOM   5236 C CA  . VAL B 1 132 ? -4.191  0.499   -42.186 1.00 48.77  ? 132  VAL B CA  1 
ATOM   5237 C C   . VAL B 1 132 ? -3.725  1.786   -42.886 1.00 52.33  ? 132  VAL B C   1 
ATOM   5238 O O   . VAL B 1 132 ? -3.833  2.863   -42.293 1.00 54.57  ? 132  VAL B O   1 
ATOM   5239 C CB  . VAL B 1 132 ? -3.299  0.201   -40.948 1.00 48.30  ? 132  VAL B CB  1 
ATOM   5240 C CG1 . VAL B 1 132 ? -4.041  -0.667  -39.956 1.00 48.56  ? 132  VAL B CG1 1 
ATOM   5241 C CG2 . VAL B 1 132 ? -1.999  -0.477  -41.360 1.00 46.34  ? 132  VAL B CG2 1 
ATOM   5242 N N   . TYR B 1 133 ? -3.229  1.689   -44.130 1.00 48.29  ? 133  TYR B N   1 
ATOM   5243 C CA  . TYR B 1 133 ? -2.796  2.888   -44.869 1.00 41.74  ? 133  TYR B CA  1 
ATOM   5244 C C   . TYR B 1 133 ? -3.792  3.314   -45.928 1.00 45.03  ? 133  TYR B C   1 
ATOM   5245 O O   . TYR B 1 133 ? -3.444  4.065   -46.846 1.00 45.57  ? 133  TYR B O   1 
ATOM   5246 C CB  . TYR B 1 133 ? -1.424  2.704   -45.538 1.00 45.03  ? 133  TYR B CB  1 
ATOM   5247 C CG  . TYR B 1 133 ? -0.378  2.088   -44.652 1.00 41.25  ? 133  TYR B CG  1 
ATOM   5248 C CD1 . TYR B 1 133 ? -0.371  2.328   -43.285 1.00 38.36  ? 133  TYR B CD1 1 
ATOM   5249 C CD2 . TYR B 1 133 ? 0.596   1.249   -45.181 1.00 39.13  ? 133  TYR B CD2 1 
ATOM   5250 C CE1 . TYR B 1 133 ? 0.585   1.749   -42.462 1.00 42.09  ? 133  TYR B CE1 1 
ATOM   5251 C CE2 . TYR B 1 133 ? 1.555   0.664   -44.372 1.00 38.63  ? 133  TYR B CE2 1 
ATOM   5252 C CZ  . TYR B 1 133 ? 1.549   0.918   -43.006 1.00 45.21  ? 133  TYR B CZ  1 
ATOM   5253 O OH  . TYR B 1 133 ? 2.488   0.331   -42.175 1.00 35.55  ? 133  TYR B OH  1 
ATOM   5254 N N   . ASP B 1 134 ? -5.028  2.838   -45.805 1.00 48.37  ? 134  ASP B N   1 
ATOM   5255 C CA  . ASP B 1 134 ? -6.087  3.155   -46.764 1.00 42.32  ? 134  ASP B CA  1 
ATOM   5256 C C   . ASP B 1 134 ? -6.423  4.649   -46.724 1.00 45.90  ? 134  ASP B C   1 
ATOM   5257 O O   . ASP B 1 134 ? -6.963  5.142   -45.730 1.00 47.09  ? 134  ASP B O   1 
ATOM   5258 C CB  . ASP B 1 134 ? -7.320  2.314   -46.422 1.00 49.86  ? 134  ASP B CB  1 
ATOM   5259 C CG  . ASP B 1 134 ? -8.455  2.477   -47.420 1.00 49.54  ? 134  ASP B CG  1 
ATOM   5260 O OD1 . ASP B 1 134 ? -8.255  3.055   -48.505 1.00 54.71  ? 134  ASP B OD1 1 
ATOM   5261 O OD2 . ASP B 1 134 ? -9.557  2.004   -47.105 1.00 60.80  ? 134  ASP B OD2 1 
ATOM   5262 N N   . GLY B 1 135 ? -6.110  5.372   -47.795 1.00 45.51  ? 135  GLY B N   1 
ATOM   5263 C CA  . GLY B 1 135 ? -6.309  6.813   -47.805 1.00 49.90  ? 135  GLY B CA  1 
ATOM   5264 C C   . GLY B 1 135 ? -7.686  7.305   -48.237 1.00 54.01  ? 135  GLY B C   1 
ATOM   5265 O O   . GLY B 1 135 ? -7.864  8.491   -48.539 1.00 49.17  ? 135  GLY B O   1 
ATOM   5266 N N   . ARG B 1 136 ? -8.673  6.418   -48.269 1.00 51.84  ? 136  ARG B N   1 
ATOM   5267 C CA  . ARG B 1 136 ? -9.980  6.824   -48.774 1.00 55.81  ? 136  ARG B CA  1 
ATOM   5268 C C   . ARG B 1 136 ? -10.718 7.752   -47.799 1.00 55.34  ? 136  ARG B C   1 
ATOM   5269 O O   . ARG B 1 136 ? -11.369 8.711   -48.228 1.00 55.24  ? 136  ARG B O   1 
ATOM   5270 C CB  . ARG B 1 136 ? -10.835 5.609   -49.171 1.00 61.09  ? 136  ARG B CB  1 
ATOM   5271 C CG  . ARG B 1 136 ? -11.891 5.210   -48.158 1.00 60.10  ? 136  ARG B CG  1 
ATOM   5272 C CD  . ARG B 1 136 ? -11.985 3.705   -48.050 1.00 63.75  ? 136  ARG B CD  1 
ATOM   5273 N NE  . ARG B 1 136 ? -12.388 3.084   -49.307 1.00 72.31  ? 136  ARG B NE  1 
ATOM   5274 C CZ  . ARG B 1 136 ? -11.943 1.907   -49.741 1.00 74.61  ? 136  ARG B CZ  1 
ATOM   5275 N NH1 . ARG B 1 136 ? -11.061 1.216   -49.029 1.00 76.47  ? 136  ARG B NH1 1 
ATOM   5276 N NH2 . ARG B 1 136 ? -12.376 1.419   -50.894 1.00 75.68  ? 136  ARG B NH2 1 
ATOM   5277 N N   . PHE B 1 137 ? -10.595 7.493   -46.499 1.00 50.59  ? 137  PHE B N   1 
ATOM   5278 C CA  . PHE B 1 137 ? -11.288 8.312   -45.503 1.00 54.31  ? 137  PHE B CA  1 
ATOM   5279 C C   . PHE B 1 137 ? -10.827 9.770   -45.452 1.00 56.52  ? 137  PHE B C   1 
ATOM   5280 O O   . PHE B 1 137 ? -11.659 10.679  -45.504 1.00 56.36  ? 137  PHE B O   1 
ATOM   5281 C CB  . PHE B 1 137 ? -11.201 7.674   -44.131 1.00 49.67  ? 137  PHE B CB  1 
ATOM   5282 C CG  . PHE B 1 137 ? -11.585 6.231   -44.133 1.00 57.14  ? 137  PHE B CG  1 
ATOM   5283 C CD1 . PHE B 1 137 ? -12.912 5.857   -44.314 1.00 58.95  ? 137  PHE B CD1 1 
ATOM   5284 C CD2 . PHE B 1 137 ? -10.622 5.243   -43.980 1.00 55.25  ? 137  PHE B CD2 1 
ATOM   5285 C CE1 . PHE B 1 137 ? -13.275 4.518   -44.327 1.00 58.76  ? 137  PHE B CE1 1 
ATOM   5286 C CE2 . PHE B 1 137 ? -10.974 3.897   -43.992 1.00 58.51  ? 137  PHE B CE2 1 
ATOM   5287 C CZ  . PHE B 1 137 ? -12.302 3.534   -44.163 1.00 57.93  ? 137  PHE B CZ  1 
ATOM   5288 N N   . LEU B 1 138 ? -9.516  9.996   -45.363 1.00 54.47  ? 138  LEU B N   1 
ATOM   5289 C CA  . LEU B 1 138 ? -8.980  11.361  -45.367 1.00 54.67  ? 138  LEU B CA  1 
ATOM   5290 C C   . LEU B 1 138 ? -9.307  12.090  -46.669 1.00 57.06  ? 138  LEU B C   1 
ATOM   5291 O O   . LEU B 1 138 ? -9.429  13.322  -46.692 1.00 61.90  ? 138  LEU B O   1 
ATOM   5292 C CB  . LEU B 1 138 ? -7.466  11.373  -45.123 1.00 55.14  ? 138  LEU B CB  1 
ATOM   5293 C CG  . LEU B 1 138 ? -6.928  10.965  -43.751 1.00 50.48  ? 138  LEU B CG  1 
ATOM   5294 C CD1 . LEU B 1 138 ? -5.511  10.479  -43.903 1.00 44.99  ? 138  LEU B CD1 1 
ATOM   5295 C CD2 . LEU B 1 138 ? -6.959  12.132  -42.780 1.00 55.85  ? 138  LEU B CD2 1 
ATOM   5296 N N   . ALA B 1 139 ? -9.440  11.332  -47.755 1.00 56.50  ? 139  ALA B N   1 
ATOM   5297 C CA  . ALA B 1 139 ? -9.785  11.925  -49.044 1.00 58.08  ? 139  ALA B CA  1 
ATOM   5298 C C   . ALA B 1 139 ? -11.244 12.381  -49.030 1.00 58.51  ? 139  ALA B C   1 
ATOM   5299 O O   . ALA B 1 139 ? -11.581 13.445  -49.553 1.00 56.98  ? 139  ALA B O   1 
ATOM   5300 C CB  . ALA B 1 139 ? -9.537  10.938  -50.177 1.00 48.64  ? 139  ALA B CB  1 
ATOM   5301 N N   . GLN B 1 140 ? -12.096 11.569  -48.411 1.00 56.52  ? 140  GLN B N   1 
ATOM   5302 C CA  . GLN B 1 140 ? -13.533 11.813  -48.382 1.00 58.59  ? 140  GLN B CA  1 
ATOM   5303 C C   . GLN B 1 140 ? -13.925 12.823  -47.295 1.00 58.91  ? 140  GLN B C   1 
ATOM   5304 O O   . GLN B 1 140 ? -14.483 13.879  -47.588 1.00 55.76  ? 140  GLN B O   1 
ATOM   5305 C CB  . GLN B 1 140 ? -14.267 10.483  -48.164 1.00 59.43  ? 140  GLN B CB  1 
ATOM   5306 C CG  . GLN B 1 140 ? -15.669 10.437  -48.749 1.00 62.96  ? 140  GLN B CG  1 
ATOM   5307 C CD  . GLN B 1 140 ? -16.694 11.129  -47.870 1.00 63.34  ? 140  GLN B CD  1 
ATOM   5308 O OE1 . GLN B 1 140 ? -16.810 10.833  -46.675 1.00 64.82  ? 140  GLN B OE1 1 
ATOM   5309 N NE2 . GLN B 1 140 ? -17.440 12.060  -48.455 1.00 59.09  ? 140  GLN B NE2 1 
ATOM   5310 N N   . VAL B 1 141 ? -13.625 12.489  -46.044 1.00 59.24  ? 141  VAL B N   1 
ATOM   5311 C CA  . VAL B 1 141 ? -14.008 13.318  -44.907 1.00 56.59  ? 141  VAL B CA  1 
ATOM   5312 C C   . VAL B 1 141 ? -13.310 14.679  -44.874 1.00 63.99  ? 141  VAL B C   1 
ATOM   5313 O O   . VAL B 1 141 ? -13.950 15.702  -44.611 1.00 62.72  ? 141  VAL B O   1 
ATOM   5314 C CB  . VAL B 1 141 ? -13.740 12.593  -43.591 1.00 55.66  ? 141  VAL B CB  1 
ATOM   5315 C CG1 . VAL B 1 141 ? -14.153 13.459  -42.412 1.00 54.46  ? 141  VAL B CG1 1 
ATOM   5316 C CG2 . VAL B 1 141 ? -14.467 11.241  -43.583 1.00 51.91  ? 141  VAL B CG2 1 
ATOM   5317 N N   . GLU B 1 142 ? -12.010 14.694  -45.160 1.00 60.78  ? 142  GLU B N   1 
ATOM   5318 C CA  . GLU B 1 142 ? -11.227 15.918  -45.028 1.00 52.19  ? 142  GLU B CA  1 
ATOM   5319 C C   . GLU B 1 142 ? -10.908 16.583  -46.350 1.00 54.79  ? 142  GLU B C   1 
ATOM   5320 O O   . GLU B 1 142 ? -10.351 17.689  -46.378 1.00 60.08  ? 142  GLU B O   1 
ATOM   5321 C CB  . GLU B 1 142 ? -9.943  15.653  -44.244 1.00 52.35  ? 142  GLU B CB  1 
ATOM   5322 C CG  . GLU B 1 142 ? -10.177 15.369  -42.768 1.00 58.13  ? 142  GLU B CG  1 
ATOM   5323 C CD  . GLU B 1 142 ? -10.813 16.559  -42.039 1.00 69.48  ? 142  GLU B CD  1 
ATOM   5324 O OE1 . GLU B 1 142 ? -10.673 17.725  -42.515 1.00 63.92  ? 142  GLU B OE1 1 
ATOM   5325 O OE2 . GLU B 1 142 ? -11.443 16.324  -40.979 1.00 70.14  ? 142  GLU B OE2 1 
ATOM   5326 N N   . GLY B 1 143 ? -11.256 15.912  -47.445 1.00 54.11  ? 143  GLY B N   1 
ATOM   5327 C CA  . GLY B 1 143 ? -11.051 16.471  -48.775 1.00 53.04  ? 143  GLY B CA  1 
ATOM   5328 C C   . GLY B 1 143 ? -9.586  16.601  -49.162 1.00 63.29  ? 143  GLY B C   1 
ATOM   5329 O O   . GLY B 1 143 ? -9.207  17.515  -49.902 1.00 61.32  ? 143  GLY B O   1 
ATOM   5330 N N   . ALA B 1 144 ? -8.766  15.676  -48.662 1.00 62.87  ? 144  ALA B N   1 
ATOM   5331 C CA  . ALA B 1 144 ? -7.328  15.699  -48.908 1.00 53.33  ? 144  ALA B CA  1 
ATOM   5332 C C   . ALA B 1 144 ? -6.947  14.791  -50.079 1.00 52.40  ? 144  ALA B C   1 
ATOM   5333 O O   . ALA B 1 144 ? -7.488  13.692  -50.232 1.00 55.63  ? 144  ALA B O   1 
ATOM   5334 C CB  . ALA B 1 144 ? -6.580  15.272  -47.648 1.00 47.84  ? 144  ALA B CB  1 
ATOM   5335 N N   . VAL B 1 145 ? -6.021  15.257  -50.907 1.00 47.22  ? 145  VAL B N   1 
ATOM   5336 C CA  . VAL B 1 145 ? -5.335  14.372  -51.828 1.00 48.75  ? 145  VAL B CA  1 
ATOM   5337 C C   . VAL B 1 145 ? -4.234  13.618  -51.057 1.00 51.66  ? 145  VAL B C   1 
ATOM   5338 O O   . VAL B 1 145 ? -3.282  14.229  -50.547 1.00 51.40  ? 145  VAL B O   1 
ATOM   5339 C CB  . VAL B 1 145 ? -4.720  15.141  -53.015 1.00 47.70  ? 145  VAL B CB  1 
ATOM   5340 C CG1 . VAL B 1 145 ? -3.850  14.211  -53.867 1.00 44.10  ? 145  VAL B CG1 1 
ATOM   5341 C CG2 . VAL B 1 145 ? -5.813  15.767  -53.856 1.00 44.71  ? 145  VAL B CG2 1 
ATOM   5342 N N   . LEU B 1 146 ? -4.370  12.294  -50.986 1.00 48.25  ? 146  LEU B N   1 
ATOM   5343 C CA  . LEU B 1 146 ? -3.437  11.443  -50.259 1.00 45.50  ? 146  LEU B CA  1 
ATOM   5344 C C   . LEU B 1 146 ? -2.570  10.569  -51.190 1.00 51.15  ? 146  LEU B C   1 
ATOM   5345 O O   . LEU B 1 146 ? -3.095  9.847   -52.046 1.00 52.77  ? 146  LEU B O   1 
ATOM   5346 C CB  . LEU B 1 146 ? -4.208  10.543  -49.295 1.00 42.84  ? 146  LEU B CB  1 
ATOM   5347 C CG  . LEU B 1 146 ? -3.247  10.042  -48.223 1.00 57.56  ? 146  LEU B CG  1 
ATOM   5348 C CD1 . LEU B 1 146 ? -3.702  10.516  -46.872 1.00 48.64  ? 146  LEU B CD1 1 
ATOM   5349 C CD2 . LEU B 1 146 ? -3.071  8.525   -48.250 1.00 58.29  ? 146  LEU B CD2 1 
ATOM   5350 N N   . VAL B 1 147 ? -1.250  10.624  -51.020 1.00 47.99  ? 147  VAL B N   1 
ATOM   5351 C CA  . VAL B 1 147 ? -0.350  9.792   -51.821 1.00 39.00  ? 147  VAL B CA  1 
ATOM   5352 C C   . VAL B 1 147 ? 0.426   8.800   -50.943 1.00 45.23  ? 147  VAL B C   1 
ATOM   5353 O O   . VAL B 1 147 ? 0.866   9.163   -49.856 1.00 48.36  ? 147  VAL B O   1 
ATOM   5354 C CB  . VAL B 1 147 ? 0.667   10.638  -52.608 1.00 38.33  ? 147  VAL B CB  1 
ATOM   5355 C CG1 . VAL B 1 147 ? 1.527   9.739   -53.501 1.00 44.75  ? 147  VAL B CG1 1 
ATOM   5356 C CG2 . VAL B 1 147 ? -0.029  11.708  -53.444 1.00 41.86  ? 147  VAL B CG2 1 
ATOM   5357 N N   . SER B 1 148 ? 0.577   7.550   -51.391 1.00 43.11  ? 148  SER B N   1 
ATOM   5358 C CA  . SER B 1 148 ? 1.567   6.657   -50.784 1.00 43.95  ? 148  SER B CA  1 
ATOM   5359 C C   . SER B 1 148 ? 2.399   5.921   -51.838 1.00 45.82  ? 148  SER B C   1 
ATOM   5360 O O   . SER B 1 148 ? 1.902   5.612   -52.923 1.00 44.48  ? 148  SER B O   1 
ATOM   5361 C CB  . SER B 1 148 ? 0.916   5.670   -49.827 1.00 36.60  ? 148  SER B CB  1 
ATOM   5362 O OG  . SER B 1 148 ? 0.054   4.800   -50.529 1.00 47.26  ? 148  SER B OG  1 
ATOM   5363 N N   . MET B 1 149 ? 3.663   5.645   -51.519 1.00 39.69  ? 149  MET B N   1 
ATOM   5364 C CA  . MET B 1 149 ? 4.539   4.952   -52.469 1.00 40.21  ? 149  MET B CA  1 
ATOM   5365 C C   . MET B 1 149 ? 5.148   3.678   -51.895 1.00 39.96  ? 149  MET B C   1 
ATOM   5366 O O   . MET B 1 149 ? 5.288   3.528   -50.673 1.00 42.43  ? 149  MET B O   1 
ATOM   5367 C CB  . MET B 1 149 ? 5.660   5.878   -52.989 1.00 36.80  ? 149  MET B CB  1 
ATOM   5368 C CG  . MET B 1 149 ? 6.907   5.959   -52.086 1.00 45.94  ? 149  MET B CG  1 
ATOM   5369 S SD  . MET B 1 149 ? 6.638   6.772   -50.482 1.00 41.72  ? 149  MET B SD  1 
ATOM   5370 C CE  . MET B 1 149 ? 6.694   8.493   -51.001 1.00 43.09  ? 149  MET B CE  1 
ATOM   5371 N N   . ASN B 1 150 ? 5.492   2.757   -52.788 1.00 37.24  ? 150  ASN B N   1 
ATOM   5372 C CA  . ASN B 1 150 ? 6.374   1.667   -52.424 1.00 36.96  ? 150  ASN B CA  1 
ATOM   5373 C C   . ASN B 1 150 ? 7.821   2.118   -52.552 1.00 35.98  ? 150  ASN B C   1 
ATOM   5374 O O   . ASN B 1 150 ? 8.168   2.890   -53.449 1.00 35.89  ? 150  ASN B O   1 
ATOM   5375 C CB  . ASN B 1 150 ? 6.133   0.451   -53.308 1.00 41.85  ? 150  ASN B CB  1 
ATOM   5376 C CG  . ASN B 1 150 ? 4.894   -0.324  -52.906 1.00 42.48  ? 150  ASN B CG  1 
ATOM   5377 O OD1 . ASN B 1 150 ? 4.205   0.034   -51.942 1.00 41.27  ? 150  ASN B OD1 1 
ATOM   5378 N ND2 . ASN B 1 150 ? 4.598   -1.393  -53.646 1.00 48.38  ? 150  ASN B ND2 1 
ATOM   5379 N N   . TYR B 1 151 ? 8.664   1.653   -51.637 1.00 34.77  ? 151  TYR B N   1 
ATOM   5380 C CA  . TYR B 1 151 ? 10.097  1.881   -51.765 1.00 37.07  ? 151  TYR B CA  1 
ATOM   5381 C C   . TYR B 1 151 ? 10.831  0.579   -51.424 1.00 37.48  ? 151  TYR B C   1 
ATOM   5382 O O   . TYR B 1 151 ? 10.351  -0.223  -50.608 1.00 38.84  ? 151  TYR B O   1 
ATOM   5383 C CB  . TYR B 1 151 ? 10.563  3.068   -50.896 1.00 38.22  ? 151  TYR B CB  1 
ATOM   5384 C CG  . TYR B 1 151 ? 10.393  2.859   -49.410 1.00 34.12  ? 151  TYR B CG  1 
ATOM   5385 C CD1 . TYR B 1 151 ? 9.181   3.147   -48.770 1.00 36.31  ? 151  TYR B CD1 1 
ATOM   5386 C CD2 . TYR B 1 151 ? 11.440  2.373   -48.643 1.00 29.98  ? 151  TYR B CD2 1 
ATOM   5387 C CE1 . TYR B 1 151 ? 9.032   2.961   -47.393 1.00 36.22  ? 151  TYR B CE1 1 
ATOM   5388 C CE2 . TYR B 1 151 ? 11.296  2.168   -47.279 1.00 38.93  ? 151  TYR B CE2 1 
ATOM   5389 C CZ  . TYR B 1 151 ? 10.096  2.463   -46.660 1.00 43.21  ? 151  TYR B CZ  1 
ATOM   5390 O OH  . TYR B 1 151 ? 9.972   2.252   -45.308 1.00 39.02  ? 151  TYR B OH  1 
ATOM   5391 N N   . ARG B 1 152 ? 11.980  0.359   -52.057 1.00 41.19  ? 152  ARG B N   1 
ATOM   5392 C CA  . ARG B 1 152 ? 12.742  -0.866  -51.833 1.00 43.88  ? 152  ARG B CA  1 
ATOM   5393 C C   . ARG B 1 152 ? 13.192  -1.004  -50.368 1.00 39.67  ? 152  ARG B C   1 
ATOM   5394 O O   . ARG B 1 152 ? 13.607  -0.030  -49.739 1.00 38.16  ? 152  ARG B O   1 
ATOM   5395 C CB  . ARG B 1 152 ? 13.941  -0.911  -52.778 1.00 43.45  ? 152  ARG B CB  1 
ATOM   5396 C CG  . ARG B 1 152 ? 13.628  -1.443  -54.171 1.00 42.91  ? 152  ARG B CG  1 
ATOM   5397 C CD  . ARG B 1 152 ? 14.833  -1.302  -55.092 1.00 38.10  ? 152  ARG B CD  1 
ATOM   5398 N NE  . ARG B 1 152 ? 15.016  0.092   -55.471 1.00 37.60  ? 152  ARG B NE  1 
ATOM   5399 C CZ  . ARG B 1 152 ? 16.057  0.561   -56.149 1.00 43.70  ? 152  ARG B CZ  1 
ATOM   5400 N NH1 . ARG B 1 152 ? 17.039  -0.255  -56.526 1.00 40.99  ? 152  ARG B NH1 1 
ATOM   5401 N NH2 . ARG B 1 152 ? 16.112  1.855   -56.448 1.00 40.57  ? 152  ARG B NH2 1 
ATOM   5402 N N   . VAL B 1 153 ? 13.100  -2.215  -49.833 1.00 35.88  ? 153  VAL B N   1 
ATOM   5403 C CA  . VAL B 1 153 ? 13.518  -2.486  -48.460 1.00 39.45  ? 153  VAL B CA  1 
ATOM   5404 C C   . VAL B 1 153 ? 14.584  -3.583  -48.442 1.00 42.77  ? 153  VAL B C   1 
ATOM   5405 O O   . VAL B 1 153 ? 14.965  -4.083  -49.502 1.00 45.25  ? 153  VAL B O   1 
ATOM   5406 C CB  . VAL B 1 153 ? 12.329  -2.936  -47.586 1.00 42.18  ? 153  VAL B CB  1 
ATOM   5407 C CG1 . VAL B 1 153 ? 11.357  -1.785  -47.368 1.00 41.68  ? 153  VAL B CG1 1 
ATOM   5408 C CG2 . VAL B 1 153 ? 11.631  -4.140  -48.223 1.00 40.86  ? 153  VAL B CG2 1 
ATOM   5409 N N   . GLY B 1 154 ? 15.044  -3.953  -47.239 1.00 44.84  ? 154  GLY B N   1 
ATOM   5410 C CA  . GLY B 1 154 ? 16.099  -4.943  -47.045 1.00 45.11  ? 154  GLY B CA  1 
ATOM   5411 C C   . GLY B 1 154 ? 17.348  -4.679  -47.867 1.00 45.77  ? 154  GLY B C   1 
ATOM   5412 O O   . GLY B 1 154 ? 17.738  -3.519  -48.079 1.00 43.57  ? 154  GLY B O   1 
ATOM   5413 N N   . THR B 1 155 ? 17.971  -5.755  -48.344 1.00 44.67  ? 155  THR B N   1 
ATOM   5414 C CA  . THR B 1 155 ? 19.156  -5.641  -49.202 1.00 50.86  ? 155  THR B CA  1 
ATOM   5415 C C   . THR B 1 155 ? 18.892  -4.854  -50.501 1.00 50.22  ? 155  THR B C   1 
ATOM   5416 O O   . THR B 1 155 ? 19.750  -4.087  -50.954 1.00 49.11  ? 155  THR B O   1 
ATOM   5417 C CB  . THR B 1 155 ? 19.756  -7.026  -49.574 1.00 48.45  ? 155  THR B CB  1 
ATOM   5418 O OG1 . THR B 1 155 ? 18.819  -7.760  -50.370 1.00 47.96  ? 155  THR B OG1 1 
ATOM   5419 C CG2 . THR B 1 155 ? 20.108  -7.834  -48.327 1.00 50.20  ? 155  THR B CG2 1 
ATOM   5420 N N   . PHE B 1 156 ? 17.720  -5.044  -51.102 1.00 39.40  ? 156  PHE B N   1 
ATOM   5421 C CA  . PHE B 1 156 ? 17.448  -4.418  -52.396 1.00 46.14  ? 156  PHE B CA  1 
ATOM   5422 C C   . PHE B 1 156 ? 17.391  -2.911  -52.284 1.00 43.55  ? 156  PHE B C   1 
ATOM   5423 O O   . PHE B 1 156 ? 17.770  -2.197  -53.218 1.00 46.94  ? 156  PHE B O   1 
ATOM   5424 C CB  . PHE B 1 156 ? 16.147  -4.952  -52.975 1.00 46.03  ? 156  PHE B CB  1 
ATOM   5425 C CG  . PHE B 1 156 ? 16.043  -6.426  -52.886 1.00 47.16  ? 156  PHE B CG  1 
ATOM   5426 C CD1 . PHE B 1 156 ? 16.665  -7.234  -53.837 1.00 48.47  ? 156  PHE B CD1 1 
ATOM   5427 C CD2 . PHE B 1 156 ? 15.369  -7.020  -51.824 1.00 45.70  ? 156  PHE B CD2 1 
ATOM   5428 C CE1 . PHE B 1 156 ? 16.586  -8.618  -53.743 1.00 45.19  ? 156  PHE B CE1 1 
ATOM   5429 C CE2 . PHE B 1 156 ? 15.285  -8.403  -51.724 1.00 46.70  ? 156  PHE B CE2 1 
ATOM   5430 C CZ  . PHE B 1 156 ? 15.894  -9.202  -52.684 1.00 48.74  ? 156  PHE B CZ  1 
ATOM   5431 N N   . GLY B 1 157 ? 16.919  -2.442  -51.128 1.00 45.03  ? 157  GLY B N   1 
ATOM   5432 C CA  . GLY B 1 157 ? 16.826  -1.023  -50.837 1.00 38.10  ? 157  GLY B CA  1 
ATOM   5433 C C   . GLY B 1 157 ? 18.033  -0.379  -50.168 1.00 39.35  ? 157  GLY B C   1 
ATOM   5434 O O   . GLY B 1 157 ? 18.306  0.799   -50.418 1.00 35.07  ? 157  GLY B O   1 
ATOM   5435 N N   . PHE B 1 158 ? 18.759  -1.120  -49.327 1.00 43.38  ? 158  PHE B N   1 
ATOM   5436 C CA  . PHE B 1 158 ? 19.764  -0.467  -48.465 1.00 48.13  ? 158  PHE B CA  1 
ATOM   5437 C C   . PHE B 1 158 ? 21.150  -1.099  -48.372 1.00 48.67  ? 158  PHE B C   1 
ATOM   5438 O O   . PHE B 1 158 ? 22.020  -0.551  -47.691 1.00 53.21  ? 158  PHE B O   1 
ATOM   5439 C CB  . PHE B 1 158 ? 19.187  -0.164  -47.058 1.00 42.74  ? 158  PHE B CB  1 
ATOM   5440 C CG  . PHE B 1 158 ? 18.019  0.771   -47.100 1.00 39.01  ? 158  PHE B CG  1 
ATOM   5441 C CD1 . PHE B 1 158 ? 18.220  2.142   -47.231 1.00 36.34  ? 158  PHE B CD1 1 
ATOM   5442 C CD2 . PHE B 1 158 ? 16.718  0.282   -47.092 1.00 35.41  ? 158  PHE B CD2 1 
ATOM   5443 C CE1 . PHE B 1 158 ? 17.135  3.017   -47.312 1.00 40.14  ? 158  PHE B CE1 1 
ATOM   5444 C CE2 . PHE B 1 158 ? 15.635  1.151   -47.178 1.00 39.02  ? 158  PHE B CE2 1 
ATOM   5445 C CZ  . PHE B 1 158 ? 15.841  2.515   -47.286 1.00 40.67  ? 158  PHE B CZ  1 
ATOM   5446 N N   . LEU B 1 159 ? 21.361  -2.231  -49.041 1.00 49.42  ? 159  LEU B N   1 
ATOM   5447 C CA  . LEU B 1 159 ? 22.712  -2.785  -49.164 1.00 45.33  ? 159  LEU B CA  1 
ATOM   5448 C C   . LEU B 1 159 ? 23.648  -1.819  -49.890 1.00 51.28  ? 159  LEU B C   1 
ATOM   5449 O O   . LEU B 1 159 ? 23.422  -1.470  -51.052 1.00 58.64  ? 159  LEU B O   1 
ATOM   5450 C CB  . LEU B 1 159 ? 22.696  -4.109  -49.913 1.00 49.97  ? 159  LEU B CB  1 
ATOM   5451 C CG  . LEU B 1 159 ? 24.030  -4.862  -50.004 1.00 48.63  ? 159  LEU B CG  1 
ATOM   5452 C CD1 . LEU B 1 159 ? 23.791  -6.346  -49.749 1.00 40.63  ? 159  LEU B CD1 1 
ATOM   5453 C CD2 . LEU B 1 159 ? 24.687  -4.649  -51.365 1.00 53.95  ? 159  LEU B CD2 1 
ATOM   5454 N N   . ALA B 1 160 ? 24.705  -1.403  -49.200 1.00 53.38  ? 160  ALA B N   1 
ATOM   5455 C CA  . ALA B 1 160 ? 25.665  -0.456  -49.750 1.00 51.45  ? 160  ALA B CA  1 
ATOM   5456 C C   . ALA B 1 160 ? 27.096  -0.985  -49.678 1.00 53.54  ? 160  ALA B C   1 
ATOM   5457 O O   . ALA B 1 160 ? 27.515  -1.587  -48.677 1.00 53.12  ? 160  ALA B O   1 
ATOM   5458 C CB  . ALA B 1 160 ? 25.576  0.866   -49.015 1.00 51.50  ? 160  ALA B CB  1 
ATOM   5459 N N   . LEU B 1 161 ? 27.838  -0.762  -50.755 1.00 56.12  ? 161  LEU B N   1 
ATOM   5460 C CA  . LEU B 1 161 ? 29.292  -0.819  -50.712 1.00 60.09  ? 161  LEU B CA  1 
ATOM   5461 C C   . LEU B 1 161 ? 29.742  0.614   -50.980 1.00 58.09  ? 161  LEU B C   1 
ATOM   5462 O O   . LEU B 1 161 ? 29.966  1.015   -52.131 1.00 56.19  ? 161  LEU B O   1 
ATOM   5463 C CB  . LEU B 1 161 ? 29.840  -1.823  -51.722 1.00 55.91  ? 161  LEU B CB  1 
ATOM   5464 C CG  . LEU B 1 161 ? 29.692  -3.248  -51.163 1.00 60.03  ? 161  LEU B CG  1 
ATOM   5465 C CD1 . LEU B 1 161 ? 28.699  -4.088  -51.954 1.00 65.88  ? 161  LEU B CD1 1 
ATOM   5466 C CD2 . LEU B 1 161 ? 31.032  -3.943  -51.077 1.00 61.91  ? 161  LEU B CD2 1 
ATOM   5467 N N   . PRO B 1 162 ? 29.828  1.406   -49.898 1.00 57.12  ? 162  PRO B N   1 
ATOM   5468 C CA  . PRO B 1 162 ? 29.926  2.865   -49.995 1.00 58.71  ? 162  PRO B CA  1 
ATOM   5469 C C   . PRO B 1 162 ? 31.100  3.270   -50.860 1.00 61.23  ? 162  PRO B C   1 
ATOM   5470 O O   . PRO B 1 162 ? 32.162  2.658   -50.757 1.00 59.87  ? 162  PRO B O   1 
ATOM   5471 C CB  . PRO B 1 162 ? 30.125  3.293   -48.539 1.00 60.17  ? 162  PRO B CB  1 
ATOM   5472 C CG  . PRO B 1 162 ? 29.440  2.200   -47.737 1.00 56.12  ? 162  PRO B CG  1 
ATOM   5473 C CD  . PRO B 1 162 ? 29.769  0.943   -48.496 1.00 56.21  ? 162  PRO B CD  1 
ATOM   5474 N N   . GLY B 1 163 ? 30.895  4.257   -51.727 1.00 62.77  ? 163  GLY B N   1 
ATOM   5475 C CA  . GLY B 1 163 ? 31.954  4.717   -52.605 1.00 51.62  ? 163  GLY B CA  1 
ATOM   5476 C C   . GLY B 1 163 ? 31.936  4.084   -53.985 1.00 61.09  ? 163  GLY B C   1 
ATOM   5477 O O   . GLY B 1 163 ? 32.434  4.682   -54.947 1.00 62.74  ? 163  GLY B O   1 
ATOM   5478 N N   . SER B 1 164 ? 31.378  2.877   -54.084 1.00 60.37  ? 164  SER B N   1 
ATOM   5479 C CA  . SER B 1 164 ? 31.259  2.187   -55.368 1.00 58.37  ? 164  SER B CA  1 
ATOM   5480 C C   . SER B 1 164 ? 30.156  2.790   -56.230 1.00 63.49  ? 164  SER B C   1 
ATOM   5481 O O   . SER B 1 164 ? 29.235  3.433   -55.709 1.00 58.26  ? 164  SER B O   1 
ATOM   5482 C CB  . SER B 1 164 ? 30.949  0.718   -55.141 1.00 59.71  ? 164  SER B CB  1 
ATOM   5483 O OG  . SER B 1 164 ? 29.620  0.572   -54.685 1.00 56.93  ? 164  SER B OG  1 
ATOM   5484 N N   . ARG B 1 165 ? 30.242  2.564   -57.541 1.00 70.89  ? 165  ARG B N   1 
ATOM   5485 C CA  . ARG B 1 165 ? 29.254  3.094   -58.479 1.00 74.83  ? 165  ARG B CA  1 
ATOM   5486 C C   . ARG B 1 165 ? 27.993  2.217   -58.526 1.00 72.20  ? 165  ARG B C   1 
ATOM   5487 O O   . ARG B 1 165 ? 26.903  2.710   -58.822 1.00 73.02  ? 165  ARG B O   1 
ATOM   5488 C CB  . ARG B 1 165 ? 29.869  3.233   -59.882 1.00 83.52  ? 165  ARG B CB  1 
ATOM   5489 C CG  . ARG B 1 165 ? 28.953  3.867   -60.935 1.00 94.03  ? 165  ARG B CG  1 
ATOM   5490 C CD  . ARG B 1 165 ? 29.276  3.378   -62.358 1.00 106.63 ? 165  ARG B CD  1 
ATOM   5491 N NE  . ARG B 1 165 ? 28.062  3.095   -63.134 1.00 117.26 ? 165  ARG B NE  1 
ATOM   5492 C CZ  . ARG B 1 165 ? 27.541  1.878   -63.306 1.00 110.29 ? 165  ARG B CZ  1 
ATOM   5493 N NH1 . ARG B 1 165 ? 28.127  0.813   -62.764 1.00 93.24  ? 165  ARG B NH1 1 
ATOM   5494 N NH2 . ARG B 1 165 ? 26.434  1.722   -64.024 1.00 102.14 ? 165  ARG B NH2 1 
ATOM   5495 N N   . GLU B 1 166 ? 28.144  0.936   -58.187 1.00 62.85  ? 166  GLU B N   1 
ATOM   5496 C CA  . GLU B 1 166 ? 27.097  -0.075  -58.413 1.00 69.12  ? 166  GLU B CA  1 
ATOM   5497 C C   . GLU B 1 166 ? 26.199  -0.365  -57.204 1.00 64.43  ? 166  GLU B C   1 
ATOM   5498 O O   . GLU B 1 166 ? 25.133  -0.976  -57.339 1.00 61.80  ? 166  GLU B O   1 
ATOM   5499 C CB  . GLU B 1 166 ? 27.722  -1.388  -58.922 1.00 72.08  ? 166  GLU B CB  1 
ATOM   5500 C CG  . GLU B 1 166 ? 29.227  -1.523  -58.664 1.00 79.74  ? 166  GLU B CG  1 
ATOM   5501 C CD  . GLU B 1 166 ? 30.063  -1.172  -59.885 1.00 86.76  ? 166  GLU B CD  1 
ATOM   5502 O OE1 . GLU B 1 166 ? 29.556  -1.328  -61.021 1.00 89.89  ? 166  GLU B OE1 1 
ATOM   5503 O OE2 . GLU B 1 166 ? 31.224  -0.745  -59.707 1.00 85.15  ? 166  GLU B OE2 1 
ATOM   5504 N N   . ALA B 1 167 ? 26.649  0.054   -56.026 1.00 61.04  ? 167  ALA B N   1 
ATOM   5505 C CA  . ALA B 1 167 ? 25.861  -0.062  -54.799 1.00 58.46  ? 167  ALA B CA  1 
ATOM   5506 C C   . ALA B 1 167 ? 26.130  1.122   -53.867 1.00 54.53  ? 167  ALA B C   1 
ATOM   5507 O O   . ALA B 1 167 ? 26.708  0.959   -52.800 1.00 53.61  ? 167  ALA B O   1 
ATOM   5508 C CB  . ALA B 1 167 ? 26.156  -1.369  -54.096 1.00 46.75  ? 167  ALA B CB  1 
ATOM   5509 N N   . PRO B 1 168 ? 25.681  2.317   -54.269 1.00 55.04  ? 168  PRO B N   1 
ATOM   5510 C CA  . PRO B 1 168 ? 26.005  3.558   -53.557 1.00 53.18  ? 168  PRO B CA  1 
ATOM   5511 C C   . PRO B 1 168 ? 25.359  3.640   -52.163 1.00 59.99  ? 168  PRO B C   1 
ATOM   5512 O O   . PRO B 1 168 ? 25.862  4.380   -51.311 1.00 59.87  ? 168  PRO B O   1 
ATOM   5513 C CB  . PRO B 1 168 ? 25.405  4.650   -54.456 1.00 45.88  ? 168  PRO B CB  1 
ATOM   5514 C CG  . PRO B 1 168 ? 24.853  3.944   -55.680 1.00 59.14  ? 168  PRO B CG  1 
ATOM   5515 C CD  . PRO B 1 168 ? 24.661  2.523   -55.311 1.00 53.12  ? 168  PRO B CD  1 
ATOM   5516 N N   . GLY B 1 169 ? 24.271  2.903   -51.941 1.00 50.33  ? 169  GLY B N   1 
ATOM   5517 C CA  . GLY B 1 169 ? 23.529  2.997   -50.697 1.00 46.84  ? 169  GLY B CA  1 
ATOM   5518 C C   . GLY B 1 169 ? 22.338  3.945   -50.768 1.00 47.25  ? 169  GLY B C   1 
ATOM   5519 O O   . GLY B 1 169 ? 22.254  4.792   -51.684 1.00 47.63  ? 169  GLY B O   1 
ATOM   5520 N N   . ASN B 1 170 ? 21.412  3.783   -49.817 1.00 37.55  ? 170  ASN B N   1 
ATOM   5521 C CA  . ASN B 1 170 ? 20.232  4.643   -49.692 1.00 44.92  ? 170  ASN B CA  1 
ATOM   5522 C C   . ASN B 1 170 ? 19.275  4.664   -50.898 1.00 44.67  ? 170  ASN B C   1 
ATOM   5523 O O   . ASN B 1 170 ? 18.499  5.622   -51.056 1.00 43.59  ? 170  ASN B O   1 
ATOM   5524 C CB  . ASN B 1 170 ? 20.663  6.089   -49.375 1.00 34.33  ? 170  ASN B CB  1 
ATOM   5525 C CG  . ASN B 1 170 ? 21.451  6.200   -48.084 1.00 44.57  ? 170  ASN B CG  1 
ATOM   5526 O OD1 . ASN B 1 170 ? 21.184  5.498   -47.099 1.00 41.70  ? 170  ASN B OD1 1 
ATOM   5527 N ND2 . ASN B 1 170 ? 22.425  7.102   -48.077 1.00 50.39  ? 170  ASN B ND2 1 
ATOM   5528 N N   . VAL B 1 171 ? 19.310  3.638   -51.745 1.00 38.65  ? 171  VAL B N   1 
ATOM   5529 C CA  . VAL B 1 171 ? 18.493  3.697   -52.957 1.00 40.09  ? 171  VAL B CA  1 
ATOM   5530 C C   . VAL B 1 171 ? 16.994  3.636   -52.615 1.00 40.23  ? 171  VAL B C   1 
ATOM   5531 O O   . VAL B 1 171 ? 16.158  4.226   -53.316 1.00 38.23  ? 171  VAL B O   1 
ATOM   5532 C CB  . VAL B 1 171 ? 18.911  2.659   -54.030 1.00 42.13  ? 171  VAL B CB  1 
ATOM   5533 C CG1 . VAL B 1 171 ? 20.398  2.808   -54.344 1.00 40.50  ? 171  VAL B CG1 1 
ATOM   5534 C CG2 . VAL B 1 171 ? 18.571  1.226   -53.593 1.00 39.74  ? 171  VAL B CG2 1 
ATOM   5535 N N   . GLY B 1 172 ? 16.668  2.970   -51.509 1.00 36.81  ? 172  GLY B N   1 
ATOM   5536 C CA  . GLY B 1 172 ? 15.320  3.017   -50.963 1.00 41.33  ? 172  GLY B CA  1 
ATOM   5537 C C   . GLY B 1 172 ? 14.853  4.429   -50.619 1.00 43.17  ? 172  GLY B C   1 
ATOM   5538 O O   . GLY B 1 172 ? 13.684  4.774   -50.843 1.00 39.76  ? 172  GLY B O   1 
ATOM   5539 N N   . LEU B 1 173 ? 15.752  5.254   -50.080 1.00 40.00  ? 173  LEU B N   1 
ATOM   5540 C CA  . LEU B 1 173 ? 15.402  6.644   -49.826 1.00 36.88  ? 173  LEU B CA  1 
ATOM   5541 C C   . LEU B 1 173 ? 15.266  7.388   -51.141 1.00 41.68  ? 173  LEU B C   1 
ATOM   5542 O O   . LEU B 1 173 ? 14.376  8.237   -51.283 1.00 43.71  ? 173  LEU B O   1 
ATOM   5543 C CB  . LEU B 1 173 ? 16.409  7.332   -48.889 1.00 44.22  ? 173  LEU B CB  1 
ATOM   5544 C CG  . LEU B 1 173 ? 16.493  6.752   -47.470 1.00 39.32  ? 173  LEU B CG  1 
ATOM   5545 C CD1 . LEU B 1 173 ? 17.696  7.308   -46.721 1.00 35.81  ? 173  LEU B CD1 1 
ATOM   5546 C CD2 . LEU B 1 173 ? 15.209  7.009   -46.705 1.00 39.08  ? 173  LEU B CD2 1 
ATOM   5547 N N   . LEU B 1 174 ? 16.134  7.074   -52.103 1.00 36.30  ? 174  LEU B N   1 
ATOM   5548 C CA  . LEU B 1 174 ? 16.040  7.705   -53.426 1.00 42.31  ? 174  LEU B CA  1 
ATOM   5549 C C   . LEU B 1 174 ? 14.725  7.355   -54.153 1.00 45.76  ? 174  LEU B C   1 
ATOM   5550 O O   . LEU B 1 174 ? 14.239  8.146   -54.971 1.00 43.50  ? 174  LEU B O   1 
ATOM   5551 C CB  . LEU B 1 174 ? 17.251  7.368   -54.296 1.00 44.22  ? 174  LEU B CB  1 
ATOM   5552 C CG  . LEU B 1 174 ? 18.588  7.986   -53.869 1.00 51.11  ? 174  LEU B CG  1 
ATOM   5553 C CD1 . LEU B 1 174 ? 19.739  7.439   -54.714 1.00 43.77  ? 174  LEU B CD1 1 
ATOM   5554 C CD2 . LEU B 1 174 ? 18.545  9.508   -53.944 1.00 40.95  ? 174  LEU B CD2 1 
ATOM   5555 N N   . ASP B 1 175 ? 14.149  6.189   -53.852 1.00 37.29  ? 175  ASP B N   1 
ATOM   5556 C CA  . ASP B 1 175 ? 12.839  5.829   -54.394 1.00 40.13  ? 175  ASP B CA  1 
ATOM   5557 C C   . ASP B 1 175 ? 11.771  6.768   -53.867 1.00 43.78  ? 175  ASP B C   1 
ATOM   5558 O O   . ASP B 1 175 ? 10.911  7.237   -54.621 1.00 41.75  ? 175  ASP B O   1 
ATOM   5559 C CB  . ASP B 1 175 ? 12.446  4.400   -54.002 1.00 41.86  ? 175  ASP B CB  1 
ATOM   5560 C CG  . ASP B 1 175 ? 13.377  3.355   -54.590 1.00 40.19  ? 175  ASP B CG  1 
ATOM   5561 O OD1 . ASP B 1 175 ? 14.072  3.665   -55.586 1.00 39.13  ? 175  ASP B OD1 1 
ATOM   5562 O OD2 . ASP B 1 175 ? 13.415  2.225   -54.049 1.00 43.57  ? 175  ASP B OD2 1 
ATOM   5563 N N   . GLN B 1 176 ? 11.810  7.000   -52.559 1.00 38.84  ? 176  GLN B N   1 
ATOM   5564 C CA  . GLN B 1 176 ? 10.895  7.923   -51.924 1.00 37.72  ? 176  GLN B CA  1 
ATOM   5565 C C   . GLN B 1 176 ? 11.044  9.294   -52.549 1.00 38.33  ? 176  GLN B C   1 
ATOM   5566 O O   . GLN B 1 176 ? 10.050  9.924   -52.907 1.00 37.55  ? 176  GLN B O   1 
ATOM   5567 C CB  . GLN B 1 176 ? 11.172  8.001   -50.423 1.00 39.23  ? 176  GLN B CB  1 
ATOM   5568 C CG  . GLN B 1 176 ? 10.937  6.679   -49.681 1.00 39.28  ? 176  GLN B CG  1 
ATOM   5569 C CD  . GLN B 1 176 ? 11.491  6.720   -48.267 1.00 41.30  ? 176  GLN B CD  1 
ATOM   5570 O OE1 . GLN B 1 176 ? 11.879  7.794   -47.766 1.00 39.22  ? 176  GLN B OE1 1 
ATOM   5571 N NE2 . GLN B 1 176 ? 11.543  5.550   -47.614 1.00 34.47  ? 176  GLN B NE2 1 
ATOM   5572 N N   . ARG B 1 177 ? 12.284  9.748   -52.694 1.00 37.63  ? 177  ARG B N   1 
ATOM   5573 C CA  . ARG B 1 177 ? 12.543  11.063  -53.283 1.00 38.40  ? 177  ARG B CA  1 
ATOM   5574 C C   . ARG B 1 177 ? 11.963  11.169  -54.697 1.00 46.95  ? 177  ARG B C   1 
ATOM   5575 O O   . ARG B 1 177 ? 11.349  12.188  -55.055 1.00 45.90  ? 177  ARG B O   1 
ATOM   5576 C CB  . ARG B 1 177 ? 14.045  11.383  -53.296 1.00 38.82  ? 177  ARG B CB  1 
ATOM   5577 C CG  . ARG B 1 177 ? 14.385  12.710  -53.972 1.00 44.54  ? 177  ARG B CG  1 
ATOM   5578 C CD  . ARG B 1 177 ? 15.863  12.992  -53.908 1.00 43.65  ? 177  ARG B CD  1 
ATOM   5579 N NE  . ARG B 1 177 ? 16.256  13.392  -52.560 1.00 54.53  ? 177  ARG B NE  1 
ATOM   5580 C CZ  . ARG B 1 177 ? 17.509  13.420  -52.117 1.00 56.61  ? 177  ARG B CZ  1 
ATOM   5581 N NH1 . ARG B 1 177 ? 18.511  13.068  -52.920 1.00 57.83  ? 177  ARG B NH1 1 
ATOM   5582 N NH2 . ARG B 1 177 ? 17.756  13.801  -50.867 1.00 51.69  ? 177  ARG B NH2 1 
ATOM   5583 N N   . LEU B 1 178 ? 12.142  10.114  -55.492 1.00 45.60  ? 178  LEU B N   1 
ATOM   5584 C CA  . LEU B 1 178 ? 11.590  10.082  -56.851 1.00 41.85  ? 178  LEU B CA  1 
ATOM   5585 C C   . LEU B 1 178 ? 10.056  10.154  -56.847 1.00 42.25  ? 178  LEU B C   1 
ATOM   5586 O O   . LEU B 1 178 ? 9.462   10.863  -57.670 1.00 44.68  ? 178  LEU B O   1 
ATOM   5587 C CB  . LEU B 1 178 ? 12.077  8.849   -57.615 1.00 40.83  ? 178  LEU B CB  1 
ATOM   5588 C CG  . LEU B 1 178 ? 11.675  8.739   -59.086 1.00 41.38  ? 178  LEU B CG  1 
ATOM   5589 C CD1 . LEU B 1 178 ? 12.193  9.932   -59.862 1.00 31.93  ? 178  LEU B CD1 1 
ATOM   5590 C CD2 . LEU B 1 178 ? 12.193  7.429   -59.671 1.00 40.90  ? 178  LEU B CD2 1 
ATOM   5591 N N   . ALA B 1 179 ? 9.422   9.435   -55.920 1.00 36.58  ? 179  ALA B N   1 
ATOM   5592 C CA  . ALA B 1 179 ? 7.977   9.541   -55.726 1.00 33.38  ? 179  ALA B CA  1 
ATOM   5593 C C   . ALA B 1 179 ? 7.549   11.001  -55.392 1.00 44.50  ? 179  ALA B C   1 
ATOM   5594 O O   . ALA B 1 179 ? 6.564   11.516  -55.937 1.00 43.06  ? 179  ALA B O   1 
ATOM   5595 C CB  . ALA B 1 179 ? 7.529   8.576   -54.646 1.00 38.50  ? 179  ALA B CB  1 
ATOM   5596 N N   . LEU B 1 180 ? 8.307   11.657  -54.512 1.00 42.34  ? 180  LEU B N   1 
ATOM   5597 C CA  . LEU B 1 180 ? 8.114   13.075  -54.197 1.00 41.58  ? 180  LEU B CA  1 
ATOM   5598 C C   . LEU B 1 180 ? 8.264   13.978  -55.433 1.00 43.97  ? 180  LEU B C   1 
ATOM   5599 O O   . LEU B 1 180 ? 7.436   14.875  -55.636 1.00 44.33  ? 180  LEU B O   1 
ATOM   5600 C CB  . LEU B 1 180 ? 9.081   13.533  -53.092 1.00 34.95  ? 180  LEU B CB  1 
ATOM   5601 C CG  . LEU B 1 180 ? 8.767   13.387  -51.592 1.00 38.57  ? 180  LEU B CG  1 
ATOM   5602 C CD1 . LEU B 1 180 ? 7.989   12.120  -51.237 1.00 32.66  ? 180  LEU B CD1 1 
ATOM   5603 C CD2 . LEU B 1 180 ? 10.070  13.451  -50.788 1.00 40.70  ? 180  LEU B CD2 1 
ATOM   5604 N N   . GLN B 1 181 ? 9.315   13.764  -56.235 1.00 43.44  ? 181  GLN B N   1 
ATOM   5605 C CA  . GLN B 1 181 ? 9.481   14.489  -57.509 1.00 51.67  ? 181  GLN B CA  1 
ATOM   5606 C C   . GLN B 1 181 ? 8.247   14.293  -58.392 1.00 52.53  ? 181  GLN B C   1 
ATOM   5607 O O   . GLN B 1 181 ? 7.775   15.241  -59.034 1.00 42.95  ? 181  GLN B O   1 
ATOM   5608 C CB  . GLN B 1 181 ? 10.726  14.012  -58.286 1.00 41.47  ? 181  GLN B CB  1 
ATOM   5609 C CG  . GLN B 1 181 ? 11.938  14.953  -58.241 1.00 59.06  ? 181  GLN B CG  1 
ATOM   5610 C CD  . GLN B 1 181 ? 13.282  14.205  -58.028 1.00 72.72  ? 181  GLN B CD  1 
ATOM   5611 O OE1 . GLN B 1 181 ? 13.405  13.008  -58.328 1.00 68.32  ? 181  GLN B OE1 1 
ATOM   5612 N NE2 . GLN B 1 181 ? 14.284  14.918  -57.496 1.00 56.91  ? 181  GLN B NE2 1 
ATOM   5613 N N   . TRP B 1 182 ? 7.735   13.060  -58.421 1.00 41.09  ? 182  TRP B N   1 
ATOM   5614 C CA  . TRP B 1 182 ? 6.594   12.727  -59.263 1.00 43.23  ? 182  TRP B CA  1 
ATOM   5615 C C   . TRP B 1 182 ? 5.359   13.516  -58.823 1.00 46.41  ? 182  TRP B C   1 
ATOM   5616 O O   . TRP B 1 182 ? 4.586   13.988  -59.661 1.00 47.94  ? 182  TRP B O   1 
ATOM   5617 C CB  . TRP B 1 182 ? 6.321   11.221  -59.219 1.00 44.16  ? 182  TRP B CB  1 
ATOM   5618 C CG  . TRP B 1 182 ? 5.231   10.746  -60.150 1.00 46.42  ? 182  TRP B CG  1 
ATOM   5619 C CD1 . TRP B 1 182 ? 5.394   10.209  -61.398 1.00 47.84  ? 182  TRP B CD1 1 
ATOM   5620 C CD2 . TRP B 1 182 ? 3.814   10.752  -59.902 1.00 45.06  ? 182  TRP B CD2 1 
ATOM   5621 N NE1 . TRP B 1 182 ? 4.171   9.882   -61.940 1.00 46.71  ? 182  TRP B NE1 1 
ATOM   5622 C CE2 . TRP B 1 182 ? 3.184   10.205  -61.046 1.00 48.01  ? 182  TRP B CE2 1 
ATOM   5623 C CE3 . TRP B 1 182 ? 3.019   11.164  -58.828 1.00 39.24  ? 182  TRP B CE3 1 
ATOM   5624 C CZ2 . TRP B 1 182 ? 1.797   10.060  -61.149 1.00 46.89  ? 182  TRP B CZ2 1 
ATOM   5625 C CZ3 . TRP B 1 182 ? 1.635   11.019  -58.928 1.00 42.12  ? 182  TRP B CZ3 1 
ATOM   5626 C CH2 . TRP B 1 182 ? 1.040   10.471  -60.082 1.00 49.94  ? 182  TRP B CH2 1 
ATOM   5627 N N   . VAL B 1 183 ? 5.188   13.661  -57.508 1.00 41.06  ? 183  VAL B N   1 
ATOM   5628 C CA  . VAL B 1 183 ? 4.116   14.478  -56.956 1.00 42.73  ? 183  VAL B CA  1 
ATOM   5629 C C   . VAL B 1 183 ? 4.244   15.956  -57.396 1.00 47.74  ? 183  VAL B C   1 
ATOM   5630 O O   . VAL B 1 183 ? 3.261   16.555  -57.839 1.00 46.79  ? 183  VAL B O   1 
ATOM   5631 C CB  . VAL B 1 183 ? 4.028   14.328  -55.418 1.00 44.71  ? 183  VAL B CB  1 
ATOM   5632 C CG1 . VAL B 1 183 ? 3.126   15.406  -54.800 1.00 37.20  ? 183  VAL B CG1 1 
ATOM   5633 C CG2 . VAL B 1 183 ? 3.534   12.919  -55.058 1.00 41.05  ? 183  VAL B CG2 1 
ATOM   5634 N N   . GLN B 1 184 ? 5.445   16.530  -57.313 1.00 40.49  ? 184  GLN B N   1 
ATOM   5635 C CA  . GLN B 1 184 ? 5.675   17.895  -57.810 1.00 45.15  ? 184  GLN B CA  1 
ATOM   5636 C C   . GLN B 1 184 ? 5.188   18.094  -59.239 1.00 48.38  ? 184  GLN B C   1 
ATOM   5637 O O   . GLN B 1 184 ? 4.553   19.113  -59.545 1.00 46.69  ? 184  GLN B O   1 
ATOM   5638 C CB  . GLN B 1 184 ? 7.159   18.287  -57.731 1.00 35.65  ? 184  GLN B CB  1 
ATOM   5639 C CG  . GLN B 1 184 ? 7.640   18.572  -56.327 1.00 48.75  ? 184  GLN B CG  1 
ATOM   5640 C CD  . GLN B 1 184 ? 6.876   19.711  -55.695 1.00 55.54  ? 184  GLN B CD  1 
ATOM   5641 O OE1 . GLN B 1 184 ? 6.977   20.861  -56.136 1.00 63.81  ? 184  GLN B OE1 1 
ATOM   5642 N NE2 . GLN B 1 184 ? 6.096   19.400  -54.661 1.00 45.65  ? 184  GLN B NE2 1 
ATOM   5643 N N   . GLU B 1 185 ? 5.484   17.112  -60.093 1.00 49.84  ? 185  GLU B N   1 
ATOM   5644 C CA  . GLU B 1 185 ? 5.251   17.199  -61.535 1.00 51.55  ? 185  GLU B CA  1 
ATOM   5645 C C   . GLU B 1 185 ? 3.829   16.857  -61.971 1.00 51.35  ? 185  GLU B C   1 
ATOM   5646 O O   . GLU B 1 185 ? 3.388   17.270  -63.045 1.00 59.08  ? 185  GLU B O   1 
ATOM   5647 C CB  . GLU B 1 185 ? 6.174   16.223  -62.269 1.00 61.77  ? 185  GLU B CB  1 
ATOM   5648 C CG  . GLU B 1 185 ? 7.634   16.585  -62.318 1.00 61.04  ? 185  GLU B CG  1 
ATOM   5649 C CD  . GLU B 1 185 ? 8.467   15.403  -62.777 1.00 73.06  ? 185  GLU B CD  1 
ATOM   5650 O OE1 . GLU B 1 185 ? 7.877   14.303  -62.944 1.00 78.65  ? 185  GLU B OE1 1 
ATOM   5651 O OE2 . GLU B 1 185 ? 9.697   15.560  -62.959 1.00 67.52  ? 185  GLU B OE2 1 
ATOM   5652 N N   . ASN B 1 186 ? 3.119   16.081  -61.162 1.00 44.81  ? 186  ASN B N   1 
ATOM   5653 C CA  . ASN B 1 186 ? 1.884   15.472  -61.632 1.00 44.01  ? 186  ASN B CA  1 
ATOM   5654 C C   . ASN B 1 186 ? 0.671   15.623  -60.717 1.00 51.43  ? 186  ASN B C   1 
ATOM   5655 O O   . ASN B 1 186 ? -0.465  15.356  -61.138 1.00 51.65  ? 186  ASN B O   1 
ATOM   5656 C CB  . ASN B 1 186 ? 2.117   13.976  -61.901 1.00 46.48  ? 186  ASN B CB  1 
ATOM   5657 C CG  . ASN B 1 186 ? 3.110   13.730  -63.015 1.00 50.55  ? 186  ASN B CG  1 
ATOM   5658 O OD1 . ASN B 1 186 ? 2.869   14.113  -64.162 1.00 54.67  ? 186  ASN B OD1 1 
ATOM   5659 N ND2 . ASN B 1 186 ? 4.215   13.054  -62.696 1.00 51.66  ? 186  ASN B ND2 1 
ATOM   5660 N N   . ILE B 1 187 ? 0.891   16.024  -59.466 1.00 50.64  ? 187  ILE B N   1 
ATOM   5661 C CA  . ILE B 1 187 ? -0.209  15.990  -58.502 1.00 45.28  ? 187  ILE B CA  1 
ATOM   5662 C C   . ILE B 1 187 ? -1.307  17.002  -58.867 1.00 47.58  ? 187  ILE B C   1 
ATOM   5663 O O   . ILE B 1 187 ? -2.493  16.719  -58.660 1.00 49.71  ? 187  ILE B O   1 
ATOM   5664 C CB  . ILE B 1 187 ? 0.255   16.104  -57.017 1.00 47.52  ? 187  ILE B CB  1 
ATOM   5665 C CG1 . ILE B 1 187 ? -0.749  15.415  -56.093 1.00 37.91  ? 187  ILE B CG1 1 
ATOM   5666 C CG2 . ILE B 1 187 ? 0.501   17.568  -56.605 1.00 45.61  ? 187  ILE B CG2 1 
ATOM   5667 C CD1 . ILE B 1 187 ? -0.915  13.937  -56.383 1.00 41.67  ? 187  ILE B CD1 1 
ATOM   5668 N N   . ALA B 1 188 ? -0.919  18.141  -59.451 1.00 45.13  ? 188  ALA B N   1 
ATOM   5669 C CA  . ALA B 1 188 ? -1.894  19.124  -59.961 1.00 49.63  ? 188  ALA B CA  1 
ATOM   5670 C C   . ALA B 1 188 ? -2.996  18.538  -60.876 1.00 53.94  ? 188  ALA B C   1 
ATOM   5671 O O   . ALA B 1 188 ? -4.141  18.998  -60.834 1.00 53.43  ? 188  ALA B O   1 
ATOM   5672 C CB  . ALA B 1 188 ? -1.189  20.284  -60.649 1.00 36.60  ? 188  ALA B CB  1 
ATOM   5673 N N   . ALA B 1 189 ? -2.658  17.525  -61.679 1.00 48.99  ? 189  ALA B N   1 
ATOM   5674 C CA  . ALA B 1 189 ? -3.639  16.856  -62.536 1.00 45.91  ? 189  ALA B CA  1 
ATOM   5675 C C   . ALA B 1 189 ? -4.746  16.143  -61.742 1.00 53.34  ? 189  ALA B C   1 
ATOM   5676 O O   . ALA B 1 189 ? -5.797  15.806  -62.294 1.00 57.53  ? 189  ALA B O   1 
ATOM   5677 C CB  . ALA B 1 189 ? -2.942  15.876  -63.484 1.00 44.27  ? 189  ALA B CB  1 
ATOM   5678 N N   . PHE B 1 190 ? -4.502  15.910  -60.452 1.00 50.79  ? 190  PHE B N   1 
ATOM   5679 C CA  . PHE B 1 190 ? -5.455  15.225  -59.585 1.00 50.68  ? 190  PHE B CA  1 
ATOM   5680 C C   . PHE B 1 190 ? -6.185  16.210  -58.668 1.00 56.00  ? 190  PHE B C   1 
ATOM   5681 O O   . PHE B 1 190 ? -7.064  15.807  -57.887 1.00 59.16  ? 190  PHE B O   1 
ATOM   5682 C CB  . PHE B 1 190 ? -4.736  14.177  -58.722 1.00 53.38  ? 190  PHE B CB  1 
ATOM   5683 C CG  . PHE B 1 190 ? -4.076  13.061  -59.510 1.00 54.92  ? 190  PHE B CG  1 
ATOM   5684 C CD1 . PHE B 1 190 ? -2.807  13.226  -60.063 1.00 50.59  ? 190  PHE B CD1 1 
ATOM   5685 C CD2 . PHE B 1 190 ? -4.713  11.832  -59.663 1.00 57.56  ? 190  PHE B CD2 1 
ATOM   5686 C CE1 . PHE B 1 190 ? -2.198  12.196  -60.771 1.00 49.81  ? 190  PHE B CE1 1 
ATOM   5687 C CE2 . PHE B 1 190 ? -4.108  10.796  -60.372 1.00 51.98  ? 190  PHE B CE2 1 
ATOM   5688 C CZ  . PHE B 1 190 ? -2.848  10.982  -60.923 1.00 51.76  ? 190  PHE B CZ  1 
ATOM   5689 N N   . GLY B 1 191 ? -5.810  17.490  -58.750 1.00 52.37  ? 191  GLY B N   1 
ATOM   5690 C CA  . GLY B 1 191 ? -6.384  18.526  -57.900 1.00 61.97  ? 191  GLY B CA  1 
ATOM   5691 C C   . GLY B 1 191 ? -5.611  18.784  -56.609 1.00 64.32  ? 191  GLY B C   1 
ATOM   5692 O O   . GLY B 1 191 ? -6.172  19.258  -55.607 1.00 65.33  ? 191  GLY B O   1 
ATOM   5693 N N   . GLY B 1 192 ? -4.319  18.472  -56.630 1.00 59.35  ? 192  GLY B N   1 
ATOM   5694 C CA  . GLY B 1 192 ? -3.482  18.635  -55.461 1.00 51.21  ? 192  GLY B CA  1 
ATOM   5695 C C   . GLY B 1 192 ? -2.571  19.828  -55.618 1.00 50.96  ? 192  GLY B C   1 
ATOM   5696 O O   . GLY B 1 192 ? -2.258  20.231  -56.735 1.00 55.47  ? 192  GLY B O   1 
ATOM   5697 N N   . ASP B 1 193 ? -2.142  20.392  -54.495 1.00 53.63  ? 193  ASP B N   1 
ATOM   5698 C CA  . ASP B 1 193 ? -1.321  21.596  -54.510 1.00 53.76  ? 193  ASP B CA  1 
ATOM   5699 C C   . ASP B 1 193 ? 0.147   21.217  -54.316 1.00 54.58  ? 193  ASP B C   1 
ATOM   5700 O O   . ASP B 1 193 ? 0.567   20.916  -53.190 1.00 55.34  ? 193  ASP B O   1 
ATOM   5701 C CB  . ASP B 1 193 ? -1.782  22.529  -53.387 1.00 56.39  ? 193  ASP B CB  1 
ATOM   5702 C CG  . ASP B 1 193 ? -1.195  23.939  -53.494 1.00 61.58  ? 193  ASP B CG  1 
ATOM   5703 O OD1 . ASP B 1 193 ? -0.290  24.175  -54.337 1.00 56.61  ? 193  ASP B OD1 1 
ATOM   5704 O OD2 . ASP B 1 193 ? -1.646  24.815  -52.711 1.00 63.80  ? 193  ASP B OD2 1 
ATOM   5705 N N   . PRO B 1 194 ? 0.940   21.246  -55.408 1.00 56.45  ? 194  PRO B N   1 
ATOM   5706 C CA  . PRO B 1 194 ? 2.377   20.926  -55.301 1.00 60.65  ? 194  PRO B CA  1 
ATOM   5707 C C   . PRO B 1 194 ? 3.065   21.868  -54.312 1.00 53.78  ? 194  PRO B C   1 
ATOM   5708 O O   . PRO B 1 194 ? 4.152   21.570  -53.811 1.00 54.72  ? 194  PRO B O   1 
ATOM   5709 C CB  . PRO B 1 194 ? 2.928   21.186  -56.717 1.00 50.32  ? 194  PRO B CB  1 
ATOM   5710 C CG  . PRO B 1 194 ? 1.743   21.416  -57.601 1.00 45.81  ? 194  PRO B CG  1 
ATOM   5711 C CD  . PRO B 1 194 ? 0.562   21.754  -56.741 1.00 50.75  ? 194  PRO B CD  1 
ATOM   5712 N N   . MET B 1 195 ? 2.427   23.004  -54.041 1.00 54.72  ? 195  MET B N   1 
ATOM   5713 C CA  . MET B 1 195 ? 2.995   23.991  -53.130 1.00 62.76  ? 195  MET B CA  1 
ATOM   5714 C C   . MET B 1 195 ? 2.595   23.794  -51.671 1.00 57.02  ? 195  MET B C   1 
ATOM   5715 O O   . MET B 1 195 ? 3.121   24.469  -50.785 1.00 51.51  ? 195  MET B O   1 
ATOM   5716 C CB  . MET B 1 195 ? 2.718   25.412  -53.607 1.00 56.26  ? 195  MET B CB  1 
ATOM   5717 C CG  . MET B 1 195 ? 3.653   25.814  -54.732 1.00 53.29  ? 195  MET B CG  1 
ATOM   5718 S SD  . MET B 1 195 ? 3.669   27.576  -55.056 1.00 98.10  ? 195  MET B SD  1 
ATOM   5719 C CE  . MET B 1 195 ? 1.913   27.898  -55.253 1.00 79.73  ? 195  MET B CE  1 
ATOM   5720 N N   . SER B 1 196 ? 1.702   22.843  -51.418 1.00 52.46  ? 196  SER B N   1 
ATOM   5721 C CA  . SER B 1 196 ? 1.416   22.451  -50.044 1.00 57.21  ? 196  SER B CA  1 
ATOM   5722 C C   . SER B 1 196 ? 1.508   20.933  -49.866 1.00 49.98  ? 196  SER B C   1 
ATOM   5723 O O   . SER B 1 196 ? 0.489   20.221  -49.869 1.00 42.35  ? 196  SER B O   1 
ATOM   5724 C CB  . SER B 1 196 ? 0.051   22.972  -49.585 1.00 48.33  ? 196  SER B CB  1 
ATOM   5725 O OG  . SER B 1 196 ? -0.244  22.497  -48.278 1.00 56.75  ? 196  SER B OG  1 
ATOM   5726 N N   . VAL B 1 197 ? 2.734   20.446  -49.699 1.00 42.49  ? 197  VAL B N   1 
ATOM   5727 C CA  . VAL B 1 197 ? 2.969   19.009  -49.546 1.00 46.98  ? 197  VAL B CA  1 
ATOM   5728 C C   . VAL B 1 197 ? 3.492   18.673  -48.148 1.00 37.40  ? 197  VAL B C   1 
ATOM   5729 O O   . VAL B 1 197 ? 4.548   19.149  -47.753 1.00 48.18  ? 197  VAL B O   1 
ATOM   5730 C CB  . VAL B 1 197 ? 3.954   18.485  -50.636 1.00 44.75  ? 197  VAL B CB  1 
ATOM   5731 C CG1 . VAL B 1 197 ? 4.345   17.032  -50.371 1.00 39.06  ? 197  VAL B CG1 1 
ATOM   5732 C CG2 . VAL B 1 197 ? 3.347   18.657  -52.037 1.00 39.34  ? 197  VAL B CG2 1 
ATOM   5733 N N   . THR B 1 198 ? 2.752   17.855  -47.407 1.00 35.57  ? 198  THR B N   1 
ATOM   5734 C CA  . THR B 1 198 ? 3.153   17.419  -46.065 1.00 37.44  ? 198  THR B CA  1 
ATOM   5735 C C   . THR B 1 198 ? 3.551   15.940  -46.064 1.00 40.60  ? 198  THR B C   1 
ATOM   5736 O O   . THR B 1 198 ? 2.723   15.077  -46.384 1.00 42.54  ? 198  THR B O   1 
ATOM   5737 C CB  . THR B 1 198 ? 1.983   17.572  -45.053 1.00 37.20  ? 198  THR B CB  1 
ATOM   5738 O OG1 . THR B 1 198 ? 1.541   18.930  -45.029 1.00 48.08  ? 198  THR B OG1 1 
ATOM   5739 C CG2 . THR B 1 198 ? 2.399   17.134  -43.632 1.00 35.81  ? 198  THR B CG2 1 
ATOM   5740 N N   . LEU B 1 199 ? 4.797   15.634  -45.695 1.00 37.70  ? 199  LEU B N   1 
ATOM   5741 C CA  . LEU B 1 199 ? 5.195   14.235  -45.510 1.00 36.04  ? 199  LEU B CA  1 
ATOM   5742 C C   . LEU B 1 199 ? 4.716   13.723  -44.153 1.00 41.27  ? 199  LEU B C   1 
ATOM   5743 O O   . LEU B 1 199 ? 4.812   14.441  -43.150 1.00 47.46  ? 199  LEU B O   1 
ATOM   5744 C CB  . LEU B 1 199 ? 6.715   14.082  -45.598 1.00 35.98  ? 199  LEU B CB  1 
ATOM   5745 C CG  . LEU B 1 199 ? 7.403   14.570  -46.872 1.00 42.92  ? 199  LEU B CG  1 
ATOM   5746 C CD1 . LEU B 1 199 ? 8.919   14.375  -46.766 1.00 35.51  ? 199  LEU B CD1 1 
ATOM   5747 C CD2 . LEU B 1 199 ? 6.834   13.856  -48.101 1.00 40.31  ? 199  LEU B CD2 1 
ATOM   5748 N N   . PHE B 1 200 ? 4.198   12.497  -44.112 1.00 38.68  ? 200  PHE B N   1 
ATOM   5749 C CA  . PHE B 1 200 ? 3.987   11.814  -42.832 1.00 36.68  ? 200  PHE B CA  1 
ATOM   5750 C C   . PHE B 1 200 ? 4.310   10.324  -42.906 1.00 41.48  ? 200  PHE B C   1 
ATOM   5751 O O   . PHE B 1 200 ? 4.043   9.654   -43.910 1.00 39.78  ? 200  PHE B O   1 
ATOM   5752 C CB  . PHE B 1 200 ? 2.603   12.086  -42.205 1.00 36.54  ? 200  PHE B CB  1 
ATOM   5753 C CG  . PHE B 1 200 ? 1.432   11.395  -42.885 1.00 40.10  ? 200  PHE B CG  1 
ATOM   5754 C CD1 . PHE B 1 200 ? 1.256   11.432  -44.262 1.00 35.49  ? 200  PHE B CD1 1 
ATOM   5755 C CD2 . PHE B 1 200 ? 0.463   10.755  -42.115 1.00 42.76  ? 200  PHE B CD2 1 
ATOM   5756 C CE1 . PHE B 1 200 ? 0.143   10.827  -44.857 1.00 43.08  ? 200  PHE B CE1 1 
ATOM   5757 C CE2 . PHE B 1 200 ? -0.649  10.142  -42.703 1.00 39.63  ? 200  PHE B CE2 1 
ATOM   5758 C CZ  . PHE B 1 200 ? -0.806  10.180  -44.078 1.00 40.01  ? 200  PHE B CZ  1 
ATOM   5759 N N   . GLY B 1 201 ? 4.898   9.824   -41.830 1.00 33.80  ? 201  GLY B N   1 
ATOM   5760 C CA  . GLY B 1 201 ? 5.351   8.462   -41.795 1.00 37.13  ? 201  GLY B CA  1 
ATOM   5761 C C   . GLY B 1 201 ? 5.413   7.997   -40.363 1.00 38.94  ? 201  GLY B C   1 
ATOM   5762 O O   . GLY B 1 201 ? 5.624   8.793   -39.444 1.00 42.43  ? 201  GLY B O   1 
ATOM   5763 N N   . GLU B 1 202 ? 5.230   6.699   -40.169 1.00 40.98  ? 202  GLU B N   1 
ATOM   5764 C CA  . GLU B 1 202 ? 5.365   6.109   -38.845 1.00 40.18  ? 202  GLU B CA  1 
ATOM   5765 C C   . GLU B 1 202 ? 6.652   5.273   -38.749 1.00 47.04  ? 202  GLU B C   1 
ATOM   5766 O O   . GLU B 1 202 ? 7.045   4.574   -39.696 1.00 44.86  ? 202  GLU B O   1 
ATOM   5767 C CB  . GLU B 1 202 ? 4.135   5.268   -38.523 1.00 43.07  ? 202  GLU B CB  1 
ATOM   5768 C CG  . GLU B 1 202 ? 4.008   4.873   -37.081 1.00 44.42  ? 202  GLU B CG  1 
ATOM   5769 C CD  . GLU B 1 202 ? 4.683   3.561   -36.806 1.00 55.33  ? 202  GLU B CD  1 
ATOM   5770 O OE1 . GLU B 1 202 ? 5.108   2.901   -37.784 1.00 54.29  ? 202  GLU B OE1 1 
ATOM   5771 O OE2 . GLU B 1 202 ? 4.799   3.192   -35.616 1.00 65.26  ? 202  GLU B OE2 1 
HETATM 5772 N N   . GFT B 1 203 ? 7.503   4.898   -37.817 1.00 47.20  ? 203  GFT B N   1 
HETATM 5773 C CA  . GFT B 1 203 ? 8.692   4.277   -37.204 1.00 45.66  ? 203  GFT B CA  1 
HETATM 5774 C C   . GFT B 1 203 ? 9.893   4.230   -38.253 1.00 49.39  ? 203  GFT B C   1 
HETATM 5775 O O   . GFT B 1 203 ? 10.337  5.560   -38.440 1.00 40.26  ? 203  GFT B O   1 
HETATM 5776 C CB  . GFT B 1 203 ? 8.271   2.837   -36.656 1.00 52.02  ? 203  GFT B CB  1 
HETATM 5777 O OG  . GFT B 1 203 ? 9.290   1.880   -36.537 1.00 60.78  ? 203  GFT B OG  1 
HETATM 5778 C CAA . GFT B 1 203 ? 10.567  -0.545  -36.292 1.00 52.69  ? 203  GFT B CAA 1 
HETATM 5779 O OAC . GFT B 1 203 ? 9.773   0.562   -38.639 1.00 51.56  ? 203  GFT B OAC 1 
HETATM 5780 C CAD . GFT B 1 203 ? 5.073   -3.067  -37.403 1.00 69.57  ? 203  GFT B CAD 1 
HETATM 5781 C CAE . GFT B 1 203 ? 6.534   -3.379  -37.785 1.00 72.41  ? 203  GFT B CAE 1 
HETATM 5782 C CAF . GFT B 1 203 ? 4.801   -1.564  -37.434 1.00 59.15  ? 203  GFT B CAF 1 
HETATM 5783 C CAG . GFT B 1 203 ? 7.501   -2.766  -36.773 1.00 72.09  ? 203  GFT B CAG 1 
HETATM 5784 C CAH . GFT B 1 203 ? 5.707   -0.848  -36.438 1.00 71.64  ? 203  GFT B CAH 1 
HETATM 5785 O OAI . GFT B 1 203 ? 7.960   -0.413  -37.293 1.00 59.10  ? 203  GFT B OAI 1 
HETATM 5786 C CAJ . GFT B 1 203 ? 7.221   -1.256  -36.447 1.00 78.09  ? 203  GFT B CAJ 1 
HETATM 5787 P PAK . GFT B 1 203 ? 9.364   0.352   -37.132 1.00 50.77  ? 203  GFT B PAK 1 
ATOM   5788 N N   . ALA B 1 204 ? 10.220  3.385   -39.227 1.00 44.94  ? 204  ALA B N   1 
ATOM   5789 C CA  . ALA B 1 204 ? 11.192  3.698   -40.267 1.00 45.55  ? 204  ALA B CA  1 
ATOM   5790 C C   . ALA B 1 204 ? 10.655  4.739   -41.251 1.00 42.82  ? 204  ALA B C   1 
ATOM   5791 O O   . ALA B 1 204 ? 11.436  5.497   -41.844 1.00 40.58  ? 204  ALA B O   1 
ATOM   5792 C CB  . ALA B 1 204 ? 11.618  2.440   -41.003 1.00 44.74  ? 204  ALA B CB  1 
ATOM   5793 N N   . GLY B 1 205 ? 9.333   4.778   -41.422 1.00 40.57  ? 205  GLY B N   1 
ATOM   5794 C CA  . GLY B 1 205 ? 8.704   5.831   -42.208 1.00 40.15  ? 205  GLY B CA  1 
ATOM   5795 C C   . GLY B 1 205 ? 8.995   7.207   -41.615 1.00 42.70  ? 205  GLY B C   1 
ATOM   5796 O O   . GLY B 1 205 ? 9.323   8.157   -42.346 1.00 44.53  ? 205  GLY B O   1 
ATOM   5797 N N   . ALA B 1 206 ? 8.885   7.310   -40.289 1.00 38.64  ? 206  ALA B N   1 
ATOM   5798 C CA  . ALA B 1 206 ? 9.202   8.543   -39.574 1.00 36.71  ? 206  ALA B CA  1 
ATOM   5799 C C   . ALA B 1 206 ? 10.674  8.956   -39.784 1.00 37.57  ? 206  ALA B C   1 
ATOM   5800 O O   . ALA B 1 206 ? 10.967  10.102  -40.172 1.00 39.28  ? 206  ALA B O   1 
ATOM   5801 C CB  . ALA B 1 206 ? 8.880   8.382   -38.105 1.00 36.41  ? 206  ALA B CB  1 
ATOM   5802 N N   . ALA B 1 207 ? 11.583  8.014   -39.530 1.00 37.43  ? 207  ALA B N   1 
ATOM   5803 C CA  . ALA B 1 207 ? 13.008  8.178   -39.815 1.00 37.13  ? 207  ALA B CA  1 
ATOM   5804 C C   . ALA B 1 207 ? 13.280  8.632   -41.256 1.00 38.58  ? 207  ALA B C   1 
ATOM   5805 O O   . ALA B 1 207 ? 14.119  9.512   -41.480 1.00 41.37  ? 207  ALA B O   1 
ATOM   5806 C CB  . ALA B 1 207 ? 13.743  6.891   -39.515 1.00 35.29  ? 207  ALA B CB  1 
ATOM   5807 N N   . SER B 1 208 ? 12.580  8.044   -42.230 1.00 39.27  ? 208  SER B N   1 
ATOM   5808 C CA  . SER B 1 208 ? 12.737  8.456   -43.638 1.00 40.94  ? 208  SER B CA  1 
ATOM   5809 C C   . SER B 1 208 ? 12.334  9.909   -43.801 1.00 37.54  ? 208  SER B C   1 
ATOM   5810 O O   . SER B 1 208 ? 13.056  10.689  -44.415 1.00 39.10  ? 208  SER B O   1 
ATOM   5811 C CB  . SER B 1 208 ? 11.899  7.587   -44.590 1.00 38.78  ? 208  SER B CB  1 
ATOM   5812 O OG  . SER B 1 208 ? 12.265  6.221   -44.520 1.00 38.54  ? 208  SER B OG  1 
ATOM   5813 N N   . VAL B 1 209 ? 11.165  10.265  -43.270 1.00 40.45  ? 209  VAL B N   1 
ATOM   5814 C CA  . VAL B 1 209 ? 10.741  11.663  -43.267 1.00 43.98  ? 209  VAL B CA  1 
ATOM   5815 C C   . VAL B 1 209 ? 11.848  12.546  -42.689 1.00 43.66  ? 209  VAL B C   1 
ATOM   5816 O O   . VAL B 1 209 ? 12.218  13.554  -43.305 1.00 41.61  ? 209  VAL B O   1 
ATOM   5817 C CB  . VAL B 1 209 ? 9.465   11.886  -42.462 1.00 35.86  ? 209  VAL B CB  1 
ATOM   5818 C CG1 . VAL B 1 209 ? 9.208   13.376  -42.334 1.00 37.04  ? 209  VAL B CG1 1 
ATOM   5819 C CG2 . VAL B 1 209 ? 8.289   11.187  -43.129 1.00 36.43  ? 209  VAL B CG2 1 
ATOM   5820 N N   . GLY B 1 210 ? 12.384  12.150  -41.530 1.00 38.25  ? 210  GLY B N   1 
ATOM   5821 C CA  . GLY B 1 210 ? 13.530  12.828  -40.941 1.00 41.27  ? 210  GLY B CA  1 
ATOM   5822 C C   . GLY B 1 210 ? 14.720  12.975  -41.885 1.00 44.75  ? 210  GLY B C   1 
ATOM   5823 O O   . GLY B 1 210 ? 15.367  14.034  -41.937 1.00 42.55  ? 210  GLY B O   1 
ATOM   5824 N N   . MET B 1 211 ? 15.016  11.931  -42.654 1.00 40.26  ? 211  MET B N   1 
ATOM   5825 C CA  . MET B 1 211 ? 16.135  12.029  -43.583 1.00 41.91  ? 211  MET B CA  1 
ATOM   5826 C C   . MET B 1 211 ? 15.868  12.979  -44.746 1.00 44.60  ? 211  MET B C   1 
ATOM   5827 O O   . MET B 1 211 ? 16.791  13.664  -45.218 1.00 44.75  ? 211  MET B O   1 
ATOM   5828 C CB  . MET B 1 211 ? 16.620  10.651  -44.028 1.00 40.11  ? 211  MET B CB  1 
ATOM   5829 C CG  . MET B 1 211 ? 17.653  10.097  -43.041 1.00 45.15  ? 211  MET B CG  1 
ATOM   5830 S SD  . MET B 1 211 ? 17.478  8.347   -42.808 1.00 55.90  ? 211  MET B SD  1 
ATOM   5831 C CE  . MET B 1 211 ? 17.911  8.176   -41.101 1.00 47.93  ? 211  MET B CE  1 
ATOM   5832 N N   . HIS B 1 212 ? 14.612  13.065  -45.181 1.00 39.20  ? 212  HIS B N   1 
ATOM   5833 C CA  . HIS B 1 212 ? 14.272  14.041  -46.214 1.00 41.14  ? 212  HIS B CA  1 
ATOM   5834 C C   . HIS B 1 212 ? 14.434  15.475  -45.702 1.00 44.00  ? 212  HIS B C   1 
ATOM   5835 O O   . HIS B 1 212 ? 14.807  16.359  -46.469 1.00 44.93  ? 212  HIS B O   1 
ATOM   5836 C CB  . HIS B 1 212 ? 12.887  13.776  -46.813 1.00 37.86  ? 212  HIS B CB  1 
ATOM   5837 C CG  . HIS B 1 212 ? 12.805  12.489  -47.577 1.00 42.61  ? 212  HIS B CG  1 
ATOM   5838 N ND1 . HIS B 1 212 ? 13.474  12.285  -48.768 1.00 37.65  ? 212  HIS B ND1 1 
ATOM   5839 C CD2 . HIS B 1 212 ? 12.125  11.342  -47.328 1.00 41.59  ? 212  HIS B CD2 1 
ATOM   5840 C CE1 . HIS B 1 212 ? 13.212  11.070  -49.218 1.00 38.36  ? 212  HIS B CE1 1 
ATOM   5841 N NE2 . HIS B 1 212 ? 12.391  10.479  -48.365 1.00 41.73  ? 212  HIS B NE2 1 
ATOM   5842 N N   . ILE B 1 213 ? 14.183  15.694  -44.408 1.00 42.17  ? 213  ILE B N   1 
ATOM   5843 C CA  . ILE B 1 213 ? 14.459  16.989  -43.774 1.00 43.66  ? 213  ILE B CA  1 
ATOM   5844 C C   . ILE B 1 213 ? 15.959  17.340  -43.785 1.00 48.25  ? 213  ILE B C   1 
ATOM   5845 O O   . ILE B 1 213 ? 16.344  18.489  -44.032 1.00 52.63  ? 213  ILE B O   1 
ATOM   5846 C CB  . ILE B 1 213 ? 13.918  17.029  -42.315 1.00 47.09  ? 213  ILE B CB  1 
ATOM   5847 C CG1 . ILE B 1 213 ? 12.387  17.142  -42.321 1.00 41.55  ? 213  ILE B CG1 1 
ATOM   5848 C CG2 . ILE B 1 213 ? 14.543  18.191  -41.505 1.00 39.56  ? 213  ILE B CG2 1 
ATOM   5849 C CD1 . ILE B 1 213 ? 11.726  16.642  -41.039 1.00 39.81  ? 213  ILE B CD1 1 
ATOM   5850 N N   . LEU B 1 214 ? 16.795  16.340  -43.527 1.00 45.01  ? 214  LEU B N   1 
ATOM   5851 C CA  . LEU B 1 214 ? 18.233  16.542  -43.398 1.00 43.69  ? 214  LEU B CA  1 
ATOM   5852 C C   . LEU B 1 214 ? 18.962  16.397  -44.733 1.00 47.14  ? 214  LEU B C   1 
ATOM   5853 O O   . LEU B 1 214 ? 20.195  16.427  -44.775 1.00 51.25  ? 214  LEU B O   1 
ATOM   5854 C CB  . LEU B 1 214 ? 18.820  15.542  -42.386 1.00 38.61  ? 214  LEU B CB  1 
ATOM   5855 C CG  . LEU B 1 214 ? 18.181  15.561  -40.996 1.00 43.11  ? 214  LEU B CG  1 
ATOM   5856 C CD1 . LEU B 1 214 ? 18.674  14.411  -40.128 1.00 41.47  ? 214  LEU B CD1 1 
ATOM   5857 C CD2 . LEU B 1 214 ? 18.451  16.902  -40.337 1.00 41.04  ? 214  LEU B CD2 1 
ATOM   5858 N N   . SER B 1 215 ? 18.220  16.215  -45.819 1.00 44.48  ? 215  SER B N   1 
ATOM   5859 C CA  . SER B 1 215 ? 18.866  16.064  -47.120 1.00 47.07  ? 215  SER B CA  1 
ATOM   5860 C C   . SER B 1 215 ? 18.426  17.153  -48.094 1.00 49.01  ? 215  SER B C   1 
ATOM   5861 O O   . SER B 1 215 ? 17.264  17.194  -48.511 1.00 55.12  ? 215  SER B O   1 
ATOM   5862 C CB  . SER B 1 215 ? 18.608  14.675  -47.699 1.00 48.68  ? 215  SER B CB  1 
ATOM   5863 O OG  . SER B 1 215 ? 19.531  14.382  -48.737 1.00 50.49  ? 215  SER B OG  1 
ATOM   5864 N N   . LEU B 1 216 ? 19.357  18.030  -48.463 1.00 53.21  ? 216  LEU B N   1 
ATOM   5865 C CA  . LEU B 1 216 ? 18.997  19.234  -49.215 1.00 53.41  ? 216  LEU B CA  1 
ATOM   5866 C C   . LEU B 1 216 ? 18.162  19.016  -50.489 1.00 53.53  ? 216  LEU B C   1 
ATOM   5867 O O   . LEU B 1 216 ? 17.163  19.710  -50.673 1.00 56.64  ? 216  LEU B O   1 
ATOM   5868 C CB  . LEU B 1 216 ? 20.215  20.122  -49.482 1.00 60.50  ? 216  LEU B CB  1 
ATOM   5869 C CG  . LEU B 1 216 ? 19.858  21.546  -49.938 1.00 70.73  ? 216  LEU B CG  1 
ATOM   5870 C CD1 . LEU B 1 216 ? 18.942  22.242  -48.921 1.00 58.77  ? 216  LEU B CD1 1 
ATOM   5871 C CD2 . LEU B 1 216 ? 21.112  22.383  -50.205 1.00 59.97  ? 216  LEU B CD2 1 
ATOM   5872 N N   . PRO B 1 217 ? 18.551  18.057  -51.363 1.00 53.64  ? 217  PRO B N   1 
ATOM   5873 C CA  . PRO B 1 217 ? 17.728  17.873  -52.572 1.00 52.58  ? 217  PRO B CA  1 
ATOM   5874 C C   . PRO B 1 217 ? 16.257  17.488  -52.307 1.00 52.64  ? 217  PRO B C   1 
ATOM   5875 O O   . PRO B 1 217 ? 15.409  17.780  -53.157 1.00 54.18  ? 217  PRO B O   1 
ATOM   5876 C CB  . PRO B 1 217 ? 18.457  16.750  -53.328 1.00 55.80  ? 217  PRO B CB  1 
ATOM   5877 C CG  . PRO B 1 217 ? 19.865  16.833  -52.849 1.00 45.34  ? 217  PRO B CG  1 
ATOM   5878 C CD  . PRO B 1 217 ? 19.758  17.204  -51.395 1.00 49.29  ? 217  PRO B CD  1 
ATOM   5879 N N   . SER B 1 218 ? 15.967  16.871  -51.155 1.00 56.17  ? 218  SER B N   1 
ATOM   5880 C CA  . SER B 1 218 ? 14.590  16.516  -50.772 1.00 48.58  ? 218  SER B CA  1 
ATOM   5881 C C   . SER B 1 218 ? 13.755  17.714  -50.340 1.00 49.21  ? 218  SER B C   1 
ATOM   5882 O O   . SER B 1 218 ? 12.537  17.713  -50.514 1.00 45.99  ? 218  SER B O   1 
ATOM   5883 C CB  . SER B 1 218 ? 14.581  15.478  -49.643 1.00 42.55  ? 218  SER B CB  1 
ATOM   5884 O OG  . SER B 1 218 ? 14.790  14.168  -50.137 1.00 46.80  ? 218  SER B OG  1 
ATOM   5885 N N   . ARG B 1 219 ? 14.417  18.728  -49.783 1.00 51.89  ? 219  ARG B N   1 
ATOM   5886 C CA  . ARG B 1 219 ? 13.736  19.860  -49.137 1.00 56.00  ? 219  ARG B CA  1 
ATOM   5887 C C   . ARG B 1 219 ? 12.819  20.702  -50.040 1.00 50.60  ? 219  ARG B C   1 
ATOM   5888 O O   . ARG B 1 219 ? 11.812  21.236  -49.577 1.00 59.48  ? 219  ARG B O   1 
ATOM   5889 C CB  . ARG B 1 219 ? 14.741  20.758  -48.395 1.00 52.34  ? 219  ARG B CB  1 
ATOM   5890 C CG  . ARG B 1 219 ? 15.274  20.151  -47.102 1.00 52.56  ? 219  ARG B CG  1 
ATOM   5891 C CD  . ARG B 1 219 ? 14.163  19.965  -46.062 1.00 55.47  ? 219  ARG B CD  1 
ATOM   5892 N NE  . ARG B 1 219 ? 13.711  21.236  -45.493 1.00 58.12  ? 219  ARG B NE  1 
ATOM   5893 C CZ  . ARG B 1 219 ? 14.400  21.938  -44.589 1.00 73.31  ? 219  ARG B CZ  1 
ATOM   5894 N NH1 . ARG B 1 219 ? 15.585  21.496  -44.152 1.00 56.99  ? 219  ARG B NH1 1 
ATOM   5895 N NH2 . ARG B 1 219 ? 13.912  23.087  -44.121 1.00 70.10  ? 219  ARG B NH2 1 
ATOM   5896 N N   . SER B 1 220 ? 13.147  20.816  -51.318 1.00 47.56  ? 220  SER B N   1 
ATOM   5897 C CA  . SER B 1 220 ? 12.281  21.548  -52.237 1.00 46.32  ? 220  SER B CA  1 
ATOM   5898 C C   . SER B 1 220 ? 11.008  20.773  -52.609 1.00 47.95  ? 220  SER B C   1 
ATOM   5899 O O   . SER B 1 220 ? 10.175  21.266  -53.364 1.00 51.42  ? 220  SER B O   1 
ATOM   5900 C CB  . SER B 1 220 ? 13.048  21.892  -53.514 1.00 49.89  ? 220  SER B CB  1 
ATOM   5901 O OG  . SER B 1 220 ? 13.621  20.727  -54.091 1.00 55.52  ? 220  SER B OG  1 
ATOM   5902 N N   . LEU B 1 221 ? 10.859  19.560  -52.097 1.00 47.87  ? 221  LEU B N   1 
ATOM   5903 C CA  . LEU B 1 221 ? 9.770   18.690  -52.537 1.00 47.90  ? 221  LEU B CA  1 
ATOM   5904 C C   . LEU B 1 221 ? 8.632   18.611  -51.522 1.00 46.79  ? 221  LEU B C   1 
ATOM   5905 O O   . LEU B 1 221 ? 7.637   17.924  -51.754 1.00 48.01  ? 221  LEU B O   1 
ATOM   5906 C CB  . LEU B 1 221 ? 10.299  17.280  -52.844 1.00 46.49  ? 221  LEU B CB  1 
ATOM   5907 C CG  . LEU B 1 221 ? 11.489  17.195  -53.808 1.00 45.06  ? 221  LEU B CG  1 
ATOM   5908 C CD1 . LEU B 1 221 ? 11.982  15.757  -53.924 1.00 44.67  ? 221  LEU B CD1 1 
ATOM   5909 C CD2 . LEU B 1 221 ? 11.108  17.740  -55.163 1.00 35.67  ? 221  LEU B CD2 1 
ATOM   5910 N N   . PHE B 1 222 ? 8.788   19.296  -50.390 1.00 47.31  ? 222  PHE B N   1 
ATOM   5911 C CA  . PHE B 1 222 ? 7.736   19.339  -49.371 1.00 47.33  ? 222  PHE B CA  1 
ATOM   5912 C C   . PHE B 1 222 ? 7.853   20.571  -48.465 1.00 45.18  ? 222  PHE B C   1 
ATOM   5913 O O   . PHE B 1 222 ? 8.879   21.251  -48.455 1.00 48.34  ? 222  PHE B O   1 
ATOM   5914 C CB  . PHE B 1 222 ? 7.727   18.047  -48.540 1.00 45.32  ? 222  PHE B CB  1 
ATOM   5915 C CG  . PHE B 1 222 ? 8.956   17.856  -47.694 1.00 47.73  ? 222  PHE B CG  1 
ATOM   5916 C CD1 . PHE B 1 222 ? 10.117  17.306  -48.241 1.00 41.78  ? 222  PHE B CD1 1 
ATOM   5917 C CD2 . PHE B 1 222 ? 8.952   18.223  -46.344 1.00 42.50  ? 222  PHE B CD2 1 
ATOM   5918 C CE1 . PHE B 1 222 ? 11.257  17.120  -47.460 1.00 42.96  ? 222  PHE B CE1 1 
ATOM   5919 C CE2 . PHE B 1 222 ? 10.081  18.044  -45.562 1.00 43.00  ? 222  PHE B CE2 1 
ATOM   5920 C CZ  . PHE B 1 222 ? 11.241  17.490  -46.118 1.00 44.92  ? 222  PHE B CZ  1 
ATOM   5921 N N   . HIS B 1 223 ? 6.804   20.846  -47.692 1.00 46.37  ? 223  HIS B N   1 
ATOM   5922 C CA  . HIS B 1 223 ? 6.762   22.064  -46.880 1.00 51.49  ? 223  HIS B CA  1 
ATOM   5923 C C   . HIS B 1 223 ? 6.635   21.802  -45.380 1.00 54.58  ? 223  HIS B C   1 
ATOM   5924 O O   . HIS B 1 223 ? 7.069   22.623  -44.565 1.00 63.46  ? 223  HIS B O   1 
ATOM   5925 C CB  . HIS B 1 223 ? 5.664   22.978  -47.419 1.00 50.50  ? 223  HIS B CB  1 
ATOM   5926 C CG  . HIS B 1 223 ? 5.726   23.125  -48.907 1.00 60.95  ? 223  HIS B CG  1 
ATOM   5927 N ND1 . HIS B 1 223 ? 5.154   22.209  -49.771 1.00 58.58  ? 223  HIS B ND1 1 
ATOM   5928 C CD2 . HIS B 1 223 ? 6.370   24.027  -49.690 1.00 57.25  ? 223  HIS B CD2 1 
ATOM   5929 C CE1 . HIS B 1 223 ? 5.415   22.559  -51.018 1.00 55.63  ? 223  HIS B CE1 1 
ATOM   5930 N NE2 . HIS B 1 223 ? 6.145   23.663  -50.997 1.00 61.22  ? 223  HIS B NE2 1 
ATOM   5931 N N   . ARG B 1 224 ? 6.093   20.633  -45.029 1.00 43.29  ? 224  ARG B N   1 
ATOM   5932 C CA  . ARG B 1 224 ? 5.827   20.280  -43.639 1.00 42.25  ? 224  ARG B CA  1 
ATOM   5933 C C   . ARG B 1 224 ? 6.053   18.791  -43.422 1.00 44.38  ? 224  ARG B C   1 
ATOM   5934 O O   . ARG B 1 224 ? 6.012   18.021  -44.387 1.00 43.65  ? 224  ARG B O   1 
ATOM   5935 C CB  . ARG B 1 224 ? 4.384   20.652  -43.270 1.00 46.87  ? 224  ARG B CB  1 
ATOM   5936 C CG  . ARG B 1 224 ? 4.244   22.083  -42.821 1.00 51.32  ? 224  ARG B CG  1 
ATOM   5937 C CD  . ARG B 1 224 ? 2.802   22.469  -42.622 1.00 56.86  ? 224  ARG B CD  1 
ATOM   5938 N NE  . ARG B 1 224 ? 2.090   22.571  -43.887 1.00 64.01  ? 224  ARG B NE  1 
ATOM   5939 C CZ  . ARG B 1 224 ? 2.131   23.639  -44.675 1.00 68.88  ? 224  ARG B CZ  1 
ATOM   5940 N NH1 . ARG B 1 224 ? 2.857   24.695  -44.321 1.00 69.67  ? 224  ARG B NH1 1 
ATOM   5941 N NH2 . ARG B 1 224 ? 1.455   23.647  -45.818 1.00 73.07  ? 224  ARG B NH2 1 
ATOM   5942 N N   . ALA B 1 225 ? 6.273   18.384  -42.166 1.00 36.21  ? 225  ALA B N   1 
ATOM   5943 C CA  . ALA B 1 225 ? 6.576   16.985  -41.866 1.00 35.66  ? 225  ALA B CA  1 
ATOM   5944 C C   . ALA B 1 225 ? 5.922   16.487  -40.598 1.00 39.76  ? 225  ALA B C   1 
ATOM   5945 O O   . ALA B 1 225 ? 5.746   17.242  -39.647 1.00 39.99  ? 225  ALA B O   1 
ATOM   5946 C CB  . ALA B 1 225 ? 8.084   16.764  -41.798 1.00 40.70  ? 225  ALA B CB  1 
ATOM   5947 N N   . VAL B 1 226 ? 5.575   15.201  -40.598 1.00 43.22  ? 226  VAL B N   1 
ATOM   5948 C CA  . VAL B 1 226 ? 5.045   14.529  -39.421 1.00 39.55  ? 226  VAL B CA  1 
ATOM   5949 C C   . VAL B 1 226 ? 5.836   13.253  -39.184 1.00 40.12  ? 226  VAL B C   1 
ATOM   5950 O O   . VAL B 1 226 ? 5.904   12.397  -40.061 1.00 40.58  ? 226  VAL B O   1 
ATOM   5951 C CB  . VAL B 1 226 ? 3.573   14.142  -39.598 1.00 38.67  ? 226  VAL B CB  1 
ATOM   5952 C CG1 . VAL B 1 226 ? 3.037   13.455  -38.316 1.00 31.47  ? 226  VAL B CG1 1 
ATOM   5953 C CG2 . VAL B 1 226 ? 2.736   15.364  -39.995 1.00 40.53  ? 226  VAL B CG2 1 
ATOM   5954 N N   . LEU B 1 227 ? 6.430   13.132  -38.001 1.00 39.83  ? 227  LEU B N   1 
ATOM   5955 C CA  . LEU B 1 227 ? 7.197   11.944  -37.650 1.00 36.88  ? 227  LEU B CA  1 
ATOM   5956 C C   . LEU B 1 227 ? 6.494   11.235  -36.506 1.00 44.09  ? 227  LEU B C   1 
ATOM   5957 O O   . LEU B 1 227 ? 6.431   11.764  -35.389 1.00 43.82  ? 227  LEU B O   1 
ATOM   5958 C CB  . LEU B 1 227 ? 8.636   12.297  -37.240 1.00 32.34  ? 227  LEU B CB  1 
ATOM   5959 C CG  . LEU B 1 227 ? 9.541   12.861  -38.347 1.00 41.73  ? 227  LEU B CG  1 
ATOM   5960 C CD1 . LEU B 1 227 ? 9.233   14.319  -38.702 1.00 33.21  ? 227  LEU B CD1 1 
ATOM   5961 C CD2 . LEU B 1 227 ? 11.003  12.709  -37.972 1.00 41.57  ? 227  LEU B CD2 1 
ATOM   5962 N N   . GLN B 1 228 ? 5.969   10.039  -36.772 1.00 42.91  ? 228  GLN B N   1 
ATOM   5963 C CA  . GLN B 1 228 ? 5.255   9.304   -35.736 1.00 41.08  ? 228  GLN B CA  1 
ATOM   5964 C C   . GLN B 1 228 ? 6.084   8.118   -35.242 1.00 43.98  ? 228  GLN B C   1 
ATOM   5965 O O   . GLN B 1 228 ? 6.290   7.141   -35.970 1.00 46.20  ? 228  GLN B O   1 
ATOM   5966 C CB  . GLN B 1 228 ? 3.887   8.834   -36.242 1.00 37.64  ? 228  GLN B CB  1 
ATOM   5967 C CG  . GLN B 1 228 ? 3.088   9.894   -36.999 1.00 34.81  ? 228  GLN B CG  1 
ATOM   5968 C CD  . GLN B 1 228 ? 1.805   9.323   -37.610 1.00 47.05  ? 228  GLN B CD  1 
ATOM   5969 O OE1 . GLN B 1 228 ? 1.169   9.951   -38.477 1.00 45.02  ? 228  GLN B OE1 1 
ATOM   5970 N NE2 . GLN B 1 228 ? 1.423   8.119   -37.161 1.00 42.47  ? 228  GLN B NE2 1 
ATOM   5971 N N   . SER B 1 229 ? 6.558   8.217   -34.003 1.00 37.52  ? 229  SER B N   1 
ATOM   5972 C CA  . SER B 1 229 ? 7.333   7.149   -33.364 1.00 42.25  ? 229  SER B CA  1 
ATOM   5973 C C   . SER B 1 229 ? 8.616   6.747   -34.089 1.00 38.42  ? 229  SER B C   1 
ATOM   5974 O O   . SER B 1 229 ? 8.976   5.570   -34.095 1.00 44.51  ? 229  SER B O   1 
ATOM   5975 C CB  . SER B 1 229 ? 6.474   5.897   -33.141 1.00 46.63  ? 229  SER B CB  1 
ATOM   5976 O OG  . SER B 1 229 ? 5.342   6.189   -32.346 1.00 45.85  ? 229  SER B OG  1 
ATOM   5977 N N   . GLY B 1 230 ? 9.312   7.705   -34.687 1.00 38.94  ? 230  GLY B N   1 
ATOM   5978 C CA  . GLY B 1 230 ? 10.593  7.403   -35.307 1.00 37.89  ? 230  GLY B CA  1 
ATOM   5979 C C   . GLY B 1 230 ? 11.356  8.669   -35.640 1.00 42.33  ? 230  GLY B C   1 
ATOM   5980 O O   . GLY B 1 230 ? 10.763  9.744   -35.829 1.00 45.54  ? 230  GLY B O   1 
ATOM   5981 N N   . THR B 1 231 ? 12.678  8.550   -35.715 1.00 40.67  ? 231  THR B N   1 
ATOM   5982 C CA  . THR B 1 231 ? 13.553  9.702   -35.961 1.00 41.22  ? 231  THR B CA  1 
ATOM   5983 C C   . THR B 1 231 ? 14.769  9.281   -36.774 1.00 37.36  ? 231  THR B C   1 
ATOM   5984 O O   . THR B 1 231 ? 15.158  8.116   -36.747 1.00 38.99  ? 231  THR B O   1 
ATOM   5985 C CB  . THR B 1 231 ? 14.074  10.337  -34.628 1.00 46.11  ? 231  THR B CB  1 
ATOM   5986 O OG1 . THR B 1 231 ? 14.773  9.349   -33.862 1.00 42.21  ? 231  THR B OG1 1 
ATOM   5987 C CG2 . THR B 1 231 ? 12.934  10.928  -33.787 1.00 39.88  ? 231  THR B CG2 1 
ATOM   5988 N N   . PRO B 1 232 ? 15.382  10.232  -37.492 1.00 40.82  ? 232  PRO B N   1 
ATOM   5989 C CA  . PRO B 1 232 ? 16.624  9.923   -38.224 1.00 39.75  ? 232  PRO B CA  1 
ATOM   5990 C C   . PRO B 1 232 ? 17.816  9.715   -37.290 1.00 44.94  ? 232  PRO B C   1 
ATOM   5991 O O   . PRO B 1 232 ? 18.659  8.852   -37.552 1.00 55.22  ? 232  PRO B O   1 
ATOM   5992 C CB  . PRO B 1 232 ? 16.835  11.154  -39.115 1.00 38.95  ? 232  PRO B CB  1 
ATOM   5993 C CG  . PRO B 1 232 ? 16.032  12.249  -38.459 1.00 40.96  ? 232  PRO B CG  1 
ATOM   5994 C CD  . PRO B 1 232 ? 14.862  11.578  -37.799 1.00 38.80  ? 232  PRO B CD  1 
ATOM   5995 N N   . ASN B 1 233 ? 17.881  10.497  -36.217 1.00 46.87  ? 233  ASN B N   1 
ATOM   5996 C CA  . ASN B 1 233 ? 18.899  10.320  -35.183 1.00 43.41  ? 233  ASN B CA  1 
ATOM   5997 C C   . ASN B 1 233 ? 18.571  9.058   -34.409 1.00 48.78  ? 233  ASN B C   1 
ATOM   5998 O O   . ASN B 1 233 ? 17.503  8.458   -34.604 1.00 44.58  ? 233  ASN B O   1 
ATOM   5999 C CB  . ASN B 1 233 ? 18.923  11.537  -34.246 1.00 42.00  ? 233  ASN B CB  1 
ATOM   6000 C CG  . ASN B 1 233 ? 17.542  11.853  -33.651 1.00 43.67  ? 233  ASN B CG  1 
ATOM   6001 O OD1 . ASN B 1 233 ? 16.608  12.238  -34.369 1.00 45.19  ? 233  ASN B OD1 1 
ATOM   6002 N ND2 . ASN B 1 233 ? 17.412  11.697  -32.335 1.00 42.44  ? 233  ASN B ND2 1 
ATOM   6003 N N   . GLY B 1 234 ? 19.472  8.630   -33.533 1.00 50.03  ? 234  GLY B N   1 
ATOM   6004 C CA  . GLY B 1 234 ? 19.179  7.434   -32.756 1.00 55.50  ? 234  GLY B CA  1 
ATOM   6005 C C   . GLY B 1 234 ? 19.812  6.144   -33.260 1.00 52.97  ? 234  GLY B C   1 
ATOM   6006 O O   . GLY B 1 234 ? 20.348  6.090   -34.374 1.00 54.47  ? 234  GLY B O   1 
ATOM   6007 N N   . PRO B 1 235 ? 19.722  5.088   -32.441 1.00 45.99  ? 235  PRO B N   1 
ATOM   6008 C CA  . PRO B 1 235 ? 20.586  3.900   -32.488 1.00 50.96  ? 235  PRO B CA  1 
ATOM   6009 C C   . PRO B 1 235 ? 20.344  2.910   -33.633 1.00 51.05  ? 235  PRO B C   1 
ATOM   6010 O O   . PRO B 1 235 ? 21.276  2.174   -33.974 1.00 51.99  ? 235  PRO B O   1 
ATOM   6011 C CB  . PRO B 1 235 ? 20.315  3.224   -31.128 1.00 52.66  ? 235  PRO B CB  1 
ATOM   6012 C CG  . PRO B 1 235 ? 18.945  3.661   -30.751 1.00 48.13  ? 235  PRO B CG  1 
ATOM   6013 C CD  . PRO B 1 235 ? 18.796  5.063   -31.292 1.00 44.21  ? 235  PRO B CD  1 
ATOM   6014 N N   . TRP B 1 236 ? 19.144  2.892   -34.214 1.00 44.92  ? 236  TRP B N   1 
ATOM   6015 C CA  . TRP B 1 236 ? 18.770  1.841   -35.173 1.00 40.33  ? 236  TRP B CA  1 
ATOM   6016 C C   . TRP B 1 236 ? 18.602  2.274   -36.642 1.00 47.27  ? 236  TRP B C   1 
ATOM   6017 O O   . TRP B 1 236 ? 18.614  1.431   -37.535 1.00 50.06  ? 236  TRP B O   1 
ATOM   6018 C CB  . TRP B 1 236 ? 17.481  1.156   -34.711 1.00 41.44  ? 236  TRP B CB  1 
ATOM   6019 C CG  . TRP B 1 236 ? 16.350  2.121   -34.543 1.00 46.62  ? 236  TRP B CG  1 
ATOM   6020 C CD1 . TRP B 1 236 ? 15.990  2.766   -33.395 1.00 45.49  ? 236  TRP B CD1 1 
ATOM   6021 C CD2 . TRP B 1 236 ? 15.437  2.567   -35.556 1.00 47.76  ? 236  TRP B CD2 1 
ATOM   6022 N NE1 . TRP B 1 236 ? 14.910  3.583   -33.628 1.00 42.05  ? 236  TRP B NE1 1 
ATOM   6023 C CE2 . TRP B 1 236 ? 14.548  3.483   -34.944 1.00 45.79  ? 236  TRP B CE2 1 
ATOM   6024 C CE3 . TRP B 1 236 ? 15.279  2.281   -36.918 1.00 48.37  ? 236  TRP B CE3 1 
ATOM   6025 C CZ2 . TRP B 1 236 ? 13.511  4.116   -35.648 1.00 42.33  ? 236  TRP B CZ2 1 
ATOM   6026 C CZ3 . TRP B 1 236 ? 14.250  2.914   -37.622 1.00 49.65  ? 236  TRP B CZ3 1 
ATOM   6027 C CH2 . TRP B 1 236 ? 13.379  3.819   -36.982 1.00 47.02  ? 236  TRP B CH2 1 
ATOM   6028 N N   . ALA B 1 237 ? 18.444  3.573   -36.892 1.00 49.16  ? 237  ALA B N   1 
ATOM   6029 C CA  . ALA B 1 237 ? 18.057  4.072   -38.222 1.00 46.80  ? 237  ALA B CA  1 
ATOM   6030 C C   . ALA B 1 237 ? 19.208  4.376   -39.200 1.00 45.98  ? 237  ALA B C   1 
ATOM   6031 O O   . ALA B 1 237 ? 18.975  4.507   -40.405 1.00 46.13  ? 237  ALA B O   1 
ATOM   6032 C CB  . ALA B 1 237 ? 17.136  5.309   -38.080 1.00 45.09  ? 237  ALA B CB  1 
ATOM   6033 N N   . THR B 1 238 ? 20.434  4.525   -38.698 1.00 42.56  ? 238  THR B N   1 
ATOM   6034 C CA  . THR B 1 238 ? 21.583  4.684   -39.592 1.00 41.88  ? 238  THR B CA  1 
ATOM   6035 C C   . THR B 1 238 ? 22.730  3.733   -39.269 1.00 48.64  ? 238  THR B C   1 
ATOM   6036 O O   . THR B 1 238 ? 22.772  3.117   -38.199 1.00 52.57  ? 238  THR B O   1 
ATOM   6037 C CB  . THR B 1 238 ? 22.140  6.129   -39.638 1.00 42.53  ? 238  THR B CB  1 
ATOM   6038 O OG1 . THR B 1 238 ? 22.522  6.556   -38.322 1.00 51.79  ? 238  THR B OG1 1 
ATOM   6039 C CG2 . THR B 1 238 ? 21.119  7.081   -40.207 1.00 42.89  ? 238  THR B CG2 1 
ATOM   6040 N N   . VAL B 1 239 ? 23.659  3.620   -40.213 1.00 47.38  ? 239  VAL B N   1 
ATOM   6041 C CA  . VAL B 1 239 ? 24.911  2.914   -39.982 1.00 43.84  ? 239  VAL B CA  1 
ATOM   6042 C C   . VAL B 1 239 ? 26.055  3.704   -40.604 1.00 46.90  ? 239  VAL B C   1 
ATOM   6043 O O   . VAL B 1 239 ? 25.853  4.504   -41.525 1.00 49.90  ? 239  VAL B O   1 
ATOM   6044 C CB  . VAL B 1 239 ? 24.880  1.463   -40.532 1.00 47.60  ? 239  VAL B CB  1 
ATOM   6045 C CG1 . VAL B 1 239 ? 24.125  0.546   -39.571 1.00 40.67  ? 239  VAL B CG1 1 
ATOM   6046 C CG2 . VAL B 1 239 ? 24.248  1.437   -41.921 1.00 42.94  ? 239  VAL B CG2 1 
ATOM   6047 N N   . SER B 1 240 ? 27.254  3.509   -40.072 1.00 52.17  ? 240  SER B N   1 
ATOM   6048 C CA  . SER B 1 240 ? 28.443  4.087   -40.683 1.00 51.17  ? 240  SER B CA  1 
ATOM   6049 C C   . SER B 1 240 ? 28.714  3.367   -41.997 1.00 49.47  ? 240  SER B C   1 
ATOM   6050 O O   . SER B 1 240 ? 28.229  2.242   -42.209 1.00 45.70  ? 240  SER B O   1 
ATOM   6051 C CB  . SER B 1 240 ? 29.636  3.891   -39.767 1.00 48.92  ? 240  SER B CB  1 
ATOM   6052 O OG  . SER B 1 240 ? 29.790  2.512   -39.463 1.00 51.46  ? 240  SER B OG  1 
ATOM   6053 N N   . ALA B 1 241 ? 29.489  4.006   -42.871 1.00 49.26  ? 241  ALA B N   1 
ATOM   6054 C CA  . ALA B 1 241 ? 29.910  3.370   -44.120 1.00 50.39  ? 241  ALA B CA  1 
ATOM   6055 C C   . ALA B 1 241 ? 30.656  2.079   -43.833 1.00 50.88  ? 241  ALA B C   1 
ATOM   6056 O O   . ALA B 1 241 ? 30.418  1.064   -44.500 1.00 54.57  ? 241  ALA B O   1 
ATOM   6057 C CB  . ALA B 1 241 ? 30.768  4.308   -44.950 1.00 34.98  ? 241  ALA B CB  1 
ATOM   6058 N N   . GLY B 1 242 ? 31.547  2.119   -42.838 1.00 50.46  ? 242  GLY B N   1 
ATOM   6059 C CA  . GLY B 1 242 ? 32.315  0.949   -42.444 1.00 42.60  ? 242  GLY B CA  1 
ATOM   6060 C C   . GLY B 1 242 ? 31.445  -0.242  -42.095 1.00 50.45  ? 242  GLY B C   1 
ATOM   6061 O O   . GLY B 1 242 ? 31.691  -1.376  -42.522 1.00 58.71  ? 242  GLY B O   1 
ATOM   6062 N N   . GLU B 1 243 ? 30.410  0.021   -41.315 1.00 52.76  ? 243  GLU B N   1 
ATOM   6063 C CA  . GLU B 1 243 ? 29.533  -1.037  -40.855 1.00 54.29  ? 243  GLU B CA  1 
ATOM   6064 C C   . GLU B 1 243 ? 28.641  -1.563  -41.985 1.00 55.52  ? 243  GLU B C   1 
ATOM   6065 O O   . GLU B 1 243 ? 28.296  -2.750  -42.012 1.00 53.15  ? 243  GLU B O   1 
ATOM   6066 C CB  . GLU B 1 243 ? 28.705  -0.540  -39.663 1.00 52.01  ? 243  GLU B CB  1 
ATOM   6067 C CG  . GLU B 1 243 ? 27.704  -1.537  -39.113 1.00 51.82  ? 243  GLU B CG  1 
ATOM   6068 C CD  . GLU B 1 243 ? 28.356  -2.753  -38.480 1.00 53.71  ? 243  GLU B CD  1 
ATOM   6069 O OE1 . GLU B 1 243 ? 29.605  -2.787  -38.335 1.00 59.34  ? 243  GLU B OE1 1 
ATOM   6070 O OE2 . GLU B 1 243 ? 27.603  -3.680  -38.112 1.00 46.99  ? 243  GLU B OE2 1 
ATOM   6071 N N   . ALA B 1 244 ? 28.278  -0.691  -42.923 1.00 54.09  ? 244  ALA B N   1 
ATOM   6072 C CA  . ALA B 1 244 ? 27.444  -1.115  -44.055 1.00 55.85  ? 244  ALA B CA  1 
ATOM   6073 C C   . ALA B 1 244 ? 28.252  -2.000  -45.005 1.00 53.70  ? 244  ALA B C   1 
ATOM   6074 O O   . ALA B 1 244 ? 27.761  -3.021  -45.498 1.00 49.03  ? 244  ALA B O   1 
ATOM   6075 C CB  . ALA B 1 244 ? 26.868  0.085   -44.789 1.00 43.80  ? 244  ALA B CB  1 
ATOM   6076 N N   . ARG B 1 245 ? 29.498  -1.598  -45.250 1.00 55.84  ? 245  ARG B N   1 
ATOM   6077 C CA  . ARG B 1 245 ? 30.427  -2.401  -46.035 1.00 54.92  ? 245  ARG B CA  1 
ATOM   6078 C C   . ARG B 1 245 ? 30.639  -3.765  -45.388 1.00 56.65  ? 245  ARG B C   1 
ATOM   6079 O O   . ARG B 1 245 ? 30.685  -4.791  -46.069 1.00 58.13  ? 245  ARG B O   1 
ATOM   6080 C CB  . ARG B 1 245 ? 31.759  -1.674  -46.182 1.00 56.58  ? 245  ARG B CB  1 
ATOM   6081 C CG  . ARG B 1 245 ? 32.797  -2.459  -46.954 1.00 54.58  ? 245  ARG B CG  1 
ATOM   6082 C CD  . ARG B 1 245 ? 33.971  -1.577  -47.314 1.00 49.95  ? 245  ARG B CD  1 
ATOM   6083 N NE  . ARG B 1 245 ? 33.611  -0.519  -48.259 1.00 58.03  ? 245  ARG B NE  1 
ATOM   6084 C CZ  . ARG B 1 245 ? 33.602  -0.667  -49.585 1.00 64.90  ? 245  ARG B CZ  1 
ATOM   6085 N NH1 . ARG B 1 245 ? 33.916  -1.834  -50.137 1.00 61.93  ? 245  ARG B NH1 1 
ATOM   6086 N NH2 . ARG B 1 245 ? 33.275  0.354   -50.366 1.00 66.02  ? 245  ARG B NH2 1 
ATOM   6087 N N   . ARG B 1 246 ? 30.754  -3.768  -44.066 1.00 52.57  ? 246  ARG B N   1 
ATOM   6088 C CA  . ARG B 1 246 ? 31.001  -4.989  -43.330 1.00 56.75  ? 246  ARG B CA  1 
ATOM   6089 C C   . ARG B 1 246 ? 29.827  -5.947  -43.522 1.00 59.26  ? 246  ARG B C   1 
ATOM   6090 O O   . ARG B 1 246 ? 30.013  -7.140  -43.785 1.00 58.30  ? 246  ARG B O   1 
ATOM   6091 C CB  . ARG B 1 246 ? 31.190  -4.659  -41.845 1.00 62.44  ? 246  ARG B CB  1 
ATOM   6092 C CG  . ARG B 1 246 ? 31.699  -5.810  -41.002 1.00 54.72  ? 246  ARG B CG  1 
ATOM   6093 C CD  . ARG B 1 246 ? 31.160  -5.730  -39.586 1.00 50.36  ? 246  ARG B CD  1 
ATOM   6094 N NE  . ARG B 1 246 ? 30.440  -6.957  -39.286 1.00 59.58  ? 246  ARG B NE  1 
ATOM   6095 C CZ  . ARG B 1 246 ? 29.174  -7.018  -38.892 1.00 59.66  ? 246  ARG B CZ  1 
ATOM   6096 N NH1 . ARG B 1 246 ? 28.474  -5.907  -38.715 1.00 57.90  ? 246  ARG B NH1 1 
ATOM   6097 N NH2 . ARG B 1 246 ? 28.614  -8.199  -38.658 1.00 62.48  ? 246  ARG B NH2 1 
ATOM   6098 N N   . ARG B 1 247 ? 28.613  -5.416  -43.416 1.00 60.00  ? 247  ARG B N   1 
ATOM   6099 C CA  . ARG B 1 247 ? 27.422  -6.255  -43.502 1.00 57.32  ? 247  ARG B CA  1 
ATOM   6100 C C   . ARG B 1 247 ? 27.186  -6.763  -44.927 1.00 56.59  ? 247  ARG B C   1 
ATOM   6101 O O   . ARG B 1 247 ? 26.822  -7.931  -45.120 1.00 52.40  ? 247  ARG B O   1 
ATOM   6102 C CB  . ARG B 1 247 ? 26.195  -5.518  -42.950 1.00 53.26  ? 247  ARG B CB  1 
ATOM   6103 C CG  . ARG B 1 247 ? 26.306  -5.147  -41.471 1.00 50.38  ? 247  ARG B CG  1 
ATOM   6104 C CD  . ARG B 1 247 ? 25.021  -4.545  -40.981 1.00 46.08  ? 247  ARG B CD  1 
ATOM   6105 N NE  . ARG B 1 247 ? 25.118  -3.939  -39.660 1.00 55.44  ? 247  ARG B NE  1 
ATOM   6106 C CZ  . ARG B 1 247 ? 24.082  -3.401  -39.021 1.00 56.59  ? 247  ARG B CZ  1 
ATOM   6107 N NH1 . ARG B 1 247 ? 22.884  -3.407  -39.601 1.00 49.19  ? 247  ARG B NH1 1 
ATOM   6108 N NH2 . ARG B 1 247 ? 24.241  -2.858  -37.814 1.00 44.21  ? 247  ARG B NH2 1 
ATOM   6109 N N   . ALA B 1 248 ? 27.411  -5.889  -45.913 1.00 53.54  ? 248  ALA B N   1 
ATOM   6110 C CA  . ALA B 1 248 ? 27.313  -6.266  -47.325 1.00 54.85  ? 248  ALA B CA  1 
ATOM   6111 C C   . ALA B 1 248 ? 28.297  -7.392  -47.694 1.00 61.14  ? 248  ALA B C   1 
ATOM   6112 O O   . ALA B 1 248 ? 27.878  -8.434  -48.219 1.00 56.49  ? 248  ALA B O   1 
ATOM   6113 C CB  . ALA B 1 248 ? 27.521  -5.051  -48.227 1.00 42.44  ? 248  ALA B CB  1 
ATOM   6114 N N   . THR B 1 249 ? 29.590  -7.185  -47.416 1.00 57.94  ? 249  THR B N   1 
ATOM   6115 C CA  . THR B 1 249 ? 30.604  -8.198  -47.718 1.00 55.09  ? 249  THR B CA  1 
ATOM   6116 C C   . THR B 1 249 ? 30.326  -9.522  -46.989 1.00 57.58  ? 249  THR B C   1 
ATOM   6117 O O   . THR B 1 249 ? 30.563  -10.598 -47.544 1.00 61.60  ? 249  THR B O   1 
ATOM   6118 C CB  . THR B 1 249 ? 32.063  -7.714  -47.455 1.00 53.11  ? 249  THR B CB  1 
ATOM   6119 O OG1 . THR B 1 249 ? 32.313  -7.660  -46.052 1.00 73.07  ? 249  THR B OG1 1 
ATOM   6120 C CG2 . THR B 1 249 ? 32.319  -6.331  -48.075 1.00 48.91  ? 249  THR B CG2 1 
ATOM   6121 N N   . LEU B 1 250 ? 29.796  -9.444  -45.768 1.00 54.18  ? 250  LEU B N   1 
ATOM   6122 C CA  . LEU B 1 250 ? 29.425  -10.645 -45.018 1.00 55.70  ? 250  LEU B CA  1 
ATOM   6123 C C   . LEU B 1 250 ? 28.227  -11.380 -45.629 1.00 58.47  ? 250  LEU B C   1 
ATOM   6124 O O   . LEU B 1 250 ? 28.123  -12.614 -45.543 1.00 63.58  ? 250  LEU B O   1 
ATOM   6125 C CB  . LEU B 1 250 ? 29.159  -10.315 -43.541 1.00 54.50  ? 250  LEU B CB  1 
ATOM   6126 C CG  . LEU B 1 250 ? 28.540  -11.435 -42.682 1.00 57.38  ? 250  LEU B CG  1 
ATOM   6127 C CD1 . LEU B 1 250 ? 29.403  -12.695 -42.691 1.00 50.25  ? 250  LEU B CD1 1 
ATOM   6128 C CD2 . LEU B 1 250 ? 28.302  -10.975 -41.252 1.00 58.98  ? 250  LEU B CD2 1 
ATOM   6129 N N   . LEU B 1 251 ? 27.317  -10.633 -46.245 1.00 62.07  ? 251  LEU B N   1 
ATOM   6130 C CA  . LEU B 1 251 ? 26.161  -11.263 -46.875 1.00 60.12  ? 251  LEU B CA  1 
ATOM   6131 C C   . LEU B 1 251 ? 26.580  -11.890 -48.199 1.00 59.91  ? 251  LEU B C   1 
ATOM   6132 O O   . LEU B 1 251 ? 26.103  -12.970 -48.561 1.00 62.64  ? 251  LEU B O   1 
ATOM   6133 C CB  . LEU B 1 251 ? 25.022  -10.265 -47.086 1.00 61.05  ? 251  LEU B CB  1 
ATOM   6134 C CG  . LEU B 1 251 ? 23.810  -10.922 -47.752 1.00 58.97  ? 251  LEU B CG  1 
ATOM   6135 C CD1 . LEU B 1 251 ? 22.774  -11.328 -46.723 1.00 53.39  ? 251  LEU B CD1 1 
ATOM   6136 C CD2 . LEU B 1 251 ? 23.227  -10.026 -48.834 1.00 59.66  ? 251  LEU B CD2 1 
ATOM   6137 N N   . ALA B 1 252 ? 27.485  -11.213 -48.907 1.00 59.26  ? 252  ALA B N   1 
ATOM   6138 C CA  . ALA B 1 252 ? 28.051  -11.739 -50.148 1.00 64.01  ? 252  ALA B CA  1 
ATOM   6139 C C   . ALA B 1 252 ? 28.785  -13.057 -49.882 1.00 69.77  ? 252  ALA B C   1 
ATOM   6140 O O   . ALA B 1 252 ? 28.657  -14.016 -50.644 1.00 72.63  ? 252  ALA B O   1 
ATOM   6141 C CB  . ALA B 1 252 ? 28.991  -10.721 -50.773 1.00 61.46  ? 252  ALA B CB  1 
ATOM   6142 N N   . ARG B 1 253 ? 29.546  -13.096 -48.793 1.00 65.55  ? 253  ARG B N   1 
ATOM   6143 C CA  . ARG B 1 253 ? 30.229  -14.312 -48.386 1.00 68.40  ? 253  ARG B CA  1 
ATOM   6144 C C   . ARG B 1 253 ? 29.211  -15.417 -48.088 1.00 66.93  ? 253  ARG B C   1 
ATOM   6145 O O   . ARG B 1 253 ? 29.397  -16.573 -48.472 1.00 71.66  ? 253  ARG B O   1 
ATOM   6146 C CB  . ARG B 1 253 ? 31.101  -14.036 -47.156 1.00 69.69  ? 253  ARG B CB  1 
ATOM   6147 C CG  . ARG B 1 253 ? 31.740  -15.266 -46.548 1.00 74.22  ? 253  ARG B CG  1 
ATOM   6148 C CD  . ARG B 1 253 ? 32.119  -15.046 -45.088 1.00 75.76  ? 253  ARG B CD  1 
ATOM   6149 N NE  . ARG B 1 253 ? 32.752  -16.238 -44.529 1.00 96.98  ? 253  ARG B NE  1 
ATOM   6150 C CZ  . ARG B 1 253 ? 32.146  -17.104 -43.719 1.00 106.66 ? 253  ARG B CZ  1 
ATOM   6151 N NH1 . ARG B 1 253 ? 30.885  -16.906 -43.348 1.00 91.19  ? 253  ARG B NH1 1 
ATOM   6152 N NH2 . ARG B 1 253 ? 32.809  -18.165 -43.271 1.00 108.68 ? 253  ARG B NH2 1 
ATOM   6153 N N   . LEU B 1 254 ? 28.127  -15.050 -47.418 1.00 65.29  ? 254  LEU B N   1 
ATOM   6154 C CA  . LEU B 1 254 ? 27.122  -16.018 -46.997 1.00 65.63  ? 254  LEU B CA  1 
ATOM   6155 C C   . LEU B 1 254 ? 26.345  -16.624 -48.161 1.00 69.37  ? 254  LEU B C   1 
ATOM   6156 O O   . LEU B 1 254 ? 25.754  -17.699 -48.022 1.00 69.58  ? 254  LEU B O   1 
ATOM   6157 C CB  . LEU B 1 254 ? 26.151  -15.375 -46.000 1.00 69.29  ? 254  LEU B CB  1 
ATOM   6158 C CG  . LEU B 1 254 ? 26.590  -15.317 -44.537 1.00 68.64  ? 254  LEU B CG  1 
ATOM   6159 C CD1 . LEU B 1 254 ? 25.643  -14.454 -43.721 1.00 72.76  ? 254  LEU B CD1 1 
ATOM   6160 C CD2 . LEU B 1 254 ? 26.638  -16.719 -43.964 1.00 71.24  ? 254  LEU B CD2 1 
ATOM   6161 N N   . VAL B 1 255 ? 26.327  -15.938 -49.302 1.00 66.80  ? 255  VAL B N   1 
ATOM   6162 C CA  . VAL B 1 255 ? 25.602  -16.474 -50.459 1.00 73.21  ? 255  VAL B CA  1 
ATOM   6163 C C   . VAL B 1 255 ? 26.519  -16.946 -51.597 1.00 70.12  ? 255  VAL B C   1 
ATOM   6164 O O   . VAL B 1 255 ? 26.034  -17.390 -52.639 1.00 76.78  ? 255  VAL B O   1 
ATOM   6165 C CB  . VAL B 1 255 ? 24.490  -15.507 -51.000 1.00 68.88  ? 255  VAL B CB  1 
ATOM   6166 C CG1 . VAL B 1 255 ? 23.553  -15.093 -49.881 1.00 62.08  ? 255  VAL B CG1 1 
ATOM   6167 C CG2 . VAL B 1 255 ? 25.090  -14.287 -51.697 1.00 55.17  ? 255  VAL B CG2 1 
ATOM   6168 N N   . GLY B 1 256 ? 27.832  -16.841 -51.397 1.00 70.19  ? 256  GLY B N   1 
ATOM   6169 C CA  . GLY B 1 256 ? 28.793  -17.403 -52.327 1.00 62.05  ? 256  GLY B CA  1 
ATOM   6170 C C   . GLY B 1 256 ? 29.596  -16.425 -53.163 1.00 69.73  ? 256  GLY B C   1 
ATOM   6171 O O   . GLY B 1 256 ? 30.078  -16.786 -54.235 1.00 75.60  ? 256  GLY B O   1 
ATOM   6172 N N   . CYS B 1 257 ? 29.783  -15.201 -52.681 1.00 65.99  ? 257  CYS B N   1 
ATOM   6173 C CA  . CYS B 1 257 ? 30.460  -14.194 -53.500 1.00 71.24  ? 257  CYS B CA  1 
ATOM   6174 C C   . CYS B 1 257 ? 31.739  -13.632 -52.888 1.00 73.10  ? 257  CYS B C   1 
ATOM   6175 O O   . CYS B 1 257 ? 32.786  -13.616 -53.540 1.00 73.41  ? 257  CYS B O   1 
ATOM   6176 C CB  . CYS B 1 257 ? 29.488  -13.063 -53.881 1.00 76.79  ? 257  CYS B CB  1 
ATOM   6177 S SG  . CYS B 1 257 ? 28.006  -13.622 -54.820 1.00 98.28  ? 257  CYS B SG  1 
ATOM   6178 N N   . ASN B 1 265 ? 37.319  -6.851  -54.816 1.00 76.77  ? 265  ASN B N   1 
ATOM   6179 C CA  . ASN B 1 265 ? 36.812  -5.837  -55.746 1.00 88.63  ? 265  ASN B CA  1 
ATOM   6180 C C   . ASN B 1 265 ? 35.287  -5.649  -55.679 1.00 84.21  ? 265  ASN B C   1 
ATOM   6181 O O   . ASN B 1 265 ? 34.527  -6.628  -55.767 1.00 78.47  ? 265  ASN B O   1 
ATOM   6182 C CB  . ASN B 1 265 ? 37.242  -6.170  -57.176 1.00 87.99  ? 265  ASN B CB  1 
ATOM   6183 C CG  . ASN B 1 265 ? 36.777  -5.134  -58.182 1.00 94.48  ? 265  ASN B CG  1 
ATOM   6184 O OD1 . ASN B 1 265 ? 35.996  -5.439  -59.089 1.00 90.77  ? 265  ASN B OD1 1 
ATOM   6185 N ND2 . ASN B 1 265 ? 37.254  -3.898  -58.027 1.00 90.97  ? 265  ASN B ND2 1 
ATOM   6186 N N   . ASP B 1 266 ? 34.850  -4.396  -55.528 1.00 81.09  ? 266  ASP B N   1 
ATOM   6187 C CA  . ASP B 1 266 ? 33.417  -4.075  -55.425 1.00 74.71  ? 266  ASP B CA  1 
ATOM   6188 C C   . ASP B 1 266 ? 32.599  -4.553  -56.626 1.00 70.45  ? 266  ASP B C   1 
ATOM   6189 O O   . ASP B 1 266 ? 31.638  -5.302  -56.460 1.00 66.97  ? 266  ASP B O   1 
ATOM   6190 C CB  . ASP B 1 266 ? 33.193  -2.573  -55.200 1.00 69.82  ? 266  ASP B CB  1 
ATOM   6191 C CG  . ASP B 1 266 ? 33.511  -2.136  -53.768 1.00 80.00  ? 266  ASP B CG  1 
ATOM   6192 O OD1 . ASP B 1 266 ? 33.658  -3.025  -52.888 1.00 73.90  ? 266  ASP B OD1 1 
ATOM   6193 O OD2 . ASP B 1 266 ? 33.607  -0.903  -53.519 1.00 66.37  ? 266  ASP B OD2 1 
ATOM   6194 N N   . THR B 1 267 ? 33.001  -4.131  -57.825 1.00 75.24  ? 267  THR B N   1 
ATOM   6195 C CA  . THR B 1 267 ? 32.304  -4.478  -59.070 1.00 70.98  ? 267  THR B CA  1 
ATOM   6196 C C   . THR B 1 267 ? 32.059  -5.985  -59.252 1.00 69.55  ? 267  THR B C   1 
ATOM   6197 O O   . THR B 1 267 ? 30.964  -6.406  -59.658 1.00 67.15  ? 267  THR B O   1 
ATOM   6198 C CB  . THR B 1 267 ? 33.063  -3.937  -60.304 1.00 70.88  ? 267  THR B CB  1 
ATOM   6199 O OG1 . THR B 1 267 ? 33.509  -2.596  -60.054 1.00 70.68  ? 267  THR B OG1 1 
ATOM   6200 C CG2 . THR B 1 267 ? 32.180  -3.964  -61.536 1.00 67.44  ? 267  THR B CG2 1 
ATOM   6201 N N   . GLU B 1 268 ? 33.074  -6.788  -58.943 1.00 72.83  ? 268  GLU B N   1 
ATOM   6202 C CA  . GLU B 1 268 ? 32.981  -8.238  -59.069 1.00 70.77  ? 268  GLU B CA  1 
ATOM   6203 C C   . GLU B 1 268 ? 31.991  -8.792  -58.055 1.00 67.16  ? 268  GLU B C   1 
ATOM   6204 O O   . GLU B 1 268 ? 31.184  -9.678  -58.362 1.00 65.23  ? 268  GLU B O   1 
ATOM   6205 C CB  . GLU B 1 268 ? 34.356  -8.889  -58.853 1.00 84.72  ? 268  GLU B CB  1 
ATOM   6206 C CG  . GLU B 1 268 ? 35.306  -8.835  -60.061 1.00 104.77 ? 268  GLU B CG  1 
ATOM   6207 C CD  . GLU B 1 268 ? 36.651  -9.528  -59.800 1.00 124.25 ? 268  GLU B CD  1 
ATOM   6208 O OE1 . GLU B 1 268 ? 37.466  -8.978  -59.022 1.00 117.85 ? 268  GLU B OE1 1 
ATOM   6209 O OE2 . GLU B 1 268 ? 36.895  -10.616 -60.377 1.00 113.83 ? 268  GLU B OE2 1 
ATOM   6210 N N   . LEU B 1 269 ? 32.062  -8.260  -56.839 1.00 73.20  ? 269  LEU B N   1 
ATOM   6211 C CA  . LEU B 1 269 ? 31.214  -8.713  -55.739 1.00 65.92  ? 269  LEU B CA  1 
ATOM   6212 C C   . LEU B 1 269 ? 29.735  -8.435  -56.010 1.00 64.14  ? 269  LEU B C   1 
ATOM   6213 O O   . LEU B 1 269 ? 28.883  -9.308  -55.821 1.00 63.50  ? 269  LEU B O   1 
ATOM   6214 C CB  . LEU B 1 269 ? 31.640  -8.024  -54.444 1.00 66.85  ? 269  LEU B CB  1 
ATOM   6215 C CG  . LEU B 1 269 ? 30.973  -8.546  -53.177 1.00 67.62  ? 269  LEU B CG  1 
ATOM   6216 C CD1 . LEU B 1 269 ? 32.004  -9.206  -52.282 1.00 81.44  ? 269  LEU B CD1 1 
ATOM   6217 C CD2 . LEU B 1 269 ? 30.285  -7.409  -52.466 1.00 65.45  ? 269  LEU B CD2 1 
ATOM   6218 N N   . ILE B 1 270 ? 29.434  -7.219  -56.461 1.00 60.84  ? 270  ILE B N   1 
ATOM   6219 C CA  . ILE B 1 270 ? 28.053  -6.833  -56.715 1.00 66.33  ? 270  ILE B CA  1 
ATOM   6220 C C   . ILE B 1 270 ? 27.473  -7.531  -57.945 1.00 67.81  ? 270  ILE B C   1 
ATOM   6221 O O   . ILE B 1 270 ? 26.308  -7.963  -57.927 1.00 59.97  ? 270  ILE B O   1 
ATOM   6222 C CB  . ILE B 1 270 ? 27.912  -5.316  -56.820 1.00 69.63  ? 270  ILE B CB  1 
ATOM   6223 C CG1 . ILE B 1 270 ? 28.447  -4.682  -55.538 1.00 66.01  ? 270  ILE B CG1 1 
ATOM   6224 C CG2 . ILE B 1 270 ? 26.450  -4.936  -57.025 1.00 68.97  ? 270  ILE B CG2 1 
ATOM   6225 C CD1 . ILE B 1 270 ? 28.810  -3.234  -55.682 1.00 76.62  ? 270  ILE B CD1 1 
ATOM   6226 N N   . ALA B 1 271 ? 28.286  -7.653  -58.997 1.00 64.43  ? 271  ALA B N   1 
ATOM   6227 C CA  . ALA B 1 271 ? 27.902  -8.444  -60.163 1.00 62.74  ? 271  ALA B CA  1 
ATOM   6228 C C   . ALA B 1 271 ? 27.410  -9.831  -59.748 1.00 60.78  ? 271  ALA B C   1 
ATOM   6229 O O   . ALA B 1 271 ? 26.408  -10.329 -60.269 1.00 65.57  ? 271  ALA B O   1 
ATOM   6230 C CB  . ALA B 1 271 ? 29.050  -8.567  -61.114 1.00 59.87  ? 271  ALA B CB  1 
ATOM   6231 N N   . CYS B 1 272 ? 28.105  -10.448 -58.800 1.00 58.62  ? 272  CYS B N   1 
ATOM   6232 C CA  . CYS B 1 272 ? 27.710  -11.773 -58.336 1.00 64.21  ? 272  CYS B CA  1 
ATOM   6233 C C   . CYS B 1 272 ? 26.419  -11.749 -57.514 1.00 63.70  ? 272  CYS B C   1 
ATOM   6234 O O   . CYS B 1 272 ? 25.597  -12.661 -57.648 1.00 62.26  ? 272  CYS B O   1 
ATOM   6235 C CB  . CYS B 1 272 ? 28.852  -12.455 -57.566 1.00 59.19  ? 272  CYS B CB  1 
ATOM   6236 S SG  . CYS B 1 272 ? 28.403  -14.039 -56.796 1.00 88.26  ? 272  CYS B SG  1 
ATOM   6237 N N   . LEU B 1 273 ? 26.242  -10.725 -56.671 1.00 63.67  ? 273  LEU B N   1 
ATOM   6238 C CA  . LEU B 1 273 ? 24.998  -10.594 -55.894 1.00 62.24  ? 273  LEU B CA  1 
ATOM   6239 C C   . LEU B 1 273 ? 23.790  -10.401 -56.820 1.00 60.31  ? 273  LEU B C   1 
ATOM   6240 O O   . LEU B 1 273 ? 22.697  -10.913 -56.535 1.00 55.21  ? 273  LEU B O   1 
ATOM   6241 C CB  . LEU B 1 273 ? 25.075  -9.469  -54.852 1.00 53.96  ? 273  LEU B CB  1 
ATOM   6242 C CG  . LEU B 1 273 ? 25.957  -9.680  -53.612 1.00 56.83  ? 273  LEU B CG  1 
ATOM   6243 C CD1 . LEU B 1 273 ? 26.224  -8.363  -52.905 1.00 54.41  ? 273  LEU B CD1 1 
ATOM   6244 C CD2 . LEU B 1 273 ? 25.352  -10.684 -52.639 1.00 52.81  ? 273  LEU B CD2 1 
ATOM   6245 N N   . ARG B 1 274 ? 24.001  -9.697  -57.937 1.00 55.76  ? 274  ARG B N   1 
ATOM   6246 C CA  . ARG B 1 274 ? 22.951  -9.523  -58.948 1.00 60.67  ? 274  ARG B CA  1 
ATOM   6247 C C   . ARG B 1 274 ? 22.467  -10.835 -59.584 1.00 62.97  ? 274  ARG B C   1 
ATOM   6248 O O   . ARG B 1 274 ? 21.323  -10.920 -60.052 1.00 63.55  ? 274  ARG B O   1 
ATOM   6249 C CB  . ARG B 1 274 ? 23.389  -8.543  -60.038 1.00 53.51  ? 274  ARG B CB  1 
ATOM   6250 C CG  . ARG B 1 274 ? 23.588  -7.133  -59.533 1.00 57.83  ? 274  ARG B CG  1 
ATOM   6251 C CD  . ARG B 1 274 ? 23.366  -6.135  -60.630 1.00 54.20  ? 274  ARG B CD  1 
ATOM   6252 N NE  . ARG B 1 274 ? 24.621  -5.570  -61.086 1.00 59.43  ? 274  ARG B NE  1 
ATOM   6253 C CZ  . ARG B 1 274 ? 25.093  -4.392  -60.690 1.00 71.22  ? 274  ARG B CZ  1 
ATOM   6254 N NH1 . ARG B 1 274 ? 24.407  -3.640  -59.830 1.00 63.01  ? 274  ARG B NH1 1 
ATOM   6255 N NH2 . ARG B 1 274 ? 26.256  -3.960  -61.159 1.00 76.28  ? 274  ARG B NH2 1 
ATOM   6256 N N   . THR B 1 275 ? 23.318  -11.858 -59.586 1.00 58.07  ? 275  THR B N   1 
ATOM   6257 C CA  . THR B 1 275 ? 22.958  -13.129 -60.213 1.00 55.71  ? 275  THR B CA  1 
ATOM   6258 C C   . THR B 1 275 ? 22.113  -13.992 -59.297 1.00 61.90  ? 275  THR B C   1 
ATOM   6259 O O   . THR B 1 275 ? 21.634  -15.051 -59.708 1.00 68.57  ? 275  THR B O   1 
ATOM   6260 C CB  . THR B 1 275 ? 24.196  -13.939 -60.656 1.00 59.65  ? 275  THR B CB  1 
ATOM   6261 O OG1 . THR B 1 275 ? 24.911  -14.408 -59.500 1.00 64.19  ? 275  THR B OG1 1 
ATOM   6262 C CG2 . THR B 1 275 ? 25.114  -13.091 -61.545 1.00 50.08  ? 275  THR B CG2 1 
ATOM   6263 N N   . ARG B 1 276 ? 21.917  -13.546 -58.060 1.00 60.81  ? 276  ARG B N   1 
ATOM   6264 C CA  . ARG B 1 276 ? 21.217  -14.380 -57.080 1.00 62.19  ? 276  ARG B CA  1 
ATOM   6265 C C   . ARG B 1 276 ? 19.698  -14.131 -57.034 1.00 57.34  ? 276  ARG B C   1 
ATOM   6266 O O   . ARG B 1 276 ? 19.248  -12.985 -57.028 1.00 57.72  ? 276  ARG B O   1 
ATOM   6267 C CB  . ARG B 1 276 ? 21.844  -14.195 -55.685 1.00 62.98  ? 276  ARG B CB  1 
ATOM   6268 C CG  . ARG B 1 276 ? 23.326  -14.586 -55.590 1.00 66.63  ? 276  ARG B CG  1 
ATOM   6269 C CD  . ARG B 1 276 ? 23.502  -16.109 -55.539 1.00 73.25  ? 276  ARG B CD  1 
ATOM   6270 N NE  . ARG B 1 276 ? 24.865  -16.507 -55.185 1.00 76.59  ? 276  ARG B NE  1 
ATOM   6271 C CZ  . ARG B 1 276 ? 25.873  -16.583 -56.052 1.00 83.72  ? 276  ARG B CZ  1 
ATOM   6272 N NH1 . ARG B 1 276 ? 25.676  -16.279 -57.330 1.00 85.98  ? 276  ARG B NH1 1 
ATOM   6273 N NH2 . ARG B 1 276 ? 27.080  -16.955 -55.641 1.00 75.12  ? 276  ARG B NH2 1 
ATOM   6274 N N   . PRO B 1 277 ? 18.903  -15.209 -57.009 1.00 60.56  ? 277  PRO B N   1 
ATOM   6275 C CA  . PRO B 1 277 ? 17.465  -15.084 -56.729 1.00 61.91  ? 277  PRO B CA  1 
ATOM   6276 C C   . PRO B 1 277 ? 17.191  -14.249 -55.468 1.00 61.44  ? 277  PRO B C   1 
ATOM   6277 O O   . PRO B 1 277 ? 17.913  -14.390 -54.472 1.00 57.22  ? 277  PRO B O   1 
ATOM   6278 C CB  . PRO B 1 277 ? 17.024  -16.542 -56.485 1.00 59.37  ? 277  PRO B CB  1 
ATOM   6279 C CG  . PRO B 1 277 ? 17.986  -17.359 -57.234 1.00 54.03  ? 277  PRO B CG  1 
ATOM   6280 C CD  . PRO B 1 277 ? 19.300  -16.602 -57.277 1.00 60.87  ? 277  PRO B CD  1 
ATOM   6281 N N   . ALA B 1 278 ? 16.161  -13.406 -55.516 1.00 60.65  ? 278  ALA B N   1 
ATOM   6282 C CA  . ALA B 1 278 ? 15.784  -12.558 -54.384 1.00 59.32  ? 278  ALA B CA  1 
ATOM   6283 C C   . ALA B 1 278 ? 15.706  -13.291 -53.037 1.00 58.32  ? 278  ALA B C   1 
ATOM   6284 O O   . ALA B 1 278 ? 16.198  -12.787 -52.028 1.00 59.62  ? 278  ALA B O   1 
ATOM   6285 C CB  . ALA B 1 278 ? 14.464  -11.826 -54.669 1.00 54.83  ? 278  ALA B CB  1 
ATOM   6286 N N   . GLN B 1 279 ? 15.095  -14.472 -53.011 1.00 59.42  ? 279  GLN B N   1 
ATOM   6287 C CA  . GLN B 1 279 ? 14.900  -15.157 -51.734 1.00 62.84  ? 279  GLN B CA  1 
ATOM   6288 C C   . GLN B 1 279 ? 16.217  -15.654 -51.117 1.00 62.13  ? 279  GLN B C   1 
ATOM   6289 O O   . GLN B 1 279 ? 16.291  -15.894 -49.914 1.00 61.98  ? 279  GLN B O   1 
ATOM   6290 C CB  . GLN B 1 279 ? 13.882  -16.293 -51.858 1.00 54.86  ? 279  GLN B CB  1 
ATOM   6291 C CG  . GLN B 1 279 ? 13.514  -16.917 -50.525 1.00 59.22  ? 279  GLN B CG  1 
ATOM   6292 C CD  . GLN B 1 279 ? 12.839  -15.938 -49.599 1.00 57.40  ? 279  GLN B CD  1 
ATOM   6293 O OE1 . GLN B 1 279 ? 12.056  -15.102 -50.036 1.00 60.65  ? 279  GLN B OE1 1 
ATOM   6294 N NE2 . GLN B 1 279 ? 13.143  -16.030 -48.311 1.00 60.91  ? 279  GLN B NE2 1 
ATOM   6295 N N   . ASP B 1 280 ? 17.257  -15.790 -51.937 1.00 61.18  ? 280  ASP B N   1 
ATOM   6296 C CA  . ASP B 1 280 ? 18.572  -16.206 -51.442 1.00 66.96  ? 280  ASP B CA  1 
ATOM   6297 C C   . ASP B 1 280 ? 19.234  -15.082 -50.633 1.00 68.61  ? 280  ASP B C   1 
ATOM   6298 O O   . ASP B 1 280 ? 19.937  -15.333 -49.647 1.00 69.82  ? 280  ASP B O   1 
ATOM   6299 C CB  . ASP B 1 280 ? 19.487  -16.642 -52.599 1.00 59.61  ? 280  ASP B CB  1 
ATOM   6300 C CG  . ASP B 1 280 ? 18.999  -17.910 -53.299 1.00 70.77  ? 280  ASP B CG  1 
ATOM   6301 O OD1 . ASP B 1 280 ? 17.956  -18.479 -52.888 1.00 73.92  ? 280  ASP B OD1 1 
ATOM   6302 O OD2 . ASP B 1 280 ? 19.666  -18.334 -54.269 1.00 69.19  ? 280  ASP B OD2 1 
ATOM   6303 N N   . LEU B 1 281 ? 19.007  -13.846 -51.068 1.00 64.45  ? 281  LEU B N   1 
ATOM   6304 C CA  . LEU B 1 281 ? 19.467  -12.665 -50.348 1.00 59.42  ? 281  LEU B CA  1 
ATOM   6305 C C   . LEU B 1 281 ? 18.715  -12.522 -49.012 1.00 59.93  ? 281  LEU B C   1 
ATOM   6306 O O   . LEU B 1 281 ? 19.322  -12.447 -47.945 1.00 57.19  ? 281  LEU B O   1 
ATOM   6307 C CB  . LEU B 1 281 ? 19.285  -11.423 -51.222 1.00 54.15  ? 281  LEU B CB  1 
ATOM   6308 C CG  . LEU B 1 281 ? 20.531  -10.969 -51.995 1.00 56.64  ? 281  LEU B CG  1 
ATOM   6309 C CD1 . LEU B 1 281 ? 21.420  -12.154 -52.342 1.00 58.19  ? 281  LEU B CD1 1 
ATOM   6310 C CD2 . LEU B 1 281 ? 20.171  -10.192 -53.260 1.00 53.11  ? 281  LEU B CD2 1 
ATOM   6311 N N   . VAL B 1 282 ? 17.390  -12.522 -49.087 1.00 53.50  ? 282  VAL B N   1 
ATOM   6312 C CA  . VAL B 1 282 ? 16.529  -12.458 -47.917 1.00 54.33  ? 282  VAL B CA  1 
ATOM   6313 C C   . VAL B 1 282 ? 16.803  -13.586 -46.897 1.00 65.31  ? 282  VAL B C   1 
ATOM   6314 O O   . VAL B 1 282 ? 16.686  -13.374 -45.681 1.00 66.13  ? 282  VAL B O   1 
ATOM   6315 C CB  . VAL B 1 282 ? 15.042  -12.447 -48.367 1.00 53.35  ? 282  VAL B CB  1 
ATOM   6316 C CG1 . VAL B 1 282 ? 14.083  -12.558 -47.192 1.00 48.04  ? 282  VAL B CG1 1 
ATOM   6317 C CG2 . VAL B 1 282 ? 14.759  -11.190 -49.185 1.00 53.47  ? 282  VAL B CG2 1 
ATOM   6318 N N   . ASP B 1 283 ? 17.181  -14.769 -47.387 1.00 64.57  ? 283  ASP B N   1 
ATOM   6319 C CA  . ASP B 1 283 ? 17.467  -15.927 -46.521 1.00 65.87  ? 283  ASP B CA  1 
ATOM   6320 C C   . ASP B 1 283 ? 18.569  -15.656 -45.489 1.00 67.72  ? 283  ASP B C   1 
ATOM   6321 O O   . ASP B 1 283 ? 18.517  -16.164 -44.366 1.00 63.31  ? 283  ASP B O   1 
ATOM   6322 C CB  . ASP B 1 283 ? 17.874  -17.149 -47.362 1.00 63.19  ? 283  ASP B CB  1 
ATOM   6323 C CG  . ASP B 1 283 ? 16.683  -17.995 -47.799 1.00 77.09  ? 283  ASP B CG  1 
ATOM   6324 O OD1 . ASP B 1 283 ? 15.588  -17.871 -47.190 1.00 73.78  ? 283  ASP B OD1 1 
ATOM   6325 O OD2 . ASP B 1 283 ? 16.852  -18.800 -48.750 1.00 77.31  ? 283  ASP B OD2 1 
ATOM   6326 N N   . HIS B 1 284 ? 19.559  -14.854 -45.881 1.00 63.75  ? 284  HIS B N   1 
ATOM   6327 C CA  . HIS B 1 284 ? 20.710  -14.558 -45.035 1.00 68.37  ? 284  HIS B CA  1 
ATOM   6328 C C   . HIS B 1 284 ? 20.757  -13.119 -44.488 1.00 65.81  ? 284  HIS B C   1 
ATOM   6329 O O   . HIS B 1 284 ? 21.764  -12.724 -43.886 1.00 62.57  ? 284  HIS B O   1 
ATOM   6330 C CB  . HIS B 1 284 ? 22.014  -14.852 -45.801 1.00 70.93  ? 284  HIS B CB  1 
ATOM   6331 C CG  . HIS B 1 284 ? 22.341  -16.306 -45.907 1.00 77.25  ? 284  HIS B CG  1 
ATOM   6332 N ND1 . HIS B 1 284 ? 22.873  -17.025 -44.856 1.00 80.37  ? 284  HIS B ND1 1 
ATOM   6333 C CD2 . HIS B 1 284 ? 22.214  -17.180 -46.936 1.00 74.15  ? 284  HIS B CD2 1 
ATOM   6334 C CE1 . HIS B 1 284 ? 23.058  -18.277 -45.233 1.00 88.93  ? 284  HIS B CE1 1 
ATOM   6335 N NE2 . HIS B 1 284 ? 22.666  -18.398 -46.491 1.00 86.17  ? 284  HIS B NE2 1 
ATOM   6336 N N   . GLU B 1 285 ? 19.694  -12.336 -44.679 1.00 61.59  ? 285  GLU B N   1 
ATOM   6337 C CA  . GLU B 1 285 ? 19.756  -10.912 -44.316 1.00 63.34  ? 285  GLU B CA  1 
ATOM   6338 C C   . GLU B 1 285 ? 19.782  -10.693 -42.801 1.00 64.68  ? 285  GLU B C   1 
ATOM   6339 O O   . GLU B 1 285 ? 20.381  -9.725  -42.323 1.00 53.85  ? 285  GLU B O   1 
ATOM   6340 C CB  . GLU B 1 285 ? 18.649  -10.072 -44.992 1.00 56.74  ? 285  GLU B CB  1 
ATOM   6341 C CG  . GLU B 1 285 ? 17.426  -9.756  -44.127 1.00 63.94  ? 285  GLU B CG  1 
ATOM   6342 C CD  . GLU B 1 285 ? 16.527  -8.663  -44.726 1.00 67.20  ? 285  GLU B CD  1 
ATOM   6343 O OE1 . GLU B 1 285 ? 15.723  -8.984  -45.631 1.00 61.80  ? 285  GLU B OE1 1 
ATOM   6344 O OE2 . GLU B 1 285 ? 16.613  -7.484  -44.282 1.00 71.35  ? 285  GLU B OE2 1 
ATOM   6345 N N   . TRP B 1 286 ? 19.165  -11.607 -42.053 1.00 61.99  ? 286  TRP B N   1 
ATOM   6346 C CA  . TRP B 1 286 ? 19.161  -11.509 -40.593 1.00 61.33  ? 286  TRP B CA  1 
ATOM   6347 C C   . TRP B 1 286 ? 20.440  -12.034 -39.910 1.00 68.40  ? 286  TRP B C   1 
ATOM   6348 O O   . TRP B 1 286 ? 20.571  -11.964 -38.684 1.00 73.67  ? 286  TRP B O   1 
ATOM   6349 C CB  . TRP B 1 286 ? 17.923  -12.201 -40.015 1.00 57.18  ? 286  TRP B CB  1 
ATOM   6350 C CG  . TRP B 1 286 ? 16.644  -11.403 -40.191 1.00 70.50  ? 286  TRP B CG  1 
ATOM   6351 C CD1 . TRP B 1 286 ? 15.609  -11.690 -41.030 1.00 66.19  ? 286  TRP B CD1 1 
ATOM   6352 C CD2 . TRP B 1 286 ? 16.280  -10.185 -39.511 1.00 75.64  ? 286  TRP B CD2 1 
ATOM   6353 N NE1 . TRP B 1 286 ? 14.620  -10.742 -40.910 1.00 65.93  ? 286  TRP B NE1 1 
ATOM   6354 C CE2 . TRP B 1 286 ? 15.004  -9.807  -39.985 1.00 73.23  ? 286  TRP B CE2 1 
ATOM   6355 C CE3 . TRP B 1 286 ? 16.910  -9.379  -38.546 1.00 67.23  ? 286  TRP B CE3 1 
ATOM   6356 C CZ2 . TRP B 1 286 ? 14.343  -8.658  -39.528 1.00 71.09  ? 286  TRP B CZ2 1 
ATOM   6357 C CZ3 . TRP B 1 286 ? 16.252  -8.239  -38.089 1.00 61.09  ? 286  TRP B CZ3 1 
ATOM   6358 C CH2 . TRP B 1 286 ? 14.983  -7.891  -38.581 1.00 71.51  ? 286  TRP B CH2 1 
ATOM   6359 N N   . HIS B 1 287 ? 21.390  -12.531 -40.698 1.00 62.72  ? 287  HIS B N   1 
ATOM   6360 C CA  . HIS B 1 287 ? 22.581  -13.164 -40.139 1.00 61.09  ? 287  HIS B CA  1 
ATOM   6361 C C   . HIS B 1 287 ? 23.798  -12.255 -40.148 1.00 61.13  ? 287  HIS B C   1 
ATOM   6362 O O   . HIS B 1 287 ? 24.912  -12.712 -39.893 1.00 63.35  ? 287  HIS B O   1 
ATOM   6363 C CB  . HIS B 1 287 ? 22.889  -14.478 -40.873 1.00 63.51  ? 287  HIS B CB  1 
ATOM   6364 C CG  . HIS B 1 287 ? 21.801  -15.498 -40.750 1.00 65.73  ? 287  HIS B CG  1 
ATOM   6365 N ND1 . HIS B 1 287 ? 21.690  -16.581 -41.597 1.00 70.06  ? 287  HIS B ND1 1 
ATOM   6366 C CD2 . HIS B 1 287 ? 20.768  -15.594 -39.878 1.00 63.69  ? 287  HIS B CD2 1 
ATOM   6367 C CE1 . HIS B 1 287 ? 20.637  -17.301 -41.250 1.00 71.77  ? 287  HIS B CE1 1 
ATOM   6368 N NE2 . HIS B 1 287 ? 20.058  -16.723 -40.212 1.00 74.59  ? 287  HIS B NE2 1 
ATOM   6369 N N   . VAL B 1 288 ? 23.595  -10.969 -40.425 1.00 62.23  ? 288  VAL B N   1 
ATOM   6370 C CA  . VAL B 1 288 ? 24.736  -10.056 -40.504 1.00 60.18  ? 288  VAL B CA  1 
ATOM   6371 C C   . VAL B 1 288 ? 24.859  -9.054  -39.338 1.00 59.86  ? 288  VAL B C   1 
ATOM   6372 O O   . VAL B 1 288 ? 25.819  -8.271  -39.303 1.00 60.13  ? 288  VAL B O   1 
ATOM   6373 C CB  . VAL B 1 288 ? 24.822  -9.324  -41.880 1.00 56.14  ? 288  VAL B CB  1 
ATOM   6374 C CG1 . VAL B 1 288 ? 24.716  -10.324 -43.026 1.00 55.76  ? 288  VAL B CG1 1 
ATOM   6375 C CG2 . VAL B 1 288 ? 23.747  -8.256  -41.988 1.00 52.19  ? 288  VAL B CG2 1 
ATOM   6376 N N   . LEU B 1 289 ? 23.913  -9.081  -38.393 1.00 53.55  ? 289  LEU B N   1 
ATOM   6377 C CA  . LEU B 1 289 ? 23.983  -8.192  -37.218 1.00 58.05  ? 289  LEU B CA  1 
ATOM   6378 C C   . LEU B 1 289 ? 25.142  -8.576  -36.268 1.00 63.75  ? 289  LEU B C   1 
ATOM   6379 O O   . LEU B 1 289 ? 25.416  -9.769  -36.052 1.00 62.96  ? 289  LEU B O   1 
ATOM   6380 C CB  . LEU B 1 289 ? 22.633  -8.138  -36.471 1.00 57.65  ? 289  LEU B CB  1 
ATOM   6381 C CG  . LEU B 1 289 ? 21.482  -7.359  -37.133 1.00 53.38  ? 289  LEU B CG  1 
ATOM   6382 C CD1 . LEU B 1 289 ? 20.115  -7.707  -36.522 1.00 43.58  ? 289  LEU B CD1 1 
ATOM   6383 C CD2 . LEU B 1 289 ? 21.734  -5.855  -37.080 1.00 53.72  ? 289  LEU B CD2 1 
ATOM   6384 N N   . PRO B 1 290 ? 25.828  -7.561  -35.700 1.00 67.92  ? 290  PRO B N   1 
ATOM   6385 C CA  . PRO B 1 290 ? 27.029  -7.752  -34.864 1.00 66.72  ? 290  PRO B CA  1 
ATOM   6386 C C   . PRO B 1 290 ? 26.765  -8.449  -33.512 1.00 63.80  ? 290  PRO B C   1 
ATOM   6387 O O   . PRO B 1 290 ? 27.587  -9.252  -33.069 1.00 64.52  ? 290  PRO B O   1 
ATOM   6388 C CB  . PRO B 1 290 ? 27.527  -6.315  -34.610 1.00 61.90  ? 290  PRO B CB  1 
ATOM   6389 C CG  . PRO B 1 290 ? 26.678  -5.413  -35.448 1.00 61.42  ? 290  PRO B CG  1 
ATOM   6390 C CD  . PRO B 1 290 ? 25.412  -6.148  -35.747 1.00 64.55  ? 290  PRO B CD  1 
ATOM   6391 N N   . GLN B 1 291 ? 25.646  -8.128  -32.867 1.00 64.34  ? 291  GLN B N   1 
ATOM   6392 C CA  . GLN B 1 291 ? 25.279  -8.737  -31.587 1.00 67.65  ? 291  GLN B CA  1 
ATOM   6393 C C   . GLN B 1 291 ? 23.868  -9.303  -31.653 1.00 65.18  ? 291  GLN B C   1 
ATOM   6394 O O   . GLN B 1 291 ? 23.119  -9.026  -32.595 1.00 65.22  ? 291  GLN B O   1 
ATOM   6395 C CB  . GLN B 1 291 ? 25.321  -7.697  -30.446 1.00 63.90  ? 291  GLN B CB  1 
ATOM   6396 C CG  . GLN B 1 291 ? 26.637  -6.942  -30.295 1.00 56.90  ? 291  GLN B CG  1 
ATOM   6397 C CD  . GLN B 1 291 ? 26.665  -5.671  -31.113 1.00 62.61  ? 291  GLN B CD  1 
ATOM   6398 O OE1 . GLN B 1 291 ? 25.610  -5.153  -31.495 1.00 68.22  ? 291  GLN B OE1 1 
ATOM   6399 N NE2 . GLN B 1 291 ? 27.871  -5.158  -31.396 1.00 56.90  ? 291  GLN B NE2 1 
ATOM   6400 N N   . GLU B 1 292 ? 23.506  -10.091 -30.645 1.00 64.05  ? 292  GLU B N   1 
ATOM   6401 C CA  . GLU B 1 292 ? 22.111  -10.456 -30.439 1.00 61.62  ? 292  GLU B CA  1 
ATOM   6402 C C   . GLU B 1 292 ? 21.365  -9.158  -30.090 1.00 64.63  ? 292  GLU B C   1 
ATOM   6403 O O   . GLU B 1 292 ? 21.832  -8.364  -29.257 1.00 71.38  ? 292  GLU B O   1 
ATOM   6404 C CB  . GLU B 1 292 ? 22.004  -11.487 -29.313 1.00 68.14  ? 292  GLU B CB  1 
ATOM   6405 C CG  . GLU B 1 292 ? 20.637  -12.160 -29.175 1.00 76.72  ? 292  GLU B CG  1 
ATOM   6406 C CD  . GLU B 1 292 ? 20.600  -13.182 -28.038 1.00 92.89  ? 292  GLU B CD  1 
ATOM   6407 O OE1 . GLU B 1 292 ? 21.685  -13.555 -27.521 1.00 84.37  ? 292  GLU B OE1 1 
ATOM   6408 O OE2 . GLU B 1 292 ? 19.481  -13.607 -27.662 1.00 90.29  ? 292  GLU B OE2 1 
ATOM   6409 N N   . SER B 1 293 ? 20.226  -8.926  -30.739 1.00 59.11  ? 293  SER B N   1 
ATOM   6410 C CA  . SER B 1 293 ? 19.558  -7.626  -30.667 1.00 49.20  ? 293  SER B CA  1 
ATOM   6411 C C   . SER B 1 293 ? 18.042  -7.764  -30.729 1.00 56.04  ? 293  SER B C   1 
ATOM   6412 O O   . SER B 1 293 ? 17.517  -8.797  -31.159 1.00 58.79  ? 293  SER B O   1 
ATOM   6413 C CB  . SER B 1 293 ? 19.991  -6.745  -31.851 1.00 53.93  ? 293  SER B CB  1 
ATOM   6414 O OG  . SER B 1 293 ? 21.393  -6.729  -32.043 1.00 59.38  ? 293  SER B OG  1 
ATOM   6415 N N   . ILE B 1 294 ? 17.344  -6.730  -30.266 1.00 53.76  ? 294  ILE B N   1 
ATOM   6416 C CA  . ILE B 1 294 ? 16.026  -6.417  -30.802 1.00 54.45  ? 294  ILE B CA  1 
ATOM   6417 C C   . ILE B 1 294 ? 16.080  -4.966  -31.242 1.00 50.48  ? 294  ILE B C   1 
ATOM   6418 O O   . ILE B 1 294 ? 17.021  -4.255  -30.890 1.00 49.89  ? 294  ILE B O   1 
ATOM   6419 C CB  . ILE B 1 294 ? 14.878  -6.662  -29.815 1.00 53.79  ? 294  ILE B CB  1 
ATOM   6420 C CG1 . ILE B 1 294 ? 15.124  -5.906  -28.511 1.00 56.12  ? 294  ILE B CG1 1 
ATOM   6421 C CG2 . ILE B 1 294 ? 14.711  -8.152  -29.570 1.00 56.27  ? 294  ILE B CG2 1 
ATOM   6422 C CD1 . ILE B 1 294 ? 13.892  -5.848  -27.615 1.00 51.30  ? 294  ILE B CD1 1 
ATOM   6423 N N   . PHE B 1 295 ? 15.083  -4.542  -32.016 1.00 54.89  ? 295  PHE B N   1 
ATOM   6424 C CA  . PHE B 1 295 ? 15.021  -3.179  -32.535 1.00 48.67  ? 295  PHE B CA  1 
ATOM   6425 C C   . PHE B 1 295 ? 16.332  -2.788  -33.209 1.00 45.21  ? 295  PHE B C   1 
ATOM   6426 O O   . PHE B 1 295 ? 16.853  -1.696  -33.006 1.00 48.05  ? 295  PHE B O   1 
ATOM   6427 C CB  . PHE B 1 295 ? 14.645  -2.180  -31.427 1.00 42.24  ? 295  PHE B CB  1 
ATOM   6428 C CG  . PHE B 1 295 ? 13.702  -1.095  -31.880 1.00 45.86  ? 295  PHE B CG  1 
ATOM   6429 C CD1 . PHE B 1 295 ? 13.976  -0.340  -33.019 1.00 45.43  ? 295  PHE B CD1 1 
ATOM   6430 C CD2 . PHE B 1 295 ? 12.525  -0.845  -31.182 1.00 49.23  ? 295  PHE B CD2 1 
ATOM   6431 C CE1 . PHE B 1 295 ? 13.096  0.654   -33.446 1.00 41.01  ? 295  PHE B CE1 1 
ATOM   6432 C CE2 . PHE B 1 295 ? 11.646  0.149   -31.602 1.00 44.16  ? 295  PHE B CE2 1 
ATOM   6433 C CZ  . PHE B 1 295 ? 11.931  0.892   -32.738 1.00 45.62  ? 295  PHE B CZ  1 
ATOM   6434 N N   . ARG B 1 296 ? 16.865  -3.709  -33.995 1.00 48.06  ? 296  ARG B N   1 
ATOM   6435 C CA  . ARG B 1 296 ? 18.073  -3.472  -34.773 1.00 48.92  ? 296  ARG B CA  1 
ATOM   6436 C C   . ARG B 1 296 ? 17.913  -4.250  -36.089 1.00 51.17  ? 296  ARG B C   1 
ATOM   6437 O O   . ARG B 1 296 ? 17.442  -5.395  -36.097 1.00 53.05  ? 296  ARG B O   1 
ATOM   6438 C CB  . ARG B 1 296 ? 19.315  -3.910  -33.989 1.00 49.41  ? 296  ARG B CB  1 
ATOM   6439 C CG  . ARG B 1 296 ? 20.485  -2.938  -34.085 1.00 54.77  ? 296  ARG B CG  1 
ATOM   6440 C CD  . ARG B 1 296 ? 20.761  -2.219  -32.774 1.00 52.57  ? 296  ARG B CD  1 
ATOM   6441 N NE  . ARG B 1 296 ? 19.623  -1.417  -32.352 1.00 54.47  ? 296  ARG B NE  1 
ATOM   6442 C CZ  . ARG B 1 296 ? 19.606  -0.608  -31.295 1.00 50.02  ? 296  ARG B CZ  1 
ATOM   6443 N NH1 . ARG B 1 296 ? 20.680  -0.452  -30.519 1.00 45.41  ? 296  ARG B NH1 1 
ATOM   6444 N NH2 . ARG B 1 296 ? 18.495  0.054   -31.021 1.00 51.94  ? 296  ARG B NH2 1 
ATOM   6445 N N   . PHE B 1 297 ? 18.266  -3.609  -37.198 1.00 51.71  ? 297  PHE B N   1 
ATOM   6446 C CA  . PHE B 1 297 ? 17.886  -4.089  -38.525 1.00 48.18  ? 297  PHE B CA  1 
ATOM   6447 C C   . PHE B 1 297 ? 19.102  -4.042  -39.457 1.00 53.63  ? 297  PHE B C   1 
ATOM   6448 O O   . PHE B 1 297 ? 19.904  -3.103  -39.390 1.00 44.45  ? 297  PHE B O   1 
ATOM   6449 C CB  . PHE B 1 297 ? 16.738  -3.237  -39.079 1.00 37.93  ? 297  PHE B CB  1 
ATOM   6450 C CG  . PHE B 1 297 ? 15.633  -2.968  -38.071 1.00 48.92  ? 297  PHE B CG  1 
ATOM   6451 C CD1 . PHE B 1 297 ? 14.802  -3.996  -37.624 1.00 48.68  ? 297  PHE B CD1 1 
ATOM   6452 C CD2 . PHE B 1 297 ? 15.422  -1.684  -37.568 1.00 46.83  ? 297  PHE B CD2 1 
ATOM   6453 C CE1 . PHE B 1 297 ? 13.779  -3.743  -36.694 1.00 51.78  ? 297  PHE B CE1 1 
ATOM   6454 C CE2 . PHE B 1 297 ? 14.406  -1.427  -36.628 1.00 37.52  ? 297  PHE B CE2 1 
ATOM   6455 C CZ  . PHE B 1 297 ? 13.592  -2.453  -36.199 1.00 46.55  ? 297  PHE B CZ  1 
ATOM   6456 N N   . SER B 1 298 ? 19.240  -5.045  -40.325 1.00 47.17  ? 298  SER B N   1 
ATOM   6457 C CA  . SER B 1 298 ? 20.506  -5.253  -41.030 1.00 49.38  ? 298  SER B CA  1 
ATOM   6458 C C   . SER B 1 298 ? 20.813  -4.258  -42.148 1.00 49.25  ? 298  SER B C   1 
ATOM   6459 O O   . SER B 1 298 ? 21.964  -3.832  -42.305 1.00 49.29  ? 298  SER B O   1 
ATOM   6460 C CB  . SER B 1 298 ? 20.599  -6.683  -41.551 1.00 49.43  ? 298  SER B CB  1 
ATOM   6461 O OG  . SER B 1 298 ? 20.290  -7.609  -40.520 1.00 63.19  ? 298  SER B OG  1 
ATOM   6462 N N   . PHE B 1 299 ? 19.813  -3.882  -42.938 1.00 41.09  ? 299  PHE B N   1 
ATOM   6463 C CA  . PHE B 1 299 ? 20.109  -2.957  -44.029 1.00 45.26  ? 299  PHE B CA  1 
ATOM   6464 C C   . PHE B 1 299 ? 19.248  -1.712  -43.947 1.00 48.48  ? 299  PHE B C   1 
ATOM   6465 O O   . PHE B 1 299 ? 18.024  -1.751  -44.168 1.00 50.74  ? 299  PHE B O   1 
ATOM   6466 C CB  . PHE B 1 299 ? 20.046  -3.665  -45.389 1.00 42.29  ? 299  PHE B CB  1 
ATOM   6467 C CG  . PHE B 1 299 ? 20.999  -4.825  -45.485 1.00 46.59  ? 299  PHE B CG  1 
ATOM   6468 C CD1 . PHE B 1 299 ? 22.319  -4.620  -45.863 1.00 42.00  ? 299  PHE B CD1 1 
ATOM   6469 C CD2 . PHE B 1 299 ? 20.598  -6.113  -45.123 1.00 45.87  ? 299  PHE B CD2 1 
ATOM   6470 C CE1 . PHE B 1 299 ? 23.219  -5.681  -45.906 1.00 42.09  ? 299  PHE B CE1 1 
ATOM   6471 C CE2 . PHE B 1 299 ? 21.491  -7.173  -45.167 1.00 48.24  ? 299  PHE B CE2 1 
ATOM   6472 C CZ  . PHE B 1 299 ? 22.801  -6.958  -45.560 1.00 46.37  ? 299  PHE B CZ  1 
ATOM   6473 N N   . VAL B 1 300 ? 19.910  -0.618  -43.577 1.00 36.37  ? 300  VAL B N   1 
ATOM   6474 C CA  . VAL B 1 300 ? 19.245  0.636   -43.219 1.00 45.79  ? 300  VAL B CA  1 
ATOM   6475 C C   . VAL B 1 300 ? 20.006  1.792   -43.887 1.00 39.30  ? 300  VAL B C   1 
ATOM   6476 O O   . VAL B 1 300 ? 21.078  1.570   -44.458 1.00 42.73  ? 300  VAL B O   1 
ATOM   6477 C CB  . VAL B 1 300 ? 19.167  0.818   -41.667 1.00 39.51  ? 300  VAL B CB  1 
ATOM   6478 C CG1 . VAL B 1 300 ? 18.409  -0.341  -41.005 1.00 34.48  ? 300  VAL B CG1 1 
ATOM   6479 C CG2 . VAL B 1 300 ? 20.559  0.965   -41.082 1.00 37.69  ? 300  VAL B CG2 1 
ATOM   6480 N N   . PRO B 1 301 ? 19.447  3.015   -43.859 1.00 35.86  ? 301  PRO B N   1 
ATOM   6481 C CA  . PRO B 1 301 ? 20.184  4.115   -44.497 1.00 40.61  ? 301  PRO B CA  1 
ATOM   6482 C C   . PRO B 1 301 ? 21.612  4.269   -43.949 1.00 44.74  ? 301  PRO B C   1 
ATOM   6483 O O   . PRO B 1 301 ? 21.848  3.975   -42.765 1.00 39.68  ? 301  PRO B O   1 
ATOM   6484 C CB  . PRO B 1 301 ? 19.329  5.349   -44.158 1.00 37.67  ? 301  PRO B CB  1 
ATOM   6485 C CG  . PRO B 1 301 ? 17.942  4.803   -44.083 1.00 39.12  ? 301  PRO B CG  1 
ATOM   6486 C CD  . PRO B 1 301 ? 18.096  3.433   -43.437 1.00 42.18  ? 301  PRO B CD  1 
ATOM   6487 N N   . VAL B 1 302 ? 22.540  4.706   -44.803 1.00 42.70  ? 302  VAL B N   1 
ATOM   6488 C CA  . VAL B 1 302 ? 23.963  4.757   -44.446 1.00 46.47  ? 302  VAL B CA  1 
ATOM   6489 C C   . VAL B 1 302 ? 24.534  6.183   -44.515 1.00 46.10  ? 302  VAL B C   1 
ATOM   6490 O O   . VAL B 1 302 ? 24.233  6.942   -45.452 1.00 48.07  ? 302  VAL B O   1 
ATOM   6491 C CB  . VAL B 1 302 ? 24.798  3.777   -45.337 1.00 45.51  ? 302  VAL B CB  1 
ATOM   6492 C CG1 . VAL B 1 302 ? 24.775  4.218   -46.809 1.00 44.97  ? 302  VAL B CG1 1 
ATOM   6493 C CG2 . VAL B 1 302 ? 26.224  3.657   -44.838 1.00 47.04  ? 302  VAL B CG2 1 
ATOM   6494 N N   . VAL B 1 303 ? 25.335  6.565   -43.521 1.00 46.59  ? 303  VAL B N   1 
ATOM   6495 C CA  . VAL B 1 303 ? 25.967  7.883   -43.576 1.00 50.97  ? 303  VAL B CA  1 
ATOM   6496 C C   . VAL B 1 303 ? 27.032  7.850   -44.667 1.00 52.07  ? 303  VAL B C   1 
ATOM   6497 O O   . VAL B 1 303 ? 28.120  7.290   -44.486 1.00 55.42  ? 303  VAL B O   1 
ATOM   6498 C CB  . VAL B 1 303 ? 26.577  8.317   -42.233 1.00 46.85  ? 303  VAL B CB  1 
ATOM   6499 C CG1 . VAL B 1 303 ? 26.959  9.797   -42.297 1.00 46.21  ? 303  VAL B CG1 1 
ATOM   6500 C CG2 . VAL B 1 303 ? 25.594  8.072   -41.110 1.00 43.23  ? 303  VAL B CG2 1 
ATOM   6501 N N   . ASP B 1 304 ? 26.706  8.451   -45.806 1.00 53.47  ? 304  ASP B N   1 
ATOM   6502 C CA  . ASP B 1 304 ? 27.493  8.257   -47.017 1.00 52.71  ? 304  ASP B CA  1 
ATOM   6503 C C   . ASP B 1 304 ? 28.276  9.500   -47.458 1.00 56.22  ? 304  ASP B C   1 
ATOM   6504 O O   . ASP B 1 304 ? 29.127  9.423   -48.340 1.00 62.50  ? 304  ASP B O   1 
ATOM   6505 C CB  . ASP B 1 304 ? 26.584  7.746   -48.150 1.00 53.47  ? 304  ASP B CB  1 
ATOM   6506 C CG  . ASP B 1 304 ? 25.448  8.725   -48.502 1.00 59.82  ? 304  ASP B CG  1 
ATOM   6507 O OD1 . ASP B 1 304 ? 25.164  9.659   -47.713 1.00 55.39  ? 304  ASP B OD1 1 
ATOM   6508 O OD2 . ASP B 1 304 ? 24.819  8.550   -49.575 1.00 58.48  ? 304  ASP B OD2 1 
ATOM   6509 N N   . GLY B 1 305 ? 27.995  10.641  -46.836 1.00 60.99  ? 305  GLY B N   1 
ATOM   6510 C CA  . GLY B 1 305 ? 28.581  11.898  -47.261 1.00 54.35  ? 305  GLY B CA  1 
ATOM   6511 C C   . GLY B 1 305 ? 27.814  12.477  -48.440 1.00 58.59  ? 305  GLY B C   1 
ATOM   6512 O O   . GLY B 1 305 ? 28.077  13.611  -48.860 1.00 65.41  ? 305  GLY B O   1 
ATOM   6513 N N   . ASP B 1 306 ? 26.861  11.702  -48.966 1.00 54.65  ? 306  ASP B N   1 
ATOM   6514 C CA  . ASP B 1 306 ? 26.051  12.120  -50.111 1.00 59.51  ? 306  ASP B CA  1 
ATOM   6515 C C   . ASP B 1 306 ? 24.609  12.485  -49.716 1.00 63.18  ? 306  ASP B C   1 
ATOM   6516 O O   . ASP B 1 306 ? 24.327  13.663  -49.439 1.00 59.44  ? 306  ASP B O   1 
ATOM   6517 C CB  . ASP B 1 306 ? 26.064  11.044  -51.202 1.00 61.69  ? 306  ASP B CB  1 
ATOM   6518 C CG  . ASP B 1 306 ? 25.623  11.580  -52.555 1.00 68.42  ? 306  ASP B CG  1 
ATOM   6519 O OD1 . ASP B 1 306 ? 25.518  12.823  -52.705 1.00 70.77  ? 306  ASP B OD1 1 
ATOM   6520 O OD2 . ASP B 1 306 ? 25.394  10.758  -53.470 1.00 74.48  ? 306  ASP B OD2 1 
ATOM   6521 N N   . PHE B 1 307 ? 23.706  11.496  -49.705 1.00 57.82  ? 307  PHE B N   1 
ATOM   6522 C CA  . PHE B 1 307 ? 22.341  11.721  -49.224 1.00 54.54  ? 307  PHE B CA  1 
ATOM   6523 C C   . PHE B 1 307 ? 22.426  12.349  -47.834 1.00 51.55  ? 307  PHE B C   1 
ATOM   6524 O O   . PHE B 1 307 ? 21.832  13.396  -47.571 1.00 52.34  ? 307  PHE B O   1 
ATOM   6525 C CB  . PHE B 1 307 ? 21.522  10.418  -49.165 1.00 48.22  ? 307  PHE B CB  1 
ATOM   6526 C CG  . PHE B 1 307 ? 20.018  10.645  -49.118 1.00 50.24  ? 307  PHE B CG  1 
ATOM   6527 C CD1 . PHE B 1 307 ? 19.380  11.048  -47.936 1.00 52.20  ? 307  PHE B CD1 1 
ATOM   6528 C CD2 . PHE B 1 307 ? 19.244  10.474  -50.260 1.00 48.40  ? 307  PHE B CD2 1 
ATOM   6529 C CE1 . PHE B 1 307 ? 17.988  11.271  -47.896 1.00 38.45  ? 307  PHE B CE1 1 
ATOM   6530 C CE2 . PHE B 1 307 ? 17.867  10.687  -50.233 1.00 47.30  ? 307  PHE B CE2 1 
ATOM   6531 C CZ  . PHE B 1 307 ? 17.239  11.088  -49.048 1.00 50.72  ? 307  PHE B CZ  1 
ATOM   6532 N N   . LEU B 1 308 ? 23.199  11.699  -46.966 1.00 52.68  ? 308  LEU B N   1 
ATOM   6533 C CA  . LEU B 1 308 ? 23.515  12.204  -45.637 1.00 53.08  ? 308  LEU B CA  1 
ATOM   6534 C C   . LEU B 1 308 ? 24.953  12.735  -45.597 1.00 56.74  ? 308  LEU B C   1 
ATOM   6535 O O   . LEU B 1 308 ? 25.905  11.949  -45.602 1.00 57.48  ? 308  LEU B O   1 
ATOM   6536 C CB  . LEU B 1 308 ? 23.362  11.077  -44.614 1.00 54.08  ? 308  LEU B CB  1 
ATOM   6537 C CG  . LEU B 1 308 ? 21.956  10.488  -44.487 1.00 46.64  ? 308  LEU B CG  1 
ATOM   6538 C CD1 . LEU B 1 308 ? 21.938  9.359   -43.470 1.00 44.04  ? 308  LEU B CD1 1 
ATOM   6539 C CD2 . LEU B 1 308 ? 20.996  11.592  -44.103 1.00 42.60  ? 308  LEU B CD2 1 
ATOM   6540 N N   . SER B 1 309 ? 25.112  14.057  -45.544 1.00 56.99  ? 309  SER B N   1 
ATOM   6541 C CA  . SER B 1 309 ? 26.443  14.678  -45.556 1.00 55.71  ? 309  SER B CA  1 
ATOM   6542 C C   . SER B 1 309 ? 27.271  14.376  -44.297 1.00 54.97  ? 309  SER B C   1 
ATOM   6543 O O   . SER B 1 309 ? 28.503  14.327  -44.346 1.00 61.33  ? 309  SER B O   1 
ATOM   6544 C CB  . SER B 1 309 ? 26.319  16.188  -45.750 1.00 53.16  ? 309  SER B CB  1 
ATOM   6545 O OG  . SER B 1 309 ? 25.802  16.820  -44.588 1.00 62.14  ? 309  SER B OG  1 
ATOM   6546 N N   . ASP B 1 310 ? 26.578  14.178  -43.180 1.00 56.60  ? 310  ASP B N   1 
ATOM   6547 C CA  . ASP B 1 310 ? 27.188  13.840  -41.895 1.00 58.62  ? 310  ASP B CA  1 
ATOM   6548 C C   . ASP B 1 310 ? 26.169  12.947  -41.169 1.00 52.17  ? 310  ASP B C   1 
ATOM   6549 O O   . ASP B 1 310 ? 25.149  12.588  -41.744 1.00 56.77  ? 310  ASP B O   1 
ATOM   6550 C CB  . ASP B 1 310 ? 27.461  15.124  -41.096 1.00 57.68  ? 310  ASP B CB  1 
ATOM   6551 C CG  . ASP B 1 310 ? 28.635  14.992  -40.117 1.00 63.43  ? 310  ASP B CG  1 
ATOM   6552 O OD1 . ASP B 1 310 ? 28.898  13.883  -39.598 1.00 64.65  ? 310  ASP B OD1 1 
ATOM   6553 O OD2 . ASP B 1 310 ? 29.288  16.023  -39.852 1.00 63.80  ? 310  ASP B OD2 1 
ATOM   6554 N N   . THR B 1 311 ? 26.428  12.582  -39.919 1.00 53.39  ? 311  THR B N   1 
ATOM   6555 C CA  . THR B 1 311 ? 25.446  11.823  -39.148 1.00 53.46  ? 311  THR B CA  1 
ATOM   6556 C C   . THR B 1 311 ? 24.205  12.669  -38.873 1.00 55.45  ? 311  THR B C   1 
ATOM   6557 O O   . THR B 1 311 ? 24.290  13.904  -38.811 1.00 55.72  ? 311  THR B O   1 
ATOM   6558 C CB  . THR B 1 311 ? 26.029  11.350  -37.812 1.00 53.56  ? 311  THR B CB  1 
ATOM   6559 O OG1 . THR B 1 311 ? 26.282  12.484  -36.971 1.00 54.19  ? 311  THR B OG1 1 
ATOM   6560 C CG2 . THR B 1 311 ? 27.324  10.601  -38.060 1.00 42.93  ? 311  THR B CG2 1 
ATOM   6561 N N   . PRO B 1 312 ? 23.041  12.012  -38.719 1.00 53.72  ? 312  PRO B N   1 
ATOM   6562 C CA  . PRO B 1 312 ? 21.831  12.777  -38.391 1.00 56.27  ? 312  PRO B CA  1 
ATOM   6563 C C   . PRO B 1 312 ? 22.016  13.585  -37.110 1.00 54.12  ? 312  PRO B C   1 
ATOM   6564 O O   . PRO B 1 312 ? 21.541  14.721  -37.033 1.00 54.07  ? 312  PRO B O   1 
ATOM   6565 C CB  . PRO B 1 312 ? 20.768  11.693  -38.199 1.00 50.96  ? 312  PRO B CB  1 
ATOM   6566 C CG  . PRO B 1 312 ? 21.227  10.568  -39.059 1.00 53.48  ? 312  PRO B CG  1 
ATOM   6567 C CD  . PRO B 1 312 ? 22.743  10.589  -38.973 1.00 58.15  ? 312  PRO B CD  1 
ATOM   6568 N N   . GLU B 1 313 ? 22.706  13.002  -36.131 1.00 57.06  ? 313  GLU B N   1 
ATOM   6569 C CA  . GLU B 1 313 ? 23.043  13.716  -34.902 1.00 64.20  ? 313  GLU B CA  1 
ATOM   6570 C C   . GLU B 1 313 ? 23.753  15.054  -35.200 1.00 58.46  ? 313  GLU B C   1 
ATOM   6571 O O   . GLU B 1 313 ? 23.311  16.118  -34.764 1.00 58.07  ? 313  GLU B O   1 
ATOM   6572 C CB  . GLU B 1 313 ? 23.896  12.821  -34.004 1.00 67.55  ? 313  GLU B CB  1 
ATOM   6573 C CG  . GLU B 1 313 ? 24.614  13.562  -32.888 1.00 84.63  ? 313  GLU B CG  1 
ATOM   6574 C CD  . GLU B 1 313 ? 24.654  12.770  -31.592 1.00 101.10 ? 313  GLU B CD  1 
ATOM   6575 O OE1 . GLU B 1 313 ? 23.569  12.565  -30.991 1.00 98.13  ? 313  GLU B OE1 1 
ATOM   6576 O OE2 . GLU B 1 313 ? 25.764  12.359  -31.175 1.00 104.62 ? 313  GLU B OE2 1 
ATOM   6577 N N   . ALA B 1 314 ? 24.831  14.994  -35.972 1.00 51.23  ? 314  ALA B N   1 
ATOM   6578 C CA  . ALA B 1 314 ? 25.545  16.192  -36.394 1.00 50.46  ? 314  ALA B CA  1 
ATOM   6579 C C   . ALA B 1 314 ? 24.664  17.158  -37.187 1.00 58.53  ? 314  ALA B C   1 
ATOM   6580 O O   . ALA B 1 314 ? 24.746  18.375  -37.015 1.00 60.79  ? 314  ALA B O   1 
ATOM   6581 C CB  . ALA B 1 314 ? 26.773  15.812  -37.216 1.00 48.85  ? 314  ALA B CB  1 
ATOM   6582 N N   . LEU B 1 315 ? 23.825  16.616  -38.062 1.00 59.72  ? 315  LEU B N   1 
ATOM   6583 C CA  . LEU B 1 315 ? 23.003  17.454  -38.929 1.00 56.43  ? 315  LEU B CA  1 
ATOM   6584 C C   . LEU B 1 315 ? 21.878  18.159  -38.176 1.00 57.24  ? 315  LEU B C   1 
ATOM   6585 O O   . LEU B 1 315 ? 21.479  19.263  -38.562 1.00 53.89  ? 315  LEU B O   1 
ATOM   6586 C CB  . LEU B 1 315 ? 22.428  16.635  -40.084 1.00 53.85  ? 315  LEU B CB  1 
ATOM   6587 C CG  . LEU B 1 315 ? 23.433  16.067  -41.075 1.00 50.35  ? 315  LEU B CG  1 
ATOM   6588 C CD1 . LEU B 1 315 ? 22.709  15.263  -42.123 1.00 46.59  ? 315  LEU B CD1 1 
ATOM   6589 C CD2 . LEU B 1 315 ? 24.230  17.193  -41.706 1.00 52.63  ? 315  LEU B CD2 1 
ATOM   6590 N N   . ILE B 1 316 ? 21.355  17.532  -37.118 1.00 52.69  ? 316  ILE B N   1 
ATOM   6591 C CA  . ILE B 1 316 ? 20.291  18.184  -36.346 1.00 55.76  ? 316  ILE B CA  1 
ATOM   6592 C C   . ILE B 1 316 ? 20.858  19.192  -35.362 1.00 59.55  ? 316  ILE B C   1 
ATOM   6593 O O   . ILE B 1 316 ? 20.162  20.130  -34.983 1.00 63.25  ? 316  ILE B O   1 
ATOM   6594 C CB  . ILE B 1 316 ? 19.319  17.207  -35.605 1.00 49.67  ? 316  ILE B CB  1 
ATOM   6595 C CG1 . ILE B 1 316 ? 19.996  16.543  -34.405 1.00 53.99  ? 316  ILE B CG1 1 
ATOM   6596 C CG2 . ILE B 1 316 ? 18.730  16.184  -36.563 1.00 44.31  ? 316  ILE B CG2 1 
ATOM   6597 C CD1 . ILE B 1 316 ? 19.102  15.588  -33.643 1.00 50.81  ? 316  ILE B CD1 1 
ATOM   6598 N N   . ASN B 1 317 ? 22.113  18.997  -34.950 1.00 60.10  ? 317  ASN B N   1 
ATOM   6599 C CA  . ASN B 1 317 ? 22.782  19.946  -34.057 1.00 58.37  ? 317  ASN B CA  1 
ATOM   6600 C C   . ASN B 1 317 ? 23.136  21.257  -34.752 1.00 59.05  ? 317  ASN B C   1 
ATOM   6601 O O   . ASN B 1 317 ? 23.231  22.291  -34.110 1.00 65.02  ? 317  ASN B O   1 
ATOM   6602 C CB  . ASN B 1 317 ? 24.058  19.342  -33.467 1.00 61.38  ? 317  ASN B CB  1 
ATOM   6603 C CG  . ASN B 1 317 ? 23.779  18.284  -32.414 1.00 66.72  ? 317  ASN B CG  1 
ATOM   6604 O OD1 . ASN B 1 317 ? 22.674  18.199  -31.872 1.00 68.31  ? 317  ASN B OD1 1 
ATOM   6605 N ND2 . ASN B 1 317 ? 24.789  17.469  -32.114 1.00 69.78  ? 317  ASN B ND2 1 
ATOM   6606 N N   . THR B 1 318 ? 23.325  21.214  -36.067 1.00 59.58  ? 318  THR B N   1 
ATOM   6607 C CA  . THR B 1 318 ? 23.855  22.367  -36.782 1.00 62.77  ? 318  THR B CA  1 
ATOM   6608 C C   . THR B 1 318 ? 22.915  22.926  -37.838 1.00 66.74  ? 318  THR B C   1 
ATOM   6609 O O   . THR B 1 318 ? 23.195  23.973  -38.427 1.00 78.81  ? 318  THR B O   1 
ATOM   6610 C CB  . THR B 1 318 ? 25.191  22.041  -37.482 1.00 68.06  ? 318  THR B CB  1 
ATOM   6611 O OG1 . THR B 1 318 ? 24.942  21.223  -38.635 1.00 64.11  ? 318  THR B OG1 1 
ATOM   6612 C CG2 . THR B 1 318 ? 26.148  21.325  -36.523 1.00 69.39  ? 318  THR B CG2 1 
ATOM   6613 N N   . GLY B 1 319 ? 21.805  22.244  -38.087 1.00 58.57  ? 319  GLY B N   1 
ATOM   6614 C CA  . GLY B 1 319 ? 20.922  22.662  -39.163 1.00 63.72  ? 319  GLY B CA  1 
ATOM   6615 C C   . GLY B 1 319 ? 20.196  23.971  -38.895 1.00 65.17  ? 319  GLY B C   1 
ATOM   6616 O O   . GLY B 1 319 ? 20.079  24.394  -37.736 1.00 63.73  ? 319  GLY B O   1 
ATOM   6617 N N   . ASP B 1 320 ? 19.725  24.619  -39.963 1.00 61.39  ? 320  ASP B N   1 
ATOM   6618 C CA  . ASP B 1 320 ? 18.807  25.750  -39.833 1.00 70.58  ? 320  ASP B CA  1 
ATOM   6619 C C   . ASP B 1 320 ? 17.401  25.340  -40.274 1.00 73.88  ? 320  ASP B C   1 
ATOM   6620 O O   . ASP B 1 320 ? 17.144  25.067  -41.465 1.00 69.77  ? 320  ASP B O   1 
ATOM   6621 C CB  . ASP B 1 320 ? 19.272  26.969  -40.633 1.00 79.44  ? 320  ASP B CB  1 
ATOM   6622 C CG  . ASP B 1 320 ? 18.364  28.185  -40.426 1.00 80.29  ? 320  ASP B CG  1 
ATOM   6623 O OD1 . ASP B 1 320 ? 17.921  28.416  -39.276 1.00 80.22  ? 320  ASP B OD1 1 
ATOM   6624 O OD2 . ASP B 1 320 ? 18.096  28.910  -41.411 1.00 89.56  ? 320  ASP B OD2 1 
ATOM   6625 N N   . PHE B 1 321 ? 16.489  25.309  -39.307 1.00 64.60  ? 321  PHE B N   1 
ATOM   6626 C CA  . PHE B 1 321 ? 15.159  24.782  -39.541 1.00 59.75  ? 321  PHE B CA  1 
ATOM   6627 C C   . PHE B 1 321 ? 14.113  25.880  -39.418 1.00 64.41  ? 321  PHE B C   1 
ATOM   6628 O O   . PHE B 1 321 ? 12.992  25.634  -38.986 1.00 67.94  ? 321  PHE B O   1 
ATOM   6629 C CB  . PHE B 1 321 ? 14.898  23.642  -38.560 1.00 56.77  ? 321  PHE B CB  1 
ATOM   6630 C CG  . PHE B 1 321 ? 15.922  22.528  -38.638 1.00 58.88  ? 321  PHE B CG  1 
ATOM   6631 C CD1 . PHE B 1 321 ? 16.039  21.752  -39.791 1.00 53.60  ? 321  PHE B CD1 1 
ATOM   6632 C CD2 . PHE B 1 321 ? 16.754  22.244  -37.563 1.00 57.69  ? 321  PHE B CD2 1 
ATOM   6633 C CE1 . PHE B 1 321 ? 16.966  20.718  -39.869 1.00 50.39  ? 321  PHE B CE1 1 
ATOM   6634 C CE2 . PHE B 1 321 ? 17.683  21.205  -37.637 1.00 57.57  ? 321  PHE B CE2 1 
ATOM   6635 C CZ  . PHE B 1 321 ? 17.785  20.442  -38.797 1.00 51.80  ? 321  PHE B CZ  1 
ATOM   6636 N N   . GLN B 1 322 ? 14.487  27.089  -39.833 1.00 71.72  ? 322  GLN B N   1 
ATOM   6637 C CA  . GLN B 1 322 ? 13.641  28.274  -39.675 1.00 73.23  ? 322  GLN B CA  1 
ATOM   6638 C C   . GLN B 1 322 ? 12.270  28.228  -40.367 1.00 74.92  ? 322  GLN B C   1 
ATOM   6639 O O   . GLN B 1 322 ? 11.254  28.584  -39.754 1.00 74.49  ? 322  GLN B O   1 
ATOM   6640 C CB  . GLN B 1 322 ? 14.407  29.544  -40.080 1.00 73.96  ? 322  GLN B CB  1 
ATOM   6641 C CG  . GLN B 1 322 ? 15.131  30.246  -38.925 1.00 80.03  ? 322  GLN B CG  1 
ATOM   6642 C CD  . GLN B 1 322 ? 14.170  30.893  -37.918 1.00 92.69  ? 322  GLN B CD  1 
ATOM   6643 O OE1 . GLN B 1 322 ? 12.964  31.023  -38.174 1.00 84.23  ? 322  GLN B OE1 1 
ATOM   6644 N NE2 . GLN B 1 322 ? 14.708  31.307  -36.767 1.00 86.37  ? 322  GLN B NE2 1 
ATOM   6645 N N   . ASP B 1 323 ? 12.218  27.813  -41.630 1.00 69.76  ? 323  ASP B N   1 
ATOM   6646 C CA  . ASP B 1 323 ? 10.920  27.807  -42.320 1.00 87.40  ? 323  ASP B CA  1 
ATOM   6647 C C   . ASP B 1 323 ? 10.298  26.410  -42.374 1.00 78.00  ? 323  ASP B C   1 
ATOM   6648 O O   . ASP B 1 323 ? 9.820   25.960  -43.420 1.00 79.85  ? 323  ASP B O   1 
ATOM   6649 C CB  . ASP B 1 323 ? 11.002  28.462  -43.714 1.00 99.36  ? 323  ASP B CB  1 
ATOM   6650 C CG  . ASP B 1 323 ? 11.191  29.993  -43.647 1.00 112.56 ? 323  ASP B CG  1 
ATOM   6651 O OD1 . ASP B 1 323 ? 10.566  30.659  -42.782 1.00 102.07 ? 323  ASP B OD1 1 
ATOM   6652 O OD2 . ASP B 1 323 ? 11.974  30.529  -44.466 1.00 114.10 ? 323  ASP B OD2 1 
ATOM   6653 N N   . LEU B 1 324 ? 10.296  25.745  -41.220 1.00 71.40  ? 324  LEU B N   1 
ATOM   6654 C CA  . LEU B 1 324 ? 9.878   24.354  -41.118 1.00 62.68  ? 324  LEU B CA  1 
ATOM   6655 C C   . LEU B 1 324 ? 8.874   24.158  -39.996 1.00 51.25  ? 324  LEU B C   1 
ATOM   6656 O O   . LEU B 1 324 ? 9.104   24.598  -38.870 1.00 55.73  ? 324  LEU B O   1 
ATOM   6657 C CB  . LEU B 1 324 ? 11.093  23.464  -40.851 1.00 57.28  ? 324  LEU B CB  1 
ATOM   6658 C CG  . LEU B 1 324 ? 10.814  21.961  -40.844 1.00 55.41  ? 324  LEU B CG  1 
ATOM   6659 C CD1 . LEU B 1 324 ? 10.207  21.536  -42.177 1.00 53.73  ? 324  LEU B CD1 1 
ATOM   6660 C CD2 . LEU B 1 324 ? 12.090  21.176  -40.558 1.00 54.11  ? 324  LEU B CD2 1 
ATOM   6661 N N   . GLN B 1 325 ? 7.764   23.495  -40.305 1.00 50.09  ? 325  GLN B N   1 
ATOM   6662 C CA  . GLN B 1 325 ? 6.826   23.065  -39.272 1.00 47.95  ? 325  GLN B CA  1 
ATOM   6663 C C   . GLN B 1 325 ? 6.752   21.544  -39.204 1.00 47.27  ? 325  GLN B C   1 
ATOM   6664 O O   . GLN B 1 325 ? 6.640   20.870  -40.234 1.00 48.72  ? 325  GLN B O   1 
ATOM   6665 C CB  . GLN B 1 325 ? 5.454   23.656  -39.503 1.00 40.59  ? 325  GLN B CB  1 
ATOM   6666 C CG  . GLN B 1 325 ? 5.496   25.144  -39.682 1.00 53.02  ? 325  GLN B CG  1 
ATOM   6667 C CD  . GLN B 1 325 ? 4.870   25.582  -40.984 1.00 58.75  ? 325  GLN B CD  1 
ATOM   6668 O OE1 . GLN B 1 325 ? 4.987   24.906  -42.010 1.00 54.55  ? 325  GLN B OE1 1 
ATOM   6669 N NE2 . GLN B 1 325 ? 4.184   26.718  -40.949 1.00 72.72  ? 325  GLN B NE2 1 
ATOM   6670 N N   . VAL B 1 326 ? 6.799   21.023  -37.980 1.00 37.63  ? 326  VAL B N   1 
ATOM   6671 C CA  . VAL B 1 326 ? 6.976   19.605  -37.742 1.00 39.18  ? 326  VAL B CA  1 
ATOM   6672 C C   . VAL B 1 326 ? 6.056   19.158  -36.625 1.00 42.74  ? 326  VAL B C   1 
ATOM   6673 O O   . VAL B 1 326 ? 5.961   19.832  -35.597 1.00 40.80  ? 326  VAL B O   1 
ATOM   6674 C CB  . VAL B 1 326 ? 8.445   19.284  -37.323 1.00 45.47  ? 326  VAL B CB  1 
ATOM   6675 C CG1 . VAL B 1 326 ? 8.597   17.822  -36.920 1.00 42.91  ? 326  VAL B CG1 1 
ATOM   6676 C CG2 . VAL B 1 326 ? 9.409   19.604  -38.447 1.00 50.36  ? 326  VAL B CG2 1 
ATOM   6677 N N   . LEU B 1 327 ? 5.390   18.018  -36.823 1.00 40.86  ? 327  LEU B N   1 
ATOM   6678 C CA  . LEU B 1 327 ? 4.567   17.393  -35.788 1.00 38.68  ? 327  LEU B CA  1 
ATOM   6679 C C   . LEU B 1 327 ? 5.206   16.042  -35.423 1.00 41.60  ? 327  LEU B C   1 
ATOM   6680 O O   . LEU B 1 327 ? 5.532   15.241  -36.304 1.00 45.11  ? 327  LEU B O   1 
ATOM   6681 C CB  . LEU B 1 327 ? 3.124   17.222  -36.288 1.00 38.25  ? 327  LEU B CB  1 
ATOM   6682 C CG  . LEU B 1 327 ? 2.203   16.343  -35.429 1.00 42.30  ? 327  LEU B CG  1 
ATOM   6683 C CD1 . LEU B 1 327 ? 1.920   17.008  -34.095 1.00 38.32  ? 327  LEU B CD1 1 
ATOM   6684 C CD2 . LEU B 1 327 ? 0.903   16.018  -36.170 1.00 40.82  ? 327  LEU B CD2 1 
ATOM   6685 N N   . VAL B 1 328 ? 5.418   15.800  -34.133 1.00 34.83  ? 328  VAL B N   1 
ATOM   6686 C CA  . VAL B 1 328 ? 6.107   14.590  -33.695 1.00 37.20  ? 328  VAL B CA  1 
ATOM   6687 C C   . VAL B 1 328 ? 5.433   14.018  -32.468 1.00 45.65  ? 328  VAL B C   1 
ATOM   6688 O O   . VAL B 1 328 ? 4.881   14.763  -31.646 1.00 41.17  ? 328  VAL B O   1 
ATOM   6689 C CB  . VAL B 1 328 ? 7.574   14.841  -33.311 1.00 39.24  ? 328  VAL B CB  1 
ATOM   6690 C CG1 . VAL B 1 328 ? 8.428   14.956  -34.538 1.00 44.96  ? 328  VAL B CG1 1 
ATOM   6691 C CG2 . VAL B 1 328 ? 7.683   16.097  -32.449 1.00 45.33  ? 328  VAL B CG2 1 
ATOM   6692 N N   . GLY B 1 329 ? 5.482   12.696  -32.336 1.00 36.57  ? 329  GLY B N   1 
ATOM   6693 C CA  . GLY B 1 329 ? 4.959   12.089  -31.141 1.00 39.91  ? 329  GLY B CA  1 
ATOM   6694 C C   . GLY B 1 329 ? 5.321   10.640  -31.007 1.00 44.00  ? 329  GLY B C   1 
ATOM   6695 O O   . GLY B 1 329 ? 6.090   10.104  -31.808 1.00 42.52  ? 329  GLY B O   1 
ATOM   6696 N N   . VAL B 1 330 ? 4.764   10.012  -29.976 1.00 41.17  ? 330  VAL B N   1 
ATOM   6697 C CA  . VAL B 1 330 ? 5.108   8.647   -29.626 1.00 38.20  ? 330  VAL B CA  1 
ATOM   6698 C C   . VAL B 1 330 ? 3.821   7.995   -29.104 1.00 46.93  ? 330  VAL B C   1 
ATOM   6699 O O   . VAL B 1 330 ? 2.849   8.705   -28.797 1.00 43.56  ? 330  VAL B O   1 
ATOM   6700 C CB  . VAL B 1 330 ? 6.245   8.608   -28.555 1.00 42.43  ? 330  VAL B CB  1 
ATOM   6701 C CG1 . VAL B 1 330 ? 7.559   9.176   -29.109 1.00 42.71  ? 330  VAL B CG1 1 
ATOM   6702 C CG2 . VAL B 1 330 ? 5.844   9.373   -27.300 1.00 33.89  ? 330  VAL B CG2 1 
ATOM   6703 N N   . VAL B 1 331 ? 3.792   6.662   -29.040 1.00 43.26  ? 331  VAL B N   1 
ATOM   6704 C CA  . VAL B 1 331 ? 2.666   5.959   -28.420 1.00 42.09  ? 331  VAL B CA  1 
ATOM   6705 C C   . VAL B 1 331 ? 3.052   5.670   -26.981 1.00 45.76  ? 331  VAL B C   1 
ATOM   6706 O O   . VAL B 1 331 ? 4.205   5.886   -26.610 1.00 43.88  ? 331  VAL B O   1 
ATOM   6707 C CB  . VAL B 1 331 ? 2.269   4.646   -29.171 1.00 45.99  ? 331  VAL B CB  1 
ATOM   6708 C CG1 . VAL B 1 331 ? 1.787   4.966   -30.575 1.00 42.22  ? 331  VAL B CG1 1 
ATOM   6709 C CG2 . VAL B 1 331 ? 3.437   3.651   -29.222 1.00 38.09  ? 331  VAL B CG2 1 
ATOM   6710 N N   . LYS B 1 332 ? 2.108   5.179   -26.176 1.00 49.70  ? 332  LYS B N   1 
ATOM   6711 C CA  . LYS B 1 332 ? 2.350   5.026   -24.745 1.00 45.80  ? 332  LYS B CA  1 
ATOM   6712 C C   . LYS B 1 332 ? 3.370   3.927   -24.445 1.00 46.33  ? 332  LYS B C   1 
ATOM   6713 O O   . LYS B 1 332 ? 4.129   4.030   -23.482 1.00 48.82  ? 332  LYS B O   1 
ATOM   6714 C CB  . LYS B 1 332 ? 1.038   4.805   -23.976 1.00 52.99  ? 332  LYS B CB  1 
ATOM   6715 C CG  . LYS B 1 332 ? 1.197   4.770   -22.438 1.00 50.02  ? 332  LYS B CG  1 
ATOM   6716 C CD  . LYS B 1 332 ? -0.131  4.407   -21.744 1.00 62.38  ? 332  LYS B CD  1 
ATOM   6717 C CE  . LYS B 1 332 ? 0.052   3.317   -20.662 1.00 76.91  ? 332  LYS B CE  1 
ATOM   6718 N NZ  . LYS B 1 332 ? -0.289  1.921   -21.119 1.00 58.13  ? 332  LYS B NZ  1 
ATOM   6719 N N   . ASP B 1 333 ? 3.419   2.889   -25.275 1.00 49.27  ? 333  ASP B N   1 
ATOM   6720 C CA  . ASP B 1 333 ? 4.310   1.762   -24.984 1.00 48.66  ? 333  ASP B CA  1 
ATOM   6721 C C   . ASP B 1 333 ? 5.199   1.379   -26.169 1.00 48.48  ? 333  ASP B C   1 
ATOM   6722 O O   . ASP B 1 333 ? 5.048   0.319   -26.767 1.00 52.99  ? 333  ASP B O   1 
ATOM   6723 C CB  . ASP B 1 333 ? 3.509   0.565   -24.446 1.00 53.43  ? 333  ASP B CB  1 
ATOM   6724 C CG  . ASP B 1 333 ? 2.646   0.931   -23.227 1.00 53.20  ? 333  ASP B CG  1 
ATOM   6725 O OD1 . ASP B 1 333 ? 3.182   0.997   -22.097 1.00 55.25  ? 333  ASP B OD1 1 
ATOM   6726 O OD2 . ASP B 1 333 ? 1.425   1.154   -23.401 1.00 53.61  ? 333  ASP B OD2 1 
ATOM   6727 N N   . GLU B 1 334 ? 6.138   2.262   -26.487 1.00 53.96  ? 334  GLU B N   1 
ATOM   6728 C CA  . GLU B 1 334 ? 7.022   2.113   -27.644 1.00 45.27  ? 334  GLU B CA  1 
ATOM   6729 C C   . GLU B 1 334 ? 7.843   0.821   -27.670 1.00 48.47  ? 334  GLU B C   1 
ATOM   6730 O O   . GLU B 1 334 ? 8.233   0.339   -28.742 1.00 52.33  ? 334  GLU B O   1 
ATOM   6731 C CB  . GLU B 1 334 ? 7.969   3.322   -27.724 1.00 42.87  ? 334  GLU B CB  1 
ATOM   6732 C CG  . GLU B 1 334 ? 7.292   4.620   -28.156 1.00 47.27  ? 334  GLU B CG  1 
ATOM   6733 C CD  . GLU B 1 334 ? 6.832   4.585   -29.621 1.00 53.47  ? 334  GLU B CD  1 
ATOM   6734 O OE1 . GLU B 1 334 ? 7.323   3.717   -30.399 1.00 49.74  ? 334  GLU B OE1 1 
ATOM   6735 O OE2 . GLU B 1 334 ? 5.989   5.441   -29.998 1.00 45.76  ? 334  GLU B OE2 1 
ATOM   6736 N N   . GLY B 1 335 ? 8.099   0.248   -26.501 1.00 47.55  ? 335  GLY B N   1 
ATOM   6737 C CA  . GLY B 1 335 ? 9.033   -0.857  -26.431 1.00 51.85  ? 335  GLY B CA  1 
ATOM   6738 C C   . GLY B 1 335 ? 8.453   -2.254  -26.318 1.00 52.14  ? 335  GLY B C   1 
ATOM   6739 O O   . GLY B 1 335 ? 9.219   -3.220  -26.292 1.00 56.18  ? 335  GLY B O   1 
ATOM   6740 N N   . SER B 1 336 ? 7.129   -2.384  -26.244 1.00 47.43  ? 336  SER B N   1 
ATOM   6741 C CA  . SER B 1 336 ? 6.541   -3.699  -25.947 1.00 55.56  ? 336  SER B CA  1 
ATOM   6742 C C   . SER B 1 336 ? 6.612   -4.674  -27.140 1.00 53.06  ? 336  SER B C   1 
ATOM   6743 O O   . SER B 1 336 ? 6.872   -5.864  -26.971 1.00 55.35  ? 336  SER B O   1 
ATOM   6744 C CB  . SER B 1 336 ? 5.098   -3.563  -25.438 1.00 50.73  ? 336  SER B CB  1 
ATOM   6745 O OG  . SER B 1 336 ? 4.236   -3.074  -26.449 1.00 50.19  ? 336  SER B OG  1 
ATOM   6746 N N   . TYR B 1 337 ? 6.423   -4.140  -28.339 1.00 53.53  ? 337  TYR B N   1 
ATOM   6747 C CA  . TYR B 1 337 ? 6.256   -4.935  -29.549 1.00 54.26  ? 337  TYR B CA  1 
ATOM   6748 C C   . TYR B 1 337 ? 7.387   -5.915  -29.829 1.00 50.79  ? 337  TYR B C   1 
ATOM   6749 O O   . TYR B 1 337 ? 7.138   -7.092  -30.074 1.00 53.69  ? 337  TYR B O   1 
ATOM   6750 C CB  . TYR B 1 337 ? 6.067   -4.007  -30.756 1.00 58.80  ? 337  TYR B CB  1 
ATOM   6751 C CG  . TYR B 1 337 ? 5.566   -4.709  -31.986 1.00 58.76  ? 337  TYR B CG  1 
ATOM   6752 C CD1 . TYR B 1 337 ? 6.446   -5.360  -32.851 1.00 61.10  ? 337  TYR B CD1 1 
ATOM   6753 C CD2 . TYR B 1 337 ? 4.211   -4.731  -32.285 1.00 59.85  ? 337  TYR B CD2 1 
ATOM   6754 C CE1 . TYR B 1 337 ? 5.987   -6.019  -33.983 1.00 58.36  ? 337  TYR B CE1 1 
ATOM   6755 C CE2 . TYR B 1 337 ? 3.738   -5.379  -33.423 1.00 57.12  ? 337  TYR B CE2 1 
ATOM   6756 C CZ  . TYR B 1 337 ? 4.629   -6.025  -34.266 1.00 56.07  ? 337  TYR B CZ  1 
ATOM   6757 O OH  . TYR B 1 337 ? 4.155   -6.667  -35.392 1.00 57.76  ? 337  TYR B OH  1 
ATOM   6758 N N   . PHE B 1 338 ? 8.623   -5.431  -29.798 1.00 53.19  ? 338  PHE B N   1 
ATOM   6759 C CA  . PHE B 1 338 ? 9.760   -6.243  -30.219 1.00 56.24  ? 338  PHE B CA  1 
ATOM   6760 C C   . PHE B 1 338 ? 10.274  -7.171  -29.121 1.00 57.53  ? 338  PHE B C   1 
ATOM   6761 O O   . PHE B 1 338 ? 11.150  -8.004  -29.374 1.00 57.45  ? 338  PHE B O   1 
ATOM   6762 C CB  . PHE B 1 338 ? 10.909  -5.371  -30.762 1.00 59.77  ? 338  PHE B CB  1 
ATOM   6763 C CG  . PHE B 1 338 ? 10.708  -4.899  -32.192 1.00 63.38  ? 338  PHE B CG  1 
ATOM   6764 C CD1 . PHE B 1 338 ? 10.655  -5.816  -33.249 1.00 72.04  ? 338  PHE B CD1 1 
ATOM   6765 C CD2 . PHE B 1 338 ? 10.591  -3.537  -32.482 1.00 58.99  ? 338  PHE B CD2 1 
ATOM   6766 C CE1 . PHE B 1 338 ? 10.475  -5.381  -34.586 1.00 73.78  ? 338  PHE B CE1 1 
ATOM   6767 C CE2 . PHE B 1 338 ? 10.413  -3.093  -33.803 1.00 64.36  ? 338  PHE B CE2 1 
ATOM   6768 C CZ  . PHE B 1 338 ? 10.358  -4.018  -34.860 1.00 68.91  ? 338  PHE B CZ  1 
ATOM   6769 N N   . LEU B 1 339 ? 9.734   -7.027  -27.910 1.00 54.93  ? 339  LEU B N   1 
ATOM   6770 C CA  . LEU B 1 339 ? 10.158  -7.866  -26.785 1.00 62.62  ? 339  LEU B CA  1 
ATOM   6771 C C   . LEU B 1 339 ? 9.902   -9.351  -27.071 1.00 62.07  ? 339  LEU B C   1 
ATOM   6772 O O   . LEU B 1 339 ? 10.711  -10.211 -26.711 1.00 61.57  ? 339  LEU B O   1 
ATOM   6773 C CB  . LEU B 1 339 ? 9.471   -7.426  -25.482 1.00 57.65  ? 339  LEU B CB  1 
ATOM   6774 C CG  . LEU B 1 339 ? 9.950   -6.107  -24.866 1.00 53.45  ? 339  LEU B CG  1 
ATOM   6775 C CD1 . LEU B 1 339 ? 9.102   -5.726  -23.657 1.00 51.50  ? 339  LEU B CD1 1 
ATOM   6776 C CD2 . LEU B 1 339 ? 11.424  -6.179  -24.489 1.00 52.77  ? 339  LEU B CD2 1 
ATOM   6777 N N   . VAL B 1 340 ? 8.789   -9.637  -27.743 1.00 61.90  ? 340  VAL B N   1 
ATOM   6778 C CA  . VAL B 1 340 ? 8.435   -11.007 -28.113 1.00 68.01  ? 340  VAL B CA  1 
ATOM   6779 C C   . VAL B 1 340 ? 9.315   -11.571 -29.243 1.00 66.06  ? 340  VAL B C   1 
ATOM   6780 O O   . VAL B 1 340 ? 9.280   -12.773 -29.515 1.00 67.90  ? 340  VAL B O   1 
ATOM   6781 C CB  . VAL B 1 340 ? 6.945   -11.123 -28.521 1.00 62.10  ? 340  VAL B CB  1 
ATOM   6782 C CG1 . VAL B 1 340 ? 6.055   -10.350 -27.550 1.00 56.53  ? 340  VAL B CG1 1 
ATOM   6783 C CG2 . VAL B 1 340 ? 6.749   -10.611 -29.930 1.00 64.55  ? 340  VAL B CG2 1 
ATOM   6784 N N   . TYR B 1 341 ? 10.101  -10.711 -29.891 1.00 62.48  ? 341  TYR B N   1 
ATOM   6785 C CA  . TYR B 1 341 ? 10.968  -11.140 -30.994 1.00 62.24  ? 341  TYR B CA  1 
ATOM   6786 C C   . TYR B 1 341 ? 12.417  -11.386 -30.581 1.00 69.28  ? 341  TYR B C   1 
ATOM   6787 O O   . TYR B 1 341 ? 13.341  -11.063 -31.341 1.00 74.81  ? 341  TYR B O   1 
ATOM   6788 C CB  . TYR B 1 341 ? 10.976  -10.106 -32.118 1.00 59.53  ? 341  TYR B CB  1 
ATOM   6789 C CG  . TYR B 1 341 ? 9.738   -10.091 -32.970 1.00 67.27  ? 341  TYR B CG  1 
ATOM   6790 C CD1 . TYR B 1 341 ? 8.631   -9.339  -32.599 1.00 60.14  ? 341  TYR B CD1 1 
ATOM   6791 C CD2 . TYR B 1 341 ? 9.681   -10.806 -34.163 1.00 64.99  ? 341  TYR B CD2 1 
ATOM   6792 C CE1 . TYR B 1 341 ? 7.496   -9.307  -33.378 1.00 57.55  ? 341  TYR B CE1 1 
ATOM   6793 C CE2 . TYR B 1 341 ? 8.552   -10.780 -34.952 1.00 60.25  ? 341  TYR B CE2 1 
ATOM   6794 C CZ  . TYR B 1 341 ? 7.459   -10.028 -34.556 1.00 66.60  ? 341  TYR B CZ  1 
ATOM   6795 O OH  . TYR B 1 341 ? 6.325   -9.996  -35.339 1.00 71.14  ? 341  TYR B OH  1 
ATOM   6796 N N   . GLY B 1 342 ? 12.635  -11.927 -29.386 1.00 69.97  ? 342  GLY B N   1 
ATOM   6797 C CA  . GLY B 1 342 ? 13.992  -12.268 -28.989 1.00 73.25  ? 342  GLY B CA  1 
ATOM   6798 C C   . GLY B 1 342 ? 14.437  -11.967 -27.565 1.00 69.14  ? 342  GLY B C   1 
ATOM   6799 O O   . GLY B 1 342 ? 15.590  -12.247 -27.212 1.00 60.43  ? 342  GLY B O   1 
ATOM   6800 N N   . VAL B 1 343 ? 13.554  -11.396 -26.746 1.00 59.94  ? 343  VAL B N   1 
ATOM   6801 C CA  . VAL B 1 343 ? 13.867  -11.259 -25.326 1.00 62.74  ? 343  VAL B CA  1 
ATOM   6802 C C   . VAL B 1 343 ? 13.228  -12.409 -24.555 1.00 57.55  ? 343  VAL B C   1 
ATOM   6803 O O   . VAL B 1 343 ? 11.997  -12.534 -24.524 1.00 64.81  ? 343  VAL B O   1 
ATOM   6804 C CB  . VAL B 1 343 ? 13.444  -9.884  -24.742 1.00 65.26  ? 343  VAL B CB  1 
ATOM   6805 C CG1 . VAL B 1 343 ? 13.920  -9.753  -23.295 1.00 54.99  ? 343  VAL B CG1 1 
ATOM   6806 C CG2 . VAL B 1 343 ? 14.020  -8.757  -25.579 1.00 60.54  ? 343  VAL B CG2 1 
ATOM   6807 N N   . PRO B 1 344 ? 14.068  -13.274 -23.954 1.00 55.89  ? 344  PRO B N   1 
ATOM   6808 C CA  . PRO B 1 344 ? 13.573  -14.447 -23.218 1.00 62.43  ? 344  PRO B CA  1 
ATOM   6809 C C   . PRO B 1 344 ? 12.658  -14.067 -22.050 1.00 66.18  ? 344  PRO B C   1 
ATOM   6810 O O   . PRO B 1 344 ? 13.007  -13.193 -21.246 1.00 65.67  ? 344  PRO B O   1 
ATOM   6811 C CB  . PRO B 1 344 ? 14.855  -15.101 -22.692 1.00 59.89  ? 344  PRO B CB  1 
ATOM   6812 C CG  . PRO B 1 344 ? 15.910  -14.676 -23.637 1.00 60.86  ? 344  PRO B CG  1 
ATOM   6813 C CD  . PRO B 1 344 ? 15.539  -13.275 -24.059 1.00 61.74  ? 344  PRO B CD  1 
ATOM   6814 N N   . GLY B 1 345 ? 11.503  -14.722 -21.969 1.00 57.49  ? 345  GLY B N   1 
ATOM   6815 C CA  . GLY B 1 345 ? 10.535  -14.443 -20.930 1.00 53.95  ? 345  GLY B CA  1 
ATOM   6816 C C   . GLY B 1 345 ? 9.283   -13.807 -21.497 1.00 61.19  ? 345  GLY B C   1 
ATOM   6817 O O   . GLY B 1 345 ? 8.215   -13.826 -20.869 1.00 66.77  ? 345  GLY B O   1 
ATOM   6818 N N   . PHE B 1 346 ? 9.405   -13.249 -22.696 1.00 59.70  ? 346  PHE B N   1 
ATOM   6819 C CA  . PHE B 1 346 ? 8.323   -12.451 -23.257 1.00 62.23  ? 346  PHE B CA  1 
ATOM   6820 C C   . PHE B 1 346 ? 7.568   -13.188 -24.350 1.00 66.61  ? 346  PHE B C   1 
ATOM   6821 O O   . PHE B 1 346 ? 8.175   -13.814 -25.226 1.00 71.83  ? 346  PHE B O   1 
ATOM   6822 C CB  . PHE B 1 346 ? 8.857   -11.104 -23.771 1.00 65.28  ? 346  PHE B CB  1 
ATOM   6823 C CG  . PHE B 1 346 ? 9.276   -10.164 -22.672 1.00 58.18  ? 346  PHE B CG  1 
ATOM   6824 C CD1 . PHE B 1 346 ? 10.540  -10.271 -22.093 1.00 54.93  ? 346  PHE B CD1 1 
ATOM   6825 C CD2 . PHE B 1 346 ? 8.396   -9.191  -22.196 1.00 53.08  ? 346  PHE B CD2 1 
ATOM   6826 C CE1 . PHE B 1 346 ? 10.928  -9.418  -21.067 1.00 50.63  ? 346  PHE B CE1 1 
ATOM   6827 C CE2 . PHE B 1 346 ? 8.774   -8.337  -21.177 1.00 50.48  ? 346  PHE B CE2 1 
ATOM   6828 C CZ  . PHE B 1 346 ? 10.048  -8.450  -20.610 1.00 56.53  ? 346  PHE B CZ  1 
ATOM   6829 N N   . SER B 1 347 ? 6.240   -13.115 -24.281 1.00 65.76  ? 347  SER B N   1 
ATOM   6830 C CA  . SER B 1 347 ? 5.377   -13.745 -25.272 1.00 66.36  ? 347  SER B CA  1 
ATOM   6831 C C   . SER B 1 347 ? 3.990   -13.124 -25.232 1.00 67.46  ? 347  SER B C   1 
ATOM   6832 O O   . SER B 1 347 ? 3.560   -12.604 -24.196 1.00 70.21  ? 347  SER B O   1 
ATOM   6833 C CB  . SER B 1 347 ? 5.298   -15.259 -25.027 1.00 78.63  ? 347  SER B CB  1 
ATOM   6834 O OG  . SER B 1 347 ? 4.022   -15.781 -25.356 1.00 77.39  ? 347  SER B OG  1 
ATOM   6835 N N   . LYS B 1 348 ? 3.291   -13.181 -26.364 1.00 67.14  ? 348  LYS B N   1 
ATOM   6836 C CA  . LYS B 1 348 ? 1.917   -12.697 -26.441 1.00 64.85  ? 348  LYS B CA  1 
ATOM   6837 C C   . LYS B 1 348 ? 0.937   -13.660 -25.766 1.00 71.17  ? 348  LYS B C   1 
ATOM   6838 O O   . LYS B 1 348 ? -0.244  -13.340 -25.595 1.00 68.17  ? 348  LYS B O   1 
ATOM   6839 C CB  . LYS B 1 348 ? 1.503   -12.519 -27.903 1.00 69.20  ? 348  LYS B CB  1 
ATOM   6840 C CG  . LYS B 1 348 ? 1.292   -13.832 -28.637 1.00 65.53  ? 348  LYS B CG  1 
ATOM   6841 C CD  . LYS B 1 348 ? 0.465   -13.650 -29.908 1.00 72.76  ? 348  LYS B CD  1 
ATOM   6842 C CE  . LYS B 1 348 ? -0.259  -14.941 -30.290 1.00 72.37  ? 348  LYS B CE  1 
ATOM   6843 N NZ  . LYS B 1 348 ? -1.260  -15.325 -29.253 1.00 78.00  ? 348  LYS B NZ  1 
ATOM   6844 N N   . ASP B 1 349 ? 1.420   -14.841 -25.388 1.00 70.19  ? 349  ASP B N   1 
ATOM   6845 C CA  . ASP B 1 349 ? 0.518   -15.911 -24.965 1.00 78.58  ? 349  ASP B CA  1 
ATOM   6846 C C   . ASP B 1 349 ? 0.264   -15.984 -23.452 1.00 79.28  ? 349  ASP B C   1 
ATOM   6847 O O   . ASP B 1 349 ? -0.845  -16.316 -23.029 1.00 78.12  ? 349  ASP B O   1 
ATOM   6848 C CB  . ASP B 1 349 ? 0.946   -17.257 -25.570 1.00 73.13  ? 349  ASP B CB  1 
ATOM   6849 C CG  . ASP B 1 349 ? 0.683   -17.324 -27.076 1.00 74.93  ? 349  ASP B CG  1 
ATOM   6850 O OD1 . ASP B 1 349 ? -0.386  -16.839 -27.522 1.00 67.37  ? 349  ASP B OD1 1 
ATOM   6851 O OD2 . ASP B 1 349 ? 1.544   -17.852 -27.817 1.00 73.72  ? 349  ASP B OD2 1 
ATOM   6852 N N   . ASN B 1 350 ? 1.274   -15.670 -22.642 1.00 76.79  ? 350  ASN B N   1 
ATOM   6853 C CA  . ASN B 1 350 ? 1.042   -15.479 -21.207 1.00 79.02  ? 350  ASN B CA  1 
ATOM   6854 C C   . ASN B 1 350 ? 1.059   -13.999 -20.801 1.00 80.34  ? 350  ASN B C   1 
ATOM   6855 O O   . ASN B 1 350 ? 0.452   -13.163 -21.474 1.00 79.05  ? 350  ASN B O   1 
ATOM   6856 C CB  . ASN B 1 350 ? 2.002   -16.317 -20.355 1.00 75.15  ? 350  ASN B CB  1 
ATOM   6857 C CG  . ASN B 1 350 ? 3.445   -16.193 -20.799 1.00 81.39  ? 350  ASN B CG  1 
ATOM   6858 O OD1 . ASN B 1 350 ? 3.933   -15.094 -21.072 1.00 80.86  ? 350  ASN B OD1 1 
ATOM   6859 N ND2 . ASN B 1 350 ? 4.142   -17.332 -20.861 1.00 87.53  ? 350  ASN B ND2 1 
ATOM   6860 N N   . GLU B 1 351 ? 1.739   -13.674 -19.705 1.00 79.74  ? 351  GLU B N   1 
ATOM   6861 C CA  . GLU B 1 351 ? 1.761   -12.295 -19.219 1.00 72.04  ? 351  GLU B CA  1 
ATOM   6862 C C   . GLU B 1 351 ? 3.171   -11.785 -19.057 1.00 69.26  ? 351  GLU B C   1 
ATOM   6863 O O   . GLU B 1 351 ? 3.383   -10.642 -18.647 1.00 64.44  ? 351  GLU B O   1 
ATOM   6864 C CB  . GLU B 1 351 ? 1.027   -12.179 -17.898 1.00 64.53  ? 351  GLU B CB  1 
ATOM   6865 C CG  . GLU B 1 351 ? -0.387  -11.698 -18.048 1.00 66.37  ? 351  GLU B CG  1 
ATOM   6866 C CD  . GLU B 1 351 ? -1.164  -11.862 -16.765 1.00 91.68  ? 351  GLU B CD  1 
ATOM   6867 O OE1 . GLU B 1 351 ? -0.518  -11.957 -15.695 1.00 84.29  ? 351  GLU B OE1 1 
ATOM   6868 O OE2 . GLU B 1 351 ? -2.415  -11.906 -16.823 1.00 102.25 ? 351  GLU B OE2 1 
ATOM   6869 N N   . SER B 1 352 ? 4.123   -12.661 -19.363 1.00 69.41  ? 352  SER B N   1 
ATOM   6870 C CA  . SER B 1 352 ? 5.538   -12.325 -19.384 1.00 68.11  ? 352  SER B CA  1 
ATOM   6871 C C   . SER B 1 352 ? 6.007   -11.635 -18.108 1.00 70.42  ? 352  SER B C   1 
ATOM   6872 O O   . SER B 1 352 ? 6.787   -10.681 -18.164 1.00 68.82  ? 352  SER B O   1 
ATOM   6873 C CB  . SER B 1 352 ? 5.856   -11.457 -20.601 1.00 66.43  ? 352  SER B CB  1 
ATOM   6874 O OG  . SER B 1 352 ? 5.156   -11.910 -21.744 1.00 69.78  ? 352  SER B OG  1 
ATOM   6875 N N   . LEU B 1 353 ? 5.518   -12.103 -16.961 1.00 71.09  ? 353  LEU B N   1 
ATOM   6876 C CA  . LEU B 1 353 ? 6.099   -11.704 -15.682 1.00 63.35  ? 353  LEU B CA  1 
ATOM   6877 C C   . LEU B 1 353 ? 7.481   -12.349 -15.614 1.00 60.98  ? 353  LEU B C   1 
ATOM   6878 O O   . LEU B 1 353 ? 7.602   -13.567 -15.557 1.00 69.30  ? 353  LEU B O   1 
ATOM   6879 C CB  . LEU B 1 353 ? 5.224   -12.157 -14.520 1.00 60.73  ? 353  LEU B CB  1 
ATOM   6880 C CG  . LEU B 1 353 ? 3.760   -11.695 -14.576 1.00 67.69  ? 353  LEU B CG  1 
ATOM   6881 C CD1 . LEU B 1 353 ? 2.928   -12.386 -13.518 1.00 70.56  ? 353  LEU B CD1 1 
ATOM   6882 C CD2 . LEU B 1 353 ? 3.637   -10.189 -14.427 1.00 67.77  ? 353  LEU B CD2 1 
ATOM   6883 N N   . ILE B 1 354 ? 8.520   -11.525 -15.657 1.00 61.44  ? 354  ILE B N   1 
ATOM   6884 C CA  . ILE B 1 354 ? 9.886   -12.019 -15.762 1.00 62.83  ? 354  ILE B CA  1 
ATOM   6885 C C   . ILE B 1 354 ? 10.650  -11.908 -14.447 1.00 60.21  ? 354  ILE B C   1 
ATOM   6886 O O   . ILE B 1 354 ? 10.260  -11.169 -13.545 1.00 58.84  ? 354  ILE B O   1 
ATOM   6887 C CB  . ILE B 1 354 ? 10.682  -11.249 -16.845 1.00 68.50  ? 354  ILE B CB  1 
ATOM   6888 C CG1 . ILE B 1 354 ? 10.505  -9.731  -16.666 1.00 59.30  ? 354  ILE B CG1 1 
ATOM   6889 C CG2 . ILE B 1 354 ? 10.253  -11.684 -18.242 1.00 60.79  ? 354  ILE B CG2 1 
ATOM   6890 C CD1 . ILE B 1 354 ? 11.686  -8.917  -17.148 1.00 55.45  ? 354  ILE B CD1 1 
ATOM   6891 N N   . SER B 1 355 ? 11.751  -12.644 -14.357 1.00 64.04  ? 355  SER B N   1 
ATOM   6892 C CA  . SER B 1 355 ? 12.636  -12.589 -13.201 1.00 63.49  ? 355  SER B CA  1 
ATOM   6893 C C   . SER B 1 355 ? 13.665  -11.463 -13.335 1.00 66.51  ? 355  SER B C   1 
ATOM   6894 O O   . SER B 1 355 ? 13.870  -10.917 -14.422 1.00 66.81  ? 355  SER B O   1 
ATOM   6895 C CB  . SER B 1 355 ? 13.396  -13.908 -13.078 1.00 58.42  ? 355  SER B CB  1 
ATOM   6896 O OG  . SER B 1 355 ? 14.664  -13.814 -13.723 1.00 70.59  ? 355  SER B OG  1 
ATOM   6897 N N   . ARG B 1 356 ? 14.324  -11.146 -12.225 1.00 65.00  ? 356  ARG B N   1 
ATOM   6898 C CA  . ARG B 1 356 ? 15.438  -10.207 -12.218 1.00 65.93  ? 356  ARG B CA  1 
ATOM   6899 C C   . ARG B 1 356 ? 16.542  -10.597 -13.207 1.00 65.49  ? 356  ARG B C   1 
ATOM   6900 O O   . ARG B 1 356 ? 17.073  -9.743  -13.922 1.00 66.14  ? 356  ARG B O   1 
ATOM   6901 C CB  . ARG B 1 356 ? 16.023  -10.087 -10.800 1.00 62.78  ? 356  ARG B CB  1 
ATOM   6902 C CG  . ARG B 1 356 ? 17.208  -9.125  -10.688 1.00 61.29  ? 356  ARG B CG  1 
ATOM   6903 C CD  . ARG B 1 356 ? 16.939  -7.988  -9.693  1.00 66.80  ? 356  ARG B CD  1 
ATOM   6904 N NE  . ARG B 1 356 ? 17.904  -6.897  -9.844  1.00 68.74  ? 356  ARG B NE  1 
ATOM   6905 C CZ  . ARG B 1 356 ? 17.599  -5.674  -10.281 1.00 66.06  ? 356  ARG B CZ  1 
ATOM   6906 N NH1 . ARG B 1 356 ? 16.346  -5.373  -10.601 1.00 60.83  ? 356  ARG B NH1 1 
ATOM   6907 N NH2 . ARG B 1 356 ? 18.547  -4.745  -10.397 1.00 61.88  ? 356  ARG B NH2 1 
ATOM   6908 N N   . ALA B 1 357 ? 16.888  -11.882 -13.249 1.00 69.51  ? 357  ALA B N   1 
ATOM   6909 C CA  . ALA B 1 357 ? 18.009  -12.342 -14.076 1.00 68.96  ? 357  ALA B CA  1 
ATOM   6910 C C   . ALA B 1 357 ? 17.677  -12.212 -15.549 1.00 60.63  ? 357  ALA B C   1 
ATOM   6911 O O   . ALA B 1 357 ? 18.536  -11.860 -16.359 1.00 56.79  ? 357  ALA B O   1 
ATOM   6912 C CB  . ALA B 1 357 ? 18.375  -13.776 -13.741 1.00 58.33  ? 357  ALA B CB  1 
ATOM   6913 N N   . GLN B 1 358 ? 16.424  -12.504 -15.888 1.00 62.76  ? 358  GLN B N   1 
ATOM   6914 C CA  . GLN B 1 358 ? 15.945  -12.342 -17.254 1.00 66.11  ? 358  GLN B CA  1 
ATOM   6915 C C   . GLN B 1 358 ? 15.995  -10.875 -17.670 1.00 67.16  ? 358  GLN B C   1 
ATOM   6916 O O   . GLN B 1 358 ? 16.270  -10.557 -18.834 1.00 62.85  ? 358  GLN B O   1 
ATOM   6917 C CB  . GLN B 1 358 ? 14.517  -12.853 -17.368 1.00 65.79  ? 358  GLN B CB  1 
ATOM   6918 C CG  . GLN B 1 358 ? 14.375  -14.347 -17.240 1.00 60.58  ? 358  GLN B CG  1 
ATOM   6919 C CD  . GLN B 1 358 ? 12.924  -14.774 -17.317 1.00 65.70  ? 358  GLN B CD  1 
ATOM   6920 O OE1 . GLN B 1 358 ? 12.112  -14.412 -16.459 1.00 67.59  ? 358  GLN B OE1 1 
ATOM   6921 N NE2 . GLN B 1 358 ? 12.582  -15.531 -18.359 1.00 66.34  ? 358  GLN B NE2 1 
ATOM   6922 N N   . PHE B 1 359 ? 15.717  -9.997  -16.704 1.00 65.65  ? 359  PHE B N   1 
ATOM   6923 C CA  . PHE B 1 359 ? 15.763  -8.554  -16.902 1.00 58.01  ? 359  PHE B CA  1 
ATOM   6924 C C   . PHE B 1 359 ? 17.177  -8.062  -17.216 1.00 58.00  ? 359  PHE B C   1 
ATOM   6925 O O   . PHE B 1 359 ? 17.360  -7.197  -18.077 1.00 57.65  ? 359  PHE B O   1 
ATOM   6926 C CB  . PHE B 1 359 ? 15.184  -7.836  -15.676 1.00 61.16  ? 359  PHE B CB  1 
ATOM   6927 C CG  . PHE B 1 359 ? 15.306  -6.336  -15.727 1.00 64.06  ? 359  PHE B CG  1 
ATOM   6928 C CD1 . PHE B 1 359 ? 14.486  -5.585  -16.558 1.00 66.51  ? 359  PHE B CD1 1 
ATOM   6929 C CD2 . PHE B 1 359 ? 16.234  -5.671  -14.934 1.00 65.68  ? 359  PHE B CD2 1 
ATOM   6930 C CE1 . PHE B 1 359 ? 14.601  -4.189  -16.610 1.00 63.78  ? 359  PHE B CE1 1 
ATOM   6931 C CE2 . PHE B 1 359 ? 16.346  -4.277  -14.977 1.00 59.74  ? 359  PHE B CE2 1 
ATOM   6932 C CZ  . PHE B 1 359 ? 15.530  -3.542  -15.816 1.00 58.36  ? 359  PHE B CZ  1 
ATOM   6933 N N   . LEU B 1 360 ? 18.175  -8.612  -16.533 1.00 57.56  ? 360  LEU B N   1 
ATOM   6934 C CA  . LEU B 1 360 ? 19.552  -8.174  -16.746 1.00 58.94  ? 360  LEU B CA  1 
ATOM   6935 C C   . LEU B 1 360 ? 20.047  -8.686  -18.092 1.00 65.73  ? 360  LEU B C   1 
ATOM   6936 O O   . LEU B 1 360 ? 20.870  -8.045  -18.758 1.00 65.76  ? 360  LEU B O   1 
ATOM   6937 C CB  . LEU B 1 360 ? 20.479  -8.662  -15.625 1.00 59.57  ? 360  LEU B CB  1 
ATOM   6938 C CG  . LEU B 1 360 ? 20.093  -8.473  -14.148 1.00 69.62  ? 360  LEU B CG  1 
ATOM   6939 C CD1 . LEU B 1 360 ? 21.216  -8.966  -13.240 1.00 72.76  ? 360  LEU B CD1 1 
ATOM   6940 C CD2 . LEU B 1 360 ? 19.712  -7.031  -13.786 1.00 59.35  ? 360  LEU B CD2 1 
ATOM   6941 N N   . ALA B 1 361 ? 19.532  -9.847  -18.485 1.00 67.35  ? 361  ALA B N   1 
ATOM   6942 C CA  . ALA B 1 361 ? 19.871  -10.457 -19.766 1.00 66.76  ? 361  ALA B CA  1 
ATOM   6943 C C   . ALA B 1 361 ? 19.166  -9.728  -20.911 1.00 63.57  ? 361  ALA B C   1 
ATOM   6944 O O   . ALA B 1 361 ? 19.731  -9.574  -21.999 1.00 66.39  ? 361  ALA B O   1 
ATOM   6945 C CB  . ALA B 1 361 ? 19.497  -11.938 -19.764 1.00 61.41  ? 361  ALA B CB  1 
ATOM   6946 N N   . GLY B 1 362 ? 17.933  -9.288  -20.658 1.00 55.05  ? 362  GLY B N   1 
ATOM   6947 C CA  . GLY B 1 362 ? 17.163  -8.543  -21.642 1.00 57.67  ? 362  GLY B CA  1 
ATOM   6948 C C   . GLY B 1 362 ? 17.785  -7.200  -21.990 1.00 64.29  ? 362  GLY B C   1 
ATOM   6949 O O   . GLY B 1 362 ? 17.707  -6.745  -23.135 1.00 64.55  ? 362  GLY B O   1 
ATOM   6950 N N   . VAL B 1 363 ? 18.410  -6.565  -21.002 1.00 61.09  ? 363  VAL B N   1 
ATOM   6951 C CA  . VAL B 1 363 ? 19.027  -5.256  -21.188 1.00 58.77  ? 363  VAL B CA  1 
ATOM   6952 C C   . VAL B 1 363 ? 20.234  -5.320  -22.138 1.00 56.65  ? 363  VAL B C   1 
ATOM   6953 O O   . VAL B 1 363 ? 20.495  -4.367  -22.883 1.00 56.21  ? 363  VAL B O   1 
ATOM   6954 C CB  . VAL B 1 363 ? 19.394  -4.622  -19.813 1.00 56.16  ? 363  VAL B CB  1 
ATOM   6955 C CG1 . VAL B 1 363 ? 20.390  -3.478  -19.957 1.00 41.46  ? 363  VAL B CG1 1 
ATOM   6956 C CG2 . VAL B 1 363 ? 18.131  -4.156  -19.095 1.00 55.66  ? 363  VAL B CG2 1 
ATOM   6957 N N   . ARG B 1 364 ? 20.958  -6.443  -22.124 1.00 56.05  ? 364  ARG B N   1 
ATOM   6958 C CA  . ARG B 1 364 ? 22.108  -6.616  -23.020 1.00 57.80  ? 364  ARG B CA  1 
ATOM   6959 C C   . ARG B 1 364 ? 21.660  -6.819  -24.467 1.00 58.07  ? 364  ARG B C   1 
ATOM   6960 O O   . ARG B 1 364 ? 22.419  -6.562  -25.402 1.00 60.98  ? 364  ARG B O   1 
ATOM   6961 C CB  . ARG B 1 364 ? 22.969  -7.801  -22.587 1.00 61.65  ? 364  ARG B CB  1 
ATOM   6962 C CG  . ARG B 1 364 ? 23.348  -7.820  -21.105 1.00 71.03  ? 364  ARG B CG  1 
ATOM   6963 C CD  . ARG B 1 364 ? 23.970  -6.503  -20.642 1.00 69.30  ? 364  ARG B CD  1 
ATOM   6964 N NE  . ARG B 1 364 ? 25.070  -6.051  -21.496 1.00 65.32  ? 364  ARG B NE  1 
ATOM   6965 C CZ  . ARG B 1 364 ? 26.358  -6.187  -21.189 1.00 70.38  ? 364  ARG B CZ  1 
ATOM   6966 N NH1 . ARG B 1 364 ? 26.706  -6.767  -20.046 1.00 75.44  ? 364  ARG B NH1 1 
ATOM   6967 N NH2 . ARG B 1 364 ? 27.298  -5.742  -22.021 1.00 69.59  ? 364  ARG B NH2 1 
ATOM   6968 N N   . ILE B 1 365 ? 20.426  -7.297  -24.633 1.00 58.47  ? 365  ILE B N   1 
ATOM   6969 C CA  . ILE B 1 365 ? 19.820  -7.520  -25.946 1.00 60.86  ? 365  ILE B CA  1 
ATOM   6970 C C   . ILE B 1 365 ? 19.139  -6.235  -26.438 1.00 62.89  ? 365  ILE B C   1 
ATOM   6971 O O   . ILE B 1 365 ? 19.288  -5.848  -27.611 1.00 55.00  ? 365  ILE B O   1 
ATOM   6972 C CB  . ILE B 1 365 ? 18.795  -8.688  -25.894 1.00 55.86  ? 365  ILE B CB  1 
ATOM   6973 C CG1 . ILE B 1 365 ? 19.503  -10.010 -25.565 1.00 59.84  ? 365  ILE B CG1 1 
ATOM   6974 C CG2 . ILE B 1 365 ? 18.020  -8.805  -27.203 1.00 55.59  ? 365  ILE B CG2 1 
ATOM   6975 C CD1 . ILE B 1 365 ? 18.557  -11.121 -25.150 1.00 60.20  ? 365  ILE B CD1 1 
ATOM   6976 N N   . GLY B 1 366 ? 18.411  -5.578  -25.526 1.00 58.27  ? 366  GLY B N   1 
ATOM   6977 C CA  . GLY B 1 366 ? 17.739  -4.314  -25.799 1.00 54.34  ? 366  GLY B CA  1 
ATOM   6978 C C   . GLY B 1 366 ? 18.683  -3.145  -26.043 1.00 50.31  ? 366  GLY B C   1 
ATOM   6979 O O   . GLY B 1 366 ? 18.377  -2.240  -26.824 1.00 50.45  ? 366  GLY B O   1 
ATOM   6980 N N   . VAL B 1 367 ? 19.830  -3.154  -25.374 1.00 44.61  ? 367  VAL B N   1 
ATOM   6981 C CA  . VAL B 1 367 ? 20.836  -2.109  -25.575 1.00 56.29  ? 367  VAL B CA  1 
ATOM   6982 C C   . VAL B 1 367 ? 22.124  -2.783  -26.027 1.00 55.58  ? 367  VAL B C   1 
ATOM   6983 O O   . VAL B 1 367 ? 23.136  -2.743  -25.332 1.00 50.52  ? 367  VAL B O   1 
ATOM   6984 C CB  . VAL B 1 367 ? 21.089  -1.286  -24.279 1.00 53.53  ? 367  VAL B CB  1 
ATOM   6985 C CG1 . VAL B 1 367 ? 21.878  -0.018  -24.592 1.00 41.31  ? 367  VAL B CG1 1 
ATOM   6986 C CG2 . VAL B 1 367 ? 19.771  -0.935  -23.595 1.00 42.01  ? 367  VAL B CG2 1 
ATOM   6987 N N   . PRO B 1 368 ? 22.091  -3.399  -27.215 1.00 60.07  ? 368  PRO B N   1 
ATOM   6988 C CA  . PRO B 1 368 ? 23.128  -4.366  -27.605 1.00 55.18  ? 368  PRO B CA  1 
ATOM   6989 C C   . PRO B 1 368 ? 24.527  -3.754  -27.729 1.00 55.28  ? 368  PRO B C   1 
ATOM   6990 O O   . PRO B 1 368 ? 25.525  -4.478  -27.750 1.00 56.63  ? 368  PRO B O   1 
ATOM   6991 C CB  . PRO B 1 368 ? 22.636  -4.864  -28.964 1.00 59.28  ? 368  PRO B CB  1 
ATOM   6992 C CG  . PRO B 1 368 ? 21.848  -3.697  -29.515 1.00 59.22  ? 368  PRO B CG  1 
ATOM   6993 C CD  . PRO B 1 368 ? 21.154  -3.110  -28.319 1.00 55.49  ? 368  PRO B CD  1 
ATOM   6994 N N   A GLN B 1 369 ? 24.589  -2.430  -27.818 0.47 55.02  ? 369  GLN B N   1 
ATOM   6995 N N   B GLN B 1 369 ? 24.598  -2.429  -27.783 0.53 55.03  ? 369  GLN B N   1 
ATOM   6996 C CA  A GLN B 1 369 ? 25.868  -1.735  -27.925 0.47 53.60  ? 369  GLN B CA  1 
ATOM   6997 C CA  B GLN B 1 369 ? 25.884  -1.746  -27.898 0.53 53.59  ? 369  GLN B CA  1 
ATOM   6998 C C   A GLN B 1 369 ? 26.404  -1.300  -26.556 0.47 55.51  ? 369  GLN B C   1 
ATOM   6999 C C   B GLN B 1 369 ? 26.415  -1.305  -26.544 0.53 55.51  ? 369  GLN B C   1 
ATOM   7000 O O   A GLN B 1 369 ? 27.465  -0.678  -26.478 0.47 58.41  ? 369  GLN B O   1 
ATOM   7001 O O   B GLN B 1 369 ? 27.466  -0.668  -26.464 0.53 58.42  ? 369  GLN B O   1 
ATOM   7002 C CB  A GLN B 1 369 ? 25.760  -0.528  -28.871 0.47 52.09  ? 369  GLN B CB  1 
ATOM   7003 C CB  B GLN B 1 369 ? 25.773  -0.535  -28.825 0.53 51.96  ? 369  GLN B CB  1 
ATOM   7004 C CG  A GLN B 1 369 ? 26.052  -0.827  -30.363 0.47 56.08  ? 369  GLN B CG  1 
ATOM   7005 C CG  B GLN B 1 369 ? 24.340  -0.197  -29.237 0.53 57.35  ? 369  GLN B CG  1 
ATOM   7006 C CD  A GLN B 1 369 ? 24.955  -1.626  -31.076 0.47 51.51  ? 369  GLN B CD  1 
ATOM   7007 C CD  B GLN B 1 369 ? 23.579  0.545   -28.166 0.53 50.29  ? 369  GLN B CD  1 
ATOM   7008 O OE1 A GLN B 1 369 ? 23.837  -1.142  -31.292 0.47 47.06  ? 369  GLN B OE1 1 
ATOM   7009 O OE1 B GLN B 1 369 ? 22.419  0.245   -27.900 0.53 48.74  ? 369  GLN B OE1 1 
ATOM   7010 N NE2 A GLN B 1 369 ? 25.286  -2.844  -31.462 0.47 46.63  ? 369  GLN B NE2 1 
ATOM   7011 N NE2 B GLN B 1 369 ? 24.229  1.527   -27.548 0.53 47.55  ? 369  GLN B NE2 1 
ATOM   7012 N N   . ALA B 1 370 ? 25.686  -1.640  -25.483 1.00 53.39  ? 370  ALA B N   1 
ATOM   7013 C CA  . ALA B 1 370 ? 26.089  -1.255  -24.119 1.00 59.68  ? 370  ALA B CA  1 
ATOM   7014 C C   . ALA B 1 370 ? 27.301  -2.029  -23.594 1.00 62.86  ? 370  ALA B C   1 
ATOM   7015 O O   . ALA B 1 370 ? 27.320  -3.276  -23.631 1.00 57.41  ? 370  ALA B O   1 
ATOM   7016 C CB  . ALA B 1 370 ? 24.914  -1.397  -23.131 1.00 53.27  ? 370  ALA B CB  1 
ATOM   7017 N N   . SER B 1 371 ? 28.299  -1.286  -23.100 1.00 57.66  ? 371  SER B N   1 
ATOM   7018 C CA  . SER B 1 371 ? 29.388  -1.869  -22.311 1.00 53.92  ? 371  SER B CA  1 
ATOM   7019 C C   . SER B 1 371 ? 28.839  -2.426  -20.993 1.00 59.66  ? 371  SER B C   1 
ATOM   7020 O O   . SER B 1 371 ? 27.695  -2.149  -20.622 1.00 56.90  ? 371  SER B O   1 
ATOM   7021 C CB  . SER B 1 371 ? 30.468  -0.827  -22.033 1.00 62.18  ? 371  SER B CB  1 
ATOM   7022 O OG  . SER B 1 371 ? 29.995  0.216   -21.191 1.00 66.74  ? 371  SER B OG  1 
ATOM   7023 N N   . ASP B 1 372 ? 29.639  -3.223  -20.291 1.00 66.25  ? 372  ASP B N   1 
ATOM   7024 C CA  . ASP B 1 372 ? 29.201  -3.777  -19.013 1.00 65.14  ? 372  ASP B CA  1 
ATOM   7025 C C   . ASP B 1 372 ? 28.758  -2.677  -18.051 1.00 61.91  ? 372  ASP B C   1 
ATOM   7026 O O   . ASP B 1 372 ? 27.693  -2.769  -17.423 1.00 58.32  ? 372  ASP B O   1 
ATOM   7027 C CB  . ASP B 1 372 ? 30.312  -4.612  -18.390 1.00 75.47  ? 372  ASP B CB  1 
ATOM   7028 C CG  . ASP B 1 372 ? 30.438  -5.964  -19.042 1.00 87.86  ? 372  ASP B CG  1 
ATOM   7029 O OD1 . ASP B 1 372 ? 29.381  -6.604  -19.252 1.00 85.28  ? 372  ASP B OD1 1 
ATOM   7030 O OD2 . ASP B 1 372 ? 31.577  -6.375  -19.360 1.00 88.85  ? 372  ASP B OD2 1 
ATOM   7031 N N   . LEU B 1 373 ? 29.574  -1.630  -17.971 1.00 56.11  ? 373  LEU B N   1 
ATOM   7032 C CA  . LEU B 1 373 ? 29.301  -0.490  -17.113 1.00 53.94  ? 373  LEU B CA  1 
ATOM   7033 C C   . LEU B 1 373 ? 28.056  0.284   -17.551 1.00 57.69  ? 373  LEU B C   1 
ATOM   7034 O O   . LEU B 1 373 ? 27.204  0.635   -16.721 1.00 58.17  ? 373  LEU B O   1 
ATOM   7035 C CB  . LEU B 1 373 ? 30.518  0.432   -17.069 1.00 58.53  ? 373  LEU B CB  1 
ATOM   7036 C CG  . LEU B 1 373 ? 30.374  1.636   -16.137 1.00 61.99  ? 373  LEU B CG  1 
ATOM   7037 C CD1 . LEU B 1 373 ? 30.036  1.158   -14.734 1.00 54.39  ? 373  LEU B CD1 1 
ATOM   7038 C CD2 . LEU B 1 373 ? 31.642  2.483   -16.144 1.00 58.13  ? 373  LEU B CD2 1 
ATOM   7039 N N   . ALA B 1 374 ? 27.951  0.552   -18.850 1.00 58.47  ? 374  ALA B N   1 
ATOM   7040 C CA  . ALA B 1 374 ? 26.758  1.201   -19.396 1.00 60.32  ? 374  ALA B CA  1 
ATOM   7041 C C   . ALA B 1 374 ? 25.490  0.385   -19.130 1.00 53.82  ? 374  ALA B C   1 
ATOM   7042 O O   . ALA B 1 374 ? 24.451  0.942   -18.769 1.00 54.38  ? 374  ALA B O   1 
ATOM   7043 C CB  . ALA B 1 374 ? 26.921  1.474   -20.883 1.00 59.41  ? 374  ALA B CB  1 
ATOM   7044 N N   . ALA B 1 375 ? 25.577  -0.929  -19.303 1.00 51.31  ? 375  ALA B N   1 
ATOM   7045 C CA  . ALA B 1 375 ? 24.447  -1.815  -19.021 1.00 53.90  ? 375  ALA B CA  1 
ATOM   7046 C C   . ALA B 1 375 ? 24.000  -1.702  -17.566 1.00 55.71  ? 375  ALA B C   1 
ATOM   7047 O O   . ALA B 1 375 ? 22.807  -1.644  -17.279 1.00 55.80  ? 375  ALA B O   1 
ATOM   7048 C CB  . ALA B 1 375 ? 24.813  -3.246  -19.345 1.00 57.07  ? 375  ALA B CB  1 
ATOM   7049 N N   . GLU B 1 376 ? 24.968  -1.665  -16.654 1.00 58.09  ? 376  GLU B N   1 
ATOM   7050 C CA  . GLU B 1 376 ? 24.685  -1.558  -15.226 1.00 60.19  ? 376  GLU B CA  1 
ATOM   7051 C C   . GLU B 1 376 ? 23.926  -0.272  -14.921 1.00 62.19  ? 376  GLU B C   1 
ATOM   7052 O O   . GLU B 1 376 ? 22.921  -0.288  -14.203 1.00 53.49  ? 376  GLU B O   1 
ATOM   7053 C CB  . GLU B 1 376 ? 25.985  -1.578  -14.420 1.00 60.62  ? 376  GLU B CB  1 
ATOM   7054 C CG  . GLU B 1 376 ? 25.942  -2.453  -13.189 1.00 77.23  ? 376  GLU B CG  1 
ATOM   7055 C CD  . GLU B 1 376 ? 26.156  -3.918  -13.536 1.00 106.32 ? 376  GLU B CD  1 
ATOM   7056 O OE1 . GLU B 1 376 ? 27.336  -4.344  -13.585 1.00 101.25 ? 376  GLU B OE1 1 
ATOM   7057 O OE2 . GLU B 1 376 ? 25.149  -4.634  -13.769 1.00 101.65 ? 376  GLU B OE2 1 
ATOM   7058 N N   . ALA B 1 377 ? 24.425  0.839   -15.467 1.00 56.50  ? 377  ALA B N   1 
ATOM   7059 C CA  . ALA B 1 377 ? 23.759  2.129   -15.345 1.00 51.79  ? 377  ALA B CA  1 
ATOM   7060 C C   . ALA B 1 377 ? 22.283  2.039   -15.756 1.00 54.85  ? 377  ALA B C   1 
ATOM   7061 O O   . ALA B 1 377 ? 21.415  2.623   -15.102 1.00 58.21  ? 377  ALA B O   1 
ATOM   7062 C CB  . ALA B 1 377 ? 24.485  3.184   -16.176 1.00 46.58  ? 377  ALA B CB  1 
ATOM   7063 N N   . VAL B 1 378 ? 21.999  1.308   -16.833 1.00 50.81  ? 378  VAL B N   1 
ATOM   7064 C CA  . VAL B 1 378 ? 20.626  1.193   -17.308 1.00 50.44  ? 378  VAL B CA  1 
ATOM   7065 C C   . VAL B 1 378 ? 19.797  0.453   -16.283 1.00 48.71  ? 378  VAL B C   1 
ATOM   7066 O O   . VAL B 1 378 ? 18.730  0.931   -15.886 1.00 53.14  ? 378  VAL B O   1 
ATOM   7067 C CB  . VAL B 1 378 ? 20.515  0.472   -18.673 1.00 53.00  ? 378  VAL B CB  1 
ATOM   7068 C CG1 . VAL B 1 378 ? 19.040  0.221   -19.026 1.00 46.48  ? 378  VAL B CG1 1 
ATOM   7069 C CG2 . VAL B 1 378 ? 21.182  1.295   -19.752 1.00 42.00  ? 378  VAL B CG2 1 
ATOM   7070 N N   . VAL B 1 379 ? 20.298  -0.708  -15.862 1.00 50.17  ? 379  VAL B N   1 
ATOM   7071 C CA  . VAL B 1 379 ? 19.642  -1.530  -14.849 1.00 50.51  ? 379  VAL B CA  1 
ATOM   7072 C C   . VAL B 1 379 ? 19.346  -0.758  -13.564 1.00 54.60  ? 379  VAL B C   1 
ATOM   7073 O O   . VAL B 1 379 ? 18.227  -0.814  -13.026 1.00 56.51  ? 379  VAL B O   1 
ATOM   7074 C CB  . VAL B 1 379 ? 20.506  -2.747  -14.503 1.00 48.45  ? 379  VAL B CB  1 
ATOM   7075 C CG1 . VAL B 1 379 ? 19.914  -3.492  -13.329 1.00 43.16  ? 379  VAL B CG1 1 
ATOM   7076 C CG2 . VAL B 1 379 ? 20.648  -3.659  -15.726 1.00 50.77  ? 379  VAL B CG2 1 
ATOM   7077 N N   . LEU B 1 380 ? 20.347  -0.030  -13.081 1.00 50.79  ? 380  LEU B N   1 
ATOM   7078 C CA  . LEU B 1 380 ? 20.218  0.659   -11.811 1.00 59.43  ? 380  LEU B CA  1 
ATOM   7079 C C   . LEU B 1 380 ? 19.208  1.796   -11.923 1.00 57.63  ? 380  LEU B C   1 
ATOM   7080 O O   . LEU B 1 380 ? 18.472  2.085   -10.977 1.00 57.02  ? 380  LEU B O   1 
ATOM   7081 C CB  . LEU B 1 380 ? 21.594  1.111   -11.293 1.00 66.11  ? 380  LEU B CB  1 
ATOM   7082 C CG  . LEU B 1 380 ? 22.586  -0.063  -11.091 1.00 69.85  ? 380  LEU B CG  1 
ATOM   7083 C CD1 . LEU B 1 380 ? 23.868  0.324   -10.336 1.00 66.13  ? 380  LEU B CD1 1 
ATOM   7084 C CD2 . LEU B 1 380 ? 21.926  -1.285  -10.422 1.00 60.08  ? 380  LEU B CD2 1 
ATOM   7085 N N   . HIS B 1 381 ? 19.138  2.394   -13.107 1.00 52.83  ? 381  HIS B N   1 
ATOM   7086 C CA  . HIS B 1 381 ? 18.155  3.436   -13.395 1.00 50.14  ? 381  HIS B CA  1 
ATOM   7087 C C   . HIS B 1 381 ? 16.711  2.919   -13.456 1.00 51.44  ? 381  HIS B C   1 
ATOM   7088 O O   . HIS B 1 381 ? 15.789  3.534   -12.907 1.00 49.62  ? 381  HIS B O   1 
ATOM   7089 C CB  . HIS B 1 381 ? 18.504  4.125   -14.714 1.00 53.90  ? 381  HIS B CB  1 
ATOM   7090 C CG  . HIS B 1 381 ? 17.665  5.326   -15.005 1.00 55.54  ? 381  HIS B CG  1 
ATOM   7091 N ND1 . HIS B 1 381 ? 18.002  6.596   -14.577 1.00 60.82  ? 381  HIS B ND1 1 
ATOM   7092 C CD2 . HIS B 1 381 ? 16.493  5.457   -15.676 1.00 48.74  ? 381  HIS B CD2 1 
ATOM   7093 C CE1 . HIS B 1 381 ? 17.074  7.450   -14.965 1.00 65.04  ? 381  HIS B CE1 1 
ATOM   7094 N NE2 . HIS B 1 381 ? 16.148  6.784   -15.636 1.00 62.08  ? 381  HIS B NE2 1 
ATOM   7095 N N   . TYR B 1 382 ? 16.520  1.782   -14.118 1.00 50.54  ? 382  TYR B N   1 
ATOM   7096 C CA  . TYR B 1 382 ? 15.174  1.293   -14.410 1.00 53.03  ? 382  TYR B CA  1 
ATOM   7097 C C   . TYR B 1 382 ? 14.596  0.357   -13.347 1.00 52.96  ? 382  TYR B C   1 
ATOM   7098 O O   . TYR B 1 382 ? 13.382  0.133   -13.311 1.00 54.63  ? 382  TYR B O   1 
ATOM   7099 C CB  . TYR B 1 382 ? 15.126  0.648   -15.794 1.00 52.76  ? 382  TYR B CB  1 
ATOM   7100 C CG  . TYR B 1 382 ? 14.986  1.656   -16.911 1.00 43.93  ? 382  TYR B CG  1 
ATOM   7101 C CD1 . TYR B 1 382 ? 16.105  2.232   -17.496 1.00 42.02  ? 382  TYR B CD1 1 
ATOM   7102 C CD2 . TYR B 1 382 ? 13.735  2.043   -17.366 1.00 39.69  ? 382  TYR B CD2 1 
ATOM   7103 C CE1 . TYR B 1 382 ? 15.985  3.154   -18.512 1.00 40.91  ? 382  TYR B CE1 1 
ATOM   7104 C CE2 . TYR B 1 382 ? 13.600  2.970   -18.386 1.00 42.05  ? 382  TYR B CE2 1 
ATOM   7105 C CZ  . TYR B 1 382 ? 14.733  3.522   -18.962 1.00 49.08  ? 382  TYR B CZ  1 
ATOM   7106 O OH  . TYR B 1 382 ? 14.620  4.449   -19.991 1.00 49.92  ? 382  TYR B OH  1 
ATOM   7107 N N   . THR B 1 383 ? 15.453  -0.185  -12.486 1.00 49.14  ? 383  THR B N   1 
ATOM   7108 C CA  . THR B 1 383 ? 14.968  -0.892  -11.307 1.00 48.85  ? 383  THR B CA  1 
ATOM   7109 C C   . THR B 1 383 ? 14.232  0.042   -10.330 1.00 52.05  ? 383  THR B C   1 
ATOM   7110 O O   . THR B 1 383 ? 14.717  1.135   -10.002 1.00 54.96  ? 383  THR B O   1 
ATOM   7111 C CB  . THR B 1 383 ? 16.112  -1.560  -10.556 1.00 54.77  ? 383  THR B CB  1 
ATOM   7112 O OG1 . THR B 1 383 ? 16.836  -2.404  -11.456 1.00 56.43  ? 383  THR B OG1 1 
ATOM   7113 C CG2 . THR B 1 383 ? 15.576  -2.381  -9.383  1.00 57.52  ? 383  THR B CG2 1 
ATOM   7114 N N   . ASP B 1 384 ? 13.046  -0.387  -9.897  1.00 56.04  ? 384  ASP B N   1 
ATOM   7115 C CA  . ASP B 1 384 ? 12.346  0.234   -8.775  1.00 64.81  ? 384  ASP B CA  1 
ATOM   7116 C C   . ASP B 1 384 ? 12.893  -0.374  -7.473  1.00 65.59  ? 384  ASP B C   1 
ATOM   7117 O O   . ASP B 1 384 ? 12.611  -1.531  -7.143  1.00 57.24  ? 384  ASP B O   1 
ATOM   7118 C CB  . ASP B 1 384 ? 10.843  -0.010  -8.864  1.00 60.67  ? 384  ASP B CB  1 
ATOM   7119 C CG  . ASP B 1 384 ? 10.067  0.771   -7.821  1.00 74.07  ? 384  ASP B CG  1 
ATOM   7120 O OD1 . ASP B 1 384 ? 10.306  0.538   -6.617  1.00 75.02  ? 384  ASP B OD1 1 
ATOM   7121 O OD2 . ASP B 1 384 ? 9.221   1.619   -8.202  1.00 75.99  ? 384  ASP B OD2 1 
ATOM   7122 N N   . TRP B 1 385 ? 13.670  0.403   -6.728  1.00 58.26  ? 385  TRP B N   1 
ATOM   7123 C CA  . TRP B 1 385 ? 14.391  -0.159  -5.589  1.00 69.15  ? 385  TRP B CA  1 
ATOM   7124 C C   . TRP B 1 385 ? 13.541  -0.467  -4.339  1.00 66.95  ? 385  TRP B C   1 
ATOM   7125 O O   . TRP B 1 385 ? 14.040  -1.040  -3.369  1.00 62.15  ? 385  TRP B O   1 
ATOM   7126 C CB  . TRP B 1 385 ? 15.631  0.678   -5.281  1.00 60.36  ? 385  TRP B CB  1 
ATOM   7127 C CG  . TRP B 1 385 ? 16.606  0.608   -6.414  1.00 61.15  ? 385  TRP B CG  1 
ATOM   7128 C CD1 . TRP B 1 385 ? 16.788  1.535   -7.405  1.00 59.47  ? 385  TRP B CD1 1 
ATOM   7129 C CD2 . TRP B 1 385 ? 17.506  -0.469  -6.703  1.00 59.46  ? 385  TRP B CD2 1 
ATOM   7130 N NE1 . TRP B 1 385 ? 17.758  1.107   -8.282  1.00 50.80  ? 385  TRP B NE1 1 
ATOM   7131 C CE2 . TRP B 1 385 ? 18.220  -0.117  -7.872  1.00 56.41  ? 385  TRP B CE2 1 
ATOM   7132 C CE3 . TRP B 1 385 ? 17.785  -1.692  -6.083  1.00 52.96  ? 385  TRP B CE3 1 
ATOM   7133 C CZ2 . TRP B 1 385 ? 19.197  -0.947  -8.434  1.00 59.75  ? 385  TRP B CZ2 1 
ATOM   7134 C CZ3 . TRP B 1 385 ? 18.761  -2.517  -6.643  1.00 54.36  ? 385  TRP B CZ3 1 
ATOM   7135 C CH2 . TRP B 1 385 ? 19.452  -2.140  -7.806  1.00 56.94  ? 385  TRP B CH2 1 
ATOM   7136 N N   . LEU B 1 386 ? 12.257  -0.120  -4.384  1.00 63.41  ? 386  LEU B N   1 
ATOM   7137 C CA  . LEU B 1 386 ? 11.317  -0.558  -3.358  1.00 68.73  ? 386  LEU B CA  1 
ATOM   7138 C C   . LEU B 1 386 ? 10.781  -1.961  -3.645  1.00 76.47  ? 386  LEU B C   1 
ATOM   7139 O O   . LEU B 1 386 ? 10.422  -2.704  -2.717  1.00 76.02  ? 386  LEU B O   1 
ATOM   7140 C CB  . LEU B 1 386 ? 10.148  0.408   -3.265  1.00 72.30  ? 386  LEU B CB  1 
ATOM   7141 C CG  . LEU B 1 386 ? 10.110  1.201   -1.968  1.00 77.39  ? 386  LEU B CG  1 
ATOM   7142 C CD1 . LEU B 1 386 ? 8.701   1.733   -1.746  1.00 82.30  ? 386  LEU B CD1 1 
ATOM   7143 C CD2 . LEU B 1 386 ? 10.565  0.322   -0.810  1.00 70.47  ? 386  LEU B CD2 1 
ATOM   7144 N N   . HIS B 1 387 ? 10.714  -2.298  -4.935  1.00 74.12  ? 387  HIS B N   1 
ATOM   7145 C CA  . HIS B 1 387 ? 10.254  -3.602  -5.404  1.00 68.06  ? 387  HIS B CA  1 
ATOM   7146 C C   . HIS B 1 387 ? 11.183  -4.101  -6.513  1.00 64.09  ? 387  HIS B C   1 
ATOM   7147 O O   . HIS B 1 387 ? 10.757  -4.248  -7.660  1.00 69.84  ? 387  HIS B O   1 
ATOM   7148 C CB  . HIS B 1 387 ? 8.831   -3.490  -5.957  1.00 66.09  ? 387  HIS B CB  1 
ATOM   7149 C CG  . HIS B 1 387 ? 7.928   -2.601  -5.155  1.00 77.25  ? 387  HIS B CG  1 
ATOM   7150 N ND1 . HIS B 1 387 ? 7.432   -1.406  -5.641  1.00 76.33  ? 387  HIS B ND1 1 
ATOM   7151 C CD2 . HIS B 1 387 ? 7.423   -2.733  -3.903  1.00 78.81  ? 387  HIS B CD2 1 
ATOM   7152 C CE1 . HIS B 1 387 ? 6.665   -0.842  -4.726  1.00 72.72  ? 387  HIS B CE1 1 
ATOM   7153 N NE2 . HIS B 1 387 ? 6.644   -1.626  -3.660  1.00 84.10  ? 387  HIS B NE2 1 
ATOM   7154 N N   . PRO B 1 388 ? 12.459  -4.360  -6.179  1.00 67.12  ? 388  PRO B N   1 
ATOM   7155 C CA  . PRO B 1 388 ? 13.477  -4.632  -7.203  1.00 66.71  ? 388  PRO B CA  1 
ATOM   7156 C C   . PRO B 1 388 ? 13.333  -6.002  -7.852  1.00 65.71  ? 388  PRO B C   1 
ATOM   7157 O O   . PRO B 1 388 ? 13.958  -6.257  -8.885  1.00 67.82  ? 388  PRO B O   1 
ATOM   7158 C CB  . PRO B 1 388 ? 14.786  -4.576  -6.408  1.00 64.80  ? 388  PRO B CB  1 
ATOM   7159 C CG  . PRO B 1 388 ? 14.398  -4.996  -5.043  1.00 56.98  ? 388  PRO B CG  1 
ATOM   7160 C CD  . PRO B 1 388 ? 13.023  -4.425  -4.818  1.00 62.45  ? 388  PRO B CD  1 
ATOM   7161 N N   . GLU B 1 389 ? 12.536  -6.874  -7.244  1.00 69.72  ? 389  GLU B N   1 
ATOM   7162 C CA  . GLU B 1 389 ? 12.413  -8.250  -7.720  1.00 67.32  ? 389  GLU B CA  1 
ATOM   7163 C C   . GLU B 1 389 ? 11.008  -8.564  -8.221  1.00 62.79  ? 389  GLU B C   1 
ATOM   7164 O O   . GLU B 1 389 ? 10.762  -9.648  -8.757  1.00 70.17  ? 389  GLU B O   1 
ATOM   7165 C CB  . GLU B 1 389 ? 12.827  -9.248  -6.628  1.00 65.53  ? 389  GLU B CB  1 
ATOM   7166 C CG  . GLU B 1 389 ? 14.314  -9.215  -6.257  1.00 69.49  ? 389  GLU B CG  1 
ATOM   7167 C CD  . GLU B 1 389 ? 15.111  -10.388 -6.840  1.00 94.52  ? 389  GLU B CD  1 
ATOM   7168 O OE1 . GLU B 1 389 ? 14.513  -11.237 -7.549  1.00 99.90  ? 389  GLU B OE1 1 
ATOM   7169 O OE2 . GLU B 1 389 ? 16.339  -10.466 -6.592  1.00 92.63  ? 389  GLU B OE2 1 
ATOM   7170 N N   . ASP B 1 390 ? 10.090  -7.616  -8.047  1.00 62.72  ? 390  ASP B N   1 
ATOM   7171 C CA  . ASP B 1 390 ? 8.720   -7.778  -8.527  1.00 62.80  ? 390  ASP B CA  1 
ATOM   7172 C C   . ASP B 1 390 ? 8.718   -7.959  -10.053 1.00 72.18  ? 390  ASP B C   1 
ATOM   7173 O O   . ASP B 1 390 ? 9.288   -7.145  -10.786 1.00 70.28  ? 390  ASP B O   1 
ATOM   7174 C CB  . ASP B 1 390 ? 7.870   -6.577  -8.111  1.00 57.49  ? 390  ASP B CB  1 
ATOM   7175 C CG  . ASP B 1 390 ? 6.486   -6.600  -8.730  1.00 71.30  ? 390  ASP B CG  1 
ATOM   7176 O OD1 . ASP B 1 390 ? 5.672   -7.479  -8.363  1.00 73.98  ? 390  ASP B OD1 1 
ATOM   7177 O OD2 . ASP B 1 390 ? 6.209   -5.733  -9.587  1.00 69.02  ? 390  ASP B OD2 1 
ATOM   7178 N N   . PRO B 1 391 ? 8.095   -9.046  -10.536 1.00 76.08  ? 391  PRO B N   1 
ATOM   7179 C CA  . PRO B 1 391 ? 8.138   -9.388  -11.966 1.00 70.71  ? 391  PRO B CA  1 
ATOM   7180 C C   . PRO B 1 391 ? 7.351   -8.404  -12.842 1.00 64.94  ? 391  PRO B C   1 
ATOM   7181 O O   . PRO B 1 391 ? 7.788   -8.125  -13.956 1.00 64.66  ? 391  PRO B O   1 
ATOM   7182 C CB  . PRO B 1 391 ? 7.507   -10.787 -12.019 1.00 65.83  ? 391  PRO B CB  1 
ATOM   7183 C CG  . PRO B 1 391 ? 7.472   -11.263 -10.587 1.00 71.66  ? 391  PRO B CG  1 
ATOM   7184 C CD  . PRO B 1 391 ? 7.330   -10.033 -9.759  1.00 70.55  ? 391  PRO B CD  1 
ATOM   7185 N N   . THR B 1 392 ? 6.227   -7.885  -12.349 1.00 59.89  ? 392  THR B N   1 
ATOM   7186 C CA  . THR B 1 392 ? 5.467   -6.869  -13.085 1.00 63.41  ? 392  THR B CA  1 
ATOM   7187 C C   . THR B 1 392 ? 6.285   -5.592  -13.355 1.00 63.22  ? 392  THR B C   1 
ATOM   7188 O O   . THR B 1 392 ? 6.244   -5.045  -14.454 1.00 60.18  ? 392  THR B O   1 
ATOM   7189 C CB  . THR B 1 392 ? 4.174   -6.471  -12.337 1.00 66.33  ? 392  THR B CB  1 
ATOM   7190 O OG1 . THR B 1 392 ? 3.478   -7.648  -11.900 1.00 67.51  ? 392  THR B OG1 1 
ATOM   7191 C CG2 . THR B 1 392 ? 3.277   -5.635  -13.230 1.00 49.61  ? 392  THR B CG2 1 
ATOM   7192 N N   . HIS B 1 393 ? 7.010   -5.115  -12.343 1.00 69.84  ? 393  HIS B N   1 
ATOM   7193 C CA  . HIS B 1 393 ? 7.836   -3.914  -12.485 1.00 70.19  ? 393  HIS B CA  1 
ATOM   7194 C C   . HIS B 1 393 ? 8.930   -4.158  -13.505 1.00 64.31  ? 393  HIS B C   1 
ATOM   7195 O O   . HIS B 1 393 ? 9.132   -3.347  -14.421 1.00 57.27  ? 393  HIS B O   1 
ATOM   7196 C CB  . HIS B 1 393 ? 8.459   -3.502  -11.146 1.00 65.40  ? 393  HIS B CB  1 
ATOM   7197 C CG  . HIS B 1 393 ? 7.523   -2.748  -10.253 1.00 77.99  ? 393  HIS B CG  1 
ATOM   7198 N ND1 . HIS B 1 393 ? 6.151   -2.861  -10.348 1.00 87.17  ? 393  HIS B ND1 1 
ATOM   7199 C CD2 . HIS B 1 393 ? 7.759   -1.861  -9.257  1.00 81.71  ? 393  HIS B CD2 1 
ATOM   7200 C CE1 . HIS B 1 393 ? 5.583   -2.081  -9.444  1.00 84.53  ? 393  HIS B CE1 1 
ATOM   7201 N NE2 . HIS B 1 393 ? 6.536   -1.461  -8.771  1.00 79.02  ? 393  HIS B NE2 1 
ATOM   7202 N N   . LEU B 1 394 ? 9.616   -5.287  -13.327 1.00 58.82  ? 394  LEU B N   1 
ATOM   7203 C CA  . LEU B 1 394 ? 10.675  -5.742  -14.221 1.00 62.93  ? 394  LEU B CA  1 
ATOM   7204 C C   . LEU B 1 394 ? 10.228  -5.859  -15.691 1.00 59.14  ? 394  LEU B C   1 
ATOM   7205 O O   . LEU B 1 394 ? 10.953  -5.450  -16.605 1.00 54.28  ? 394  LEU B O   1 
ATOM   7206 C CB  . LEU B 1 394 ? 11.217  -7.084  -13.722 1.00 61.78  ? 394  LEU B CB  1 
ATOM   7207 C CG  . LEU B 1 394 ? 11.964  -6.999  -12.391 1.00 66.62  ? 394  LEU B CG  1 
ATOM   7208 C CD1 . LEU B 1 394 ? 12.281  -8.390  -11.849 1.00 60.57  ? 394  LEU B CD1 1 
ATOM   7209 C CD2 . LEU B 1 394 ? 13.239  -6.170  -12.546 1.00 54.01  ? 394  LEU B CD2 1 
ATOM   7210 N N   . ARG B 1 395 ? 9.040   -6.419  -15.902 1.00 58.12  ? 395  ARG B N   1 
ATOM   7211 C CA  . ARG B 1 395 ? 8.468   -6.568  -17.237 1.00 60.20  ? 395  ARG B CA  1 
ATOM   7212 C C   . ARG B 1 395 ? 8.177   -5.184  -17.856 1.00 59.60  ? 395  ARG B C   1 
ATOM   7213 O O   . ARG B 1 395 ? 8.622   -4.893  -18.971 1.00 53.93  ? 395  ARG B O   1 
ATOM   7214 C CB  . ARG B 1 395 ? 7.218   -7.479  -17.178 1.00 55.67  ? 395  ARG B CB  1 
ATOM   7215 C CG  . ARG B 1 395 ? 6.393   -7.582  -18.452 1.00 55.34  ? 395  ARG B CG  1 
ATOM   7216 C CD  . ARG B 1 395 ? 5.116   -6.760  -18.341 1.00 56.47  ? 395  ARG B CD  1 
ATOM   7217 N NE  . ARG B 1 395 ? 3.971   -7.500  -17.814 1.00 61.55  ? 395  ARG B NE  1 
ATOM   7218 C CZ  . ARG B 1 395 ? 2.896   -6.929  -17.272 1.00 62.46  ? 395  ARG B CZ  1 
ATOM   7219 N NH1 . ARG B 1 395 ? 2.823   -5.611  -17.159 1.00 63.28  ? 395  ARG B NH1 1 
ATOM   7220 N NH2 . ARG B 1 395 ? 1.895   -7.677  -16.829 1.00 67.25  ? 395  ARG B NH2 1 
ATOM   7221 N N   . ASP B 1 396 ? 7.468   -4.330  -17.116 1.00 56.90  ? 396  ASP B N   1 
ATOM   7222 C CA  . ASP B 1 396 ? 7.154   -2.981  -17.585 1.00 55.48  ? 396  ASP B CA  1 
ATOM   7223 C C   . ASP B 1 396 ? 8.413   -2.127  -17.829 1.00 53.96  ? 396  ASP B C   1 
ATOM   7224 O O   . ASP B 1 396 ? 8.420   -1.262  -18.707 1.00 53.56  ? 396  ASP B O   1 
ATOM   7225 C CB  . ASP B 1 396 ? 6.199   -2.273  -16.616 1.00 56.49  ? 396  ASP B CB  1 
ATOM   7226 C CG  . ASP B 1 396 ? 4.782   -2.842  -16.662 1.00 65.64  ? 396  ASP B CG  1 
ATOM   7227 O OD1 . ASP B 1 396 ? 4.466   -3.585  -17.618 1.00 68.99  ? 396  ASP B OD1 1 
ATOM   7228 O OD2 . ASP B 1 396 ? 3.978   -2.538  -15.753 1.00 60.63  ? 396  ASP B OD2 1 
ATOM   7229 N N   . ALA B 1 397 ? 9.476   -2.388  -17.073 1.00 46.63  ? 397  ALA B N   1 
ATOM   7230 C CA  . ALA B 1 397 ? 10.706  -1.606  -17.182 1.00 53.67  ? 397  ALA B CA  1 
ATOM   7231 C C   . ALA B 1 397 ? 11.513  -2.022  -18.406 1.00 54.05  ? 397  ALA B C   1 
ATOM   7232 O O   . ALA B 1 397 ? 12.095  -1.178  -19.106 1.00 47.84  ? 397  ALA B O   1 
ATOM   7233 C CB  . ALA B 1 397 ? 11.554  -1.743  -15.919 1.00 49.03  ? 397  ALA B CB  1 
ATOM   7234 N N   . MET B 1 398 ? 11.561  -3.331  -18.644 1.00 52.50  ? 398  MET B N   1 
ATOM   7235 C CA  . MET B 1 398 ? 12.171  -3.875  -19.852 1.00 52.76  ? 398  MET B CA  1 
ATOM   7236 C C   . MET B 1 398 ? 11.583  -3.203  -21.103 1.00 49.80  ? 398  MET B C   1 
ATOM   7237 O O   . MET B 1 398 ? 12.321  -2.743  -21.983 1.00 42.59  ? 398  MET B O   1 
ATOM   7238 C CB  . MET B 1 398 ? 11.944  -5.380  -19.925 1.00 48.84  ? 398  MET B CB  1 
ATOM   7239 C CG  . MET B 1 398 ? 12.744  -6.028  -21.027 1.00 52.06  ? 398  MET B CG  1 
ATOM   7240 S SD  . MET B 1 398 ? 14.510  -5.897  -20.697 1.00 56.93  ? 398  MET B SD  1 
ATOM   7241 C CE  . MET B 1 398 ? 15.030  -4.757  -21.982 1.00 58.75  ? 398  MET B CE  1 
ATOM   7242 N N   . SER B 1 399 ? 10.253  -3.147  -21.157 1.00 44.03  ? 399  SER B N   1 
ATOM   7243 C CA  . SER B 1 399 ? 9.542   -2.440  -22.209 1.00 44.25  ? 399  SER B CA  1 
ATOM   7244 C C   . SER B 1 399 ? 10.003  -0.981  -22.301 1.00 51.17  ? 399  SER B C   1 
ATOM   7245 O O   . SER B 1 399 ? 10.359  -0.486  -23.389 1.00 47.42  ? 399  SER B O   1 
ATOM   7246 C CB  . SER B 1 399 ? 8.046   -2.502  -21.935 1.00 45.59  ? 399  SER B CB  1 
ATOM   7247 O OG  . SER B 1 399 ? 7.342   -1.669  -22.827 1.00 43.48  ? 399  SER B OG  1 
ATOM   7248 N N   . ALA B 1 400 ? 10.005  -0.313  -21.144 1.00 52.09  ? 400  ALA B N   1 
ATOM   7249 C CA  . ALA B 1 400 ? 10.459  1.070   -21.010 1.00 46.68  ? 400  ALA B CA  1 
ATOM   7250 C C   . ALA B 1 400 ? 11.894  1.295   -21.517 1.00 43.03  ? 400  ALA B C   1 
ATOM   7251 O O   . ALA B 1 400 ? 12.147  2.245   -22.261 1.00 42.88  ? 400  ALA B O   1 
ATOM   7252 C CB  . ALA B 1 400 ? 10.328  1.521   -19.570 1.00 48.06  ? 400  ALA B CB  1 
ATOM   7253 N N   . VAL B 1 401 ? 12.827  0.436   -21.110 1.00 39.84  ? 401  VAL B N   1 
ATOM   7254 C CA  . VAL B 1 401 ? 14.207  0.524   -21.599 1.00 47.37  ? 401  VAL B CA  1 
ATOM   7255 C C   . VAL B 1 401 ? 14.248  0.532   -23.136 1.00 48.37  ? 401  VAL B C   1 
ATOM   7256 O O   . VAL B 1 401 ? 14.927  1.368   -23.748 1.00 41.49  ? 401  VAL B O   1 
ATOM   7257 C CB  . VAL B 1 401 ? 15.087  -0.652  -21.072 1.00 43.57  ? 401  VAL B CB  1 
ATOM   7258 C CG1 . VAL B 1 401 ? 16.374  -0.759  -21.872 1.00 34.97  ? 401  VAL B CG1 1 
ATOM   7259 C CG2 . VAL B 1 401 ? 15.391  -0.487  -19.586 1.00 39.03  ? 401  VAL B CG2 1 
ATOM   7260 N N   . VAL B 1 402 ? 13.498  -0.387  -23.743 1.00 44.97  ? 402  VAL B N   1 
ATOM   7261 C CA  . VAL B 1 402 ? 13.514  -0.570  -25.186 1.00 46.55  ? 402  VAL B CA  1 
ATOM   7262 C C   . VAL B 1 402 ? 12.885  0.633   -25.895 1.00 49.37  ? 402  VAL B C   1 
ATOM   7263 O O   . VAL B 1 402 ? 13.472  1.185   -26.849 1.00 40.81  ? 402  VAL B O   1 
ATOM   7264 C CB  . VAL B 1 402 ? 12.810  -1.900  -25.593 1.00 51.23  ? 402  VAL B CB  1 
ATOM   7265 C CG1 . VAL B 1 402 ? 12.537  -1.958  -27.109 1.00 44.30  ? 402  VAL B CG1 1 
ATOM   7266 C CG2 . VAL B 1 402 ? 13.641  -3.095  -25.132 1.00 48.28  ? 402  VAL B CG2 1 
ATOM   7267 N N   . GLY B 1 403 ? 11.708  1.044   -25.418 1.00 42.05  ? 403  GLY B N   1 
ATOM   7268 C CA  . GLY B 1 403 ? 11.016  2.193   -25.976 1.00 44.50  ? 403  GLY B CA  1 
ATOM   7269 C C   . GLY B 1 403 ? 11.768  3.511   -25.832 1.00 46.89  ? 403  GLY B C   1 
ATOM   7270 O O   . GLY B 1 403 ? 11.834  4.296   -26.793 1.00 45.55  ? 403  GLY B O   1 
ATOM   7271 N N   . ASP B 1 404 ? 12.336  3.756   -24.648 1.00 42.78  ? 404  ASP B N   1 
ATOM   7272 C CA  . ASP B 1 404 ? 13.043  5.013   -24.384 1.00 42.99  ? 404  ASP B CA  1 
ATOM   7273 C C   . ASP B 1 404 ? 14.300  5.122   -25.230 1.00 39.63  ? 404  ASP B C   1 
ATOM   7274 O O   . ASP B 1 404 ? 14.548  6.147   -25.878 1.00 42.80  ? 404  ASP B O   1 
ATOM   7275 C CB  . ASP B 1 404 ? 13.413  5.147   -22.898 1.00 45.71  ? 404  ASP B CB  1 
ATOM   7276 C CG  . ASP B 1 404 ? 12.187  5.272   -21.989 1.00 49.35  ? 404  ASP B CG  1 
ATOM   7277 O OD1 . ASP B 1 404 ? 11.083  5.582   -22.507 1.00 52.22  ? 404  ASP B OD1 1 
ATOM   7278 O OD2 . ASP B 1 404 ? 12.328  5.074   -20.753 1.00 47.94  ? 404  ASP B OD2 1 
ATOM   7279 N N   . HIS B 1 405 ? 15.094  4.056   -25.218 1.00 43.14  ? 405  HIS B N   1 
ATOM   7280 C CA  . HIS B 1 405 ? 16.347  3.997   -25.969 1.00 40.04  ? 405  HIS B CA  1 
ATOM   7281 C C   . HIS B 1 405 ? 16.125  4.232   -27.476 1.00 38.62  ? 405  HIS B C   1 
ATOM   7282 O O   . HIS B 1 405 ? 16.852  4.996   -28.105 1.00 44.19  ? 405  HIS B O   1 
ATOM   7283 C CB  . HIS B 1 405 ? 17.028  2.642   -25.720 1.00 35.90  ? 405  HIS B CB  1 
ATOM   7284 C CG  . HIS B 1 405 ? 18.311  2.448   -26.475 1.00 48.64  ? 405  HIS B CG  1 
ATOM   7285 N ND1 . HIS B 1 405 ? 19.311  3.402   -26.518 1.00 40.95  ? 405  HIS B ND1 1 
ATOM   7286 C CD2 . HIS B 1 405 ? 18.761  1.396   -27.207 1.00 45.40  ? 405  HIS B CD2 1 
ATOM   7287 C CE1 . HIS B 1 405 ? 20.318  2.947   -27.246 1.00 47.43  ? 405  HIS B CE1 1 
ATOM   7288 N NE2 . HIS B 1 405 ? 20.011  1.733   -27.674 1.00 52.99  ? 405  HIS B NE2 1 
ATOM   7289 N N   . ASN B 1 406 ? 15.098  3.607   -28.040 1.00 38.69  ? 406  ASN B N   1 
ATOM   7290 C CA  . ASN B 1 406 ? 14.927  3.571   -29.493 1.00 39.61  ? 406  ASN B CA  1 
ATOM   7291 C C   . ASN B 1 406 ? 14.025  4.656   -30.065 1.00 42.62  ? 406  ASN B C   1 
ATOM   7292 O O   . ASN B 1 406 ? 14.274  5.151   -31.166 1.00 41.03  ? 406  ASN B O   1 
ATOM   7293 C CB  . ASN B 1 406 ? 14.407  2.197   -29.929 1.00 35.61  ? 406  ASN B CB  1 
ATOM   7294 C CG  . ASN B 1 406 ? 15.450  1.110   -29.756 1.00 43.05  ? 406  ASN B CG  1 
ATOM   7295 O OD1 . ASN B 1 406 ? 16.500  1.148   -30.399 1.00 42.26  ? 406  ASN B OD1 1 
ATOM   7296 N ND2 . ASN B 1 406 ? 15.176  0.146   -28.877 1.00 41.40  ? 406  ASN B ND2 1 
ATOM   7297 N N   . VAL B 1 407 ? 12.982  5.027   -29.325 1.00 38.55  ? 407  VAL B N   1 
ATOM   7298 C CA  . VAL B 1 407 ? 12.010  5.979   -29.846 1.00 39.97  ? 407  VAL B CA  1 
ATOM   7299 C C   . VAL B 1 407 ? 11.885  7.264   -28.999 1.00 46.92  ? 407  VAL B C   1 
ATOM   7300 O O   . VAL B 1 407 ? 12.266  8.348   -29.462 1.00 48.02  ? 407  VAL B O   1 
ATOM   7301 C CB  . VAL B 1 407 ? 10.625  5.306   -30.079 1.00 41.26  ? 407  VAL B CB  1 
ATOM   7302 C CG1 . VAL B 1 407 ? 9.647   6.287   -30.692 1.00 43.48  ? 407  VAL B CG1 1 
ATOM   7303 C CG2 . VAL B 1 407 ? 10.775  4.082   -30.975 1.00 40.66  ? 407  VAL B CG2 1 
ATOM   7304 N N   . VAL B 1 408 ? 11.393  7.140   -27.765 1.00 42.97  ? 408  VAL B N   1 
ATOM   7305 C CA  . VAL B 1 408 ? 11.024  8.307   -26.957 1.00 44.82  ? 408  VAL B CA  1 
ATOM   7306 C C   . VAL B 1 408 ? 12.155  9.320   -26.780 1.00 42.18  ? 408  VAL B C   1 
ATOM   7307 O O   . VAL B 1 408 ? 11.995  10.510  -27.051 1.00 42.38  ? 408  VAL B O   1 
ATOM   7308 C CB  . VAL B 1 408 ? 10.480  7.915   -25.555 1.00 49.09  ? 408  VAL B CB  1 
ATOM   7309 C CG1 . VAL B 1 408 ? 9.959   9.151   -24.838 1.00 36.04  ? 408  VAL B CG1 1 
ATOM   7310 C CG2 . VAL B 1 408 ? 9.383   6.844   -25.664 1.00 39.90  ? 408  VAL B CG2 1 
ATOM   7311 N N   . CYS B 1 409 ? 13.310  8.861   -26.343 1.00 41.46  ? 409  CYS B N   1 
ATOM   7312 C CA  . CYS B 1 409 ? 14.411  9.795   -26.155 1.00 41.76  ? 409  CYS B CA  1 
ATOM   7313 C C   . CYS B 1 409 ? 15.018  10.347  -27.466 1.00 44.95  ? 409  CYS B C   1 
ATOM   7314 O O   . CYS B 1 409 ? 15.302  11.541  -27.550 1.00 45.60  ? 409  CYS B O   1 
ATOM   7315 C CB  . CYS B 1 409 ? 15.439  9.220   -25.179 1.00 43.11  ? 409  CYS B CB  1 
ATOM   7316 S SG  . CYS B 1 409 ? 14.678  8.985   -23.534 1.00 50.97  ? 409  CYS B SG  1 
ATOM   7317 N N   . PRO B 1 410 ? 15.194  9.492   -28.497 1.00 46.45  ? 410  PRO B N   1 
ATOM   7318 C CA  . PRO B 1 410 ? 15.515  10.093  -29.806 1.00 45.77  ? 410  PRO B CA  1 
ATOM   7319 C C   . PRO B 1 410 ? 14.463  11.115  -30.278 1.00 44.93  ? 410  PRO B C   1 
ATOM   7320 O O   . PRO B 1 410 ? 14.859  12.113  -30.885 1.00 41.42  ? 410  PRO B O   1 
ATOM   7321 C CB  . PRO B 1 410 ? 15.568  8.884   -30.752 1.00 38.81  ? 410  PRO B CB  1 
ATOM   7322 C CG  . PRO B 1 410 ? 15.958  7.745   -29.864 1.00 42.95  ? 410  PRO B CG  1 
ATOM   7323 C CD  . PRO B 1 410 ? 15.305  8.016   -28.519 1.00 40.96  ? 410  PRO B CD  1 
ATOM   7324 N N   . VAL B 1 411 ? 13.174  10.896  -30.002 1.00 38.11  ? 411  VAL B N   1 
ATOM   7325 C CA  . VAL B 1 411 ? 12.160  11.887  -30.383 1.00 42.03  ? 411  VAL B CA  1 
ATOM   7326 C C   . VAL B 1 411 ? 12.296  13.197  -29.571 1.00 43.18  ? 411  VAL B C   1 
ATOM   7327 O O   . VAL B 1 411 ? 12.265  14.294  -30.144 1.00 36.08  ? 411  VAL B O   1 
ATOM   7328 C CB  . VAL B 1 411 ? 10.705  11.338  -30.293 1.00 35.54  ? 411  VAL B CB  1 
ATOM   7329 C CG1 . VAL B 1 411 ? 9.684   12.467  -30.366 1.00 34.41  ? 411  VAL B CG1 1 
ATOM   7330 C CG2 . VAL B 1 411 ? 10.439  10.331  -31.379 1.00 41.90  ? 411  VAL B CG2 1 
ATOM   7331 N N   . ALA B 1 412 ? 12.447  13.071  -28.252 1.00 38.60  ? 412  ALA B N   1 
ATOM   7332 C CA  . ALA B 1 412 ? 12.638  14.229  -27.370 1.00 42.64  ? 412  ALA B CA  1 
ATOM   7333 C C   . ALA B 1 412 ? 13.832  15.062  -27.823 1.00 44.57  ? 412  ALA B C   1 
ATOM   7334 O O   . ALA B 1 412 ? 13.767  16.303  -27.866 1.00 45.48  ? 412  ALA B O   1 
ATOM   7335 C CB  . ALA B 1 412 ? 12.816  13.784  -25.902 1.00 36.04  ? 412  ALA B CB  1 
ATOM   7336 N N   . GLN B 1 413 ? 14.915  14.361  -28.157 1.00 42.12  ? 413  GLN B N   1 
ATOM   7337 C CA  . GLN B 1 413 ? 16.130  14.985  -28.672 1.00 46.55  ? 413  GLN B CA  1 
ATOM   7338 C C   . GLN B 1 413 ? 15.905  15.776  -29.972 1.00 45.03  ? 413  GLN B C   1 
ATOM   7339 O O   . GLN B 1 413 ? 16.322  16.940  -30.082 1.00 44.85  ? 413  GLN B O   1 
ATOM   7340 C CB  . GLN B 1 413 ? 17.207  13.923  -28.870 1.00 43.59  ? 413  GLN B CB  1 
ATOM   7341 C CG  . GLN B 1 413 ? 18.283  14.311  -29.856 1.00 53.18  ? 413  GLN B CG  1 
ATOM   7342 C CD  . GLN B 1 413 ? 19.652  13.901  -29.377 1.00 64.71  ? 413  GLN B CD  1 
ATOM   7343 O OE1 . GLN B 1 413 ? 20.212  12.905  -29.852 1.00 69.15  ? 413  GLN B OE1 1 
ATOM   7344 N NE2 . GLN B 1 413 ? 20.211  14.671  -28.440 1.00 68.46  ? 413  GLN B NE2 1 
ATOM   7345 N N   . LEU B 1 414 ? 15.258  15.145  -30.951 1.00 43.43  ? 414  LEU B N   1 
ATOM   7346 C CA  . LEU B 1 414 ? 14.961  15.807  -32.216 1.00 38.96  ? 414  LEU B CA  1 
ATOM   7347 C C   . LEU B 1 414 ? 14.062  17.040  -32.007 1.00 40.41  ? 414  LEU B C   1 
ATOM   7348 O O   . LEU B 1 414 ? 14.336  18.124  -32.531 1.00 38.85  ? 414  LEU B O   1 
ATOM   7349 C CB  . LEU B 1 414 ? 14.302  14.826  -33.185 1.00 42.61  ? 414  LEU B CB  1 
ATOM   7350 C CG  . LEU B 1 414 ? 13.938  15.376  -34.570 1.00 37.72  ? 414  LEU B CG  1 
ATOM   7351 C CD1 . LEU B 1 414 ? 15.194  15.509  -35.403 1.00 43.54  ? 414  LEU B CD1 1 
ATOM   7352 C CD2 . LEU B 1 414 ? 12.930  14.477  -35.262 1.00 46.68  ? 414  LEU B CD2 1 
ATOM   7353 N N   . ALA B 1 415 ? 12.994  16.864  -31.234 1.00 40.25  ? 415  ALA B N   1 
ATOM   7354 C CA  . ALA B 1 415 ? 12.050  17.939  -30.964 1.00 43.33  ? 415  ALA B CA  1 
ATOM   7355 C C   . ALA B 1 415 ? 12.779  19.145  -30.372 1.00 44.65  ? 415  ALA B C   1 
ATOM   7356 O O   . ALA B 1 415 ? 12.616  20.284  -30.840 1.00 45.24  ? 415  ALA B O   1 
ATOM   7357 C CB  . ALA B 1 415 ? 10.970  17.458  -30.015 1.00 45.01  ? 415  ALA B CB  1 
ATOM   7358 N N   . GLY B 1 416 ? 13.592  18.880  -29.353 1.00 42.99  ? 416  GLY B N   1 
ATOM   7359 C CA  . GLY B 1 416 ? 14.416  19.900  -28.731 1.00 45.52  ? 416  GLY B CA  1 
ATOM   7360 C C   . GLY B 1 416 ? 15.319  20.648  -29.696 1.00 49.40  ? 416  GLY B C   1 
ATOM   7361 O O   . GLY B 1 416 ? 15.333  21.883  -29.673 1.00 49.84  ? 416  GLY B O   1 
ATOM   7362 N N   . ARG B 1 417 ? 16.066  19.924  -30.539 1.00 42.66  ? 417  ARG B N   1 
ATOM   7363 C CA  . ARG B 1 417 ? 16.981  20.568  -31.491 1.00 43.06  ? 417  ARG B CA  1 
ATOM   7364 C C   . ARG B 1 417 ? 16.241  21.371  -32.567 1.00 46.23  ? 417  ARG B C   1 
ATOM   7365 O O   . ARG B 1 417 ? 16.615  22.506  -32.856 1.00 49.44  ? 417  ARG B O   1 
ATOM   7366 C CB  . ARG B 1 417 ? 17.945  19.557  -32.127 1.00 47.41  ? 417  ARG B CB  1 
ATOM   7367 C CG  . ARG B 1 417 ? 18.872  18.853  -31.139 1.00 48.28  ? 417  ARG B CG  1 
ATOM   7368 C CD  . ARG B 1 417 ? 19.491  19.832  -30.148 1.00 63.81  ? 417  ARG B CD  1 
ATOM   7369 N NE  . ARG B 1 417 ? 20.498  20.687  -30.776 1.00 78.85  ? 417  ARG B NE  1 
ATOM   7370 C CZ  . ARG B 1 417 ? 21.738  20.866  -30.313 1.00 82.81  ? 417  ARG B CZ  1 
ATOM   7371 N NH1 . ARG B 1 417 ? 22.133  20.259  -29.195 1.00 78.49  ? 417  ARG B NH1 1 
ATOM   7372 N NH2 . ARG B 1 417 ? 22.589  21.655  -30.968 1.00 75.17  ? 417  ARG B NH2 1 
ATOM   7373 N N   . LEU B 1 418 ? 15.189  20.793  -33.146 1.00 42.63  ? 418  LEU B N   1 
ATOM   7374 C CA  . LEU B 1 418 ? 14.375  21.512  -34.118 1.00 43.04  ? 418  LEU B CA  1 
ATOM   7375 C C   . LEU B 1 418 ? 13.776  22.810  -33.538 1.00 50.11  ? 418  LEU B C   1 
ATOM   7376 O O   . LEU B 1 418 ? 13.769  23.856  -34.207 1.00 48.02  ? 418  LEU B O   1 
ATOM   7377 C CB  . LEU B 1 418 ? 13.251  20.621  -34.659 1.00 42.08  ? 418  LEU B CB  1 
ATOM   7378 C CG  . LEU B 1 418 ? 13.568  19.383  -35.511 1.00 43.48  ? 418  LEU B CG  1 
ATOM   7379 C CD1 . LEU B 1 418 ? 12.282  18.807  -36.084 1.00 40.28  ? 418  LEU B CD1 1 
ATOM   7380 C CD2 . LEU B 1 418 ? 14.540  19.691  -36.620 1.00 47.02  ? 418  LEU B CD2 1 
ATOM   7381 N N   . ALA B 1 419 ? 13.272  22.743  -32.305 1.00 42.62  ? 419  ALA B N   1 
ATOM   7382 C CA  . ALA B 1 419 ? 12.673  23.921  -31.681 1.00 44.10  ? 419  ALA B CA  1 
ATOM   7383 C C   . ALA B 1 419 ? 13.732  24.989  -31.385 1.00 48.80  ? 419  ALA B C   1 
ATOM   7384 O O   . ALA B 1 419 ? 13.485  26.191  -31.529 1.00 48.16  ? 419  ALA B O   1 
ATOM   7385 C CB  . ALA B 1 419 ? 11.924  23.544  -30.407 1.00 40.11  ? 419  ALA B CB  1 
ATOM   7386 N N   . ALA B 1 420 ? 14.912  24.540  -30.969 1.00 51.33  ? 420  ALA B N   1 
ATOM   7387 C CA  . ALA B 1 420 ? 16.004  25.445  -30.642 1.00 48.19  ? 420  ALA B CA  1 
ATOM   7388 C C   . ALA B 1 420 ? 16.542  26.140  -31.891 1.00 53.61  ? 420  ALA B C   1 
ATOM   7389 O O   . ALA B 1 420 ? 16.995  27.283  -31.815 1.00 57.89  ? 420  ALA B O   1 
ATOM   7390 C CB  . ALA B 1 420 ? 17.118  24.697  -29.914 1.00 41.05  ? 420  ALA B CB  1 
ATOM   7391 N N   . GLN B 1 421 ? 16.479  25.465  -33.037 1.00 51.06  ? 421  GLN B N   1 
ATOM   7392 C CA  . GLN B 1 421 ? 17.051  26.026  -34.255 1.00 48.10  ? 421  GLN B CA  1 
ATOM   7393 C C   . GLN B 1 421 ? 16.018  26.504  -35.285 1.00 51.52  ? 421  GLN B C   1 
ATOM   7394 O O   . GLN B 1 421 ? 16.278  26.466  -36.498 1.00 49.00  ? 421  GLN B O   1 
ATOM   7395 C CB  . GLN B 1 421 ? 18.065  25.056  -34.876 1.00 53.96  ? 421  GLN B CB  1 
ATOM   7396 C CG  . GLN B 1 421 ? 19.342  24.918  -34.038 1.00 47.72  ? 421  GLN B CG  1 
ATOM   7397 C CD  . GLN B 1 421 ? 19.882  23.498  -34.012 1.00 58.55  ? 421  GLN B CD  1 
ATOM   7398 O OE1 . GLN B 1 421 ? 20.089  22.913  -32.940 1.00 59.57  ? 421  GLN B OE1 1 
ATOM   7399 N NE2 . GLN B 1 421 ? 20.125  22.940  -35.194 1.00 64.41  ? 421  GLN B NE2 1 
ATOM   7400 N N   . GLY B 1 422 ? 14.857  26.955  -34.803 1.00 49.95  ? 422  GLY B N   1 
ATOM   7401 C CA  . GLY B 1 422 ? 13.936  27.697  -35.649 1.00 56.80  ? 422  GLY B CA  1 
ATOM   7402 C C   . GLY B 1 422 ? 12.634  27.054  -36.104 1.00 58.61  ? 422  GLY B C   1 
ATOM   7403 O O   . GLY B 1 422 ? 11.768  27.749  -36.628 1.00 59.17  ? 422  GLY B O   1 
ATOM   7404 N N   . ALA B 1 423 ? 12.476  25.745  -35.936 1.00 50.53  ? 423  ALA B N   1 
ATOM   7405 C CA  . ALA B 1 423 ? 11.243  25.102  -36.392 1.00 51.89  ? 423  ALA B CA  1 
ATOM   7406 C C   . ALA B 1 423 ? 10.055  25.349  -35.457 1.00 48.57  ? 423  ALA B C   1 
ATOM   7407 O O   . ALA B 1 423 ? 10.216  25.519  -34.251 1.00 48.42  ? 423  ALA B O   1 
ATOM   7408 C CB  . ALA B 1 423 ? 11.449  23.612  -36.600 1.00 43.87  ? 423  ALA B CB  1 
ATOM   7409 N N   . ARG B 1 424 ? 8.859   25.380  -36.033 1.00 48.29  ? 424  ARG B N   1 
ATOM   7410 C CA  . ARG B 1 424 ? 7.627   25.320  -35.260 1.00 46.44  ? 424  ARG B CA  1 
ATOM   7411 C C   . ARG B 1 424 ? 7.365   23.829  -35.019 1.00 43.24  ? 424  ARG B C   1 
ATOM   7412 O O   . ARG B 1 424 ? 7.235   23.053  -35.972 1.00 43.63  ? 424  ARG B O   1 
ATOM   7413 C CB  . ARG B 1 424 ? 6.493   25.978  -36.057 1.00 53.04  ? 424  ARG B CB  1 
ATOM   7414 C CG  . ARG B 1 424 ? 5.073   25.875  -35.467 1.00 64.86  ? 424  ARG B CG  1 
ATOM   7415 C CD  . ARG B 1 424 ? 4.169   27.036  -35.972 1.00 71.93  ? 424  ARG B CD  1 
ATOM   7416 N NE  . ARG B 1 424 ? 3.695   27.855  -34.852 1.00 66.29  ? 424  ARG B NE  1 
ATOM   7417 C CZ  . ARG B 1 424 ? 4.488   28.610  -34.097 1.00 67.62  ? 424  ARG B CZ  1 
ATOM   7418 N NH1 . ARG B 1 424 ? 5.796   28.678  -34.338 1.00 73.97  ? 424  ARG B NH1 1 
ATOM   7419 N NH2 . ARG B 1 424 ? 3.973   29.299  -33.097 1.00 71.54  ? 424  ARG B NH2 1 
ATOM   7420 N N   . VAL B 1 425 ? 7.318   23.418  -33.757 1.00 35.72  ? 425  VAL B N   1 
ATOM   7421 C CA  . VAL B 1 425 ? 7.207   21.994  -33.430 1.00 40.83  ? 425  VAL B CA  1 
ATOM   7422 C C   . VAL B 1 425 ? 5.986   21.717  -32.553 1.00 41.69  ? 425  VAL B C   1 
ATOM   7423 O O   . VAL B 1 425 ? 5.768   22.389  -31.543 1.00 49.87  ? 425  VAL B O   1 
ATOM   7424 C CB  . VAL B 1 425 ? 8.493   21.483  -32.710 1.00 40.53  ? 425  VAL B CB  1 
ATOM   7425 C CG1 . VAL B 1 425 ? 8.406   19.993  -32.391 1.00 33.85  ? 425  VAL B CG1 1 
ATOM   7426 C CG2 . VAL B 1 425 ? 9.719   21.781  -33.554 1.00 38.84  ? 425  VAL B CG2 1 
ATOM   7427 N N   . TYR B 1 426 ? 5.188   20.731  -32.942 1.00 45.79  ? 426  TYR B N   1 
ATOM   7428 C CA  . TYR B 1 426 ? 4.098   20.250  -32.097 1.00 41.27  ? 426  TYR B CA  1 
ATOM   7429 C C   . TYR B 1 426 ? 4.360   18.806  -31.706 1.00 41.33  ? 426  TYR B C   1 
ATOM   7430 O O   . TYR B 1 426 ? 4.706   17.984  -32.558 1.00 41.21  ? 426  TYR B O   1 
ATOM   7431 C CB  . TYR B 1 426 ? 2.770   20.359  -32.828 1.00 42.77  ? 426  TYR B CB  1 
ATOM   7432 C CG  . TYR B 1 426 ? 2.368   21.778  -33.098 1.00 36.46  ? 426  TYR B CG  1 
ATOM   7433 C CD1 . TYR B 1 426 ? 2.810   22.432  -34.229 1.00 35.80  ? 426  TYR B CD1 1 
ATOM   7434 C CD2 . TYR B 1 426 ? 1.552   22.473  -32.203 1.00 37.65  ? 426  TYR B CD2 1 
ATOM   7435 C CE1 . TYR B 1 426 ? 2.448   23.749  -34.485 1.00 41.34  ? 426  TYR B CE1 1 
ATOM   7436 C CE2 . TYR B 1 426 ? 1.186   23.785  -32.443 1.00 43.15  ? 426  TYR B CE2 1 
ATOM   7437 C CZ  . TYR B 1 426 ? 1.640   24.415  -33.594 1.00 42.94  ? 426  TYR B CZ  1 
ATOM   7438 O OH  . TYR B 1 426 ? 1.284   25.714  -33.845 1.00 48.01  ? 426  TYR B OH  1 
ATOM   7439 N N   . ALA B 1 427 ? 4.198   18.502  -30.421 1.00 40.47  ? 427  ALA B N   1 
ATOM   7440 C CA  . ALA B 1 427 ? 4.506   17.172  -29.910 1.00 40.41  ? 427  ALA B CA  1 
ATOM   7441 C C   . ALA B 1 427 ? 3.307   16.508  -29.234 1.00 45.35  ? 427  ALA B C   1 
ATOM   7442 O O   . ALA B 1 427 ? 2.436   17.192  -28.689 1.00 41.80  ? 427  ALA B O   1 
ATOM   7443 C CB  . ALA B 1 427 ? 5.708   17.221  -28.956 1.00 36.94  ? 427  ALA B CB  1 
ATOM   7444 N N   . TYR B 1 428 ? 3.276   15.174  -29.262 1.00 42.52  ? 428  TYR B N   1 
ATOM   7445 C CA  . TYR B 1 428 ? 2.157   14.427  -28.688 1.00 37.06  ? 428  TYR B CA  1 
ATOM   7446 C C   . TYR B 1 428 ? 2.605   13.113  -28.065 1.00 39.47  ? 428  TYR B C   1 
ATOM   7447 O O   . TYR B 1 428 ? 3.722   12.633  -28.299 1.00 39.83  ? 428  TYR B O   1 
ATOM   7448 C CB  . TYR B 1 428 ? 1.055   14.148  -29.743 1.00 38.91  ? 428  TYR B CB  1 
ATOM   7449 C CG  . TYR B 1 428 ? 1.461   13.148  -30.824 1.00 44.05  ? 428  TYR B CG  1 
ATOM   7450 C CD1 . TYR B 1 428 ? 1.498   11.766  -30.565 1.00 42.73  ? 428  TYR B CD1 1 
ATOM   7451 C CD2 . TYR B 1 428 ? 1.810   13.580  -32.098 1.00 37.62  ? 428  TYR B CD2 1 
ATOM   7452 C CE1 . TYR B 1 428 ? 1.891   10.862  -31.529 1.00 36.77  ? 428  TYR B CE1 1 
ATOM   7453 C CE2 . TYR B 1 428 ? 2.190   12.679  -33.081 1.00 40.89  ? 428  TYR B CE2 1 
ATOM   7454 C CZ  . TYR B 1 428 ? 2.231   11.322  -32.791 1.00 45.82  ? 428  TYR B CZ  1 
ATOM   7455 O OH  . TYR B 1 428 ? 2.617   10.418  -33.762 1.00 49.67  ? 428  TYR B OH  1 
ATOM   7456 N N   . ILE B 1 429 ? 1.706   12.540  -27.276 1.00 36.61  ? 429  ILE B N   1 
ATOM   7457 C CA  . ILE B 1 429 ? 1.779   11.150  -26.870 1.00 38.80  ? 429  ILE B CA  1 
ATOM   7458 C C   . ILE B 1 429 ? 0.390   10.546  -27.102 1.00 42.73  ? 429  ILE B C   1 
ATOM   7459 O O   . ILE B 1 429 ? -0.637  11.150  -26.751 1.00 47.06  ? 429  ILE B O   1 
ATOM   7460 C CB  . ILE B 1 429 ? 2.235   10.999  -25.399 1.00 42.98  ? 429  ILE B CB  1 
ATOM   7461 C CG1 . ILE B 1 429 ? 2.397   9.528   -25.025 1.00 46.64  ? 429  ILE B CG1 1 
ATOM   7462 C CG2 . ILE B 1 429 ? 1.272   11.703  -24.446 1.00 47.45  ? 429  ILE B CG2 1 
ATOM   7463 C CD1 . ILE B 1 429 ? 3.156   9.337   -23.718 1.00 44.34  ? 429  ILE B CD1 1 
ATOM   7464 N N   . PHE B 1 430 ? 0.359   9.376   -27.734 1.00 45.28  ? 430  PHE B N   1 
ATOM   7465 C CA  . PHE B 1 430 ? -0.888  8.694   -28.062 1.00 41.12  ? 430  PHE B CA  1 
ATOM   7466 C C   . PHE B 1 430 ? -1.117  7.608   -27.013 1.00 46.20  ? 430  PHE B C   1 
ATOM   7467 O O   . PHE B 1 430 ? -0.230  6.782   -26.773 1.00 46.97  ? 430  PHE B O   1 
ATOM   7468 C CB  . PHE B 1 430 ? -0.749  8.079   -29.444 1.00 44.61  ? 430  PHE B CB  1 
ATOM   7469 C CG  . PHE B 1 430 ? -2.026  7.531   -29.998 1.00 49.04  ? 430  PHE B CG  1 
ATOM   7470 C CD1 . PHE B 1 430 ? -2.888  8.351   -30.715 1.00 43.30  ? 430  PHE B CD1 1 
ATOM   7471 C CD2 . PHE B 1 430 ? -2.362  6.191   -29.825 1.00 49.12  ? 430  PHE B CD2 1 
ATOM   7472 C CE1 . PHE B 1 430 ? -4.066  7.853   -31.241 1.00 45.66  ? 430  PHE B CE1 1 
ATOM   7473 C CE2 . PHE B 1 430 ? -3.548  5.683   -30.352 1.00 46.88  ? 430  PHE B CE2 1 
ATOM   7474 C CZ  . PHE B 1 430 ? -4.397  6.513   -31.057 1.00 45.57  ? 430  PHE B CZ  1 
ATOM   7475 N N   . GLU B 1 431 ? -2.286  7.597   -26.374 1.00 46.99  ? 431  GLU B N   1 
ATOM   7476 C CA  . GLU B 1 431 ? -2.462  6.740   -25.184 1.00 54.12  ? 431  GLU B CA  1 
ATOM   7477 C C   . GLU B 1 431 ? -3.646  5.784   -25.274 1.00 55.21  ? 431  GLU B C   1 
ATOM   7478 O O   . GLU B 1 431 ? -3.820  4.918   -24.411 1.00 54.13  ? 431  GLU B O   1 
ATOM   7479 C CB  . GLU B 1 431 ? -2.591  7.584   -23.906 1.00 43.18  ? 431  GLU B CB  1 
ATOM   7480 C CG  . GLU B 1 431 ? -1.283  8.154   -23.387 1.00 54.49  ? 431  GLU B CG  1 
ATOM   7481 C CD  . GLU B 1 431 ? -1.482  9.107   -22.212 1.00 57.56  ? 431  GLU B CD  1 
ATOM   7482 O OE1 . GLU B 1 431 ? -2.538  9.787   -22.146 1.00 57.54  ? 431  GLU B OE1 1 
ATOM   7483 O OE2 . GLU B 1 431 ? -0.578  9.171   -21.352 1.00 51.22  ? 431  GLU B OE2 1 
ATOM   7484 N N   . HIS B 1 432 ? -4.460  5.945   -26.312 1.00 55.75  ? 432  HIS B N   1 
ATOM   7485 C CA  . HIS B 1 432 ? -5.619  5.083   -26.492 1.00 52.39  ? 432  HIS B CA  1 
ATOM   7486 C C   . HIS B 1 432 ? -5.290  3.683   -27.031 1.00 54.70  ? 432  HIS B C   1 
ATOM   7487 O O   . HIS B 1 432 ? -4.686  3.545   -28.100 1.00 56.80  ? 432  HIS B O   1 
ATOM   7488 C CB  . HIS B 1 432 ? -6.625  5.727   -27.429 1.00 47.67  ? 432  HIS B CB  1 
ATOM   7489 C CG  . HIS B 1 432 ? -7.846  4.891   -27.622 1.00 57.43  ? 432  HIS B CG  1 
ATOM   7490 N ND1 . HIS B 1 432 ? -8.571  4.394   -26.560 1.00 62.86  ? 432  HIS B ND1 1 
ATOM   7491 C CD2 . HIS B 1 432 ? -8.441  4.418   -28.743 1.00 56.54  ? 432  HIS B CD2 1 
ATOM   7492 C CE1 . HIS B 1 432 ? -9.578  3.671   -27.019 1.00 60.41  ? 432  HIS B CE1 1 
ATOM   7493 N NE2 . HIS B 1 432 ? -9.523  3.672   -28.340 1.00 61.84  ? 432  HIS B NE2 1 
ATOM   7494 N N   . ARG B 1 433 ? -5.704  2.651   -26.297 1.00 55.55  ? 433  ARG B N   1 
ATOM   7495 C CA  . ARG B 1 433 ? -5.583  1.265   -26.768 1.00 54.68  ? 433  ARG B CA  1 
ATOM   7496 C C   . ARG B 1 433 ? -6.878  0.818   -27.468 1.00 54.77  ? 433  ARG B C   1 
ATOM   7497 O O   . ARG B 1 433 ? -7.939  0.745   -26.838 1.00 55.70  ? 433  ARG B O   1 
ATOM   7498 C CB  . ARG B 1 433 ? -5.264  0.324   -25.603 1.00 52.75  ? 433  ARG B CB  1 
ATOM   7499 C CG  . ARG B 1 433 ? -5.036  -1.122  -26.013 1.00 56.67  ? 433  ARG B CG  1 
ATOM   7500 C CD  . ARG B 1 433 ? -4.854  -2.037  -24.813 1.00 50.16  ? 433  ARG B CD  1 
ATOM   7501 N NE  . ARG B 1 433 ? -5.259  -3.404  -25.139 1.00 55.46  ? 433  ARG B NE  1 
ATOM   7502 C CZ  . ARG B 1 433 ? -4.425  -4.423  -25.331 1.00 57.48  ? 433  ARG B CZ  1 
ATOM   7503 N NH1 . ARG B 1 433 ? -3.111  -4.259  -25.227 1.00 55.87  ? 433  ARG B NH1 1 
ATOM   7504 N NH2 . ARG B 1 433 ? -4.913  -5.618  -25.627 1.00 60.00  ? 433  ARG B NH2 1 
ATOM   7505 N N   . ALA B 1 434 ? -6.782  0.522   -28.767 1.00 56.85  ? 434  ALA B N   1 
ATOM   7506 C CA  . ALA B 1 434 ? -7.934  0.135   -29.591 1.00 56.21  ? 434  ALA B CA  1 
ATOM   7507 C C   . ALA B 1 434 ? -8.651  -1.104  -29.053 1.00 58.87  ? 434  ALA B C   1 
ATOM   7508 O O   . ALA B 1 434 ? -8.006  -2.078  -28.654 1.00 61.31  ? 434  ALA B O   1 
ATOM   7509 C CB  . ALA B 1 434 ? -7.493  -0.094  -31.033 1.00 54.56  ? 434  ALA B CB  1 
ATOM   7510 N N   . SER B 1 435 ? -9.982  -1.061  -29.041 1.00 59.72  ? 435  SER B N   1 
ATOM   7511 C CA  . SER B 1 435 ? -10.788 -2.196  -28.585 1.00 62.79  ? 435  SER B CA  1 
ATOM   7512 C C   . SER B 1 435 ? -10.492 -3.457  -29.395 1.00 67.47  ? 435  SER B C   1 
ATOM   7513 O O   . SER B 1 435 ? -10.465 -4.572  -28.855 1.00 67.75  ? 435  SER B O   1 
ATOM   7514 C CB  . SER B 1 435 ? -12.285 -1.856  -28.639 1.00 63.68  ? 435  SER B CB  1 
ATOM   7515 O OG  . SER B 1 435 ? -12.613 -1.068  -29.770 1.00 66.84  ? 435  SER B OG  1 
ATOM   7516 N N   . THR B 1 436 ? -10.229 -3.246  -30.684 1.00 69.34  ? 436  THR B N   1 
ATOM   7517 C CA  . THR B 1 436 ? -9.988  -4.310  -31.658 1.00 64.82  ? 436  THR B CA  1 
ATOM   7518 C C   . THR B 1 436 ? -8.610  -4.980  -31.544 1.00 71.36  ? 436  THR B C   1 
ATOM   7519 O O   . THR B 1 436 ? -8.321  -5.938  -32.270 1.00 78.44  ? 436  THR B O   1 
ATOM   7520 C CB  . THR B 1 436 ? -10.134 -3.751  -33.093 1.00 67.44  ? 436  THR B CB  1 
ATOM   7521 O OG1 . THR B 1 436 ? -9.001  -2.927  -33.408 1.00 73.96  ? 436  THR B OG1 1 
ATOM   7522 C CG2 . THR B 1 436 ? -11.408 -2.917  -33.215 1.00 75.59  ? 436  THR B CG2 1 
ATOM   7523 N N   . LEU B 1 437 ? -7.759  -4.481  -30.650 1.00 67.56  ? 437  LEU B N   1 
ATOM   7524 C CA  . LEU B 1 437 ? -6.377  -4.968  -30.551 1.00 67.58  ? 437  LEU B CA  1 
ATOM   7525 C C   . LEU B 1 437 ? -6.296  -6.430  -30.124 1.00 63.32  ? 437  LEU B C   1 
ATOM   7526 O O   . LEU B 1 437 ? -6.962  -6.836  -29.173 1.00 69.06  ? 437  LEU B O   1 
ATOM   7527 C CB  . LEU B 1 437 ? -5.556  -4.100  -29.588 1.00 63.77  ? 437  LEU B CB  1 
ATOM   7528 C CG  . LEU B 1 437 ? -4.110  -3.872  -30.039 1.00 62.93  ? 437  LEU B CG  1 
ATOM   7529 C CD1 . LEU B 1 437 ? -3.974  -2.492  -30.627 1.00 61.29  ? 437  LEU B CD1 1 
ATOM   7530 C CD2 . LEU B 1 437 ? -3.125  -4.076  -28.903 1.00 63.18  ? 437  LEU B CD2 1 
ATOM   7531 N N   . THR B 1 438 ? -5.462  -7.207  -30.815 1.00 62.82  ? 438  THR B N   1 
ATOM   7532 C CA  . THR B 1 438 ? -5.358  -8.648  -30.565 1.00 57.88  ? 438  THR B CA  1 
ATOM   7533 C C   . THR B 1 438 ? -4.090  -9.038  -29.792 1.00 62.12  ? 438  THR B C   1 
ATOM   7534 O O   . THR B 1 438 ? -3.892  -10.219 -29.464 1.00 65.65  ? 438  THR B O   1 
ATOM   7535 C CB  . THR B 1 438 ? -5.436  -9.459  -31.883 1.00 64.64  ? 438  THR B CB  1 
ATOM   7536 O OG1 . THR B 1 438 ? -4.241  -9.255  -32.653 1.00 68.85  ? 438  THR B OG1 1 
ATOM   7537 C CG2 . THR B 1 438 ? -6.637  -9.025  -32.700 1.00 63.76  ? 438  THR B CG2 1 
ATOM   7538 N N   . TRP B 1 439 ? -3.228  -8.057  -29.515 1.00 55.46  ? 439  TRP B N   1 
ATOM   7539 C CA  . TRP B 1 439 ? -2.102  -8.266  -28.600 1.00 59.91  ? 439  TRP B CA  1 
ATOM   7540 C C   . TRP B 1 439 ? -2.604  -8.222  -27.143 1.00 55.38  ? 439  TRP B C   1 
ATOM   7541 O O   . TRP B 1 439 ? -3.628  -7.592  -26.855 1.00 55.41  ? 439  TRP B O   1 
ATOM   7542 C CB  . TRP B 1 439 ? -1.022  -7.201  -28.806 1.00 54.01  ? 439  TRP B CB  1 
ATOM   7543 C CG  . TRP B 1 439 ? -0.351  -7.220  -30.150 1.00 55.90  ? 439  TRP B CG  1 
ATOM   7544 C CD1 . TRP B 1 439 ? -0.638  -6.415  -31.223 1.00 53.86  ? 439  TRP B CD1 1 
ATOM   7545 C CD2 . TRP B 1 439 ? 0.739   -8.062  -30.564 1.00 52.64  ? 439  TRP B CD2 1 
ATOM   7546 N NE1 . TRP B 1 439 ? 0.196   -6.717  -32.278 1.00 52.36  ? 439  TRP B NE1 1 
ATOM   7547 C CE2 . TRP B 1 439 ? 1.052   -7.720  -31.900 1.00 51.02  ? 439  TRP B CE2 1 
ATOM   7548 C CE3 . TRP B 1 439 ? 1.472   -9.078  -29.941 1.00 54.33  ? 439  TRP B CE3 1 
ATOM   7549 C CZ2 . TRP B 1 439 ? 2.072   -8.353  -32.619 1.00 50.70  ? 439  TRP B CZ2 1 
ATOM   7550 C CZ3 . TRP B 1 439 ? 2.489   -9.698  -30.654 1.00 56.83  ? 439  TRP B CZ3 1 
ATOM   7551 C CH2 . TRP B 1 439 ? 2.777   -9.333  -31.981 1.00 52.58  ? 439  TRP B CH2 1 
ATOM   7552 N N   . PRO B 1 440 ? -1.887  -8.888  -26.220 1.00 48.60  ? 440  PRO B N   1 
ATOM   7553 C CA  . PRO B 1 440 ? -2.291  -8.889  -24.802 1.00 51.81  ? 440  PRO B CA  1 
ATOM   7554 C C   . PRO B 1 440 ? -2.361  -7.485  -24.169 1.00 57.92  ? 440  PRO B C   1 
ATOM   7555 O O   . PRO B 1 440 ? -1.841  -6.501  -24.718 1.00 56.76  ? 440  PRO B O   1 
ATOM   7556 C CB  . PRO B 1 440 ? -1.165  -9.666  -24.106 1.00 53.31  ? 440  PRO B CB  1 
ATOM   7557 C CG  . PRO B 1 440 ? -0.406  -10.326 -25.159 1.00 57.05  ? 440  PRO B CG  1 
ATOM   7558 C CD  . PRO B 1 440 ? -0.608  -9.584  -26.438 1.00 48.21  ? 440  PRO B CD  1 
ATOM   7559 N N   . LEU B 1 441 ? -2.989  -7.408  -23.000 1.00 56.91  ? 441  LEU B N   1 
ATOM   7560 C CA  . LEU B 1 441 ? -3.084  -6.151  -22.273 1.00 64.76  ? 441  LEU B CA  1 
ATOM   7561 C C   . LEU B 1 441 ? -1.723  -5.611  -21.814 1.00 61.60  ? 441  LEU B C   1 
ATOM   7562 O O   . LEU B 1 441 ? -1.500  -4.396  -21.831 1.00 63.11  ? 441  LEU B O   1 
ATOM   7563 C CB  . LEU B 1 441 ? -4.033  -6.285  -21.082 1.00 60.77  ? 441  LEU B CB  1 
ATOM   7564 C CG  . LEU B 1 441 ? -5.519  -6.302  -21.454 1.00 72.92  ? 441  LEU B CG  1 
ATOM   7565 C CD1 . LEU B 1 441 ? -6.383  -6.787  -20.287 1.00 64.05  ? 441  LEU B CD1 1 
ATOM   7566 C CD2 . LEU B 1 441 ? -5.977  -4.919  -21.932 1.00 66.38  ? 441  LEU B CD2 1 
ATOM   7567 N N   . TRP B 1 442 ? -0.810  -6.494  -21.421 1.00 49.43  ? 442  TRP B N   1 
ATOM   7568 C CA  . TRP B 1 442 ? 0.474   -6.017  -20.902 1.00 59.33  ? 442  TRP B CA  1 
ATOM   7569 C C   . TRP B 1 442 ? 1.295   -5.202  -21.919 1.00 58.41  ? 442  TRP B C   1 
ATOM   7570 O O   . TRP B 1 442 ? 2.194   -4.455  -21.539 1.00 59.21  ? 442  TRP B O   1 
ATOM   7571 C CB  . TRP B 1 442 ? 1.316   -7.155  -20.313 1.00 55.40  ? 442  TRP B CB  1 
ATOM   7572 C CG  . TRP B 1 442 ? 1.907   -8.094  -21.326 1.00 58.74  ? 442  TRP B CG  1 
ATOM   7573 C CD1 . TRP B 1 442 ? 1.400   -9.302  -21.710 1.00 61.43  ? 442  TRP B CD1 1 
ATOM   7574 C CD2 . TRP B 1 442 ? 3.127   -7.915  -22.069 1.00 64.18  ? 442  TRP B CD2 1 
ATOM   7575 N NE1 . TRP B 1 442 ? 2.222   -9.885  -22.650 1.00 64.77  ? 442  TRP B NE1 1 
ATOM   7576 C CE2 . TRP B 1 442 ? 3.287   -9.055  -22.889 1.00 61.95  ? 442  TRP B CE2 1 
ATOM   7577 C CE3 . TRP B 1 442 ? 4.096   -6.901  -22.126 1.00 57.93  ? 442  TRP B CE3 1 
ATOM   7578 C CZ2 . TRP B 1 442 ? 4.376   -9.209  -23.757 1.00 60.40  ? 442  TRP B CZ2 1 
ATOM   7579 C CZ3 . TRP B 1 442 ? 5.178   -7.057  -22.988 1.00 56.61  ? 442  TRP B CZ3 1 
ATOM   7580 C CH2 . TRP B 1 442 ? 5.307   -8.204  -23.793 1.00 55.24  ? 442  TRP B CH2 1 
ATOM   7581 N N   . MET B 1 443 ? 0.983   -5.344  -23.201 1.00 58.88  ? 443  MET B N   1 
ATOM   7582 C CA  . MET B 1 443 ? 1.691   -4.603  -24.235 1.00 58.16  ? 443  MET B CA  1 
ATOM   7583 C C   . MET B 1 443 ? 1.156   -3.177  -24.374 1.00 53.36  ? 443  MET B C   1 
ATOM   7584 O O   . MET B 1 443 ? 1.829   -2.309  -24.937 1.00 52.91  ? 443  MET B O   1 
ATOM   7585 C CB  . MET B 1 443 ? 1.643   -5.353  -25.572 1.00 49.13  ? 443  MET B CB  1 
ATOM   7586 C CG  . MET B 1 443 ? 2.429   -6.656  -25.545 1.00 52.85  ? 443  MET B CG  1 
ATOM   7587 S SD  . MET B 1 443 ? 2.420   -7.528  -27.123 1.00 57.71  ? 443  MET B SD  1 
ATOM   7588 C CE  . MET B 1 443 ? 4.021   -7.135  -27.799 1.00 54.88  ? 443  MET B CE  1 
ATOM   7589 N N   . GLY B 1 444 ? -0.044  -2.944  -23.846 1.00 51.20  ? 444  GLY B N   1 
ATOM   7590 C CA  . GLY B 1 444 ? -0.645  -1.622  -23.841 1.00 55.51  ? 444  GLY B CA  1 
ATOM   7591 C C   . GLY B 1 444 ? -0.928  -1.070  -25.230 1.00 59.80  ? 444  GLY B C   1 
ATOM   7592 O O   . GLY B 1 444 ? -1.721  -1.645  -25.989 1.00 58.94  ? 444  GLY B O   1 
ATOM   7593 N N   . VAL B 1 445 ? -0.284  0.055   -25.549 1.00 55.49  ? 445  VAL B N   1 
ATOM   7594 C CA  . VAL B 1 445 ? -0.367  0.676   -26.863 1.00 48.51  ? 445  VAL B CA  1 
ATOM   7595 C C   . VAL B 1 445 ? 0.974   0.484   -27.561 1.00 52.11  ? 445  VAL B C   1 
ATOM   7596 O O   . VAL B 1 445 ? 1.923   1.220   -27.285 1.00 56.18  ? 445  VAL B O   1 
ATOM   7597 C CB  . VAL B 1 445 ? -0.627  2.191   -26.732 1.00 54.15  ? 445  VAL B CB  1 
ATOM   7598 C CG1 . VAL B 1 445 ? -0.895  2.820   -28.100 1.00 45.77  ? 445  VAL B CG1 1 
ATOM   7599 C CG2 . VAL B 1 445 ? -1.782  2.462   -25.757 1.00 52.68  ? 445  VAL B CG2 1 
ATOM   7600 N N   . PRO B 1 446 ? 1.075   -0.524  -28.449 1.00 55.28  ? 446  PRO B N   1 
ATOM   7601 C CA  . PRO B 1 446 ? 2.364   -0.731  -29.131 1.00 55.42  ? 446  PRO B CA  1 
ATOM   7602 C C   . PRO B 1 446 ? 2.494   0.166   -30.367 1.00 50.38  ? 446  PRO B C   1 
ATOM   7603 O O   . PRO B 1 446 ? 1.508   0.808   -30.763 1.00 50.48  ? 446  PRO B O   1 
ATOM   7604 C CB  . PRO B 1 446 ? 2.319   -2.224  -29.544 1.00 54.74  ? 446  PRO B CB  1 
ATOM   7605 C CG  . PRO B 1 446 ? 1.022   -2.788  -28.926 1.00 49.49  ? 446  PRO B CG  1 
ATOM   7606 C CD  . PRO B 1 446 ? 0.118   -1.608  -28.736 1.00 48.44  ? 446  PRO B CD  1 
ATOM   7607 N N   A HIS B 1 447 ? 3.685   0.248   -30.948 0.62 51.62  ? 447  HIS B N   1 
ATOM   7608 N N   B HIS B 1 447 ? 3.704   0.190   -30.937 0.38 51.94  ? 447  HIS B N   1 
ATOM   7609 C CA  A HIS B 1 447 ? 3.918   1.193   -32.033 0.62 53.57  ? 447  HIS B CA  1 
ATOM   7610 C CA  B HIS B 1 447 ? 3.980   0.625   -32.308 0.38 54.85  ? 447  HIS B CA  1 
ATOM   7611 C C   A HIS B 1 447 ? 3.299   0.751   -33.376 0.62 54.98  ? 447  HIS B C   1 
ATOM   7612 C C   B HIS B 1 447 ? 2.798   0.538   -33.247 0.38 54.42  ? 447  HIS B C   1 
ATOM   7613 O O   A HIS B 1 447 ? 3.572   -0.340  -33.891 0.62 57.65  ? 447  HIS B O   1 
ATOM   7614 O O   B HIS B 1 447 ? 2.225   -0.535  -33.412 0.38 53.24  ? 447  HIS B O   1 
ATOM   7615 C CB  A HIS B 1 447 ? 5.413   1.527   -32.157 0.62 51.24  ? 447  HIS B CB  1 
ATOM   7616 C CB  B HIS B 1 447 ? 5.019   -0.316  -32.933 0.38 59.77  ? 447  HIS B CB  1 
ATOM   7617 C CG  A HIS B 1 447 ? 6.291   0.334   -32.373 0.62 58.74  ? 447  HIS B CG  1 
ATOM   7618 C CG  B HIS B 1 447 ? 6.440   0.069   -32.680 0.38 59.97  ? 447  HIS B CG  1 
ATOM   7619 N ND1 A HIS B 1 447 ? 5.847   -0.824  -32.979 0.62 63.07  ? 447  HIS B ND1 1 
ATOM   7620 N ND1 B HIS B 1 447 ? 6.892   1.368   -32.773 0.38 57.62  ? 447  HIS B ND1 1 
ATOM   7621 C CD2 A HIS B 1 447 ? 7.596   0.122   -32.074 0.62 62.35  ? 447  HIS B CD2 1 
ATOM   7622 C CD2 B HIS B 1 447 ? 7.517   -0.685  -32.351 0.38 61.80  ? 447  HIS B CD2 1 
ATOM   7623 C CE1 A HIS B 1 447 ? 6.839   -1.694  -33.046 0.62 63.79  ? 447  HIS B CE1 1 
ATOM   7624 C CE1 B HIS B 1 447 ? 8.186   1.398   -32.502 0.38 59.79  ? 447  HIS B CE1 1 
ATOM   7625 N NE2 A HIS B 1 447 ? 7.913   -1.146  -32.502 0.62 61.06  ? 447  HIS B NE2 1 
ATOM   7626 N NE2 B HIS B 1 447 ? 8.587   0.166   -32.240 0.38 61.21  ? 447  HIS B NE2 1 
ATOM   7627 N N   . GLY B 1 448 ? 2.458   1.632   -33.912 1.00 52.31  ? 448  GLY B N   1 
ATOM   7628 C CA  . GLY B 1 448 ? 1.695   1.446   -35.125 1.00 47.74  ? 448  GLY B CA  1 
ATOM   7629 C C   . GLY B 1 448 ? 0.220   1.226   -34.874 1.00 48.46  ? 448  GLY B C   1 
ATOM   7630 O O   . GLY B 1 448 ? -0.535  1.008   -35.825 1.00 51.91  ? 448  GLY B O   1 
ATOM   7631 N N   . TYR B 1 449 ? -0.211  1.279   -33.613 1.00 46.87  ? 449  TYR B N   1 
ATOM   7632 C CA  . TYR B 1 449 ? -1.649  1.138   -33.336 1.00 51.73  ? 449  TYR B CA  1 
ATOM   7633 C C   . TYR B 1 449 ? -2.382  2.461   -33.165 1.00 46.27  ? 449  TYR B C   1 
ATOM   7634 O O   . TYR B 1 449 ? -3.542  2.494   -32.756 1.00 55.26  ? 449  TYR B O   1 
ATOM   7635 C CB  . TYR B 1 449 ? -1.926  0.109   -32.237 1.00 42.65  ? 449  TYR B CB  1 
ATOM   7636 C CG  . TYR B 1 449 ? -1.495  -1.230  -32.747 1.00 51.81  ? 449  TYR B CG  1 
ATOM   7637 C CD1 . TYR B 1 449 ? -2.320  -1.973  -33.590 1.00 49.31  ? 449  TYR B CD1 1 
ATOM   7638 C CD2 . TYR B 1 449 ? -0.223  -1.707  -32.485 1.00 49.42  ? 449  TYR B CD2 1 
ATOM   7639 C CE1 . TYR B 1 449 ? -1.906  -3.188  -34.100 1.00 48.54  ? 449  TYR B CE1 1 
ATOM   7640 C CE2 . TYR B 1 449 ? 0.207   -2.910  -32.999 1.00 51.50  ? 449  TYR B CE2 1 
ATOM   7641 C CZ  . TYR B 1 449 ? -0.640  -3.651  -33.805 1.00 47.42  ? 449  TYR B CZ  1 
ATOM   7642 O OH  . TYR B 1 449 ? -0.206  -4.856  -34.314 1.00 55.84  ? 449  TYR B OH  1 
ATOM   7643 N N   . GLU B 1 450 ? -1.685  3.535   -33.532 1.00 41.72  ? 450  GLU B N   1 
ATOM   7644 C CA  . GLU B 1 450 ? -2.288  4.847   -33.704 1.00 45.92  ? 450  GLU B CA  1 
ATOM   7645 C C   . GLU B 1 450 ? -2.661  5.075   -35.181 1.00 49.64  ? 450  GLU B C   1 
ATOM   7646 O O   . GLU B 1 450 ? -3.551  5.885   -35.489 1.00 46.51  ? 450  GLU B O   1 
ATOM   7647 C CB  . GLU B 1 450 ? -1.332  5.951   -33.193 1.00 42.55  ? 450  GLU B CB  1 
ATOM   7648 C CG  . GLU B 1 450 ? -0.284  6.468   -34.211 1.00 46.17  ? 450  GLU B CG  1 
ATOM   7649 C CD  . GLU B 1 450 ? 0.957   5.557   -34.353 1.00 49.34  ? 450  GLU B CD  1 
ATOM   7650 O OE1 . GLU B 1 450 ? 0.902   4.367   -33.956 1.00 42.59  ? 450  GLU B OE1 1 
ATOM   7651 O OE2 . GLU B 1 450 ? 1.997   6.037   -34.874 1.00 50.44  ? 450  GLU B OE2 1 
ATOM   7652 N N   . ILE B 1 451 ? -1.994  4.346   -36.082 1.00 44.18  ? 451  ILE B N   1 
ATOM   7653 C CA  . ILE B 1 451 ? -2.115  4.584   -37.524 1.00 38.96  ? 451  ILE B CA  1 
ATOM   7654 C C   . ILE B 1 451 ? -3.548  4.429   -38.026 1.00 42.93  ? 451  ILE B C   1 
ATOM   7655 O O   . ILE B 1 451 ? -4.030  5.231   -38.839 1.00 47.59  ? 451  ILE B O   1 
ATOM   7656 C CB  . ILE B 1 451 ? -1.171  3.654   -38.335 1.00 47.72  ? 451  ILE B CB  1 
ATOM   7657 C CG1 . ILE B 1 451 ? 0.293   3.879   -37.938 1.00 49.41  ? 451  ILE B CG1 1 
ATOM   7658 C CG2 . ILE B 1 451 ? -1.326  3.875   -39.830 1.00 41.51  ? 451  ILE B CG2 1 
ATOM   7659 C CD1 . ILE B 1 451 ? 1.267   2.980   -38.671 1.00 44.78  ? 451  ILE B CD1 1 
ATOM   7660 N N   . GLU B 1 452 ? -4.235  3.401   -37.533 1.00 50.65  ? 452  GLU B N   1 
ATOM   7661 C CA  . GLU B 1 452 ? -5.609  3.130   -37.965 1.00 50.97  ? 452  GLU B CA  1 
ATOM   7662 C C   . GLU B 1 452 ? -6.546  4.297   -37.645 1.00 50.93  ? 452  GLU B C   1 
ATOM   7663 O O   . GLU B 1 452 ? -7.444  4.611   -38.435 1.00 52.31  ? 452  GLU B O   1 
ATOM   7664 C CB  . GLU B 1 452 ? -6.118  1.811   -37.377 1.00 52.97  ? 452  GLU B CB  1 
ATOM   7665 C CG  . GLU B 1 452 ? -6.127  1.753   -35.859 1.00 57.15  ? 452  GLU B CG  1 
ATOM   7666 C CD  . GLU B 1 452 ? -5.954  0.333   -35.333 1.00 64.07  ? 452  GLU B CD  1 
ATOM   7667 O OE1 . GLU B 1 452 ? -4.901  -0.287  -35.609 1.00 65.47  ? 452  GLU B OE1 1 
ATOM   7668 O OE2 . GLU B 1 452 ? -6.864  -0.166  -34.634 1.00 72.08  ? 452  GLU B OE2 1 
ATOM   7669 N N   . PHE B 1 453 ? -6.308  4.957   -36.509 1.00 51.10  ? 453  PHE B N   1 
ATOM   7670 C CA  . PHE B 1 453 ? -7.078  6.150   -36.117 1.00 45.76  ? 453  PHE B CA  1 
ATOM   7671 C C   . PHE B 1 453 ? -6.778  7.403   -36.943 1.00 44.85  ? 453  PHE B C   1 
ATOM   7672 O O   . PHE B 1 453 ? -7.717  8.091   -37.352 1.00 43.76  ? 453  PHE B O   1 
ATOM   7673 C CB  . PHE B 1 453 ? -6.890  6.445   -34.632 1.00 42.10  ? 453  PHE B CB  1 
ATOM   7674 C CG  . PHE B 1 453 ? -7.373  5.347   -33.743 1.00 38.45  ? 453  PHE B CG  1 
ATOM   7675 C CD1 . PHE B 1 453 ? -8.705  5.291   -33.351 1.00 43.01  ? 453  PHE B CD1 1 
ATOM   7676 C CD2 . PHE B 1 453 ? -6.503  4.352   -33.312 1.00 46.26  ? 453  PHE B CD2 1 
ATOM   7677 C CE1 . PHE B 1 453 ? -9.162  4.267   -32.525 1.00 49.86  ? 453  PHE B CE1 1 
ATOM   7678 C CE2 . PHE B 1 453 ? -6.949  3.321   -32.481 1.00 53.30  ? 453  PHE B CE2 1 
ATOM   7679 C CZ  . PHE B 1 453 ? -8.286  3.280   -32.086 1.00 52.95  ? 453  PHE B CZ  1 
ATOM   7680 N N   . ILE B 1 454 ? -5.491  7.705   -37.168 1.00 46.69  ? 454  ILE B N   1 
ATOM   7681 C CA  . ILE B 1 454 ? -5.095  8.794   -38.077 1.00 38.91  ? 454  ILE B CA  1 
ATOM   7682 C C   . ILE B 1 454 ? -5.715  8.627   -39.472 1.00 46.37  ? 454  ILE B C   1 
ATOM   7683 O O   . ILE B 1 454 ? -6.156  9.605   -40.086 1.00 46.80  ? 454  ILE B O   1 
ATOM   7684 C CB  . ILE B 1 454 ? -3.560  8.893   -38.267 1.00 46.67  ? 454  ILE B CB  1 
ATOM   7685 C CG1 . ILE B 1 454 ? -2.811  8.939   -36.921 1.00 46.09  ? 454  ILE B CG1 1 
ATOM   7686 C CG2 . ILE B 1 454 ? -3.198  10.077  -39.181 1.00 39.50  ? 454  ILE B CG2 1 
ATOM   7687 C CD1 . ILE B 1 454 ? -3.176  10.114  -36.057 1.00 53.63  ? 454  ILE B CD1 1 
ATOM   7688 N N   . PHE B 1 455 ? -5.751  7.390   -39.977 1.00 50.13  ? 455  PHE B N   1 
ATOM   7689 C CA  . PHE B 1 455 ? -6.272  7.144   -41.333 1.00 51.23  ? 455  PHE B CA  1 
ATOM   7690 C C   . PHE B 1 455 ? -7.792  7.130   -41.400 1.00 49.45  ? 455  PHE B C   1 
ATOM   7691 O O   . PHE B 1 455 ? -8.362  7.282   -42.474 1.00 48.80  ? 455  PHE B O   1 
ATOM   7692 C CB  . PHE B 1 455 ? -5.679  5.869   -41.953 1.00 49.97  ? 455  PHE B CB  1 
ATOM   7693 C CG  . PHE B 1 455 ? -4.385  6.109   -42.683 1.00 46.70  ? 455  PHE B CG  1 
ATOM   7694 C CD1 . PHE B 1 455 ? -3.169  6.064   -42.013 1.00 43.71  ? 455  PHE B CD1 1 
ATOM   7695 C CD2 . PHE B 1 455 ? -4.389  6.417   -44.032 1.00 43.12  ? 455  PHE B CD2 1 
ATOM   7696 C CE1 . PHE B 1 455 ? -1.984  6.307   -42.682 1.00 46.55  ? 455  PHE B CE1 1 
ATOM   7697 C CE2 . PHE B 1 455 ? -3.202  6.666   -44.713 1.00 43.17  ? 455  PHE B CE2 1 
ATOM   7698 C CZ  . PHE B 1 455 ? -1.999  6.614   -44.039 1.00 44.23  ? 455  PHE B CZ  1 
ATOM   7699 N N   . GLY B 1 456 ? -8.437  6.929   -40.253 1.00 49.42  ? 456  GLY B N   1 
ATOM   7700 C CA  . GLY B 1 456 ? -9.880  7.051   -40.172 1.00 56.20  ? 456  GLY B CA  1 
ATOM   7701 C C   . GLY B 1 456 ? -10.636 5.740   -40.263 1.00 60.93  ? 456  GLY B C   1 
ATOM   7702 O O   . GLY B 1 456 ? -11.842 5.732   -40.497 1.00 58.55  ? 456  GLY B O   1 
ATOM   7703 N N   . LEU B 1 457 ? -9.925  4.632   -40.074 1.00 57.42  ? 457  LEU B N   1 
ATOM   7704 C CA  . LEU B 1 457 ? -10.538 3.304   -40.105 1.00 57.84  ? 457  LEU B CA  1 
ATOM   7705 C C   . LEU B 1 457 ? -11.779 3.098   -39.205 1.00 64.26  ? 457  LEU B C   1 
ATOM   7706 O O   . LEU B 1 457 ? -12.677 2.340   -39.573 1.00 65.20  ? 457  LEU B O   1 
ATOM   7707 C CB  . LEU B 1 457 ? -9.491  2.204   -39.853 1.00 55.74  ? 457  LEU B CB  1 
ATOM   7708 C CG  . LEU B 1 457 ? -8.914  1.561   -41.121 1.00 51.65  ? 457  LEU B CG  1 
ATOM   7709 C CD1 . LEU B 1 457 ? -8.052  2.550   -41.911 1.00 48.14  ? 457  LEU B CD1 1 
ATOM   7710 C CD2 . LEU B 1 457 ? -8.128  0.314   -40.768 1.00 49.35  ? 457  LEU B CD2 1 
ATOM   7711 N N   . PRO B 1 458 ? -11.839 3.748   -38.024 1.00 61.76  ? 458  PRO B N   1 
ATOM   7712 C CA  . PRO B 1 458 ? -13.068 3.536   -37.241 1.00 64.84  ? 458  PRO B CA  1 
ATOM   7713 C C   . PRO B 1 458 ? -14.348 4.135   -37.839 1.00 60.46  ? 458  PRO B C   1 
ATOM   7714 O O   . PRO B 1 458 ? -15.422 3.959   -37.269 1.00 72.08  ? 458  PRO B O   1 
ATOM   7715 C CB  . PRO B 1 458 ? -12.741 4.194   -35.898 1.00 60.25  ? 458  PRO B CB  1 
ATOM   7716 C CG  . PRO B 1 458 ? -11.266 4.083   -35.789 1.00 60.75  ? 458  PRO B CG  1 
ATOM   7717 C CD  . PRO B 1 458 ? -10.754 4.293   -37.185 1.00 54.06  ? 458  PRO B CD  1 
ATOM   7718 N N   . LEU B 1 459 ? -14.235 4.821   -38.969 1.00 57.16  ? 459  LEU B N   1 
ATOM   7719 C CA  . LEU B 1 459 ? -15.397 5.391   -39.646 1.00 62.32  ? 459  LEU B CA  1 
ATOM   7720 C C   . LEU B 1 459 ? -16.069 4.344   -40.534 1.00 73.88  ? 459  LEU B C   1 
ATOM   7721 O O   . LEU B 1 459 ? -17.104 4.602   -41.166 1.00 74.77  ? 459  LEU B O   1 
ATOM   7722 C CB  . LEU B 1 459 ? -14.997 6.613   -40.476 1.00 62.27  ? 459  LEU B CB  1 
ATOM   7723 C CG  . LEU B 1 459 ? -14.963 7.964   -39.756 1.00 64.43  ? 459  LEU B CG  1 
ATOM   7724 C CD1 . LEU B 1 459 ? -14.067 7.946   -38.514 1.00 59.96  ? 459  LEU B CD1 1 
ATOM   7725 C CD2 . LEU B 1 459 ? -14.518 9.050   -40.726 1.00 58.06  ? 459  LEU B CD2 1 
ATOM   7726 N N   . ASP B 1 460 ? -15.458 3.164   -40.576 1.00 72.34  ? 460  ASP B N   1 
ATOM   7727 C CA  . ASP B 1 460 ? -16.043 2.001   -41.222 1.00 71.12  ? 460  ASP B CA  1 
ATOM   7728 C C   . ASP B 1 460 ? -16.821 1.228   -40.161 1.00 77.68  ? 460  ASP B C   1 
ATOM   7729 O O   . ASP B 1 460 ? -16.231 0.668   -39.221 1.00 77.98  ? 460  ASP B O   1 
ATOM   7730 C CB  . ASP B 1 460 ? -14.945 1.125   -41.820 1.00 75.68  ? 460  ASP B CB  1 
ATOM   7731 C CG  . ASP B 1 460 ? -15.465 0.165   -42.866 1.00 79.16  ? 460  ASP B CG  1 
ATOM   7732 O OD1 . ASP B 1 460 ? -16.537 -0.444  -42.646 1.00 84.64  ? 460  ASP B OD1 1 
ATOM   7733 O OD2 . ASP B 1 460 ? -14.798 0.021   -43.915 1.00 80.08  ? 460  ASP B OD2 1 
ATOM   7734 N N   . PRO B 1 461 ? -18.158 1.212   -40.300 1.00 85.64  ? 461  PRO B N   1 
ATOM   7735 C CA  . PRO B 1 461 ? -19.070 0.613   -39.314 1.00 80.77  ? 461  PRO B CA  1 
ATOM   7736 C C   . PRO B 1 461 ? -18.898 -0.901  -39.242 1.00 76.22  ? 461  PRO B C   1 
ATOM   7737 O O   . PRO B 1 461 ? -19.214 -1.517  -38.217 1.00 79.13  ? 461  PRO B O   1 
ATOM   7738 C CB  . PRO B 1 461 ? -20.461 0.980   -39.859 1.00 78.44  ? 461  PRO B CB  1 
ATOM   7739 C CG  . PRO B 1 461 ? -20.223 2.167   -40.773 1.00 74.71  ? 461  PRO B CG  1 
ATOM   7740 C CD  . PRO B 1 461 ? -18.891 1.867   -41.400 1.00 79.95  ? 461  PRO B CD  1 
ATOM   7741 N N   . SER B 1 462 ? -18.378 -1.479  -40.322 1.00 76.19  ? 462  SER B N   1 
ATOM   7742 C CA  . SER B 1 462 ? -18.199 -2.922  -40.429 1.00 68.85  ? 462  SER B CA  1 
ATOM   7743 C C   . SER B 1 462 ? -16.973 -3.405  -39.660 1.00 78.52  ? 462  SER B C   1 
ATOM   7744 O O   . SER B 1 462 ? -16.740 -4.617  -39.560 1.00 80.55  ? 462  SER B O   1 
ATOM   7745 C CB  . SER B 1 462 ? -18.103 -3.344  -41.905 1.00 72.52  ? 462  SER B CB  1 
ATOM   7746 O OG  . SER B 1 462 ? -16.760 -3.366  -42.377 1.00 67.84  ? 462  SER B OG  1 
ATOM   7747 N N   . LEU B 1 463 ? -16.194 -2.470  -39.112 1.00 77.92  ? 463  LEU B N   1 
ATOM   7748 C CA  . LEU B 1 463 ? -14.945 -2.834  -38.433 1.00 74.81  ? 463  LEU B CA  1 
ATOM   7749 C C   . LEU B 1 463 ? -15.078 -2.981  -36.918 1.00 75.63  ? 463  LEU B C   1 
ATOM   7750 O O   . LEU B 1 463 ? -14.136 -3.407  -36.241 1.00 78.29  ? 463  LEU B O   1 
ATOM   7751 C CB  . LEU B 1 463 ? -13.819 -1.873  -38.811 1.00 74.16  ? 463  LEU B CB  1 
ATOM   7752 C CG  . LEU B 1 463 ? -13.170 -2.217  -40.156 1.00 73.83  ? 463  LEU B CG  1 
ATOM   7753 C CD1 . LEU B 1 463 ? -12.364 -1.055  -40.701 1.00 66.35  ? 463  LEU B CD1 1 
ATOM   7754 C CD2 . LEU B 1 463 ? -12.295 -3.453  -40.005 1.00 73.24  ? 463  LEU B CD2 1 
ATOM   7755 N N   . ASN B 1 464 ? -16.251 -2.628  -36.399 1.00 72.85  ? 464  ASN B N   1 
ATOM   7756 C CA  . ASN B 1 464 ? -16.601 -2.911  -35.008 1.00 86.97  ? 464  ASN B CA  1 
ATOM   7757 C C   . ASN B 1 464 ? -15.749 -2.158  -33.977 1.00 86.66  ? 464  ASN B C   1 
ATOM   7758 O O   . ASN B 1 464 ? -15.434 -2.679  -32.892 1.00 80.47  ? 464  ASN B O   1 
ATOM   7759 C CB  . ASN B 1 464 ? -16.615 -4.430  -34.742 1.00 90.27  ? 464  ASN B CB  1 
ATOM   7760 C CG  . ASN B 1 464 ? -17.518 -5.188  -35.716 1.00 96.24  ? 464  ASN B CG  1 
ATOM   7761 O OD1 . ASN B 1 464 ? -18.578 -4.689  -36.123 1.00 84.67  ? 464  ASN B OD1 1 
ATOM   7762 N ND2 . ASN B 1 464 ? -17.095 -6.398  -36.099 1.00 90.27  ? 464  ASN B ND2 1 
ATOM   7763 N N   . TYR B 1 465 ? -15.379 -0.929  -34.333 1.00 76.15  ? 465  TYR B N   1 
ATOM   7764 C CA  . TYR B 1 465 ? -14.805 0.004   -33.378 1.00 69.72  ? 465  TYR B CA  1 
ATOM   7765 C C   . TYR B 1 465 ? -15.945 0.627   -32.575 1.00 69.23  ? 465  TYR B C   1 
ATOM   7766 O O   . TYR B 1 465 ? -17.055 0.789   -33.090 1.00 72.30  ? 465  TYR B O   1 
ATOM   7767 C CB  . TYR B 1 465 ? -14.045 1.112   -34.107 1.00 67.50  ? 465  TYR B CB  1 
ATOM   7768 C CG  . TYR B 1 465 ? -12.679 0.734   -34.636 1.00 70.35  ? 465  TYR B CG  1 
ATOM   7769 C CD1 . TYR B 1 465 ? -11.578 0.655   -33.787 1.00 63.32  ? 465  TYR B CD1 1 
ATOM   7770 C CD2 . TYR B 1 465 ? -12.482 0.492   -35.989 1.00 66.68  ? 465  TYR B CD2 1 
ATOM   7771 C CE1 . TYR B 1 465 ? -10.322 0.328   -34.272 1.00 66.27  ? 465  TYR B CE1 1 
ATOM   7772 C CE2 . TYR B 1 465 ? -11.234 0.172   -36.484 1.00 68.71  ? 465  TYR B CE2 1 
ATOM   7773 C CZ  . TYR B 1 465 ? -10.155 0.087   -35.623 1.00 71.95  ? 465  TYR B CZ  1 
ATOM   7774 O OH  . TYR B 1 465 ? -8.911  -0.233  -36.121 1.00 61.56  ? 465  TYR B OH  1 
ATOM   7775 N N   . THR B 1 466 ? -15.679 0.986   -31.323 1.00 66.93  ? 466  THR B N   1 
ATOM   7776 C CA  . THR B 1 466 ? -16.684 1.672   -30.515 1.00 63.89  ? 466  THR B CA  1 
ATOM   7777 C C   . THR B 1 466 ? -16.990 3.054   -31.088 1.00 63.05  ? 466  THR B C   1 
ATOM   7778 O O   . THR B 1 466 ? -16.212 3.599   -31.872 1.00 67.47  ? 466  THR B O   1 
ATOM   7779 C CB  . THR B 1 466 ? -16.254 1.822   -29.044 1.00 64.69  ? 466  THR B CB  1 
ATOM   7780 O OG1 . THR B 1 466 ? -15.464 3.012   -28.882 1.00 67.57  ? 466  THR B OG1 1 
ATOM   7781 C CG2 . THR B 1 466 ? -15.475 0.600   -28.590 1.00 56.82  ? 466  THR B CG2 1 
ATOM   7782 N N   . THR B 1 467 ? -18.127 3.615   -30.693 1.00 65.18  ? 467  THR B N   1 
ATOM   7783 C CA  . THR B 1 467 ? -18.578 4.879   -31.257 1.00 67.56  ? 467  THR B CA  1 
ATOM   7784 C C   . THR B 1 467 ? -17.740 6.060   -30.749 1.00 67.72  ? 467  THR B C   1 
ATOM   7785 O O   . THR B 1 467 ? -17.626 7.084   -31.435 1.00 64.57  ? 467  THR B O   1 
ATOM   7786 C CB  . THR B 1 467 ? -20.093 5.119   -31.007 1.00 65.63  ? 467  THR B CB  1 
ATOM   7787 O OG1 . THR B 1 467 ? -20.475 6.392   -31.548 1.00 78.95  ? 467  THR B OG1 1 
ATOM   7788 C CG2 . THR B 1 467 ? -20.403 5.089   -29.522 1.00 67.75  ? 467  THR B CG2 1 
ATOM   7789 N N   . GLU B 1 468 ? -17.150 5.915   -29.560 1.00 60.06  ? 468  GLU B N   1 
ATOM   7790 C CA  . GLU B 1 468 ? -16.232 6.927   -29.053 1.00 64.62  ? 468  GLU B CA  1 
ATOM   7791 C C   . GLU B 1 468 ? -14.960 6.950   -29.910 1.00 67.26  ? 468  GLU B C   1 
ATOM   7792 O O   . GLU B 1 468 ? -14.420 8.031   -30.215 1.00 53.80  ? 468  GLU B O   1 
ATOM   7793 C CB  . GLU B 1 468 ? -15.879 6.668   -27.586 1.00 68.24  ? 468  GLU B CB  1 
ATOM   7794 C CG  . GLU B 1 468 ? -17.067 6.661   -26.642 1.00 81.73  ? 468  GLU B CG  1 
ATOM   7795 C CD  . GLU B 1 468 ? -17.402 5.260   -26.140 1.00 104.36 ? 468  GLU B CD  1 
ATOM   7796 O OE1 . GLU B 1 468 ? -16.459 4.516   -25.773 1.00 102.57 ? 468  GLU B OE1 1 
ATOM   7797 O OE2 . GLU B 1 468 ? -18.605 4.900   -26.118 1.00 100.60 ? 468  GLU B OE2 1 
ATOM   7798 N N   . GLU B 1 469 ? -14.501 5.751   -30.288 1.00 61.21  ? 469  GLU B N   1 
ATOM   7799 C CA  . GLU B 1 469 ? -13.354 5.569   -31.177 1.00 56.61  ? 469  GLU B CA  1 
ATOM   7800 C C   . GLU B 1 469 ? -13.552 6.233   -32.540 1.00 58.42  ? 469  GLU B C   1 
ATOM   7801 O O   . GLU B 1 469 ? -12.600 6.748   -33.137 1.00 58.30  ? 469  GLU B O   1 
ATOM   7802 C CB  . GLU B 1 469 ? -13.040 4.086   -31.348 1.00 50.92  ? 469  GLU B CB  1 
ATOM   7803 C CG  . GLU B 1 469 ? -12.269 3.510   -30.181 1.00 50.30  ? 469  GLU B CG  1 
ATOM   7804 C CD  . GLU B 1 469 ? -12.075 2.012   -30.294 1.00 62.04  ? 469  GLU B CD  1 
ATOM   7805 O OE1 . GLU B 1 469 ? -12.915 1.350   -30.949 1.00 66.06  ? 469  GLU B OE1 1 
ATOM   7806 O OE2 . GLU B 1 469 ? -11.085 1.487   -29.725 1.00 61.25  ? 469  GLU B OE2 1 
ATOM   7807 N N   . ARG B 1 470 ? -14.788 6.228   -33.022 1.00 56.77  ? 470  ARG B N   1 
ATOM   7808 C CA  . ARG B 1 470 ? -15.121 6.899   -34.269 1.00 55.75  ? 470  ARG B CA  1 
ATOM   7809 C C   . ARG B 1 470 ? -14.998 8.422   -34.107 1.00 56.19  ? 470  ARG B C   1 
ATOM   7810 O O   . ARG B 1 470 ? -14.523 9.113   -35.008 1.00 61.03  ? 470  ARG B O   1 
ATOM   7811 C CB  . ARG B 1 470 ? -16.520 6.479   -34.730 1.00 59.21  ? 470  ARG B CB  1 
ATOM   7812 C CG  . ARG B 1 470 ? -16.871 6.862   -36.158 1.00 72.29  ? 470  ARG B CG  1 
ATOM   7813 C CD  . ARG B 1 470 ? -17.620 8.191   -36.241 1.00 80.64  ? 470  ARG B CD  1 
ATOM   7814 N NE  . ARG B 1 470 ? -18.906 8.161   -35.533 1.00 96.23  ? 470  ARG B NE  1 
ATOM   7815 C CZ  . ARG B 1 470 ? -19.688 9.226   -35.355 1.00 102.03 ? 470  ARG B CZ  1 
ATOM   7816 N NH1 . ARG B 1 470 ? -19.317 10.410  -35.832 1.00 96.34  ? 470  ARG B NH1 1 
ATOM   7817 N NH2 . ARG B 1 470 ? -20.839 9.113   -34.699 1.00 102.65 ? 470  ARG B NH2 1 
ATOM   7818 N N   . ILE B 1 471 ? -15.401 8.943   -32.951 1.00 63.64  ? 471  ILE B N   1 
ATOM   7819 C CA  . ILE B 1 471 ? -15.272 10.382  -32.665 1.00 69.44  ? 471  ILE B CA  1 
ATOM   7820 C C   . ILE B 1 471 ? -13.800 10.803  -32.479 1.00 57.28  ? 471  ILE B C   1 
ATOM   7821 O O   . ILE B 1 471 ? -13.379 11.859  -32.985 1.00 55.02  ? 471  ILE B O   1 
ATOM   7822 C CB  . ILE B 1 471 ? -16.123 10.802  -31.431 1.00 69.73  ? 471  ILE B CB  1 
ATOM   7823 C CG1 . ILE B 1 471 ? -17.609 10.514  -31.682 1.00 65.08  ? 471  ILE B CG1 1 
ATOM   7824 C CG2 . ILE B 1 471 ? -15.920 12.279  -31.104 1.00 52.12  ? 471  ILE B CG2 1 
ATOM   7825 C CD1 . ILE B 1 471 ? -18.414 10.352  -30.412 1.00 65.14  ? 471  ILE B CD1 1 
ATOM   7826 N N   . PHE B 1 472 ? -13.045 9.967   -31.754 1.00 49.59  ? 472  PHE B N   1 
ATOM   7827 C CA  . PHE B 1 472 ? -11.589 10.092  -31.593 1.00 52.24  ? 472  PHE B CA  1 
ATOM   7828 C C   . PHE B 1 472 ? -10.881 10.169  -32.946 1.00 60.45  ? 472  PHE B C   1 
ATOM   7829 O O   . PHE B 1 472 ? -10.059 11.076  -33.186 1.00 49.73  ? 472  PHE B O   1 
ATOM   7830 C CB  . PHE B 1 472 ? -11.055 8.879   -30.839 1.00 49.66  ? 472  PHE B CB  1 
ATOM   7831 C CG  . PHE B 1 472 ? -9.612  8.999   -30.406 1.00 53.31  ? 472  PHE B CG  1 
ATOM   7832 C CD1 . PHE B 1 472 ? -9.063  10.230  -30.060 1.00 51.09  ? 472  PHE B CD1 1 
ATOM   7833 C CD2 . PHE B 1 472 ? -8.804  7.862   -30.332 1.00 44.75  ? 472  PHE B CD2 1 
ATOM   7834 C CE1 . PHE B 1 472 ? -7.729  10.328  -29.651 1.00 49.99  ? 472  PHE B CE1 1 
ATOM   7835 C CE2 . PHE B 1 472 ? -7.484  7.949   -29.931 1.00 47.72  ? 472  PHE B CE2 1 
ATOM   7836 C CZ  . PHE B 1 472 ? -6.941  9.185   -29.585 1.00 50.47  ? 472  PHE B CZ  1 
ATOM   7837 N N   . ALA B 1 473 ? -11.210 9.206   -33.814 1.00 54.55  ? 473  ALA B N   1 
ATOM   7838 C CA  . ALA B 1 473 ? -10.616 9.113   -35.136 1.00 49.61  ? 473  ALA B CA  1 
ATOM   7839 C C   . ALA B 1 473 ? -10.833 10.412  -35.889 1.00 49.98  ? 473  ALA B C   1 
ATOM   7840 O O   . ALA B 1 473 ? -9.911  10.922  -36.544 1.00 53.17  ? 473  ALA B O   1 
ATOM   7841 C CB  . ALA B 1 473 ? -11.202 7.942   -35.912 1.00 53.66  ? 473  ALA B CB  1 
ATOM   7842 N N   . GLN B 1 474 ? -12.050 10.946  -35.801 1.00 53.20  ? 474  GLN B N   1 
ATOM   7843 C CA  . GLN B 1 474 ? -12.372 12.196  -36.486 1.00 56.38  ? 474  GLN B CA  1 
ATOM   7844 C C   . GLN B 1 474 ? -11.540 13.362  -35.944 1.00 54.29  ? 474  GLN B C   1 
ATOM   7845 O O   . GLN B 1 474 ? -11.076 14.204  -36.727 1.00 53.80  ? 474  GLN B O   1 
ATOM   7846 C CB  . GLN B 1 474 ? -13.869 12.503  -36.385 1.00 59.81  ? 474  GLN B CB  1 
ATOM   7847 C CG  . GLN B 1 474 ? -14.760 11.560  -37.183 1.00 70.03  ? 474  GLN B CG  1 
ATOM   7848 C CD  . GLN B 1 474 ? -16.246 11.866  -37.009 1.00 80.15  ? 474  GLN B CD  1 
ATOM   7849 O OE1 . GLN B 1 474 ? -16.876 11.430  -36.038 1.00 80.12  ? 474  GLN B OE1 1 
ATOM   7850 N NE2 . GLN B 1 474 ? -16.810 12.620  -37.952 1.00 79.67  ? 474  GLN B NE2 1 
ATOM   7851 N N   . ARG B 1 475 ? -11.362 13.411  -34.617 1.00 46.10  ? 475  ARG B N   1 
ATOM   7852 C CA  . ARG B 1 475 ? -10.517 14.435  -34.000 1.00 55.68  ? 475  ARG B CA  1 
ATOM   7853 C C   . ARG B 1 475 ? -9.116  14.391  -34.616 1.00 52.31  ? 475  ARG B C   1 
ATOM   7854 O O   . ARG B 1 475 ? -8.617  15.408  -35.106 1.00 47.81  ? 475  ARG B O   1 
ATOM   7855 C CB  . ARG B 1 475 ? -10.413 14.240  -32.477 1.00 56.28  ? 475  ARG B CB  1 
ATOM   7856 C CG  . ARG B 1 475 ? -11.586 14.767  -31.651 1.00 56.72  ? 475  ARG B CG  1 
ATOM   7857 C CD  . ARG B 1 475 ? -11.365 14.537  -30.153 1.00 55.27  ? 475  ARG B CD  1 
ATOM   7858 N NE  . ARG B 1 475 ? -10.101 15.117  -29.698 1.00 51.79  ? 475  ARG B NE  1 
ATOM   7859 C CZ  . ARG B 1 475 ? -9.354  14.618  -28.711 1.00 51.82  ? 475  ARG B CZ  1 
ATOM   7860 N NH1 . ARG B 1 475 ? -9.746  13.527  -28.050 1.00 42.29  ? 475  ARG B NH1 1 
ATOM   7861 N NH2 . ARG B 1 475 ? -8.203  15.211  -28.387 1.00 46.39  ? 475  ARG B NH2 1 
ATOM   7862 N N   . LEU B 1 476 ? -8.502  13.202  -34.599 1.00 47.44  ? 476  LEU B N   1 
ATOM   7863 C CA  . LEU B 1 476 ? -7.148  13.000  -35.124 1.00 41.79  ? 476  LEU B CA  1 
ATOM   7864 C C   . LEU B 1 476 ? -6.998  13.397  -36.592 1.00 42.83  ? 476  LEU B C   1 
ATOM   7865 O O   . LEU B 1 476 ? -6.053  14.115  -36.938 1.00 45.92  ? 476  LEU B O   1 
ATOM   7866 C CB  . LEU B 1 476 ? -6.681  11.558  -34.895 1.00 41.24  ? 476  LEU B CB  1 
ATOM   7867 C CG  . LEU B 1 476 ? -6.669  11.170  -33.421 1.00 45.05  ? 476  LEU B CG  1 
ATOM   7868 C CD1 . LEU B 1 476 ? -6.118  9.772   -33.241 1.00 48.96  ? 476  LEU B CD1 1 
ATOM   7869 C CD2 . LEU B 1 476 ? -5.870  12.186  -32.606 1.00 43.45  ? 476  LEU B CD2 1 
ATOM   7870 N N   . MET B 1 477 ? -7.922  12.950  -37.442 1.00 39.69  ? 477  MET B N   1 
ATOM   7871 C CA  . MET B 1 477 ? -7.915  13.345  -38.848 1.00 44.50  ? 477  MET B CA  1 
ATOM   7872 C C   . MET B 1 477 ? -7.918  14.858  -38.993 1.00 45.02  ? 477  MET B C   1 
ATOM   7873 O O   . MET B 1 477 ? -7.237  15.404  -39.872 1.00 49.39  ? 477  MET B O   1 
ATOM   7874 C CB  . MET B 1 477 ? -9.118  12.750  -39.603 1.00 55.28  ? 477  MET B CB  1 
ATOM   7875 C CG  . MET B 1 477 ? -9.081  11.230  -39.786 1.00 53.78  ? 477  MET B CG  1 
ATOM   7876 S SD  . MET B 1 477 ? -10.650 10.554  -40.396 1.00 62.13  ? 477  MET B SD  1 
ATOM   7877 C CE  . MET B 1 477 ? -10.585 10.990  -42.133 1.00 48.65  ? 477  MET B CE  1 
ATOM   7878 N N   . LYS B 1 478 ? -8.686  15.532  -38.134 1.00 46.33  ? 478  LYS B N   1 
ATOM   7879 C CA  . LYS B 1 478 ? -8.714  17.006  -38.093 1.00 52.85  ? 478  LYS B CA  1 
ATOM   7880 C C   . LYS B 1 478 ? -7.363  17.620  -37.701 1.00 43.61  ? 478  LYS B C   1 
ATOM   7881 O O   . LYS B 1 478 ? -6.914  18.562  -38.356 1.00 40.62  ? 478  LYS B O   1 
ATOM   7882 C CB  . LYS B 1 478 ? -9.812  17.517  -37.149 1.00 55.64  ? 478  LYS B CB  1 
ATOM   7883 C CG  . LYS B 1 478 ? -11.040 18.099  -37.836 1.00 63.57  ? 478  LYS B CG  1 
ATOM   7884 C CD  . LYS B 1 478 ? -10.772 19.492  -38.378 1.00 68.29  ? 478  LYS B CD  1 
ATOM   7885 C CE  . LYS B 1 478 ? -12.012 20.063  -39.054 1.00 82.20  ? 478  LYS B CE  1 
ATOM   7886 N NZ  . LYS B 1 478 ? -12.449 19.245  -40.228 1.00 73.74  ? 478  LYS B NZ  1 
ATOM   7887 N N   . TYR B 1 479 ? -6.726  17.092  -36.647 1.00 41.33  ? 479  TYR B N   1 
ATOM   7888 C CA  . TYR B 1 479 ? -5.409  17.584  -36.221 1.00 41.47  ? 479  TYR B CA  1 
ATOM   7889 C C   . TYR B 1 479 ? -4.412  17.463  -37.360 1.00 44.78  ? 479  TYR B C   1 
ATOM   7890 O O   . TYR B 1 479 ? -3.766  18.459  -37.757 1.00 42.24  ? 479  TYR B O   1 
ATOM   7891 C CB  . TYR B 1 479 ? -4.864  16.796  -35.036 1.00 38.74  ? 479  TYR B CB  1 
ATOM   7892 C CG  . TYR B 1 479 ? -5.584  17.009  -33.736 1.00 43.86  ? 479  TYR B CG  1 
ATOM   7893 C CD1 . TYR B 1 479 ? -6.116  18.258  -33.396 1.00 48.05  ? 479  TYR B CD1 1 
ATOM   7894 C CD2 . TYR B 1 479 ? -5.731  15.964  -32.833 1.00 40.78  ? 479  TYR B CD2 1 
ATOM   7895 C CE1 . TYR B 1 479 ? -6.788  18.453  -32.179 1.00 37.06  ? 479  TYR B CE1 1 
ATOM   7896 C CE2 . TYR B 1 479 ? -6.404  16.147  -31.614 1.00 48.51  ? 479  TYR B CE2 1 
ATOM   7897 C CZ  . TYR B 1 479 ? -6.927  17.394  -31.294 1.00 46.24  ? 479  TYR B CZ  1 
ATOM   7898 O OH  . TYR B 1 479 ? -7.594  17.568  -30.094 1.00 50.29  ? 479  TYR B OH  1 
ATOM   7899 N N   . TRP B 1 480 ? -4.304  16.241  -37.889 1.00 38.39  ? 480  TRP B N   1 
ATOM   7900 C CA  . TRP B 1 480 ? -3.363  15.958  -38.974 1.00 41.42  ? 480  TRP B CA  1 
ATOM   7901 C C   . TRP B 1 480 ? -3.603  16.837  -40.205 1.00 43.15  ? 480  TRP B C   1 
ATOM   7902 O O   . TRP B 1 480 ? -2.663  17.450  -40.743 1.00 37.83  ? 480  TRP B O   1 
ATOM   7903 C CB  . TRP B 1 480 ? -3.387  14.474  -39.344 1.00 36.90  ? 480  TRP B CB  1 
ATOM   7904 C CG  . TRP B 1 480 ? -2.291  13.662  -38.678 1.00 43.21  ? 480  TRP B CG  1 
ATOM   7905 C CD1 . TRP B 1 480 ? -1.289  12.961  -39.303 1.00 38.34  ? 480  TRP B CD1 1 
ATOM   7906 C CD2 . TRP B 1 480 ? -2.073  13.490  -37.261 1.00 44.13  ? 480  TRP B CD2 1 
ATOM   7907 N NE1 . TRP B 1 480 ? -0.471  12.362  -38.365 1.00 42.75  ? 480  TRP B NE1 1 
ATOM   7908 C CE2 . TRP B 1 480 ? -0.930  12.669  -37.109 1.00 42.68  ? 480  TRP B CE2 1 
ATOM   7909 C CE3 . TRP B 1 480 ? -2.739  13.944  -36.113 1.00 39.33  ? 480  TRP B CE3 1 
ATOM   7910 C CZ2 . TRP B 1 480 ? -0.446  12.287  -35.855 1.00 40.50  ? 480  TRP B CZ2 1 
ATOM   7911 C CZ3 . TRP B 1 480 ? -2.262  13.571  -34.878 1.00 42.85  ? 480  TRP B CZ3 1 
ATOM   7912 C CH2 . TRP B 1 480 ? -1.123  12.747  -34.754 1.00 47.02  ? 480  TRP B CH2 1 
ATOM   7913 N N   . THR B 1 481 ? -4.858  16.924  -40.643 1.00 39.80  ? 481  THR B N   1 
ATOM   7914 C CA  . THR B 1 481 ? -5.145  17.699  -41.850 1.00 43.37  ? 481  THR B CA  1 
ATOM   7915 C C   . THR B 1 481 ? -5.073  19.209  -41.599 1.00 45.31  ? 481  THR B C   1 
ATOM   7916 O O   . THR B 1 481 ? -4.630  19.959  -42.477 1.00 45.41  ? 481  THR B O   1 
ATOM   7917 C CB  . THR B 1 481 ? -6.470  17.276  -42.544 1.00 47.88  ? 481  THR B CB  1 
ATOM   7918 O OG1 . THR B 1 481 ? -7.526  17.221  -41.582 1.00 49.64  ? 481  THR B OG1 1 
ATOM   7919 C CG2 . THR B 1 481 ? -6.327  15.908  -43.161 1.00 44.12  ? 481  THR B CG2 1 
ATOM   7920 N N   . ASN B 1 482 ? -5.490  19.666  -40.413 1.00 48.03  ? 482  ASN B N   1 
ATOM   7921 C CA  . ASN B 1 482 ? -5.239  21.068  -40.037 1.00 48.87  ? 482  ASN B CA  1 
ATOM   7922 C C   . ASN B 1 482 ? -3.755  21.391  -40.098 1.00 45.79  ? 482  ASN B C   1 
ATOM   7923 O O   . ASN B 1 482 ? -3.361  22.417  -40.671 1.00 47.76  ? 482  ASN B O   1 
ATOM   7924 C CB  . ASN B 1 482 ? -5.816  21.423  -38.663 1.00 51.06  ? 482  ASN B CB  1 
ATOM   7925 C CG  . ASN B 1 482 ? -7.328  21.609  -38.699 1.00 55.03  ? 482  ASN B CG  1 
ATOM   7926 O OD1 . ASN B 1 482 ? -7.886  22.077  -39.697 1.00 50.22  ? 482  ASN B OD1 1 
ATOM   7927 N ND2 . ASN B 1 482 ? -7.998  21.224  -37.613 1.00 55.75  ? 482  ASN B ND2 1 
ATOM   7928 N N   . PHE B 1 483 ? -2.933  20.499  -39.542 1.00 41.53  ? 483  PHE B N   1 
ATOM   7929 C CA  . PHE B 1 483 ? -1.488  20.647  -39.675 1.00 43.97  ? 483  PHE B CA  1 
ATOM   7930 C C   . PHE B 1 483 ? -1.018  20.705  -41.145 1.00 50.69  ? 483  PHE B C   1 
ATOM   7931 O O   . PHE B 1 483 ? -0.164  21.533  -41.485 1.00 48.07  ? 483  PHE B O   1 
ATOM   7932 C CB  . PHE B 1 483 ? -0.725  19.564  -38.907 1.00 44.31  ? 483  PHE B CB  1 
ATOM   7933 C CG  . PHE B 1 483 ? 0.760   19.761  -38.939 1.00 46.45  ? 483  PHE B CG  1 
ATOM   7934 C CD1 . PHE B 1 483 ? 1.369   20.690  -38.094 1.00 46.61  ? 483  PHE B CD1 1 
ATOM   7935 C CD2 . PHE B 1 483 ? 1.550   19.059  -39.843 1.00 40.99  ? 483  PHE B CD2 1 
ATOM   7936 C CE1 . PHE B 1 483 ? 2.744   20.890  -38.127 1.00 41.90  ? 483  PHE B CE1 1 
ATOM   7937 C CE2 . PHE B 1 483 ? 2.936   19.260  -39.887 1.00 40.36  ? 483  PHE B CE2 1 
ATOM   7938 C CZ  . PHE B 1 483 ? 3.530   20.173  -39.025 1.00 41.86  ? 483  PHE B CZ  1 
ATOM   7939 N N   . ALA B 1 484 ? -1.563  19.846  -42.012 1.00 46.82  ? 484  ALA B N   1 
ATOM   7940 C CA  . ALA B 1 484 ? -1.167  19.877  -43.428 1.00 49.34  ? 484  ALA B CA  1 
ATOM   7941 C C   . ALA B 1 484 ? -1.545  21.203  -44.095 1.00 50.10  ? 484  ALA B C   1 
ATOM   7942 O O   . ALA B 1 484 ? -0.742  21.786  -44.847 1.00 49.29  ? 484  ALA B O   1 
ATOM   7943 C CB  . ALA B 1 484 ? -1.759  18.703  -44.205 1.00 38.29  ? 484  ALA B CB  1 
ATOM   7944 N N   . ARG B 1 485 ? -2.763  21.675  -43.823 1.00 48.85  ? 485  ARG B N   1 
ATOM   7945 C CA  . ARG B 1 485 ? -3.225  22.945  -44.387 1.00 54.11  ? 485  ARG B CA  1 
ATOM   7946 C C   . ARG B 1 485 ? -2.430  24.135  -43.858 1.00 52.07  ? 485  ARG B C   1 
ATOM   7947 O O   . ARG B 1 485 ? -2.042  25.001  -44.631 1.00 52.39  ? 485  ARG B O   1 
ATOM   7948 C CB  . ARG B 1 485 ? -4.713  23.175  -44.095 1.00 50.25  ? 485  ARG B CB  1 
ATOM   7949 C CG  . ARG B 1 485 ? -5.673  22.472  -45.052 1.00 63.22  ? 485  ARG B CG  1 
ATOM   7950 C CD  . ARG B 1 485 ? -7.135  22.646  -44.615 1.00 62.75  ? 485  ARG B CD  1 
ATOM   7951 N NE  . ARG B 1 485 ? -7.423  21.922  -43.375 1.00 68.90  ? 485  ARG B NE  1 
ATOM   7952 C CZ  . ARG B 1 485 ? -8.117  20.783  -43.312 1.00 75.13  ? 485  ARG B CZ  1 
ATOM   7953 N NH1 . ARG B 1 485 ? -8.617  20.253  -44.427 1.00 75.85  ? 485  ARG B NH1 1 
ATOM   7954 N NH2 . ARG B 1 485 ? -8.325  20.179  -42.137 1.00 58.85  ? 485  ARG B NH2 1 
ATOM   7955 N N   . THR B 1 486 ? -2.178  24.171  -42.547 1.00 49.66  ? 486  THR B N   1 
ATOM   7956 C CA  . THR B 1 486 ? -1.707  25.412  -41.916 1.00 54.10  ? 486  THR B CA  1 
ATOM   7957 C C   . THR B 1 486 ? -0.323  25.390  -41.251 1.00 54.01  ? 486  THR B C   1 
ATOM   7958 O O   . THR B 1 486 ? 0.302   26.440  -41.103 1.00 58.57  ? 486  THR B O   1 
ATOM   7959 C CB  . THR B 1 486 ? -2.750  25.969  -40.897 1.00 55.34  ? 486  THR B CB  1 
ATOM   7960 O OG1 . THR B 1 486 ? -2.805  25.129  -39.731 1.00 47.71  ? 486  THR B OG1 1 
ATOM   7961 C CG2 . THR B 1 486 ? -4.152  26.078  -41.539 1.00 41.27  ? 486  THR B CG2 1 
ATOM   7962 N N   . GLY B 1 487 ? 0.157   24.216  -40.850 1.00 49.53  ? 487  GLY B N   1 
ATOM   7963 C CA  . GLY B 1 487 ? 1.363   24.152  -40.039 1.00 47.21  ? 487  GLY B CA  1 
ATOM   7964 C C   . GLY B 1 487 ? 1.035   24.185  -38.555 1.00 48.59  ? 487  GLY B C   1 
ATOM   7965 O O   . GLY B 1 487 ? 1.936   24.302  -37.712 1.00 49.43  ? 487  GLY B O   1 
ATOM   7966 N N   . ASP B 1 488 ? -0.262  24.066  -38.249 1.00 45.18  ? 488  ASP B N   1 
ATOM   7967 C CA  . ASP B 1 488 ? -0.790  24.190  -36.896 1.00 44.60  ? 488  ASP B CA  1 
ATOM   7968 C C   . ASP B 1 488 ? -1.979  23.237  -36.775 1.00 47.67  ? 488  ASP B C   1 
ATOM   7969 O O   . ASP B 1 488 ? -2.944  23.352  -37.530 1.00 48.11  ? 488  ASP B O   1 
ATOM   7970 C CB  . ASP B 1 488 ? -1.236  25.643  -36.673 1.00 44.56  ? 488  ASP B CB  1 
ATOM   7971 C CG  . ASP B 1 488 ? -1.692  25.933  -35.239 1.00 52.10  ? 488  ASP B CG  1 
ATOM   7972 O OD1 . ASP B 1 488 ? -2.264  25.045  -34.563 1.00 53.18  ? 488  ASP B OD1 1 
ATOM   7973 O OD2 . ASP B 1 488 ? -1.485  27.084  -34.786 1.00 57.07  ? 488  ASP B OD2 1 
ATOM   7974 N N   . PRO B 1 489 ? -1.920  22.297  -35.817 1.00 43.56  ? 489  PRO B N   1 
ATOM   7975 C CA  . PRO B 1 489 ? -2.971  21.278  -35.644 1.00 40.25  ? 489  PRO B CA  1 
ATOM   7976 C C   . PRO B 1 489 ? -4.317  21.818  -35.133 1.00 47.63  ? 489  PRO B C   1 
ATOM   7977 O O   . PRO B 1 489 ? -5.319  21.107  -35.220 1.00 53.27  ? 489  PRO B O   1 
ATOM   7978 C CB  . PRO B 1 489 ? -2.392  20.327  -34.583 1.00 42.59  ? 489  PRO B CB  1 
ATOM   7979 C CG  . PRO B 1 489 ? -1.037  20.867  -34.204 1.00 43.39  ? 489  PRO B CG  1 
ATOM   7980 C CD  . PRO B 1 489 ? -0.897  22.250  -34.760 1.00 41.48  ? 489  PRO B CD  1 
ATOM   7981 N N   . ASN B 1 490 ? -4.336  23.041  -34.607 1.00 53.98  ? 490  ASN B N   1 
ATOM   7982 C CA  . ASN B 1 490 ? -5.513  23.581  -33.914 1.00 61.01  ? 490  ASN B CA  1 
ATOM   7983 C C   . ASN B 1 490 ? -6.638  24.032  -34.852 1.00 57.91  ? 490  ASN B C   1 
ATOM   7984 O O   . ASN B 1 490 ? -6.373  24.633  -35.899 1.00 57.99  ? 490  ASN B O   1 
ATOM   7985 C CB  . ASN B 1 490 ? -5.099  24.742  -32.990 1.00 52.28  ? 490  ASN B CB  1 
ATOM   7986 C CG  . ASN B 1 490 ? -4.242  24.288  -31.819 1.00 50.08  ? 490  ASN B CG  1 
ATOM   7987 O OD1 . ASN B 1 490 ? -4.754  23.751  -30.832 1.00 53.96  ? 490  ASN B OD1 1 
ATOM   7988 N ND2 . ASN B 1 490 ? -2.936  24.516  -31.913 1.00 45.69  ? 490  ASN B ND2 1 
ATOM   7989 N N   . ASP B 1 491 ? -7.886  23.752  -34.467 1.00 66.20  ? 491  ASP B N   1 
ATOM   7990 C CA  . ASP B 1 491 ? -9.059  24.170  -35.247 1.00 84.30  ? 491  ASP B CA  1 
ATOM   7991 C C   . ASP B 1 491 ? -9.431  25.638  -34.962 1.00 95.64  ? 491  ASP B C   1 
ATOM   7992 O O   . ASP B 1 491 ? -9.772  25.984  -33.818 1.00 96.24  ? 491  ASP B O   1 
ATOM   7993 C CB  . ASP B 1 491 ? -10.258 23.251  -34.944 1.00 86.92  ? 491  ASP B CB  1 
ATOM   7994 C CG  . ASP B 1 491 ? -11.167 23.019  -36.165 1.00 96.55  ? 491  ASP B CG  1 
ATOM   7995 O OD1 . ASP B 1 491 ? -11.119 23.814  -37.135 1.00 96.04  ? 491  ASP B OD1 1 
ATOM   7996 O OD2 . ASP B 1 491 ? -11.940 22.032  -36.149 1.00 97.53  ? 491  ASP B OD2 1 
ATOM   7997 N N   . PRO B 1 492 ? -9.360  26.508  -35.998 1.00 95.28  ? 492  PRO B N   1 
ATOM   7998 C CA  . PRO B 1 492 ? -9.751  27.926  -35.872 1.00 101.24 ? 492  PRO B CA  1 
ATOM   7999 C C   . PRO B 1 492 ? -11.250 28.083  -35.598 1.00 106.10 ? 492  PRO B C   1 
ATOM   8000 O O   . PRO B 1 492 ? -11.674 29.079  -35.001 1.00 107.25 ? 492  PRO B O   1 
ATOM   8001 C CB  . PRO B 1 492 ? -9.399  28.526  -37.244 1.00 91.82  ? 492  PRO B CB  1 
ATOM   8002 C CG  . PRO B 1 492 ? -8.432  27.565  -37.855 1.00 95.69  ? 492  PRO B CG  1 
ATOM   8003 C CD  . PRO B 1 492 ? -8.832  26.208  -37.340 1.00 93.11  ? 492  PRO B CD  1 
ATOM   8004 N N   . ARG B 1 493 ? -12.039 27.108  -36.042 1.00 109.38 ? 493  ARG B N   1 
ATOM   8005 C CA  . ARG B 1 493 ? -13.454 27.050  -35.691 1.00 115.49 ? 493  ARG B CA  1 
ATOM   8006 C C   . ARG B 1 493 ? -13.605 26.921  -34.173 1.00 110.68 ? 493  ARG B C   1 
ATOM   8007 O O   . ARG B 1 493 ? -14.077 27.847  -33.510 1.00 102.76 ? 493  ARG B O   1 
ATOM   8008 C CB  . ARG B 1 493 ? -14.144 25.879  -36.408 1.00 105.11 ? 493  ARG B CB  1 
ATOM   8009 N N   . ASP B 1 494 ? -13.179 25.781  -33.632 1.00 104.72 ? 494  ASP B N   1 
ATOM   8010 C CA  . ASP B 1 494 ? -13.292 25.518  -32.202 1.00 107.47 ? 494  ASP B CA  1 
ATOM   8011 C C   . ASP B 1 494 ? -12.400 26.419  -31.336 1.00 112.16 ? 494  ASP B C   1 
ATOM   8012 O O   . ASP B 1 494 ? -11.574 27.191  -31.848 1.00 100.63 ? 494  ASP B O   1 
ATOM   8013 C CB  . ASP B 1 494 ? -13.032 24.042  -31.898 1.00 108.70 ? 494  ASP B CB  1 
ATOM   8014 C CG  . ASP B 1 494 ? -13.846 23.539  -30.718 1.00 116.86 ? 494  ASP B CG  1 
ATOM   8015 O OD1 . ASP B 1 494 ? -13.792 24.172  -29.638 1.00 111.43 ? 494  ASP B OD1 1 
ATOM   8016 O OD2 . ASP B 1 494 ? -14.550 22.517  -30.881 1.00 117.43 ? 494  ASP B OD2 1 
ATOM   8017 N N   . SER B 1 495 ? -12.577 26.298  -30.018 1.00 111.13 ? 495  SER B N   1 
ATOM   8018 C CA  . SER B 1 495 ? -12.048 27.269  -29.055 1.00 100.76 ? 495  SER B CA  1 
ATOM   8019 C C   . SER B 1 495 ? -12.275 26.823  -27.599 1.00 98.52  ? 495  SER B C   1 
ATOM   8020 O O   . SER B 1 495 ? -13.056 25.885  -27.350 1.00 93.99  ? 495  SER B O   1 
ATOM   8021 C CB  . SER B 1 495 ? -12.688 28.651  -29.317 1.00 85.98  ? 495  SER B CB  1 
ATOM   8022 O OG  . SER B 1 495 ? -13.124 29.268  -28.119 1.00 77.36  ? 495  SER B OG  1 
ATOM   8023 N N   . LYS B 1 496 ? -11.583 27.497  -26.663 1.00 94.03  ? 496  LYS B N   1 
ATOM   8024 C CA  . LYS B 1 496 ? -11.616 27.190  -25.213 1.00 97.86  ? 496  LYS B CA  1 
ATOM   8025 C C   . LYS B 1 496 ? -11.289 25.713  -24.999 1.00 112.63 ? 496  LYS B C   1 
ATOM   8026 O O   . LYS B 1 496 ? -11.931 25.006  -24.199 1.00 106.12 ? 496  LYS B O   1 
ATOM   8027 C CB  . LYS B 1 496 ? -12.992 27.550  -24.629 1.00 87.10  ? 496  LYS B CB  1 
ATOM   8028 C CG  . LYS B 1 496 ? -13.011 28.754  -23.692 1.00 74.05  ? 496  LYS B CG  1 
ATOM   8029 C CD  . LYS B 1 496 ? -12.149 29.974  -24.111 1.00 64.30  ? 496  LYS B CD  1 
ATOM   8030 C CE  . LYS B 1 496 ? -12.700 30.709  -25.350 1.00 61.81  ? 496  LYS B CE  1 
ATOM   8031 N NZ  . LYS B 1 496 ? -13.957 31.454  -25.114 1.00 56.69  ? 496  LYS B NZ  1 
ATOM   8032 N N   . SER B 1 497 ? -10.230 25.293  -25.690 1.00 100.60 ? 497  SER B N   1 
ATOM   8033 C CA  . SER B 1 497 ? -10.231 24.011  -26.403 1.00 97.52  ? 497  SER B CA  1 
ATOM   8034 C C   . SER B 1 497 ? -9.881  22.673  -25.677 1.00 89.44  ? 497  SER B C   1 
ATOM   8035 O O   . SER B 1 497 ? -10.557 21.666  -25.914 1.00 91.65  ? 497  SER B O   1 
ATOM   8036 C CB  . SER B 1 497 ? -9.521  24.178  -27.776 1.00 91.98  ? 497  SER B CB  1 
ATOM   8037 O OG  . SER B 1 497 ? -9.199  25.557  -28.025 1.00 88.13  ? 497  SER B OG  1 
ATOM   8038 N N   . PRO B 1 498 ? -8.778  22.616  -24.897 1.00 81.32  ? 498  PRO B N   1 
ATOM   8039 C CA  . PRO B 1 498 ? -7.672  23.574  -24.766 1.00 79.58  ? 498  PRO B CA  1 
ATOM   8040 C C   . PRO B 1 498 ? -6.858  23.631  -26.062 1.00 69.10  ? 498  PRO B C   1 
ATOM   8041 O O   . PRO B 1 498 ? -6.997  22.764  -26.932 1.00 59.14  ? 498  PRO B O   1 
ATOM   8042 C CB  . PRO B 1 498 ? -6.816  22.962  -23.651 1.00 69.59  ? 498  PRO B CB  1 
ATOM   8043 C CG  . PRO B 1 498 ? -7.753  22.086  -22.882 1.00 70.16  ? 498  PRO B CG  1 
ATOM   8044 C CD  . PRO B 1 498 ? -8.622  21.492  -23.950 1.00 70.73  ? 498  PRO B CD  1 
ATOM   8045 N N   . GLN B 1 499 ? -6.036  24.658  -26.208 1.00 58.81  ? 499  GLN B N   1 
ATOM   8046 C CA  . GLN B 1 499 ? -5.246  24.777  -27.414 1.00 54.89  ? 499  GLN B CA  1 
ATOM   8047 C C   . GLN B 1 499 ? -4.030  23.857  -27.328 1.00 48.92  ? 499  GLN B C   1 
ATOM   8048 O O   . GLN B 1 499 ? -3.517  23.599  -26.235 1.00 45.62  ? 499  GLN B O   1 
ATOM   8049 C CB  . GLN B 1 499 ? -4.854  26.242  -27.652 1.00 55.33  ? 499  GLN B CB  1 
ATOM   8050 C CG  . GLN B 1 499 ? -6.040  27.113  -28.089 1.00 48.53  ? 499  GLN B CG  1 
ATOM   8051 C CD  . GLN B 1 499 ? -6.350  27.001  -29.585 1.00 55.31  ? 499  GLN B CD  1 
ATOM   8052 O OE1 . GLN B 1 499 ? -7.476  26.653  -29.971 1.00 60.50  ? 499  GLN B OE1 1 
ATOM   8053 N NE2 . GLN B 1 499 ? -5.346  27.269  -30.434 1.00 55.67  ? 499  GLN B NE2 1 
ATOM   8054 N N   . TRP B 1 500 ? -3.603  23.327  -28.474 1.00 46.74  ? 500  TRP B N   1 
ATOM   8055 C CA  . TRP B 1 500 ? -2.377  22.534  -28.559 1.00 46.06  ? 500  TRP B CA  1 
ATOM   8056 C C   . TRP B 1 500 ? -1.184  23.510  -28.706 1.00 42.54  ? 500  TRP B C   1 
ATOM   8057 O O   . TRP B 1 500 ? -1.052  24.193  -29.732 1.00 42.28  ? 500  TRP B O   1 
ATOM   8058 C CB  . TRP B 1 500 ? -2.474  21.547  -29.749 1.00 43.09  ? 500  TRP B CB  1 
ATOM   8059 C CG  . TRP B 1 500 ? -1.335  20.546  -29.870 1.00 40.87  ? 500  TRP B CG  1 
ATOM   8060 C CD1 . TRP B 1 500 ? -0.091  20.651  -29.320 1.00 41.01  ? 500  TRP B CD1 1 
ATOM   8061 C CD2 . TRP B 1 500 ? -1.343  19.305  -30.601 1.00 44.87  ? 500  TRP B CD2 1 
ATOM   8062 N NE1 . TRP B 1 500 ? 0.673   19.560  -29.657 1.00 41.10  ? 500  TRP B NE1 1 
ATOM   8063 C CE2 . TRP B 1 500 ? -0.068  18.717  -30.440 1.00 45.30  ? 500  TRP B CE2 1 
ATOM   8064 C CE3 . TRP B 1 500 ? -2.303  18.632  -31.368 1.00 43.88  ? 500  TRP B CE3 1 
ATOM   8065 C CZ2 . TRP B 1 500 ? 0.270   17.486  -31.009 1.00 46.24  ? 500  TRP B CZ2 1 
ATOM   8066 C CZ3 . TRP B 1 500 ? -1.965  17.410  -31.934 1.00 42.09  ? 500  TRP B CZ3 1 
ATOM   8067 C CH2 . TRP B 1 500 ? -0.690  16.851  -31.752 1.00 44.09  ? 500  TRP B CH2 1 
ATOM   8068 N N   . PRO B 1 501 ? -0.327  23.601  -27.669 1.00 41.11  ? 501  PRO B N   1 
ATOM   8069 C CA  . PRO B 1 501 ? 0.773   24.581  -27.727 1.00 44.93  ? 501  PRO B CA  1 
ATOM   8070 C C   . PRO B 1 501 ? 2.011   24.024  -28.421 1.00 47.23  ? 501  PRO B C   1 
ATOM   8071 O O   . PRO B 1 501 ? 2.262   22.805  -28.357 1.00 39.92  ? 501  PRO B O   1 
ATOM   8072 C CB  . PRO B 1 501 ? 1.087   24.855  -26.246 1.00 31.53  ? 501  PRO B CB  1 
ATOM   8073 C CG  . PRO B 1 501 ? 0.701   23.572  -25.536 1.00 36.55  ? 501  PRO B CG  1 
ATOM   8074 C CD  . PRO B 1 501 ? -0.403  22.920  -26.357 1.00 42.79  ? 501  PRO B CD  1 
ATOM   8075 N N   . PRO B 1 502 ? 2.771   24.904  -29.093 1.00 43.31  ? 502  PRO B N   1 
ATOM   8076 C CA  . PRO B 1 502 ? 4.059   24.507  -29.671 1.00 43.01  ? 502  PRO B CA  1 
ATOM   8077 C C   . PRO B 1 502 ? 5.008   23.922  -28.615 1.00 43.41  ? 502  PRO B C   1 
ATOM   8078 O O   . PRO B 1 502 ? 5.004   24.354  -27.463 1.00 44.66  ? 502  PRO B O   1 
ATOM   8079 C CB  . PRO B 1 502 ? 4.614   25.830  -30.206 1.00 37.51  ? 502  PRO B CB  1 
ATOM   8080 C CG  . PRO B 1 502 ? 3.378   26.611  -30.576 1.00 46.56  ? 502  PRO B CG  1 
ATOM   8081 C CD  . PRO B 1 502 ? 2.368   26.261  -29.509 1.00 41.34  ? 502  PRO B CD  1 
ATOM   8082 N N   . TYR B 1 503 ? 5.795   22.925  -29.003 1.00 44.71  ? 503  TYR B N   1 
ATOM   8083 C CA  . TYR B 1 503 ? 6.866   22.426  -28.152 1.00 45.71  ? 503  TYR B CA  1 
ATOM   8084 C C   . TYR B 1 503 ? 8.044   23.414  -28.187 1.00 47.44  ? 503  TYR B C   1 
ATOM   8085 O O   . TYR B 1 503 ? 8.443   23.892  -29.256 1.00 48.34  ? 503  TYR B O   1 
ATOM   8086 C CB  . TYR B 1 503 ? 7.310   21.040  -28.619 1.00 42.33  ? 503  TYR B CB  1 
ATOM   8087 C CG  . TYR B 1 503 ? 8.392   20.389  -27.778 1.00 43.44  ? 503  TYR B CG  1 
ATOM   8088 C CD1 . TYR B 1 503 ? 9.738   20.639  -28.033 1.00 39.25  ? 503  TYR B CD1 1 
ATOM   8089 C CD2 . TYR B 1 503 ? 8.069   19.499  -26.749 1.00 38.59  ? 503  TYR B CD2 1 
ATOM   8090 C CE1 . TYR B 1 503 ? 10.726  20.042  -27.285 1.00 44.14  ? 503  TYR B CE1 1 
ATOM   8091 C CE2 . TYR B 1 503 ? 9.065   18.894  -25.983 1.00 43.48  ? 503  TYR B CE2 1 
ATOM   8092 C CZ  . TYR B 1 503 ? 10.394  19.172  -26.256 1.00 45.04  ? 503  TYR B CZ  1 
ATOM   8093 O OH  . TYR B 1 503 ? 11.405  18.586  -25.516 1.00 47.23  ? 503  TYR B OH  1 
ATOM   8094 N N   . THR B 1 504 ? 8.579   23.733  -27.011 1.00 48.67  ? 504  THR B N   1 
ATOM   8095 C CA  . THR B 1 504 ? 9.730   24.628  -26.886 1.00 47.32  ? 504  THR B CA  1 
ATOM   8096 C C   . THR B 1 504 ? 10.771  24.011  -25.957 1.00 47.51  ? 504  THR B C   1 
ATOM   8097 O O   . THR B 1 504 ? 10.470  23.102  -25.189 1.00 52.09  ? 504  THR B O   1 
ATOM   8098 C CB  . THR B 1 504 ? 9.318   26.017  -26.350 1.00 49.58  ? 504  THR B CB  1 
ATOM   8099 O OG1 . THR B 1 504 ? 8.753   25.881  -25.035 1.00 52.31  ? 504  THR B OG1 1 
ATOM   8100 C CG2 . THR B 1 504 ? 8.304   26.673  -27.290 1.00 35.49  ? 504  THR B CG2 1 
ATOM   8101 N N   . THR B 1 505 ? 12.005  24.487  -26.044 1.00 55.08  ? 505  THR B N   1 
ATOM   8102 C CA  . THR B 1 505 ? 13.053  24.011  -25.140 1.00 59.34  ? 505  THR B CA  1 
ATOM   8103 C C   . THR B 1 505 ? 12.798  24.521  -23.716 1.00 57.33  ? 505  THR B C   1 
ATOM   8104 O O   . THR B 1 505 ? 13.022  23.804  -22.735 1.00 55.89  ? 505  THR B O   1 
ATOM   8105 C CB  . THR B 1 505 ? 14.465  24.396  -25.641 1.00 52.06  ? 505  THR B CB  1 
ATOM   8106 O OG1 . THR B 1 505 ? 14.448  25.733  -26.172 1.00 63.99  ? 505  THR B OG1 1 
ATOM   8107 C CG2 . THR B 1 505 ? 14.894  23.435  -26.740 1.00 52.29  ? 505  THR B CG2 1 
ATOM   8108 N N   . ALA B 1 506 ? 12.302  25.752  -23.624 1.00 55.30  ? 506  ALA B N   1 
ATOM   8109 C CA  . ALA B 1 506 ? 11.894  26.332  -22.350 1.00 56.92  ? 506  ALA B CA  1 
ATOM   8110 C C   . ALA B 1 506 ? 10.815  25.503  -21.630 1.00 60.49  ? 506  ALA B C   1 
ATOM   8111 O O   . ALA B 1 506 ? 11.077  24.920  -20.574 1.00 60.86  ? 506  ALA B O   1 
ATOM   8112 C CB  . ALA B 1 506 ? 11.413  27.778  -22.552 1.00 53.81  ? 506  ALA B CB  1 
ATOM   8113 N N   . ALA B 1 507 ? 9.606   25.450  -22.196 1.00 54.44  ? 507  ALA B N   1 
ATOM   8114 C CA  . ALA B 1 507 ? 8.469   24.866  -21.485 1.00 47.51  ? 507  ALA B CA  1 
ATOM   8115 C C   . ALA B 1 507 ? 8.221   23.380  -21.768 1.00 50.60  ? 507  ALA B C   1 
ATOM   8116 O O   . ALA B 1 507 ? 7.473   22.738  -21.035 1.00 49.71  ? 507  ALA B O   1 
ATOM   8117 C CB  . ALA B 1 507 ? 7.202   25.678  -21.744 1.00 53.46  ? 507  ALA B CB  1 
ATOM   8118 N N   . GLN B 1 508 ? 8.836   22.854  -22.828 1.00 53.66  ? 508  GLN B N   1 
ATOM   8119 C CA  . GLN B 1 508 ? 8.703   21.442  -23.236 1.00 51.49  ? 508  GLN B CA  1 
ATOM   8120 C C   . GLN B 1 508 ? 7.269   20.873  -23.191 1.00 53.97  ? 508  GLN B C   1 
ATOM   8121 O O   . GLN B 1 508 ? 7.041   19.752  -22.696 1.00 47.18  ? 508  GLN B O   1 
ATOM   8122 C CB  . GLN B 1 508 ? 9.667   20.548  -22.444 1.00 45.16  ? 508  GLN B CB  1 
ATOM   8123 C CG  . GLN B 1 508 ? 11.137  20.954  -22.563 1.00 51.60  ? 508  GLN B CG  1 
ATOM   8124 C CD  . GLN B 1 508 ? 12.027  20.309  -21.498 1.00 50.22  ? 508  GLN B CD  1 
ATOM   8125 O OE1 . GLN B 1 508 ? 12.180  19.085  -21.445 1.00 48.14  ? 508  GLN B OE1 1 
ATOM   8126 N NE2 . GLN B 1 508 ? 12.606  21.138  -20.638 1.00 53.64  ? 508  GLN B NE2 1 
ATOM   8127 N N   . GLN B 1 509 ? 6.317   21.637  -23.726 1.00 42.79  ? 509  GLN B N   1 
ATOM   8128 C CA  . GLN B 1 509 ? 4.916   21.222  -23.725 1.00 46.06  ? 509  GLN B CA  1 
ATOM   8129 C C   . GLN B 1 509 ? 4.503   20.276  -24.866 1.00 47.70  ? 509  GLN B C   1 
ATOM   8130 O O   . GLN B 1 509 ? 4.878   20.456  -26.036 1.00 46.15  ? 509  GLN B O   1 
ATOM   8131 C CB  . GLN B 1 509 ? 4.010   22.452  -23.741 1.00 45.03  ? 509  GLN B CB  1 
ATOM   8132 C CG  . GLN B 1 509 ? 4.091   23.296  -22.486 1.00 44.11  ? 509  GLN B CG  1 
ATOM   8133 C CD  . GLN B 1 509 ? 3.349   24.609  -22.641 1.00 52.49  ? 509  GLN B CD  1 
ATOM   8134 O OE1 . GLN B 1 509 ? 3.774   25.488  -23.404 1.00 53.43  ? 509  GLN B OE1 1 
ATOM   8135 N NE2 . GLN B 1 509 ? 2.229   24.751  -21.924 1.00 48.36  ? 509  GLN B NE2 1 
ATOM   8136 N N   . TYR B 1 510 ? 3.701   19.279  -24.502 1.00 44.07  ? 510  TYR B N   1 
ATOM   8137 C CA  . TYR B 1 510 ? 3.151   18.304  -25.441 1.00 47.08  ? 510  TYR B CA  1 
ATOM   8138 C C   . TYR B 1 510 ? 1.735   17.914  -24.977 1.00 44.77  ? 510  TYR B C   1 
ATOM   8139 O O   . TYR B 1 510 ? 1.369   18.143  -23.815 1.00 46.54  ? 510  TYR B O   1 
ATOM   8140 C CB  . TYR B 1 510 ? 4.064   17.070  -25.539 1.00 40.90  ? 510  TYR B CB  1 
ATOM   8141 C CG  . TYR B 1 510 ? 4.158   16.240  -24.273 1.00 42.90  ? 510  TYR B CG  1 
ATOM   8142 C CD1 . TYR B 1 510 ? 5.039   16.585  -23.249 1.00 45.55  ? 510  TYR B CD1 1 
ATOM   8143 C CD2 . TYR B 1 510 ? 3.388   15.088  -24.112 1.00 46.00  ? 510  TYR B CD2 1 
ATOM   8144 C CE1 . TYR B 1 510 ? 5.140   15.808  -22.092 1.00 46.28  ? 510  TYR B CE1 1 
ATOM   8145 C CE2 . TYR B 1 510 ? 3.476   14.305  -22.950 1.00 43.00  ? 510  TYR B CE2 1 
ATOM   8146 C CZ  . TYR B 1 510 ? 4.357   14.673  -21.953 1.00 48.53  ? 510  TYR B CZ  1 
ATOM   8147 O OH  . TYR B 1 510 ? 4.458   13.901  -20.817 1.00 51.48  ? 510  TYR B OH  1 
ATOM   8148 N N   . VAL B 1 511 ? 0.935   17.337  -25.868 1.00 38.51  ? 511  VAL B N   1 
ATOM   8149 C CA  . VAL B 1 511 ? -0.440  16.985  -25.503 1.00 39.30  ? 511  VAL B CA  1 
ATOM   8150 C C   . VAL B 1 511 ? -0.661  15.467  -25.447 1.00 44.20  ? 511  VAL B C   1 
ATOM   8151 O O   . VAL B 1 511 ? 0.026   14.698  -26.131 1.00 40.86  ? 511  VAL B O   1 
ATOM   8152 C CB  . VAL B 1 511 ? -1.444  17.632  -26.466 1.00 41.64  ? 511  VAL B CB  1 
ATOM   8153 C CG1 . VAL B 1 511 ? -1.178  19.133  -26.562 1.00 38.50  ? 511  VAL B CG1 1 
ATOM   8154 C CG2 . VAL B 1 511 ? -1.343  16.986  -27.847 1.00 42.08  ? 511  VAL B CG2 1 
ATOM   8155 N N   . SER B 1 512 ? -1.611  15.033  -24.622 1.00 42.86  ? 512  SER B N   1 
ATOM   8156 C CA  . SER B 1 512 ? -2.030  13.632  -24.631 1.00 46.12  ? 512  SER B CA  1 
ATOM   8157 C C   . SER B 1 512 ? -3.156  13.409  -25.655 1.00 54.03  ? 512  SER B C   1 
ATOM   8158 O O   . SER B 1 512 ? -4.144  14.165  -25.698 1.00 48.98  ? 512  SER B O   1 
ATOM   8159 C CB  . SER B 1 512 ? -2.492  13.185  -23.245 1.00 48.45  ? 512  SER B CB  1 
ATOM   8160 O OG  . SER B 1 512 ? -3.706  13.828  -22.883 1.00 59.66  ? 512  SER B OG  1 
ATOM   8161 N N   . LEU B 1 513 ? -2.996  12.386  -26.495 1.00 52.83  ? 513  LEU B N   1 
ATOM   8162 C CA  . LEU B 1 513 ? -4.053  12.015  -27.439 1.00 47.57  ? 513  LEU B CA  1 
ATOM   8163 C C   . LEU B 1 513 ? -4.749  10.753  -26.930 1.00 52.37  ? 513  LEU B C   1 
ATOM   8164 O O   . LEU B 1 513 ? -4.126  9.681   -26.834 1.00 53.39  ? 513  LEU B O   1 
ATOM   8165 C CB  . LEU B 1 513 ? -3.485  11.801  -28.842 1.00 43.10  ? 513  LEU B CB  1 
ATOM   8166 C CG  . LEU B 1 513 ? -2.908  13.051  -29.510 1.00 46.96  ? 513  LEU B CG  1 
ATOM   8167 C CD1 . LEU B 1 513 ? -2.283  12.744  -30.878 1.00 47.36  ? 513  LEU B CD1 1 
ATOM   8168 C CD2 . LEU B 1 513 ? -3.982  14.116  -29.637 1.00 40.46  ? 513  LEU B CD2 1 
ATOM   8169 N N   . ASN B 1 514 ? -6.029  10.902  -26.576 1.00 48.03  ? 514  ASN B N   1 
ATOM   8170 C CA  . ASN B 1 514 ? -6.854  9.813   -26.040 1.00 46.33  ? 514  ASN B CA  1 
ATOM   8171 C C   . ASN B 1 514 ? -8.335  10.206  -26.060 1.00 54.36  ? 514  ASN B C   1 
ATOM   8172 O O   . ASN B 1 514 ? -8.705  11.204  -26.706 1.00 51.36  ? 514  ASN B O   1 
ATOM   8173 C CB  . ASN B 1 514 ? -6.388  9.377   -24.646 1.00 46.65  ? 514  ASN B CB  1 
ATOM   8174 C CG  . ASN B 1 514 ? -6.342  10.535  -23.647 1.00 59.72  ? 514  ASN B CG  1 
ATOM   8175 O OD1 . ASN B 1 514 ? -7.201  11.429  -23.659 1.00 59.22  ? 514  ASN B OD1 1 
ATOM   8176 N ND2 . ASN B 1 514 ? -5.330  10.526  -22.776 1.00 56.84  ? 514  ASN B ND2 1 
ATOM   8177 N N   . LEU B 1 515 ? -9.187  9.447   -25.371 1.00 55.22  ? 515  LEU B N   1 
ATOM   8178 C CA  . LEU B 1 515 ? -10.627 9.718   -25.470 1.00 58.75  ? 515  LEU B CA  1 
ATOM   8179 C C   . LEU B 1 515 ? -11.045 11.006  -24.754 1.00 57.57  ? 515  LEU B C   1 
ATOM   8180 O O   . LEU B 1 515 ? -12.000 11.671  -25.174 1.00 55.49  ? 515  LEU B O   1 
ATOM   8181 C CB  . LEU B 1 515 ? -11.458 8.525   -25.001 1.00 53.76  ? 515  LEU B CB  1 
ATOM   8182 C CG  . LEU B 1 515 ? -11.219 7.273   -25.841 1.00 61.21  ? 515  LEU B CG  1 
ATOM   8183 C CD1 . LEU B 1 515 ? -11.886 6.061   -25.212 1.00 59.08  ? 515  LEU B CD1 1 
ATOM   8184 C CD2 . LEU B 1 515 ? -11.684 7.475   -27.281 1.00 51.51  ? 515  LEU B CD2 1 
ATOM   8185 N N   . LYS B 1 516 ? -10.324 11.358  -23.686 1.00 57.35  ? 516  LYS B N   1 
ATOM   8186 C CA  . LYS B 1 516 ? -10.561 12.614  -22.970 1.00 57.12  ? 516  LYS B CA  1 
ATOM   8187 C C   . LYS B 1 516 ? -10.122 13.797  -23.845 1.00 56.39  ? 516  LYS B C   1 
ATOM   8188 O O   . LYS B 1 516 ? -9.398  13.614  -24.825 1.00 53.63  ? 516  LYS B O   1 
ATOM   8189 C CB  . LYS B 1 516 ? -9.819  12.600  -21.632 1.00 56.95  ? 516  LYS B CB  1 
ATOM   8190 C CG  . LYS B 1 516 ? -10.258 11.464  -20.689 1.00 58.81  ? 516  LYS B CG  1 
ATOM   8191 C CD  . LYS B 1 516 ? -9.418  11.431  -19.407 1.00 79.33  ? 516  LYS B CD  1 
ATOM   8192 C CE  . LYS B 1 516 ? -8.313  10.365  -19.478 1.00 89.91  ? 516  LYS B CE  1 
ATOM   8193 N NZ  . LYS B 1 516 ? -7.335  10.409  -18.332 1.00 83.46  ? 516  LYS B NZ  1 
ATOM   8194 N N   . PRO B 1 517 ? -10.589 15.010  -23.527 1.00 60.60  ? 517  PRO B N   1 
ATOM   8195 C CA  . PRO B 1 517 ? -10.081 16.176  -24.273 1.00 61.01  ? 517  PRO B CA  1 
ATOM   8196 C C   . PRO B 1 517 ? -8.561  16.375  -24.097 1.00 55.72  ? 517  PRO B C   1 
ATOM   8197 O O   . PRO B 1 517 ? -7.960  15.773  -23.182 1.00 51.79  ? 517  PRO B O   1 
ATOM   8198 C CB  . PRO B 1 517 ? -10.845 17.355  -23.652 1.00 56.71  ? 517  PRO B CB  1 
ATOM   8199 C CG  . PRO B 1 517 ? -12.104 16.740  -23.117 1.00 51.51  ? 517  PRO B CG  1 
ATOM   8200 C CD  . PRO B 1 517 ? -11.717 15.355  -22.642 1.00 55.05  ? 517  PRO B CD  1 
ATOM   8201 N N   . LEU B 1 518 ? -7.950  17.179  -24.973 1.00 46.45  ? 518  LEU B N   1 
ATOM   8202 C CA  . LEU B 1 518 ? -6.506  17.424  -24.912 1.00 48.58  ? 518  LEU B CA  1 
ATOM   8203 C C   . LEU B 1 518 ? -6.084  17.842  -23.519 1.00 54.65  ? 518  LEU B C   1 
ATOM   8204 O O   . LEU B 1 518 ? -6.716  18.700  -22.885 1.00 55.87  ? 518  LEU B O   1 
ATOM   8205 C CB  . LEU B 1 518 ? -6.062  18.529  -25.880 1.00 46.16  ? 518  LEU B CB  1 
ATOM   8206 C CG  . LEU B 1 518 ? -5.832  18.208  -27.354 1.00 46.21  ? 518  LEU B CG  1 
ATOM   8207 C CD1 . LEU B 1 518 ? -5.297  19.441  -28.094 1.00 44.84  ? 518  LEU B CD1 1 
ATOM   8208 C CD2 . LEU B 1 518 ? -4.896  17.013  -27.511 1.00 43.80  ? 518  LEU B CD2 1 
ATOM   8209 N N   . GLU B 1 519 ? -5.007  17.234  -23.051 1.00 46.35  ? 519  GLU B N   1 
ATOM   8210 C CA  . GLU B 1 519 ? -4.418  17.613  -21.783 1.00 56.86  ? 519  GLU B CA  1 
ATOM   8211 C C   . GLU B 1 519 ? -2.959  18.000  -22.060 1.00 51.77  ? 519  GLU B C   1 
ATOM   8212 O O   . GLU B 1 519 ? -2.204  17.227  -22.645 1.00 56.29  ? 519  GLU B O   1 
ATOM   8213 C CB  . GLU B 1 519 ? -4.537  16.445  -20.794 1.00 53.79  ? 519  GLU B CB  1 
ATOM   8214 C CG  . GLU B 1 519 ? -3.720  16.579  -19.538 1.00 56.96  ? 519  GLU B CG  1 
ATOM   8215 C CD  . GLU B 1 519 ? -3.788  15.322  -18.690 1.00 75.18  ? 519  GLU B CD  1 
ATOM   8216 O OE1 . GLU B 1 519 ? -4.914  14.773  -18.556 1.00 79.00  ? 519  GLU B OE1 1 
ATOM   8217 O OE2 . GLU B 1 519 ? -2.722  14.883  -18.170 1.00 57.49  ? 519  GLU B OE2 1 
ATOM   8218 N N   . VAL B 1 520 ? -2.567  19.205  -21.675 1.00 44.38  ? 520  VAL B N   1 
ATOM   8219 C CA  . VAL B 1 520 ? -1.198  19.641  -21.910 1.00 47.41  ? 520  VAL B CA  1 
ATOM   8220 C C   . VAL B 1 520 ? -0.265  19.163  -20.786 1.00 40.99  ? 520  VAL B C   1 
ATOM   8221 O O   . VAL B 1 520 ? -0.567  19.341  -19.610 1.00 47.12  ? 520  VAL B O   1 
ATOM   8222 C CB  . VAL B 1 520 ? -1.119  21.177  -22.065 1.00 40.95  ? 520  VAL B CB  1 
ATOM   8223 C CG1 . VAL B 1 520 ? 0.329   21.615  -22.292 1.00 40.83  ? 520  VAL B CG1 1 
ATOM   8224 C CG2 . VAL B 1 520 ? -2.035  21.652  -23.217 1.00 39.31  ? 520  VAL B CG2 1 
ATOM   8225 N N   . ARG B 1 521 ? 0.854   18.534  -21.154 1.00 40.96  ? 521  ARG B N   1 
ATOM   8226 C CA  . ARG B 1 521 ? 1.860   18.107  -20.180 1.00 41.22  ? 521  ARG B CA  1 
ATOM   8227 C C   . ARG B 1 521 ? 3.213   18.747  -20.461 1.00 42.18  ? 521  ARG B C   1 
ATOM   8228 O O   . ARG B 1 521 ? 3.419   19.356  -21.514 1.00 43.92  ? 521  ARG B O   1 
ATOM   8229 C CB  . ARG B 1 521 ? 2.002   16.589  -20.163 1.00 44.90  ? 521  ARG B CB  1 
ATOM   8230 C CG  . ARG B 1 521 ? 0.681   15.885  -20.067 1.00 46.75  ? 521  ARG B CG  1 
ATOM   8231 C CD  . ARG B 1 521 ? 0.797   14.444  -19.622 1.00 49.14  ? 521  ARG B CD  1 
ATOM   8232 N NE  . ARG B 1 521 ? -0.538  13.853  -19.661 1.00 58.31  ? 521  ARG B NE  1 
ATOM   8233 C CZ  . ARG B 1 521 ? -0.808  12.617  -20.061 1.00 55.72  ? 521  ARG B CZ  1 
ATOM   8234 N NH1 . ARG B 1 521 ? 0.178   11.808  -20.441 1.00 45.16  ? 521  ARG B NH1 1 
ATOM   8235 N NH2 . ARG B 1 521 ? -2.071  12.196  -20.076 1.00 50.33  ? 521  ARG B NH2 1 
ATOM   8236 N N   . ARG B 1 522 ? 4.139   18.609  -19.519 1.00 46.07  ? 522  ARG B N   1 
ATOM   8237 C CA  . ARG B 1 522 ? 5.444   19.244  -19.661 1.00 47.37  ? 522  ARG B CA  1 
ATOM   8238 C C   . ARG B 1 522 ? 6.575   18.256  -19.438 1.00 49.32  ? 522  ARG B C   1 
ATOM   8239 O O   . ARG B 1 522 ? 6.574   17.502  -18.455 1.00 51.81  ? 522  ARG B O   1 
ATOM   8240 C CB  . ARG B 1 522 ? 5.577   20.452  -18.723 1.00 43.76  ? 522  ARG B CB  1 
ATOM   8241 C CG  . ARG B 1 522 ? 4.715   21.642  -19.139 1.00 44.52  ? 522  ARG B CG  1 
ATOM   8242 C CD  . ARG B 1 522 ? 4.825   22.834  -18.184 1.00 52.90  ? 522  ARG B CD  1 
ATOM   8243 N NE  . ARG B 1 522 ? 6.162   23.435  -18.150 1.00 61.50  ? 522  ARG B NE  1 
ATOM   8244 C CZ  . ARG B 1 522 ? 6.437   24.639  -17.645 1.00 57.57  ? 522  ARG B CZ  1 
ATOM   8245 N NH1 . ARG B 1 522 ? 5.461   25.388  -17.141 1.00 52.96  ? 522  ARG B NH1 1 
ATOM   8246 N NH2 . ARG B 1 522 ? 7.690   25.100  -17.652 1.00 56.79  ? 522  ARG B NH2 1 
ATOM   8247 N N   . GLY B 1 523 ? 7.532   18.253  -20.364 1.00 47.92  ? 523  GLY B N   1 
ATOM   8248 C CA  . GLY B 1 523 ? 8.694   17.388  -20.248 1.00 48.13  ? 523  GLY B CA  1 
ATOM   8249 C C   . GLY B 1 523 ? 8.421   15.980  -20.727 1.00 46.85  ? 523  GLY B C   1 
ATOM   8250 O O   . GLY B 1 523 ? 7.612   15.267  -20.150 1.00 56.86  ? 523  GLY B O   1 
ATOM   8251 N N   . LEU B 1 524 ? 9.101   15.582  -21.793 1.00 53.10  ? 524  LEU B N   1 
ATOM   8252 C CA  . LEU B 1 524 ? 8.928   14.259  -22.368 1.00 50.60  ? 524  LEU B CA  1 
ATOM   8253 C C   . LEU B 1 524 ? 9.971   13.317  -21.795 1.00 52.48  ? 524  LEU B C   1 
ATOM   8254 O O   . LEU B 1 524 ? 11.104  13.248  -22.319 1.00 52.54  ? 524  LEU B O   1 
ATOM   8255 C CB  . LEU B 1 524 ? 9.085   14.346  -23.879 1.00 57.31  ? 524  LEU B CB  1 
ATOM   8256 C CG  . LEU B 1 524 ? 7.973   13.653  -24.650 1.00 62.45  ? 524  LEU B CG  1 
ATOM   8257 C CD1 . LEU B 1 524 ? 7.476   14.568  -25.768 1.00 61.03  ? 524  LEU B CD1 1 
ATOM   8258 C CD2 . LEU B 1 524 ? 8.499   12.349  -25.203 1.00 60.70  ? 524  LEU B CD2 1 
ATOM   8259 N N   . ARG B 1 525 ? 9.593   12.600  -20.729 1.00 51.65  ? 525  ARG B N   1 
ATOM   8260 C CA  . ARG B 1 525 ? 10.522  11.736  -19.994 1.00 50.29  ? 525  ARG B CA  1 
ATOM   8261 C C   . ARG B 1 525 ? 11.818  12.483  -19.686 1.00 53.03  ? 525  ARG B C   1 
ATOM   8262 O O   . ARG B 1 525 ? 12.911  11.971  -19.981 1.00 52.96  ? 525  ARG B O   1 
ATOM   8263 C CB  . ARG B 1 525 ? 10.874  10.502  -20.825 1.00 53.51  ? 525  ARG B CB  1 
ATOM   8264 C CG  . ARG B 1 525 ? 9.713   9.635   -21.185 1.00 49.18  ? 525  ARG B CG  1 
ATOM   8265 C CD  . ARG B 1 525 ? 9.483   8.620   -20.105 1.00 63.51  ? 525  ARG B CD  1 
ATOM   8266 N NE  . ARG B 1 525 ? 9.232   7.291   -20.666 1.00 68.68  ? 525  ARG B NE  1 
ATOM   8267 C CZ  . ARG B 1 525 ? 8.067   6.902   -21.180 1.00 63.29  ? 525  ARG B CZ  1 
ATOM   8268 N NH1 . ARG B 1 525 ? 7.034   7.748   -21.223 1.00 67.05  ? 525  ARG B NH1 1 
ATOM   8269 N NH2 . ARG B 1 525 ? 7.932   5.667   -21.654 1.00 59.78  ? 525  ARG B NH2 1 
ATOM   8270 N N   . ALA B 1 526 ? 11.715  13.680  -19.109 1.00 46.97  ? 526  ALA B N   1 
ATOM   8271 C CA  . ALA B 1 526 ? 12.861  14.591  -19.118 1.00 41.68  ? 526  ALA B CA  1 
ATOM   8272 C C   . ALA B 1 526 ? 14.046  14.109  -18.284 1.00 46.79  ? 526  ALA B C   1 
ATOM   8273 O O   . ALA B 1 526 ? 15.202  14.309  -18.678 1.00 53.94  ? 526  ALA B O   1 
ATOM   8274 C CB  . ALA B 1 526 ? 12.447  16.002  -18.728 1.00 45.19  ? 526  ALA B CB  1 
ATOM   8275 N N   . GLN B 1 527 ? 13.771  13.482  -17.141 1.00 45.67  ? 527  GLN B N   1 
ATOM   8276 C CA  . GLN B 1 527 ? 14.847  12.975  -16.283 1.00 48.82  ? 527  GLN B CA  1 
ATOM   8277 C C   . GLN B 1 527 ? 15.530  11.804  -16.957 1.00 46.67  ? 527  GLN B C   1 
ATOM   8278 O O   . GLN B 1 527 ? 16.761  11.751  -17.044 1.00 44.22  ? 527  GLN B O   1 
ATOM   8279 C CB  . GLN B 1 527 ? 14.317  12.565  -14.899 1.00 48.96  ? 527  GLN B CB  1 
ATOM   8280 C CG  . GLN B 1 527 ? 13.984  13.735  -13.992 1.00 51.49  ? 527  GLN B CG  1 
ATOM   8281 C CD  . GLN B 1 527 ? 15.092  14.794  -13.967 1.00 57.99  ? 527  GLN B CD  1 
ATOM   8282 O OE1 . GLN B 1 527 ? 14.931  15.899  -14.515 1.00 52.83  ? 527  GLN B OE1 1 
ATOM   8283 N NE2 . GLN B 1 527 ? 16.218  14.461  -13.320 1.00 51.79  ? 527  GLN B NE2 1 
ATOM   8284 N N   . THR B 1 528 ? 14.706  10.883  -17.452 1.00 49.75  ? 528  THR B N   1 
ATOM   8285 C CA  . THR B 1 528 ? 15.172  9.681   -18.128 1.00 44.28  ? 528  THR B CA  1 
ATOM   8286 C C   . THR B 1 528 ? 15.812  9.979   -19.499 1.00 49.00  ? 528  THR B C   1 
ATOM   8287 O O   . THR B 1 528 ? 16.796  9.337   -19.881 1.00 46.98  ? 528  THR B O   1 
ATOM   8288 C CB  . THR B 1 528 ? 14.017  8.666   -18.256 1.00 56.96  ? 528  THR B CB  1 
ATOM   8289 O OG1 . THR B 1 528 ? 13.732  8.113   -16.957 1.00 57.08  ? 528  THR B OG1 1 
ATOM   8290 C CG2 . THR B 1 528 ? 14.356  7.539   -19.257 1.00 41.77  ? 528  THR B CG2 1 
ATOM   8291 N N   . CYS B 1 529 ? 15.294  10.962  -20.232 1.00 44.02  ? 529  CYS B N   1 
ATOM   8292 C CA  . CYS B 1 529 ? 15.934  11.282  -21.501 1.00 45.08  ? 529  CYS B CA  1 
ATOM   8293 C C   . CYS B 1 529 ? 17.276  11.995  -21.330 1.00 47.77  ? 529  CYS B C   1 
ATOM   8294 O O   . CYS B 1 529 ? 18.143  11.870  -22.198 1.00 47.14  ? 529  CYS B O   1 
ATOM   8295 C CB  . CYS B 1 529 ? 14.979  11.990  -22.483 1.00 46.66  ? 529  CYS B CB  1 
ATOM   8296 S SG  . CYS B 1 529 ? 13.769  10.811  -23.222 1.00 67.07  ? 529  CYS B SG  1 
ATOM   8297 N N   . ALA B 1 530 ? 17.468  12.700  -20.208 1.00 43.01  ? 530  ALA B N   1 
ATOM   8298 C CA  . ALA B 1 530 ? 18.793  13.269  -19.885 1.00 50.05  ? 530  ALA B CA  1 
ATOM   8299 C C   . ALA B 1 530 ? 19.827  12.155  -19.734 1.00 47.79  ? 530  ALA B C   1 
ATOM   8300 O O   . ALA B 1 530 ? 20.966  12.291  -20.183 1.00 48.48  ? 530  ALA B O   1 
ATOM   8301 C CB  . ALA B 1 530 ? 18.751  14.133  -18.626 1.00 45.44  ? 530  ALA B CB  1 
ATOM   8302 N N   . PHE B 1 531 ? 19.416  11.051  -19.112 1.00 44.34  ? 531  PHE B N   1 
ATOM   8303 C CA  . PHE B 1 531 ? 20.263  9.868   -18.988 1.00 47.57  ? 531  PHE B CA  1 
ATOM   8304 C C   . PHE B 1 531 ? 20.682  9.312   -20.346 1.00 45.32  ? 531  PHE B C   1 
ATOM   8305 O O   . PHE B 1 531 ? 21.860  9.055   -20.580 1.00 49.96  ? 531  PHE B O   1 
ATOM   8306 C CB  . PHE B 1 531 ? 19.544  8.779   -18.173 1.00 48.96  ? 531  PHE B CB  1 
ATOM   8307 C CG  . PHE B 1 531 ? 20.253  7.451   -18.163 1.00 48.48  ? 531  PHE B CG  1 
ATOM   8308 C CD1 . PHE B 1 531 ? 21.451  7.288   -17.480 1.00 55.00  ? 531  PHE B CD1 1 
ATOM   8309 C CD2 . PHE B 1 531 ? 19.715  6.359   -18.829 1.00 54.19  ? 531  PHE B CD2 1 
ATOM   8310 C CE1 . PHE B 1 531 ? 22.103  6.057   -17.469 1.00 57.04  ? 531  PHE B CE1 1 
ATOM   8311 C CE2 . PHE B 1 531 ? 20.362  5.123   -18.821 1.00 50.62  ? 531  PHE B CE2 1 
ATOM   8312 C CZ  . PHE B 1 531 ? 21.556  4.975   -18.139 1.00 52.05  ? 531  PHE B CZ  1 
ATOM   8313 N N   . TRP B 1 532 ? 19.710  9.122   -21.233 1.00 46.61  ? 532  TRP B N   1 
ATOM   8314 C CA  . TRP B 1 532 ? 19.969  8.552   -22.552 1.00 49.33  ? 532  TRP B CA  1 
ATOM   8315 C C   . TRP B 1 532 ? 20.710  9.511   -23.469 1.00 47.51  ? 532  TRP B C   1 
ATOM   8316 O O   . TRP B 1 532 ? 21.625  9.104   -24.174 1.00 49.27  ? 532  TRP B O   1 
ATOM   8317 C CB  . TRP B 1 532 ? 18.663  8.104   -23.225 1.00 47.85  ? 532  TRP B CB  1 
ATOM   8318 C CG  . TRP B 1 532 ? 18.097  6.827   -22.664 1.00 46.83  ? 532  TRP B CG  1 
ATOM   8319 C CD1 . TRP B 1 532 ? 16.975  6.691   -21.901 1.00 45.62  ? 532  TRP B CD1 1 
ATOM   8320 C CD2 . TRP B 1 532 ? 18.640  5.505   -22.817 1.00 41.71  ? 532  TRP B CD2 1 
ATOM   8321 N NE1 . TRP B 1 532 ? 16.778  5.366   -21.579 1.00 45.63  ? 532  TRP B NE1 1 
ATOM   8322 C CE2 . TRP B 1 532 ? 17.788  4.617   -22.126 1.00 34.40  ? 532  TRP B CE2 1 
ATOM   8323 C CE3 . TRP B 1 532 ? 19.765  4.989   -23.470 1.00 44.10  ? 532  TRP B CE3 1 
ATOM   8324 C CZ2 . TRP B 1 532 ? 18.020  3.234   -22.071 1.00 39.60  ? 532  TRP B CZ2 1 
ATOM   8325 C CZ3 . TRP B 1 532 ? 19.998  3.609   -23.420 1.00 43.24  ? 532  TRP B CZ3 1 
ATOM   8326 C CH2 . TRP B 1 532 ? 19.127  2.751   -22.723 1.00 42.13  ? 532  TRP B CH2 1 
ATOM   8327 N N   . ASN B 1 533 ? 20.328  10.784  -23.450 1.00 50.09  ? 533  ASN B N   1 
ATOM   8328 C CA  . ASN B 1 533 ? 20.874  11.745  -24.410 1.00 46.47  ? 533  ASN B CA  1 
ATOM   8329 C C   . ASN B 1 533 ? 22.125  12.488  -23.952 1.00 48.98  ? 533  ASN B C   1 
ATOM   8330 O O   . ASN B 1 533 ? 22.914  12.946  -24.777 1.00 50.36  ? 533  ASN B O   1 
ATOM   8331 C CB  . ASN B 1 533 ? 19.803  12.755  -24.848 1.00 47.48  ? 533  ASN B CB  1 
ATOM   8332 C CG  . ASN B 1 533 ? 18.617  12.090  -25.527 1.00 50.55  ? 533  ASN B CG  1 
ATOM   8333 O OD1 . ASN B 1 533 ? 18.740  11.006  -26.098 1.00 54.81  ? 533  ASN B OD1 1 
ATOM   8334 N ND2 . ASN B 1 533 ? 17.461  12.730  -25.452 1.00 49.09  ? 533  ASN B ND2 1 
ATOM   8335 N N   . ARG B 1 534 ? 22.320  12.609  -22.645 1.00 54.66  ? 534  ARG B N   1 
ATOM   8336 C CA  . ARG B 1 534 ? 23.471  13.356  -22.156 1.00 54.24  ? 534  ARG B CA  1 
ATOM   8337 C C   . ARG B 1 534 ? 24.535  12.482  -21.513 1.00 56.18  ? 534  ARG B C   1 
ATOM   8338 O O   . ARG B 1 534 ? 25.728  12.666  -21.763 1.00 58.16  ? 534  ARG B O   1 
ATOM   8339 C CB  . ARG B 1 534 ? 23.034  14.449  -21.182 1.00 53.68  ? 534  ARG B CB  1 
ATOM   8340 C CG  . ARG B 1 534 ? 22.214  15.532  -21.830 1.00 52.21  ? 534  ARG B CG  1 
ATOM   8341 C CD  . ARG B 1 534 ? 21.718  16.522  -20.808 1.00 50.29  ? 534  ARG B CD  1 
ATOM   8342 N NE  . ARG B 1 534 ? 20.564  17.244  -21.332 1.00 67.52  ? 534  ARG B NE  1 
ATOM   8343 C CZ  . ARG B 1 534 ? 20.586  18.521  -21.703 1.00 68.16  ? 534  ARG B CZ  1 
ATOM   8344 N NH1 . ARG B 1 534 ? 21.710  19.226  -21.588 1.00 63.37  ? 534  ARG B NH1 1 
ATOM   8345 N NH2 . ARG B 1 534 ? 19.481  19.093  -22.177 1.00 55.10  ? 534  ARG B NH2 1 
ATOM   8346 N N   . PHE B 1 535 ? 24.113  11.534  -20.684 1.00 53.88  ? 535  PHE B N   1 
ATOM   8347 C CA  . PHE B 1 535 ? 25.077  10.827  -19.864 1.00 52.27  ? 535  PHE B CA  1 
ATOM   8348 C C   . PHE B 1 535 ? 25.606  9.569   -20.526 1.00 53.19  ? 535  PHE B C   1 
ATOM   8349 O O   . PHE B 1 535 ? 26.815  9.345   -20.574 1.00 58.52  ? 535  PHE B O   1 
ATOM   8350 C CB  . PHE B 1 535 ? 24.500  10.501  -18.494 1.00 51.41  ? 535  PHE B CB  1 
ATOM   8351 C CG  . PHE B 1 535 ? 25.448  9.738   -17.630 1.00 54.14  ? 535  PHE B CG  1 
ATOM   8352 C CD1 . PHE B 1 535 ? 26.581  10.354  -17.107 1.00 51.04  ? 535  PHE B CD1 1 
ATOM   8353 C CD2 . PHE B 1 535 ? 25.228  8.394   -17.363 1.00 46.16  ? 535  PHE B CD2 1 
ATOM   8354 C CE1 . PHE B 1 535 ? 27.469  9.643   -16.320 1.00 48.02  ? 535  PHE B CE1 1 
ATOM   8355 C CE2 . PHE B 1 535 ? 26.106  7.683   -16.579 1.00 51.57  ? 535  PHE B CE2 1 
ATOM   8356 C CZ  . PHE B 1 535 ? 27.229  8.305   -16.052 1.00 50.48  ? 535  PHE B CZ  1 
ATOM   8357 N N   . LEU B 1 536 ? 24.697  8.752   -21.036 1.00 48.94  ? 536  LEU B N   1 
ATOM   8358 C CA  . LEU B 1 536 ? 25.072  7.489   -21.676 1.00 59.44  ? 536  LEU B CA  1 
ATOM   8359 C C   . LEU B 1 536 ? 26.182  7.584   -22.740 1.00 62.38  ? 536  LEU B C   1 
ATOM   8360 O O   . LEU B 1 536 ? 27.067  6.732   -22.763 1.00 63.60  ? 536  LEU B O   1 
ATOM   8361 C CB  . LEU B 1 536 ? 23.833  6.767   -22.220 1.00 58.23  ? 536  LEU B CB  1 
ATOM   8362 C CG  . LEU B 1 536 ? 23.526  5.405   -21.596 1.00 61.53  ? 536  LEU B CG  1 
ATOM   8363 C CD1 . LEU B 1 536 ? 23.835  4.325   -22.610 1.00 60.92  ? 536  LEU B CD1 1 
ATOM   8364 C CD2 . LEU B 1 536 ? 24.321  5.186   -20.305 1.00 61.15  ? 536  LEU B CD2 1 
ATOM   8365 N N   . PRO B 1 537 ? 26.142  8.609   -23.621 1.00 59.69  ? 537  PRO B N   1 
ATOM   8366 C CA  . PRO B 1 537 ? 27.293  8.811   -24.514 1.00 62.01  ? 537  PRO B CA  1 
ATOM   8367 C C   . PRO B 1 537 ? 28.640  8.933   -23.783 1.00 72.08  ? 537  PRO B C   1 
ATOM   8368 O O   . PRO B 1 537 ? 29.574  8.201   -24.132 1.00 76.21  ? 537  PRO B O   1 
ATOM   8369 C CB  . PRO B 1 537 ? 26.963  10.136  -25.205 1.00 60.94  ? 537  PRO B CB  1 
ATOM   8370 C CG  . PRO B 1 537 ? 25.482  10.160  -25.254 1.00 57.00  ? 537  PRO B CG  1 
ATOM   8371 C CD  . PRO B 1 537 ? 25.017  9.500   -23.977 1.00 59.70  ? 537  PRO B CD  1 
ATOM   8372 N N   . LYS B 1 538 ? 28.731  9.834   -22.800 1.00 70.82  ? 538  LYS B N   1 
ATOM   8373 C CA  . LYS B 1 538 ? 29.965  10.047  -22.033 1.00 66.78  ? 538  LYS B CA  1 
ATOM   8374 C C   . LYS B 1 538 ? 30.514  8.754   -21.439 1.00 70.64  ? 538  LYS B C   1 
ATOM   8375 O O   . LYS B 1 538 ? 31.729  8.565   -21.343 1.00 79.71  ? 538  LYS B O   1 
ATOM   8376 C CB  . LYS B 1 538 ? 29.745  11.081  -20.922 1.00 67.68  ? 538  LYS B CB  1 
ATOM   8377 C CG  . LYS B 1 538 ? 29.990  12.523  -21.349 1.00 74.01  ? 538  LYS B CG  1 
ATOM   8378 C CD  . LYS B 1 538 ? 29.610  13.515  -20.255 1.00 82.09  ? 538  LYS B CD  1 
ATOM   8379 C CE  . LYS B 1 538 ? 30.393  14.820  -20.398 1.00 97.33  ? 538  LYS B CE  1 
ATOM   8380 N NZ  . LYS B 1 538 ? 31.744  14.762  -19.752 1.00 94.43  ? 538  LYS B NZ  1 
ATOM   8381 N N   . LEU B 1 539 ? 29.607  7.865   -21.053 1.00 64.64  ? 539  LEU B N   1 
ATOM   8382 C CA  . LEU B 1 539 ? 29.970  6.592   -20.439 1.00 74.77  ? 539  LEU B CA  1 
ATOM   8383 C C   . LEU B 1 539 ? 30.610  5.624   -21.429 1.00 84.73  ? 539  LEU B C   1 
ATOM   8384 O O   . LEU B 1 539 ? 31.680  5.067   -21.174 1.00 91.42  ? 539  LEU B O   1 
ATOM   8385 C CB  . LEU B 1 539 ? 28.724  5.948   -19.842 1.00 67.06  ? 539  LEU B CB  1 
ATOM   8386 C CG  . LEU B 1 539 ? 28.999  4.832   -18.858 1.00 64.47  ? 539  LEU B CG  1 
ATOM   8387 C CD1 . LEU B 1 539 ? 30.091  5.285   -17.911 1.00 76.07  ? 539  LEU B CD1 1 
ATOM   8388 C CD2 . LEU B 1 539 ? 27.731  4.516   -18.092 1.00 68.29  ? 539  LEU B CD2 1 
ATOM   8389 N N   . LEU B 1 540 ? 29.927  5.425   -22.553 1.00 92.86  ? 540  LEU B N   1 
ATOM   8390 C CA  . LEU B 1 540 ? 30.399  4.571   -23.639 1.00 92.34  ? 540  LEU B CA  1 
ATOM   8391 C C   . LEU B 1 540 ? 31.673  5.122   -24.284 1.00 95.37  ? 540  LEU B C   1 
ATOM   8392 O O   . LEU B 1 540 ? 32.530  4.350   -24.723 1.00 100.21 ? 540  LEU B O   1 
ATOM   8393 C CB  . LEU B 1 540 ? 29.292  4.392   -24.687 1.00 82.80  ? 540  LEU B CB  1 
ATOM   8394 C CG  . LEU B 1 540 ? 28.174  3.427   -24.284 1.00 79.05  ? 540  LEU B CG  1 
ATOM   8395 C CD1 . LEU B 1 540 ? 27.040  3.448   -25.300 1.00 71.14  ? 540  LEU B CD1 1 
ATOM   8396 C CD2 . LEU B 1 540 ? 28.741  2.017   -24.125 1.00 77.90  ? 540  LEU B CD2 1 
ATOM   8397 N N   . SER B 1 541 ? 31.791  6.450   -24.334 1.00 84.02  ? 541  SER B N   1 
ATOM   8398 C CA  . SER B 1 541 ? 33.003  7.099   -24.832 1.00 93.02  ? 541  SER B CA  1 
ATOM   8399 C C   . SER B 1 541 ? 34.245  6.658   -24.049 1.00 104.02 ? 541  SER B C   1 
ATOM   8400 O O   . SER B 1 541 ? 35.324  6.474   -24.624 1.00 111.61 ? 541  SER B O   1 
ATOM   8401 C CB  . SER B 1 541 ? 32.869  8.627   -24.781 1.00 90.87  ? 541  SER B CB  1 
ATOM   8402 O OG  . SER B 1 541 ? 33.544  9.176   -23.656 1.00 96.92  ? 541  SER B OG  1 
ATOM   8403 N N   . ALA B 1 542 ? 34.088  6.492   -22.738 1.00 105.72 ? 542  ALA B N   1 
ATOM   8404 C CA  . ALA B 1 542 ? 35.198  6.093   -21.886 1.00 106.93 ? 542  ALA B CA  1 
ATOM   8405 C C   . ALA B 1 542 ? 35.136  4.626   -21.490 1.00 110.51 ? 542  ALA B C   1 
ATOM   8406 O O   . ALA B 1 542 ? 35.086  4.299   -20.303 1.00 104.79 ? 542  ALA B O   1 
ATOM   8407 C CB  . ALA B 1 542 ? 35.282  6.978   -20.644 1.00 94.59  ? 542  ALA B CB  1 
ATOM   8408 N N   . THR B 1 543 ? 35.107  3.745   -22.487 1.00 116.06 ? 543  THR B N   1 
ATOM   8409 C CA  . THR B 1 543 ? 35.702  2.430   -22.303 1.00 124.35 ? 543  THR B CA  1 
ATOM   8410 C C   . THR B 1 543 ? 37.203  2.731   -22.181 1.00 136.42 ? 543  THR B C   1 
ATOM   8411 O O   . THR B 1 543 ? 37.873  3.022   -23.181 1.00 133.10 ? 543  THR B O   1 
ATOM   8412 C CB  . THR B 1 543 ? 35.463  1.464   -23.496 1.00 111.88 ? 543  THR B CB  1 
ATOM   8413 O OG1 . THR B 1 543 ? 36.308  1.810   -24.607 1.00 106.86 ? 543  THR B OG1 1 
ATOM   8414 C CG2 . THR B 1 543 ? 34.012  1.497   -23.937 1.00 105.51 ? 543  THR B CG2 1 
ATOM   8415 O OXT . THR B 1 543 ? 37.783  2.728   -21.085 1.00 131.78 ? 543  THR B OXT 1 
HETATM 8416 C C1  . 1KA C 2 .   ? 45.617  -1.843  7.816   1.00 55.80  ? 1543 1KA A C1  1 
HETATM 8417 O O1  . 1KA C 2 .   ? 46.792  -1.869  8.579   1.00 69.69  ? 1543 1KA A O1  1 
HETATM 8418 C C2  . 1KA C 2 .   ? 44.690  -3.050  7.950   1.00 66.65  ? 1543 1KA A C2  1 
HETATM 8419 O O2  . 1KA C 2 .   ? 43.611  -3.144  7.064   1.00 73.89  ? 1543 1KA A O2  1 
HETATM 8420 C C3  . 1KA C 2 .   ? 43.650  -4.096  6.038   1.00 83.69  ? 1543 1KA A C3  1 
HETATM 8421 C C4  . 1KA C 2 .   ? 42.628  -5.233  6.074   1.00 80.34  ? 1543 1KA A C4  1 
HETATM 8422 O O4  . 1KA C 2 .   ? 42.667  -6.152  5.016   1.00 83.88  ? 1543 1KA A O4  1 
HETATM 8423 C C13 . P15 D 3 .   ? 15.713  11.122  -11.023 1.00 80.91  ? 1544 P15 A C13 1 
HETATM 8424 O O6  . P15 D 3 .   ? 16.703  11.584  -11.907 1.00 83.47  ? 1544 P15 A O6  1 
HETATM 8425 C C12 . P15 D 3 .   ? 17.606  10.676  -12.499 1.00 72.01  ? 1544 P15 A C12 1 
HETATM 8426 C C11 . P15 D 3 .   ? 18.317  11.085  -13.797 1.00 68.14  ? 1544 P15 A C11 1 
HETATM 8427 O O5  . P15 D 3 .   ? 19.522  10.435  -14.120 1.00 78.44  ? 1544 P15 A O5  1 
HETATM 8428 C C10 . P15 D 3 .   ? 20.515  11.058  -14.914 1.00 71.11  ? 1544 P15 A C10 1 
HETATM 8429 C C9  . P15 D 3 .   ? 21.911  10.408  -14.945 1.00 71.75  ? 1544 P15 A C9  1 
HETATM 8430 O O4  . P15 D 3 .   ? 22.240  9.436   -13.965 1.00 74.18  ? 1544 P15 A O4  1 
HETATM 8431 C C8  . P15 D 3 .   ? 23.509  8.813   -13.946 1.00 60.53  ? 1544 P15 A C8  1 
HETATM 8432 C C7  . P15 D 3 .   ? 23.594  7.278   -13.922 1.00 58.13  ? 1544 P15 A C7  1 
HETATM 8433 O O3  . P15 D 3 .   ? 22.859  6.578   -12.948 1.00 66.30  ? 1544 P15 A O3  1 
HETATM 8434 C C6  . P15 D 3 .   ? 22.930  5.172   -12.846 1.00 66.86  ? 1544 P15 A C6  1 
HETATM 8435 C C5  . P15 D 3 .   ? 22.272  4.511   -11.621 1.00 64.25  ? 1544 P15 A C5  1 
HETATM 8436 O O2  . P15 D 3 .   ? 21.107  5.139   -11.138 1.00 73.61  ? 1544 P15 A O2  1 
HETATM 8437 C C4  . P15 D 3 .   ? 20.288  4.595   -10.130 1.00 70.61  ? 1544 P15 A C4  1 
HETATM 8438 C C3  . P15 D 3 .   ? 18.951  5.307   -9.852  1.00 65.69  ? 1544 P15 A C3  1 
HETATM 8439 O O1  . P15 D 3 .   ? 18.666  6.489   -10.567 1.00 71.27  ? 1544 P15 A O1  1 
HETATM 8440 C C2  . P15 D 3 .   ? 17.354  7.001   -10.618 1.00 73.14  ? 1544 P15 A C2  1 
HETATM 8441 C C1  . P15 D 3 .   ? 16.418  6.533   -11.746 1.00 73.94  ? 1544 P15 A C1  1 
HETATM 8442 O OXT . P15 D 3 .   ? 15.028  6.702   -11.610 1.00 74.80  ? 1544 P15 A OXT 1 
HETATM 8443 C C1  . 1KA E 2 .   ? 14.467  16.740  -10.020 1.00 64.09  ? 1545 1KA A C1  1 
HETATM 8444 O O1  . 1KA E 2 .   ? 13.188  16.199  -10.256 1.00 67.15  ? 1545 1KA A O1  1 
HETATM 8445 C C2  . 1KA E 2 .   ? 15.593  15.792  -9.588  1.00 55.36  ? 1545 1KA A C2  1 
HETATM 8446 O O2  . 1KA E 2 .   ? 15.250  14.541  -9.038  1.00 76.29  ? 1545 1KA A O2  1 
HETATM 8447 C C3  . 1KA E 2 .   ? 16.226  13.756  -8.393  1.00 71.72  ? 1545 1KA A C3  1 
HETATM 8448 C C4  . 1KA E 2 .   ? 16.524  14.034  -6.911  1.00 74.78  ? 1545 1KA A C4  1 
HETATM 8449 O O4  . 1KA E 2 .   ? 16.864  15.353  -6.536  1.00 73.78  ? 1545 1KA A O4  1 
HETATM 8450 C C1  . 1KA F 2 .   ? 35.123  24.302  9.402   1.00 70.91  ? 1546 1KA A C1  1 
HETATM 8451 O O1  . 1KA F 2 .   ? 34.339  23.169  9.095   1.00 66.67  ? 1546 1KA A O1  1 
HETATM 8452 C C2  . 1KA F 2 .   ? 36.004  24.865  8.275   1.00 83.86  ? 1546 1KA A C2  1 
HETATM 8453 O O2  . 1KA F 2 .   ? 37.173  25.584  8.583   1.00 83.63  ? 1546 1KA A O2  1 
HETATM 8454 C C3  . 1KA F 2 .   ? 37.497  26.711  7.811   1.00 81.62  ? 1546 1KA A C3  1 
HETATM 8455 C C4  . 1KA F 2 .   ? 38.965  27.037  7.524   1.00 82.31  ? 1546 1KA A C4  1 
HETATM 8456 O O4  . 1KA F 2 .   ? 39.672  27.847  8.432   1.00 89.90  ? 1546 1KA A O4  1 
HETATM 8457 C C1  . 1KA G 2 .   ? 10.830  2.264   -15.063 1.00 77.13  ? 1544 1KA B C1  1 
HETATM 8458 O O1  . 1KA G 2 .   ? 9.556   1.770   -15.418 1.00 78.75  ? 1544 1KA B O1  1 
HETATM 8459 C C2  . 1KA G 2 .   ? 11.140  2.564   -13.589 1.00 75.93  ? 1544 1KA B C2  1 
HETATM 8460 O O2  . 1KA G 2 .   ? 12.035  3.617   -13.297 1.00 78.49  ? 1544 1KA B O2  1 
HETATM 8461 C C3  . 1KA G 2 .   ? 11.960  4.299   -12.074 1.00 65.98  ? 1544 1KA B C3  1 
HETATM 8462 C C4  . 1KA G 2 .   ? 11.741  3.466   -10.807 1.00 70.56  ? 1544 1KA B C4  1 
HETATM 8463 O O4  . 1KA G 2 .   ? 10.664  3.817   -9.975  1.00 71.43  ? 1544 1KA B O4  1 
HETATM 8464 C C1  . 1KA H 2 .   ? 31.965  13.146  -42.161 1.00 83.75  ? 1545 1KA B C1  1 
HETATM 8465 O O1  . 1KA H 2 .   ? 32.225  14.527  -42.253 1.00 82.51  ? 1545 1KA B O1  1 
HETATM 8466 C C2  . 1KA H 2 .   ? 30.994  12.518  -43.168 1.00 74.65  ? 1545 1KA B C2  1 
HETATM 8467 O O2  . 1KA H 2 .   ? 31.133  11.164  -43.507 1.00 74.53  ? 1545 1KA B O2  1 
HETATM 8468 C C3  . 1KA H 2 .   ? 31.213  10.799  -44.861 1.00 73.23  ? 1545 1KA B C3  1 
HETATM 8469 C C4  . 1KA H 2 .   ? 31.764  9.410   -45.211 1.00 72.85  ? 1545 1KA B C4  1 
HETATM 8470 O O4  . 1KA H 2 .   ? 32.408  9.240   -46.450 1.00 58.97  ? 1545 1KA B O4  1 
HETATM 8471 O O   . HOH I 4 .   ? 30.357  18.316  56.294  1.00 68.19  ? 2001 HOH A O   1 
HETATM 8472 O O   . HOH I 4 .   ? 31.995  1.176   46.662  1.00 56.64  ? 2002 HOH A O   1 
HETATM 8473 O O   . HOH I 4 .   ? 39.288  3.914   38.588  1.00 54.81  ? 2003 HOH A O   1 
HETATM 8474 O O   . HOH I 4 .   ? 18.271  13.522  50.137  1.00 58.92  ? 2004 HOH A O   1 
HETATM 8475 O O   . HOH I 4 .   ? 21.764  19.898  48.253  1.00 51.07  ? 2005 HOH A O   1 
HETATM 8476 O O   . HOH I 4 .   ? 24.656  8.915   48.463  1.00 49.10  ? 2006 HOH A O   1 
HETATM 8477 O O   . HOH I 4 .   ? 19.782  11.519  44.149  1.00 72.57  ? 2007 HOH A O   1 
HETATM 8478 O O   . HOH I 4 .   ? 28.676  4.992   47.336  1.00 41.71  ? 2008 HOH A O   1 
HETATM 8479 O O   . HOH I 4 .   ? 29.863  2.732   46.121  1.00 43.35  ? 2009 HOH A O   1 
HETATM 8480 O O   . HOH I 4 .   ? 37.294  3.862   46.222  1.00 44.02  ? 2010 HOH A O   1 
HETATM 8481 O O   . HOH I 4 .   ? 40.357  15.766  39.196  1.00 49.56  ? 2011 HOH A O   1 
HETATM 8482 O O   . HOH I 4 .   ? 43.038  1.672   45.106  1.00 59.26  ? 2012 HOH A O   1 
HETATM 8483 O O   . HOH I 4 .   ? 44.346  0.828   41.344  1.00 61.85  ? 2013 HOH A O   1 
HETATM 8484 O O   . HOH I 4 .   ? 36.797  5.466   39.299  1.00 49.50  ? 2014 HOH A O   1 
HETATM 8485 O O   . HOH I 4 .   ? 38.960  9.239   47.834  1.00 53.95  ? 2015 HOH A O   1 
HETATM 8486 O O   . HOH I 4 .   ? 39.084  9.515   50.806  1.00 65.06  ? 2016 HOH A O   1 
HETATM 8487 O O   . HOH I 4 .   ? 26.802  20.241  46.531  1.00 45.69  ? 2017 HOH A O   1 
HETATM 8488 O O   . HOH I 4 .   ? 23.745  20.777  46.045  1.00 49.54  ? 2018 HOH A O   1 
HETATM 8489 O O   . HOH I 4 .   ? 21.573  22.950  44.434  1.00 64.21  ? 2019 HOH A O   1 
HETATM 8490 O O   . HOH I 4 .   ? 19.951  24.381  39.307  1.00 47.42  ? 2020 HOH A O   1 
HETATM 8491 O O   . HOH I 4 .   ? 32.892  17.595  32.689  1.00 38.21  ? 2021 HOH A O   1 
HETATM 8492 O O   . HOH I 4 .   ? 37.392  17.219  38.622  1.00 48.93  ? 2022 HOH A O   1 
HETATM 8493 O O   . HOH I 4 .   ? 38.026  7.458   37.983  1.00 53.30  ? 2023 HOH A O   1 
HETATM 8494 O O   . HOH I 4 .   ? 38.683  4.729   34.592  1.00 49.18  ? 2024 HOH A O   1 
HETATM 8495 O O   . HOH I 4 .   ? 41.372  13.284  33.732  1.00 43.59  ? 2025 HOH A O   1 
HETATM 8496 O O   . HOH I 4 .   ? 46.028  8.908   29.662  1.00 46.06  ? 2026 HOH A O   1 
HETATM 8497 O O   . HOH I 4 .   ? 46.673  15.401  24.161  1.00 40.91  ? 2027 HOH A O   1 
HETATM 8498 O O   . HOH I 4 .   ? 54.277  19.571  29.205  1.00 65.41  ? 2028 HOH A O   1 
HETATM 8499 O O   . HOH I 4 .   ? 47.360  9.006   27.243  1.00 49.02  ? 2029 HOH A O   1 
HETATM 8500 O O   . HOH I 4 .   ? 53.365  10.053  21.873  1.00 46.74  ? 2030 HOH A O   1 
HETATM 8501 O O   . HOH I 4 .   ? 46.481  13.375  22.569  1.00 38.10  ? 2031 HOH A O   1 
HETATM 8502 O O   . HOH I 4 .   ? 47.624  8.366   17.901  1.00 38.86  ? 2032 HOH A O   1 
HETATM 8503 O O   . HOH I 4 .   ? 50.348  6.152   27.411  1.00 62.90  ? 2033 HOH A O   1 
HETATM 8504 O O   . HOH I 4 .   ? 45.302  10.203  40.825  1.00 61.13  ? 2034 HOH A O   1 
HETATM 8505 O O   . HOH I 4 .   ? 42.697  13.988  35.903  1.00 51.40  ? 2035 HOH A O   1 
HETATM 8506 O O   . HOH I 4 .   ? 40.584  15.392  45.591  1.00 56.39  ? 2036 HOH A O   1 
HETATM 8507 O O   . HOH I 4 .   ? 41.495  9.083   50.867  1.00 60.86  ? 2037 HOH A O   1 
HETATM 8508 O O   . HOH I 4 .   ? 40.011  17.019  47.180  1.00 59.95  ? 2038 HOH A O   1 
HETATM 8509 O O   . HOH I 4 .   ? 38.274  18.256  44.427  1.00 52.93  ? 2039 HOH A O   1 
HETATM 8510 O O   . HOH I 4 .   ? 26.766  24.205  38.703  1.00 59.12  ? 2040 HOH A O   1 
HETATM 8511 O O   . HOH I 4 .   ? 33.562  24.626  35.390  1.00 59.68  ? 2041 HOH A O   1 
HETATM 8512 O O   . HOH I 4 .   ? 29.043  23.598  35.548  1.00 54.80  ? 2042 HOH A O   1 
HETATM 8513 O O   . HOH I 4 .   ? 33.440  19.861  29.274  1.00 41.78  ? 2043 HOH A O   1 
HETATM 8514 O O   . HOH I 4 .   ? 35.832  -3.628  30.832  1.00 52.26  ? 2044 HOH A O   1 
HETATM 8515 O O   . HOH I 4 .   ? 26.805  -7.069  30.450  1.00 67.60  ? 2045 HOH A O   1 
HETATM 8516 O O   . HOH I 4 .   ? 27.920  -6.356  35.280  1.00 51.87  ? 2046 HOH A O   1 
HETATM 8517 O O   . HOH I 4 .   ? 35.685  18.031  24.531  1.00 31.48  ? 2047 HOH A O   1 
HETATM 8518 O O   . HOH I 4 .   ? 41.424  17.352  21.788  1.00 39.16  ? 2048 HOH A O   1 
HETATM 8519 O O   . HOH I 4 .   ? 42.487  17.630  23.991  1.00 53.03  ? 2049 HOH A O   1 
HETATM 8520 O O   . HOH I 4 .   ? 41.981  19.535  18.145  1.00 41.22  ? 2050 HOH A O   1 
HETATM 8521 O O   . HOH I 4 .   ? 48.737  26.910  23.636  1.00 56.35  ? 2051 HOH A O   1 
HETATM 8522 O O   . HOH I 4 .   ? 41.392  27.278  19.680  1.00 53.27  ? 2052 HOH A O   1 
HETATM 8523 O O   . HOH I 4 .   ? 34.812  24.416  18.492  1.00 52.84  ? 2053 HOH A O   1 
HETATM 8524 O O   . HOH I 4 .   ? 40.134  20.945  16.404  1.00 44.29  ? 2054 HOH A O   1 
HETATM 8525 O O   . HOH I 4 .   ? 40.516  27.971  17.193  1.00 57.88  ? 2055 HOH A O   1 
HETATM 8526 O O   . HOH I 4 .   ? 21.686  34.924  17.241  1.00 53.51  ? 2056 HOH A O   1 
HETATM 8527 O O   . HOH I 4 .   ? 24.596  29.989  22.424  1.00 73.87  ? 2057 HOH A O   1 
HETATM 8528 O O   . HOH I 4 .   ? 14.626  -7.802  23.083  1.00 66.11  ? 2058 HOH A O   1 
HETATM 8529 O O   . HOH I 4 .   ? 15.701  -6.199  27.593  1.00 62.87  ? 2059 HOH A O   1 
HETATM 8530 O O   . HOH I 4 .   ? 30.276  26.154  15.532  1.00 54.44  ? 2060 HOH A O   1 
HETATM 8531 O O   . HOH I 4 .   ? 32.492  33.984  18.779  1.00 76.09  ? 2061 HOH A O   1 
HETATM 8532 O O   . HOH I 4 .   ? 39.184  9.281   2.457   1.00 55.08  ? 2062 HOH A O   1 
HETATM 8533 O O   . HOH I 4 .   ? 24.297  24.585  23.412  1.00 42.56  ? 2063 HOH A O   1 
HETATM 8534 O O   . HOH I 4 .   ? 30.200  21.098  19.149  1.00 37.17  ? 2064 HOH A O   1 
HETATM 8535 O O   . HOH I 4 .   ? 44.619  -1.651  3.760   1.00 73.73  ? 2065 HOH A O   1 
HETATM 8536 O O   . HOH I 4 .   ? 41.727  0.539   4.306   1.00 54.24  ? 2066 HOH A O   1 
HETATM 8537 O O   . HOH I 4 .   ? 32.397  24.707  16.827  1.00 53.09  ? 2067 HOH A O   1 
HETATM 8538 O O   . HOH I 4 .   ? 52.957  9.510   3.541   1.00 45.69  ? 2068 HOH A O   1 
HETATM 8539 O O   . HOH I 4 .   ? 44.784  9.293   -3.529  1.00 64.98  ? 2069 HOH A O   1 
HETATM 8540 O O   . HOH I 4 .   ? 53.765  11.908  2.537   1.00 47.77  ? 2070 HOH A O   1 
HETATM 8541 O O   . HOH I 4 .   ? 36.514  28.154  25.716  1.00 48.71  ? 2071 HOH A O   1 
HETATM 8542 O O   . HOH I 4 .   ? 39.585  28.780  26.777  1.00 53.52  ? 2072 HOH A O   1 
HETATM 8543 O O   . HOH I 4 .   ? 46.373  21.959  28.093  1.00 54.64  ? 2073 HOH A O   1 
HETATM 8544 O O   . HOH I 4 .   ? 64.460  4.517   18.112  1.00 75.96  ? 2074 HOH A O   1 
HETATM 8545 O O   . HOH I 4 .   ? 44.398  16.119  24.945  1.00 43.04  ? 2075 HOH A O   1 
HETATM 8546 O O   . HOH I 4 .   ? 48.653  22.029  26.331  1.00 44.69  ? 2076 HOH A O   1 
HETATM 8547 O O   . HOH I 4 .   ? 42.376  14.630  31.587  1.00 43.81  ? 2077 HOH A O   1 
HETATM 8548 O O   . HOH I 4 .   ? 44.338  16.637  36.488  1.00 50.65  ? 2078 HOH A O   1 
HETATM 8549 O O   . HOH I 4 .   ? 53.013  20.220  26.971  1.00 62.58  ? 2079 HOH A O   1 
HETATM 8550 O O   . HOH I 4 .   ? 32.400  17.217  29.878  1.00 38.35  ? 2080 HOH A O   1 
HETATM 8551 O O   . HOH I 4 .   ? 17.261  -1.991  34.396  1.00 55.98  ? 2081 HOH A O   1 
HETATM 8552 O O   . HOH I 4 .   ? 14.439  5.619   37.731  1.00 59.11  ? 2082 HOH A O   1 
HETATM 8553 O O   . HOH I 4 .   ? 19.713  1.329   28.402  1.00 50.99  ? 2083 HOH A O   1 
HETATM 8554 O O   . HOH I 4 .   ? 29.737  12.949  24.922  1.00 35.87  ? 2084 HOH A O   1 
HETATM 8555 O O   . HOH I 4 .   ? 26.365  16.049  18.576  1.00 36.08  ? 2085 HOH A O   1 
HETATM 8556 O O   . HOH I 4 .   ? 29.230  18.666  20.208  1.00 34.08  ? 2086 HOH A O   1 
HETATM 8557 O O   . HOH I 4 .   ? 33.570  15.221  17.382  1.00 30.04  ? 2087 HOH A O   1 
HETATM 8558 O O   . HOH I 4 .   ? 38.545  16.051  12.571  1.00 38.91  ? 2088 HOH A O   1 
HETATM 8559 O O   . HOH I 4 .   ? 31.580  29.237  -7.462  1.00 48.48  ? 2089 HOH A O   1 
HETATM 8560 O O   . HOH I 4 .   ? 31.118  21.655  16.564  1.00 47.27  ? 2090 HOH A O   1 
HETATM 8561 O O   . HOH I 4 .   ? 26.213  15.966  28.426  1.00 40.14  ? 2091 HOH A O   1 
HETATM 8562 O O   . HOH I 4 .   ? 25.448  19.445  29.042  1.00 38.78  ? 2092 HOH A O   1 
HETATM 8563 O O   . HOH I 4 .   ? 25.720  23.322  30.126  1.00 40.40  ? 2093 HOH A O   1 
HETATM 8564 O O   . HOH I 4 .   ? 29.909  26.168  -15.331 1.00 58.30  ? 2094 HOH A O   1 
HETATM 8565 O O   . HOH I 4 .   ? 34.843  23.923  -10.498 1.00 58.12  ? 2095 HOH A O   1 
HETATM 8566 O O   . HOH I 4 .   ? 40.827  11.497  -8.713  1.00 52.43  ? 2096 HOH A O   1 
HETATM 8567 O O   . HOH I 4 .   ? 41.594  12.482  -6.486  1.00 58.40  ? 2097 HOH A O   1 
HETATM 8568 O O   . HOH I 4 .   ? 17.951  15.785  29.427  1.00 39.90  ? 2098 HOH A O   1 
HETATM 8569 O O   . HOH I 4 .   ? 8.660   12.309  28.377  1.00 60.54  ? 2099 HOH A O   1 
HETATM 8570 O O   . HOH I 4 .   ? 11.793  27.146  1.985   1.00 72.34  ? 2100 HOH A O   1 
HETATM 8571 O O   . HOH I 4 .   ? 26.063  -2.247  -2.061  1.00 64.27  ? 2101 HOH A O   1 
HETATM 8572 O O   . HOH I 4 .   ? 15.133  -11.314 7.337   1.00 60.83  ? 2102 HOH A O   1 
HETATM 8573 O O   . HOH I 4 .   ? 44.132  19.571  16.182  1.00 43.93  ? 2103 HOH A O   1 
HETATM 8574 O O   . HOH I 4 .   ? 43.067  8.204   14.199  1.00 41.13  ? 2104 HOH A O   1 
HETATM 8575 O O   . HOH I 4 .   ? 43.566  10.244  11.207  1.00 38.39  ? 2105 HOH A O   1 
HETATM 8576 O O   . HOH I 4 .   ? 46.797  11.230  10.830  1.00 41.63  ? 2106 HOH A O   1 
HETATM 8577 O O   . HOH I 4 .   ? 51.126  3.874   7.494   1.00 61.19  ? 2107 HOH A O   1 
HETATM 8578 O O   . HOH I 4 .   ? 50.271  0.697   16.369  1.00 59.53  ? 2108 HOH A O   1 
HETATM 8579 O O   . HOH I 4 .   ? 53.432  -1.040  19.433  1.00 57.53  ? 2109 HOH A O   1 
HETATM 8580 O O   . HOH I 4 .   ? 50.638  2.464   21.518  1.00 56.42  ? 2110 HOH A O   1 
HETATM 8581 O O   . HOH I 4 .   ? 57.621  4.064   15.986  1.00 59.99  ? 2111 HOH A O   1 
HETATM 8582 O O   . HOH I 4 .   ? 62.652  4.751   21.197  1.00 72.39  ? 2112 HOH A O   1 
HETATM 8583 O O   . HOH I 4 .   ? 45.628  1.912   16.082  1.00 54.13  ? 2113 HOH A O   1 
HETATM 8584 O O   . HOH I 4 .   ? 44.414  2.051   18.468  1.00 57.00  ? 2114 HOH A O   1 
HETATM 8585 O O   . HOH I 4 .   ? 1.623   13.268  22.490  1.00 62.03  ? 2115 HOH A O   1 
HETATM 8586 O O   . HOH I 4 .   ? 4.529   11.336  25.444  1.00 58.90  ? 2116 HOH A O   1 
HETATM 8587 O O   . HOH I 4 .   ? 40.833  -1.382  23.690  1.00 44.64  ? 2117 HOH A O   1 
HETATM 8588 O O   . HOH I 4 .   ? 29.115  0.580   29.850  1.00 41.31  ? 2118 HOH A O   1 
HETATM 8589 O O   . HOH I 4 .   ? 35.181  -2.381  32.983  1.00 53.70  ? 2119 HOH A O   1 
HETATM 8590 O O   . HOH I 4 .   ? 37.506  2.443   34.273  1.00 49.14  ? 2120 HOH A O   1 
HETATM 8591 O O   . HOH I 4 .   ? 28.287  -0.602  37.667  1.00 40.52  ? 2121 HOH A O   1 
HETATM 8592 O O   . HOH I 4 .   ? 27.233  -5.809  32.584  1.00 54.33  ? 2122 HOH A O   1 
HETATM 8593 O O   . HOH I 4 .   ? 32.112  -5.232  31.609  1.00 53.39  ? 2123 HOH A O   1 
HETATM 8594 O O   . HOH I 4 .   ? 32.494  1.031   41.807  1.00 48.14  ? 2124 HOH A O   1 
HETATM 8595 O O   . HOH I 4 .   ? 37.144  2.288   37.088  1.00 44.22  ? 2125 HOH A O   1 
HETATM 8596 O O   . HOH I 4 .   ? 34.131  -1.555  42.108  1.00 51.60  ? 2126 HOH A O   1 
HETATM 8597 O O   . HOH I 4 .   ? 0.671   11.071  18.811  1.00 63.55  ? 2127 HOH A O   1 
HETATM 8598 O O   . HOH I 4 .   ? 14.781  11.818  -3.469  1.00 66.02  ? 2128 HOH A O   1 
HETATM 8599 O O   . HOH I 4 .   ? 21.399  15.593  13.257  1.00 48.69  ? 2129 HOH A O   1 
HETATM 8600 O O   . HOH I 4 .   ? 32.947  -6.568  14.289  1.00 58.87  ? 2130 HOH A O   1 
HETATM 8601 O O   . HOH I 4 .   ? 37.161  -4.001  14.163  1.00 47.61  ? 2131 HOH A O   1 
HETATM 8602 O O   . HOH I 4 .   ? 37.565  -5.618  16.471  1.00 57.20  ? 2132 HOH A O   1 
HETATM 8603 O O   . HOH I 4 .   ? 39.235  -8.465  19.886  1.00 65.26  ? 2133 HOH A O   1 
HETATM 8604 O O   . HOH I 4 .   ? 27.118  -5.148  22.015  1.00 53.08  ? 2134 HOH A O   1 
HETATM 8605 O O   . HOH I 4 .   ? 25.322  -9.145  18.257  1.00 75.75  ? 2135 HOH A O   1 
HETATM 8606 O O   . HOH I 4 .   ? 16.025  -7.059  25.113  1.00 69.16  ? 2136 HOH A O   1 
HETATM 8607 O O   . HOH I 4 .   ? 18.985  12.513  13.468  1.00 37.05  ? 2137 HOH A O   1 
HETATM 8608 O O   . HOH I 4 .   ? 27.463  9.192   7.938   1.00 46.18  ? 2138 HOH A O   1 
HETATM 8609 O O   . HOH I 4 .   ? 33.983  5.503   6.575   1.00 45.00  ? 2139 HOH A O   1 
HETATM 8610 O O   . HOH I 4 .   ? 30.933  8.771   6.828   1.00 47.17  ? 2140 HOH A O   1 
HETATM 8611 O O   . HOH I 4 .   ? 28.250  3.766   2.422   1.00 55.08  ? 2141 HOH A O   1 
HETATM 8612 O O   . HOH I 4 .   ? 31.873  2.896   3.139   1.00 59.69  ? 2142 HOH A O   1 
HETATM 8613 O O   . HOH I 4 .   ? 36.599  6.370   2.922   1.00 61.02  ? 2143 HOH A O   1 
HETATM 8614 O O   . HOH I 4 .   ? 35.911  9.936   0.649   1.00 57.04  ? 2144 HOH A O   1 
HETATM 8615 O O   . HOH I 4 .   ? 37.781  10.356  4.153   1.00 42.83  ? 2145 HOH A O   1 
HETATM 8616 O O   . HOH I 4 .   ? 37.129  13.350  7.053   1.00 40.14  ? 2146 HOH A O   1 
HETATM 8617 O O   . HOH I 4 .   ? 41.144  7.562   2.784   1.00 45.27  ? 2147 HOH A O   1 
HETATM 8618 O O   . HOH I 4 .   ? 43.135  6.806   0.169   1.00 51.52  ? 2148 HOH A O   1 
HETATM 8619 O O   . HOH I 4 .   ? 43.731  1.132   5.799   1.00 52.06  ? 2149 HOH A O   1 
HETATM 8620 O O   . HOH I 4 .   ? 51.170  7.332   2.835   1.00 54.47  ? 2150 HOH A O   1 
HETATM 8621 O O   . HOH I 4 .   ? 45.086  11.837  -1.321  1.00 55.18  ? 2151 HOH A O   1 
HETATM 8622 O O   . HOH I 4 .   ? 46.918  9.239   -0.619  1.00 62.02  ? 2152 HOH A O   1 
HETATM 8623 O O   . HOH I 4 .   ? 52.410  14.188  3.329   1.00 63.19  ? 2153 HOH A O   1 
HETATM 8624 O O   . HOH I 4 .   ? 47.040  18.780  1.388   1.00 53.50  ? 2154 HOH A O   1 
HETATM 8625 O O   . HOH I 4 .   ? 38.420  12.775  4.658   1.00 42.01  ? 2155 HOH A O   1 
HETATM 8626 O O   . HOH I 4 .   ? 63.785  4.563   15.656  1.00 71.00  ? 2156 HOH A O   1 
HETATM 8627 O O   . HOH I 4 .   ? 65.464  6.499   16.971  1.00 66.55  ? 2157 HOH A O   1 
HETATM 8628 O O   . HOH I 4 .   ? 59.841  4.800   11.079  1.00 67.94  ? 2158 HOH A O   1 
HETATM 8629 O O   . HOH I 4 .   ? 54.013  21.201  24.846  1.00 59.74  ? 2159 HOH A O   1 
HETATM 8630 O O   . HOH I 4 .   ? 54.761  23.783  24.432  1.00 57.25  ? 2160 HOH A O   1 
HETATM 8631 O O   . HOH I 4 .   ? 50.302  28.768  15.648  1.00 59.19  ? 2161 HOH A O   1 
HETATM 8632 O O   . HOH I 4 .   ? 40.748  17.333  12.365  1.00 39.91  ? 2162 HOH A O   1 
HETATM 8633 O O   . HOH I 4 .   ? 39.835  19.223  10.553  1.00 56.78  ? 2163 HOH A O   1 
HETATM 8634 O O   . HOH I 4 .   ? 44.065  21.620  -0.860  1.00 63.07  ? 2164 HOH A O   1 
HETATM 8635 O O   . HOH I 4 .   ? 42.027  21.975  1.150   1.00 55.11  ? 2165 HOH A O   1 
HETATM 8636 O O   . HOH I 4 .   ? 38.981  16.407  0.976   1.00 51.81  ? 2166 HOH A O   1 
HETATM 8637 O O   . HOH I 4 .   ? 37.090  20.046  -4.871  1.00 41.83  ? 2167 HOH A O   1 
HETATM 8638 O O   . HOH I 4 .   ? 36.944  22.389  -6.511  1.00 54.58  ? 2168 HOH A O   1 
HETATM 8639 O O   . HOH I 4 .   ? 35.991  20.165  4.404   1.00 40.14  ? 2169 HOH A O   1 
HETATM 8640 O O   . HOH I 4 .   ? 30.751  16.752  1.033   1.00 44.28  ? 2170 HOH A O   1 
HETATM 8641 O O   . HOH I 4 .   ? 32.872  21.232  6.408   1.00 46.20  ? 2171 HOH A O   1 
HETATM 8642 O O   . HOH I 4 .   ? 44.304  11.829  9.243   1.00 44.95  ? 2172 HOH A O   1 
HETATM 8643 O O   . HOH I 4 .   ? 48.423  -0.186  11.178  1.00 65.88  ? 2173 HOH A O   1 
HETATM 8644 O O   . HOH I 4 .   ? 47.840  -4.519  17.117  1.00 54.00  ? 2174 HOH A O   1 
HETATM 8645 O O   . HOH I 4 .   ? 33.824  2.534   4.712   1.00 57.03  ? 2175 HOH A O   1 
HETATM 8646 O O   . HOH I 4 .   ? 33.013  1.563   -1.791  1.00 64.91  ? 2176 HOH A O   1 
HETATM 8647 O O   . HOH I 4 .   ? 18.513  15.458  4.274   1.00 40.96  ? 2177 HOH A O   1 
HETATM 8648 O O   . HOH I 4 .   ? 11.868  23.084  7.189   1.00 59.95  ? 2178 HOH A O   1 
HETATM 8649 O O   . HOH I 4 .   ? 22.293  20.249  7.741   1.00 39.28  ? 2179 HOH A O   1 
HETATM 8650 O O   . HOH I 4 .   ? 18.022  22.286  2.332   1.00 60.35  ? 2180 HOH A O   1 
HETATM 8651 O O   . HOH I 4 .   ? 19.763  18.195  2.757   1.00 48.19  ? 2181 HOH A O   1 
HETATM 8652 O O   . HOH I 4 .   ? 26.166  19.726  6.412   0.70 48.68  ? 2182 HOH A O   1 
HETATM 8653 O O   . HOH I 4 .   ? 29.781  27.694  -6.082  1.00 45.76  ? 2183 HOH A O   1 
HETATM 8654 O O   . HOH I 4 .   ? 20.316  33.717  10.163  1.00 53.83  ? 2184 HOH A O   1 
HETATM 8655 O O   . HOH I 4 .   ? 15.519  31.542  3.476   1.00 53.45  ? 2185 HOH A O   1 
HETATM 8656 O O   . HOH I 4 .   ? 13.519  30.720  0.987   1.00 58.02  ? 2186 HOH A O   1 
HETATM 8657 O O   . HOH I 4 .   ? 27.267  32.693  -11.359 1.00 47.04  ? 2187 HOH A O   1 
HETATM 8658 O O   . HOH I 4 .   ? 25.480  29.714  -14.767 1.00 46.01  ? 2188 HOH A O   1 
HETATM 8659 O O   . HOH I 4 .   ? 26.760  27.441  -16.382 1.00 62.86  ? 2189 HOH A O   1 
HETATM 8660 O O   . HOH I 4 .   ? 31.270  26.056  -12.726 1.00 51.42  ? 2190 HOH A O   1 
HETATM 8661 O O   . HOH I 4 .   ? 30.357  32.138  -6.817  1.00 50.74  ? 2191 HOH A O   1 
HETATM 8662 O O   . HOH I 4 .   ? 30.626  20.048  -11.578 1.00 57.52  ? 2192 HOH A O   1 
HETATM 8663 O O   . HOH I 4 .   ? 34.532  24.064  -7.600  1.00 42.70  ? 2193 HOH A O   1 
HETATM 8664 O O   . HOH I 4 .   ? 35.406  16.627  -7.307  1.00 59.48  ? 2194 HOH A O   1 
HETATM 8665 O O   . HOH I 4 .   ? 39.355  14.027  -7.010  1.00 59.58  ? 2195 HOH A O   1 
HETATM 8666 O O   . HOH I 4 .   ? 35.993  7.770   -13.805 1.00 62.96  ? 2196 HOH A O   1 
HETATM 8667 O O   . HOH I 4 .   ? 36.501  10.865  -15.367 1.00 53.14  ? 2197 HOH A O   1 
HETATM 8668 O O   . HOH I 4 .   ? 20.514  8.099   -12.413 1.00 67.38  ? 2198 HOH A O   1 
HETATM 8669 O O   . HOH I 4 .   ? 12.405  16.790  -14.643 1.00 57.66  ? 2199 HOH A O   1 
HETATM 8670 O O   . HOH I 4 .   ? 13.763  30.151  -8.402  1.00 46.58  ? 2200 HOH A O   1 
HETATM 8671 O O   . HOH I 4 .   ? 12.493  30.592  -3.481  1.00 53.66  ? 2201 HOH A O   1 
HETATM 8672 O O   . HOH I 4 .   ? 12.269  28.507  -1.297  1.00 51.45  ? 2202 HOH A O   1 
HETATM 8673 O O   . HOH I 4 .   ? 17.258  19.820  -0.483  1.00 46.76  ? 2203 HOH A O   1 
HETATM 8674 O O   . HOH I 4 .   ? 17.473  24.299  0.831   1.00 52.28  ? 2204 HOH A O   1 
HETATM 8675 O O   . HOH I 4 .   ? 19.824  15.185  2.094   1.00 42.69  ? 2205 HOH A O   1 
HETATM 8676 O O   . HOH I 4 .   ? 27.546  8.362   -0.117  1.00 41.01  ? 2206 HOH A O   1 
HETATM 8677 O O   . HOH I 4 .   ? 26.814  5.841   1.037   1.00 54.07  ? 2207 HOH A O   1 
HETATM 8678 O O   . HOH I 4 .   ? 23.885  -2.129  -0.449  1.00 72.71  ? 2208 HOH A O   1 
HETATM 8679 O O   . HOH I 4 .   ? 17.718  -11.763 8.160   1.00 52.68  ? 2209 HOH A O   1 
HETATM 8680 O O   . HOH I 4 .   ? 15.084  -5.068  11.620  1.00 50.18  ? 2210 HOH A O   1 
HETATM 8681 O O   . HOH I 4 .   ? 11.558  1.896   11.194  1.00 43.69  ? 2211 HOH A O   1 
HETATM 8682 O O   . HOH I 4 .   ? 8.679   22.077  10.748  1.00 61.99  ? 2212 HOH A O   1 
HETATM 8683 O O   . HOH I 4 .   ? 7.810   19.698  7.815   1.00 67.45  ? 2213 HOH A O   1 
HETATM 8684 O O   . HOH I 4 .   ? 14.578  21.479  14.662  1.00 42.39  ? 2214 HOH A O   1 
HETATM 8685 O O   . HOH I 4 .   ? 6.333   20.420  12.096  1.00 55.94  ? 2215 HOH A O   1 
HETATM 8686 O O   . HOH I 4 .   ? 11.530  28.199  12.670  1.00 53.93  ? 2216 HOH A O   1 
HETATM 8687 O O   . HOH I 4 .   ? 19.802  28.431  16.635  1.00 63.04  ? 2217 HOH A O   1 
HETATM 8688 O O   . HOH I 4 .   ? 13.393  24.577  2.343   1.00 61.72  ? 2218 HOH A O   1 
HETATM 8689 O O   . HOH I 4 .   ? 19.729  20.558  18.797  1.00 48.07  ? 2219 HOH A O   1 
HETATM 8690 O O   . HOH I 4 .   ? 10.499  25.996  26.612  1.00 61.77  ? 2220 HOH A O   1 
HETATM 8691 O O   . HOH I 4 .   ? 16.847  23.868  33.443  1.00 64.68  ? 2221 HOH A O   1 
HETATM 8692 O O   . HOH I 4 .   ? 7.027   26.022  26.749  1.00 50.78  ? 2222 HOH A O   1 
HETATM 8693 O O   . HOH I 4 .   ? 6.819   25.733  15.297  1.00 63.32  ? 2223 HOH A O   1 
HETATM 8694 O O   . HOH I 4 .   ? -0.465  20.633  26.946  1.00 73.50  ? 2224 HOH A O   1 
HETATM 8695 O O   . HOH I 4 .   ? 3.458   13.659  24.639  1.00 56.11  ? 2225 HOH A O   1 
HETATM 8696 O O   . HOH I 4 .   ? 3.215   16.805  18.827  1.00 57.32  ? 2226 HOH A O   1 
HETATM 8697 O O   . HOH I 4 .   ? 5.559   12.127  14.299  1.00 55.65  ? 2227 HOH A O   1 
HETATM 8698 O O   . HOH I 4 .   ? 3.462   7.067   18.579  1.00 57.55  ? 2228 HOH A O   1 
HETATM 8699 O O   . HOH I 4 .   ? 2.434   -0.645  21.469  1.00 81.88  ? 2229 HOH A O   1 
HETATM 8700 O O   . HOH I 4 .   ? 10.009  -2.546  7.133   1.00 57.68  ? 2230 HOH A O   1 
HETATM 8701 O O   . HOH I 4 .   ? 15.417  2.181   2.323   1.00 57.42  ? 2231 HOH A O   1 
HETATM 8702 O O   . HOH I 4 .   ? 8.828   -6.892  6.049   1.00 59.85  ? 2232 HOH A O   1 
HETATM 8703 O O   . HOH I 4 .   ? 4.138   0.495   5.253   1.00 53.96  ? 2233 HOH A O   1 
HETATM 8704 O O   . HOH I 4 .   ? 10.032  10.932  3.618   1.00 55.70  ? 2234 HOH A O   1 
HETATM 8705 O O   . HOH I 4 .   ? 9.770   7.363   1.157   1.00 50.63  ? 2235 HOH A O   1 
HETATM 8706 O O   . HOH I 4 .   ? 12.350  9.073   0.889   1.00 60.49  ? 2236 HOH A O   1 
HETATM 8707 O O   . HOH I 4 .   ? 4.295   19.362  11.527  1.00 71.76  ? 2237 HOH A O   1 
HETATM 8708 O O   . HOH I 4 .   ? 0.369   11.721  10.969  1.00 62.06  ? 2238 HOH A O   1 
HETATM 8709 O O   . HOH I 4 .   ? 2.032   9.146   17.271  1.00 54.32  ? 2239 HOH A O   1 
HETATM 8710 O O   . HOH I 4 .   ? 0.923   5.570   9.171   1.00 57.60  ? 2240 HOH A O   1 
HETATM 8711 O O   . HOH I 4 .   ? 6.115   7.126   1.516   1.00 56.28  ? 2241 HOH A O   1 
HETATM 8712 O O   . HOH I 4 .   ? 12.281  6.088   -1.459  1.00 60.72  ? 2242 HOH A O   1 
HETATM 8713 O O   . HOH I 4 .   ? 14.700  8.506   -4.151  1.00 48.47  ? 2243 HOH A O   1 
HETATM 8714 O O   . HOH I 4 .   ? 11.934  12.823  2.855   1.00 57.59  ? 2244 HOH A O   1 
HETATM 8715 O O   . HOH I 4 .   ? 34.219  -1.118  -8.384  1.00 71.51  ? 2245 HOH A O   1 
HETATM 8716 O O   . HOH I 4 .   ? 39.352  7.941   -13.170 1.00 67.58  ? 2246 HOH A O   1 
HETATM 8717 O O   . HOH I 4 .   ? 30.984  34.551  -3.970  1.00 66.75  ? 2247 HOH A O   1 
HETATM 8718 O O   . HOH I 4 .   ? 26.708  38.529  2.581   1.00 64.23  ? 2248 HOH A O   1 
HETATM 8719 O O   . HOH I 4 .   ? 29.916  38.796  0.960   1.00 69.60  ? 2249 HOH A O   1 
HETATM 8720 O O   . HOH I 4 .   ? 13.886  40.864  25.905  1.00 66.30  ? 2250 HOH A O   1 
HETATM 8721 O O   . HOH I 4 .   ? 13.364  9.224   -13.282 1.00 75.04  ? 2251 HOH A O   1 
HETATM 8722 O O   . HOH I 4 .   ? 16.560  17.594  -5.271  1.00 58.89  ? 2252 HOH A O   1 
HETATM 8723 O O   . HOH J 4 .   ? -9.916  13.016  -60.056 1.00 56.35  ? 2001 HOH B O   1 
HETATM 8724 O O   . HOH J 4 .   ? -11.963 12.703  -58.876 1.00 73.43  ? 2002 HOH B O   1 
HETATM 8725 O O   . HOH J 4 .   ? 0.970   12.597  -71.679 1.00 69.28  ? 2003 HOH B O   1 
HETATM 8726 O O   . HOH J 4 .   ? 0.955   16.871  -65.807 1.00 67.25  ? 2004 HOH B O   1 
HETATM 8727 O O   . HOH J 4 .   ? 1.149   16.400  -69.380 1.00 61.91  ? 2005 HOH B O   1 
HETATM 8728 O O   . HOH J 4 .   ? 4.232   10.574  -65.407 1.00 55.83  ? 2006 HOH B O   1 
HETATM 8729 O O   . HOH J 4 .   ? 4.159   19.361  -64.350 1.00 64.76  ? 2007 HOH B O   1 
HETATM 8730 O O   . HOH J 4 .   ? -0.878  7.060   -72.893 1.00 47.71  ? 2008 HOH B O   1 
HETATM 8731 O O   . HOH J 4 .   ? -7.970  12.840  -69.663 1.00 61.59  ? 2009 HOH B O   1 
HETATM 8732 O O   . HOH J 4 .   ? -12.789 2.236   -63.113 1.00 61.40  ? 2010 HOH B O   1 
HETATM 8733 O O   . HOH J 4 .   ? -15.051 2.668   -61.101 1.00 57.93  ? 2011 HOH B O   1 
HETATM 8734 O O   . HOH J 4 .   ? -21.054 5.574   -54.359 1.00 81.57  ? 2012 HOH B O   1 
HETATM 8735 O O   . HOH J 4 .   ? -2.637  -1.200  -61.330 1.00 59.60  ? 2013 HOH B O   1 
HETATM 8736 O O   . HOH J 4 .   ? 4.961   8.152   -64.285 1.00 46.49  ? 2014 HOH B O   1 
HETATM 8737 O O   . HOH J 4 .   ? 7.628   0.748   -62.132 1.00 45.51  ? 2015 HOH B O   1 
HETATM 8738 O O   . HOH J 4 .   ? 14.907  2.376   -62.015 1.00 48.57  ? 2016 HOH B O   1 
HETATM 8739 O O   . HOH J 4 .   ? 9.002   0.865   -68.451 1.00 50.77  ? 2017 HOH B O   1 
HETATM 8740 O O   . HOH J 4 .   ? 12.383  -1.223  -68.428 1.00 51.37  ? 2018 HOH B O   1 
HETATM 8741 O O   . HOH J 4 .   ? 15.706  -4.720  -56.764 1.00 48.13  ? 2019 HOH B O   1 
HETATM 8742 O O   . HOH J 4 .   ? 16.719  -8.262  -59.943 1.00 55.67  ? 2020 HOH B O   1 
HETATM 8743 O O   . HOH J 4 .   ? 17.046  0.949   -60.334 1.00 55.64  ? 2021 HOH B O   1 
HETATM 8744 O O   . HOH J 4 .   ? 17.592  -3.064  -55.727 1.00 42.50  ? 2022 HOH B O   1 
HETATM 8745 O O   . HOH J 4 .   ? 22.964  0.440   -53.018 1.00 49.03  ? 2023 HOH B O   1 
HETATM 8746 O O   . HOH J 4 .   ? 16.443  0.551   -65.906 1.00 69.72  ? 2024 HOH B O   1 
HETATM 8747 O O   . HOH J 4 .   ? 10.399  9.588   -68.340 1.00 52.16  ? 2025 HOH B O   1 
HETATM 8748 O O   . HOH J 4 .   ? -0.960  0.395   -75.139 1.00 55.05  ? 2026 HOH B O   1 
HETATM 8749 O O   . HOH J 4 .   ? -1.187  6.654   -76.687 1.00 57.71  ? 2027 HOH B O   1 
HETATM 8750 O O   . HOH J 4 .   ? -4.114  -5.889  -56.260 1.00 53.36  ? 2028 HOH B O   1 
HETATM 8751 O O   . HOH J 4 .   ? -6.267  -3.587  -55.372 1.00 53.45  ? 2029 HOH B O   1 
HETATM 8752 O O   . HOH J 4 .   ? 19.298  15.812  -56.656 1.00 68.62  ? 2030 HOH B O   1 
HETATM 8753 O O   . HOH J 4 .   ? 22.856  16.102  -54.667 1.00 66.45  ? 2031 HOH B O   1 
HETATM 8754 O O   . HOH J 4 .   ? -0.586  -6.813  -57.337 1.00 52.14  ? 2032 HOH B O   1 
HETATM 8755 O O   . HOH J 4 .   ? 5.210   -6.275  -60.450 1.00 52.45  ? 2033 HOH B O   1 
HETATM 8756 O O   . HOH J 4 .   ? 0.928   -0.945  -64.020 1.00 65.69  ? 2034 HOH B O   1 
HETATM 8757 O O   . HOH J 4 .   ? 6.706   -2.533  -50.394 1.00 41.94  ? 2035 HOH B O   1 
HETATM 8758 O O   . HOH J 4 .   ? 12.468  -4.668  -51.587 1.00 42.65  ? 2036 HOH B O   1 
HETATM 8759 O O   . HOH J 4 .   ? 14.368  -7.538  -48.528 1.00 51.63  ? 2037 HOH B O   1 
HETATM 8760 O O   . HOH J 4 .   ? 4.338   -5.509  -46.045 1.00 48.59  ? 2038 HOH B O   1 
HETATM 8761 O O   . HOH J 4 .   ? 6.949   -8.494  -44.382 1.00 55.84  ? 2039 HOH B O   1 
HETATM 8762 O O   . HOH J 4 .   ? 13.408  -7.847  -46.082 1.00 45.03  ? 2040 HOH B O   1 
HETATM 8763 O O   . HOH J 4 .   ? 12.229  -11.007 -37.344 1.00 61.29  ? 2041 HOH B O   1 
HETATM 8764 O O   . HOH J 4 .   ? 10.703  -14.896 -45.683 1.00 53.61  ? 2042 HOH B O   1 
HETATM 8765 O O   . HOH J 4 .   ? 3.955   -14.026 -37.436 1.00 70.45  ? 2043 HOH B O   1 
HETATM 8766 O O   . HOH J 4 .   ? -6.092  -13.138 -34.246 1.00 63.23  ? 2044 HOH B O   1 
HETATM 8767 O O   . HOH J 4 .   ? -4.301  -6.877  -33.817 1.00 64.85  ? 2045 HOH B O   1 
HETATM 8768 O O   . HOH J 4 .   ? -1.562  -7.551  -44.401 1.00 49.09  ? 2046 HOH B O   1 
HETATM 8769 O O   . HOH J 4 .   ? -0.100  -12.828 -43.957 1.00 73.09  ? 2047 HOH B O   1 
HETATM 8770 O O   . HOH J 4 .   ? 4.720   -3.646  -42.552 1.00 42.84  ? 2048 HOH B O   1 
HETATM 8771 O O   . HOH J 4 .   ? 29.772  1.117   -36.012 1.00 45.75  ? 2049 HOH B O   1 
HETATM 8772 O O   . HOH J 4 .   ? 6.223   -7.975  -41.119 1.00 55.34  ? 2050 HOH B O   1 
HETATM 8773 O O   . HOH J 4 .   ? 32.115  -2.835  -33.475 1.00 66.83  ? 2051 HOH B O   1 
HETATM 8774 O O   . HOH J 4 .   ? 2.515   -12.521 -46.799 1.00 58.06  ? 2052 HOH B O   1 
HETATM 8775 O O   . HOH J 4 .   ? 34.315  -4.843  -44.486 1.00 52.92  ? 2053 HOH B O   1 
HETATM 8776 O O   . HOH J 4 .   ? 4.051   -16.581 -55.895 1.00 71.70  ? 2054 HOH B O   1 
HETATM 8777 O O   . HOH J 4 .   ? 1.425   -16.710 -58.127 1.00 68.18  ? 2055 HOH B O   1 
HETATM 8778 O O   . HOH J 4 .   ? 4.915   -13.473 -53.323 1.00 56.32  ? 2056 HOH B O   1 
HETATM 8779 O O   . HOH J 4 .   ? 36.630  -11.888 -52.404 1.00 80.76  ? 2057 HOH B O   1 
HETATM 8780 O O   . HOH J 4 .   ? 13.154  -4.496  -55.314 1.00 48.09  ? 2058 HOH B O   1 
HETATM 8781 O O   . HOH J 4 .   ? 8.773   -1.150  -60.662 1.00 42.47  ? 2059 HOH B O   1 
HETATM 8782 O O   . HOH J 4 .   ? 10.233  -6.395  -64.105 1.00 39.26  ? 2060 HOH B O   1 
HETATM 8783 O O   . HOH J 4 .   ? 8.609   -8.519  -63.753 1.00 65.56  ? 2061 HOH B O   1 
HETATM 8784 O O   . HOH J 4 .   ? 6.377   -0.546  -64.606 1.00 51.08  ? 2062 HOH B O   1 
HETATM 8785 O O   . HOH J 4 .   ? 12.415  -8.427  -36.119 1.00 63.95  ? 2063 HOH B O   1 
HETATM 8786 O O   . HOH J 4 .   ? 23.772  17.457  -52.296 1.00 66.71  ? 2064 HOH B O   1 
HETATM 8787 O O   . HOH J 4 .   ? 0.074   19.715  -47.092 1.00 44.55  ? 2065 HOH B O   1 
HETATM 8788 O O   . HOH J 4 .   ? 4.217   4.598   -48.203 1.00 38.14  ? 2066 HOH B O   1 
HETATM 8789 O O   . HOH J 4 .   ? -1.312  -2.338  -18.178 1.00 66.81  ? 2067 HOH B O   1 
HETATM 8790 O O   . HOH J 4 .   ? 4.143   2.209   -40.895 1.00 38.78  ? 2068 HOH B O   1 
HETATM 8791 O O   . HOH J 4 .   ? 4.341   -1.096  -43.295 1.00 42.57  ? 2069 HOH B O   1 
HETATM 8792 O O   . HOH J 4 .   ? 10.346  -0.093  -43.852 1.00 40.37  ? 2070 HOH B O   1 
HETATM 8793 O O   . HOH J 4 .   ? 16.495  -3.229  -42.745 0.50 32.69  ? 2071 HOH B O   1 
HETATM 8794 O O   . HOH J 4 .   ? 8.132   -6.253  -38.006 1.00 90.79  ? 2072 HOH B O   1 
HETATM 8795 O O   . HOH J 4 .   ? 6.567   -5.283  -40.972 1.00 65.21  ? 2073 HOH B O   1 
HETATM 8796 O O   . HOH J 4 .   ? -3.447  0.899   -48.306 1.00 39.33  ? 2074 HOH B O   1 
HETATM 8797 O O   . HOH J 4 .   ? -1.464  3.648   -48.730 1.00 48.07  ? 2075 HOH B O   1 
HETATM 8798 O O   . HOH J 4 .   ? -5.805  -2.527  -48.653 1.00 52.98  ? 2076 HOH B O   1 
HETATM 8799 O O   . HOH J 4 .   ? -3.583  -5.463  -44.629 1.00 54.67  ? 2077 HOH B O   1 
HETATM 8800 O O   . HOH J 4 .   ? -10.205 -2.815  -48.305 1.00 63.33  ? 2078 HOH B O   1 
HETATM 8801 O O   . HOH J 4 .   ? -7.928  7.669   -44.978 1.00 55.64  ? 2079 HOH B O   1 
HETATM 8802 O O   . HOH J 4 .   ? -8.511  20.496  -47.456 1.00 64.10  ? 2080 HOH B O   1 
HETATM 8803 O O   . HOH J 4 .   ? -12.709 14.462  -39.369 1.00 65.36  ? 2081 HOH B O   1 
HETATM 8804 O O   . HOH J 4 .   ? 22.669  16.678  -26.127 1.00 63.29  ? 2082 HOH B O   1 
HETATM 8805 O O   . HOH J 4 .   ? 16.823  -8.577  -48.217 1.00 53.47  ? 2083 HOH B O   1 
HETATM 8806 O O   . HOH J 4 .   ? 20.815  1.186   -51.139 1.00 56.16  ? 2084 HOH B O   1 
HETATM 8807 O O   . HOH J 4 .   ? 21.982  2.132   -47.696 1.00 44.61  ? 2085 HOH B O   1 
HETATM 8808 O O   . HOH J 4 .   ? 25.024  -3.071  -46.688 1.00 44.46  ? 2086 HOH B O   1 
HETATM 8809 O O   . HOH J 4 .   ? 25.552  5.692   -58.455 1.00 62.02  ? 2087 HOH B O   1 
HETATM 8810 O O   . HOH J 4 .   ? 25.150  6.921   -51.547 1.00 59.52  ? 2088 HOH B O   1 
HETATM 8811 O O   . HOH J 4 .   ? -17.203 -9.156  -39.291 1.00 85.88  ? 2089 HOH B O   1 
HETATM 8812 O O   . HOH J 4 .   ? 22.792  7.297   -52.875 1.00 51.28  ? 2090 HOH B O   1 
HETATM 8813 O O   . HOH J 4 .   ? -21.424 -10.275 -39.707 1.00 73.34  ? 2091 HOH B O   1 
HETATM 8814 O O   . HOH J 4 .   ? 15.656  9.850   -56.610 1.00 50.93  ? 2092 HOH B O   1 
HETATM 8815 O O   . HOH J 4 .   ? 18.728  12.559  -55.611 1.00 47.53  ? 2093 HOH B O   1 
HETATM 8816 O O   . HOH J 4 .   ? 21.332  13.331  -52.093 1.00 63.93  ? 2094 HOH B O   1 
HETATM 8817 O O   . HOH J 4 .   ? 6.037   16.771  -53.577 1.00 38.42  ? 2095 HOH B O   1 
HETATM 8818 O O   . HOH J 4 .   ? 1.866   19.170  -60.102 1.00 44.35  ? 2096 HOH B O   1 
HETATM 8819 O O   . HOH J 4 .   ? 2.438   11.567  -17.355 1.00 51.58  ? 2097 HOH B O   1 
HETATM 8820 O O   . HOH J 4 .   ? -4.091  23.643  -20.499 1.00 53.84  ? 2098 HOH B O   1 
HETATM 8821 O O   . HOH J 4 .   ? 2.447   19.702  -16.195 1.00 59.38  ? 2099 HOH B O   1 
HETATM 8822 O O   . HOH J 4 .   ? 3.661   4.197   -33.562 1.00 46.37  ? 2100 HOH B O   1 
HETATM 8823 O O   . HOH J 4 .   ? 22.746  15.686  -46.098 1.00 53.82  ? 2101 HOH B O   1 
HETATM 8824 O O   . HOH J 4 .   ? 22.127  17.368  -48.163 1.00 53.00  ? 2102 HOH B O   1 
HETATM 8825 O O   . HOH J 4 .   ? 10.078  23.873  -50.017 1.00 60.86  ? 2103 HOH B O   1 
HETATM 8826 O O   . HOH J 4 .   ? 11.437  21.741  -46.792 1.00 57.55  ? 2104 HOH B O   1 
HETATM 8827 O O   . HOH J 4 .   ? 5.069   26.003  -46.081 1.00 62.98  ? 2105 HOH B O   1 
HETATM 8828 O O   . HOH J 4 .   ? 3.132   7.884   -32.864 1.00 39.11  ? 2106 HOH B O   1 
HETATM 8829 O O   . HOH J 4 .   ? 13.698  6.764   -33.485 1.00 43.46  ? 2107 HOH B O   1 
HETATM 8830 O O   . HOH J 4 .   ? 20.595  7.555   -36.594 1.00 50.61  ? 2108 HOH B O   1 
HETATM 8831 O O   . HOH J 4 .   ? 17.086  5.599   -34.710 1.00 44.94  ? 2109 HOH B O   1 
HETATM 8832 O O   . HOH J 4 .   ? 19.630  10.333  -30.309 1.00 57.29  ? 2110 HOH B O   1 
HETATM 8833 O O   . HOH J 4 .   ? 22.300  10.099  -32.883 1.00 60.56  ? 2111 HOH B O   1 
HETATM 8834 O O   . HOH J 4 .   ? 22.710  1.283   -36.027 1.00 38.82  ? 2112 HOH B O   1 
HETATM 8835 O O   . HOH J 4 .   ? 24.288  1.931   -32.884 1.00 57.85  ? 2113 HOH B O   1 
HETATM 8836 O O   . HOH J 4 .   ? 19.285  -1.120  -37.311 1.00 41.78  ? 2114 HOH B O   1 
HETATM 8837 O O   . HOH J 4 .   ? 27.184  1.839   -37.449 1.00 49.09  ? 2115 HOH B O   1 
HETATM 8838 O O   . HOH J 4 .   ? 31.731  2.078   -37.001 1.00 62.78  ? 2116 HOH B O   1 
HETATM 8839 O O   . HOH J 4 .   ? 30.008  6.672   -42.252 1.00 48.57  ? 2117 HOH B O   1 
HETATM 8840 O O   . HOH J 4 .   ? 32.412  -2.027  -37.849 1.00 60.63  ? 2118 HOH B O   1 
HETATM 8841 O O   . HOH J 4 .   ? 31.314  -3.537  -35.639 1.00 57.09  ? 2119 HOH B O   1 
HETATM 8842 O O   . HOH J 4 .   ? 32.704  -8.571  -42.950 1.00 52.02  ? 2120 HOH B O   1 
HETATM 8843 O O   . HOH J 4 .   ? 27.894  -10.723 -37.749 1.00 59.31  ? 2121 HOH B O   1 
HETATM 8844 O O   . HOH J 4 .   ? 21.983  -1.452  -36.816 1.00 53.54  ? 2122 HOH B O   1 
HETATM 8845 O O   . HOH J 4 .   ? 34.539  -7.103  -43.231 1.00 54.42  ? 2123 HOH B O   1 
HETATM 8846 O O   . HOH J 4 .   ? 32.783  -16.059 -55.212 1.00 73.94  ? 2124 HOH B O   1 
HETATM 8847 O O   . HOH J 4 .   ? 34.431  -11.856 -53.540 1.00 79.79  ? 2125 HOH B O   1 
HETATM 8848 O O   . HOH J 4 .   ? 36.620  -8.938  -53.561 1.00 77.19  ? 2126 HOH B O   1 
HETATM 8849 O O   . HOH J 4 .   ? 34.542  0.489   -55.349 1.00 66.59  ? 2127 HOH B O   1 
HETATM 8850 O O   . HOH J 4 .   ? 17.385  -5.392  -43.191 0.50 41.94  ? 2128 HOH B O   1 
HETATM 8851 O O   . HOH J 4 .   ? 17.100  -6.691  -40.772 1.00 64.92  ? 2129 HOH B O   1 
HETATM 8852 O O   . HOH J 4 .   ? 15.940  -15.870 -40.124 1.00 60.09  ? 2130 HOH B O   1 
HETATM 8853 O O   . HOH J 4 .   ? 23.086  -5.302  -33.475 1.00 58.79  ? 2131 HOH B O   1 
HETATM 8854 O O   . HOH J 4 .   ? 30.921  -3.782  -29.006 1.00 59.80  ? 2132 HOH B O   1 
HETATM 8855 O O   . HOH J 4 .   ? 16.654  -2.089  -28.452 1.00 53.64  ? 2133 HOH B O   1 
HETATM 8856 O O   . HOH J 4 .   ? 13.795  -6.907  -33.733 1.00 56.83  ? 2134 HOH B O   1 
HETATM 8857 O O   . HOH J 4 .   ? 22.627  15.600  -50.551 1.00 56.52  ? 2135 HOH B O   1 
HETATM 8858 O O   . HOH J 4 .   ? 22.164  9.946   -52.822 1.00 53.91  ? 2136 HOH B O   1 
HETATM 8859 O O   . HOH J 4 .   ? 29.333  12.281  -53.979 1.00 63.33  ? 2137 HOH B O   1 
HETATM 8860 O O   . HOH J 4 .   ? 22.925  9.855   -35.394 1.00 61.44  ? 2138 HOH B O   1 
HETATM 8861 O O   . HOH J 4 .   ? 8.509   27.884  -39.143 1.00 63.96  ? 2139 HOH B O   1 
HETATM 8862 O O   . HOH J 4 .   ? 5.925   6.110   -24.994 1.00 65.80  ? 2140 HOH B O   1 
HETATM 8863 O O   . HOH J 4 .   ? 7.168   4.206   -24.478 1.00 45.82  ? 2141 HOH B O   1 
HETATM 8864 O O   . HOH J 4 .   ? -2.799  0.109   -21.918 1.00 73.03  ? 2142 HOH B O   1 
HETATM 8865 O O   . HOH J 4 .   ? 0.140   -0.387  -19.919 1.00 75.36  ? 2143 HOH B O   1 
HETATM 8866 O O   . HOH J 4 .   ? 5.716   -1.113  -29.060 1.00 57.92  ? 2144 HOH B O   1 
HETATM 8867 O O   . HOH J 4 .   ? 4.833   -1.313  -21.834 1.00 52.84  ? 2145 HOH B O   1 
HETATM 8868 O O   . HOH J 4 .   ? 2.907   0.440   -18.539 1.00 63.62  ? 2146 HOH B O   1 
HETATM 8869 O O   . HOH J 4 .   ? 7.807   0.977   -23.683 1.00 52.32  ? 2147 HOH B O   1 
HETATM 8870 O O   . HOH J 4 .   ? 9.157   -2.540  -29.772 0.99 59.64  ? 2148 HOH B O   1 
HETATM 8871 O O   . HOH J 4 .   ? 13.906  -11.075 -35.238 1.00 58.98  ? 2149 HOH B O   1 
HETATM 8872 O O   . HOH J 4 .   ? 11.142  -18.313 -21.405 1.00 65.11  ? 2150 HOH B O   1 
HETATM 8873 O O   . HOH J 4 .   ? 3.193   -15.119 -16.664 1.00 69.63  ? 2151 HOH B O   1 
HETATM 8874 O O   . HOH J 4 .   ? 21.116  -12.645 -16.243 1.00 59.89  ? 2152 HOH B O   1 
HETATM 8875 O O   . HOH J 4 .   ? 22.688  -10.862 -17.624 1.00 67.36  ? 2153 HOH B O   1 
HETATM 8876 O O   . HOH J 4 .   ? 32.472  -4.186  -21.352 1.00 67.72  ? 2154 HOH B O   1 
HETATM 8877 O O   . HOH J 4 .   ? 33.840  -7.282  -19.502 1.00 76.62  ? 2155 HOH B O   1 
HETATM 8878 O O   . HOH J 4 .   ? 12.086  -3.059  -10.368 1.00 60.89  ? 2156 HOH B O   1 
HETATM 8879 O O   . HOH J 4 .   ? 6.641   0.321   -19.501 1.00 52.56  ? 2157 HOH B O   1 
HETATM 8880 O O   . HOH J 4 .   ? 4.712   -3.605  -20.528 1.00 56.20  ? 2158 HOH B O   1 
HETATM 8881 O O   . HOH J 4 .   ? 9.297   3.638   -23.528 1.00 52.08  ? 2159 HOH B O   1 
HETATM 8882 O O   . HOH J 4 .   ? 18.983  6.393   -27.009 1.00 49.77  ? 2160 HOH B O   1 
HETATM 8883 O O   . HOH J 4 .   ? 18.488  8.978   -27.977 1.00 48.09  ? 2161 HOH B O   1 
HETATM 8884 O O   . HOH J 4 .   ? 19.931  16.309  -26.528 1.00 66.54  ? 2162 HOH B O   1 
HETATM 8885 O O   . HOH J 4 .   ? 11.681  27.527  -32.688 1.00 61.33  ? 2163 HOH B O   1 
HETATM 8886 O O   . HOH J 4 .   ? 8.023   25.276  -31.747 1.00 48.08  ? 2164 HOH B O   1 
HETATM 8887 O O   . HOH J 4 .   ? -0.414  27.318  -32.153 1.00 41.15  ? 2165 HOH B O   1 
HETATM 8888 O O   . HOH J 4 .   ? 3.540   20.260  -28.404 1.00 49.44  ? 2166 HOH B O   1 
HETATM 8889 O O   . HOH J 4 .   ? 1.641   8.030   -20.982 1.00 53.19  ? 2167 HOH B O   1 
HETATM 8890 O O   . HOH J 4 .   ? -4.423  1.667   -30.084 1.00 54.26  ? 2168 HOH B O   1 
HETATM 8891 O O   . HOH J 4 .   ? -8.377  6.082   -23.597 1.00 61.45  ? 2169 HOH B O   1 
HETATM 8892 O O   . HOH J 4 .   ? 1.446   -2.266  -19.303 1.00 58.06  ? 2170 HOH B O   1 
HETATM 8893 O O   . HOH J 4 .   ? -2.886  1.261   -36.625 1.00 47.99  ? 2171 HOH B O   1 
HETATM 8894 O O   . HOH J 4 .   ? -15.892 -7.577  -37.939 1.00 86.64  ? 2172 HOH B O   1 
HETATM 8895 O O   . HOH J 4 .   ? -18.975 -8.525  -36.522 1.00 79.09  ? 2173 HOH B O   1 
HETATM 8896 O O   . HOH J 4 .   ? -9.706  18.305  -33.846 1.00 54.35  ? 2174 HOH B O   1 
HETATM 8897 O O   . HOH J 4 .   ? -7.082  14.036  -26.343 1.00 45.58  ? 2175 HOH B O   1 
HETATM 8898 O O   . HOH J 4 .   ? -5.246  24.984  -38.014 1.00 59.01  ? 2176 HOH B O   1 
HETATM 8899 O O   . HOH J 4 .   ? -1.932  27.084  -29.912 1.00 51.66  ? 2177 HOH B O   1 
HETATM 8900 O O   . HOH J 4 .   ? 6.400   24.524  -24.925 1.00 44.72  ? 2178 HOH B O   1 
HETATM 8901 O O   . HOH J 4 .   ? 10.935  17.340  -23.048 1.00 47.01  ? 2179 HOH B O   1 
HETATM 8902 O O   . HOH J 4 .   ? 12.201  26.851  -28.114 1.00 45.17  ? 2180 HOH B O   1 
HETATM 8903 O O   . HOH J 4 .   ? 12.047  28.344  -25.769 1.00 56.48  ? 2181 HOH B O   1 
HETATM 8904 O O   . HOH J 4 .   ? 2.179   27.931  -23.704 1.00 56.13  ? 2182 HOH B O   1 
HETATM 8905 O O   . HOH J 4 .   ? 2.931   11.843  -20.025 1.00 55.83  ? 2183 HOH B O   1 
HETATM 8906 O O   . HOH J 4 .   ? 6.970   12.079  -19.234 1.00 58.26  ? 2184 HOH B O   1 
HETATM 8907 O O   . HOH J 4 .   ? 5.735   14.727  -18.413 1.00 48.35  ? 2185 HOH B O   1 
HETATM 8908 O O   . HOH J 4 .   ? -6.286  13.712  -22.550 1.00 63.51  ? 2186 HOH B O   1 
HETATM 8909 O O   . HOH J 4 .   ? -4.367  21.087  -20.259 1.00 53.48  ? 2187 HOH B O   1 
HETATM 8910 O O   . HOH J 4 .   ? 1.338   21.783  -18.410 1.00 52.99  ? 2188 HOH B O   1 
HETATM 8911 O O   . HOH J 4 .   ? 3.211   17.093  -16.765 1.00 54.56  ? 2189 HOH B O   1 
HETATM 8912 O O   . HOH J 4 .   ? 9.060   14.491  -17.889 1.00 50.36  ? 2190 HOH B O   1 
HETATM 8913 O O   . HOH J 4 .   ? 12.862  15.317  -22.683 1.00 47.06  ? 2191 HOH B O   1 
HETATM 8914 O O   . HOH J 4 .   ? 11.117  12.978  -16.118 1.00 45.94  ? 2192 HOH B O   1 
HETATM 8915 O O   . HOH J 4 .   ? 11.634  10.462  -16.653 1.00 60.95  ? 2193 HOH B O   1 
HETATM 8916 O O   . HOH J 4 .   ? 17.381  15.640  -24.908 1.00 58.80  ? 2194 HOH B O   1 
HETATM 8917 O O   . HOH J 4 .   ? 10.351  -21.610 -23.142 1.00 74.01  ? 2195 HOH B O   1 
HETATM 8918 O O   . HOH J 4 .   ? 8.795   5.398   -9.429  1.00 62.67  ? 2196 HOH B O   1 
HETATM 8919 O O   . HOH J 4 .   ? 32.476  11.213  -48.008 1.00 66.48  ? 2197 HOH B O   1 
HETATM 8920 O O   . HOH J 4 .   ? -15.127 14.913  -28.768 1.00 55.02  ? 2198 HOH B O   1 
HETATM 8921 O O   . HOH J 4 .   ? 44.360  10.772  -13.105 1.00 57.85  ? 2199 HOH B O   1 
HETATM 8922 O O   . HOH J 4 .   ? 44.202  11.380  -10.783 1.00 53.94  ? 2200 HOH B O   1 
HETATM 8923 O O   . HOH J 4 .   ? 44.009  7.397   -5.172  1.00 67.30  ? 2201 HOH B O   1 
HETATM 8924 O O   . HOH J 4 .   ? 63.427  7.228   22.067  1.00 61.90  ? 2202 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 GFT 203 203 203 GFT GFT A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 ?   ?   ?   A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 GFT 203 203 203 GFT GFT B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 ?   ?   ?   B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 1KA 1   1543 1543 1KA 1KA A . 
D 3 P15 1   1544 1544 P15 P15 A . 
E 2 1KA 1   1545 1545 1KA 1KA A . 
F 2 1KA 1   1546 1546 1KA 1KA A . 
G 2 1KA 1   1544 1544 1KA 1KA B . 
H 2 1KA 1   1545 1545 1KA 1KA B . 
I 4 HOH 1   2001 2001 HOH HOH A . 
I 4 HOH 2   2002 2002 HOH HOH A . 
I 4 HOH 3   2003 2003 HOH HOH A . 
I 4 HOH 4   2004 2004 HOH HOH A . 
I 4 HOH 5   2005 2005 HOH HOH A . 
I 4 HOH 6   2006 2006 HOH HOH A . 
I 4 HOH 7   2007 2007 HOH HOH A . 
I 4 HOH 8   2008 2008 HOH HOH A . 
I 4 HOH 9   2009 2009 HOH HOH A . 
I 4 HOH 10  2010 2010 HOH HOH A . 
I 4 HOH 11  2011 2011 HOH HOH A . 
I 4 HOH 12  2012 2012 HOH HOH A . 
I 4 HOH 13  2013 2013 HOH HOH A . 
I 4 HOH 14  2014 2014 HOH HOH A . 
I 4 HOH 15  2015 2015 HOH HOH A . 
I 4 HOH 16  2016 2016 HOH HOH A . 
I 4 HOH 17  2017 2017 HOH HOH A . 
I 4 HOH 18  2018 2018 HOH HOH A . 
I 4 HOH 19  2019 2019 HOH HOH A . 
I 4 HOH 20  2020 2020 HOH HOH A . 
I 4 HOH 21  2021 2021 HOH HOH A . 
I 4 HOH 22  2022 2022 HOH HOH A . 
I 4 HOH 23  2023 2023 HOH HOH A . 
I 4 HOH 24  2024 2024 HOH HOH A . 
I 4 HOH 25  2025 2025 HOH HOH A . 
I 4 HOH 26  2026 2026 HOH HOH A . 
I 4 HOH 27  2027 2027 HOH HOH A . 
I 4 HOH 28  2028 2028 HOH HOH A . 
I 4 HOH 29  2029 2029 HOH HOH A . 
I 4 HOH 30  2030 2030 HOH HOH A . 
I 4 HOH 31  2031 2031 HOH HOH A . 
I 4 HOH 32  2032 2032 HOH HOH A . 
I 4 HOH 33  2033 2033 HOH HOH A . 
I 4 HOH 34  2034 2034 HOH HOH A . 
I 4 HOH 35  2035 2035 HOH HOH A . 
I 4 HOH 36  2036 2036 HOH HOH A . 
I 4 HOH 37  2037 2037 HOH HOH A . 
I 4 HOH 38  2038 2038 HOH HOH A . 
I 4 HOH 39  2039 2039 HOH HOH A . 
I 4 HOH 40  2040 2040 HOH HOH A . 
I 4 HOH 41  2041 2041 HOH HOH A . 
I 4 HOH 42  2042 2042 HOH HOH A . 
I 4 HOH 43  2043 2043 HOH HOH A . 
I 4 HOH 44  2044 2044 HOH HOH A . 
I 4 HOH 45  2045 2045 HOH HOH A . 
I 4 HOH 46  2046 2046 HOH HOH A . 
I 4 HOH 47  2047 2047 HOH HOH A . 
I 4 HOH 48  2048 2048 HOH HOH A . 
I 4 HOH 49  2049 2049 HOH HOH A . 
I 4 HOH 50  2050 2050 HOH HOH A . 
I 4 HOH 51  2051 2051 HOH HOH A . 
I 4 HOH 52  2052 2052 HOH HOH A . 
I 4 HOH 53  2053 2053 HOH HOH A . 
I 4 HOH 54  2054 2054 HOH HOH A . 
I 4 HOH 55  2055 2055 HOH HOH A . 
I 4 HOH 56  2056 2056 HOH HOH A . 
I 4 HOH 57  2057 2057 HOH HOH A . 
I 4 HOH 58  2058 2058 HOH HOH A . 
I 4 HOH 59  2059 2059 HOH HOH A . 
I 4 HOH 60  2060 2060 HOH HOH A . 
I 4 HOH 61  2061 2061 HOH HOH A . 
I 4 HOH 62  2062 2062 HOH HOH A . 
I 4 HOH 63  2063 2063 HOH HOH A . 
I 4 HOH 64  2064 2064 HOH HOH A . 
I 4 HOH 65  2065 2065 HOH HOH A . 
I 4 HOH 66  2066 2066 HOH HOH A . 
I 4 HOH 67  2067 2067 HOH HOH A . 
I 4 HOH 68  2068 2068 HOH HOH A . 
I 4 HOH 69  2069 2069 HOH HOH A . 
I 4 HOH 70  2070 2070 HOH HOH A . 
I 4 HOH 71  2071 2071 HOH HOH A . 
I 4 HOH 72  2072 2072 HOH HOH A . 
I 4 HOH 73  2073 2073 HOH HOH A . 
I 4 HOH 74  2074 2074 HOH HOH A . 
I 4 HOH 75  2075 2075 HOH HOH A . 
I 4 HOH 76  2076 2076 HOH HOH A . 
I 4 HOH 77  2077 2077 HOH HOH A . 
I 4 HOH 78  2078 2078 HOH HOH A . 
I 4 HOH 79  2079 2079 HOH HOH A . 
I 4 HOH 80  2080 2080 HOH HOH A . 
I 4 HOH 81  2081 2081 HOH HOH A . 
I 4 HOH 82  2082 2082 HOH HOH A . 
I 4 HOH 83  2083 2083 HOH HOH A . 
I 4 HOH 84  2084 2084 HOH HOH A . 
I 4 HOH 85  2085 2085 HOH HOH A . 
I 4 HOH 86  2086 2086 HOH HOH A . 
I 4 HOH 87  2087 2087 HOH HOH A . 
I 4 HOH 88  2088 2088 HOH HOH A . 
I 4 HOH 89  2089 2089 HOH HOH A . 
I 4 HOH 90  2090 2090 HOH HOH A . 
I 4 HOH 91  2091 2091 HOH HOH A . 
I 4 HOH 92  2092 2092 HOH HOH A . 
I 4 HOH 93  2093 2093 HOH HOH A . 
I 4 HOH 94  2094 2094 HOH HOH A . 
I 4 HOH 95  2095 2095 HOH HOH A . 
I 4 HOH 96  2096 2096 HOH HOH A . 
I 4 HOH 97  2097 2097 HOH HOH A . 
I 4 HOH 98  2098 2098 HOH HOH A . 
I 4 HOH 99  2099 2099 HOH HOH A . 
I 4 HOH 100 2100 2100 HOH HOH A . 
I 4 HOH 101 2101 2101 HOH HOH A . 
I 4 HOH 102 2102 2102 HOH HOH A . 
I 4 HOH 103 2103 2103 HOH HOH A . 
I 4 HOH 104 2104 2104 HOH HOH A . 
I 4 HOH 105 2105 2105 HOH HOH A . 
I 4 HOH 106 2106 2106 HOH HOH A . 
I 4 HOH 107 2107 2107 HOH HOH A . 
I 4 HOH 108 2108 2108 HOH HOH A . 
I 4 HOH 109 2109 2109 HOH HOH A . 
I 4 HOH 110 2110 2110 HOH HOH A . 
I 4 HOH 111 2111 2111 HOH HOH A . 
I 4 HOH 112 2112 2112 HOH HOH A . 
I 4 HOH 113 2113 2113 HOH HOH A . 
I 4 HOH 114 2114 2114 HOH HOH A . 
I 4 HOH 115 2115 2115 HOH HOH A . 
I 4 HOH 116 2116 2116 HOH HOH A . 
I 4 HOH 117 2117 2117 HOH HOH A . 
I 4 HOH 118 2118 2118 HOH HOH A . 
I 4 HOH 119 2119 2119 HOH HOH A . 
I 4 HOH 120 2120 2120 HOH HOH A . 
I 4 HOH 121 2121 2121 HOH HOH A . 
I 4 HOH 122 2122 2122 HOH HOH A . 
I 4 HOH 123 2123 2123 HOH HOH A . 
I 4 HOH 124 2124 2124 HOH HOH A . 
I 4 HOH 125 2125 2125 HOH HOH A . 
I 4 HOH 126 2126 2126 HOH HOH A . 
I 4 HOH 127 2127 2127 HOH HOH A . 
I 4 HOH 128 2128 2128 HOH HOH A . 
I 4 HOH 129 2129 2129 HOH HOH A . 
I 4 HOH 130 2130 2130 HOH HOH A . 
I 4 HOH 131 2131 2131 HOH HOH A . 
I 4 HOH 132 2132 2132 HOH HOH A . 
I 4 HOH 133 2133 2133 HOH HOH A . 
I 4 HOH 134 2134 2134 HOH HOH A . 
I 4 HOH 135 2135 2135 HOH HOH A . 
I 4 HOH 136 2136 2136 HOH HOH A . 
I 4 HOH 137 2137 2137 HOH HOH A . 
I 4 HOH 138 2138 2138 HOH HOH A . 
I 4 HOH 139 2139 2139 HOH HOH A . 
I 4 HOH 140 2140 2140 HOH HOH A . 
I 4 HOH 141 2141 2141 HOH HOH A . 
I 4 HOH 142 2142 2142 HOH HOH A . 
I 4 HOH 143 2143 2143 HOH HOH A . 
I 4 HOH 144 2144 2144 HOH HOH A . 
I 4 HOH 145 2145 2145 HOH HOH A . 
I 4 HOH 146 2146 2146 HOH HOH A . 
I 4 HOH 147 2147 2147 HOH HOH A . 
I 4 HOH 148 2148 2148 HOH HOH A . 
I 4 HOH 149 2149 2149 HOH HOH A . 
I 4 HOH 150 2150 2150 HOH HOH A . 
I 4 HOH 151 2151 2151 HOH HOH A . 
I 4 HOH 152 2152 2152 HOH HOH A . 
I 4 HOH 153 2153 2153 HOH HOH A . 
I 4 HOH 154 2154 2154 HOH HOH A . 
I 4 HOH 155 2155 2155 HOH HOH A . 
I 4 HOH 156 2156 2156 HOH HOH A . 
I 4 HOH 157 2157 2157 HOH HOH A . 
I 4 HOH 158 2158 2158 HOH HOH A . 
I 4 HOH 159 2159 2159 HOH HOH A . 
I 4 HOH 160 2160 2160 HOH HOH A . 
I 4 HOH 161 2161 2161 HOH HOH A . 
I 4 HOH 162 2162 2162 HOH HOH A . 
I 4 HOH 163 2163 2163 HOH HOH A . 
I 4 HOH 164 2164 2164 HOH HOH A . 
I 4 HOH 165 2165 2165 HOH HOH A . 
I 4 HOH 166 2166 2166 HOH HOH A . 
I 4 HOH 167 2167 2167 HOH HOH A . 
I 4 HOH 168 2168 2168 HOH HOH A . 
I 4 HOH 169 2169 2169 HOH HOH A . 
I 4 HOH 170 2170 2170 HOH HOH A . 
I 4 HOH 171 2171 2171 HOH HOH A . 
I 4 HOH 172 2172 2172 HOH HOH A . 
I 4 HOH 173 2173 2173 HOH HOH A . 
I 4 HOH 174 2174 2174 HOH HOH A . 
I 4 HOH 175 2175 2175 HOH HOH A . 
I 4 HOH 176 2176 2176 HOH HOH A . 
I 4 HOH 177 2177 2177 HOH HOH A . 
I 4 HOH 178 2178 2178 HOH HOH A . 
I 4 HOH 179 2179 2179 HOH HOH A . 
I 4 HOH 180 2180 2180 HOH HOH A . 
I 4 HOH 181 2181 2181 HOH HOH A . 
I 4 HOH 182 2182 2182 HOH HOH A . 
I 4 HOH 183 2183 2183 HOH HOH A . 
I 4 HOH 184 2184 2184 HOH HOH A . 
I 4 HOH 185 2185 2185 HOH HOH A . 
I 4 HOH 186 2186 2186 HOH HOH A . 
I 4 HOH 187 2187 2187 HOH HOH A . 
I 4 HOH 188 2188 2188 HOH HOH A . 
I 4 HOH 189 2189 2189 HOH HOH A . 
I 4 HOH 190 2190 2190 HOH HOH A . 
I 4 HOH 191 2191 2191 HOH HOH A . 
I 4 HOH 192 2192 2192 HOH HOH A . 
I 4 HOH 193 2193 2193 HOH HOH A . 
I 4 HOH 194 2194 2194 HOH HOH A . 
I 4 HOH 195 2195 2195 HOH HOH A . 
I 4 HOH 196 2196 2196 HOH HOH A . 
I 4 HOH 197 2197 2197 HOH HOH A . 
I 4 HOH 198 2198 2198 HOH HOH A . 
I 4 HOH 199 2199 2199 HOH HOH A . 
I 4 HOH 200 2200 2200 HOH HOH A . 
I 4 HOH 201 2201 2201 HOH HOH A . 
I 4 HOH 202 2202 2202 HOH HOH A . 
I 4 HOH 203 2203 2203 HOH HOH A . 
I 4 HOH 204 2204 2204 HOH HOH A . 
I 4 HOH 205 2205 2205 HOH HOH A . 
I 4 HOH 206 2206 2206 HOH HOH A . 
I 4 HOH 207 2207 2207 HOH HOH A . 
I 4 HOH 208 2208 2208 HOH HOH A . 
I 4 HOH 209 2209 2209 HOH HOH A . 
I 4 HOH 210 2210 2210 HOH HOH A . 
I 4 HOH 211 2211 2211 HOH HOH A . 
I 4 HOH 212 2212 2212 HOH HOH A . 
I 4 HOH 213 2213 2213 HOH HOH A . 
I 4 HOH 214 2214 2214 HOH HOH A . 
I 4 HOH 215 2215 2215 HOH HOH A . 
I 4 HOH 216 2216 2216 HOH HOH A . 
I 4 HOH 217 2217 2217 HOH HOH A . 
I 4 HOH 218 2218 2218 HOH HOH A . 
I 4 HOH 219 2219 2219 HOH HOH A . 
I 4 HOH 220 2220 2220 HOH HOH A . 
I 4 HOH 221 2221 2221 HOH HOH A . 
I 4 HOH 222 2222 2222 HOH HOH A . 
I 4 HOH 223 2223 2223 HOH HOH A . 
I 4 HOH 224 2224 2224 HOH HOH A . 
I 4 HOH 225 2225 2225 HOH HOH A . 
I 4 HOH 226 2226 2226 HOH HOH A . 
I 4 HOH 227 2227 2227 HOH HOH A . 
I 4 HOH 228 2228 2228 HOH HOH A . 
I 4 HOH 229 2229 2229 HOH HOH A . 
I 4 HOH 230 2230 2230 HOH HOH A . 
I 4 HOH 231 2231 2231 HOH HOH A . 
I 4 HOH 232 2232 2232 HOH HOH A . 
I 4 HOH 233 2233 2233 HOH HOH A . 
I 4 HOH 234 2234 2234 HOH HOH A . 
I 4 HOH 235 2235 2235 HOH HOH A . 
I 4 HOH 236 2236 2236 HOH HOH A . 
I 4 HOH 237 2237 2237 HOH HOH A . 
I 4 HOH 238 2238 2238 HOH HOH A . 
I 4 HOH 239 2239 2239 HOH HOH A . 
I 4 HOH 240 2240 2240 HOH HOH A . 
I 4 HOH 241 2241 2241 HOH HOH A . 
I 4 HOH 242 2242 2242 HOH HOH A . 
I 4 HOH 243 2243 2243 HOH HOH A . 
I 4 HOH 244 2244 2244 HOH HOH A . 
I 4 HOH 245 2245 2245 HOH HOH A . 
I 4 HOH 246 2246 2246 HOH HOH A . 
I 4 HOH 247 2247 2247 HOH HOH A . 
I 4 HOH 248 2248 2248 HOH HOH A . 
I 4 HOH 249 2249 2249 HOH HOH A . 
I 4 HOH 250 2250 2250 HOH HOH A . 
I 4 HOH 251 2251 2251 HOH HOH A . 
I 4 HOH 252 2252 2252 HOH HOH A . 
J 4 HOH 1   2001 2001 HOH HOH B . 
J 4 HOH 2   2002 2002 HOH HOH B . 
J 4 HOH 3   2003 2003 HOH HOH B . 
J 4 HOH 4   2004 2004 HOH HOH B . 
J 4 HOH 5   2005 2005 HOH HOH B . 
J 4 HOH 6   2006 2006 HOH HOH B . 
J 4 HOH 7   2007 2007 HOH HOH B . 
J 4 HOH 8   2008 2008 HOH HOH B . 
J 4 HOH 9   2009 2009 HOH HOH B . 
J 4 HOH 10  2010 2010 HOH HOH B . 
J 4 HOH 11  2011 2011 HOH HOH B . 
J 4 HOH 12  2012 2012 HOH HOH B . 
J 4 HOH 13  2013 2013 HOH HOH B . 
J 4 HOH 14  2014 2014 HOH HOH B . 
J 4 HOH 15  2015 2015 HOH HOH B . 
J 4 HOH 16  2016 2016 HOH HOH B . 
J 4 HOH 17  2017 2017 HOH HOH B . 
J 4 HOH 18  2018 2018 HOH HOH B . 
J 4 HOH 19  2019 2019 HOH HOH B . 
J 4 HOH 20  2020 2020 HOH HOH B . 
J 4 HOH 21  2021 2021 HOH HOH B . 
J 4 HOH 22  2022 2022 HOH HOH B . 
J 4 HOH 23  2023 2023 HOH HOH B . 
J 4 HOH 24  2024 2024 HOH HOH B . 
J 4 HOH 25  2025 2025 HOH HOH B . 
J 4 HOH 26  2026 2026 HOH HOH B . 
J 4 HOH 27  2027 2027 HOH HOH B . 
J 4 HOH 28  2028 2028 HOH HOH B . 
J 4 HOH 29  2029 2029 HOH HOH B . 
J 4 HOH 30  2030 2030 HOH HOH B . 
J 4 HOH 31  2031 2031 HOH HOH B . 
J 4 HOH 32  2032 2032 HOH HOH B . 
J 4 HOH 33  2033 2033 HOH HOH B . 
J 4 HOH 34  2034 2034 HOH HOH B . 
J 4 HOH 35  2035 2035 HOH HOH B . 
J 4 HOH 36  2036 2036 HOH HOH B . 
J 4 HOH 37  2037 2037 HOH HOH B . 
J 4 HOH 38  2038 2038 HOH HOH B . 
J 4 HOH 39  2039 2039 HOH HOH B . 
J 4 HOH 40  2040 2040 HOH HOH B . 
J 4 HOH 41  2041 2041 HOH HOH B . 
J 4 HOH 42  2042 2042 HOH HOH B . 
J 4 HOH 43  2043 2043 HOH HOH B . 
J 4 HOH 44  2044 2044 HOH HOH B . 
J 4 HOH 45  2045 2045 HOH HOH B . 
J 4 HOH 46  2046 2046 HOH HOH B . 
J 4 HOH 47  2047 2047 HOH HOH B . 
J 4 HOH 48  2048 2048 HOH HOH B . 
J 4 HOH 49  2049 2049 HOH HOH B . 
J 4 HOH 50  2050 2050 HOH HOH B . 
J 4 HOH 51  2051 2051 HOH HOH B . 
J 4 HOH 52  2052 2052 HOH HOH B . 
J 4 HOH 53  2053 2053 HOH HOH B . 
J 4 HOH 54  2054 2054 HOH HOH B . 
J 4 HOH 55  2055 2055 HOH HOH B . 
J 4 HOH 56  2056 2056 HOH HOH B . 
J 4 HOH 57  2057 2057 HOH HOH B . 
J 4 HOH 58  2058 2058 HOH HOH B . 
J 4 HOH 59  2059 2059 HOH HOH B . 
J 4 HOH 60  2060 2060 HOH HOH B . 
J 4 HOH 61  2061 2061 HOH HOH B . 
J 4 HOH 62  2062 2062 HOH HOH B . 
J 4 HOH 63  2063 2063 HOH HOH B . 
J 4 HOH 64  2064 2064 HOH HOH B . 
J 4 HOH 65  2065 2065 HOH HOH B . 
J 4 HOH 66  2066 2066 HOH HOH B . 
J 4 HOH 67  2067 2067 HOH HOH B . 
J 4 HOH 68  2068 2068 HOH HOH B . 
J 4 HOH 69  2069 2069 HOH HOH B . 
J 4 HOH 70  2070 2070 HOH HOH B . 
J 4 HOH 71  2071 2071 HOH HOH B . 
J 4 HOH 72  2072 2072 HOH HOH B . 
J 4 HOH 73  2073 2073 HOH HOH B . 
J 4 HOH 74  2074 2074 HOH HOH B . 
J 4 HOH 75  2075 2075 HOH HOH B . 
J 4 HOH 76  2076 2076 HOH HOH B . 
J 4 HOH 77  2077 2077 HOH HOH B . 
J 4 HOH 78  2078 2078 HOH HOH B . 
J 4 HOH 79  2079 2079 HOH HOH B . 
J 4 HOH 80  2080 2080 HOH HOH B . 
J 4 HOH 81  2081 2081 HOH HOH B . 
J 4 HOH 82  2082 2082 HOH HOH B . 
J 4 HOH 83  2083 2083 HOH HOH B . 
J 4 HOH 84  2084 2084 HOH HOH B . 
J 4 HOH 85  2085 2085 HOH HOH B . 
J 4 HOH 86  2086 2086 HOH HOH B . 
J 4 HOH 87  2087 2087 HOH HOH B . 
J 4 HOH 88  2088 2088 HOH HOH B . 
J 4 HOH 89  2089 2089 HOH HOH B . 
J 4 HOH 90  2090 2090 HOH HOH B . 
J 4 HOH 91  2091 2091 HOH HOH B . 
J 4 HOH 92  2092 2092 HOH HOH B . 
J 4 HOH 93  2093 2093 HOH HOH B . 
J 4 HOH 94  2094 2094 HOH HOH B . 
J 4 HOH 95  2095 2095 HOH HOH B . 
J 4 HOH 96  2096 2096 HOH HOH B . 
J 4 HOH 97  2097 2097 HOH HOH B . 
J 4 HOH 98  2098 2098 HOH HOH B . 
J 4 HOH 99  2099 2099 HOH HOH B . 
J 4 HOH 100 2100 2100 HOH HOH B . 
J 4 HOH 101 2101 2101 HOH HOH B . 
J 4 HOH 102 2102 2102 HOH HOH B . 
J 4 HOH 103 2103 2103 HOH HOH B . 
J 4 HOH 104 2104 2104 HOH HOH B . 
J 4 HOH 105 2105 2105 HOH HOH B . 
J 4 HOH 106 2106 2106 HOH HOH B . 
J 4 HOH 107 2107 2107 HOH HOH B . 
J 4 HOH 108 2108 2108 HOH HOH B . 
J 4 HOH 109 2109 2109 HOH HOH B . 
J 4 HOH 110 2110 2110 HOH HOH B . 
J 4 HOH 111 2111 2111 HOH HOH B . 
J 4 HOH 112 2112 2112 HOH HOH B . 
J 4 HOH 113 2113 2113 HOH HOH B . 
J 4 HOH 114 2114 2114 HOH HOH B . 
J 4 HOH 115 2115 2115 HOH HOH B . 
J 4 HOH 116 2116 2116 HOH HOH B . 
J 4 HOH 117 2117 2117 HOH HOH B . 
J 4 HOH 118 2118 2118 HOH HOH B . 
J 4 HOH 119 2119 2119 HOH HOH B . 
J 4 HOH 120 2120 2120 HOH HOH B . 
J 4 HOH 121 2121 2121 HOH HOH B . 
J 4 HOH 122 2122 2122 HOH HOH B . 
J 4 HOH 123 2123 2123 HOH HOH B . 
J 4 HOH 124 2124 2124 HOH HOH B . 
J 4 HOH 125 2125 2125 HOH HOH B . 
J 4 HOH 126 2126 2126 HOH HOH B . 
J 4 HOH 127 2127 2127 HOH HOH B . 
J 4 HOH 128 2128 2128 HOH HOH B . 
J 4 HOH 129 2129 2129 HOH HOH B . 
J 4 HOH 130 2130 2130 HOH HOH B . 
J 4 HOH 131 2131 2131 HOH HOH B . 
J 4 HOH 132 2132 2132 HOH HOH B . 
J 4 HOH 133 2133 2133 HOH HOH B . 
J 4 HOH 134 2134 2134 HOH HOH B . 
J 4 HOH 135 2135 2135 HOH HOH B . 
J 4 HOH 136 2136 2136 HOH HOH B . 
J 4 HOH 137 2137 2137 HOH HOH B . 
J 4 HOH 138 2138 2138 HOH HOH B . 
J 4 HOH 139 2139 2139 HOH HOH B . 
J 4 HOH 140 2140 2140 HOH HOH B . 
J 4 HOH 141 2141 2141 HOH HOH B . 
J 4 HOH 142 2142 2142 HOH HOH B . 
J 4 HOH 143 2143 2143 HOH HOH B . 
J 4 HOH 144 2144 2144 HOH HOH B . 
J 4 HOH 145 2145 2145 HOH HOH B . 
J 4 HOH 146 2146 2146 HOH HOH B . 
J 4 HOH 147 2147 2147 HOH HOH B . 
J 4 HOH 148 2148 2148 HOH HOH B . 
J 4 HOH 149 2149 2149 HOH HOH B . 
J 4 HOH 150 2150 2150 HOH HOH B . 
J 4 HOH 151 2151 2151 HOH HOH B . 
J 4 HOH 152 2152 2152 HOH HOH B . 
J 4 HOH 153 2153 2153 HOH HOH B . 
J 4 HOH 154 2154 2154 HOH HOH B . 
J 4 HOH 155 2155 2155 HOH HOH B . 
J 4 HOH 156 2156 2156 HOH HOH B . 
J 4 HOH 157 2157 2157 HOH HOH B . 
J 4 HOH 158 2158 2158 HOH HOH B . 
J 4 HOH 159 2159 2159 HOH HOH B . 
J 4 HOH 160 2160 2160 HOH HOH B . 
J 4 HOH 161 2161 2161 HOH HOH B . 
J 4 HOH 162 2162 2162 HOH HOH B . 
J 4 HOH 163 2163 2163 HOH HOH B . 
J 4 HOH 164 2164 2164 HOH HOH B . 
J 4 HOH 165 2165 2165 HOH HOH B . 
J 4 HOH 166 2166 2166 HOH HOH B . 
J 4 HOH 167 2167 2167 HOH HOH B . 
J 4 HOH 168 2168 2168 HOH HOH B . 
J 4 HOH 169 2169 2169 HOH HOH B . 
J 4 HOH 170 2170 2170 HOH HOH B . 
J 4 HOH 171 2171 2171 HOH HOH B . 
J 4 HOH 172 2172 2172 HOH HOH B . 
J 4 HOH 173 2173 2173 HOH HOH B . 
J 4 HOH 174 2174 2174 HOH HOH B . 
J 4 HOH 175 2175 2175 HOH HOH B . 
J 4 HOH 176 2176 2176 HOH HOH B . 
J 4 HOH 177 2177 2177 HOH HOH B . 
J 4 HOH 178 2178 2178 HOH HOH B . 
J 4 HOH 179 2179 2179 HOH HOH B . 
J 4 HOH 180 2180 2180 HOH HOH B . 
J 4 HOH 181 2181 2181 HOH HOH B . 
J 4 HOH 182 2182 2182 HOH HOH B . 
J 4 HOH 183 2183 2183 HOH HOH B . 
J 4 HOH 184 2184 2184 HOH HOH B . 
J 4 HOH 185 2185 2185 HOH HOH B . 
J 4 HOH 186 2186 2186 HOH HOH B . 
J 4 HOH 187 2187 2187 HOH HOH B . 
J 4 HOH 188 2188 2188 HOH HOH B . 
J 4 HOH 189 2189 2189 HOH HOH B . 
J 4 HOH 190 2190 2190 HOH HOH B . 
J 4 HOH 191 2191 2191 HOH HOH B . 
J 4 HOH 192 2192 2192 HOH HOH B . 
J 4 HOH 193 2193 2193 HOH HOH B . 
J 4 HOH 194 2194 2194 HOH HOH B . 
J 4 HOH 195 2195 2195 HOH HOH B . 
J 4 HOH 196 2196 2196 HOH HOH B . 
J 4 HOH 197 2197 2197 HOH HOH B . 
J 4 HOH 198 2198 2198 HOH HOH B . 
J 4 HOH 199 2199 2199 HOH HOH B . 
J 4 HOH 200 2200 2200 HOH HOH B . 
J 4 HOH 201 2201 2201 HOH HOH B . 
J 4 HOH 202 2202 2202 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A GFT 203 A GFT 203 ? SER ? 
2 B GFT 203 B GFT 203 ? SER ? 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,I 
2 1 B,G,H,J     
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-03-27 
2 'Structure model' 1 1 2013-04-17 
3 'Structure model' 1 2 2018-01-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.pdbx_synchrotron_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
XDS    'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
REFMAC phasing          .                 ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O  A GLU 202 ? ? C A GLU 202 ? ? N  A GFT 203 ? ? 112.53 122.70 -10.17 1.60 Y 
2 1 C  A GLU 202 ? ? N A GFT 203 ? ? CA A GFT 203 ? ? 138.12 121.70 16.42  2.50 Y 
3 1 CA A GFT 203 ? ? C A GFT 203 ? ? N  A ALA 204 ? ? 137.89 117.20 20.69  2.20 Y 
4 1 O  A GFT 203 ? ? C A GFT 203 ? ? N  A ALA 204 ? ? 111.11 122.70 -11.59 1.60 Y 
5 1 CA B GLU 202 ? ? C B GLU 202 ? ? N  B GFT 203 ? ? 137.73 117.20 20.53  2.20 Y 
6 1 O  B GLU 202 ? ? C B GLU 202 ? ? N  B GFT 203 ? ? 100.08 122.70 -22.62 1.60 Y 
7 1 C  B GLU 202 ? ? N B GFT 203 ? ? CA B GFT 203 ? ? 159.27 121.70 37.57  2.50 Y 
8 1 CA B GFT 203 ? ? C B GFT 203 ? ? N  B ALA 204 ? ? 133.25 117.20 16.05  2.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 77.39   -9.85   
2  1 ALA A 62  ? ? -119.81 55.60   
3  1 ALA A 127 ? ? -173.10 144.42  
4  1 ALA A 167 ? ? -151.55 68.64   
5  1 GFT A 203 ? ? 77.46   -85.43  
6  1 ASP A 306 ? ? -129.53 -92.25  
7  1 VAL A 407 ? ? -129.84 -66.20  
8  1 HIS A 447 ? A -34.23  133.90  
9  1 ARG A 493 ? ? -61.06  -85.25  
10 1 SER B 93  ? ? -174.62 144.97  
11 1 CYS B 96  ? ? -146.19 -2.38   
12 1 PRO B 108 ? ? -39.21  136.50  
13 1 GFT B 203 ? ? 27.69   -83.63  
14 1 ASP B 306 ? ? -106.62 -88.53  
15 1 ASP B 323 ? ? -100.77 47.57   
16 1 TYR B 341 ? ? -98.25  36.91   
17 1 ASN B 350 ? ? -104.75 -135.13 
18 1 VAL B 407 ? ? -120.16 -66.05  
19 1 HIS B 447 ? B -23.33  126.00  
20 1 ASN B 514 ? ? -166.09 -167.02 
21 1 ALA B 542 ? ? -103.26 57.40   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LYS B 496 ? ? SER B 497 ? ? -136.53 
2 1 ALA B 542 ? ? THR B 543 ? ? 149.13  
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 GLU A 202 ? ? 18.61  
2 1 GFT A 203 ? ? -13.42 
3 1 HIS A 393 ? B 14.27  
4 1 GFT B 203 ? ? -17.63 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2249 ? 6.90 . 
2 1 O ? A HOH 2250 ? 7.81 . 
3 1 O ? B HOH 2091 ? 6.84 . 
4 1 O ? B HOH 2195 ? 7.08 . 
5 1 O ? B HOH 2199 ? 7.82 . 
6 1 O ? B HOH 2200 ? 8.52 . 
7 1 O ? B HOH 2201 ? 7.83 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 496 ? CG  ? A LYS 496 CG  
2  1 Y 1 A LYS 496 ? CD  ? A LYS 496 CD  
3  1 Y 1 A LYS 496 ? CE  ? A LYS 496 CE  
4  1 Y 1 A LYS 496 ? NZ  ? A LYS 496 NZ  
5  1 Y 1 B ARG 493 ? CG  ? B ARG 493 CG  
6  1 Y 1 B ARG 493 ? CD  ? B ARG 493 CD  
7  1 Y 1 B ARG 493 ? NE  ? B ARG 493 NE  
8  1 Y 1 B ARG 493 ? CZ  ? B ARG 493 CZ  
9  1 Y 1 B ARG 493 ? NH1 ? B ARG 493 NH1 
10 1 Y 1 B ARG 493 ? NH2 ? B ARG 493 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 258 ? A PRO 258 
2  1 Y 1 A PRO 259 ? A PRO 259 
3  1 Y 1 A GLY 260 ? A GLY 260 
4  1 Y 1 A GLY 261 ? A GLY 261 
5  1 Y 1 A ALA 262 ? A ALA 262 
6  1 Y 1 A GLY 263 ? A GLY 263 
7  1 Y 1 A GLY 264 ? A GLY 264 
8  1 Y 1 A THR 543 ? A THR 543 
9  1 Y 1 B GLU 1   ? B GLU 1   
10 1 Y 1 B GLY 2   ? B GLY 2   
11 1 Y 1 B ARG 3   ? B ARG 3   
12 1 Y 1 B PRO 258 ? B PRO 258 
13 1 Y 1 B PRO 259 ? B PRO 259 
14 1 Y 1 B GLY 260 ? B GLY 260 
15 1 Y 1 B GLY 261 ? B GLY 261 
16 1 Y 1 B ALA 262 ? B ALA 262 
17 1 Y 1 B GLY 263 ? B GLY 263 
18 1 Y 1 B GLY 264 ? B GLY 264 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(2-hydroxyethoxy)acetaldehyde'       1KA 
3 2,5,8,11,14,17-HEXAOXANONADECAN-19-OL P15 
4 water                                 HOH 
#