data_3ZNS
# 
_entry.id   3ZNS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ZNS         
PDBE  EBI-55849    
WWPDB D_1290055849 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3ZNR 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'HDAC7 BOUND WITH INHIBITOR TMP269' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ZNS 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-02-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lobera, M.'     1 
'Madauss, K.P.'  2 
'Pohlhaus, D.T.' 3 
'Trump, R.P.'    4 
'Nolan, M.A.'    5 
# 
_citation.id                        primary 
_citation.title                     'Selective Class Iia Histone Deacetylase Inhibition Via a Non-Chelating Zinc Binding Group' 
_citation.journal_abbrev            Nat.Chem.Biol. 
_citation.journal_volume            9 
_citation.page_first                319 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1552-4450 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23524983 
_citation.pdbx_database_id_DOI      10.1038/NCHEMBIO.1223 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lobera, M.'          1  
primary 'Madauss, K.P.'       2  
primary 'Pohlhaus, D.T.'      3  
primary 'Wright, Q.G.'        4  
primary 'Trocha, M.'          5  
primary 'Schmidt, D.R.'       6  
primary 'Baloglu, E.'         7  
primary 'Trump, R.P.'         8  
primary 'Head, M.S.'          9  
primary 'Hofmann, G.A.'       10 
primary 'Murray-Thompson, M.' 11 
primary 'Schwartz, B.'        12 
primary 'Chakravorty, S.'     13 
primary 'Wu, Z.'              14 
primary 'Mander, P.K.'        15 
primary 'Kruidenier, L.'      16 
primary 'Reid, R.A.'          17 
primary 'Burkhart, W.'        18 
primary 'Turunen, B.J.'       19 
primary 'Rong, J.X.'          20 
primary 'Wagner, C.'          21 
primary 'Moyer, M.B.'         22 
primary 'Wells, C.'           23 
primary 'Hong, X.'            24 
primary 'Moore, J.T.'         25 
primary 'Williams, J.D.'      26 
primary 'Soler, D.'           27 
primary 'Ghosh, S.'           28 
primary 'Nolan, M.A.'         29 
# 
_cell.entry_id           3ZNS 
_cell.length_a           81.570 
_cell.length_b           81.570 
_cell.length_c           150.101 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              9 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3ZNS 
_symmetry.space_group_name_H-M             'P 32' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                145 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HISTONE DEACETYLASE 7' 45518.340 3   3.5.1.98 ? 'CATALYTIC DOMAIN' INHIBITOR 
2 non-polymer syn 'ZINC ION' 65.409    6   ?        ? ?                  ?         
3 non-polymer syn 'POTASSIUM ION' 39.098    6   ?        ? ?                  ?         
4 non-polymer syn 
'N-{[1-methyl-4-(4-phenyl-1,3-thiazol-2-yl)piperidin-4-yl]methyl}-3-[5-(trifluoromethyl)-1,2,4-oxadiazol-3-yl]benzamide' 527.561   
3   ?        ? ?                  ?         
5 water       nat water 18.015    133 ?        ? ?                  ?         
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HDAC7, HD7, HISTONE DEACETYLASE 7A, HD7A' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGL
RSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARW
AAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQ
DPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGF
DAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALEGGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNA
IRSLEAVIRVHSKYWGCMQRLAS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGL
RSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARW
AAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQ
DPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGF
DAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALEGGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNA
IRSLEAVIRVHSKYWGCMQRLAS
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ARG n 
1 4   ALA n 
1 5   GLN n 
1 6   SER n 
1 7   SER n 
1 8   PRO n 
1 9   ALA n 
1 10  ALA n 
1 11  PRO n 
1 12  ALA n 
1 13  SER n 
1 14  LEU n 
1 15  SER n 
1 16  ALA n 
1 17  PRO n 
1 18  GLU n 
1 19  PRO n 
1 20  ALA n 
1 21  SER n 
1 22  GLN n 
1 23  ALA n 
1 24  ARG n 
1 25  VAL n 
1 26  LEU n 
1 27  SER n 
1 28  SER n 
1 29  SER n 
1 30  GLU n 
1 31  THR n 
1 32  PRO n 
1 33  ALA n 
1 34  ARG n 
1 35  THR n 
1 36  LEU n 
1 37  PRO n 
1 38  PHE n 
1 39  THR n 
1 40  THR n 
1 41  GLY n 
1 42  LEU n 
1 43  ILE n 
1 44  TYR n 
1 45  ASP n 
1 46  SER n 
1 47  VAL n 
1 48  MET n 
1 49  LEU n 
1 50  LYS n 
1 51  HIS n 
1 52  GLN n 
1 53  CYS n 
1 54  SER n 
1 55  CYS n 
1 56  GLY n 
1 57  ASP n 
1 58  ASN n 
1 59  SER n 
1 60  ARG n 
1 61  HIS n 
1 62  PRO n 
1 63  GLU n 
1 64  HIS n 
1 65  ALA n 
1 66  GLY n 
1 67  ARG n 
1 68  ILE n 
1 69  GLN n 
1 70  SER n 
1 71  ILE n 
1 72  TRP n 
1 73  SER n 
1 74  ARG n 
1 75  LEU n 
1 76  GLN n 
1 77  GLU n 
1 78  ARG n 
1 79  GLY n 
1 80  LEU n 
1 81  ARG n 
1 82  SER n 
1 83  GLN n 
1 84  CYS n 
1 85  GLU n 
1 86  CYS n 
1 87  LEU n 
1 88  ARG n 
1 89  GLY n 
1 90  ARG n 
1 91  LYS n 
1 92  ALA n 
1 93  SER n 
1 94  LEU n 
1 95  GLU n 
1 96  GLU n 
1 97  LEU n 
1 98  GLN n 
1 99  SER n 
1 100 VAL n 
1 101 HIS n 
1 102 SER n 
1 103 GLU n 
1 104 ARG n 
1 105 HIS n 
1 106 VAL n 
1 107 LEU n 
1 108 LEU n 
1 109 TYR n 
1 110 GLY n 
1 111 THR n 
1 112 ASN n 
1 113 PRO n 
1 114 LEU n 
1 115 SER n 
1 116 ARG n 
1 117 LEU n 
1 118 LYS n 
1 119 LEU n 
1 120 ASP n 
1 121 ASN n 
1 122 GLY n 
1 123 LYS n 
1 124 LEU n 
1 125 ALA n 
1 126 GLY n 
1 127 LEU n 
1 128 LEU n 
1 129 ALA n 
1 130 GLN n 
1 131 ARG n 
1 132 MET n 
1 133 PHE n 
1 134 VAL n 
1 135 MET n 
1 136 LEU n 
1 137 PRO n 
1 138 CYS n 
1 139 GLY n 
1 140 GLY n 
1 141 VAL n 
1 142 GLY n 
1 143 VAL n 
1 144 ASP n 
1 145 THR n 
1 146 ASP n 
1 147 THR n 
1 148 ILE n 
1 149 TRP n 
1 150 ASN n 
1 151 GLU n 
1 152 LEU n 
1 153 HIS n 
1 154 SER n 
1 155 SER n 
1 156 ASN n 
1 157 ALA n 
1 158 ALA n 
1 159 ARG n 
1 160 TRP n 
1 161 ALA n 
1 162 ALA n 
1 163 GLY n 
1 164 SER n 
1 165 VAL n 
1 166 THR n 
1 167 ASP n 
1 168 LEU n 
1 169 ALA n 
1 170 PHE n 
1 171 LYS n 
1 172 VAL n 
1 173 ALA n 
1 174 SER n 
1 175 ARG n 
1 176 GLU n 
1 177 LEU n 
1 178 LYS n 
1 179 ASN n 
1 180 GLY n 
1 181 PHE n 
1 182 ALA n 
1 183 VAL n 
1 184 VAL n 
1 185 ARG n 
1 186 PRO n 
1 187 PRO n 
1 188 GLY n 
1 189 HIS n 
1 190 HIS n 
1 191 ALA n 
1 192 ASP n 
1 193 HIS n 
1 194 SER n 
1 195 THR n 
1 196 ALA n 
1 197 MET n 
1 198 GLY n 
1 199 PHE n 
1 200 CYS n 
1 201 PHE n 
1 202 PHE n 
1 203 ASN n 
1 204 SER n 
1 205 VAL n 
1 206 ALA n 
1 207 ILE n 
1 208 ALA n 
1 209 CYS n 
1 210 ARG n 
1 211 GLN n 
1 212 LEU n 
1 213 GLN n 
1 214 GLN n 
1 215 GLN n 
1 216 SER n 
1 217 LYS n 
1 218 ALA n 
1 219 SER n 
1 220 LYS n 
1 221 ILE n 
1 222 LEU n 
1 223 ILE n 
1 224 VAL n 
1 225 ASP n 
1 226 TRP n 
1 227 ASP n 
1 228 VAL n 
1 229 HIS n 
1 230 HIS n 
1 231 GLY n 
1 232 ASN n 
1 233 GLY n 
1 234 THR n 
1 235 GLN n 
1 236 GLN n 
1 237 THR n 
1 238 PHE n 
1 239 TYR n 
1 240 GLN n 
1 241 ASP n 
1 242 PRO n 
1 243 SER n 
1 244 VAL n 
1 245 LEU n 
1 246 TYR n 
1 247 ILE n 
1 248 SER n 
1 249 LEU n 
1 250 HIS n 
1 251 ARG n 
1 252 HIS n 
1 253 ASP n 
1 254 ASP n 
1 255 GLY n 
1 256 ASN n 
1 257 PHE n 
1 258 PHE n 
1 259 PRO n 
1 260 GLY n 
1 261 SER n 
1 262 GLY n 
1 263 ALA n 
1 264 VAL n 
1 265 ASP n 
1 266 GLU n 
1 267 VAL n 
1 268 GLY n 
1 269 ALA n 
1 270 GLY n 
1 271 SER n 
1 272 GLY n 
1 273 GLU n 
1 274 GLY n 
1 275 PHE n 
1 276 ASN n 
1 277 VAL n 
1 278 ASN n 
1 279 VAL n 
1 280 ALA n 
1 281 TRP n 
1 282 ALA n 
1 283 GLY n 
1 284 GLY n 
1 285 LEU n 
1 286 ASP n 
1 287 PRO n 
1 288 PRO n 
1 289 MET n 
1 290 GLY n 
1 291 ASP n 
1 292 PRO n 
1 293 GLU n 
1 294 TYR n 
1 295 LEU n 
1 296 ALA n 
1 297 ALA n 
1 298 PHE n 
1 299 ARG n 
1 300 ILE n 
1 301 VAL n 
1 302 VAL n 
1 303 MET n 
1 304 PRO n 
1 305 ILE n 
1 306 ALA n 
1 307 ARG n 
1 308 GLU n 
1 309 PHE n 
1 310 SER n 
1 311 PRO n 
1 312 ASP n 
1 313 LEU n 
1 314 VAL n 
1 315 LEU n 
1 316 VAL n 
1 317 SER n 
1 318 ALA n 
1 319 GLY n 
1 320 PHE n 
1 321 ASP n 
1 322 ALA n 
1 323 ALA n 
1 324 GLU n 
1 325 GLY n 
1 326 HIS n 
1 327 PRO n 
1 328 ALA n 
1 329 PRO n 
1 330 LEU n 
1 331 GLY n 
1 332 GLY n 
1 333 TYR n 
1 334 HIS n 
1 335 VAL n 
1 336 SER n 
1 337 ALA n 
1 338 LYS n 
1 339 CYS n 
1 340 PHE n 
1 341 GLY n 
1 342 TYR n 
1 343 MET n 
1 344 THR n 
1 345 GLN n 
1 346 GLN n 
1 347 LEU n 
1 348 MET n 
1 349 ASN n 
1 350 LEU n 
1 351 ALA n 
1 352 GLY n 
1 353 GLY n 
1 354 ALA n 
1 355 VAL n 
1 356 VAL n 
1 357 LEU n 
1 358 ALA n 
1 359 LEU n 
1 360 GLU n 
1 361 GLY n 
1 362 GLY n 
1 363 HIS n 
1 364 ASP n 
1 365 LEU n 
1 366 THR n 
1 367 ALA n 
1 368 ILE n 
1 369 CYS n 
1 370 ASP n 
1 371 ALA n 
1 372 SER n 
1 373 GLU n 
1 374 ALA n 
1 375 CYS n 
1 376 VAL n 
1 377 ALA n 
1 378 ALA n 
1 379 LEU n 
1 380 LEU n 
1 381 GLY n 
1 382 ASN n 
1 383 ARG n 
1 384 VAL n 
1 385 ASP n 
1 386 PRO n 
1 387 LEU n 
1 388 SER n 
1 389 GLU n 
1 390 GLU n 
1 391 GLY n 
1 392 TRP n 
1 393 LYS n 
1 394 GLN n 
1 395 LYS n 
1 396 PRO n 
1 397 ASN n 
1 398 LEU n 
1 399 ASN n 
1 400 ALA n 
1 401 ILE n 
1 402 ARG n 
1 403 SER n 
1 404 LEU n 
1 405 GLU n 
1 406 ALA n 
1 407 VAL n 
1 408 ILE n 
1 409 ARG n 
1 410 VAL n 
1 411 HIS n 
1 412 SER n 
1 413 LYS n 
1 414 TYR n 
1 415 TRP n 
1 416 GLY n 
1 417 CYS n 
1 418 MET n 
1 419 GLN n 
1 420 ARG n 
1 421 LEU n 
1 422 ALA n 
1 423 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HDAC7_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q8WUI4 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ZNS A 2 ? 423 ? Q8WUI4 482 ? 903 ? 482 903 
2 1 3ZNS B 2 ? 423 ? Q8WUI4 482 ? 903 ? 482 903 
3 1 3ZNS C 2 ? 423 ? Q8WUI4 482 ? 903 ? 482 903 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ZNS GLY A 1 ? UNP Q8WUI4 ? ? 'expression tag' 481 1 
2 3ZNS GLY B 1 ? UNP Q8WUI4 ? ? 'expression tag' 481 2 
3 3ZNS GLY C 1 ? UNP Q8WUI4 ? ? 'expression tag' 481 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER ? 'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'        131.173 
K   non-polymer         . 'POTASSIUM ION' ? 'K 1'                39.098  
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'      149.211 
NU7 non-polymer         . 
'N-{[1-methyl-4-(4-phenyl-1,3-thiazol-2-yl)piperidin-4-yl]methyl}-3-[5-(trifluoromethyl)-1,2,4-oxadiazol-3-yl]benzamide' ? 
'C26 H24 F3 N5 O2 S' 527.561 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'        117.146 
ZN  non-polymer         . 'ZINC ION' ? 'Zn 2'               65.409  
# 
_exptl.entry_id          3ZNS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_percent_sol   41.74 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '10% PEG 3350, 3% ISOPROPANAL, HEPES PH7.5, pH 7.4' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARRESEARCH MX-300' 
_diffrn_detector.pdbx_collection_date   2010-03-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-G' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-G 
_diffrn_source.pdbx_wavelength             0.97 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3ZNS 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.45 
_reflns.number_obs                   38814 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        30.30 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.45 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           0.50 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.60 
_reflns_shell.pdbx_redundancy        5.9 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3ZNS 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     38814 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             70.71 
_refine.ls_d_res_high                            2.45 
_refine.ls_percent_reflns_obs                    99.78 
_refine.ls_R_factor_obs                          0.18814 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18619 
_refine.ls_R_factor_R_free                       0.22496 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2054 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.939 
_refine.B_iso_mean                               26.288 
_refine.aniso_B[1][1]                            2.16 
_refine.aniso_B[2][2]                            2.16 
_refine.aniso_B[3][3]                            -3.24 
_refine.aniso_B[1][2]                            1.08 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.649 
_refine.pdbx_overall_ESU_R_Free                  0.264 
_refine.overall_SU_ML                            0.210 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             20.711 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8345 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         123 
_refine_hist.number_atoms_solvent             133 
_refine_hist.number_atoms_total               8601 
_refine_hist.d_res_high                       2.45 
_refine_hist.d_res_low                        70.71 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.021  ? 8669  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 5693  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.964  1.949  ? 11785 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.801  3.000  ? 13813 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.253  5.000  ? 1101  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.066 23.789 ? 388   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.883 15.000 ? 1290  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.677 15.000 ? 52    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.053  0.200  ? 1263  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.021  ? 9915  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1804  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.208  1.500  ? 5463  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.032  1.500  ? 2275  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.395  2.000  ? 8675  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.574  3.000  ? 3206  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 0.952  4.500  ? 3110  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.452 
_refine_ls_shell.d_res_low                        2.516 
_refine_ls_shell.number_reflns_R_work             2861 
_refine_ls_shell.R_factor_R_work                  0.237 
_refine_ls_shell.percent_reflns_obs               99.31 
_refine_ls_shell.R_factor_R_free                  0.274 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             163 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  3ZNS 
_struct.title                     'HDAC7 bound with TFMO inhibitor tmp942' 
_struct.pdbx_descriptor           'HISTONE DEACETYLASE 7 (E.C.3.5.1.98)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ZNS 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, ZBG, MBG' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 2 ? 
J N N 2 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 2 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 4 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 45  ? HIS A 51  ? ASP A 525 HIS A 531 5 ? 7  
HELX_P HELX_P2  2  ALA A 65  ? ARG A 78  ? ALA A 545 ARG A 558 1 ? 14 
HELX_P HELX_P3  3  LEU A 80  ? CYS A 84  ? LEU A 560 CYS A 564 5 ? 5  
HELX_P HELX_P4  4  SER A 93  ? SER A 99  ? SER A 573 SER A 579 1 ? 7  
HELX_P HELX_P5  5  SER A 102 ? THR A 111 ? SER A 582 THR A 591 1 ? 10 
HELX_P HELX_P6  6  HIS A 153 ? SER A 174 ? HIS A 633 SER A 654 1 ? 22 
HELX_P HELX_P7  7  ASN A 203 ? GLN A 215 ? ASN A 683 GLN A 695 1 ? 13 
HELX_P HELX_P8  8  GLY A 231 ? PHE A 238 ? GLY A 711 PHE A 718 1 ? 8  
HELX_P HELX_P9  9  ASP A 253 ? ASN A 256 ? ASP A 733 ASN A 736 5 ? 4  
HELX_P HELX_P10 10 ALA A 269 ? GLU A 273 ? ALA A 749 GLU A 753 5 ? 5  
HELX_P HELX_P11 11 GLY A 290 ? VAL A 301 ? GLY A 770 VAL A 781 1 ? 12 
HELX_P HELX_P12 12 VAL A 301 ? SER A 310 ? VAL A 781 SER A 790 1 ? 10 
HELX_P HELX_P13 13 SER A 336 ? MET A 348 ? SER A 816 MET A 828 1 ? 13 
HELX_P HELX_P14 14 ASN A 349 ? GLY A 353 ? ASN A 829 GLY A 833 5 ? 5  
HELX_P HELX_P15 15 ASP A 364 ? LEU A 380 ? ASP A 844 LEU A 860 1 ? 17 
HELX_P HELX_P16 16 ASP A 385 ? GLU A 389 ? ASP A 865 GLU A 869 5 ? 5  
HELX_P HELX_P17 17 ASN A 397 ? SER A 412 ? ASN A 877 SER A 892 1 ? 16 
HELX_P HELX_P18 18 TRP A 415 ? GLN A 419 ? TRP A 895 GLN A 899 5 ? 5  
HELX_P HELX_P19 19 ASP B 45  ? HIS B 51  ? ASP B 525 HIS B 531 5 ? 7  
HELX_P HELX_P20 20 ALA B 65  ? ARG B 78  ? ALA B 545 ARG B 558 1 ? 14 
HELX_P HELX_P21 21 LEU B 80  ? SER B 82  ? LEU B 560 SER B 562 5 ? 3  
HELX_P HELX_P22 22 SER B 93  ? GLN B 98  ? SER B 573 GLN B 578 1 ? 6  
HELX_P HELX_P23 23 SER B 102 ? THR B 111 ? SER B 582 THR B 591 1 ? 10 
HELX_P HELX_P24 24 ASP B 120 ? GLN B 130 ? ASP B 600 GLN B 610 1 ? 11 
HELX_P HELX_P25 25 HIS B 153 ? SER B 174 ? HIS B 633 SER B 654 1 ? 22 
HELX_P HELX_P26 26 ASN B 203 ? SER B 216 ? ASN B 683 SER B 696 1 ? 14 
HELX_P HELX_P27 27 GLY B 231 ? TYR B 239 ? GLY B 711 TYR B 719 1 ? 9  
HELX_P HELX_P28 28 ALA B 269 ? GLU B 273 ? ALA B 749 GLU B 753 5 ? 5  
HELX_P HELX_P29 29 GLY B 290 ? VAL B 301 ? GLY B 770 VAL B 781 1 ? 12 
HELX_P HELX_P30 30 VAL B 301 ? SER B 310 ? VAL B 781 SER B 790 1 ? 10 
HELX_P HELX_P31 31 SER B 336 ? MET B 348 ? SER B 816 MET B 828 1 ? 13 
HELX_P HELX_P32 32 ASN B 349 ? GLY B 353 ? ASN B 829 GLY B 833 5 ? 5  
HELX_P HELX_P33 33 ASP B 364 ? LEU B 380 ? ASP B 844 LEU B 860 1 ? 17 
HELX_P HELX_P34 34 ASP B 385 ? GLU B 389 ? ASP B 865 GLU B 869 5 ? 5  
HELX_P HELX_P35 35 GLU B 389 ? GLN B 394 ? GLU B 869 GLN B 874 5 ? 6  
HELX_P HELX_P36 36 ASN B 397 ? SER B 412 ? ASN B 877 SER B 892 1 ? 16 
HELX_P HELX_P37 37 TRP B 415 ? GLN B 419 ? TRP B 895 GLN B 899 5 ? 5  
HELX_P HELX_P38 38 ASP C 45  ? HIS C 51  ? ASP C 525 HIS C 531 5 ? 7  
HELX_P HELX_P39 39 ALA C 65  ? ARG C 78  ? ALA C 545 ARG C 558 1 ? 14 
HELX_P HELX_P40 40 LEU C 80  ? CYS C 84  ? LEU C 560 CYS C 564 5 ? 5  
HELX_P HELX_P41 41 SER C 93  ? SER C 99  ? SER C 573 SER C 579 1 ? 7  
HELX_P HELX_P42 42 SER C 102 ? THR C 111 ? SER C 582 THR C 591 1 ? 10 
HELX_P HELX_P43 43 HIS C 153 ? SER C 174 ? HIS C 633 SER C 654 1 ? 22 
HELX_P HELX_P44 44 ASN C 203 ? GLN C 215 ? ASN C 683 GLN C 695 1 ? 13 
HELX_P HELX_P45 45 GLY C 231 ? PHE C 238 ? GLY C 711 PHE C 718 1 ? 8  
HELX_P HELX_P46 46 ALA C 269 ? GLU C 273 ? ALA C 749 GLU C 753 5 ? 5  
HELX_P HELX_P47 47 GLY C 290 ? VAL C 301 ? GLY C 770 VAL C 781 1 ? 12 
HELX_P HELX_P48 48 VAL C 301 ? SER C 310 ? VAL C 781 SER C 790 1 ? 10 
HELX_P HELX_P49 49 SER C 336 ? ASN C 349 ? SER C 816 ASN C 829 1 ? 14 
HELX_P HELX_P50 50 LEU C 350 ? GLY C 353 ? LEU C 830 GLY C 833 5 ? 4  
HELX_P HELX_P51 51 ASP C 364 ? LEU C 380 ? ASP C 844 LEU C 860 1 ? 17 
HELX_P HELX_P52 52 ASP C 385 ? GLU C 389 ? ASP C 865 GLU C 869 5 ? 5  
HELX_P HELX_P53 53 GLU C 389 ? GLN C 394 ? GLU C 869 GLN C 874 5 ? 6  
HELX_P HELX_P54 54 ASN C 397 ? SER C 412 ? ASN C 877 SER C 892 1 ? 16 
HELX_P HELX_P55 55 TRP C 415 ? GLN C 419 ? TRP C 895 GLN C 899 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D ZN  .  ZN ? ? ? 1_555 A HIS 229 ND1 ? ? A ZN  101 A HIS 709  1_555 ? ? ? ? ? ? ? 1.958 ? 
metalc2  metalc ? ? D ZN  .  ZN ? ? ? 1_555 A ASP 321 OD2 ? ? A ZN  101 A ASP 801  1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc3  metalc ? ? D ZN  .  ZN ? ? ? 1_555 A ASP 227 OD1 ? ? A ZN  101 A ASP 707  1_555 ? ? ? ? ? ? ? 2.009 ? 
metalc4  metalc ? ? E ZN  .  ZN ? ? ? 1_555 A CYS 53  SG  ? ? A ZN  102 A CYS 533  1_555 ? ? ? ? ? ? ? 2.418 ? 
metalc5  metalc ? ? E ZN  .  ZN ? ? ? 1_555 A HIS 61  NE2 ? ? A ZN  102 A HIS 541  1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc6  metalc ? ? E ZN  .  ZN ? ? ? 1_555 A CYS 138 SG  ? ? A ZN  102 A CYS 618  1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc7  metalc ? ? E ZN  .  ZN ? ? ? 1_555 A CYS 55  SG  ? ? A ZN  102 A CYS 535  1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc8  metalc ? ? F K   .  K  ? ? ? 1_555 A ASP 225 OD1 ? ? A K   201 A ASP 705  1_555 ? ? ? ? ? ? ? 2.870 ? 
metalc9  metalc ? ? F K   .  K  ? ? ? 1_555 A SER 248 OG  ? ? A K   201 A SER 728  1_555 ? ? ? ? ? ? ? 2.785 ? 
metalc10 metalc ? ? F K   .  K  ? ? ? 1_555 A ASP 227 O   ? ? A K   201 A ASP 707  1_555 ? ? ? ? ? ? ? 2.521 ? 
metalc11 metalc ? ? F K   .  K  ? ? ? 1_555 A HIS 229 O   ? ? A K   201 A HIS 709  1_555 ? ? ? ? ? ? ? 2.855 ? 
metalc12 metalc ? ? F K   .  K  ? ? ? 1_555 A ASP 225 O   ? ? A K   201 A ASP 705  1_555 ? ? ? ? ? ? ? 2.942 ? 
metalc13 metalc ? ? F K   .  K  ? ? ? 1_555 A LEU 249 O   ? ? A K   201 A LEU 729  1_555 ? ? ? ? ? ? ? 3.011 ? 
metalc14 metalc ? ? G K   .  K  ? ? ? 1_555 A ASP 241 O   ? ? A K   202 A ASP 721  1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc15 metalc ? ? G K   .  K  ? ? ? 1_555 A VAL 244 O   ? ? A K   202 A VAL 724  1_555 ? ? ? ? ? ? ? 2.630 ? 
metalc16 metalc ? ? G K   .  K  ? ? ? 1_555 A PHE 275 O   ? ? A K   202 A PHE 755  1_555 ? ? ? ? ? ? ? 3.411 ? 
metalc17 metalc ? ? G K   .  K  ? ? ? 1_555 A PHE 238 O   ? ? A K   202 A PHE 718  1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc18 metalc ? ? I ZN  .  ZN ? ? ? 1_555 B HIS 229 ND1 ? ? B ZN  101 B HIS 709  1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc19 metalc ? ? I ZN  .  ZN ? ? ? 1_555 B ASP 227 OD1 ? ? B ZN  101 B ASP 707  1_555 ? ? ? ? ? ? ? 1.989 ? 
metalc20 metalc ? ? I ZN  .  ZN ? ? ? 1_555 B ASP 321 OD2 ? ? B ZN  101 B ASP 801  1_555 ? ? ? ? ? ? ? 1.860 ? 
metalc21 metalc ? ? J ZN  .  ZN ? ? ? 1_555 B CYS 55  SG  ? ? B ZN  102 B CYS 535  1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc22 metalc ? ? J ZN  .  ZN ? ? ? 1_555 B CYS 138 SG  ? ? B ZN  102 B CYS 618  1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc23 metalc ? ? J ZN  .  ZN ? ? ? 1_555 B HIS 61  NE2 ? ? B ZN  102 B HIS 541  1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc24 metalc ? ? J ZN  .  ZN ? ? ? 1_555 B CYS 53  SG  ? ? B ZN  102 B CYS 533  1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc25 metalc ? ? K K   .  K  ? ? ? 1_555 B SER 248 OG  ? ? B K   201 B SER 728  1_555 ? ? ? ? ? ? ? 2.768 ? 
metalc26 metalc ? ? K K   .  K  ? ? ? 1_555 B ASP 225 O   ? ? B K   201 B ASP 705  1_555 ? ? ? ? ? ? ? 2.863 ? 
metalc27 metalc ? ? K K   .  K  ? ? ? 1_555 B LEU 249 O   ? ? B K   201 B LEU 729  1_555 ? ? ? ? ? ? ? 2.780 ? 
metalc28 metalc ? ? K K   .  K  ? ? ? 1_555 B ASP 225 OD1 ? ? B K   201 B ASP 705  1_555 ? ? ? ? ? ? ? 3.089 ? 
metalc29 metalc ? ? K K   .  K  ? ? ? 1_555 B ASP 227 O   ? ? B K   201 B ASP 707  1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc30 metalc ? ? K K   .  K  ? ? ? 1_555 B HIS 229 O   ? ? B K   201 B HIS 709  1_555 ? ? ? ? ? ? ? 2.802 ? 
metalc31 metalc ? ? L K   .  K  ? ? ? 1_555 B ASP 241 O   ? ? B K   202 B ASP 721  1_555 ? ? ? ? ? ? ? 2.661 ? 
metalc32 metalc ? ? L K   .  K  ? ? ? 1_555 B PHE 275 O   ? ? B K   202 B PHE 755  1_555 ? ? ? ? ? ? ? 3.405 ? 
metalc33 metalc ? ? L K   .  K  ? ? ? 1_555 B PHE 238 O   ? ? B K   202 B PHE 718  1_555 ? ? ? ? ? ? ? 2.529 ? 
metalc34 metalc ? ? L K   .  K  ? ? ? 1_555 B VAL 244 O   ? ? B K   202 B VAL 724  1_555 ? ? ? ? ? ? ? 2.606 ? 
metalc35 metalc ? ? N ZN  .  ZN ? ? ? 1_555 C ASP 321 OD2 ? ? C ZN  101 C ASP 801  1_555 ? ? ? ? ? ? ? 1.917 ? 
metalc36 metalc ? ? N ZN  .  ZN ? ? ? 1_555 R NU7 .   O09 ? ? C ZN  101 C NU7 1900 1_555 ? ? ? ? ? ? ? 2.579 ? 
metalc37 metalc ? ? N ZN  .  ZN ? ? ? 1_555 C HIS 229 ND1 ? ? C ZN  101 C HIS 709  1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc38 metalc ? ? N ZN  .  ZN ? ? ? 1_555 C ASP 227 OD1 ? ? C ZN  101 C ASP 707  1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc39 metalc ? ? O ZN  .  ZN ? ? ? 1_555 C CYS 53  SG  ? ? C ZN  102 C CYS 533  1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc40 metalc ? ? O ZN  .  ZN ? ? ? 1_555 C HIS 61  NE2 ? ? C ZN  102 C HIS 541  1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc41 metalc ? ? O ZN  .  ZN ? ? ? 1_555 C CYS 138 SG  ? ? C ZN  102 C CYS 618  1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc42 metalc ? ? P K   .  K  ? ? ? 1_555 C SER 248 OG  ? ? C K   201 C SER 728  1_555 ? ? ? ? ? ? ? 2.749 ? 
metalc43 metalc ? ? P K   .  K  ? ? ? 1_555 C HIS 229 O   ? ? C K   201 C HIS 709  1_555 ? ? ? ? ? ? ? 2.797 ? 
metalc44 metalc ? ? P K   .  K  ? ? ? 1_555 C ASP 227 O   ? ? C K   201 C ASP 707  1_555 ? ? ? ? ? ? ? 2.656 ? 
metalc45 metalc ? ? P K   .  K  ? ? ? 1_555 C ASP 225 OD1 ? ? C K   201 C ASP 705  1_555 ? ? ? ? ? ? ? 3.118 ? 
metalc46 metalc ? ? P K   .  K  ? ? ? 1_555 C ASP 225 O   ? ? C K   201 C ASP 705  1_555 ? ? ? ? ? ? ? 2.810 ? 
metalc47 metalc ? ? P K   .  K  ? ? ? 1_555 C LEU 249 O   ? ? C K   201 C LEU 729  1_555 ? ? ? ? ? ? ? 3.301 ? 
metalc48 metalc ? ? Q K   .  K  ? ? ? 1_555 C VAL 244 O   ? ? C K   202 C VAL 724  1_555 ? ? ? ? ? ? ? 2.876 ? 
metalc49 metalc ? ? Q K   .  K  ? ? ? 1_555 C PHE 238 O   ? ? C K   202 C PHE 718  1_555 ? ? ? ? ? ? ? 2.673 ? 
metalc50 metalc ? ? Q K   .  K  ? ? ? 1_555 C PHE 275 O   ? ? C K   202 C PHE 755  1_555 ? ? ? ? ? ? ? 2.911 ? 
metalc51 metalc ? ? C CYS 55 SG ? ? ? 1_555 O ZN  .   ZN  ? ? C CYS 535 C ZN  102  1_555 ? ? ? ? ? ? ? 1.878 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ARG 185 A . ? ARG 665 A PRO 186 A ? PRO 666 A 1 0.12  
2  PHE 258 A . ? PHE 738 A PRO 259 A ? PRO 739 A 1 1.73  
3  ASP 286 A . ? ASP 766 A PRO 287 A ? PRO 767 A 1 1.72  
4  ALA 328 A . ? ALA 808 A PRO 329 A ? PRO 809 A 1 -4.66 
5  PRO 113 B . ? PRO 593 B LEU 114 B ? LEU 594 B 1 -5.66 
6  ARG 185 B . ? ARG 665 B PRO 186 B ? PRO 666 B 1 -0.53 
7  PHE 258 B . ? PHE 738 B PRO 259 B ? PRO 739 B 1 -0.36 
8  ASP 286 B . ? ASP 766 B PRO 287 B ? PRO 767 B 1 2.45  
9  ASN 112 C . ? ASN 592 C PRO 113 C ? PRO 593 C 1 -3.31 
10 ARG 185 C . ? ARG 665 C PRO 186 C ? PRO 666 C 1 -1.24 
11 PHE 258 C . ? PHE 738 C PRO 259 C ? PRO 739 C 1 0.43  
12 ASP 286 C . ? ASP 766 C PRO 287 C ? PRO 767 C 1 -0.79 
13 ALA 328 C . ? ALA 808 C PRO 329 C ? PRO 809 C 1 3.28  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
BA ? 8 ? 
CA ? 8 ? 
CB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AA 7 8 ? parallel      
BA 1 2 ? parallel      
BA 2 3 ? parallel      
BA 3 4 ? parallel      
BA 4 5 ? parallel      
BA 5 6 ? parallel      
BA 6 7 ? parallel      
BA 7 8 ? parallel      
CA 1 2 ? parallel      
CA 2 3 ? parallel      
CA 3 4 ? parallel      
CA 4 5 ? parallel      
CA 5 6 ? parallel      
CA 6 7 ? parallel      
CA 7 8 ? parallel      
CB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLU A 85  ? LEU A 87  ? GLU A 565 LEU A 567 
AA 2 THR A 40  ? ILE A 43  ? THR A 520 ILE A 523 
AA 3 ASN A 179 ? ALA A 182 ? ASN A 659 ALA A 662 
AA 4 VAL A 355 ? LEU A 359 ? VAL A 835 LEU A 839 
AA 5 LEU A 313 ? ALA A 318 ? LEU A 793 ALA A 798 
AA 6 ILE A 221 ? ASP A 225 ? ILE A 701 ASP A 705 
AA 7 VAL A 244 ? ARG A 251 ? VAL A 724 ARG A 731 
AA 8 ASN A 276 ? TRP A 281 ? ASN A 756 TRP A 761 
BA 1 CYS B 84  ? LEU B 87  ? CYS B 564 LEU B 567 
BA 2 THR B 40  ? ILE B 43  ? THR B 520 ILE B 523 
BA 3 ASN B 179 ? ALA B 182 ? ASN B 659 ALA B 662 
BA 4 VAL B 355 ? LEU B 359 ? VAL B 835 LEU B 839 
BA 5 LEU B 313 ? ALA B 318 ? LEU B 793 ALA B 798 
BA 6 ILE B 221 ? ASP B 225 ? ILE B 701 ASP B 705 
BA 7 VAL B 244 ? ARG B 251 ? VAL B 724 ARG B 731 
BA 8 ASN B 276 ? TRP B 281 ? ASN B 756 TRP B 761 
CA 1 GLU C 85  ? LEU C 87  ? GLU C 565 LEU C 567 
CA 2 THR C 40  ? ILE C 43  ? THR C 520 ILE C 523 
CA 3 ASN C 179 ? ALA C 182 ? ASN C 659 ALA C 662 
CA 4 VAL C 355 ? LEU C 359 ? VAL C 835 LEU C 839 
CA 5 LEU C 313 ? ALA C 318 ? LEU C 793 ALA C 798 
CA 6 ILE C 221 ? ASP C 225 ? ILE C 701 ASP C 705 
CA 7 VAL C 244 ? ARG C 251 ? VAL C 724 ARG C 731 
CA 8 ASN C 276 ? TRP C 281 ? ASN C 756 TRP C 761 
CB 1 VAL C 141 ? GLY C 142 ? VAL C 621 GLY C 622 
CB 2 ILE C 148 ? TRP C 149 ? ILE C 628 TRP C 629 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 85  ? N GLU A 565 O THR A 40  ? O THR A 520 
AA 2 3 N GLY A 41  ? N GLY A 521 O ASN A 179 ? O ASN A 659 
AA 3 4 N GLY A 180 ? N GLY A 660 O VAL A 355 ? O VAL A 835 
AA 4 5 N VAL A 356 ? N VAL A 836 O VAL A 314 ? O VAL A 794 
AA 5 6 N LEU A 315 ? N LEU A 795 O LEU A 222 ? O LEU A 702 
AA 6 7 N ILE A 223 ? N ILE A 703 O LEU A 245 ? O LEU A 725 
AA 7 8 N SER A 248 ? N SER A 728 O VAL A 277 ? O VAL A 757 
BA 1 2 N GLU B 85  ? N GLU B 565 O THR B 40  ? O THR B 520 
BA 2 3 N GLY B 41  ? N GLY B 521 O ASN B 179 ? O ASN B 659 
BA 3 4 N GLY B 180 ? N GLY B 660 O VAL B 355 ? O VAL B 835 
BA 4 5 N VAL B 356 ? N VAL B 836 O VAL B 314 ? O VAL B 794 
BA 5 6 N LEU B 315 ? N LEU B 795 O LEU B 222 ? O LEU B 702 
BA 6 7 N ILE B 223 ? N ILE B 703 O LEU B 245 ? O LEU B 725 
BA 7 8 N SER B 248 ? N SER B 728 O VAL B 277 ? O VAL B 757 
CA 1 2 N GLU C 85  ? N GLU C 565 O THR C 40  ? O THR C 520 
CA 2 3 N GLY C 41  ? N GLY C 521 O ASN C 179 ? O ASN C 659 
CA 3 4 N GLY C 180 ? N GLY C 660 O VAL C 355 ? O VAL C 835 
CA 4 5 N VAL C 356 ? N VAL C 836 O VAL C 314 ? O VAL C 794 
CA 5 6 N LEU C 315 ? N LEU C 795 O LEU C 222 ? O LEU C 702 
CA 6 7 N ILE C 223 ? N ILE C 703 O LEU C 245 ? O LEU C 725 
CA 7 8 N SER C 248 ? N SER C 728 O VAL C 277 ? O VAL C 757 
CB 1 2 O VAL C 141 ? O VAL C 621 N TRP C 149 ? N TRP C 629 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 101'   
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 102'   
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE K A 201'    
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE K A 202'    
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 101'   
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 102'   
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE K B 201'    
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE K B 202'    
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 101'   
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 102'   
BC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE K C 201'    
BC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE K C 202'    
BC4 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE NU7 A 1900' 
BC5 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE NU7 B 1900' 
BC6 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE NU7 C 1900' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  ASP A 227 ? ASP A 707  . ? 1_555 ? 
2   AC1 4  HIS A 229 ? HIS A 709  . ? 1_555 ? 
3   AC1 4  ASP A 321 ? ASP A 801  . ? 1_555 ? 
4   AC1 4  NU7 H .   ? NU7 A 1900 . ? 1_555 ? 
5   AC2 4  CYS A 53  ? CYS A 533  . ? 1_555 ? 
6   AC2 4  CYS A 55  ? CYS A 535  . ? 1_555 ? 
7   AC2 4  HIS A 61  ? HIS A 541  . ? 1_555 ? 
8   AC2 4  CYS A 138 ? CYS A 618  . ? 1_555 ? 
9   AC3 5  ASP A 225 ? ASP A 705  . ? 1_555 ? 
10  AC3 5  ASP A 227 ? ASP A 707  . ? 1_555 ? 
11  AC3 5  HIS A 229 ? HIS A 709  . ? 1_555 ? 
12  AC3 5  SER A 248 ? SER A 728  . ? 1_555 ? 
13  AC3 5  LEU A 249 ? LEU A 729  . ? 1_555 ? 
14  AC4 4  PHE A 238 ? PHE A 718  . ? 1_555 ? 
15  AC4 4  ASP A 241 ? ASP A 721  . ? 1_555 ? 
16  AC4 4  VAL A 244 ? VAL A 724  . ? 1_555 ? 
17  AC4 4  PHE A 275 ? PHE A 755  . ? 1_555 ? 
18  AC5 4  ASP B 227 ? ASP B 707  . ? 1_555 ? 
19  AC5 4  HIS B 229 ? HIS B 709  . ? 1_555 ? 
20  AC5 4  ASP B 321 ? ASP B 801  . ? 1_555 ? 
21  AC5 4  NU7 M .   ? NU7 B 1900 . ? 1_555 ? 
22  AC6 4  CYS B 53  ? CYS B 533  . ? 1_555 ? 
23  AC6 4  CYS B 55  ? CYS B 535  . ? 1_555 ? 
24  AC6 4  HIS B 61  ? HIS B 541  . ? 1_555 ? 
25  AC6 4  CYS B 138 ? CYS B 618  . ? 1_555 ? 
26  AC7 5  ASP B 225 ? ASP B 705  . ? 1_555 ? 
27  AC7 5  ASP B 227 ? ASP B 707  . ? 1_555 ? 
28  AC7 5  HIS B 229 ? HIS B 709  . ? 1_555 ? 
29  AC7 5  SER B 248 ? SER B 728  . ? 1_555 ? 
30  AC7 5  LEU B 249 ? LEU B 729  . ? 1_555 ? 
31  AC8 4  PHE B 238 ? PHE B 718  . ? 1_555 ? 
32  AC8 4  ASP B 241 ? ASP B 721  . ? 1_555 ? 
33  AC8 4  VAL B 244 ? VAL B 724  . ? 1_555 ? 
34  AC8 4  PHE B 275 ? PHE B 755  . ? 1_555 ? 
35  AC9 4  ASP C 227 ? ASP C 707  . ? 1_555 ? 
36  AC9 4  HIS C 229 ? HIS C 709  . ? 1_555 ? 
37  AC9 4  ASP C 321 ? ASP C 801  . ? 1_555 ? 
38  AC9 4  NU7 R .   ? NU7 C 1900 . ? 1_555 ? 
39  BC1 4  CYS C 53  ? CYS C 533  . ? 1_555 ? 
40  BC1 4  CYS C 55  ? CYS C 535  . ? 1_555 ? 
41  BC1 4  HIS C 61  ? HIS C 541  . ? 1_555 ? 
42  BC1 4  CYS C 138 ? CYS C 618  . ? 1_555 ? 
43  BC2 5  ASP C 225 ? ASP C 705  . ? 1_555 ? 
44  BC2 5  ASP C 227 ? ASP C 707  . ? 1_555 ? 
45  BC2 5  HIS C 229 ? HIS C 709  . ? 1_555 ? 
46  BC2 5  SER C 248 ? SER C 728  . ? 1_555 ? 
47  BC2 5  LEU C 249 ? LEU C 729  . ? 1_555 ? 
48  BC3 3  PHE C 238 ? PHE C 718  . ? 1_555 ? 
49  BC3 3  VAL C 244 ? VAL C 724  . ? 1_555 ? 
50  BC3 3  PHE C 275 ? PHE C 755  . ? 1_555 ? 
51  BC4 17 ZN  D .   ? ZN  A 101  . ? 1_555 ? 
52  BC4 17 PRO A 62  ? PRO A 542  . ? 1_555 ? 
53  BC4 17 ASP A 146 ? ASP A 626  . ? 1_555 ? 
54  BC4 17 PRO A 187 ? PRO A 667  . ? 1_555 ? 
55  BC4 17 HIS A 189 ? HIS A 669  . ? 1_555 ? 
56  BC4 17 HIS A 190 ? HIS A 670  . ? 1_555 ? 
57  BC4 17 GLY A 198 ? GLY A 678  . ? 1_555 ? 
58  BC4 17 PHE A 199 ? PHE A 679  . ? 1_555 ? 
59  BC4 17 CYS A 200 ? CYS A 680  . ? 1_555 ? 
60  BC4 17 ASP A 227 ? ASP A 707  . ? 1_555 ? 
61  BC4 17 HIS A 229 ? HIS A 709  . ? 1_555 ? 
62  BC4 17 PHE A 258 ? PHE A 738  . ? 1_555 ? 
63  BC4 17 ASP A 321 ? ASP A 801  . ? 1_555 ? 
64  BC4 17 LEU A 330 ? LEU A 810  . ? 1_555 ? 
65  BC4 17 GLU A 360 ? GLU A 840  . ? 1_555 ? 
66  BC4 17 GLY A 361 ? GLY A 841  . ? 1_555 ? 
67  BC4 17 HIS A 363 ? HIS A 843  . ? 1_555 ? 
68  BC5 18 ZN  I .   ? ZN  B 101  . ? 1_555 ? 
69  BC5 18 PRO B 62  ? PRO B 542  . ? 1_555 ? 
70  BC5 18 ASP B 146 ? ASP B 626  . ? 1_555 ? 
71  BC5 18 PRO B 187 ? PRO B 667  . ? 1_555 ? 
72  BC5 18 HIS B 189 ? HIS B 669  . ? 1_555 ? 
73  BC5 18 HIS B 190 ? HIS B 670  . ? 1_555 ? 
74  BC5 18 GLY B 198 ? GLY B 678  . ? 1_555 ? 
75  BC5 18 PHE B 199 ? PHE B 679  . ? 1_555 ? 
76  BC5 18 CYS B 200 ? CYS B 680  . ? 1_555 ? 
77  BC5 18 ASP B 227 ? ASP B 707  . ? 1_555 ? 
78  BC5 18 HIS B 229 ? HIS B 709  . ? 1_555 ? 
79  BC5 18 PHE B 258 ? PHE B 738  . ? 1_555 ? 
80  BC5 18 ASP B 321 ? ASP B 801  . ? 1_555 ? 
81  BC5 18 PRO B 329 ? PRO B 809  . ? 1_555 ? 
82  BC5 18 LEU B 330 ? LEU B 810  . ? 1_555 ? 
83  BC5 18 GLU B 360 ? GLU B 840  . ? 1_555 ? 
84  BC5 18 GLY B 361 ? GLY B 841  . ? 1_555 ? 
85  BC5 18 HIS B 363 ? HIS B 843  . ? 1_555 ? 
86  BC6 17 ZN  N .   ? ZN  C 101  . ? 1_555 ? 
87  BC6 17 PRO C 62  ? PRO C 542  . ? 1_555 ? 
88  BC6 17 GLU C 63  ? GLU C 543  . ? 1_555 ? 
89  BC6 17 ASP C 146 ? ASP C 626  . ? 1_555 ? 
90  BC6 17 PRO C 187 ? PRO C 667  . ? 1_555 ? 
91  BC6 17 HIS C 189 ? HIS C 669  . ? 1_555 ? 
92  BC6 17 HIS C 190 ? HIS C 670  . ? 1_555 ? 
93  BC6 17 GLY C 198 ? GLY C 678  . ? 1_555 ? 
94  BC6 17 PHE C 199 ? PHE C 679  . ? 1_555 ? 
95  BC6 17 ASP C 227 ? ASP C 707  . ? 1_555 ? 
96  BC6 17 HIS C 229 ? HIS C 709  . ? 1_555 ? 
97  BC6 17 PHE C 258 ? PHE C 738  . ? 1_555 ? 
98  BC6 17 ASP C 321 ? ASP C 801  . ? 1_555 ? 
99  BC6 17 PRO C 329 ? PRO C 809  . ? 1_555 ? 
100 BC6 17 LEU C 330 ? LEU C 810  . ? 1_555 ? 
101 BC6 17 GLU C 360 ? GLU C 840  . ? 1_555 ? 
102 BC6 17 GLY C 361 ? GLY C 841  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3ZNS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ZNS 
_atom_sites.fract_transf_matrix[1][1]   0.012259 
_atom_sites.fract_transf_matrix[1][2]   0.007078 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014156 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006662 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
K  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LEU A 1 36  ? 25.134  -12.795 -3.484  1.00 36.79 ? 516  LEU A N   1 
ATOM   2    C  CA  . LEU A 1 36  ? 24.257  -11.608 -3.260  1.00 36.89 ? 516  LEU A CA  1 
ATOM   3    C  C   . LEU A 1 36  ? 24.395  -11.072 -1.833  1.00 36.90 ? 516  LEU A C   1 
ATOM   4    O  O   . LEU A 1 36  ? 24.487  -11.858 -0.889  1.00 37.02 ? 516  LEU A O   1 
ATOM   5    C  CB  . LEU A 1 36  ? 22.791  -11.956 -3.549  1.00 36.91 ? 516  LEU A CB  1 
ATOM   6    C  CG  . LEU A 1 36  ? 22.223  -11.464 -4.885  1.00 36.87 ? 516  LEU A CG  1 
ATOM   7    C  CD1 . LEU A 1 36  ? 23.112  -11.847 -6.067  1.00 36.71 ? 516  LEU A CD1 1 
ATOM   8    C  CD2 . LEU A 1 36  ? 20.819  -11.988 -5.078  1.00 36.35 ? 516  LEU A CD2 1 
ATOM   9    N  N   . PRO A 1 37  ? 24.399  -9.730  -1.669  1.00 36.85 ? 517  PRO A N   1 
ATOM   10   C  CA  . PRO A 1 37  ? 24.533  -9.137  -0.341  1.00 36.70 ? 517  PRO A CA  1 
ATOM   11   C  C   . PRO A 1 37  ? 23.178  -8.910  0.321   1.00 36.40 ? 517  PRO A C   1 
ATOM   12   O  O   . PRO A 1 37  ? 22.157  -8.874  -0.361  1.00 36.45 ? 517  PRO A O   1 
ATOM   13   C  CB  . PRO A 1 37  ? 25.224  -7.801  -0.631  1.00 36.62 ? 517  PRO A CB  1 
ATOM   14   C  CG  . PRO A 1 37  ? 24.785  -7.433  -2.018  1.00 36.86 ? 517  PRO A CG  1 
ATOM   15   C  CD  . PRO A 1 37  ? 24.250  -8.685  -2.699  1.00 36.95 ? 517  PRO A CD  1 
ATOM   16   N  N   . PHE A 1 38  ? 23.180  -8.750  1.641   1.00 36.11 ? 518  PHE A N   1 
ATOM   17   C  CA  . PHE A 1 38  ? 21.946  -8.575  2.403   1.00 35.85 ? 518  PHE A CA  1 
ATOM   18   C  C   . PHE A 1 38  ? 21.541  -7.094  2.465   1.00 35.47 ? 518  PHE A C   1 
ATOM   19   O  O   . PHE A 1 38  ? 21.706  -6.428  3.488   1.00 35.50 ? 518  PHE A O   1 
ATOM   20   C  CB  . PHE A 1 38  ? 22.111  -9.174  3.802   1.00 35.95 ? 518  PHE A CB  1 
ATOM   21   C  CG  . PHE A 1 38  ? 20.822  -9.342  4.551   1.00 36.39 ? 518  PHE A CG  1 
ATOM   22   C  CD1 . PHE A 1 38  ? 19.902  -10.306 4.162   1.00 37.18 ? 518  PHE A CD1 1 
ATOM   23   C  CD2 . PHE A 1 38  ? 20.530  -8.544  5.651   1.00 36.89 ? 518  PHE A CD2 1 
ATOM   24   C  CE1 . PHE A 1 38  ? 18.707  -10.473 4.855   1.00 37.41 ? 518  PHE A CE1 1 
ATOM   25   C  CE2 . PHE A 1 38  ? 19.342  -8.701  6.350   1.00 37.18 ? 518  PHE A CE2 1 
ATOM   26   C  CZ  . PHE A 1 38  ? 18.426  -9.669  5.952   1.00 37.61 ? 518  PHE A CZ  1 
ATOM   27   N  N   . THR A 1 39  ? 21.029  -6.596  1.341   1.00 34.88 ? 519  THR A N   1 
ATOM   28   C  CA  . THR A 1 39  ? 20.445  -5.257  1.235   1.00 34.36 ? 519  THR A CA  1 
ATOM   29   C  C   . THR A 1 39  ? 19.117  -5.424  0.508   1.00 33.63 ? 519  THR A C   1 
ATOM   30   O  O   . THR A 1 39  ? 18.655  -6.551  0.341   1.00 33.61 ? 519  THR A O   1 
ATOM   31   C  CB  . THR A 1 39  ? 21.342  -4.298  0.426   1.00 34.41 ? 519  THR A CB  1 
ATOM   32   O  OG1 . THR A 1 39  ? 22.719  -4.649  0.609   1.00 35.27 ? 519  THR A OG1 1 
ATOM   33   C  CG2 . THR A 1 39  ? 21.114  -2.849  0.861   1.00 34.47 ? 519  THR A CG2 1 
ATOM   34   N  N   . THR A 1 40  ? 18.510  -4.324  0.064   1.00 32.71 ? 520  THR A N   1 
ATOM   35   C  CA  . THR A 1 40  ? 17.260  -4.407  -0.682  1.00 32.05 ? 520  THR A CA  1 
ATOM   36   C  C   . THR A 1 40  ? 17.569  -4.675  -2.148  1.00 31.41 ? 520  THR A C   1 
ATOM   37   O  O   . THR A 1 40  ? 18.552  -4.167  -2.685  1.00 31.00 ? 520  THR A O   1 
ATOM   38   C  CB  . THR A 1 40  ? 16.389  -3.128  -0.576  1.00 31.99 ? 520  THR A CB  1 
ATOM   39   O  OG1 . THR A 1 40  ? 16.528  -2.343  -1.759  1.00 32.22 ? 520  THR A OG1 1 
ATOM   40   C  CG2 . THR A 1 40  ? 16.740  -2.305  0.660   1.00 31.51 ? 520  THR A CG2 1 
ATOM   41   N  N   . GLY A 1 41  ? 16.725  -5.482  -2.782  1.00 30.86 ? 521  GLY A N   1 
ATOM   42   C  CA  . GLY A 1 41  ? 16.867  -5.801  -4.196  1.00 30.62 ? 521  GLY A CA  1 
ATOM   43   C  C   . GLY A 1 41  ? 15.922  -4.970  -5.046  1.00 30.38 ? 521  GLY A C   1 
ATOM   44   O  O   . GLY A 1 41  ? 14.798  -4.688  -4.632  1.00 30.08 ? 521  GLY A O   1 
ATOM   45   N  N   . LEU A 1 42  ? 16.388  -4.564  -6.226  1.00 30.23 ? 522  LEU A N   1 
ATOM   46   C  CA  . LEU A 1 42  ? 15.543  -3.895  -7.216  1.00 30.13 ? 522  LEU A CA  1 
ATOM   47   C  C   . LEU A 1 42  ? 15.502  -4.733  -8.482  1.00 29.91 ? 522  LEU A C   1 
ATOM   48   O  O   . LEU A 1 42  ? 16.545  -5.158  -8.983  1.00 29.64 ? 522  LEU A O   1 
ATOM   49   C  CB  . LEU A 1 42  ? 16.077  -2.500  -7.553  1.00 30.25 ? 522  LEU A CB  1 
ATOM   50   C  CG  . LEU A 1 42  ? 16.129  -1.461  -6.430  1.00 30.67 ? 522  LEU A CG  1 
ATOM   51   C  CD1 . LEU A 1 42  ? 16.867  -0.207  -6.902  1.00 30.29 ? 522  LEU A CD1 1 
ATOM   52   C  CD2 . LEU A 1 42  ? 14.725  -1.118  -5.940  1.00 30.70 ? 522  LEU A CD2 1 
ATOM   53   N  N   . ILE A 1 43  ? 14.297  -4.972  -8.988  1.00 29.89 ? 523  ILE A N   1 
ATOM   54   C  CA  . ILE A 1 43  ? 14.111  -5.655  -10.259 1.00 30.04 ? 523  ILE A CA  1 
ATOM   55   C  C   . ILE A 1 43  ? 13.750  -4.640  -11.334 1.00 29.89 ? 523  ILE A C   1 
ATOM   56   O  O   . ILE A 1 43  ? 12.860  -3.820  -11.137 1.00 29.96 ? 523  ILE A O   1 
ATOM   57   C  CB  . ILE A 1 43  ? 12.994  -6.723  -10.184 1.00 30.19 ? 523  ILE A CB  1 
ATOM   58   C  CG1 . ILE A 1 43  ? 13.563  -8.077  -9.742  1.00 30.65 ? 523  ILE A CG1 1 
ATOM   59   C  CG2 . ILE A 1 43  ? 12.314  -6.873  -11.535 1.00 30.10 ? 523  ILE A CG2 1 
ATOM   60   C  CD1 . ILE A 1 43  ? 14.437  -8.767  -10.794 1.00 30.59 ? 523  ILE A CD1 1 
ATOM   61   N  N   . TYR A 1 44  ? 14.447  -4.707  -12.466 1.00 29.89 ? 524  TYR A N   1 
ATOM   62   C  CA  . TYR A 1 44  ? 14.114  -3.912  -13.645 1.00 29.83 ? 524  TYR A CA  1 
ATOM   63   C  C   . TYR A 1 44  ? 14.739  -4.544  -14.881 1.00 29.79 ? 524  TYR A C   1 
ATOM   64   O  O   . TYR A 1 44  ? 15.798  -5.158  -14.800 1.00 29.67 ? 524  TYR A O   1 
ATOM   65   C  CB  . TYR A 1 44  ? 14.604  -2.466  -13.486 1.00 29.96 ? 524  TYR A CB  1 
ATOM   66   C  CG  . TYR A 1 44  ? 14.299  -1.562  -14.671 1.00 30.08 ? 524  TYR A CG  1 
ATOM   67   C  CD1 . TYR A 1 44  ? 13.058  -0.941  -14.799 1.00 30.50 ? 524  TYR A CD1 1 
ATOM   68   C  CD2 . TYR A 1 44  ? 15.251  -1.328  -15.658 1.00 30.41 ? 524  TYR A CD2 1 
ATOM   69   C  CE1 . TYR A 1 44  ? 12.769  -0.112  -15.878 1.00 30.51 ? 524  TYR A CE1 1 
ATOM   70   C  CE2 . TYR A 1 44  ? 14.974  -0.500  -16.746 1.00 30.87 ? 524  TYR A CE2 1 
ATOM   71   C  CZ  . TYR A 1 44  ? 13.731  0.107   -16.851 1.00 30.91 ? 524  TYR A CZ  1 
ATOM   72   O  OH  . TYR A 1 44  ? 13.451  0.927   -17.927 1.00 30.30 ? 524  TYR A OH  1 
ATOM   73   N  N   . ASP A 1 45  ? 14.069  -4.399  -16.019 1.00 29.92 ? 525  ASP A N   1 
ATOM   74   C  CA  . ASP A 1 45  ? 14.616  -4.820  -17.307 1.00 29.93 ? 525  ASP A CA  1 
ATOM   75   C  C   . ASP A 1 45  ? 13.854  -4.141  -18.449 1.00 30.04 ? 525  ASP A C   1 
ATOM   76   O  O   . ASP A 1 45  ? 12.636  -3.974  -18.381 1.00 29.94 ? 525  ASP A O   1 
ATOM   77   C  CB  . ASP A 1 45  ? 14.548  -6.344  -17.450 1.00 29.97 ? 525  ASP A CB  1 
ATOM   78   C  CG  . ASP A 1 45  ? 15.284  -6.850  -18.678 1.00 29.97 ? 525  ASP A CG  1 
ATOM   79   O  OD1 . ASP A 1 45  ? 14.767  -6.680  -19.799 1.00 29.59 ? 525  ASP A OD1 1 
ATOM   80   O  OD2 . ASP A 1 45  ? 16.388  -7.409  -18.522 1.00 30.79 ? 525  ASP A OD2 1 
ATOM   81   N  N   . SER A 1 46  ? 14.578  -3.762  -19.501 1.00 30.15 ? 526  SER A N   1 
ATOM   82   C  CA  . SER A 1 46  ? 13.981  -3.041  -20.629 1.00 30.24 ? 526  SER A CA  1 
ATOM   83   C  C   . SER A 1 46  ? 12.964  -3.877  -21.416 1.00 30.10 ? 526  SER A C   1 
ATOM   84   O  O   . SER A 1 46  ? 12.088  -3.321  -22.078 1.00 29.99 ? 526  SER A O   1 
ATOM   85   C  CB  . SER A 1 46  ? 15.071  -2.524  -21.568 1.00 30.25 ? 526  SER A CB  1 
ATOM   86   O  OG  . SER A 1 46  ? 15.793  -3.600  -22.138 1.00 30.49 ? 526  SER A OG  1 
ATOM   87   N  N   . VAL A 1 47  ? 13.070  -5.204  -21.334 1.00 30.10 ? 527  VAL A N   1 
ATOM   88   C  CA  . VAL A 1 47  ? 12.101  -6.112  -21.974 1.00 30.07 ? 527  VAL A CA  1 
ATOM   89   C  C   . VAL A 1 47  ? 10.642  -5.730  -21.679 1.00 29.84 ? 527  VAL A C   1 
ATOM   90   O  O   . VAL A 1 47  ? 9.774   -5.884  -22.539 1.00 30.03 ? 527  VAL A O   1 
ATOM   91   C  CB  . VAL A 1 47  ? 12.335  -7.581  -21.549 1.00 30.08 ? 527  VAL A CB  1 
ATOM   92   C  CG1 . VAL A 1 47  ? 11.200  -8.475  -22.031 1.00 30.81 ? 527  VAL A CG1 1 
ATOM   93   C  CG2 . VAL A 1 47  ? 13.661  -8.088  -22.095 1.00 30.55 ? 527  VAL A CG2 1 
ATOM   94   N  N   . MET A 1 48  ? 10.381  -5.229  -20.473 1.00 29.43 ? 528  MET A N   1 
ATOM   95   C  CA  . MET A 1 48  ? 9.033   -4.798  -20.081 1.00 29.29 ? 528  MET A CA  1 
ATOM   96   C  C   . MET A 1 48  ? 8.590   -3.460  -20.712 1.00 29.32 ? 528  MET A C   1 
ATOM   97   O  O   . MET A 1 48  ? 7.403   -3.129  -20.693 1.00 29.26 ? 528  MET A O   1 
ATOM   98   C  CB  . MET A 1 48  ? 8.926   -4.728  -18.553 1.00 29.07 ? 528  MET A CB  1 
ATOM   99   C  CG  . MET A 1 48  ? 8.950   -6.100  -17.870 1.00 28.75 ? 528  MET A CG  1 
ATOM   100  S  SD  . MET A 1 48  ? 9.048   -6.029  -16.058 1.00 27.31 ? 528  MET A SD  1 
ATOM   101  C  CE  . MET A 1 48  ? 10.709  -5.410  -15.830 1.00 26.40 ? 528  MET A CE  1 
ATOM   102  N  N   . LEU A 1 49  ? 9.529   -2.699  -21.271 1.00 29.34 ? 529  LEU A N   1 
ATOM   103  C  CA  . LEU A 1 49  ? 9.188   -1.466  -22.000 1.00 29.37 ? 529  LEU A CA  1 
ATOM   104  C  C   . LEU A 1 49  ? 8.482   -1.752  -23.325 1.00 29.33 ? 529  LEU A C   1 
ATOM   105  O  O   . LEU A 1 49  ? 7.729   -0.915  -23.824 1.00 29.58 ? 529  LEU A O   1 
ATOM   106  C  CB  . LEU A 1 49  ? 10.443  -0.633  -22.292 1.00 29.27 ? 529  LEU A CB  1 
ATOM   107  C  CG  . LEU A 1 49  ? 11.286  -0.189  -21.098 1.00 28.95 ? 529  LEU A CG  1 
ATOM   108  C  CD1 . LEU A 1 49  ? 12.561  0.495   -21.578 1.00 28.24 ? 529  LEU A CD1 1 
ATOM   109  C  CD2 . LEU A 1 49  ? 10.475  0.720   -20.189 1.00 28.82 ? 529  LEU A CD2 1 
ATOM   110  N  N   . LYS A 1 50  ? 8.708   -2.943  -23.874 1.00 29.25 ? 530  LYS A N   1 
ATOM   111  C  CA  . LYS A 1 50  ? 8.270   -3.282  -25.231 1.00 29.23 ? 530  LYS A CA  1 
ATOM   112  C  C   . LYS A 1 50  ? 6.755   -3.517  -25.316 1.00 29.29 ? 530  LYS A C   1 
ATOM   113  O  O   . LYS A 1 50  ? 6.189   -3.586  -26.411 1.00 29.25 ? 530  LYS A O   1 
ATOM   114  C  CB  . LYS A 1 50  ? 9.016   -4.526  -25.728 1.00 29.31 ? 530  LYS A CB  1 
ATOM   115  C  CG  . LYS A 1 50  ? 10.522  -4.543  -25.420 1.00 29.57 ? 530  LYS A CG  1 
ATOM   116  C  CD  . LYS A 1 50  ? 11.394  -4.104  -26.580 1.00 29.69 ? 530  LYS A CD  1 
ATOM   117  C  CE  . LYS A 1 50  ? 12.016  -5.288  -27.291 1.00 29.59 ? 530  LYS A CE  1 
ATOM   118  N  NZ  . LYS A 1 50  ? 13.161  -4.875  -28.160 1.00 29.51 ? 530  LYS A NZ  1 
ATOM   119  N  N   . HIS A 1 51  ? 6.103   -3.650  -24.163 1.00 29.38 ? 531  HIS A N   1 
ATOM   120  C  CA  . HIS A 1 51  ? 4.650   -3.769  -24.103 1.00 29.44 ? 531  HIS A CA  1 
ATOM   121  C  C   . HIS A 1 51  ? 3.999   -2.424  -24.432 1.00 29.66 ? 531  HIS A C   1 
ATOM   122  O  O   . HIS A 1 51  ? 3.850   -1.557  -23.561 1.00 29.51 ? 531  HIS A O   1 
ATOM   123  C  CB  . HIS A 1 51  ? 4.217   -4.258  -22.720 1.00 29.44 ? 531  HIS A CB  1 
ATOM   124  C  CG  . HIS A 1 51  ? 2.735   -4.287  -22.522 1.00 29.38 ? 531  HIS A CG  1 
ATOM   125  N  ND1 . HIS A 1 51  ? 1.894   -5.042  -23.309 1.00 28.89 ? 531  HIS A ND1 1 
ATOM   126  C  CD2 . HIS A 1 51  ? 1.944   -3.655  -21.622 1.00 29.36 ? 531  HIS A CD2 1 
ATOM   127  C  CE1 . HIS A 1 51  ? 0.648   -4.875  -22.904 1.00 29.21 ? 531  HIS A CE1 1 
ATOM   128  N  NE2 . HIS A 1 51  ? 0.651   -4.040  -21.880 1.00 29.63 ? 531  HIS A NE2 1 
ATOM   129  N  N   . GLN A 1 52  ? 3.645   -2.253  -25.705 1.00 29.78 ? 532  GLN A N   1 
ATOM   130  C  CA  . GLN A 1 52  ? 3.016   -1.027  -26.188 1.00 30.00 ? 532  GLN A CA  1 
ATOM   131  C  C   . GLN A 1 52  ? 2.101   -1.362  -27.363 1.00 30.23 ? 532  GLN A C   1 
ATOM   132  O  O   . GLN A 1 52  ? 2.413   -2.239  -28.165 1.00 30.21 ? 532  GLN A O   1 
ATOM   133  C  CB  . GLN A 1 52  ? 4.064   0.003   -26.654 1.00 29.88 ? 532  GLN A CB  1 
ATOM   134  C  CG  . GLN A 1 52  ? 5.455   -0.135  -26.030 1.00 30.03 ? 532  GLN A CG  1 
ATOM   135  C  CD  . GLN A 1 52  ? 6.437   0.938   -26.479 1.00 29.95 ? 532  GLN A CD  1 
ATOM   136  O  OE1 . GLN A 1 52  ? 7.264   1.396   -25.688 1.00 30.45 ? 532  GLN A OE1 1 
ATOM   137  N  NE2 . GLN A 1 52  ? 6.356   1.339   -27.743 1.00 29.41 ? 532  GLN A NE2 1 
ATOM   138  N  N   . CYS A 1 53  ? 0.985   -0.647  -27.467 1.00 30.53 ? 533  CYS A N   1 
ATOM   139  C  CA  . CYS A 1 53  ? 0.104   -0.757  -28.618 1.00 30.80 ? 533  CYS A CA  1 
ATOM   140  C  C   . CYS A 1 53  ? 0.807   -0.249  -29.879 1.00 31.20 ? 533  CYS A C   1 
ATOM   141  O  O   . CYS A 1 53  ? 1.650   0.650   -29.812 1.00 31.20 ? 533  CYS A O   1 
ATOM   142  C  CB  . CYS A 1 53  ? -1.177  0.039   -28.378 1.00 30.84 ? 533  CYS A CB  1 
ATOM   143  S  SG  . CYS A 1 53  ? -2.394  -0.155  -29.690 1.00 30.81 ? 533  CYS A SG  1 
ATOM   144  N  N   . SER A 1 54  ? 0.455   -0.826  -31.025 1.00 31.53 ? 534  SER A N   1 
ATOM   145  C  CA  . SER A 1 54  ? 1.147   -0.528  -32.282 1.00 31.90 ? 534  SER A CA  1 
ATOM   146  C  C   . SER A 1 54  ? 0.850   0.875   -32.817 1.00 32.25 ? 534  SER A C   1 
ATOM   147  O  O   . SER A 1 54  ? 1.634   1.419   -33.602 1.00 32.43 ? 534  SER A O   1 
ATOM   148  C  CB  . SER A 1 54  ? 0.808   -1.579  -33.344 1.00 31.94 ? 534  SER A CB  1 
ATOM   149  O  OG  . SER A 1 54  ? -0.582  -1.849  -33.380 1.00 31.89 ? 534  SER A OG  1 
ATOM   150  N  N   . CYS A 1 55  ? -0.270  1.458   -32.389 1.00 32.59 ? 535  CYS A N   1 
ATOM   151  C  CA  . CYS A 1 55  ? -0.645  2.817   -32.798 1.00 32.82 ? 535  CYS A CA  1 
ATOM   152  C  C   . CYS A 1 55  ? 0.312   3.879   -32.249 1.00 33.06 ? 535  CYS A C   1 
ATOM   153  O  O   . CYS A 1 55  ? 0.359   4.991   -32.767 1.00 33.39 ? 535  CYS A O   1 
ATOM   154  C  CB  . CYS A 1 55  ? -2.074  3.136   -32.358 1.00 32.85 ? 535  CYS A CB  1 
ATOM   155  S  SG  . CYS A 1 55  ? -2.272  3.275   -30.573 1.00 32.65 ? 535  CYS A SG  1 
ATOM   156  N  N   . GLY A 1 56  ? 1.048   3.539   -31.192 1.00 33.24 ? 536  GLY A N   1 
ATOM   157  C  CA  . GLY A 1 56  ? 2.131   4.381   -30.685 1.00 33.44 ? 536  GLY A CA  1 
ATOM   158  C  C   . GLY A 1 56  ? 1.751   5.357   -29.582 1.00 33.60 ? 536  GLY A C   1 
ATOM   159  O  O   . GLY A 1 56  ? 2.617   5.813   -28.834 1.00 33.71 ? 536  GLY A O   1 
ATOM   160  N  N   . ASP A 1 57  ? 0.460   5.661   -29.463 1.00 33.71 ? 537  ASP A N   1 
ATOM   161  C  CA  . ASP A 1 57  ? -0.013  6.751   -28.609 1.00 33.68 ? 537  ASP A CA  1 
ATOM   162  C  C   . ASP A 1 57  ? 0.013   6.414   -27.109 1.00 33.75 ? 537  ASP A C   1 
ATOM   163  O  O   . ASP A 1 57  ? -0.785  5.604   -26.629 1.00 33.87 ? 537  ASP A O   1 
ATOM   164  C  CB  . ASP A 1 57  ? -1.430  7.151   -29.035 1.00 33.70 ? 537  ASP A CB  1 
ATOM   165  C  CG  . ASP A 1 57  ? -1.768  8.574   -28.665 1.00 33.86 ? 537  ASP A CG  1 
ATOM   166  O  OD1 . ASP A 1 57  ? -1.301  9.046   -27.607 1.00 34.18 ? 537  ASP A OD1 1 
ATOM   167  O  OD2 . ASP A 1 57  ? -2.503  9.222   -29.441 1.00 34.11 ? 537  ASP A OD2 1 
ATOM   168  N  N   . ASN A 1 58  ? 0.922   7.057   -26.375 1.00 33.65 ? 538  ASN A N   1 
ATOM   169  C  CA  . ASN A 1 58  ? 1.038   6.870   -24.923 1.00 33.60 ? 538  ASN A CA  1 
ATOM   170  C  C   . ASN A 1 58  ? -0.030  7.614   -24.110 1.00 33.26 ? 538  ASN A C   1 
ATOM   171  O  O   . ASN A 1 58  ? -0.174  7.374   -22.905 1.00 33.09 ? 538  ASN A O   1 
ATOM   172  C  CB  . ASN A 1 58  ? 2.430   7.300   -24.441 1.00 33.79 ? 538  ASN A CB  1 
ATOM   173  C  CG  . ASN A 1 58  ? 3.532   6.388   -24.950 1.00 34.28 ? 538  ASN A CG  1 
ATOM   174  O  OD1 . ASN A 1 58  ? 3.622   5.223   -24.560 1.00 34.54 ? 538  ASN A OD1 1 
ATOM   175  N  ND2 . ASN A 1 58  ? 4.382   6.918   -25.819 1.00 35.39 ? 538  ASN A ND2 1 
ATOM   176  N  N   . SER A 1 59  ? -0.759  8.524   -24.756 1.00 32.80 ? 539  SER A N   1 
ATOM   177  C  CA  . SER A 1 59  ? -1.847  9.241   -24.094 1.00 32.54 ? 539  SER A CA  1 
ATOM   178  C  C   . SER A 1 59  ? -3.127  8.417   -24.127 1.00 32.14 ? 539  SER A C   1 
ATOM   179  O  O   . SER A 1 59  ? -3.781  8.243   -23.093 1.00 32.09 ? 539  SER A O   1 
ATOM   180  C  CB  . SER A 1 59  ? -2.078  10.606  -24.740 1.00 32.58 ? 539  SER A CB  1 
ATOM   181  O  OG  . SER A 1 59  ? -0.940  11.431  -24.573 1.00 32.85 ? 539  SER A OG  1 
ATOM   182  N  N   . ARG A 1 60  ? -3.477  7.908   -25.310 1.00 31.50 ? 540  ARG A N   1 
ATOM   183  C  CA  . ARG A 1 60  ? -4.631  7.014   -25.453 1.00 31.06 ? 540  ARG A CA  1 
ATOM   184  C  C   . ARG A 1 60  ? -4.439  5.699   -24.687 1.00 30.42 ? 540  ARG A C   1 
ATOM   185  O  O   . ARG A 1 60  ? -5.419  5.059   -24.305 1.00 30.16 ? 540  ARG A O   1 
ATOM   186  C  CB  . ARG A 1 60  ? -4.933  6.725   -26.930 1.00 31.15 ? 540  ARG A CB  1 
ATOM   187  C  CG  . ARG A 1 60  ? -6.097  5.751   -27.141 1.00 31.68 ? 540  ARG A CG  1 
ATOM   188  C  CD  . ARG A 1 60  ? -6.814  5.953   -28.472 1.00 32.83 ? 540  ARG A CD  1 
ATOM   189  N  NE  . ARG A 1 60  ? -5.907  5.878   -29.621 1.00 33.46 ? 540  ARG A NE  1 
ATOM   190  C  CZ  . ARG A 1 60  ? -5.721  6.840   -30.529 1.00 34.17 ? 540  ARG A CZ  1 
ATOM   191  N  NH1 . ARG A 1 60  ? -6.381  7.995   -30.468 1.00 34.29 ? 540  ARG A NH1 1 
ATOM   192  N  NH2 . ARG A 1 60  ? -4.863  6.639   -31.526 1.00 34.37 ? 540  ARG A NH2 1 
ATOM   193  N  N   . HIS A 1 61  ? -3.184  5.303   -24.472 1.00 29.88 ? 541  HIS A N   1 
ATOM   194  C  CA  . HIS A 1 61  ? -2.857  4.093   -23.707 1.00 29.54 ? 541  HIS A CA  1 
ATOM   195  C  C   . HIS A 1 61  ? -1.956  4.448   -22.516 1.00 29.18 ? 541  HIS A C   1 
ATOM   196  O  O   . HIS A 1 61  ? -0.737  4.320   -22.600 1.00 29.17 ? 541  HIS A O   1 
ATOM   197  C  CB  . HIS A 1 61  ? -2.200  3.059   -24.622 1.00 29.40 ? 541  HIS A CB  1 
ATOM   198  C  CG  . HIS A 1 61  ? -3.034  2.707   -25.813 1.00 29.24 ? 541  HIS A CG  1 
ATOM   199  N  ND1 . HIS A 1 61  ? -4.268  2.103   -25.703 1.00 29.00 ? 541  HIS A ND1 1 
ATOM   200  C  CD2 . HIS A 1 61  ? -2.820  2.889   -27.137 1.00 29.08 ? 541  HIS A CD2 1 
ATOM   201  C  CE1 . HIS A 1 61  ? -4.776  1.923   -26.909 1.00 29.25 ? 541  HIS A CE1 1 
ATOM   202  N  NE2 . HIS A 1 61  ? -3.917  2.391   -27.797 1.00 29.19 ? 541  HIS A NE2 1 
ATOM   203  N  N   . PRO A 1 62  ? -2.562  4.884   -21.396 1.00 28.91 ? 542  PRO A N   1 
ATOM   204  C  CA  . PRO A 1 62  ? -1.810  5.472   -20.276 1.00 28.63 ? 542  PRO A CA  1 
ATOM   205  C  C   . PRO A 1 62  ? -0.916  4.508   -19.485 1.00 28.25 ? 542  PRO A C   1 
ATOM   206  O  O   . PRO A 1 62  ? -0.003  4.958   -18.793 1.00 28.12 ? 542  PRO A O   1 
ATOM   207  C  CB  . PRO A 1 62  ? -2.909  6.048   -19.364 1.00 28.67 ? 542  PRO A CB  1 
ATOM   208  C  CG  . PRO A 1 62  ? -4.214  5.809   -20.057 1.00 29.01 ? 542  PRO A CG  1 
ATOM   209  C  CD  . PRO A 1 62  ? -3.995  4.754   -21.078 1.00 29.03 ? 542  PRO A CD  1 
ATOM   210  N  N   . GLU A 1 63  ? -1.183  3.208   -19.565 1.00 27.74 ? 543  GLU A N   1 
ATOM   211  C  CA  . GLU A 1 63  ? -0.290  2.214   -18.977 1.00 27.49 ? 543  GLU A CA  1 
ATOM   212  C  C   . GLU A 1 63  ? 0.909   2.056   -19.912 1.00 27.08 ? 543  GLU A C   1 
ATOM   213  O  O   . GLU A 1 63  ? 0.950   1.134   -20.722 1.00 26.90 ? 543  GLU A O   1 
ATOM   214  C  CB  . GLU A 1 63  ? -1.025  0.877   -18.766 1.00 27.60 ? 543  GLU A CB  1 
ATOM   215  C  CG  . GLU A 1 63  ? -0.364  -0.060  -17.749 1.00 27.77 ? 543  GLU A CG  1 
ATOM   216  C  CD  . GLU A 1 63  ? 0.981   -0.590  -18.219 1.00 28.27 ? 543  GLU A CD  1 
ATOM   217  O  OE1 . GLU A 1 63  ? 0.992   -1.545  -19.024 1.00 27.87 ? 543  GLU A OE1 1 
ATOM   218  O  OE2 . GLU A 1 63  ? 2.025   -0.042  -17.793 1.00 28.84 ? 543  GLU A OE2 1 
ATOM   219  N  N   . HIS A 1 64  ? 1.883   2.958   -19.793 1.00 26.81 ? 544  HIS A N   1 
ATOM   220  C  CA  . HIS A 1 64  ? 2.971   3.063   -20.780 1.00 26.51 ? 544  HIS A CA  1 
ATOM   221  C  C   . HIS A 1 64  ? 4.360   2.783   -20.221 1.00 26.24 ? 544  HIS A C   1 
ATOM   222  O  O   . HIS A 1 64  ? 4.572   2.784   -19.011 1.00 26.39 ? 544  HIS A O   1 
ATOM   223  C  CB  . HIS A 1 64  ? 2.947   4.432   -21.480 1.00 26.45 ? 544  HIS A CB  1 
ATOM   224  C  CG  . HIS A 1 64  ? 3.212   5.593   -20.573 1.00 26.86 ? 544  HIS A CG  1 
ATOM   225  N  ND1 . HIS A 1 64  ? 4.484   6.049   -20.301 1.00 27.19 ? 544  HIS A ND1 1 
ATOM   226  C  CD2 . HIS A 1 64  ? 2.369   6.405   -19.894 1.00 26.81 ? 544  HIS A CD2 1 
ATOM   227  C  CE1 . HIS A 1 64  ? 4.413   7.083   -19.483 1.00 27.40 ? 544  HIS A CE1 1 
ATOM   228  N  NE2 . HIS A 1 64  ? 3.140   7.319   -19.221 1.00 27.31 ? 544  HIS A NE2 1 
ATOM   229  N  N   . ALA A 1 65  ? 5.299   2.546   -21.131 1.00 26.17 ? 545  ALA A N   1 
ATOM   230  C  CA  . ALA A 1 65  ? 6.681   2.207   -20.786 1.00 26.34 ? 545  ALA A CA  1 
ATOM   231  C  C   . ALA A 1 65  ? 7.333   3.220   -19.849 1.00 26.47 ? 545  ALA A C   1 
ATOM   232  O  O   . ALA A 1 65  ? 8.081   2.843   -18.948 1.00 26.39 ? 545  ALA A O   1 
ATOM   233  C  CB  . ALA A 1 65  ? 7.513   2.066   -22.046 1.00 26.20 ? 545  ALA A CB  1 
ATOM   234  N  N   . GLY A 1 66  ? 7.048   4.501   -20.070 1.00 26.80 ? 546  GLY A N   1 
ATOM   235  C  CA  . GLY A 1 66  ? 7.610   5.584   -19.262 1.00 27.05 ? 546  GLY A CA  1 
ATOM   236  C  C   . GLY A 1 66  ? 7.405   5.430   -17.766 1.00 27.45 ? 546  GLY A C   1 
ATOM   237  O  O   . GLY A 1 66  ? 8.194   5.943   -16.971 1.00 27.54 ? 546  GLY A O   1 
ATOM   238  N  N   . ARG A 1 67  ? 6.351   4.712   -17.385 1.00 27.78 ? 547  ARG A N   1 
ATOM   239  C  CA  . ARG A 1 67  ? 6.024   4.501   -15.978 1.00 28.05 ? 547  ARG A CA  1 
ATOM   240  C  C   . ARG A 1 67  ? 7.169   3.845   -15.202 1.00 28.50 ? 547  ARG A C   1 
ATOM   241  O  O   . ARG A 1 67  ? 7.546   4.338   -14.143 1.00 28.85 ? 547  ARG A O   1 
ATOM   242  C  CB  . ARG A 1 67  ? 4.741   3.673   -15.842 1.00 27.95 ? 547  ARG A CB  1 
ATOM   243  C  CG  . ARG A 1 67  ? 3.494   4.392   -16.347 1.00 27.52 ? 547  ARG A CG  1 
ATOM   244  C  CD  . ARG A 1 67  ? 2.243   3.521   -16.266 1.00 27.01 ? 547  ARG A CD  1 
ATOM   245  N  NE  . ARG A 1 67  ? 1.977   3.087   -14.895 1.00 26.44 ? 547  ARG A NE  1 
ATOM   246  C  CZ  . ARG A 1 67  ? 2.153   1.853   -14.418 1.00 25.68 ? 547  ARG A CZ  1 
ATOM   247  N  NH1 . ARG A 1 67  ? 2.579   0.864   -15.191 1.00 25.09 ? 547  ARG A NH1 1 
ATOM   248  N  NH2 . ARG A 1 67  ? 1.886   1.608   -13.142 1.00 26.08 ? 547  ARG A NH2 1 
ATOM   249  N  N   . ILE A 1 68  ? 7.721   2.747   -15.720 1.00 28.82 ? 548  ILE A N   1 
ATOM   250  C  CA  . ILE A 1 68  ? 8.861   2.090   -15.060 1.00 29.08 ? 548  ILE A CA  1 
ATOM   251  C  C   . ILE A 1 68  ? 10.199  2.738   -15.419 1.00 29.33 ? 548  ILE A C   1 
ATOM   252  O  O   . ILE A 1 68  ? 11.130  2.735   -14.612 1.00 29.31 ? 548  ILE A O   1 
ATOM   253  C  CB  . ILE A 1 68  ? 8.928   0.560   -15.328 1.00 28.97 ? 548  ILE A CB  1 
ATOM   254  C  CG1 . ILE A 1 68  ? 9.081   0.237   -16.820 1.00 29.04 ? 548  ILE A CG1 1 
ATOM   255  C  CG2 . ILE A 1 68  ? 7.695   -0.126  -14.760 1.00 29.38 ? 548  ILE A CG2 1 
ATOM   256  C  CD1 . ILE A 1 68  ? 9.365   -1.227  -17.082 1.00 28.64 ? 548  ILE A CD1 1 
ATOM   257  N  N   . GLN A 1 69  ? 10.285  3.298   -16.622 1.00 29.66 ? 549  GLN A N   1 
ATOM   258  C  CA  . GLN A 1 69  ? 11.506  3.950   -17.087 1.00 30.02 ? 549  GLN A CA  1 
ATOM   259  C  C   . GLN A 1 69  ? 11.845  5.167   -16.235 1.00 29.90 ? 549  GLN A C   1 
ATOM   260  O  O   . GLN A 1 69  ? 13.001  5.370   -15.868 1.00 29.96 ? 549  GLN A O   1 
ATOM   261  C  CB  . GLN A 1 69  ? 11.359  4.375   -18.547 1.00 30.30 ? 549  GLN A CB  1 
ATOM   262  C  CG  . GLN A 1 69  ? 12.669  4.699   -19.241 1.00 31.37 ? 549  GLN A CG  1 
ATOM   263  C  CD  . GLN A 1 69  ? 12.494  4.861   -20.742 1.00 33.34 ? 549  GLN A CD  1 
ATOM   264  O  OE1 . GLN A 1 69  ? 13.159  4.190   -21.533 1.00 34.40 ? 549  GLN A OE1 1 
ATOM   265  N  NE2 . GLN A 1 69  ? 11.582  5.745   -21.142 1.00 34.47 ? 549  GLN A NE2 1 
ATOM   266  N  N   . SER A 1 70  ? 10.834  5.971   -15.920 1.00 29.78 ? 550  SER A N   1 
ATOM   267  C  CA  . SER A 1 70  ? 11.045  7.182   -15.132 1.00 29.68 ? 550  SER A CA  1 
ATOM   268  C  C   . SER A 1 70  ? 11.350  6.861   -13.664 1.00 29.49 ? 550  SER A C   1 
ATOM   269  O  O   . SER A 1 70  ? 12.179  7.525   -13.047 1.00 29.39 ? 550  SER A O   1 
ATOM   270  C  CB  . SER A 1 70  ? 9.840   8.123   -15.247 1.00 29.63 ? 550  SER A CB  1 
ATOM   271  O  OG  . SER A 1 70  ? 8.645   7.486   -14.833 1.00 30.32 ? 550  SER A OG  1 
ATOM   272  N  N   . ILE A 1 71  ? 10.690  5.843   -13.114 1.00 29.39 ? 551  ILE A N   1 
ATOM   273  C  CA  . ILE A 1 71  ? 10.987  5.385   -11.753 1.00 29.39 ? 551  ILE A CA  1 
ATOM   274  C  C   . ILE A 1 71  ? 12.443  4.915   -11.646 1.00 29.43 ? 551  ILE A C   1 
ATOM   275  O  O   . ILE A 1 71  ? 13.135  5.211   -10.671 1.00 29.07 ? 551  ILE A O   1 
ATOM   276  C  CB  . ILE A 1 71  ? 10.023  4.245   -11.298 1.00 29.40 ? 551  ILE A CB  1 
ATOM   277  C  CG1 . ILE A 1 71  ? 8.616   4.798   -11.066 1.00 29.05 ? 551  ILE A CG1 1 
ATOM   278  C  CG2 . ILE A 1 71  ? 10.517  3.575   -10.010 1.00 28.82 ? 551  ILE A CG2 1 
ATOM   279  C  CD1 . ILE A 1 71  ? 7.574   3.727   -10.818 1.00 28.38 ? 551  ILE A CD1 1 
ATOM   280  N  N   . TRP A 1 72  ? 12.896  4.201   -12.671 1.00 29.70 ? 552  TRP A N   1 
ATOM   281  C  CA  . TRP A 1 72  ? 14.224  3.595   -12.681 1.00 29.95 ? 552  TRP A CA  1 
ATOM   282  C  C   . TRP A 1 72  ? 15.334  4.643   -12.675 1.00 30.12 ? 552  TRP A C   1 
ATOM   283  O  O   . TRP A 1 72  ? 16.277  4.540   -11.892 1.00 30.30 ? 552  TRP A O   1 
ATOM   284  C  CB  . TRP A 1 72  ? 14.348  2.676   -13.899 1.00 29.96 ? 552  TRP A CB  1 
ATOM   285  C  CG  . TRP A 1 72  ? 15.594  1.846   -13.962 1.00 30.09 ? 552  TRP A CG  1 
ATOM   286  C  CD1 . TRP A 1 72  ? 16.504  1.823   -14.975 1.00 30.24 ? 552  TRP A CD1 1 
ATOM   287  C  CD2 . TRP A 1 72  ? 16.052  0.899   -12.991 1.00 30.21 ? 552  TRP A CD2 1 
ATOM   288  N  NE1 . TRP A 1 72  ? 17.504  0.928   -14.696 1.00 30.37 ? 552  TRP A NE1 1 
ATOM   289  C  CE2 . TRP A 1 72  ? 17.252  0.345   -13.483 1.00 30.26 ? 552  TRP A CE2 1 
ATOM   290  C  CE3 . TRP A 1 72  ? 15.569  0.470   -11.749 1.00 30.68 ? 552  TRP A CE3 1 
ATOM   291  C  CZ2 . TRP A 1 72  ? 17.981  -0.613  -12.777 1.00 30.70 ? 552  TRP A CZ2 1 
ATOM   292  C  CZ3 . TRP A 1 72  ? 16.294  -0.489  -11.048 1.00 30.94 ? 552  TRP A CZ3 1 
ATOM   293  C  CH2 . TRP A 1 72  ? 17.487  -1.018  -11.565 1.00 30.98 ? 552  TRP A CH2 1 
ATOM   294  N  N   . SER A 1 73  ? 15.222  5.651   -13.535 1.00 30.24 ? 553  SER A N   1 
ATOM   295  C  CA  . SER A 1 73  ? 16.222  6.724   -13.582 1.00 30.48 ? 553  SER A CA  1 
ATOM   296  C  C   . SER A 1 73  ? 16.117  7.661   -12.372 1.00 30.41 ? 553  SER A C   1 
ATOM   297  O  O   . SER A 1 73  ? 17.120  8.200   -11.912 1.00 30.37 ? 553  SER A O   1 
ATOM   298  C  CB  . SER A 1 73  ? 16.131  7.510   -14.902 1.00 30.63 ? 553  SER A CB  1 
ATOM   299  O  OG  . SER A 1 73  ? 14.806  7.535   -15.408 1.00 31.06 ? 553  SER A OG  1 
ATOM   300  N  N   . ARG A 1 74  ? 14.901  7.846   -11.865 1.00 30.41 ? 554  ARG A N   1 
ATOM   301  C  CA  . ARG A 1 74  ? 14.670  8.605   -10.637 1.00 30.40 ? 554  ARG A CA  1 
ATOM   302  C  C   . ARG A 1 74  ? 15.410  7.989   -9.440  1.00 30.39 ? 554  ARG A C   1 
ATOM   303  O  O   . ARG A 1 74  ? 15.977  8.711   -8.623  1.00 30.38 ? 554  ARG A O   1 
ATOM   304  C  CB  . ARG A 1 74  ? 13.166  8.686   -10.358 1.00 30.51 ? 554  ARG A CB  1 
ATOM   305  C  CG  . ARG A 1 74  ? 12.765  9.286   -9.016  1.00 31.32 ? 554  ARG A CG  1 
ATOM   306  C  CD  . ARG A 1 74  ? 12.996  10.795  -8.943  1.00 32.80 ? 554  ARG A CD  1 
ATOM   307  N  NE  . ARG A 1 74  ? 12.168  11.377  -7.884  1.00 33.61 ? 554  ARG A NE  1 
ATOM   308  C  CZ  . ARG A 1 74  ? 11.043  12.074  -8.064  1.00 33.65 ? 554  ARG A CZ  1 
ATOM   309  N  NH1 . ARG A 1 74  ? 10.570  12.348  -9.278  1.00 32.75 ? 554  ARG A NH1 1 
ATOM   310  N  NH2 . ARG A 1 74  ? 10.386  12.519  -7.002  1.00 34.40 ? 554  ARG A NH2 1 
ATOM   311  N  N   . LEU A 1 75  ? 15.409  6.662   -9.330  1.00 30.26 ? 555  LEU A N   1 
ATOM   312  C  CA  . LEU A 1 75  ? 16.132  5.996   -8.241  1.00 30.10 ? 555  LEU A CA  1 
ATOM   313  C  C   . LEU A 1 75  ? 17.642  6.249   -8.310  1.00 30.07 ? 555  LEU A C   1 
ATOM   314  O  O   . LEU A 1 75  ? 18.311  6.302   -7.279  1.00 29.94 ? 555  LEU A O   1 
ATOM   315  C  CB  . LEU A 1 75  ? 15.840  4.493   -8.225  1.00 30.01 ? 555  LEU A CB  1 
ATOM   316  C  CG  . LEU A 1 75  ? 14.451  4.137   -7.695  1.00 30.02 ? 555  LEU A CG  1 
ATOM   317  C  CD1 . LEU A 1 75  ? 14.096  2.693   -7.999  1.00 29.52 ? 555  LEU A CD1 1 
ATOM   318  C  CD2 . LEU A 1 75  ? 14.367  4.410   -6.200  1.00 30.13 ? 555  LEU A CD2 1 
ATOM   319  N  N   . GLN A 1 76  ? 18.173  6.410   -9.517  1.00 30.18 ? 556  GLN A N   1 
ATOM   320  C  CA  . GLN A 1 76  ? 19.590  6.711   -9.686  1.00 30.38 ? 556  GLN A CA  1 
ATOM   321  C  C   . GLN A 1 76  ? 19.870  8.190   -9.443  1.00 30.50 ? 556  GLN A C   1 
ATOM   322  O  O   . GLN A 1 76  ? 20.865  8.540   -8.806  1.00 30.49 ? 556  GLN A O   1 
ATOM   323  C  CB  . GLN A 1 76  ? 20.057  6.331   -11.085 1.00 30.46 ? 556  GLN A CB  1 
ATOM   324  C  CG  . GLN A 1 76  ? 21.568  6.392   -11.250 1.00 30.72 ? 556  GLN A CG  1 
ATOM   325  C  CD  . GLN A 1 76  ? 22.000  6.381   -12.693 1.00 31.13 ? 556  GLN A CD  1 
ATOM   326  O  OE1 . GLN A 1 76  ? 21.181  6.492   -13.603 1.00 31.24 ? 556  GLN A OE1 1 
ATOM   327  N  NE2 . GLN A 1 76  ? 23.300  6.257   -12.914 1.00 31.95 ? 556  GLN A NE2 1 
ATOM   328  N  N   . GLU A 1 77  ? 18.999  9.054   -9.962  1.00 30.69 ? 557  GLU A N   1 
ATOM   329  C  CA  . GLU A 1 77  ? 19.139  10.507  -9.789  1.00 30.85 ? 557  GLU A CA  1 
ATOM   330  C  C   . GLU A 1 77  ? 19.178  10.905  -8.310  1.00 30.54 ? 557  GLU A C   1 
ATOM   331  O  O   . GLU A 1 77  ? 19.908  11.824  -7.925  1.00 30.26 ? 557  GLU A O   1 
ATOM   332  C  CB  . GLU A 1 77  ? 17.998  11.247  -10.506 1.00 31.05 ? 557  GLU A CB  1 
ATOM   333  C  CG  . GLU A 1 77  ? 18.127  11.251  -12.031 1.00 32.02 ? 557  GLU A CG  1 
ATOM   334  C  CD  . GLU A 1 77  ? 16.789  11.332  -12.764 1.00 33.63 ? 557  GLU A CD  1 
ATOM   335  O  OE1 . GLU A 1 77  ? 15.758  11.651  -12.128 1.00 34.43 ? 557  GLU A OE1 1 
ATOM   336  O  OE2 . GLU A 1 77  ? 16.772  11.066  -13.988 1.00 34.75 ? 557  GLU A OE2 1 
ATOM   337  N  N   . ARG A 1 78  ? 18.404  10.189  -7.495  1.00 30.22 ? 558  ARG A N   1 
ATOM   338  C  CA  . ARG A 1 78  ? 18.301  10.456  -6.063  1.00 30.18 ? 558  ARG A CA  1 
ATOM   339  C  C   . ARG A 1 78  ? 19.281  9.605   -5.242  1.00 29.78 ? 558  ARG A C   1 
ATOM   340  O  O   . ARG A 1 78  ? 19.255  9.646   -4.010  1.00 29.56 ? 558  ARG A O   1 
ATOM   341  C  CB  . ARG A 1 78  ? 16.868  10.203  -5.583  1.00 30.34 ? 558  ARG A CB  1 
ATOM   342  C  CG  . ARG A 1 78  ? 15.782  10.846  -6.449  1.00 31.27 ? 558  ARG A CG  1 
ATOM   343  C  CD  . ARG A 1 78  ? 15.398  12.233  -5.980  1.00 32.77 ? 558  ARG A CD  1 
ATOM   344  N  NE  . ARG A 1 78  ? 14.612  12.935  -7.000  1.00 33.75 ? 558  ARG A NE  1 
ATOM   345  C  CZ  . ARG A 1 78  ? 13.695  13.874  -6.754  1.00 34.08 ? 558  ARG A CZ  1 
ATOM   346  N  NH1 . ARG A 1 78  ? 13.402  14.250  -5.509  1.00 33.54 ? 558  ARG A NH1 1 
ATOM   347  N  NH2 . ARG A 1 78  ? 13.053  14.438  -7.771  1.00 34.29 ? 558  ARG A NH2 1 
ATOM   348  N  N   . GLY A 1 79  ? 20.125  8.828   -5.925  1.00 29.40 ? 559  GLY A N   1 
ATOM   349  C  CA  . GLY A 1 79  ? 21.192  8.054   -5.279  1.00 29.21 ? 559  GLY A CA  1 
ATOM   350  C  C   . GLY A 1 79  ? 20.788  6.740   -4.618  1.00 28.93 ? 559  GLY A C   1 
ATOM   351  O  O   . GLY A 1 79  ? 21.615  6.088   -3.985  1.00 28.76 ? 559  GLY A O   1 
ATOM   352  N  N   . LEU A 1 80  ? 19.531  6.337   -4.770  1.00 28.83 ? 560  LEU A N   1 
ATOM   353  C  CA  . LEU A 1 80  ? 19.026  5.128   -4.111  1.00 28.72 ? 560  LEU A CA  1 
ATOM   354  C  C   . LEU A 1 80  ? 19.393  3.837   -4.837  1.00 28.70 ? 560  LEU A C   1 
ATOM   355  O  O   . LEU A 1 80  ? 19.648  2.821   -4.197  1.00 28.80 ? 560  LEU A O   1 
ATOM   356  C  CB  . LEU A 1 80  ? 17.507  5.201   -3.951  1.00 28.64 ? 560  LEU A CB  1 
ATOM   357  C  CG  . LEU A 1 80  ? 16.964  6.322   -3.060  1.00 28.56 ? 560  LEU A CG  1 
ATOM   358  C  CD1 . LEU A 1 80  ? 15.449  6.211   -2.950  1.00 28.40 ? 560  LEU A CD1 1 
ATOM   359  C  CD2 . LEU A 1 80  ? 17.608  6.290   -1.686  1.00 27.95 ? 560  LEU A CD2 1 
ATOM   360  N  N   . ARG A 1 81  ? 19.420  3.878   -6.166  1.00 28.78 ? 561  ARG A N   1 
ATOM   361  C  CA  . ARG A 1 81  ? 19.599  2.668   -6.976  1.00 28.96 ? 561  ARG A CA  1 
ATOM   362  C  C   . ARG A 1 81  ? 20.903  1.918   -6.684  1.00 29.03 ? 561  ARG A C   1 
ATOM   363  O  O   . ARG A 1 81  ? 20.902  0.698   -6.542  1.00 29.23 ? 561  ARG A O   1 
ATOM   364  C  CB  . ARG A 1 81  ? 19.518  2.998   -8.468  1.00 28.90 ? 561  ARG A CB  1 
ATOM   365  C  CG  . ARG A 1 81  ? 18.905  1.891   -9.299  1.00 29.44 ? 561  ARG A CG  1 
ATOM   366  C  CD  . ARG A 1 81  ? 18.552  2.377   -10.685 1.00 29.81 ? 561  ARG A CD  1 
ATOM   367  N  NE  . ARG A 1 81  ? 19.724  2.455   -11.553 1.00 31.03 ? 561  ARG A NE  1 
ATOM   368  C  CZ  . ARG A 1 81  ? 19.725  2.969   -12.783 1.00 30.76 ? 561  ARG A CZ  1 
ATOM   369  N  NH1 . ARG A 1 81  ? 18.617  3.475   -13.316 1.00 30.69 ? 561  ARG A NH1 1 
ATOM   370  N  NH2 . ARG A 1 81  ? 20.848  2.982   -13.483 1.00 31.00 ? 561  ARG A NH2 1 
ATOM   371  N  N   . SER A 1 82  ? 22.005  2.648   -6.588  1.00 29.12 ? 562  SER A N   1 
ATOM   372  C  CA  . SER A 1 82  ? 23.317  2.040   -6.352  1.00 29.18 ? 562  SER A CA  1 
ATOM   373  C  C   . SER A 1 82  ? 23.453  1.361   -4.977  1.00 29.38 ? 562  SER A C   1 
ATOM   374  O  O   . SER A 1 82  ? 24.332  0.522   -4.784  1.00 29.18 ? 562  SER A O   1 
ATOM   375  C  CB  . SER A 1 82  ? 24.408  3.096   -6.505  1.00 28.94 ? 562  SER A CB  1 
ATOM   376  O  OG  . SER A 1 82  ? 24.205  4.145   -5.581  1.00 28.53 ? 562  SER A OG  1 
ATOM   377  N  N   . GLN A 1 83  ? 22.589  1.731   -4.032  1.00 29.73 ? 563  GLN A N   1 
ATOM   378  C  CA  . GLN A 1 83  ? 22.617  1.177   -2.677  1.00 29.92 ? 563  GLN A CA  1 
ATOM   379  C  C   . GLN A 1 83  ? 21.945  -0.192  -2.627  1.00 30.26 ? 563  GLN A C   1 
ATOM   380  O  O   . GLN A 1 83  ? 22.056  -0.914  -1.633  1.00 30.58 ? 563  GLN A O   1 
ATOM   381  C  CB  . GLN A 1 83  ? 21.907  2.118   -1.701  1.00 29.80 ? 563  GLN A CB  1 
ATOM   382  C  CG  . GLN A 1 83  ? 22.447  3.536   -1.690  1.00 29.80 ? 563  GLN A CG  1 
ATOM   383  C  CD  . GLN A 1 83  ? 21.743  4.412   -0.678  1.00 29.52 ? 563  GLN A CD  1 
ATOM   384  O  OE1 . GLN A 1 83  ? 21.747  4.124   0.517   1.00 29.33 ? 563  GLN A OE1 1 
ATOM   385  N  NE2 . GLN A 1 83  ? 21.130  5.488   -1.151  1.00 29.24 ? 563  GLN A NE2 1 
ATOM   386  N  N   . CYS A 1 84  ? 21.232  -0.529  -3.696  1.00 30.49 ? 564  CYS A N   1 
ATOM   387  C  CA  . CYS A 1 84  ? 20.531  -1.797  -3.812  1.00 30.78 ? 564  CYS A CA  1 
ATOM   388  C  C   . CYS A 1 84  ? 21.313  -2.777  -4.671  1.00 30.84 ? 564  CYS A C   1 
ATOM   389  O  O   . CYS A 1 84  ? 22.284  -2.406  -5.326  1.00 30.84 ? 564  CYS A O   1 
ATOM   390  C  CB  . CYS A 1 84  ? 19.161  -1.559  -4.437  1.00 30.73 ? 564  CYS A CB  1 
ATOM   391  S  SG  . CYS A 1 84  ? 18.117  -0.490  -3.441  1.00 31.46 ? 564  CYS A SG  1 
ATOM   392  N  N   . GLU A 1 85  ? 20.892  -4.037  -4.641  1.00 31.04 ? 565  GLU A N   1 
ATOM   393  C  CA  . GLU A 1 85  ? 21.365  -5.028  -5.594  1.00 31.21 ? 565  GLU A CA  1 
ATOM   394  C  C   . GLU A 1 85  ? 20.365  -5.027  -6.741  1.00 31.09 ? 565  GLU A C   1 
ATOM   395  O  O   . GLU A 1 85  ? 19.177  -5.285  -6.532  1.00 31.21 ? 565  GLU A O   1 
ATOM   396  C  CB  . GLU A 1 85  ? 21.444  -6.415  -4.951  1.00 31.38 ? 565  GLU A CB  1 
ATOM   397  C  CG  . GLU A 1 85  ? 22.085  -7.487  -5.834  1.00 31.81 ? 565  GLU A CG  1 
ATOM   398  C  CD  . GLU A 1 85  ? 23.565  -7.249  -6.085  1.00 32.49 ? 565  GLU A CD  1 
ATOM   399  O  OE1 . GLU A 1 85  ? 24.251  -6.706  -5.193  1.00 33.15 ? 565  GLU A OE1 1 
ATOM   400  O  OE2 . GLU A 1 85  ? 24.048  -7.613  -7.178  1.00 33.06 ? 565  GLU A OE2 1 
ATOM   401  N  N   . CYS A 1 86  ? 20.841  -4.713  -7.941  1.00 30.95 ? 566  CYS A N   1 
ATOM   402  C  CA  . CYS A 1 86  ? 19.974  -4.576  -9.104  1.00 30.94 ? 566  CYS A CA  1 
ATOM   403  C  C   . CYS A 1 86  ? 19.965  -5.869  -9.901  1.00 31.00 ? 566  CYS A C   1 
ATOM   404  O  O   . CYS A 1 86  ? 21.016  -6.398  -10.260 1.00 31.12 ? 566  CYS A O   1 
ATOM   405  C  CB  . CYS A 1 86  ? 20.427  -3.400  -9.969  1.00 30.94 ? 566  CYS A CB  1 
ATOM   406  S  SG  . CYS A 1 86  ? 20.356  -1.819  -9.077  1.00 30.75 ? 566  CYS A SG  1 
ATOM   407  N  N   . LEU A 1 87  ? 18.766  -6.373  -10.163 1.00 31.14 ? 567  LEU A N   1 
ATOM   408  C  CA  . LEU A 1 87  ? 18.581  -7.669  -10.794 1.00 31.27 ? 567  LEU A CA  1 
ATOM   409  C  C   . LEU A 1 87  ? 17.696  -7.524  -12.020 1.00 31.42 ? 567  LEU A C   1 
ATOM   410  O  O   . LEU A 1 87  ? 16.805  -6.676  -12.056 1.00 31.11 ? 567  LEU A O   1 
ATOM   411  C  CB  . LEU A 1 87  ? 17.952  -8.642  -9.796  1.00 31.26 ? 567  LEU A CB  1 
ATOM   412  C  CG  . LEU A 1 87  ? 18.835  -8.978  -8.591  1.00 31.41 ? 567  LEU A CG  1 
ATOM   413  C  CD1 . LEU A 1 87  ? 18.017  -9.594  -7.463  1.00 32.07 ? 567  LEU A CD1 1 
ATOM   414  C  CD2 . LEU A 1 87  ? 19.975  -9.902  -9.005  1.00 31.01 ? 567  LEU A CD2 1 
ATOM   415  N  N   . ARG A 1 88  ? 17.949  -8.358  -13.022 1.00 31.80 ? 568  ARG A N   1 
ATOM   416  C  CA  . ARG A 1 88  ? 17.212  -8.297  -14.281 1.00 32.26 ? 568  ARG A CA  1 
ATOM   417  C  C   . ARG A 1 88  ? 15.880  -9.031  -14.198 1.00 32.24 ? 568  ARG A C   1 
ATOM   418  O  O   . ARG A 1 88  ? 14.910  -8.621  -14.831 1.00 32.44 ? 568  ARG A O   1 
ATOM   419  C  CB  . ARG A 1 88  ? 18.049  -8.885  -15.422 1.00 32.56 ? 568  ARG A CB  1 
ATOM   420  C  CG  . ARG A 1 88  ? 19.397  -8.201  -15.628 1.00 33.39 ? 568  ARG A CG  1 
ATOM   421  C  CD  . ARG A 1 88  ? 20.198  -8.874  -16.735 1.00 34.85 ? 568  ARG A CD  1 
ATOM   422  N  NE  . ARG A 1 88  ? 19.551  -8.723  -18.042 1.00 36.55 ? 568  ARG A NE  1 
ATOM   423  C  CZ  . ARG A 1 88  ? 18.810  -9.647  -18.663 1.00 37.33 ? 568  ARG A CZ  1 
ATOM   424  N  NH1 . ARG A 1 88  ? 18.590  -10.843 -18.121 1.00 37.65 ? 568  ARG A NH1 1 
ATOM   425  N  NH2 . ARG A 1 88  ? 18.278  -9.367  -19.851 1.00 37.29 ? 568  ARG A NH2 1 
ATOM   426  N  N   . GLY A 1 89  ? 15.838  -10.116 -13.428 1.00 32.31 ? 569  GLY A N   1 
ATOM   427  C  CA  . GLY A 1 89  ? 14.658  -10.975 -13.363 1.00 32.36 ? 569  GLY A CA  1 
ATOM   428  C  C   . GLY A 1 89  ? 14.699  -12.024 -14.459 1.00 32.50 ? 569  GLY A C   1 
ATOM   429  O  O   . GLY A 1 89  ? 15.769  -12.329 -14.988 1.00 32.75 ? 569  GLY A O   1 
ATOM   430  N  N   . ARG A 1 90  ? 13.537  -12.571 -14.810 1.00 32.41 ? 570  ARG A N   1 
ATOM   431  C  CA  . ARG A 1 90  ? 13.464  -13.661 -15.782 1.00 32.38 ? 570  ARG A CA  1 
ATOM   432  C  C   . ARG A 1 90  ? 12.033  -13.901 -16.271 1.00 32.33 ? 570  ARG A C   1 
ATOM   433  O  O   . ARG A 1 90  ? 11.083  -13.369 -15.703 1.00 32.41 ? 570  ARG A O   1 
ATOM   434  C  CB  . ARG A 1 90  ? 14.016  -14.951 -15.163 1.00 32.34 ? 570  ARG A CB  1 
ATOM   435  C  CG  . ARG A 1 90  ? 13.280  -15.404 -13.903 1.00 32.62 ? 570  ARG A CG  1 
ATOM   436  C  CD  . ARG A 1 90  ? 13.793  -16.741 -13.378 1.00 32.45 ? 570  ARG A CD  1 
ATOM   437  N  NE  . ARG A 1 90  ? 13.051  -17.184 -12.196 1.00 32.47 ? 570  ARG A NE  1 
ATOM   438  C  CZ  . ARG A 1 90  ? 11.826  -17.714 -12.212 1.00 32.51 ? 570  ARG A CZ  1 
ATOM   439  N  NH1 . ARG A 1 90  ? 11.168  -17.882 -13.354 1.00 32.86 ? 570  ARG A NH1 1 
ATOM   440  N  NH2 . ARG A 1 90  ? 11.245  -18.080 -11.073 1.00 32.32 ? 570  ARG A NH2 1 
ATOM   441  N  N   . LYS A 1 91  ? 11.896  -14.694 -17.332 1.00 32.29 ? 571  LYS A N   1 
ATOM   442  C  CA  . LYS A 1 91  ? 10.590  -15.170 -17.789 1.00 32.42 ? 571  LYS A CA  1 
ATOM   443  C  C   . LYS A 1 91  ? 9.972   -16.100 -16.758 1.00 32.11 ? 571  LYS A C   1 
ATOM   444  O  O   . LYS A 1 91  ? 10.645  -16.992 -16.253 1.00 32.34 ? 571  LYS A O   1 
ATOM   445  C  CB  . LYS A 1 91  ? 10.724  -15.991 -19.076 1.00 32.67 ? 571  LYS A CB  1 
ATOM   446  C  CG  . LYS A 1 91  ? 10.843  -15.213 -20.371 1.00 33.46 ? 571  LYS A CG  1 
ATOM   447  C  CD  . LYS A 1 91  ? 10.423  -16.080 -21.579 1.00 34.16 ? 571  LYS A CD  1 
ATOM   448  C  CE  . LYS A 1 91  ? 11.144  -17.436 -21.612 1.00 34.77 ? 571  LYS A CE  1 
ATOM   449  N  NZ  . LYS A 1 91  ? 10.831  -18.237 -22.838 1.00 35.29 ? 571  LYS A NZ  1 
ATOM   450  N  N   . ALA A 1 92  ? 8.690   -15.922 -16.464 1.00 31.72 ? 572  ALA A N   1 
ATOM   451  C  CA  . ALA A 1 92  ? 7.955   -16.940 -15.719 1.00 31.40 ? 572  ALA A CA  1 
ATOM   452  C  C   . ALA A 1 92  ? 7.726   -18.132 -16.648 1.00 31.14 ? 572  ALA A C   1 
ATOM   453  O  O   . ALA A 1 92  ? 7.406   -17.950 -17.826 1.00 31.12 ? 572  ALA A O   1 
ATOM   454  C  CB  . ALA A 1 92  ? 6.639   -16.393 -15.217 1.00 31.31 ? 572  ALA A CB  1 
ATOM   455  N  N   . SER A 1 93  ? 7.910   -19.347 -16.135 1.00 30.89 ? 573  SER A N   1 
ATOM   456  C  CA  . SER A 1 93  ? 7.668   -20.553 -16.932 1.00 30.48 ? 573  SER A CA  1 
ATOM   457  C  C   . SER A 1 93  ? 6.168   -20.769 -17.083 1.00 30.37 ? 573  SER A C   1 
ATOM   458  O  O   . SER A 1 93  ? 5.381   -20.265 -16.277 1.00 30.23 ? 573  SER A O   1 
ATOM   459  C  CB  . SER A 1 93  ? 8.310   -21.784 -16.286 1.00 30.45 ? 573  SER A CB  1 
ATOM   460  O  OG  . SER A 1 93  ? 7.523   -22.286 -15.218 1.00 30.37 ? 573  SER A OG  1 
ATOM   461  N  N   . LEU A 1 94  ? 5.775   -21.511 -18.115 1.00 30.22 ? 574  LEU A N   1 
ATOM   462  C  CA  . LEU A 1 94  ? 4.360   -21.839 -18.332 1.00 30.11 ? 574  LEU A CA  1 
ATOM   463  C  C   . LEU A 1 94  ? 3.761   -22.534 -17.111 1.00 30.03 ? 574  LEU A C   1 
ATOM   464  O  O   . LEU A 1 94  ? 2.604   -22.298 -16.761 1.00 30.01 ? 574  LEU A O   1 
ATOM   465  C  CB  . LEU A 1 94  ? 4.182   -22.713 -19.581 1.00 30.04 ? 574  LEU A CB  1 
ATOM   466  C  CG  . LEU A 1 94  ? 3.928   -21.981 -20.906 1.00 29.99 ? 574  LEU A CG  1 
ATOM   467  C  CD1 . LEU A 1 94  ? 4.772   -20.724 -21.039 1.00 29.80 ? 574  LEU A CD1 1 
ATOM   468  C  CD2 . LEU A 1 94  ? 4.162   -22.921 -22.091 1.00 29.61 ? 574  LEU A CD2 1 
ATOM   469  N  N   . GLU A 1 95  ? 4.565   -23.377 -16.465 1.00 29.95 ? 575  GLU A N   1 
ATOM   470  C  CA  . GLU A 1 95  ? 4.158   -24.075 -15.245 1.00 29.83 ? 575  GLU A CA  1 
ATOM   471  C  C   . GLU A 1 95  ? 3.856   -23.083 -14.111 1.00 29.42 ? 575  GLU A C   1 
ATOM   472  O  O   . GLU A 1 95  ? 2.848   -23.217 -13.417 1.00 29.18 ? 575  GLU A O   1 
ATOM   473  C  CB  . GLU A 1 95  ? 5.239   -25.074 -14.809 1.00 29.97 ? 575  GLU A CB  1 
ATOM   474  C  CG  . GLU A 1 95  ? 5.421   -26.290 -15.747 1.00 30.62 ? 575  GLU A CG  1 
ATOM   475  C  CD  . GLU A 1 95  ? 6.183   -25.993 -17.049 1.00 31.59 ? 575  GLU A CD  1 
ATOM   476  O  OE1 . GLU A 1 95  ? 6.860   -24.948 -17.148 1.00 31.56 ? 575  GLU A OE1 1 
ATOM   477  O  OE2 . GLU A 1 95  ? 6.102   -26.825 -17.983 1.00 32.69 ? 575  GLU A OE2 1 
ATOM   478  N  N   . GLU A 1 96  ? 4.719   -22.084 -13.936 1.00 29.14 ? 576  GLU A N   1 
ATOM   479  C  CA  . GLU A 1 96  ? 4.511   -21.060 -12.901 1.00 28.92 ? 576  GLU A CA  1 
ATOM   480  C  C   . GLU A 1 96  ? 3.206   -20.288 -13.113 1.00 28.52 ? 576  GLU A C   1 
ATOM   481  O  O   . GLU A 1 96  ? 2.473   -20.037 -12.157 1.00 28.39 ? 576  GLU A O   1 
ATOM   482  C  CB  . GLU A 1 96  ? 5.697   -20.094 -12.832 1.00 29.04 ? 576  GLU A CB  1 
ATOM   483  C  CG  . GLU A 1 96  ? 6.962   -20.717 -12.249 1.00 29.45 ? 576  GLU A CG  1 
ATOM   484  C  CD  . GLU A 1 96  ? 8.172   -19.780 -12.285 1.00 30.63 ? 576  GLU A CD  1 
ATOM   485  O  OE1 . GLU A 1 96  ? 8.411   -19.131 -13.331 1.00 30.26 ? 576  GLU A OE1 1 
ATOM   486  O  OE2 . GLU A 1 96  ? 8.898   -19.710 -11.267 1.00 31.04 ? 576  GLU A OE2 1 
ATOM   487  N  N   . LEU A 1 97  ? 2.912   -19.950 -14.368 1.00 28.12 ? 577  LEU A N   1 
ATOM   488  C  CA  . LEU A 1 97  ? 1.669   -19.260 -14.729 1.00 27.93 ? 577  LEU A CA  1 
ATOM   489  C  C   . LEU A 1 97  ? 0.426   -20.120 -14.463 1.00 27.94 ? 577  LEU A C   1 
ATOM   490  O  O   . LEU A 1 97  ? -0.628  -19.595 -14.098 1.00 27.70 ? 577  LEU A O   1 
ATOM   491  C  CB  . LEU A 1 97  ? 1.688   -18.837 -16.207 1.00 27.69 ? 577  LEU A CB  1 
ATOM   492  C  CG  . LEU A 1 97  ? 2.850   -17.961 -16.695 1.00 27.88 ? 577  LEU A CG  1 
ATOM   493  C  CD1 . LEU A 1 97  ? 2.735   -17.710 -18.197 1.00 27.56 ? 577  LEU A CD1 1 
ATOM   494  C  CD2 . LEU A 1 97  ? 2.942   -16.638 -15.923 1.00 27.11 ? 577  LEU A CD2 1 
ATOM   495  N  N   . GLN A 1 98  ? 0.553   -21.435 -14.647 1.00 27.99 ? 578  GLN A N   1 
ATOM   496  C  CA  . GLN A 1 98  ? -0.573  -22.356 -14.441 1.00 28.15 ? 578  GLN A CA  1 
ATOM   497  C  C   . GLN A 1 98  ? -0.889  -22.633 -12.972 1.00 28.04 ? 578  GLN A C   1 
ATOM   498  O  O   . GLN A 1 98  ? -1.927  -23.213 -12.671 1.00 27.98 ? 578  GLN A O   1 
ATOM   499  C  CB  . GLN A 1 98  ? -0.359  -23.679 -15.188 1.00 28.16 ? 578  GLN A CB  1 
ATOM   500  C  CG  . GLN A 1 98  ? -0.729  -23.599 -16.652 1.00 28.73 ? 578  GLN A CG  1 
ATOM   501  C  CD  . GLN A 1 98  ? -0.635  -24.933 -17.356 1.00 29.56 ? 578  GLN A CD  1 
ATOM   502  O  OE1 . GLN A 1 98  ? -1.473  -25.820 -17.156 1.00 29.79 ? 578  GLN A OE1 1 
ATOM   503  N  NE2 . GLN A 1 98  ? 0.386   -25.083 -18.197 1.00 29.61 ? 578  GLN A NE2 1 
ATOM   504  N  N   . SER A 1 99  ? -0.008  -22.215 -12.064 1.00 28.13 ? 579  SER A N   1 
ATOM   505  C  CA  . SER A 1 99  ? -0.281  -22.323 -10.632 1.00 27.98 ? 579  SER A CA  1 
ATOM   506  C  C   . SER A 1 99  ? -1.345  -21.312 -10.192 1.00 28.05 ? 579  SER A C   1 
ATOM   507  O  O   . SER A 1 99  ? -1.892  -21.419 -9.095  1.00 28.16 ? 579  SER A O   1 
ATOM   508  C  CB  . SER A 1 99  ? 0.999   -22.140 -9.810  1.00 27.82 ? 579  SER A CB  1 
ATOM   509  O  OG  . SER A 1 99  ? 1.366   -20.778 -9.701  1.00 27.98 ? 579  SER A OG  1 
ATOM   510  N  N   . VAL A 1 100 ? -1.622  -20.324 -11.041 1.00 28.04 ? 580  VAL A N   1 
ATOM   511  C  CA  . VAL A 1 100 ? -2.672  -19.343 -10.767 1.00 28.15 ? 580  VAL A CA  1 
ATOM   512  C  C   . VAL A 1 100 ? -3.714  -19.254 -11.881 1.00 28.21 ? 580  VAL A C   1 
ATOM   513  O  O   . VAL A 1 100 ? -4.888  -19.037 -11.595 1.00 28.32 ? 580  VAL A O   1 
ATOM   514  C  CB  . VAL A 1 100 ? -2.069  -17.936 -10.486 1.00 28.19 ? 580  VAL A CB  1 
ATOM   515  C  CG1 . VAL A 1 100 ? -3.138  -16.855 -10.536 1.00 27.66 ? 580  VAL A CG1 1 
ATOM   516  C  CG2 . VAL A 1 100 ? -1.374  -17.929 -9.138  1.00 28.07 ? 580  VAL A CG2 1 
ATOM   517  N  N   . HIS A 1 101 ? -3.296  -19.424 -13.135 1.00 28.41 ? 581  HIS A N   1 
ATOM   518  C  CA  . HIS A 1 101 ? -4.190  -19.230 -14.280 1.00 28.61 ? 581  HIS A CA  1 
ATOM   519  C  C   . HIS A 1 101 ? -4.530  -20.538 -14.975 1.00 28.78 ? 581  HIS A C   1 
ATOM   520  O  O   . HIS A 1 101 ? -3.814  -21.526 -14.828 1.00 29.05 ? 581  HIS A O   1 
ATOM   521  C  CB  . HIS A 1 101 ? -3.559  -18.256 -15.279 1.00 28.57 ? 581  HIS A CB  1 
ATOM   522  C  CG  . HIS A 1 101 ? -3.264  -16.912 -14.694 1.00 28.32 ? 581  HIS A CG  1 
ATOM   523  N  ND1 . HIS A 1 101 ? -4.254  -16.015 -14.358 1.00 27.99 ? 581  HIS A ND1 1 
ATOM   524  C  CD2 . HIS A 1 101 ? -2.091  -16.320 -14.367 1.00 28.62 ? 581  HIS A CD2 1 
ATOM   525  C  CE1 . HIS A 1 101 ? -3.703  -14.925 -13.856 1.00 28.16 ? 581  HIS A CE1 1 
ATOM   526  N  NE2 . HIS A 1 101 ? -2.392  -15.084 -13.852 1.00 28.06 ? 581  HIS A NE2 1 
ATOM   527  N  N   . SER A 1 102 ? -5.621  -20.533 -15.739 1.00 28.88 ? 582  SER A N   1 
ATOM   528  C  CA  . SER A 1 102 ? -6.077  -21.731 -16.453 1.00 29.03 ? 582  SER A CA  1 
ATOM   529  C  C   . SER A 1 102 ? -5.167  -22.064 -17.634 1.00 29.14 ? 582  SER A C   1 
ATOM   530  O  O   . SER A 1 102 ? -4.328  -21.251 -18.033 1.00 29.35 ? 582  SER A O   1 
ATOM   531  C  CB  . SER A 1 102 ? -7.516  -21.549 -16.950 1.00 28.96 ? 582  SER A CB  1 
ATOM   532  O  OG  . SER A 1 102 ? -7.571  -20.654 -18.048 1.00 29.32 ? 582  SER A OG  1 
ATOM   533  N  N   . GLU A 1 103 ? -5.349  -23.261 -18.190 1.00 29.21 ? 583  GLU A N   1 
ATOM   534  C  CA  . GLU A 1 103 ? -4.558  -23.724 -19.330 1.00 29.19 ? 583  GLU A CA  1 
ATOM   535  C  C   . GLU A 1 103 ? -4.859  -22.905 -20.585 1.00 29.26 ? 583  GLU A C   1 
ATOM   536  O  O   . GLU A 1 103 ? -3.943  -22.519 -21.313 1.00 29.21 ? 583  GLU A O   1 
ATOM   537  C  CB  . GLU A 1 103 ? -4.815  -25.210 -19.596 1.00 29.09 ? 583  GLU A CB  1 
ATOM   538  N  N   . ARG A 1 104 ? -6.140  -22.642 -20.831 1.00 29.33 ? 584  ARG A N   1 
ATOM   539  C  CA  . ARG A 1 104 ? -6.545  -21.789 -21.943 1.00 29.58 ? 584  ARG A CA  1 
ATOM   540  C  C   . ARG A 1 104 ? -5.914  -20.400 -21.817 1.00 29.87 ? 584  ARG A C   1 
ATOM   541  O  O   . ARG A 1 104 ? -5.379  -19.869 -22.788 1.00 29.96 ? 584  ARG A O   1 
ATOM   542  C  CB  . ARG A 1 104 ? -8.069  -21.669 -22.013 1.00 29.47 ? 584  ARG A CB  1 
ATOM   543  N  N   . HIS A 1 105 ? -5.963  -19.828 -20.617 1.00 30.20 ? 585  HIS A N   1 
ATOM   544  C  CA  . HIS A 1 105 ? -5.394  -18.503 -20.373 1.00 30.49 ? 585  HIS A CA  1 
ATOM   545  C  C   . HIS A 1 105 ? -3.904  -18.462 -20.710 1.00 30.64 ? 585  HIS A C   1 
ATOM   546  O  O   . HIS A 1 105 ? -3.447  -17.569 -21.425 1.00 30.59 ? 585  HIS A O   1 
ATOM   547  C  CB  . HIS A 1 105 ? -5.614  -18.083 -18.917 1.00 30.49 ? 585  HIS A CB  1 
ATOM   548  C  CG  . HIS A 1 105 ? -5.258  -16.655 -18.639 1.00 30.66 ? 585  HIS A CG  1 
ATOM   549  N  ND1 . HIS A 1 105 ? -6.097  -15.605 -18.946 1.00 30.93 ? 585  HIS A ND1 1 
ATOM   550  C  CD2 . HIS A 1 105 ? -4.153  -16.102 -18.083 1.00 30.55 ? 585  HIS A CD2 1 
ATOM   551  C  CE1 . HIS A 1 105 ? -5.525  -14.468 -18.590 1.00 30.27 ? 585  HIS A CE1 1 
ATOM   552  N  NE2 . HIS A 1 105 ? -4.344  -14.742 -18.067 1.00 30.17 ? 585  HIS A NE2 1 
ATOM   553  N  N   . VAL A 1 106 ? -3.164  -19.445 -20.209 1.00 30.91 ? 586  VAL A N   1 
ATOM   554  C  CA  . VAL A 1 106 ? -1.713  -19.497 -20.382 1.00 31.09 ? 586  VAL A CA  1 
ATOM   555  C  C   . VAL A 1 106 ? -1.303  -19.766 -21.833 1.00 31.38 ? 586  VAL A C   1 
ATOM   556  O  O   . VAL A 1 106 ? -0.313  -19.216 -22.310 1.00 31.39 ? 586  VAL A O   1 
ATOM   557  C  CB  . VAL A 1 106 ? -1.080  -20.548 -19.440 1.00 31.08 ? 586  VAL A CB  1 
ATOM   558  C  CG1 . VAL A 1 106 ? 0.407   -20.726 -19.733 1.00 30.52 ? 586  VAL A CG1 1 
ATOM   559  C  CG2 . VAL A 1 106 ? -1.307  -20.144 -17.985 1.00 30.55 ? 586  VAL A CG2 1 
ATOM   560  N  N   . LEU A 1 107 ? -2.055  -20.607 -22.535 1.00 31.93 ? 587  LEU A N   1 
ATOM   561  C  CA  . LEU A 1 107 ? -1.821  -20.802 -23.968 1.00 32.42 ? 587  LEU A CA  1 
ATOM   562  C  C   . LEU A 1 107 ? -2.055  -19.494 -24.723 1.00 32.75 ? 587  LEU A C   1 
ATOM   563  O  O   . LEU A 1 107 ? -1.243  -19.096 -25.561 1.00 32.91 ? 587  LEU A O   1 
ATOM   564  C  CB  . LEU A 1 107 ? -2.727  -21.897 -24.541 1.00 32.43 ? 587  LEU A CB  1 
ATOM   565  C  CG  . LEU A 1 107 ? -2.346  -23.352 -24.253 1.00 32.78 ? 587  LEU A CG  1 
ATOM   566  C  CD1 . LEU A 1 107 ? -3.345  -24.290 -24.916 1.00 32.32 ? 587  LEU A CD1 1 
ATOM   567  C  CD2 . LEU A 1 107 ? -0.926  -23.665 -24.719 1.00 33.04 ? 587  LEU A CD2 1 
ATOM   568  N  N   . LEU A 1 108 ? -3.159  -18.825 -24.399 1.00 33.06 ? 588  LEU A N   1 
ATOM   569  C  CA  . LEU A 1 108 ? -3.558  -17.598 -25.083 1.00 33.31 ? 588  LEU A CA  1 
ATOM   570  C  C   . LEU A 1 108 ? -2.544  -16.468 -24.929 1.00 33.51 ? 588  LEU A C   1 
ATOM   571  O  O   . LEU A 1 108 ? -2.187  -15.831 -25.914 1.00 33.52 ? 588  LEU A O   1 
ATOM   572  C  CB  . LEU A 1 108 ? -4.930  -17.132 -24.584 1.00 33.22 ? 588  LEU A CB  1 
ATOM   573  C  CG  . LEU A 1 108 ? -5.595  -15.984 -25.349 1.00 33.42 ? 588  LEU A CG  1 
ATOM   574  C  CD1 . LEU A 1 108 ? -5.686  -16.274 -26.853 1.00 32.80 ? 588  LEU A CD1 1 
ATOM   575  C  CD2 . LEU A 1 108 ? -6.975  -15.701 -24.770 1.00 33.27 ? 588  LEU A CD2 1 
ATOM   576  N  N   . TYR A 1 109 ? -2.081  -16.228 -23.703 1.00 33.91 ? 589  TYR A N   1 
ATOM   577  C  CA  . TYR A 1 109 ? -1.227  -15.071 -23.408 1.00 34.22 ? 589  TYR A CA  1 
ATOM   578  C  C   . TYR A 1 109 ? 0.236   -15.405 -23.115 1.00 34.58 ? 589  TYR A C   1 
ATOM   579  O  O   . TYR A 1 109 ? 1.064   -14.502 -23.031 1.00 34.61 ? 589  TYR A O   1 
ATOM   580  C  CB  . TYR A 1 109 ? -1.803  -14.290 -22.227 1.00 34.24 ? 589  TYR A CB  1 
ATOM   581  C  CG  . TYR A 1 109 ? -3.209  -13.798 -22.459 1.00 34.29 ? 589  TYR A CG  1 
ATOM   582  C  CD1 . TYR A 1 109 ? -3.473  -12.813 -23.404 1.00 34.61 ? 589  TYR A CD1 1 
ATOM   583  C  CD2 . TYR A 1 109 ? -4.275  -14.314 -21.732 1.00 34.68 ? 589  TYR A CD2 1 
ATOM   584  C  CE1 . TYR A 1 109 ? -4.764  -12.357 -23.623 1.00 34.75 ? 589  TYR A CE1 1 
ATOM   585  C  CE2 . TYR A 1 109 ? -5.571  -13.864 -21.943 1.00 35.01 ? 589  TYR A CE2 1 
ATOM   586  C  CZ  . TYR A 1 109 ? -5.808  -12.887 -22.891 1.00 35.01 ? 589  TYR A CZ  1 
ATOM   587  O  OH  . TYR A 1 109 ? -7.092  -12.442 -23.101 1.00 35.37 ? 589  TYR A OH  1 
ATOM   588  N  N   . GLY A 1 110 ? 0.555   -16.686 -22.957 1.00 35.13 ? 590  GLY A N   1 
ATOM   589  C  CA  . GLY A 1 110 ? 1.901   -17.100 -22.561 1.00 35.44 ? 590  GLY A CA  1 
ATOM   590  C  C   . GLY A 1 110 ? 2.746   -17.724 -23.655 1.00 35.77 ? 590  GLY A C   1 
ATOM   591  O  O   . GLY A 1 110 ? 3.935   -17.962 -23.446 1.00 35.57 ? 590  GLY A O   1 
ATOM   592  N  N   . THR A 1 111 ? 2.150   -17.989 -24.817 1.00 36.38 ? 591  THR A N   1 
ATOM   593  C  CA  . THR A 1 111 ? 2.836   -18.731 -25.876 1.00 36.82 ? 591  THR A CA  1 
ATOM   594  C  C   . THR A 1 111 ? 2.690   -18.097 -27.255 1.00 37.39 ? 591  THR A C   1 
ATOM   595  O  O   . THR A 1 111 ? 1.729   -17.373 -27.521 1.00 37.53 ? 591  THR A O   1 
ATOM   596  C  CB  . THR A 1 111 ? 2.308   -20.171 -25.965 1.00 36.83 ? 591  THR A CB  1 
ATOM   597  O  OG1 . THR A 1 111 ? 0.969   -20.159 -26.472 1.00 36.85 ? 591  THR A OG1 1 
ATOM   598  C  CG2 . THR A 1 111 ? 2.337   -20.844 -24.594 1.00 36.63 ? 591  THR A CG2 1 
ATOM   599  N  N   . ASN A 1 112 ? 3.650   -18.407 -28.128 1.00 37.98 ? 592  ASN A N   1 
ATOM   600  C  CA  . ASN A 1 112 ? 3.661   -17.933 -29.512 1.00 38.32 ? 592  ASN A CA  1 
ATOM   601  C  C   . ASN A 1 112 ? 2.711   -18.772 -30.372 1.00 38.46 ? 592  ASN A C   1 
ATOM   602  O  O   . ASN A 1 112 ? 2.745   -20.004 -30.304 1.00 38.61 ? 592  ASN A O   1 
ATOM   603  C  CB  . ASN A 1 112 ? 5.092   -17.994 -30.074 1.00 38.51 ? 592  ASN A CB  1 
ATOM   604  C  CG  . ASN A 1 112 ? 5.156   -17.760 -31.579 1.00 39.24 ? 592  ASN A CG  1 
ATOM   605  O  OD1 . ASN A 1 112 ? 4.478   -16.886 -32.120 1.00 40.66 ? 592  ASN A OD1 1 
ATOM   606  N  ND2 . ASN A 1 112 ? 5.993   -18.536 -32.258 1.00 39.87 ? 592  ASN A ND2 1 
ATOM   607  N  N   . PRO A 1 113 ? 1.855   -18.106 -31.178 1.00 38.57 ? 593  PRO A N   1 
ATOM   608  C  CA  . PRO A 1 113 ? 0.937   -18.772 -32.101 1.00 38.57 ? 593  PRO A CA  1 
ATOM   609  C  C   . PRO A 1 113 ? 1.520   -19.940 -32.904 1.00 38.55 ? 593  PRO A C   1 
ATOM   610  O  O   . PRO A 1 113 ? 0.878   -20.984 -33.013 1.00 38.64 ? 593  PRO A O   1 
ATOM   611  C  CB  . PRO A 1 113 ? 0.534   -17.640 -33.046 1.00 38.58 ? 593  PRO A CB  1 
ATOM   612  C  CG  . PRO A 1 113 ? 0.520   -16.440 -32.179 1.00 38.51 ? 593  PRO A CG  1 
ATOM   613  C  CD  . PRO A 1 113 ? 1.558   -16.661 -31.097 1.00 38.64 ? 593  PRO A CD  1 
ATOM   614  N  N   . LEU A 1 114 ? 2.714   -19.765 -33.461 1.00 38.55 ? 594  LEU A N   1 
ATOM   615  C  CA  . LEU A 1 114 ? 3.290   -20.781 -34.345 1.00 38.55 ? 594  LEU A CA  1 
ATOM   616  C  C   . LEU A 1 114 ? 3.691   -22.046 -33.595 1.00 38.60 ? 594  LEU A C   1 
ATOM   617  O  O   . LEU A 1 114 ? 3.461   -23.154 -34.082 1.00 38.73 ? 594  LEU A O   1 
ATOM   618  C  CB  . LEU A 1 114 ? 4.488   -20.220 -35.116 1.00 38.50 ? 594  LEU A CB  1 
ATOM   619  C  CG  . LEU A 1 114 ? 4.128   -19.161 -36.158 1.00 38.42 ? 594  LEU A CG  1 
ATOM   620  C  CD1 . LEU A 1 114 ? 5.379   -18.468 -36.663 1.00 38.46 ? 594  LEU A CD1 1 
ATOM   621  C  CD2 . LEU A 1 114 ? 3.345   -19.774 -37.310 1.00 37.87 ? 594  LEU A CD2 1 
ATOM   622  N  N   . SER A 1 115 ? 4.281   -21.883 -32.413 1.00 38.62 ? 595  SER A N   1 
ATOM   623  C  CA  . SER A 1 115 ? 4.680   -23.029 -31.596 1.00 38.56 ? 595  SER A CA  1 
ATOM   624  C  C   . SER A 1 115 ? 3.476   -23.609 -30.858 1.00 38.52 ? 595  SER A C   1 
ATOM   625  O  O   . SER A 1 115 ? 2.664   -24.327 -31.448 1.00 38.39 ? 595  SER A O   1 
ATOM   626  C  CB  . SER A 1 115 ? 5.776   -22.629 -30.607 1.00 38.53 ? 595  SER A CB  1 
ATOM   627  O  OG  . SER A 1 115 ? 5.438   -21.433 -29.941 1.00 38.39 ? 595  SER A OG  1 
ATOM   628  N  N   . VAL A 1 134 ? -9.326  -9.108  -30.480 1.00 33.68 ? 614  VAL A N   1 
ATOM   629  C  CA  . VAL A 1 134 ? -10.365 -8.094  -30.649 1.00 33.67 ? 614  VAL A CA  1 
ATOM   630  C  C   . VAL A 1 134 ? -9.782  -6.800  -31.219 1.00 33.54 ? 614  VAL A C   1 
ATOM   631  O  O   . VAL A 1 134 ? -8.730  -6.331  -30.786 1.00 33.56 ? 614  VAL A O   1 
ATOM   632  C  CB  . VAL A 1 134 ? -11.111 -7.821  -29.310 1.00 33.75 ? 614  VAL A CB  1 
ATOM   633  C  CG1 . VAL A 1 134 ? -11.597 -6.378  -29.223 1.00 33.68 ? 614  VAL A CG1 1 
ATOM   634  C  CG2 . VAL A 1 134 ? -12.275 -8.797  -29.143 1.00 33.78 ? 614  VAL A CG2 1 
ATOM   635  N  N   . MET A 1 135 ? -10.479 -6.238  -32.201 1.00 33.57 ? 615  MET A N   1 
ATOM   636  C  CA  . MET A 1 135 ? -10.053 -5.015  -32.880 1.00 33.52 ? 615  MET A CA  1 
ATOM   637  C  C   . MET A 1 135 ? -10.372 -3.812  -31.995 1.00 33.31 ? 615  MET A C   1 
ATOM   638  O  O   . MET A 1 135 ? -11.310 -3.863  -31.196 1.00 33.46 ? 615  MET A O   1 
ATOM   639  C  CB  . MET A 1 135 ? -10.780 -4.901  -34.222 1.00 33.61 ? 615  MET A CB  1 
ATOM   640  C  CG  . MET A 1 135 ? -10.308 -3.774  -35.134 1.00 34.09 ? 615  MET A CG  1 
ATOM   641  S  SD  . MET A 1 135 ? -8.646  -3.998  -35.795 1.00 34.83 ? 615  MET A SD  1 
ATOM   642  C  CE  . MET A 1 135 ? -8.847  -5.480  -36.779 1.00 33.66 ? 615  MET A CE  1 
ATOM   643  N  N   . LEU A 1 136 ? -9.583  -2.746  -32.124 1.00 32.92 ? 616  LEU A N   1 
ATOM   644  C  CA  . LEU A 1 136 ? -9.771  -1.530  -31.322 1.00 32.58 ? 616  LEU A CA  1 
ATOM   645  C  C   . LEU A 1 136 ? -10.048 -0.340  -32.236 1.00 32.11 ? 616  LEU A C   1 
ATOM   646  O  O   . LEU A 1 136 ? -9.730  -0.396  -33.424 1.00 32.30 ? 616  LEU A O   1 
ATOM   647  C  CB  . LEU A 1 136 ? -8.529  -1.240  -30.471 1.00 32.64 ? 616  LEU A CB  1 
ATOM   648  C  CG  . LEU A 1 136 ? -8.089  -2.308  -29.467 1.00 32.57 ? 616  LEU A CG  1 
ATOM   649  C  CD1 . LEU A 1 136 ? -6.691  -2.006  -28.956 1.00 32.21 ? 616  LEU A CD1 1 
ATOM   650  C  CD2 . LEU A 1 136 ? -9.074  -2.413  -28.314 1.00 32.92 ? 616  LEU A CD2 1 
ATOM   651  N  N   . PRO A 1 137 ? -10.638 0.743   -31.688 1.00 31.53 ? 617  PRO A N   1 
ATOM   652  C  CA  . PRO A 1 137 ? -10.883 1.953   -32.480 1.00 31.16 ? 617  PRO A CA  1 
ATOM   653  C  C   . PRO A 1 137 ? -9.619  2.551   -33.102 1.00 30.77 ? 617  PRO A C   1 
ATOM   654  O  O   . PRO A 1 137 ? -9.681  3.111   -34.195 1.00 30.64 ? 617  PRO A O   1 
ATOM   655  C  CB  . PRO A 1 137 ? -11.489 2.926   -31.462 1.00 31.20 ? 617  PRO A CB  1 
ATOM   656  C  CG  . PRO A 1 137 ? -12.076 2.067   -30.412 1.00 31.28 ? 617  PRO A CG  1 
ATOM   657  C  CD  . PRO A 1 137 ? -11.187 0.866   -30.323 1.00 31.56 ? 617  PRO A CD  1 
ATOM   658  N  N   . CYS A 1 138 ? -8.488  2.421   -32.412 1.00 30.39 ? 618  CYS A N   1 
ATOM   659  C  CA  . CYS A 1 138 ? -7.215  2.967   -32.886 1.00 30.21 ? 618  CYS A CA  1 
ATOM   660  C  C   . CYS A 1 138 ? -6.507  2.073   -33.905 1.00 30.02 ? 618  CYS A C   1 
ATOM   661  O  O   . CYS A 1 138 ? -5.484  2.471   -34.465 1.00 29.89 ? 618  CYS A O   1 
ATOM   662  C  CB  . CYS A 1 138 ? -6.275  3.198   -31.705 1.00 30.24 ? 618  CYS A CB  1 
ATOM   663  S  SG  . CYS A 1 138 ? -5.719  1.671   -30.927 1.00 30.15 ? 618  CYS A SG  1 
ATOM   664  N  N   . GLY A 1 139 ? -7.027  0.864   -34.117 1.00 29.89 ? 619  GLY A N   1 
ATOM   665  C  CA  . GLY A 1 139 ? -6.463  -0.062  -35.097 1.00 29.90 ? 619  GLY A CA  1 
ATOM   666  C  C   . GLY A 1 139 ? -5.577  -1.153  -34.533 1.00 29.87 ? 619  GLY A C   1 
ATOM   667  O  O   . GLY A 1 139 ? -5.334  -2.155  -35.204 1.00 29.84 ? 619  GLY A O   1 
ATOM   668  N  N   . GLY A 1 140 ? -5.081  -0.961  -33.312 1.00 29.90 ? 620  GLY A N   1 
ATOM   669  C  CA  . GLY A 1 140 ? -4.296  -1.986  -32.630 1.00 29.79 ? 620  GLY A CA  1 
ATOM   670  C  C   . GLY A 1 140 ? -5.178  -3.107  -32.118 1.00 29.89 ? 620  GLY A C   1 
ATOM   671  O  O   . GLY A 1 140 ? -6.402  -2.987  -32.098 1.00 29.83 ? 620  GLY A O   1 
ATOM   672  N  N   . VAL A 1 141 ? -4.553  -4.205  -31.709 1.00 30.08 ? 621  VAL A N   1 
ATOM   673  C  CA  . VAL A 1 141 ? -5.270  -5.336  -31.135 1.00 30.28 ? 621  VAL A CA  1 
ATOM   674  C  C   . VAL A 1 141 ? -5.262  -5.219  -29.611 1.00 30.54 ? 621  VAL A C   1 
ATOM   675  O  O   . VAL A 1 141 ? -4.348  -4.632  -29.027 1.00 30.35 ? 621  VAL A O   1 
ATOM   676  C  CB  . VAL A 1 141 ? -4.651  -6.681  -31.595 1.00 30.25 ? 621  VAL A CB  1 
ATOM   677  C  CG1 . VAL A 1 141 ? -5.202  -7.853  -30.791 1.00 30.40 ? 621  VAL A CG1 1 
ATOM   678  C  CG2 . VAL A 1 141 ? -4.919  -6.896  -33.075 1.00 30.17 ? 621  VAL A CG2 1 
ATOM   679  N  N   . GLY A 1 142 ? -6.299  -5.758  -28.978 1.00 30.94 ? 622  GLY A N   1 
ATOM   680  C  CA  . GLY A 1 142 ? -6.383  -5.788  -27.519 1.00 31.48 ? 622  GLY A CA  1 
ATOM   681  C  C   . GLY A 1 142 ? -7.402  -6.806  -27.051 1.00 31.74 ? 622  GLY A C   1 
ATOM   682  O  O   . GLY A 1 142 ? -8.186  -7.314  -27.859 1.00 31.81 ? 622  GLY A O   1 
ATOM   683  N  N   . VAL A 1 143 ? -7.389  -7.109  -25.754 1.00 32.01 ? 623  VAL A N   1 
ATOM   684  C  CA  . VAL A 1 143 ? -8.379  -8.024  -25.175 1.00 32.34 ? 623  VAL A CA  1 
ATOM   685  C  C   . VAL A 1 143 ? -9.670  -7.244  -24.931 1.00 32.63 ? 623  VAL A C   1 
ATOM   686  O  O   . VAL A 1 143 ? -10.769 -7.774  -25.095 1.00 32.86 ? 623  VAL A O   1 
ATOM   687  C  CB  . VAL A 1 143 ? -7.897  -8.704  -23.859 1.00 32.21 ? 623  VAL A CB  1 
ATOM   688  C  CG1 . VAL A 1 143 ? -6.402  -8.997  -23.902 1.00 31.93 ? 623  VAL A CG1 1 
ATOM   689  C  CG2 . VAL A 1 143 ? -8.233  -7.866  -22.658 1.00 32.33 ? 623  VAL A CG2 1 
ATOM   690  N  N   . ASP A 1 144 ? -9.518  -5.982  -24.538 1.00 32.86 ? 624  ASP A N   1 
ATOM   691  C  CA  . ASP A 1 144 ? -10.630 -5.037  -24.459 1.00 33.05 ? 624  ASP A CA  1 
ATOM   692  C  C   . ASP A 1 144 ? -10.092 -3.635  -24.780 1.00 32.98 ? 624  ASP A C   1 
ATOM   693  O  O   . ASP A 1 144 ? -8.956  -3.507  -25.236 1.00 33.28 ? 624  ASP A O   1 
ATOM   694  C  CB  . ASP A 1 144 ? -11.304 -5.111  -23.084 1.00 33.16 ? 624  ASP A CB  1 
ATOM   695  C  CG  . ASP A 1 144 ? -10.353 -4.814  -21.949 1.00 33.71 ? 624  ASP A CG  1 
ATOM   696  O  OD1 . ASP A 1 144 ? -9.654  -3.781  -22.017 1.00 34.99 ? 624  ASP A OD1 1 
ATOM   697  O  OD2 . ASP A 1 144 ? -10.310 -5.614  -20.986 1.00 34.44 ? 624  ASP A OD2 1 
ATOM   698  N  N   . THR A 1 145 ? -10.885 -2.594  -24.547 1.00 32.81 ? 625  THR A N   1 
ATOM   699  C  CA  . THR A 1 145 ? -10.517 -1.250  -24.996 1.00 32.63 ? 625  THR A CA  1 
ATOM   700  C  C   . THR A 1 145 ? -9.296  -0.687  -24.267 1.00 32.38 ? 625  THR A C   1 
ATOM   701  O  O   . THR A 1 145 ? -8.530  0.075   -24.847 1.00 32.53 ? 625  THR A O   1 
ATOM   702  C  CB  . THR A 1 145 ? -11.701 -0.262  -24.872 1.00 32.72 ? 625  THR A CB  1 
ATOM   703  O  OG1 . THR A 1 145 ? -11.569 0.767   -25.860 1.00 33.24 ? 625  THR A OG1 1 
ATOM   704  C  CG2 . THR A 1 145 ? -11.764 0.362   -23.479 1.00 32.73 ? 625  THR A CG2 1 
ATOM   705  N  N   . ASP A 1 146 ? -9.114  -1.073  -23.007 1.00 32.10 ? 626  ASP A N   1 
ATOM   706  C  CA  . ASP A 1 146 ? -8.000  -0.576  -22.188 1.00 31.85 ? 626  ASP A CA  1 
ATOM   707  C  C   . ASP A 1 146 ? -6.807  -1.534  -22.162 1.00 31.23 ? 626  ASP A C   1 
ATOM   708  O  O   . ASP A 1 146 ? -5.662  -1.095  -22.091 1.00 31.19 ? 626  ASP A O   1 
ATOM   709  C  CB  . ASP A 1 146 ? -8.475  -0.309  -20.751 1.00 31.99 ? 626  ASP A CB  1 
ATOM   710  C  CG  . ASP A 1 146 ? -9.448  0.857   -20.659 1.00 32.58 ? 626  ASP A CG  1 
ATOM   711  O  OD1 . ASP A 1 146 ? -9.523  1.662   -21.612 1.00 34.74 ? 626  ASP A OD1 1 
ATOM   712  O  OD2 . ASP A 1 146 ? -10.140 0.977   -19.628 1.00 33.72 ? 626  ASP A OD2 1 
ATOM   713  N  N   . THR A 1 147 ? -7.082  -2.835  -22.212 1.00 30.55 ? 627  THR A N   1 
ATOM   714  C  CA  . THR A 1 147 ? -6.042  -3.859  -22.136 1.00 29.82 ? 627  THR A CA  1 
ATOM   715  C  C   . THR A 1 147 ? -5.549  -4.207  -23.539 1.00 29.06 ? 627  THR A C   1 
ATOM   716  O  O   . THR A 1 147 ? -6.132  -5.053  -24.219 1.00 29.15 ? 627  THR A O   1 
ATOM   717  C  CB  . THR A 1 147 ? -6.580  -5.122  -21.440 1.00 29.80 ? 627  THR A CB  1 
ATOM   718  O  OG1 . THR A 1 147 ? -7.092  -4.774  -20.150 1.00 29.78 ? 627  THR A OG1 1 
ATOM   719  C  CG2 . THR A 1 147 ? -5.486  -6.176  -21.286 1.00 30.10 ? 627  THR A CG2 1 
ATOM   720  N  N   . ILE A 1 148 ? -4.475  -3.546  -23.968 1.00 28.14 ? 628  ILE A N   1 
ATOM   721  C  CA  . ILE A 1 148 ? -3.948  -3.735  -25.320 1.00 27.58 ? 628  ILE A CA  1 
ATOM   722  C  C   . ILE A 1 148 ? -3.102  -5.003  -25.407 1.00 26.85 ? 628  ILE A C   1 
ATOM   723  O  O   . ILE A 1 148 ? -2.754  -5.597  -24.390 1.00 26.88 ? 628  ILE A O   1 
ATOM   724  C  CB  . ILE A 1 148 ? -3.133  -2.499  -25.818 1.00 27.60 ? 628  ILE A CB  1 
ATOM   725  C  CG1 . ILE A 1 148 ? -1.781  -2.380  -25.103 1.00 27.52 ? 628  ILE A CG1 1 
ATOM   726  C  CG2 . ILE A 1 148 ? -3.947  -1.219  -25.655 1.00 27.88 ? 628  ILE A CG2 1 
ATOM   727  C  CD1 . ILE A 1 148 ? -0.653  -3.111  -25.803 1.00 27.13 ? 628  ILE A CD1 1 
ATOM   728  N  N   . TRP A 1 149 ? -2.777  -5.409  -26.631 1.00 25.97 ? 629  TRP A N   1 
ATOM   729  C  CA  . TRP A 1 149 ? -1.962  -6.595  -26.855 1.00 25.20 ? 629  TRP A CA  1 
ATOM   730  C  C   . TRP A 1 149 ? -1.009  -6.406  -28.024 1.00 24.65 ? 629  TRP A C   1 
ATOM   731  O  O   . TRP A 1 149 ? -1.431  -6.372  -29.180 1.00 24.40 ? 629  TRP A O   1 
ATOM   732  C  CB  . TRP A 1 149 ? -2.858  -7.805  -27.116 1.00 25.17 ? 629  TRP A CB  1 
ATOM   733  C  CG  . TRP A 1 149 ? -2.110  -9.099  -27.225 1.00 24.94 ? 629  TRP A CG  1 
ATOM   734  C  CD1 . TRP A 1 149 ? -1.899  -9.827  -28.357 1.00 24.99 ? 629  TRP A CD1 1 
ATOM   735  C  CD2 . TRP A 1 149 ? -1.473  -9.819  -26.161 1.00 24.74 ? 629  TRP A CD2 1 
ATOM   736  N  NE1 . TRP A 1 149 ? -1.173  -10.956 -28.067 1.00 25.32 ? 629  TRP A NE1 1 
ATOM   737  C  CE2 . TRP A 1 149 ? -0.898  -10.978 -26.726 1.00 24.80 ? 629  TRP A CE2 1 
ATOM   738  C  CE3 . TRP A 1 149 ? -1.332  -9.597  -24.785 1.00 24.92 ? 629  TRP A CE3 1 
ATOM   739  C  CZ2 . TRP A 1 149 ? -0.199  -11.918 -25.964 1.00 24.93 ? 629  TRP A CZ2 1 
ATOM   740  C  CZ3 . TRP A 1 149 ? -0.633  -10.530 -24.026 1.00 25.22 ? 629  TRP A CZ3 1 
ATOM   741  C  CH2 . TRP A 1 149 ? -0.079  -11.680 -24.619 1.00 25.19 ? 629  TRP A CH2 1 
ATOM   742  N  N   . ASN A 1 150 ? 0.280   -6.285  -27.717 1.00 24.09 ? 630  ASN A N   1 
ATOM   743  C  CA  . ASN A 1 150 ? 1.313   -6.295  -28.747 1.00 23.65 ? 630  ASN A CA  1 
ATOM   744  C  C   . ASN A 1 150 ? 1.606   -7.746  -29.115 1.00 23.60 ? 630  ASN A C   1 
ATOM   745  O  O   . ASN A 1 150 ? 2.061   -8.531  -28.277 1.00 23.65 ? 630  ASN A O   1 
ATOM   746  C  CB  . ASN A 1 150 ? 2.584   -5.591  -28.261 1.00 23.48 ? 630  ASN A CB  1 
ATOM   747  C  CG  . ASN A 1 150 ? 3.568   -5.328  -29.381 1.00 22.27 ? 630  ASN A CG  1 
ATOM   748  O  OD1 . ASN A 1 150 ? 4.123   -6.252  -29.966 1.00 21.04 ? 630  ASN A OD1 1 
ATOM   749  N  ND2 . ASN A 1 150 ? 3.787   -4.060  -29.686 1.00 21.33 ? 630  ASN A ND2 1 
ATOM   750  N  N   . GLU A 1 151 ? 1.336   -8.095  -30.368 1.00 23.37 ? 631  GLU A N   1 
ATOM   751  C  CA  . GLU A 1 151 ? 1.449   -9.472  -30.839 1.00 23.27 ? 631  GLU A CA  1 
ATOM   752  C  C   . GLU A 1 151 ? 2.891   -10.007 -30.865 1.00 23.43 ? 631  GLU A C   1 
ATOM   753  O  O   . GLU A 1 151 ? 3.099   -11.206 -31.069 1.00 23.18 ? 631  GLU A O   1 
ATOM   754  C  CB  . GLU A 1 151 ? 0.806   -9.596  -32.224 1.00 23.19 ? 631  GLU A CB  1 
ATOM   755  C  CG  . GLU A 1 151 ? -0.710  -9.391  -32.217 1.00 22.84 ? 631  GLU A CG  1 
ATOM   756  C  CD  . GLU A 1 151 ? -1.262  -8.987  -33.570 1.00 22.94 ? 631  GLU A CD  1 
ATOM   757  O  OE1 . GLU A 1 151 ? -1.085  -7.815  -33.961 1.00 22.32 ? 631  GLU A OE1 1 
ATOM   758  O  OE2 . GLU A 1 151 ? -1.885  -9.838  -34.243 1.00 23.75 ? 631  GLU A OE2 1 
ATOM   759  N  N   . LEU A 1 152 ? 3.874   -9.127  -30.660 1.00 23.66 ? 632  LEU A N   1 
ATOM   760  C  CA  . LEU A 1 152 ? 5.276   -9.535  -30.548 1.00 23.88 ? 632  LEU A CA  1 
ATOM   761  C  C   . LEU A 1 152 ? 5.828   -9.500  -29.121 1.00 23.97 ? 632  LEU A C   1 
ATOM   762  O  O   . LEU A 1 152 ? 6.672   -10.328 -28.788 1.00 24.05 ? 632  LEU A O   1 
ATOM   763  C  CB  . LEU A 1 152 ? 6.172   -8.664  -31.435 1.00 23.97 ? 632  LEU A CB  1 
ATOM   764  C  CG  . LEU A 1 152 ? 6.022   -8.776  -32.949 1.00 24.23 ? 632  LEU A CG  1 
ATOM   765  C  CD1 . LEU A 1 152 ? 7.100   -7.943  -33.619 1.00 24.88 ? 632  LEU A CD1 1 
ATOM   766  C  CD2 . LEU A 1 152 ? 6.094   -10.224 -33.417 1.00 24.96 ? 632  LEU A CD2 1 
ATOM   767  N  N   . HIS A 1 153 ? 5.365   -8.567  -28.282 1.00 24.09 ? 633  HIS A N   1 
ATOM   768  C  CA  . HIS A 1 153 ? 6.060   -8.272  -27.015 1.00 24.16 ? 633  HIS A CA  1 
ATOM   769  C  C   . HIS A 1 153 ? 5.264   -8.430  -25.702 1.00 24.36 ? 633  HIS A C   1 
ATOM   770  O  O   . HIS A 1 153 ? 5.860   -8.693  -24.659 1.00 24.23 ? 633  HIS A O   1 
ATOM   771  C  CB  . HIS A 1 153 ? 6.661   -6.865  -27.084 1.00 24.16 ? 633  HIS A CB  1 
ATOM   772  C  CG  . HIS A 1 153 ? 7.515   -6.634  -28.293 1.00 24.42 ? 633  HIS A CG  1 
ATOM   773  N  ND1 . HIS A 1 153 ? 8.581   -7.446  -28.619 1.00 24.80 ? 633  HIS A ND1 1 
ATOM   774  C  CD2 . HIS A 1 153 ? 7.454   -5.690  -29.263 1.00 24.59 ? 633  HIS A CD2 1 
ATOM   775  C  CE1 . HIS A 1 153 ? 9.142   -7.009  -29.733 1.00 24.40 ? 633  HIS A CE1 1 
ATOM   776  N  NE2 . HIS A 1 153 ? 8.476   -5.946  -30.146 1.00 24.21 ? 633  HIS A NE2 1 
ATOM   777  N  N   . SER A 1 154 ? 3.942   -8.280  -25.742 1.00 24.68 ? 634  SER A N   1 
ATOM   778  C  CA  . SER A 1 154 ? 3.131   -8.260  -24.514 1.00 24.93 ? 634  SER A CA  1 
ATOM   779  C  C   . SER A 1 154 ? 3.277   -9.527  -23.679 1.00 25.12 ? 634  SER A C   1 
ATOM   780  O  O   . SER A 1 154 ? 3.442   -9.458  -22.460 1.00 25.01 ? 634  SER A O   1 
ATOM   781  C  CB  . SER A 1 154 ? 1.651   -8.047  -24.842 1.00 25.09 ? 634  SER A CB  1 
ATOM   782  O  OG  . SER A 1 154 ? 1.428   -6.755  -25.370 1.00 25.70 ? 634  SER A OG  1 
ATOM   783  N  N   . SER A 1 155 ? 3.202   -10.681 -24.339 1.00 25.20 ? 635  SER A N   1 
ATOM   784  C  CA  . SER A 1 155 ? 3.374   -11.967 -23.666 1.00 25.24 ? 635  SER A CA  1 
ATOM   785  C  C   . SER A 1 155 ? 4.716   -12.028 -22.937 1.00 25.24 ? 635  SER A C   1 
ATOM   786  O  O   . SER A 1 155 ? 4.770   -12.377 -21.756 1.00 25.24 ? 635  SER A O   1 
ATOM   787  C  CB  . SER A 1 155 ? 3.267   -13.115 -24.669 1.00 25.13 ? 635  SER A CB  1 
ATOM   788  O  OG  . SER A 1 155 ? 3.529   -14.359 -24.045 1.00 25.50 ? 635  SER A OG  1 
ATOM   789  N  N   . ASN A 1 156 ? 5.788   -11.678 -23.642 1.00 25.30 ? 636  ASN A N   1 
ATOM   790  C  CA  . ASN A 1 156 ? 7.127   -11.646 -23.054 1.00 25.52 ? 636  ASN A CA  1 
ATOM   791  C  C   . ASN A 1 156 ? 7.214   -10.721 -21.841 1.00 25.48 ? 636  ASN A C   1 
ATOM   792  O  O   . ASN A 1 156 ? 7.742   -11.107 -20.800 1.00 25.61 ? 636  ASN A O   1 
ATOM   793  C  CB  . ASN A 1 156 ? 8.175   -11.224 -24.093 1.00 25.52 ? 636  ASN A CB  1 
ATOM   794  C  CG  . ASN A 1 156 ? 8.394   -12.272 -25.181 1.00 25.89 ? 636  ASN A CG  1 
ATOM   795  O  OD1 . ASN A 1 156 ? 8.773   -11.937 -26.305 1.00 26.66 ? 636  ASN A OD1 1 
ATOM   796  N  ND2 . ASN A 1 156 ? 8.164   -13.541 -24.851 1.00 25.69 ? 636  ASN A ND2 1 
ATOM   797  N  N   . ALA A 1 157 ? 6.689   -9.508  -21.974 1.00 25.58 ? 637  ALA A N   1 
ATOM   798  C  CA  . ALA A 1 157 ? 6.746   -8.521  -20.888 1.00 25.68 ? 637  ALA A CA  1 
ATOM   799  C  C   . ALA A 1 157 ? 5.906   -8.957  -19.677 1.00 25.86 ? 637  ALA A C   1 
ATOM   800  O  O   . ALA A 1 157 ? 6.300   -8.745  -18.522 1.00 25.83 ? 637  ALA A O   1 
ATOM   801  C  CB  . ALA A 1 157 ? 6.294   -7.153  -21.390 1.00 25.54 ? 637  ALA A CB  1 
ATOM   802  N  N   . ALA A 1 158 ? 4.752   -9.566  -19.946 1.00 26.08 ? 638  ALA A N   1 
ATOM   803  C  CA  . ALA A 1 158 ? 3.877   -10.057 -18.884 1.00 26.32 ? 638  ALA A CA  1 
ATOM   804  C  C   . ALA A 1 158 ? 4.546   -11.203 -18.119 1.00 26.60 ? 638  ALA A C   1 
ATOM   805  O  O   . ALA A 1 158 ? 4.502   -11.252 -16.887 1.00 26.55 ? 638  ALA A O   1 
ATOM   806  C  CB  . ALA A 1 158 ? 2.539   -10.501 -19.460 1.00 26.20 ? 638  ALA A CB  1 
ATOM   807  N  N   . ARG A 1 159 ? 5.171   -12.115 -18.857 1.00 27.02 ? 639  ARG A N   1 
ATOM   808  C  CA  . ARG A 1 159 ? 5.873   -13.241 -18.252 1.00 27.31 ? 639  ARG A CA  1 
ATOM   809  C  C   . ARG A 1 159 ? 7.095   -12.778 -17.481 1.00 27.57 ? 639  ARG A C   1 
ATOM   810  O  O   . ARG A 1 159 ? 7.437   -13.359 -16.452 1.00 28.06 ? 639  ARG A O   1 
ATOM   811  C  CB  . ARG A 1 159 ? 6.278   -14.270 -19.312 1.00 27.19 ? 639  ARG A CB  1 
ATOM   812  C  CG  . ARG A 1 159 ? 5.117   -15.111 -19.799 1.00 27.01 ? 639  ARG A CG  1 
ATOM   813  C  CD  . ARG A 1 159 ? 5.551   -16.116 -20.834 1.00 26.67 ? 639  ARG A CD  1 
ATOM   814  N  NE  . ARG A 1 159 ? 6.493   -17.083 -20.275 1.00 27.35 ? 639  ARG A NE  1 
ATOM   815  C  CZ  . ARG A 1 159 ? 7.005   -18.111 -20.946 1.00 26.39 ? 639  ARG A CZ  1 
ATOM   816  N  NH1 . ARG A 1 159 ? 6.672   -18.322 -22.208 1.00 26.27 ? 639  ARG A NH1 1 
ATOM   817  N  NH2 . ARG A 1 159 ? 7.854   -18.932 -20.346 1.00 26.66 ? 639  ARG A NH2 1 
ATOM   818  N  N   . TRP A 1 160 ? 7.752   -11.733 -17.975 1.00 27.88 ? 640  TRP A N   1 
ATOM   819  C  CA  . TRP A 1 160 ? 8.901   -11.166 -17.273 1.00 27.94 ? 640  TRP A CA  1 
ATOM   820  C  C   . TRP A 1 160 ? 8.496   -10.562 -15.929 1.00 27.99 ? 640  TRP A C   1 
ATOM   821  O  O   . TRP A 1 160 ? 9.207   -10.710 -14.941 1.00 28.10 ? 640  TRP A O   1 
ATOM   822  C  CB  . TRP A 1 160 ? 9.604   -10.106 -18.126 1.00 27.89 ? 640  TRP A CB  1 
ATOM   823  C  CG  . TRP A 1 160 ? 11.010  -9.909  -17.708 1.00 27.33 ? 640  TRP A CG  1 
ATOM   824  C  CD1 . TRP A 1 160 ? 11.474  -9.018  -16.792 1.00 27.20 ? 640  TRP A CD1 1 
ATOM   825  C  CD2 . TRP A 1 160 ? 12.144  -10.643 -18.170 1.00 26.86 ? 640  TRP A CD2 1 
ATOM   826  N  NE1 . TRP A 1 160 ? 12.838  -9.139  -16.662 1.00 27.45 ? 640  TRP A NE1 1 
ATOM   827  C  CE2 . TRP A 1 160 ? 13.273  -10.133 -17.499 1.00 27.33 ? 640  TRP A CE2 1 
ATOM   828  C  CE3 . TRP A 1 160 ? 12.316  -11.679 -19.092 1.00 26.98 ? 640  TRP A CE3 1 
ATOM   829  C  CZ2 . TRP A 1 160 ? 14.562  -10.628 -17.719 1.00 27.49 ? 640  TRP A CZ2 1 
ATOM   830  C  CZ3 . TRP A 1 160 ? 13.598  -12.171 -19.311 1.00 27.23 ? 640  TRP A CZ3 1 
ATOM   831  C  CH2 . TRP A 1 160 ? 14.703  -11.645 -18.627 1.00 27.09 ? 640  TRP A CH2 1 
ATOM   832  N  N   . ALA A 1 161 ? 7.354   -9.883  -15.898 1.00 28.22 ? 641  ALA A N   1 
ATOM   833  C  CA  . ALA A 1 161 ? 6.875   -9.252  -14.671 1.00 28.52 ? 641  ALA A CA  1 
ATOM   834  C  C   . ALA A 1 161 ? 6.550   -10.316 -13.627 1.00 28.62 ? 641  ALA A C   1 
ATOM   835  O  O   . ALA A 1 161 ? 6.945   -10.202 -12.467 1.00 28.86 ? 641  ALA A O   1 
ATOM   836  C  CB  . ALA A 1 161 ? 5.650   -8.381  -14.956 1.00 28.51 ? 641  ALA A CB  1 
ATOM   837  N  N   . ALA A 1 162 ? 5.829   -11.350 -14.050 1.00 28.71 ? 642  ALA A N   1 
ATOM   838  C  CA  . ALA A 1 162 ? 5.517   -12.480 -13.182 1.00 28.53 ? 642  ALA A CA  1 
ATOM   839  C  C   . ALA A 1 162 ? 6.805   -13.154 -12.721 1.00 28.53 ? 642  ALA A C   1 
ATOM   840  O  O   . ALA A 1 162 ? 6.994   -13.393 -11.534 1.00 28.51 ? 642  ALA A O   1 
ATOM   841  C  CB  . ALA A 1 162 ? 4.620   -13.480 -13.912 1.00 28.22 ? 642  ALA A CB  1 
ATOM   842  N  N   . GLY A 1 163 ? 7.691   -13.447 -13.666 1.00 28.77 ? 643  GLY A N   1 
ATOM   843  C  CA  . GLY A 1 163 ? 8.932   -14.151 -13.365 1.00 28.88 ? 643  GLY A CA  1 
ATOM   844  C  C   . GLY A 1 163 ? 9.839   -13.394 -12.413 1.00 29.09 ? 643  GLY A C   1 
ATOM   845  O  O   . GLY A 1 163 ? 10.497  -13.996 -11.564 1.00 29.36 ? 643  GLY A O   1 
ATOM   846  N  N   . SER A 1 164 ? 9.865   -12.071 -12.543 1.00 29.24 ? 644  SER A N   1 
ATOM   847  C  CA  . SER A 1 164 ? 10.787  -11.241 -11.778 1.00 29.24 ? 644  SER A CA  1 
ATOM   848  C  C   . SER A 1 164 ? 10.305  -10.980 -10.352 1.00 29.08 ? 644  SER A C   1 
ATOM   849  O  O   . SER A 1 164 ? 11.106  -10.986 -9.409  1.00 29.07 ? 644  SER A O   1 
ATOM   850  C  CB  . SER A 1 164 ? 11.019  -9.926  -12.512 1.00 29.48 ? 644  SER A CB  1 
ATOM   851  O  OG  . SER A 1 164 ? 11.329  -10.178 -13.872 1.00 29.93 ? 644  SER A OG  1 
ATOM   852  N  N   . VAL A 1 165 ? 9.005   -10.749 -10.188 1.00 28.80 ? 645  VAL A N   1 
ATOM   853  C  CA  . VAL A 1 165 ? 8.431   -10.634 -8.845  1.00 28.56 ? 645  VAL A CA  1 
ATOM   854  C  C   . VAL A 1 165 ? 8.642   -11.947 -8.091  1.00 28.28 ? 645  VAL A C   1 
ATOM   855  O  O   . VAL A 1 165 ? 8.947   -11.939 -6.904  1.00 28.03 ? 645  VAL A O   1 
ATOM   856  C  CB  . VAL A 1 165 ? 6.924   -10.312 -8.877  1.00 28.56 ? 645  VAL A CB  1 
ATOM   857  C  CG1 . VAL A 1 165 ? 6.338   -10.331 -7.464  1.00 27.96 ? 645  VAL A CG1 1 
ATOM   858  C  CG2 . VAL A 1 165 ? 6.688   -8.961  -9.537  1.00 28.57 ? 645  VAL A CG2 1 
ATOM   859  N  N   . THR A 1 166 ? 8.487   -13.064 -8.796  1.00 28.04 ? 646  THR A N   1 
ATOM   860  C  CA  . THR A 1 166 ? 8.707   -14.378 -8.211  1.00 28.10 ? 646  THR A CA  1 
ATOM   861  C  C   . THR A 1 166 ? 10.164  -14.550 -7.796  1.00 28.43 ? 646  THR A C   1 
ATOM   862  O  O   . THR A 1 166 ? 10.438  -14.909 -6.653  1.00 28.27 ? 646  THR A O   1 
ATOM   863  C  CB  . THR A 1 166 ? 8.297   -15.514 -9.171  1.00 28.03 ? 646  THR A CB  1 
ATOM   864  O  OG1 . THR A 1 166 ? 6.877   -15.484 -9.362  1.00 26.85 ? 646  THR A OG1 1 
ATOM   865  C  CG2 . THR A 1 166 ? 8.711   -16.875 -8.602  1.00 27.45 ? 646  THR A CG2 1 
ATOM   866  N  N   . ASP A 1 167 ? 11.089  -14.262 -8.709  1.00 28.77 ? 647  ASP A N   1 
ATOM   867  C  CA  . ASP A 1 167 ? 12.521  -14.382 -8.409  1.00 29.21 ? 647  ASP A CA  1 
ATOM   868  C  C   . ASP A 1 167 ? 12.938  -13.520 -7.202  1.00 29.08 ? 647  ASP A C   1 
ATOM   869  O  O   . ASP A 1 167 ? 13.721  -13.965 -6.366  1.00 29.06 ? 647  ASP A O   1 
ATOM   870  C  CB  . ASP A 1 167 ? 13.385  -14.040 -9.638  1.00 29.34 ? 647  ASP A CB  1 
ATOM   871  C  CG  . ASP A 1 167 ? 14.637  -14.918 -9.740  1.00 30.56 ? 647  ASP A CG  1 
ATOM   872  O  OD1 . ASP A 1 167 ? 14.495  -16.143 -9.998  1.00 32.37 ? 647  ASP A OD1 1 
ATOM   873  O  OD2 . ASP A 1 167 ? 15.757  -14.394 -9.554  1.00 30.95 ? 647  ASP A OD2 1 
ATOM   874  N  N   . LEU A 1 168 ? 12.405  -12.304 -7.108  1.00 28.97 ? 648  LEU A N   1 
ATOM   875  C  CA  . LEU A 1 168 ? 12.717  -11.413 -5.986  1.00 29.13 ? 648  LEU A CA  1 
ATOM   876  C  C   . LEU A 1 168 ? 12.164  -11.964 -4.665  1.00 29.13 ? 648  LEU A C   1 
ATOM   877  O  O   . LEU A 1 168 ? 12.872  -11.993 -3.654  1.00 29.02 ? 648  LEU A O   1 
ATOM   878  C  CB  . LEU A 1 168 ? 12.173  -10.000 -6.250  1.00 29.18 ? 648  LEU A CB  1 
ATOM   879  C  CG  . LEU A 1 168 ? 12.448  -8.907  -5.211  1.00 29.37 ? 648  LEU A CG  1 
ATOM   880  C  CD1 . LEU A 1 168 ? 13.926  -8.829  -4.869  1.00 29.61 ? 648  LEU A CD1 1 
ATOM   881  C  CD2 . LEU A 1 168 ? 11.941  -7.554  -5.704  1.00 29.44 ? 648  LEU A CD2 1 
ATOM   882  N  N   . ALA A 1 169 ? 10.908  -12.410 -4.684  1.00 29.15 ? 649  ALA A N   1 
ATOM   883  C  CA  . ALA A 1 169 ? 10.273  -13.000 -3.500  1.00 29.21 ? 649  ALA A CA  1 
ATOM   884  C  C   . ALA A 1 169 ? 11.055  -14.194 -2.967  1.00 29.29 ? 649  ALA A C   1 
ATOM   885  O  O   . ALA A 1 169 ? 11.205  -14.345 -1.754  1.00 29.51 ? 649  ALA A O   1 
ATOM   886  C  CB  . ALA A 1 169 ? 8.842   -13.412 -3.808  1.00 29.25 ? 649  ALA A CB  1 
ATOM   887  N  N   . PHE A 1 170 ? 11.551  -15.035 -3.873  1.00 29.30 ? 650  PHE A N   1 
ATOM   888  C  CA  . PHE A 1 170 ? 12.367  -16.194 -3.487  1.00 29.47 ? 650  PHE A CA  1 
ATOM   889  C  C   . PHE A 1 170 ? 13.679  -15.785 -2.830  1.00 29.33 ? 650  PHE A C   1 
ATOM   890  O  O   . PHE A 1 170 ? 14.069  -16.367 -1.823  1.00 29.21 ? 650  PHE A O   1 
ATOM   891  C  CB  . PHE A 1 170 ? 12.648  -17.108 -4.690  1.00 29.53 ? 650  PHE A CB  1 
ATOM   892  C  CG  . PHE A 1 170 ? 11.652  -18.214 -4.850  1.00 30.19 ? 650  PHE A CG  1 
ATOM   893  C  CD1 . PHE A 1 170 ? 10.423  -17.977 -5.457  1.00 30.85 ? 650  PHE A CD1 1 
ATOM   894  C  CD2 . PHE A 1 170 ? 11.933  -19.494 -4.387  1.00 30.66 ? 650  PHE A CD2 1 
ATOM   895  C  CE1 . PHE A 1 170 ? 9.489   -18.997 -5.604  1.00 31.26 ? 650  PHE A CE1 1 
ATOM   896  C  CE2 . PHE A 1 170 ? 11.000  -20.523 -4.529  1.00 31.17 ? 650  PHE A CE2 1 
ATOM   897  C  CZ  . PHE A 1 170 ? 9.774   -20.270 -5.142  1.00 31.04 ? 650  PHE A CZ  1 
ATOM   898  N  N   . LYS A 1 171 ? 14.353  -14.786 -3.401  1.00 29.47 ? 651  LYS A N   1 
ATOM   899  C  CA  . LYS A 1 171 ? 15.613  -14.286 -2.837  1.00 29.54 ? 651  LYS A CA  1 
ATOM   900  C  C   . LYS A 1 171 ? 15.404  -13.630 -1.468  1.00 29.54 ? 651  LYS A C   1 
ATOM   901  O  O   . LYS A 1 171 ? 16.249  -13.754 -0.582  1.00 29.76 ? 651  LYS A O   1 
ATOM   902  C  CB  . LYS A 1 171 ? 16.301  -13.315 -3.798  1.00 29.48 ? 651  LYS A CB  1 
ATOM   903  C  CG  . LYS A 1 171 ? 16.700  -13.953 -5.120  1.00 29.68 ? 651  LYS A CG  1 
ATOM   904  C  CD  . LYS A 1 171 ? 17.779  -13.164 -5.825  1.00 29.98 ? 651  LYS A CD  1 
ATOM   905  C  CE  . LYS A 1 171 ? 17.846  -13.489 -7.313  1.00 30.32 ? 651  LYS A CE  1 
ATOM   906  N  NZ  . LYS A 1 171 ? 18.027  -14.942 -7.600  1.00 30.24 ? 651  LYS A NZ  1 
ATOM   907  N  N   . VAL A 1 172 ? 14.271  -12.958 -1.290  1.00 29.55 ? 652  VAL A N   1 
ATOM   908  C  CA  . VAL A 1 172 ? 13.910  -12.411 0.016   1.00 29.54 ? 652  VAL A CA  1 
ATOM   909  C  C   . VAL A 1 172 ? 13.484  -13.528 0.987   1.00 29.67 ? 652  VAL A C   1 
ATOM   910  O  O   . VAL A 1 172 ? 13.884  -13.519 2.151   1.00 29.40 ? 652  VAL A O   1 
ATOM   911  C  CB  . VAL A 1 172 ? 12.812  -11.333 -0.108  1.00 29.54 ? 652  VAL A CB  1 
ATOM   912  C  CG1 . VAL A 1 172 ? 12.409  -10.810 1.264   1.00 29.04 ? 652  VAL A CG1 1 
ATOM   913  C  CG2 . VAL A 1 172 ? 13.306  -10.185 -0.992  1.00 29.61 ? 652  VAL A CG2 1 
ATOM   914  N  N   . ALA A 1 173 ? 12.706  -14.502 0.506   1.00 29.75 ? 653  ALA A N   1 
ATOM   915  C  CA  . ALA A 1 173 ? 12.267  -15.623 1.357   1.00 29.85 ? 653  ALA A CA  1 
ATOM   916  C  C   . ALA A 1 173 ? 13.440  -16.437 1.917   1.00 29.83 ? 653  ALA A C   1 
ATOM   917  O  O   . ALA A 1 173 ? 13.384  -16.902 3.051   1.00 29.79 ? 653  ALA A O   1 
ATOM   918  C  CB  . ALA A 1 173 ? 11.295  -16.528 0.605   1.00 29.69 ? 653  ALA A CB  1 
ATOM   919  N  N   . SER A 1 174 ? 14.504  -16.587 1.132   1.00 30.07 ? 654  SER A N   1 
ATOM   920  C  CA  . SER A 1 174 ? 15.723  -17.266 1.595   1.00 30.40 ? 654  SER A CA  1 
ATOM   921  C  C   . SER A 1 174 ? 16.607  -16.399 2.503   1.00 30.43 ? 654  SER A C   1 
ATOM   922  O  O   . SER A 1 174 ? 17.625  -16.867 2.995   1.00 30.40 ? 654  SER A O   1 
ATOM   923  C  CB  . SER A 1 174 ? 16.551  -17.732 0.396   1.00 30.36 ? 654  SER A CB  1 
ATOM   924  O  OG  . SER A 1 174 ? 16.956  -16.631 -0.394  1.00 31.19 ? 654  SER A OG  1 
ATOM   925  N  N   . ARG A 1 175 ? 16.213  -15.145 2.714   1.00 30.80 ? 655  ARG A N   1 
ATOM   926  C  CA  . ARG A 1 175 ? 17.021  -14.144 3.427   1.00 31.21 ? 655  ARG A CA  1 
ATOM   927  C  C   . ARG A 1 175 ? 18.373  -13.900 2.741   1.00 31.22 ? 655  ARG A C   1 
ATOM   928  O  O   . ARG A 1 175 ? 19.332  -13.454 3.374   1.00 31.26 ? 655  ARG A O   1 
ATOM   929  C  CB  . ARG A 1 175 ? 17.222  -14.502 4.913   1.00 31.29 ? 655  ARG A CB  1 
ATOM   930  C  CG  . ARG A 1 175 ? 15.976  -14.980 5.673   1.00 31.97 ? 655  ARG A CG  1 
ATOM   931  C  CD  . ARG A 1 175 ? 14.692  -14.163 5.409   1.00 33.29 ? 655  ARG A CD  1 
ATOM   932  N  NE  . ARG A 1 175 ? 14.717  -12.791 5.941   1.00 34.53 ? 655  ARG A NE  1 
ATOM   933  C  CZ  . ARG A 1 175 ? 14.574  -11.664 5.229   1.00 34.85 ? 655  ARG A CZ  1 
ATOM   934  N  NH1 . ARG A 1 175 ? 14.403  -11.686 3.911   1.00 35.12 ? 655  ARG A NH1 1 
ATOM   935  N  NH2 . ARG A 1 175 ? 14.600  -10.487 5.848   1.00 35.01 ? 655  ARG A NH2 1 
ATOM   936  N  N   . GLU A 1 176 ? 18.430  -14.185 1.442   1.00 31.19 ? 656  GLU A N   1 
ATOM   937  C  CA  . GLU A 1 176 ? 19.577  -13.846 0.612   1.00 31.25 ? 656  GLU A CA  1 
ATOM   938  C  C   . GLU A 1 176 ? 19.540  -12.338 0.321   1.00 30.80 ? 656  GLU A C   1 
ATOM   939  O  O   . GLU A 1 176 ? 20.578  -11.700 0.151   1.00 30.66 ? 656  GLU A O   1 
ATOM   940  C  CB  . GLU A 1 176 ? 19.523  -14.659 -0.682  1.00 31.49 ? 656  GLU A CB  1 
ATOM   941  C  CG  . GLU A 1 176 ? 20.763  -14.572 -1.555  1.00 32.81 ? 656  GLU A CG  1 
ATOM   942  C  CD  . GLU A 1 176 ? 20.658  -15.442 -2.804  1.00 34.99 ? 656  GLU A CD  1 
ATOM   943  O  OE1 . GLU A 1 176 ? 19.710  -16.262 -2.896  1.00 35.83 ? 656  GLU A OE1 1 
ATOM   944  O  OE2 . GLU A 1 176 ? 21.529  -15.302 -3.696  1.00 36.49 ? 656  GLU A OE2 1 
ATOM   945  N  N   . LEU A 1 177 ? 18.324  -11.795 0.254   1.00 30.21 ? 657  LEU A N   1 
ATOM   946  C  CA  . LEU A 1 177 ? 18.079  -10.357 0.228   1.00 29.91 ? 657  LEU A CA  1 
ATOM   947  C  C   . LEU A 1 177 ? 17.194  -10.003 1.424   1.00 29.64 ? 657  LEU A C   1 
ATOM   948  O  O   . LEU A 1 177 ? 16.353  -10.800 1.828   1.00 29.54 ? 657  LEU A O   1 
ATOM   949  C  CB  . LEU A 1 177 ? 17.383  -9.954  -1.084  1.00 29.88 ? 657  LEU A CB  1 
ATOM   950  C  CG  . LEU A 1 177 ? 18.218  -9.427  -2.260  1.00 29.74 ? 657  LEU A CG  1 
ATOM   951  C  CD1 . LEU A 1 177 ? 19.586  -10.081 -2.373  1.00 30.12 ? 657  LEU A CD1 1 
ATOM   952  C  CD2 . LEU A 1 177 ? 17.445  -9.589  -3.556  1.00 29.45 ? 657  LEU A CD2 1 
ATOM   953  N  N   . LYS A 1 178 ? 17.386  -8.811  1.985   1.00 29.51 ? 658  LYS A N   1 
ATOM   954  C  CA  . LYS A 1 178 ? 16.587  -8.346  3.128   1.00 29.38 ? 658  LYS A CA  1 
ATOM   955  C  C   . LYS A 1 178 ? 15.134  -8.100  2.730   1.00 28.83 ? 658  LYS A C   1 
ATOM   956  O  O   . LYS A 1 178 ? 14.210  -8.583  3.388   1.00 28.79 ? 658  LYS A O   1 
ATOM   957  C  CB  . LYS A 1 178 ? 17.189  -7.065  3.723   1.00 29.57 ? 658  LYS A CB  1 
ATOM   958  C  CG  . LYS A 1 178 ? 16.412  -6.505  4.921   1.00 30.34 ? 658  LYS A CG  1 
ATOM   959  C  CD  . LYS A 1 178 ? 17.213  -5.440  5.672   1.00 31.50 ? 658  LYS A CD  1 
ATOM   960  C  CE  . LYS A 1 178 ? 16.520  -5.027  6.976   1.00 32.23 ? 658  LYS A CE  1 
ATOM   961  N  NZ  . LYS A 1 178 ? 17.454  -4.335  7.927   1.00 31.98 ? 658  LYS A NZ  1 
ATOM   962  N  N   . ASN A 1 179 ? 14.953  -7.341  1.655   1.00 28.23 ? 659  ASN A N   1 
ATOM   963  C  CA  . ASN A 1 179 ? 13.633  -7.009  1.123   1.00 28.03 ? 659  ASN A CA  1 
ATOM   964  C  C   . ASN A 1 179 ? 13.799  -6.603  -0.340  1.00 27.99 ? 659  ASN A C   1 
ATOM   965  O  O   . ASN A 1 179 ? 14.904  -6.688  -0.877  1.00 28.07 ? 659  ASN A O   1 
ATOM   966  C  CB  . ASN A 1 179 ? 12.984  -5.889  1.953   1.00 27.95 ? 659  ASN A CB  1 
ATOM   967  C  CG  . ASN A 1 179 ? 13.910  -4.695  2.161   1.00 28.03 ? 659  ASN A CG  1 
ATOM   968  O  OD1 . ASN A 1 179 ? 14.708  -4.368  1.295   1.00 26.60 ? 659  ASN A OD1 1 
ATOM   969  N  ND2 . ASN A 1 179 ? 13.802  -4.045  3.316   1.00 27.73 ? 659  ASN A ND2 1 
ATOM   970  N  N   . GLY A 1 180 ? 12.729  -6.174  -0.997  1.00 27.92 ? 660  GLY A N   1 
ATOM   971  C  CA  . GLY A 1 180 ? 12.839  -5.797  -2.398  1.00 27.85 ? 660  GLY A CA  1 
ATOM   972  C  C   . GLY A 1 180 ? 11.698  -4.977  -2.953  1.00 28.06 ? 660  GLY A C   1 
ATOM   973  O  O   . GLY A 1 180 ? 10.606  -4.929  -2.389  1.00 28.13 ? 660  GLY A O   1 
ATOM   974  N  N   . PHE A 1 181 ? 11.973  -4.334  -4.082  1.00 28.34 ? 661  PHE A N   1 
ATOM   975  C  CA  . PHE A 1 181 ? 10.991  -3.550  -4.816  1.00 28.60 ? 661  PHE A CA  1 
ATOM   976  C  C   . PHE A 1 181 ? 11.111  -3.936  -6.282  1.00 28.15 ? 661  PHE A C   1 
ATOM   977  O  O   . PHE A 1 181 ? 12.183  -3.814  -6.867  1.00 27.88 ? 661  PHE A O   1 
ATOM   978  C  CB  . PHE A 1 181 ? 11.296  -2.064  -4.620  1.00 28.97 ? 661  PHE A CB  1 
ATOM   979  C  CG  . PHE A 1 181 ? 10.244  -1.131  -5.160  1.00 30.84 ? 661  PHE A CG  1 
ATOM   980  C  CD1 . PHE A 1 181 ? 10.106  -0.926  -6.524  1.00 32.59 ? 661  PHE A CD1 1 
ATOM   981  C  CD2 . PHE A 1 181 ? 9.434   -0.404  -4.294  1.00 33.09 ? 661  PHE A CD2 1 
ATOM   982  C  CE1 . PHE A 1 181 ? 9.157   -0.042  -7.019  1.00 33.90 ? 661  PHE A CE1 1 
ATOM   983  C  CE2 . PHE A 1 181 ? 8.484   0.490   -4.782  1.00 34.11 ? 661  PHE A CE2 1 
ATOM   984  C  CZ  . PHE A 1 181 ? 8.345   0.667   -6.149  1.00 34.30 ? 661  PHE A CZ  1 
ATOM   985  N  N   . ALA A 1 182 ? 10.014  -4.405  -6.872  1.00 27.87 ? 662  ALA A N   1 
ATOM   986  C  CA  . ALA A 1 182 ? 10.010  -4.846  -8.265  1.00 27.57 ? 662  ALA A CA  1 
ATOM   987  C  C   . ALA A 1 182 ? 9.369   -3.785  -9.155  1.00 27.45 ? 662  ALA A C   1 
ATOM   988  O  O   . ALA A 1 182 ? 8.171   -3.525  -9.050  1.00 27.56 ? 662  ALA A O   1 
ATOM   989  C  CB  . ALA A 1 182 ? 9.270   -6.166  -8.396  1.00 27.44 ? 662  ALA A CB  1 
ATOM   990  N  N   . VAL A 1 183 ? 10.175  -3.185  -10.031 1.00 27.23 ? 663  VAL A N   1 
ATOM   991  C  CA  . VAL A 1 183 ? 9.728   -2.110  -10.912 1.00 26.97 ? 663  VAL A CA  1 
ATOM   992  C  C   . VAL A 1 183 ? 9.265   -2.717  -12.234 1.00 27.22 ? 663  VAL A C   1 
ATOM   993  O  O   . VAL A 1 183 ? 9.997   -2.725  -13.229 1.00 27.38 ? 663  VAL A O   1 
ATOM   994  C  CB  . VAL A 1 183 ? 10.853  -1.072  -11.149 1.00 26.89 ? 663  VAL A CB  1 
ATOM   995  C  CG1 . VAL A 1 183 ? 10.358  0.061   -12.032 1.00 26.02 ? 663  VAL A CG1 1 
ATOM   996  C  CG2 . VAL A 1 183 ? 11.366  -0.534  -9.817  1.00 25.95 ? 663  VAL A CG2 1 
ATOM   997  N  N   . VAL A 1 184 ? 8.036   -3.219  -12.234 1.00 27.26 ? 664  VAL A N   1 
ATOM   998  C  CA  . VAL A 1 184 ? 7.543   -4.047  -13.328 1.00 27.25 ? 664  VAL A CA  1 
ATOM   999  C  C   . VAL A 1 184 ? 6.265   -3.512  -13.977 1.00 27.16 ? 664  VAL A C   1 
ATOM   1000 O  O   . VAL A 1 184 ? 5.474   -2.798  -13.357 1.00 27.18 ? 664  VAL A O   1 
ATOM   1001 C  CB  . VAL A 1 184 ? 7.275   -5.492  -12.845 1.00 27.36 ? 664  VAL A CB  1 
ATOM   1002 C  CG1 . VAL A 1 184 ? 8.574   -6.157  -12.405 1.00 27.24 ? 664  VAL A CG1 1 
ATOM   1003 C  CG2 . VAL A 1 184 ? 6.255   -5.501  -11.713 1.00 27.20 ? 664  VAL A CG2 1 
ATOM   1004 N  N   . ARG A 1 185 ? 6.096   -3.867  -15.245 1.00 27.00 ? 665  ARG A N   1 
ATOM   1005 C  CA  . ARG A 1 185 ? 4.844   -3.694  -15.961 1.00 26.80 ? 665  ARG A CA  1 
ATOM   1006 C  C   . ARG A 1 185 ? 4.787   -4.808  -16.998 1.00 26.75 ? 665  ARG A C   1 
ATOM   1007 O  O   . ARG A 1 185 ? 5.828   -5.338  -17.382 1.00 26.59 ? 665  ARG A O   1 
ATOM   1008 C  CB  . ARG A 1 185 ? 4.766   -2.312  -16.630 1.00 26.83 ? 665  ARG A CB  1 
ATOM   1009 C  CG  . ARG A 1 185 ? 5.769   -2.079  -17.758 1.00 26.48 ? 665  ARG A CG  1 
ATOM   1010 C  CD  . ARG A 1 185 ? 5.681   -0.655  -18.285 1.00 26.77 ? 665  ARG A CD  1 
ATOM   1011 N  NE  . ARG A 1 185 ? 4.487   -0.427  -19.102 1.00 26.14 ? 665  ARG A NE  1 
ATOM   1012 C  CZ  . ARG A 1 185 ? 4.402   -0.660  -20.414 1.00 26.00 ? 665  ARG A CZ  1 
ATOM   1013 N  NH1 . ARG A 1 185 ? 5.439   -1.142  -21.100 1.00 26.06 ? 665  ARG A NH1 1 
ATOM   1014 N  NH2 . ARG A 1 185 ? 3.265   -0.410  -21.053 1.00 25.74 ? 665  ARG A NH2 1 
ATOM   1015 N  N   . PRO A 1 186 ? 3.582   -5.173  -17.458 1.00 26.81 ? 666  PRO A N   1 
ATOM   1016 C  CA  . PRO A 1 186 ? 2.292   -4.609  -17.070 1.00 26.93 ? 666  PRO A CA  1 
ATOM   1017 C  C   . PRO A 1 186 ? 1.900   -5.017  -15.656 1.00 26.88 ? 666  PRO A C   1 
ATOM   1018 O  O   . PRO A 1 186 ? 2.522   -5.908  -15.087 1.00 27.14 ? 666  PRO A O   1 
ATOM   1019 C  CB  . PRO A 1 186 ? 1.327   -5.206  -18.098 1.00 26.86 ? 666  PRO A CB  1 
ATOM   1020 C  CG  . PRO A 1 186 ? 1.966   -6.465  -18.523 1.00 26.92 ? 666  PRO A CG  1 
ATOM   1021 C  CD  . PRO A 1 186 ? 3.437   -6.232  -18.470 1.00 26.83 ? 666  PRO A CD  1 
ATOM   1022 N  N   . PRO A 1 187 ? 0.880   -4.365  -15.083 1.00 26.96 ? 667  PRO A N   1 
ATOM   1023 C  CA  . PRO A 1 187 ? 0.422   -4.741  -13.745 1.00 27.19 ? 667  PRO A CA  1 
ATOM   1024 C  C   . PRO A 1 187 ? -0.289  -6.106  -13.731 1.00 27.32 ? 667  PRO A C   1 
ATOM   1025 O  O   . PRO A 1 187 ? -0.545  -6.683  -14.795 1.00 26.86 ? 667  PRO A O   1 
ATOM   1026 C  CB  . PRO A 1 187 ? -0.541  -3.612  -13.375 1.00 27.04 ? 667  PRO A CB  1 
ATOM   1027 C  CG  . PRO A 1 187 ? -1.031  -3.098  -14.674 1.00 27.13 ? 667  PRO A CG  1 
ATOM   1028 C  CD  . PRO A 1 187 ? 0.100   -3.247  -15.640 1.00 26.94 ? 667  PRO A CD  1 
ATOM   1029 N  N   . GLY A 1 188 ? -0.615  -6.601  -12.535 1.00 27.54 ? 668  GLY A N   1 
ATOM   1030 C  CA  . GLY A 1 188 ? -1.084  -7.978  -12.376 1.00 27.77 ? 668  GLY A CA  1 
ATOM   1031 C  C   . GLY A 1 188 ? -2.371  -8.236  -11.613 1.00 27.97 ? 668  GLY A C   1 
ATOM   1032 O  O   . GLY A 1 188 ? -3.093  -9.183  -11.933 1.00 27.99 ? 668  GLY A O   1 
ATOM   1033 N  N   . HIS A 1 189 ? -2.674  -7.416  -10.611 1.00 28.17 ? 669  HIS A N   1 
ATOM   1034 C  CA  . HIS A 1 189 ? -3.686  -7.787  -9.610  1.00 28.33 ? 669  HIS A CA  1 
ATOM   1035 C  C   . HIS A 1 189 ? -5.143  -7.881  -10.100 1.00 28.70 ? 669  HIS A C   1 
ATOM   1036 O  O   . HIS A 1 189 ? -5.993  -8.412  -9.382  1.00 29.12 ? 669  HIS A O   1 
ATOM   1037 C  CB  . HIS A 1 189 ? -3.571  -6.895  -8.362  1.00 28.34 ? 669  HIS A CB  1 
ATOM   1038 C  CG  . HIS A 1 189 ? -4.029  -5.483  -8.563  1.00 27.96 ? 669  HIS A CG  1 
ATOM   1039 N  ND1 . HIS A 1 189 ? -4.453  -4.689  -7.521  1.00 27.34 ? 669  HIS A ND1 1 
ATOM   1040 C  CD2 . HIS A 1 189 ? -4.137  -4.724  -9.681  1.00 27.68 ? 669  HIS A CD2 1 
ATOM   1041 C  CE1 . HIS A 1 189 ? -4.799  -3.503  -7.987  1.00 27.34 ? 669  HIS A CE1 1 
ATOM   1042 N  NE2 . HIS A 1 189 ? -4.620  -3.500  -9.295  1.00 26.95 ? 669  HIS A NE2 1 
ATOM   1043 N  N   . HIS A 1 190 ? -5.432  -7.408  -11.312 1.00 28.85 ? 670  HIS A N   1 
ATOM   1044 C  CA  . HIS A 1 190 ? -6.774  -7.562  -11.891 1.00 29.05 ? 670  HIS A CA  1 
ATOM   1045 C  C   . HIS A 1 190 ? -6.948  -8.864  -12.685 1.00 28.93 ? 670  HIS A C   1 
ATOM   1046 O  O   . HIS A 1 190 ? -8.072  -9.325  -12.886 1.00 28.83 ? 670  HIS A O   1 
ATOM   1047 C  CB  . HIS A 1 190 ? -7.136  -6.368  -12.786 1.00 29.05 ? 670  HIS A CB  1 
ATOM   1048 C  CG  . HIS A 1 190 ? -7.299  -5.076  -12.045 1.00 29.93 ? 670  HIS A CG  1 
ATOM   1049 N  ND1 . HIS A 1 190 ? -8.015  -4.970  -10.872 1.00 31.13 ? 670  HIS A ND1 1 
ATOM   1050 C  CD2 . HIS A 1 190 ? -6.855  -3.829  -12.325 1.00 30.47 ? 670  HIS A CD2 1 
ATOM   1051 C  CE1 . HIS A 1 190 ? -7.998  -3.714  -10.460 1.00 30.80 ? 670  HIS A CE1 1 
ATOM   1052 N  NE2 . HIS A 1 190 ? -7.299  -3.002  -11.323 1.00 30.82 ? 670  HIS A NE2 1 
ATOM   1053 N  N   . ALA A 1 191 ? -5.847  -9.439  -13.157 1.00 29.15 ? 671  ALA A N   1 
ATOM   1054 C  CA  . ALA A 1 191 ? -5.890  -10.716 -13.873 1.00 29.30 ? 671  ALA A CA  1 
ATOM   1055 C  C   . ALA A 1 191 ? -6.347  -11.824 -12.929 1.00 29.39 ? 671  ALA A C   1 
ATOM   1056 O  O   . ALA A 1 191 ? -5.707  -12.050 -11.909 1.00 29.20 ? 671  ALA A O   1 
ATOM   1057 C  CB  . ALA A 1 191 ? -4.516  -11.050 -14.442 1.00 29.21 ? 671  ALA A CB  1 
ATOM   1058 N  N   . ASP A 1 192 ? -7.451  -12.495 -13.259 1.00 29.69 ? 672  ASP A N   1 
ATOM   1059 C  CA  . ASP A 1 192 ? -7.937  -13.623 -12.449 1.00 30.14 ? 672  ASP A CA  1 
ATOM   1060 C  C   . ASP A 1 192 ? -7.665  -14.962 -13.152 1.00 30.04 ? 672  ASP A C   1 
ATOM   1061 O  O   . ASP A 1 192 ? -6.882  -15.008 -14.097 1.00 30.05 ? 672  ASP A O   1 
ATOM   1062 C  CB  . ASP A 1 192 ? -9.418  -13.433 -12.055 1.00 30.35 ? 672  ASP A CB  1 
ATOM   1063 C  CG  . ASP A 1 192 ? -10.385 -13.634 -13.209 1.00 31.26 ? 672  ASP A CG  1 
ATOM   1064 O  OD1 . ASP A 1 192 ? -9.993  -14.150 -14.282 1.00 32.52 ? 672  ASP A OD1 1 
ATOM   1065 O  OD2 . ASP A 1 192 ? -11.565 -13.273 -13.027 1.00 32.56 ? 672  ASP A OD2 1 
ATOM   1066 N  N   . HIS A 1 193 ? -8.296  -16.040 -12.690 1.00 30.08 ? 673  HIS A N   1 
ATOM   1067 C  CA  . HIS A 1 193 ? -7.956  -17.391 -13.157 1.00 30.26 ? 673  HIS A CA  1 
ATOM   1068 C  C   . HIS A 1 193 ? -8.004  -17.562 -14.678 1.00 30.40 ? 673  HIS A C   1 
ATOM   1069 O  O   . HIS A 1 193 ? -7.141  -18.233 -15.252 1.00 30.61 ? 673  HIS A O   1 
ATOM   1070 C  CB  . HIS A 1 193 ? -8.855  -18.440 -12.484 1.00 30.17 ? 673  HIS A CB  1 
ATOM   1071 C  CG  . HIS A 1 193 ? -8.522  -19.853 -12.860 1.00 30.16 ? 673  HIS A CG  1 
ATOM   1072 N  ND1 . HIS A 1 193 ? -9.376  -20.650 -13.592 1.00 29.96 ? 673  HIS A ND1 1 
ATOM   1073 C  CD2 . HIS A 1 193 ? -7.425  -20.608 -12.612 1.00 30.20 ? 673  HIS A CD2 1 
ATOM   1074 C  CE1 . HIS A 1 193 ? -8.823  -21.836 -13.773 1.00 29.62 ? 673  HIS A CE1 1 
ATOM   1075 N  NE2 . HIS A 1 193 ? -7.638  -21.836 -13.190 1.00 29.52 ? 673  HIS A NE2 1 
ATOM   1076 N  N   . SER A 1 194 ? -8.998  -16.965 -15.330 1.00 30.41 ? 674  SER A N   1 
ATOM   1077 C  CA  . SER A 1 194 ? -9.127  -17.091 -16.781 1.00 30.56 ? 674  SER A CA  1 
ATOM   1078 C  C   . SER A 1 194 ? -9.578  -15.798 -17.478 1.00 30.46 ? 674  SER A C   1 
ATOM   1079 O  O   . SER A 1 194 ? -10.265 -15.849 -18.493 1.00 30.55 ? 674  SER A O   1 
ATOM   1080 C  CB  . SER A 1 194 ? -10.078 -18.251 -17.107 1.00 30.73 ? 674  SER A CB  1 
ATOM   1081 O  OG  . SER A 1 194 ? -11.279 -18.145 -16.362 1.00 31.26 ? 674  SER A OG  1 
ATOM   1082 N  N   . THR A 1 195 ? -9.168  -14.646 -16.952 1.00 30.51 ? 675  THR A N   1 
ATOM   1083 C  CA  . THR A 1 195 ? -9.510  -13.357 -17.562 1.00 30.48 ? 675  THR A CA  1 
ATOM   1084 C  C   . THR A 1 195 ? -8.374  -12.341 -17.432 1.00 30.36 ? 675  THR A C   1 
ATOM   1085 O  O   . THR A 1 195 ? -7.966  -11.995 -16.322 1.00 30.24 ? 675  THR A O   1 
ATOM   1086 C  CB  . THR A 1 195 ? -10.780 -12.727 -16.926 1.00 30.59 ? 675  THR A CB  1 
ATOM   1087 O  OG1 . THR A 1 195 ? -11.738 -13.748 -16.614 1.00 31.28 ? 675  THR A OG1 1 
ATOM   1088 C  CG2 . THR A 1 195 ? -11.410 -11.711 -17.877 1.00 30.19 ? 675  THR A CG2 1 
ATOM   1089 N  N   . ALA A 1 196 ? -7.862  -11.877 -18.569 1.00 30.16 ? 676  ALA A N   1 
ATOM   1090 C  CA  . ALA A 1 196 ? -7.018  -10.684 -18.596 1.00 30.02 ? 676  ALA A CA  1 
ATOM   1091 C  C   . ALA A 1 196 ? -7.949  -9.478  -18.638 1.00 29.86 ? 676  ALA A C   1 
ATOM   1092 O  O   . ALA A 1 196 ? -8.909  -9.462  -19.406 1.00 29.73 ? 676  ALA A O   1 
ATOM   1093 C  CB  . ALA A 1 196 ? -6.092  -10.694 -19.805 1.00 29.93 ? 676  ALA A CB  1 
ATOM   1094 N  N   . MET A 1 197 ? -7.677  -8.487  -17.794 1.00 29.79 ? 677  MET A N   1 
ATOM   1095 C  CA  . MET A 1 197 ? -8.514  -7.290  -17.701 1.00 29.81 ? 677  MET A CA  1 
ATOM   1096 C  C   . MET A 1 197 ? -7.789  -6.185  -16.953 1.00 29.42 ? 677  MET A C   1 
ATOM   1097 O  O   . MET A 1 197 ? -6.786  -6.436  -16.285 1.00 29.31 ? 677  MET A O   1 
ATOM   1098 C  CB  . MET A 1 197 ? -9.818  -7.605  -16.966 1.00 29.92 ? 677  MET A CB  1 
ATOM   1099 C  CG  . MET A 1 197 ? -9.616  -7.984  -15.507 1.00 31.03 ? 677  MET A CG  1 
ATOM   1100 S  SD  . MET A 1 197 ? -11.130 -8.490  -14.684 1.00 32.93 ? 677  MET A SD  1 
ATOM   1101 C  CE  . MET A 1 197 ? -11.937 -6.907  -14.452 1.00 33.14 ? 677  MET A CE  1 
ATOM   1102 N  N   . GLY A 1 198 ? -8.315  -4.968  -17.056 1.00 29.13 ? 678  GLY A N   1 
ATOM   1103 C  CA  . GLY A 1 198 ? -7.780  -3.814  -16.334 1.00 28.93 ? 678  GLY A CA  1 
ATOM   1104 C  C   . GLY A 1 198 ? -6.272  -3.675  -16.462 1.00 28.80 ? 678  GLY A C   1 
ATOM   1105 O  O   . GLY A 1 198 ? -5.571  -3.541  -15.461 1.00 28.47 ? 678  GLY A O   1 
ATOM   1106 N  N   . PHE A 1 199 ? -5.787  -3.719  -17.703 1.00 28.61 ? 679  PHE A N   1 
ATOM   1107 C  CA  . PHE A 1 199 ? -4.355  -3.612  -18.022 1.00 28.43 ? 679  PHE A CA  1 
ATOM   1108 C  C   . PHE A 1 199 ? -3.508  -4.795  -17.534 1.00 28.40 ? 679  PHE A C   1 
ATOM   1109 O  O   . PHE A 1 199 ? -2.284  -4.723  -17.574 1.00 28.54 ? 679  PHE A O   1 
ATOM   1110 C  CB  . PHE A 1 199 ? -3.763  -2.297  -17.485 1.00 28.37 ? 679  PHE A CB  1 
ATOM   1111 C  CG  . PHE A 1 199 ? -4.519  -1.062  -17.912 1.00 28.05 ? 679  PHE A CG  1 
ATOM   1112 C  CD1 . PHE A 1 199 ? -4.248  -0.447  -19.128 1.00 27.77 ? 679  PHE A CD1 1 
ATOM   1113 C  CD2 . PHE A 1 199 ? -5.492  -0.507  -17.092 1.00 28.05 ? 679  PHE A CD2 1 
ATOM   1114 C  CE1 . PHE A 1 199 ? -4.943  0.701   -19.520 1.00 27.85 ? 679  PHE A CE1 1 
ATOM   1115 C  CE2 . PHE A 1 199 ? -6.191  0.639   -17.480 1.00 28.03 ? 679  PHE A CE2 1 
ATOM   1116 C  CZ  . PHE A 1 199 ? -5.911  1.244   -18.691 1.00 27.57 ? 679  PHE A CZ  1 
ATOM   1117 N  N   . CYS A 1 200 ? -4.144  -5.885  -17.104 1.00 28.34 ? 680  CYS A N   1 
ATOM   1118 C  CA  . CYS A 1 200 ? -3.422  -7.009  -16.501 1.00 28.18 ? 680  CYS A CA  1 
ATOM   1119 C  C   . CYS A 1 200 ? -3.605  -8.301  -17.276 1.00 28.07 ? 680  CYS A C   1 
ATOM   1120 O  O   . CYS A 1 200 ? -4.682  -8.564  -17.812 1.00 28.11 ? 680  CYS A O   1 
ATOM   1121 C  CB  . CYS A 1 200 ? -3.880  -7.218  -15.061 1.00 28.20 ? 680  CYS A CB  1 
ATOM   1122 S  SG  . CYS A 1 200 ? -3.587  -5.801  -14.005 1.00 28.31 ? 680  CYS A SG  1 
ATOM   1123 N  N   . PHE A 1 201 ? -2.547  -9.108  -17.309 1.00 27.88 ? 681  PHE A N   1 
ATOM   1124 C  CA  . PHE A 1 201 ? -2.546  -10.378 -18.033 1.00 27.99 ? 681  PHE A CA  1 
ATOM   1125 C  C   . PHE A 1 201 ? -2.251  -11.564 -17.109 1.00 27.99 ? 681  PHE A C   1 
ATOM   1126 O  O   . PHE A 1 201 ? -2.960  -12.571 -17.145 1.00 27.88 ? 681  PHE A O   1 
ATOM   1127 C  CB  . PHE A 1 201 ? -1.539  -10.318 -19.183 1.00 27.85 ? 681  PHE A CB  1 
ATOM   1128 C  CG  . PHE A 1 201 ? -1.670  -9.083  -20.024 1.00 28.19 ? 681  PHE A CG  1 
ATOM   1129 C  CD1 . PHE A 1 201 ? -0.963  -7.933  -19.699 1.00 28.85 ? 681  PHE A CD1 1 
ATOM   1130 C  CD2 . PHE A 1 201 ? -2.515  -9.058  -21.124 1.00 28.74 ? 681  PHE A CD2 1 
ATOM   1131 C  CE1 . PHE A 1 201 ? -1.081  -6.782  -20.459 1.00 28.78 ? 681  PHE A CE1 1 
ATOM   1132 C  CE2 . PHE A 1 201 ? -2.642  -7.910  -21.896 1.00 28.94 ? 681  PHE A CE2 1 
ATOM   1133 C  CZ  . PHE A 1 201 ? -1.921  -6.768  -21.561 1.00 29.05 ? 681  PHE A CZ  1 
ATOM   1134 N  N   . PHE A 1 202 ? -1.202  -11.445 -16.297 1.00 28.06 ? 682  PHE A N   1 
ATOM   1135 C  CA  . PHE A 1 202 ? -0.862  -12.460 -15.296 1.00 28.07 ? 682  PHE A CA  1 
ATOM   1136 C  C   . PHE A 1 202 ? -0.703  -11.786 -13.938 1.00 28.24 ? 682  PHE A C   1 
ATOM   1137 O  O   . PHE A 1 202 ? -0.083  -10.726 -13.839 1.00 28.56 ? 682  PHE A O   1 
ATOM   1138 C  CB  . PHE A 1 202 ? 0.438   -13.186 -15.660 1.00 28.01 ? 682  PHE A CB  1 
ATOM   1139 C  CG  . PHE A 1 202 ? 0.398   -13.895 -16.991 1.00 27.30 ? 682  PHE A CG  1 
ATOM   1140 C  CD1 . PHE A 1 202 ? -0.585  -14.827 -17.267 1.00 26.76 ? 682  PHE A CD1 1 
ATOM   1141 C  CD2 . PHE A 1 202 ? 1.365   -13.645 -17.955 1.00 27.15 ? 682  PHE A CD2 1 
ATOM   1142 C  CE1 . PHE A 1 202 ? -0.616  -15.485 -18.493 1.00 27.09 ? 682  PHE A CE1 1 
ATOM   1143 C  CE2 . PHE A 1 202 ? 1.342   -14.303 -19.176 1.00 27.39 ? 682  PHE A CE2 1 
ATOM   1144 C  CZ  . PHE A 1 202 ? 0.349   -15.222 -19.447 1.00 26.64 ? 682  PHE A CZ  1 
ATOM   1145 N  N   . ASN A 1 203 ? -1.266  -12.392 -12.895 1.00 28.12 ? 683  ASN A N   1 
ATOM   1146 C  CA  . ASN A 1 203 ? -1.191  -11.823 -11.557 1.00 28.03 ? 683  ASN A CA  1 
ATOM   1147 C  C   . ASN A 1 203 ? 0.149   -12.156 -10.910 1.00 28.16 ? 683  ASN A C   1 
ATOM   1148 O  O   . ASN A 1 203 ? 0.274   -13.130 -10.169 1.00 28.36 ? 683  ASN A O   1 
ATOM   1149 C  CB  . ASN A 1 203 ? -2.362  -12.302 -10.698 1.00 27.94 ? 683  ASN A CB  1 
ATOM   1150 C  CG  . ASN A 1 203 ? -2.506  -11.506 -9.418  1.00 27.49 ? 683  ASN A CG  1 
ATOM   1151 O  OD1 . ASN A 1 203 ? -1.528  -10.983 -8.886  1.00 26.69 ? 683  ASN A OD1 1 
ATOM   1152 N  ND2 . ASN A 1 203 ? -3.730  -11.415 -8.914  1.00 26.74 ? 683  ASN A ND2 1 
ATOM   1153 N  N   . SER A 1 204 ? 1.138   -11.317 -11.204 1.00 28.28 ? 684  SER A N   1 
ATOM   1154 C  CA  . SER A 1 204 ? 2.520   -11.515 -10.773 1.00 28.29 ? 684  SER A CA  1 
ATOM   1155 C  C   . SER A 1 204 ? 2.667   -11.798 -9.272  1.00 28.19 ? 684  SER A C   1 
ATOM   1156 O  O   . SER A 1 204 ? 3.361   -12.737 -8.889  1.00 27.94 ? 684  SER A O   1 
ATOM   1157 C  CB  . SER A 1 204 ? 3.352   -10.289 -11.169 1.00 28.43 ? 684  SER A CB  1 
ATOM   1158 O  OG  . SER A 1 204 ? 3.277   -10.076 -12.570 1.00 28.19 ? 684  SER A OG  1 
ATOM   1159 N  N   . VAL A 1 205 ? 2.004   -10.994 -8.438  1.00 28.21 ? 685  VAL A N   1 
ATOM   1160 C  CA  . VAL A 1 205 ? 2.042   -11.173 -6.978  1.00 28.07 ? 685  VAL A CA  1 
ATOM   1161 C  C   . VAL A 1 205 ? 1.431   -12.519 -6.560  1.00 28.24 ? 685  VAL A C   1 
ATOM   1162 O  O   . VAL A 1 205 ? 1.960   -13.193 -5.670  1.00 28.40 ? 685  VAL A O   1 
ATOM   1163 C  CB  . VAL A 1 205 ? 1.299   -10.031 -6.243  1.00 28.02 ? 685  VAL A CB  1 
ATOM   1164 C  CG1 . VAL A 1 205 ? 1.264   -10.284 -4.737  1.00 27.78 ? 685  VAL A CG1 1 
ATOM   1165 C  CG2 . VAL A 1 205 ? 1.952   -8.693  -6.531  1.00 28.00 ? 685  VAL A CG2 1 
ATOM   1166 N  N   . ALA A 1 206 ? 0.330   -12.900 -7.208  1.00 27.95 ? 686  ALA A N   1 
ATOM   1167 C  CA  . ALA A 1 206 ? -0.341  -14.169 -6.926  1.00 28.15 ? 686  ALA A CA  1 
ATOM   1168 C  C   . ALA A 1 206 ? 0.522   -15.359 -7.349  1.00 28.21 ? 686  ALA A C   1 
ATOM   1169 O  O   . ALA A 1 206 ? 0.614   -16.348 -6.624  1.00 28.07 ? 686  ALA A O   1 
ATOM   1170 C  CB  . ALA A 1 206 ? -1.708  -14.228 -7.622  1.00 27.81 ? 686  ALA A CB  1 
ATOM   1171 N  N   . ILE A 1 207 ? 1.149   -15.254 -8.519  1.00 28.24 ? 687  ILE A N   1 
ATOM   1172 C  CA  . ILE A 1 207 ? 2.037   -16.300 -9.010  1.00 28.24 ? 687  ILE A CA  1 
ATOM   1173 C  C   . ILE A 1 207 ? 3.253   -16.442 -8.096  1.00 28.39 ? 687  ILE A C   1 
ATOM   1174 O  O   . ILE A 1 207 ? 3.670   -17.556 -7.784  1.00 28.37 ? 687  ILE A O   1 
ATOM   1175 C  CB  . ILE A 1 207 ? 2.492   -16.037 -10.463 1.00 28.31 ? 687  ILE A CB  1 
ATOM   1176 C  CG1 . ILE A 1 207 ? 1.302   -16.158 -11.420 1.00 28.23 ? 687  ILE A CG1 1 
ATOM   1177 C  CG2 . ILE A 1 207 ? 3.577   -17.023 -10.871 1.00 27.65 ? 687  ILE A CG2 1 
ATOM   1178 C  CD1 . ILE A 1 207 ? 1.615   -15.776 -12.865 1.00 27.93 ? 687  ILE A CD1 1 
ATOM   1179 N  N   . ALA A 1 208 ? 3.801   -15.315 -7.653  1.00 28.51 ? 688  ALA A N   1 
ATOM   1180 C  CA  . ALA A 1 208 ? 4.934   -15.324 -6.729  1.00 28.72 ? 688  ALA A CA  1 
ATOM   1181 C  C   . ALA A 1 208 ? 4.561   -16.005 -5.414  1.00 28.77 ? 688  ALA A C   1 
ATOM   1182 O  O   . ALA A 1 208 ? 5.300   -16.854 -4.911  1.00 28.61 ? 688  ALA A O   1 
ATOM   1183 C  CB  . ALA A 1 208 ? 5.434   -13.898 -6.474  1.00 28.53 ? 688  ALA A CB  1 
ATOM   1184 N  N   . CYS A 1 209 ? 3.406   -15.635 -4.870  1.00 29.18 ? 689  CYS A N   1 
ATOM   1185 C  CA  . CYS A 1 209 ? 2.909   -16.225 -3.625  1.00 29.54 ? 689  CYS A CA  1 
ATOM   1186 C  C   . CYS A 1 209 ? 2.717   -17.740 -3.725  1.00 29.50 ? 689  CYS A C   1 
ATOM   1187 O  O   . CYS A 1 209 ? 3.175   -18.481 -2.861  1.00 29.70 ? 689  CYS A O   1 
ATOM   1188 C  CB  . CYS A 1 209 ? 1.599   -15.560 -3.226  1.00 29.60 ? 689  CYS A CB  1 
ATOM   1189 S  SG  . CYS A 1 209 ? 0.868   -16.209 -1.719  1.00 30.95 ? 689  CYS A SG  1 
ATOM   1190 N  N   . ARG A 1 210 ? 2.047   -18.194 -4.779  1.00 29.72 ? 690  ARG A N   1 
ATOM   1191 C  CA  . ARG A 1 210 ? 1.826   -19.630 -5.008  1.00 29.93 ? 690  ARG A CA  1 
ATOM   1192 C  C   . ARG A 1 210 ? 3.122   -20.429 -5.092  1.00 29.89 ? 690  ARG A C   1 
ATOM   1193 O  O   . ARG A 1 210 ? 3.183   -21.565 -4.630  1.00 29.52 ? 690  ARG A O   1 
ATOM   1194 C  CB  . ARG A 1 210 ? 1.032   -19.854 -6.297  1.00 30.10 ? 690  ARG A CB  1 
ATOM   1195 C  CG  . ARG A 1 210 ? -0.455  -19.747 -6.114  1.00 30.86 ? 690  ARG A CG  1 
ATOM   1196 C  CD  . ARG A 1 210 ? -1.016  -21.046 -5.580  1.00 32.09 ? 690  ARG A CD  1 
ATOM   1197 N  NE  . ARG A 1 210 ? -2.214  -20.828 -4.778  1.00 32.92 ? 690  ARG A NE  1 
ATOM   1198 C  CZ  . ARG A 1 210 ? -3.438  -20.660 -5.266  1.00 34.83 ? 690  ARG A CZ  1 
ATOM   1199 N  NH1 . ARG A 1 210 ? -3.667  -20.674 -6.582  1.00 34.99 ? 690  ARG A NH1 1 
ATOM   1200 N  NH2 . ARG A 1 210 ? -4.451  -20.478 -4.422  1.00 36.06 ? 690  ARG A NH2 1 
ATOM   1201 N  N   . GLN A 1 211 ? 4.149   -19.837 -5.696  1.00 29.90 ? 691  GLN A N   1 
ATOM   1202 C  CA  . GLN A 1 211 ? 5.422   -20.527 -5.886  1.00 29.91 ? 691  GLN A CA  1 
ATOM   1203 C  C   . GLN A 1 211 ? 6.197   -20.662 -4.579  1.00 30.34 ? 691  GLN A C   1 
ATOM   1204 O  O   . GLN A 1 211 ? 6.739   -21.728 -4.286  1.00 30.18 ? 691  GLN A O   1 
ATOM   1205 C  CB  . GLN A 1 211 ? 6.256   -19.817 -6.953  1.00 29.68 ? 691  GLN A CB  1 
ATOM   1206 C  CG  . GLN A 1 211 ? 5.670   -19.953 -8.347  1.00 28.73 ? 691  GLN A CG  1 
ATOM   1207 C  CD  . GLN A 1 211 ? 5.478   -21.400 -8.752  1.00 27.12 ? 691  GLN A CD  1 
ATOM   1208 O  OE1 . GLN A 1 211 ? 4.399   -21.796 -9.185  1.00 25.86 ? 691  GLN A OE1 1 
ATOM   1209 N  NE2 . GLN A 1 211 ? 6.520   -22.199 -8.591  1.00 25.56 ? 691  GLN A NE2 1 
ATOM   1210 N  N   . LEU A 1 212 ? 6.239   -19.583 -3.801  1.00 30.91 ? 692  LEU A N   1 
ATOM   1211 C  CA  . LEU A 1 212 ? 6.794   -19.609 -2.444  1.00 31.37 ? 692  LEU A CA  1 
ATOM   1212 C  C   . LEU A 1 212 ? 6.191   -20.748 -1.607  1.00 31.78 ? 692  LEU A C   1 
ATOM   1213 O  O   . LEU A 1 212 ? 6.911   -21.452 -0.890  1.00 31.53 ? 692  LEU A O   1 
ATOM   1214 C  CB  . LEU A 1 212 ? 6.557   -18.261 -1.743  1.00 31.40 ? 692  LEU A CB  1 
ATOM   1215 C  CG  . LEU A 1 212 ? 7.682   -17.206 -1.679  1.00 31.87 ? 692  LEU A CG  1 
ATOM   1216 C  CD1 . LEU A 1 212 ? 8.872   -17.489 -2.595  1.00 32.23 ? 692  LEU A CD1 1 
ATOM   1217 C  CD2 . LEU A 1 212 ? 7.118   -15.819 -1.950  1.00 31.32 ? 692  LEU A CD2 1 
ATOM   1218 N  N   . GLN A 1 213 ? 4.875   -20.919 -1.708  1.00 32.31 ? 693  GLN A N   1 
ATOM   1219 C  CA  . GLN A 1 213 ? 4.170   -21.986 -1.000  1.00 32.84 ? 693  GLN A CA  1 
ATOM   1220 C  C   . GLN A 1 213 ? 4.525   -23.373 -1.528  1.00 33.26 ? 693  GLN A C   1 
ATOM   1221 O  O   . GLN A 1 213 ? 4.840   -24.274 -0.752  1.00 33.25 ? 693  GLN A O   1 
ATOM   1222 C  CB  . GLN A 1 213 ? 2.658   -21.794 -1.110  1.00 32.94 ? 693  GLN A CB  1 
ATOM   1223 C  CG  . GLN A 1 213 ? 2.121   -20.627 -0.308  1.00 33.56 ? 693  GLN A CG  1 
ATOM   1224 C  CD  . GLN A 1 213 ? 0.607   -20.588 -0.305  1.00 34.17 ? 693  GLN A CD  1 
ATOM   1225 O  OE1 . GLN A 1 213 ? -0.036  -20.764 -1.345  1.00 35.02 ? 693  GLN A OE1 1 
ATOM   1226 N  NE2 . GLN A 1 213 ? 0.027   -20.360 0.868   1.00 34.27 ? 693  GLN A NE2 1 
ATOM   1227 N  N   . GLN A 1 214 ? 4.469   -23.539 -2.846  1.00 33.76 ? 694  GLN A N   1 
ATOM   1228 C  CA  . GLN A 1 214 ? 4.680   -24.847 -3.461  1.00 34.33 ? 694  GLN A CA  1 
ATOM   1229 C  C   . GLN A 1 214 ? 6.131   -25.306 -3.353  1.00 34.66 ? 694  GLN A C   1 
ATOM   1230 O  O   . GLN A 1 214 ? 6.393   -26.507 -3.298  1.00 34.74 ? 694  GLN A O   1 
ATOM   1231 C  CB  . GLN A 1 214 ? 4.197   -24.847 -4.917  1.00 34.49 ? 694  GLN A CB  1 
ATOM   1232 C  CG  . GLN A 1 214 ? 2.679   -24.645 -5.023  1.00 35.17 ? 694  GLN A CG  1 
ATOM   1233 C  CD  . GLN A 1 214 ? 2.136   -24.702 -6.441  1.00 36.27 ? 694  GLN A CD  1 
ATOM   1234 O  OE1 . GLN A 1 214 ? 2.865   -24.958 -7.407  1.00 37.11 ? 694  GLN A OE1 1 
ATOM   1235 N  NE2 . GLN A 1 214 ? 0.837   -24.461 -6.570  1.00 36.22 ? 694  GLN A NE2 1 
ATOM   1236 N  N   . GLN A 1 215 ? 7.062   -24.353 -3.295  1.00 35.07 ? 695  GLN A N   1 
ATOM   1237 C  CA  . GLN A 1 215 ? 8.477   -24.656 -3.053  1.00 35.43 ? 695  GLN A CA  1 
ATOM   1238 C  C   . GLN A 1 215 ? 8.819   -24.670 -1.557  1.00 35.67 ? 695  GLN A C   1 
ATOM   1239 O  O   . GLN A 1 215 ? 9.994   -24.748 -1.192  1.00 35.66 ? 695  GLN A O   1 
ATOM   1240 C  CB  . GLN A 1 215 ? 9.383   -23.654 -3.787  1.00 35.55 ? 695  GLN A CB  1 
ATOM   1241 C  CG  . GLN A 1 215 ? 9.389   -23.795 -5.306  1.00 35.86 ? 695  GLN A CG  1 
ATOM   1242 C  CD  . GLN A 1 215 ? 9.884   -25.154 -5.769  1.00 36.71 ? 695  GLN A CD  1 
ATOM   1243 O  OE1 . GLN A 1 215 ? 9.165   -25.889 -6.443  1.00 37.49 ? 695  GLN A OE1 1 
ATOM   1244 N  NE2 . GLN A 1 215 ? 11.113  -25.501 -5.397  1.00 37.21 ? 695  GLN A NE2 1 
ATOM   1245 N  N   . SER A 1 216 ? 7.793   -24.582 -0.706  1.00 35.85 ? 696  SER A N   1 
ATOM   1246 C  CA  . SER A 1 216 ? 7.937   -24.678 0.755   1.00 36.08 ? 696  SER A CA  1 
ATOM   1247 C  C   . SER A 1 216 ? 8.783   -23.565 1.378   1.00 36.06 ? 696  SER A C   1 
ATOM   1248 O  O   . SER A 1 216 ? 9.281   -23.712 2.494   1.00 36.02 ? 696  SER A O   1 
ATOM   1249 C  CB  . SER A 1 216 ? 8.521   -26.044 1.153   1.00 36.12 ? 696  SER A CB  1 
ATOM   1250 O  OG  . SER A 1 216 ? 7.847   -27.105 0.504   1.00 36.60 ? 696  SER A OG  1 
ATOM   1251 N  N   . LYS A 1 217 ? 8.926   -22.447 0.672   1.00 36.28 ? 697  LYS A N   1 
ATOM   1252 C  CA  . LYS A 1 217 ? 9.841   -21.390 1.095   1.00 36.47 ? 697  LYS A CA  1 
ATOM   1253 C  C   . LYS A 1 217 ? 9.177   -20.353 2.006   1.00 36.30 ? 697  LYS A C   1 
ATOM   1254 O  O   . LYS A 1 217 ? 9.846   -19.454 2.511   1.00 36.32 ? 697  LYS A O   1 
ATOM   1255 C  CB  . LYS A 1 217 ? 10.462  -20.712 -0.131  1.00 36.58 ? 697  LYS A CB  1 
ATOM   1256 C  CG  . LYS A 1 217 ? 11.821  -20.064 0.128   1.00 37.78 ? 697  LYS A CG  1 
ATOM   1257 C  CD  . LYS A 1 217 ? 12.908  -21.098 0.464   1.00 38.67 ? 697  LYS A CD  1 
ATOM   1258 C  CE  . LYS A 1 217 ? 14.238  -20.420 0.787   1.00 38.79 ? 697  LYS A CE  1 
ATOM   1259 N  NZ  . LYS A 1 217 ? 15.339  -21.403 1.068   1.00 38.84 ? 697  LYS A NZ  1 
ATOM   1260 N  N   . ALA A 1 218 ? 7.869   -20.485 2.219   1.00 36.17 ? 698  ALA A N   1 
ATOM   1261 C  CA  . ALA A 1 218 ? 7.141   -19.611 3.141   1.00 36.01 ? 698  ALA A CA  1 
ATOM   1262 C  C   . ALA A 1 218 ? 5.795   -20.227 3.521   1.00 35.82 ? 698  ALA A C   1 
ATOM   1263 O  O   . ALA A 1 218 ? 4.965   -20.500 2.654   1.00 35.87 ? 698  ALA A O   1 
ATOM   1264 C  CB  . ALA A 1 218 ? 6.939   -18.236 2.522   1.00 35.94 ? 698  ALA A CB  1 
ATOM   1265 N  N   . SER A 1 219 ? 5.587   -20.437 4.819   1.00 35.57 ? 699  SER A N   1 
ATOM   1266 C  CA  . SER A 1 219 ? 4.364   -21.056 5.324   1.00 35.41 ? 699  SER A CA  1 
ATOM   1267 C  C   . SER A 1 219 ? 3.160   -20.116 5.190   1.00 34.94 ? 699  SER A C   1 
ATOM   1268 O  O   . SER A 1 219 ? 2.204   -20.425 4.481   1.00 35.24 ? 699  SER A O   1 
ATOM   1269 C  CB  . SER A 1 219 ? 4.558   -21.484 6.786   1.00 35.58 ? 699  SER A CB  1 
ATOM   1270 O  OG  . SER A 1 219 ? 3.465   -22.247 7.264   1.00 36.38 ? 699  SER A OG  1 
ATOM   1271 N  N   . LYS A 1 220 ? 3.221   -18.970 5.861   1.00 34.22 ? 700  LYS A N   1 
ATOM   1272 C  CA  . LYS A 1 220 ? 2.118   -18.010 5.873   1.00 33.52 ? 700  LYS A CA  1 
ATOM   1273 C  C   . LYS A 1 220 ? 2.542   -16.730 5.177   1.00 32.77 ? 700  LYS A C   1 
ATOM   1274 O  O   . LYS A 1 220 ? 3.577   -16.154 5.512   1.00 32.81 ? 700  LYS A O   1 
ATOM   1275 C  CB  . LYS A 1 220 ? 1.692   -17.695 7.311   1.00 33.56 ? 700  LYS A CB  1 
ATOM   1276 C  CG  . LYS A 1 220 ? 0.903   -18.806 7.994   1.00 33.63 ? 700  LYS A CG  1 
ATOM   1277 C  CD  . LYS A 1 220 ? 0.404   -18.378 9.373   1.00 33.69 ? 700  LYS A CD  1 
ATOM   1278 C  CE  . LYS A 1 220 ? 1.532   -18.344 10.398  1.00 33.72 ? 700  LYS A CE  1 
ATOM   1279 N  NZ  . LYS A 1 220 ? 1.096   -17.792 11.707  1.00 33.59 ? 700  LYS A NZ  1 
ATOM   1280 N  N   . ILE A 1 221 ? 1.733   -16.284 4.221   1.00 31.89 ? 701  ILE A N   1 
ATOM   1281 C  CA  . ILE A 1 221 ? 2.054   -15.109 3.416   1.00 31.29 ? 701  ILE A CA  1 
ATOM   1282 C  C   . ILE A 1 221 ? 0.965   -14.041 3.558   1.00 30.75 ? 701  ILE A C   1 
ATOM   1283 O  O   . ILE A 1 221 ? -0.225  -14.326 3.412   1.00 30.53 ? 701  ILE A O   1 
ATOM   1284 C  CB  . ILE A 1 221 ? 2.243   -15.487 1.918   1.00 31.40 ? 701  ILE A CB  1 
ATOM   1285 C  CG1 . ILE A 1 221 ? 3.394   -16.491 1.763   1.00 31.21 ? 701  ILE A CG1 1 
ATOM   1286 C  CG2 . ILE A 1 221 ? 2.508   -14.238 1.059   1.00 30.74 ? 701  ILE A CG2 1 
ATOM   1287 C  CD1 . ILE A 1 221 ? 3.509   -17.086 0.380   1.00 31.03 ? 701  ILE A CD1 1 
ATOM   1288 N  N   . LEU A 1 222 ? 1.386   -12.819 3.868   1.00 30.18 ? 702  LEU A N   1 
ATOM   1289 C  CA  . LEU A 1 222 ? 0.499   -11.668 3.869   1.00 29.75 ? 702  LEU A CA  1 
ATOM   1290 C  C   . LEU A 1 222 ? 0.643   -10.964 2.533   1.00 29.81 ? 702  LEU A C   1 
ATOM   1291 O  O   . LEU A 1 222 ? 1.759   -10.650 2.117   1.00 29.98 ? 702  LEU A O   1 
ATOM   1292 C  CB  . LEU A 1 222 ? 0.867   -10.702 4.997   1.00 29.45 ? 702  LEU A CB  1 
ATOM   1293 C  CG  . LEU A 1 222 ? 0.250   -9.298  4.950   1.00 28.56 ? 702  LEU A CG  1 
ATOM   1294 C  CD1 . LEU A 1 222 ? -1.275  -9.366  4.951   1.00 26.90 ? 702  LEU A CD1 1 
ATOM   1295 C  CD2 . LEU A 1 222 ? 0.770   -8.466  6.119   1.00 27.19 ? 702  LEU A CD2 1 
ATOM   1296 N  N   . ILE A 1 223 ? -0.483  -10.727 1.866   1.00 29.67 ? 703  ILE A N   1 
ATOM   1297 C  CA  . ILE A 1 223 ? -0.520  -9.882  0.683   1.00 29.52 ? 703  ILE A CA  1 
ATOM   1298 C  C   . ILE A 1 223 ? -1.283  -8.606  1.018   1.00 29.40 ? 703  ILE A C   1 
ATOM   1299 O  O   . ILE A 1 223 ? -2.476  -8.653  1.335   1.00 29.17 ? 703  ILE A O   1 
ATOM   1300 C  CB  . ILE A 1 223 ? -1.206  -10.577 -0.514  1.00 29.61 ? 703  ILE A CB  1 
ATOM   1301 C  CG1 . ILE A 1 223 ? -0.461  -11.863 -0.891  1.00 29.57 ? 703  ILE A CG1 1 
ATOM   1302 C  CG2 . ILE A 1 223 ? -1.270  -9.621  -1.710  1.00 29.15 ? 703  ILE A CG2 1 
ATOM   1303 C  CD1 . ILE A 1 223 ? -1.074  -12.596 -2.075  1.00 29.97 ? 703  ILE A CD1 1 
ATOM   1304 N  N   . VAL A 1 224 ? -0.583  -7.475  0.958   1.00 29.32 ? 704  VAL A N   1 
ATOM   1305 C  CA  . VAL A 1 224 ? -1.198  -6.165  1.127   1.00 29.13 ? 704  VAL A CA  1 
ATOM   1306 C  C   . VAL A 1 224 ? -1.278  -5.475  -0.229  1.00 29.34 ? 704  VAL A C   1 
ATOM   1307 O  O   . VAL A 1 224 ? -0.298  -5.431  -0.977  1.00 29.43 ? 704  VAL A O   1 
ATOM   1308 C  CB  . VAL A 1 224 ? -0.411  -5.271  2.093   1.00 29.08 ? 704  VAL A CB  1 
ATOM   1309 C  CG1 . VAL A 1 224 ? -1.111  -3.919  2.241   1.00 28.89 ? 704  VAL A CG1 1 
ATOM   1310 C  CG2 . VAL A 1 224 ? -0.260  -5.948  3.454   1.00 28.64 ? 704  VAL A CG2 1 
ATOM   1311 N  N   . ASP A 1 225 ? -2.448  -4.934  -0.540  1.00 29.13 ? 705  ASP A N   1 
ATOM   1312 C  CA  . ASP A 1 225 ? -2.673  -4.274  -1.809  1.00 29.24 ? 705  ASP A CA  1 
ATOM   1313 C  C   . ASP A 1 225 ? -3.182  -2.852  -1.536  1.00 29.12 ? 705  ASP A C   1 
ATOM   1314 O  O   . ASP A 1 225 ? -4.350  -2.669  -1.189  1.00 28.93 ? 705  ASP A O   1 
ATOM   1315 C  CB  . ASP A 1 225 ? -3.670  -5.119  -2.609  1.00 29.61 ? 705  ASP A CB  1 
ATOM   1316 C  CG  . ASP A 1 225 ? -3.867  -4.634  -4.041  1.00 29.91 ? 705  ASP A CG  1 
ATOM   1317 O  OD1 . ASP A 1 225 ? -3.721  -3.420  -4.305  1.00 30.39 ? 705  ASP A OD1 1 
ATOM   1318 O  OD2 . ASP A 1 225 ? -4.201  -5.476  -4.901  1.00 30.31 ? 705  ASP A OD2 1 
ATOM   1319 N  N   . TRP A 1 226 ? -2.306  -1.851  -1.669  1.00 28.93 ? 706  TRP A N   1 
ATOM   1320 C  CA  . TRP A 1 226 ? -2.697  -0.451  -1.416  1.00 28.78 ? 706  TRP A CA  1 
ATOM   1321 C  C   . TRP A 1 226 ? -2.917  0.379   -2.692  1.00 28.75 ? 706  TRP A C   1 
ATOM   1322 O  O   . TRP A 1 226 ? -3.111  1.594   -2.628  1.00 28.66 ? 706  TRP A O   1 
ATOM   1323 C  CB  . TRP A 1 226 ? -1.717  0.246   -0.456  1.00 28.79 ? 706  TRP A CB  1 
ATOM   1324 C  CG  . TRP A 1 226 ? -0.306  0.406   -0.940  1.00 28.49 ? 706  TRP A CG  1 
ATOM   1325 C  CD1 . TRP A 1 226 ? 0.102   0.808   -2.176  1.00 28.11 ? 706  TRP A CD1 1 
ATOM   1326 C  CD2 . TRP A 1 226 ? 0.887   0.212   -0.170  1.00 27.99 ? 706  TRP A CD2 1 
ATOM   1327 N  NE1 . TRP A 1 226 ? 1.471   0.857   -2.233  1.00 28.24 ? 706  TRP A NE1 1 
ATOM   1328 C  CE2 . TRP A 1 226 ? 1.979   0.492   -1.015  1.00 28.37 ? 706  TRP A CE2 1 
ATOM   1329 C  CE3 . TRP A 1 226 ? 1.138   -0.175  1.152   1.00 27.79 ? 706  TRP A CE3 1 
ATOM   1330 C  CZ2 . TRP A 1 226 ? 3.305   0.398   -0.580  1.00 28.42 ? 706  TRP A CZ2 1 
ATOM   1331 C  CZ3 . TRP A 1 226 ? 2.453   -0.271  1.582   1.00 27.55 ? 706  TRP A CZ3 1 
ATOM   1332 C  CH2 . TRP A 1 226 ? 3.518   0.014   0.720   1.00 28.16 ? 706  TRP A CH2 1 
ATOM   1333 N  N   . ASP A 1 227 ? -2.879  -0.281  -3.849  1.00 28.72 ? 707  ASP A N   1 
ATOM   1334 C  CA  . ASP A 1 227 ? -3.353  0.308   -5.092  1.00 28.53 ? 707  ASP A CA  1 
ATOM   1335 C  C   . ASP A 1 227 ? -4.807  0.722   -4.849  1.00 28.49 ? 707  ASP A C   1 
ATOM   1336 O  O   . ASP A 1 227 ? -5.530  0.044   -4.111  1.00 28.54 ? 707  ASP A O   1 
ATOM   1337 C  CB  . ASP A 1 227 ? -3.244  -0.726  -6.222  1.00 28.62 ? 707  ASP A CB  1 
ATOM   1338 C  CG  . ASP A 1 227 ? -3.617  -0.165  -7.589  1.00 28.82 ? 707  ASP A CG  1 
ATOM   1339 O  OD1 . ASP A 1 227 ? -4.792  0.229   -7.786  1.00 28.79 ? 707  ASP A OD1 1 
ATOM   1340 O  OD2 . ASP A 1 227 ? -2.735  -0.145  -8.479  1.00 28.17 ? 707  ASP A OD2 1 
ATOM   1341 N  N   . VAL A 1 228 ? -5.238  1.830   -5.447  1.00 28.20 ? 708  VAL A N   1 
ATOM   1342 C  CA  . VAL A 1 228 ? -6.575  2.367   -5.181  1.00 27.96 ? 708  VAL A CA  1 
ATOM   1343 C  C   . VAL A 1 228 ? -7.705  1.476   -5.726  1.00 27.86 ? 708  VAL A C   1 
ATOM   1344 O  O   . VAL A 1 228 ? -8.833  1.557   -5.250  1.00 27.79 ? 708  VAL A O   1 
ATOM   1345 C  CB  . VAL A 1 228 ? -6.719  3.806   -5.725  1.00 28.03 ? 708  VAL A CB  1 
ATOM   1346 C  CG1 . VAL A 1 228 ? -6.923  3.794   -7.245  1.00 27.83 ? 708  VAL A CG1 1 
ATOM   1347 C  CG2 . VAL A 1 228 ? -7.858  4.531   -5.021  1.00 27.83 ? 708  VAL A CG2 1 
ATOM   1348 N  N   . HIS A 1 229 ? -7.401  0.632   -6.714  1.00 27.88 ? 709  HIS A N   1 
ATOM   1349 C  CA  . HIS A 1 229 ? -8.369  -0.343  -7.236  1.00 27.83 ? 709  HIS A CA  1 
ATOM   1350 C  C   . HIS A 1 229 ? -8.255  -1.677  -6.504  1.00 27.84 ? 709  HIS A C   1 
ATOM   1351 O  O   . HIS A 1 229 ? -7.162  -2.083  -6.120  1.00 27.87 ? 709  HIS A O   1 
ATOM   1352 C  CB  . HIS A 1 229 ? -8.140  -0.588  -8.722  1.00 27.78 ? 709  HIS A CB  1 
ATOM   1353 C  CG  . HIS A 1 229 ? -8.089  0.662   -9.536  1.00 27.90 ? 709  HIS A CG  1 
ATOM   1354 N  ND1 . HIS A 1 229 ? -6.925  1.375   -9.725  1.00 27.44 ? 709  HIS A ND1 1 
ATOM   1355 C  CD2 . HIS A 1 229 ? -9.058  1.334   -10.200 1.00 27.50 ? 709  HIS A CD2 1 
ATOM   1356 C  CE1 . HIS A 1 229 ? -7.180  2.431   -10.476 1.00 27.72 ? 709  HIS A CE1 1 
ATOM   1357 N  NE2 . HIS A 1 229 ? -8.466  2.428   -10.777 1.00 28.20 ? 709  HIS A NE2 1 
ATOM   1358 N  N   . HIS A 1 230 ? -9.384  -2.356  -6.321  1.00 27.81 ? 710  HIS A N   1 
ATOM   1359 C  CA  . HIS A 1 230 ? -9.410  -3.681  -5.707  1.00 27.89 ? 710  HIS A CA  1 
ATOM   1360 C  C   . HIS A 1 230 ? -8.704  -4.708  -6.591  1.00 27.88 ? 710  HIS A C   1 
ATOM   1361 O  O   . HIS A 1 230 ? -8.963  -4.783  -7.793  1.00 28.09 ? 710  HIS A O   1 
ATOM   1362 C  CB  . HIS A 1 230 ? -10.854 -4.125  -5.442  1.00 27.78 ? 710  HIS A CB  1 
ATOM   1363 C  CG  . HIS A 1 230 ? -10.957 -5.459  -4.775  1.00 27.89 ? 710  HIS A CG  1 
ATOM   1364 N  ND1 . HIS A 1 230 ? -11.531 -6.553  -5.386  1.00 28.09 ? 710  HIS A ND1 1 
ATOM   1365 C  CD2 . HIS A 1 230 ? -10.550 -5.879  -3.554  1.00 27.38 ? 710  HIS A CD2 1 
ATOM   1366 C  CE1 . HIS A 1 230 ? -11.476 -7.588  -4.568  1.00 28.13 ? 710  HIS A CE1 1 
ATOM   1367 N  NE2 . HIS A 1 230 ? -10.888 -7.205  -3.449  1.00 27.61 ? 710  HIS A NE2 1 
ATOM   1368 N  N   . GLY A 1 231 ? -7.817  -5.498  -5.995  1.00 27.67 ? 711  GLY A N   1 
ATOM   1369 C  CA  . GLY A 1 231 ? -7.147  -6.577  -6.718  1.00 27.70 ? 711  GLY A CA  1 
ATOM   1370 C  C   . GLY A 1 231 ? -8.040  -7.801  -6.807  1.00 27.60 ? 711  GLY A C   1 
ATOM   1371 O  O   . GLY A 1 231 ? -7.814  -8.795  -6.118  1.00 27.64 ? 711  GLY A O   1 
ATOM   1372 N  N   . ASN A 1 232 ? -9.058  -7.727  -7.662  1.00 27.67 ? 712  ASN A N   1 
ATOM   1373 C  CA  . ASN A 1 232 ? -10.031 -8.814  -7.822  1.00 27.60 ? 712  ASN A CA  1 
ATOM   1374 C  C   . ASN A 1 232 ? -9.371  -10.164 -8.098  1.00 27.93 ? 712  ASN A C   1 
ATOM   1375 O  O   . ASN A 1 232 ? -9.828  -11.201 -7.612  1.00 28.17 ? 712  ASN A O   1 
ATOM   1376 C  CB  . ASN A 1 232 ? -11.024 -8.492  -8.940  1.00 27.39 ? 712  ASN A CB  1 
ATOM   1377 C  CG  . ASN A 1 232 ? -10.347 -8.294  -10.284 1.00 26.80 ? 712  ASN A CG  1 
ATOM   1378 O  OD1 . ASN A 1 232 ? -9.678  -7.283  -10.505 1.00 25.48 ? 712  ASN A OD1 1 
ATOM   1379 N  ND2 . ASN A 1 232 ? -10.520 -9.257  -11.189 1.00 25.41 ? 712  ASN A ND2 1 
ATOM   1380 N  N   . GLY A 1 233 ? -8.296  -10.148 -8.877  1.00 28.12 ? 713  GLY A N   1 
ATOM   1381 C  CA  . GLY A 1 233 ? -7.586  -11.374 -9.222  1.00 28.24 ? 713  GLY A CA  1 
ATOM   1382 C  C   . GLY A 1 233 ? -7.035  -12.045 -7.986  1.00 28.12 ? 713  GLY A C   1 
ATOM   1383 O  O   . GLY A 1 233 ? -7.304  -13.215 -7.735  1.00 28.01 ? 713  GLY A O   1 
ATOM   1384 N  N   . THR A 1 234 ? -6.287  -11.276 -7.200  1.00 28.34 ? 714  THR A N   1 
ATOM   1385 C  CA  . THR A 1 234 ? -5.644  -11.776 -5.989  1.00 28.28 ? 714  THR A CA  1 
ATOM   1386 C  C   . THR A 1 234 ? -6.661  -12.302 -4.981  1.00 28.32 ? 714  THR A C   1 
ATOM   1387 O  O   . THR A 1 234 ? -6.453  -13.357 -4.382  1.00 28.40 ? 714  THR A O   1 
ATOM   1388 C  CB  . THR A 1 234 ? -4.784  -10.685 -5.328  1.00 28.29 ? 714  THR A CB  1 
ATOM   1389 O  OG1 . THR A 1 234 ? -3.959  -10.069 -6.322  1.00 28.36 ? 714  THR A OG1 1 
ATOM   1390 C  CG2 . THR A 1 234 ? -3.905  -11.275 -4.235  1.00 27.63 ? 714  THR A CG2 1 
ATOM   1391 N  N   . GLN A 1 235 ? -7.759  -11.574 -4.801  1.00 28.39 ? 715  GLN A N   1 
ATOM   1392 C  CA  . GLN A 1 235 ? -8.821  -12.026 -3.907  1.00 28.43 ? 715  GLN A CA  1 
ATOM   1393 C  C   . GLN A 1 235 ? -9.350  -13.400 -4.321  1.00 28.40 ? 715  GLN A C   1 
ATOM   1394 O  O   . GLN A 1 235 ? -9.511  -14.277 -3.479  1.00 28.59 ? 715  GLN A O   1 
ATOM   1395 C  CB  . GLN A 1 235 ? -9.974  -11.019 -3.852  1.00 28.39 ? 715  GLN A CB  1 
ATOM   1396 C  CG  . GLN A 1 235 ? -11.208 -11.562 -3.132  1.00 28.22 ? 715  GLN A CG  1 
ATOM   1397 C  CD  . GLN A 1 235 ? -12.262 -10.511 -2.886  1.00 28.02 ? 715  GLN A CD  1 
ATOM   1398 O  OE1 . GLN A 1 235 ? -12.017 -9.513  -2.204  1.00 28.20 ? 715  GLN A OE1 1 
ATOM   1399 N  NE2 . GLN A 1 235 ? -13.454 -10.738 -3.421  1.00 27.43 ? 715  GLN A NE2 1 
ATOM   1400 N  N   . GLN A 1 236 ? -9.615  -13.577 -5.612  1.00 28.34 ? 716  GLN A N   1 
ATOM   1401 C  CA  . GLN A 1 236 ? -10.190 -14.824 -6.126  1.00 28.49 ? 716  GLN A CA  1 
ATOM   1402 C  C   . GLN A 1 236 ? -9.267  -16.025 -5.909  1.00 28.03 ? 716  GLN A C   1 
ATOM   1403 O  O   . GLN A 1 236 ? -9.709  -17.077 -5.450  1.00 28.05 ? 716  GLN A O   1 
ATOM   1404 C  CB  . GLN A 1 236 ? -10.504 -14.692 -7.623  1.00 28.63 ? 716  GLN A CB  1 
ATOM   1405 C  CG  . GLN A 1 236 ? -11.266 -15.875 -8.213  1.00 29.57 ? 716  GLN A CG  1 
ATOM   1406 C  CD  . GLN A 1 236 ? -10.957 -16.109 -9.690  1.00 30.77 ? 716  GLN A CD  1 
ATOM   1407 O  OE1 . GLN A 1 236 ? -9.796  -16.246 -10.081 1.00 31.86 ? 716  GLN A OE1 1 
ATOM   1408 N  NE2 . GLN A 1 236 ? -12.001 -16.176 -10.509 1.00 30.91 ? 716  GLN A NE2 1 
ATOM   1409 N  N   . THR A 1 237 ? -7.994  -15.859 -6.253  1.00 27.63 ? 717  THR A N   1 
ATOM   1410 C  CA  . THR A 1 237 ? -7.014  -16.940 -6.180  1.00 27.22 ? 717  THR A CA  1 
ATOM   1411 C  C   . THR A 1 237 ? -6.900  -17.520 -4.776  1.00 27.24 ? 717  THR A C   1 
ATOM   1412 O  O   . THR A 1 237 ? -6.833  -18.743 -4.600  1.00 27.22 ? 717  THR A O   1 
ATOM   1413 C  CB  . THR A 1 237 ? -5.624  -16.449 -6.606  1.00 27.15 ? 717  THR A CB  1 
ATOM   1414 O  OG1 . THR A 1 237 ? -5.721  -15.819 -7.884  1.00 26.87 ? 717  THR A OG1 1 
ATOM   1415 C  CG2 . THR A 1 237 ? -4.632  -17.604 -6.679  1.00 26.30 ? 717  THR A CG2 1 
ATOM   1416 N  N   . PHE A 1 238 ? -6.890  -16.639 -3.781  1.00 26.93 ? 718  PHE A N   1 
ATOM   1417 C  CA  . PHE A 1 238 ? -6.622  -17.047 -2.408  1.00 26.78 ? 718  PHE A CA  1 
ATOM   1418 C  C   . PHE A 1 238 ? -7.872  -17.059 -1.528  1.00 26.53 ? 718  PHE A C   1 
ATOM   1419 O  O   . PHE A 1 238 ? -7.766  -17.144 -0.314  1.00 26.02 ? 718  PHE A O   1 
ATOM   1420 C  CB  . PHE A 1 238 ? -5.539  -16.144 -1.819  1.00 26.63 ? 718  PHE A CB  1 
ATOM   1421 C  CG  . PHE A 1 238 ? -4.269  -16.144 -2.612  1.00 27.23 ? 718  PHE A CG  1 
ATOM   1422 C  CD1 . PHE A 1 238 ? -3.502  -17.297 -2.704  1.00 27.29 ? 718  PHE A CD1 1 
ATOM   1423 C  CD2 . PHE A 1 238 ? -3.840  -14.999 -3.273  1.00 27.16 ? 718  PHE A CD2 1 
ATOM   1424 C  CE1 . PHE A 1 238 ? -2.328  -17.311 -3.446  1.00 28.08 ? 718  PHE A CE1 1 
ATOM   1425 C  CE2 . PHE A 1 238 ? -2.668  -15.004 -4.011  1.00 27.62 ? 718  PHE A CE2 1 
ATOM   1426 C  CZ  . PHE A 1 238 ? -1.910  -16.157 -4.101  1.00 27.82 ? 718  PHE A CZ  1 
ATOM   1427 N  N   . TYR A 1 239 ? -9.053  -17.032 -2.137  1.00 26.74 ? 719  TYR A N   1 
ATOM   1428 C  CA  . TYR A 1 239 ? -10.304 -16.854 -1.386  1.00 27.00 ? 719  TYR A CA  1 
ATOM   1429 C  C   . TYR A 1 239 ? -10.612 -17.962 -0.355  1.00 27.12 ? 719  TYR A C   1 
ATOM   1430 O  O   . TYR A 1 239 ? -11.307 -17.706 0.628   1.00 27.03 ? 719  TYR A O   1 
ATOM   1431 C  CB  . TYR A 1 239 ? -11.494 -16.687 -2.349  1.00 26.90 ? 719  TYR A CB  1 
ATOM   1432 C  CG  . TYR A 1 239 ? -12.624 -15.867 -1.766  1.00 26.73 ? 719  TYR A CG  1 
ATOM   1433 C  CD1 . TYR A 1 239 ? -12.458 -14.506 -1.511  1.00 26.30 ? 719  TYR A CD1 1 
ATOM   1434 C  CD2 . TYR A 1 239 ? -13.855 -16.443 -1.472  1.00 26.35 ? 719  TYR A CD2 1 
ATOM   1435 C  CE1 . TYR A 1 239 ? -13.480 -13.746 -0.973  1.00 25.92 ? 719  TYR A CE1 1 
ATOM   1436 C  CE2 . TYR A 1 239 ? -14.886 -15.687 -0.934  1.00 26.28 ? 719  TYR A CE2 1 
ATOM   1437 C  CZ  . TYR A 1 239 ? -14.690 -14.339 -0.690  1.00 26.07 ? 719  TYR A CZ  1 
ATOM   1438 O  OH  . TYR A 1 239 ? -15.698 -13.583 -0.150  1.00 26.22 ? 719  TYR A OH  1 
ATOM   1439 N  N   . GLN A 1 240 ? -10.085 -19.168 -0.576  1.00 27.29 ? 720  GLN A N   1 
ATOM   1440 C  CA  . GLN A 1 240 ? -10.373 -20.324 0.279   1.00 27.63 ? 720  GLN A CA  1 
ATOM   1441 C  C   . GLN A 1 240 ? -9.140  -20.900 0.980   1.00 27.67 ? 720  GLN A C   1 
ATOM   1442 O  O   . GLN A 1 240 ? -9.198  -22.003 1.543   1.00 27.25 ? 720  GLN A O   1 
ATOM   1443 C  CB  . GLN A 1 240 ? -11.025 -21.422 -0.558  1.00 27.79 ? 720  GLN A CB  1 
ATOM   1444 C  CG  . GLN A 1 240 ? -12.346 -21.019 -1.172  1.00 28.83 ? 720  GLN A CG  1 
ATOM   1445 C  CD  . GLN A 1 240 ? -12.878 -22.058 -2.127  1.00 30.63 ? 720  GLN A CD  1 
ATOM   1446 O  OE1 . GLN A 1 240 ? -13.521 -21.726 -3.123  1.00 32.40 ? 720  GLN A OE1 1 
ATOM   1447 N  NE2 . GLN A 1 240 ? -12.607 -23.327 -1.837  1.00 31.27 ? 720  GLN A NE2 1 
ATOM   1448 N  N   . ASP A 1 241 ? -8.037  -20.151 0.946   1.00 27.64 ? 721  ASP A N   1 
ATOM   1449 C  CA  . ASP A 1 241 ? -6.758  -20.593 1.497   1.00 27.86 ? 721  ASP A CA  1 
ATOM   1450 C  C   . ASP A 1 241 ? -6.426  -19.782 2.753   1.00 27.76 ? 721  ASP A C   1 
ATOM   1451 O  O   . ASP A 1 241 ? -6.107  -18.596 2.651   1.00 28.00 ? 721  ASP A O   1 
ATOM   1452 C  CB  . ASP A 1 241 ? -5.664  -20.413 0.435   1.00 27.99 ? 721  ASP A CB  1 
ATOM   1453 C  CG  . ASP A 1 241 ? -4.296  -20.898 0.894   1.00 28.83 ? 721  ASP A CG  1 
ATOM   1454 O  OD1 . ASP A 1 241 ? -4.177  -21.431 2.019   1.00 29.71 ? 721  ASP A OD1 1 
ATOM   1455 O  OD2 . ASP A 1 241 ? -3.326  -20.740 0.116   1.00 30.36 ? 721  ASP A OD2 1 
ATOM   1456 N  N   . PRO A 1 242 ? -6.485  -20.413 3.942   1.00 27.62 ? 722  PRO A N   1 
ATOM   1457 C  CA  . PRO A 1 242 ? -6.197  -19.670 5.176   1.00 27.48 ? 722  PRO A CA  1 
ATOM   1458 C  C   . PRO A 1 242 ? -4.708  -19.399 5.433   1.00 27.46 ? 722  PRO A C   1 
ATOM   1459 O  O   . PRO A 1 242 ? -4.382  -18.713 6.399   1.00 27.67 ? 722  PRO A O   1 
ATOM   1460 C  CB  . PRO A 1 242 ? -6.768  -20.579 6.271   1.00 27.29 ? 722  PRO A CB  1 
ATOM   1461 C  CG  . PRO A 1 242 ? -6.659  -21.943 5.718   1.00 27.28 ? 722  PRO A CG  1 
ATOM   1462 C  CD  . PRO A 1 242 ? -6.817  -21.825 4.217   1.00 27.39 ? 722  PRO A CD  1 
ATOM   1463 N  N   . SER A 1 243 ? -3.822  -19.937 4.596   1.00 27.45 ? 723  SER A N   1 
ATOM   1464 C  CA  . SER A 1 243 ? -2.380  -19.690 4.718   1.00 27.41 ? 723  SER A CA  1 
ATOM   1465 C  C   . SER A 1 243 ? -1.945  -18.451 3.929   1.00 27.51 ? 723  SER A C   1 
ATOM   1466 O  O   . SER A 1 243 ? -0.759  -18.124 3.872   1.00 27.30 ? 723  SER A O   1 
ATOM   1467 C  CB  . SER A 1 243 ? -1.597  -20.906 4.224   1.00 27.39 ? 723  SER A CB  1 
ATOM   1468 O  OG  . SER A 1 243 ? -1.755  -21.053 2.824   1.00 27.14 ? 723  SER A OG  1 
ATOM   1469 N  N   . VAL A 1 244 ? -2.904  -17.783 3.295   1.00 27.61 ? 724  VAL A N   1 
ATOM   1470 C  CA  . VAL A 1 244 ? -2.651  -16.512 2.639   1.00 27.77 ? 724  VAL A CA  1 
ATOM   1471 C  C   . VAL A 1 244 ? -3.668  -15.499 3.145   1.00 27.90 ? 724  VAL A C   1 
ATOM   1472 O  O   . VAL A 1 244 ? -4.866  -15.754 3.103   1.00 27.89 ? 724  VAL A O   1 
ATOM   1473 C  CB  . VAL A 1 244 ? -2.755  -16.640 1.109   1.00 27.84 ? 724  VAL A CB  1 
ATOM   1474 C  CG1 . VAL A 1 244 ? -2.690  -15.265 0.449   1.00 27.05 ? 724  VAL A CG1 1 
ATOM   1475 C  CG2 . VAL A 1 244 ? -1.655  -17.565 0.583   1.00 27.49 ? 724  VAL A CG2 1 
ATOM   1476 N  N   . LEU A 1 245 ? -3.181  -14.367 3.639   1.00 28.19 ? 725  LEU A N   1 
ATOM   1477 C  CA  . LEU A 1 245 ? -4.034  -13.299 4.137   1.00 28.31 ? 725  LEU A CA  1 
ATOM   1478 C  C   . LEU A 1 245 ? -3.948  -12.160 3.135   1.00 28.56 ? 725  LEU A C   1 
ATOM   1479 O  O   . LEU A 1 245 ? -2.862  -11.625 2.893   1.00 28.62 ? 725  LEU A O   1 
ATOM   1480 C  CB  . LEU A 1 245 ? -3.563  -12.844 5.525   1.00 28.33 ? 725  LEU A CB  1 
ATOM   1481 C  CG  . LEU A 1 245 ? -4.246  -11.622 6.160   1.00 28.49 ? 725  LEU A CG  1 
ATOM   1482 C  CD1 . LEU A 1 245 ? -5.778  -11.750 6.178   1.00 27.68 ? 725  LEU A CD1 1 
ATOM   1483 C  CD2 . LEU A 1 245 ? -3.707  -11.410 7.562   1.00 27.71 ? 725  LEU A CD2 1 
ATOM   1484 N  N   . TYR A 1 246 ? -5.085  -11.822 2.531   1.00 28.74 ? 726  TYR A N   1 
ATOM   1485 C  CA  . TYR A 1 246 ? -5.166  -10.730 1.568   1.00 28.93 ? 726  TYR A CA  1 
ATOM   1486 C  C   . TYR A 1 246 ? -5.865  -9.532  2.199   1.00 29.10 ? 726  TYR A C   1 
ATOM   1487 O  O   . TYR A 1 246 ? -7.009  -9.642  2.637   1.00 28.93 ? 726  TYR A O   1 
ATOM   1488 C  CB  . TYR A 1 246 ? -5.926  -11.164 0.312   1.00 28.83 ? 726  TYR A CB  1 
ATOM   1489 C  CG  . TYR A 1 246 ? -6.045  -10.072 -0.727  1.00 29.27 ? 726  TYR A CG  1 
ATOM   1490 C  CD1 . TYR A 1 246 ? -4.923  -9.614  -1.412  1.00 29.84 ? 726  TYR A CD1 1 
ATOM   1491 C  CD2 . TYR A 1 246 ? -7.270  -9.485  -1.014  1.00 29.86 ? 726  TYR A CD2 1 
ATOM   1492 C  CE1 . TYR A 1 246 ? -5.023  -8.606  -2.361  1.00 30.38 ? 726  TYR A CE1 1 
ATOM   1493 C  CE2 . TYR A 1 246 ? -7.384  -8.482  -1.966  1.00 30.12 ? 726  TYR A CE2 1 
ATOM   1494 C  CZ  . TYR A 1 246 ? -6.260  -8.047  -2.636  1.00 30.54 ? 726  TYR A CZ  1 
ATOM   1495 O  OH  . TYR A 1 246 ? -6.371  -7.049  -3.576  1.00 30.94 ? 726  TYR A OH  1 
ATOM   1496 N  N   . ILE A 1 247 ? -5.171  -8.396  2.242   1.00 29.34 ? 727  ILE A N   1 
ATOM   1497 C  CA  . ILE A 1 247 ? -5.745  -7.161  2.769   1.00 29.74 ? 727  ILE A CA  1 
ATOM   1498 C  C   . ILE A 1 247 ? -5.662  -6.056  1.724   1.00 30.09 ? 727  ILE A C   1 
ATOM   1499 O  O   . ILE A 1 247 ? -4.569  -5.645  1.329   1.00 30.31 ? 727  ILE A O   1 
ATOM   1500 C  CB  . ILE A 1 247 ? -5.032  -6.680  4.047   1.00 29.72 ? 727  ILE A CB  1 
ATOM   1501 C  CG1 . ILE A 1 247 ? -4.966  -7.812  5.084   1.00 29.36 ? 727  ILE A CG1 1 
ATOM   1502 C  CG2 . ILE A 1 247 ? -5.755  -5.458  4.614   1.00 29.34 ? 727  ILE A CG2 1 
ATOM   1503 C  CD1 . ILE A 1 247 ? -4.380  -7.388  6.423   1.00 28.92 ? 727  ILE A CD1 1 
ATOM   1504 N  N   . SER A 1 248 ? -6.823  -5.574  1.289   1.00 30.44 ? 728  SER A N   1 
ATOM   1505 C  CA  . SER A 1 248 ? -6.897  -4.524  0.285   1.00 30.69 ? 728  SER A CA  1 
ATOM   1506 C  C   . SER A 1 248 ? -7.438  -3.226  0.880   1.00 30.70 ? 728  SER A C   1 
ATOM   1507 O  O   . SER A 1 248 ? -8.418  -3.237  1.625   1.00 30.83 ? 728  SER A O   1 
ATOM   1508 C  CB  . SER A 1 248 ? -7.799  -4.975  -0.863  1.00 30.84 ? 728  SER A CB  1 
ATOM   1509 O  OG  . SER A 1 248 ? -7.767  -4.046  -1.937  1.00 31.14 ? 728  SER A OG  1 
ATOM   1510 N  N   . LEU A 1 249 ? -6.781  -2.114  0.566   1.00 30.72 ? 729  LEU A N   1 
ATOM   1511 C  CA  . LEU A 1 249 ? -7.370  -0.789  0.762   1.00 30.79 ? 729  LEU A CA  1 
ATOM   1512 C  C   . LEU A 1 249 ? -7.729  -0.248  -0.614  1.00 30.73 ? 729  LEU A C   1 
ATOM   1513 O  O   . LEU A 1 249 ? -6.851  -0.106  -1.462  1.00 30.82 ? 729  LEU A O   1 
ATOM   1514 C  CB  . LEU A 1 249 ? -6.394  0.161   1.463   1.00 30.77 ? 729  LEU A CB  1 
ATOM   1515 C  CG  . LEU A 1 249 ? -5.905  -0.275  2.846   1.00 30.89 ? 729  LEU A CG  1 
ATOM   1516 C  CD1 . LEU A 1 249 ? -4.783  -1.298  2.727   1.00 30.69 ? 729  LEU A CD1 1 
ATOM   1517 C  CD2 . LEU A 1 249 ? -5.440  0.926   3.638   1.00 31.67 ? 729  LEU A CD2 1 
ATOM   1518 N  N   . HIS A 1 250 ? -9.008  0.021   -0.855  1.00 30.60 ? 730  HIS A N   1 
ATOM   1519 C  CA  . HIS A 1 250 ? -9.434  0.515   -2.161  1.00 30.73 ? 730  HIS A CA  1 
ATOM   1520 C  C   . HIS A 1 250 ? -10.661 1.402   -2.101  1.00 30.79 ? 730  HIS A C   1 
ATOM   1521 O  O   . HIS A 1 250 ? -11.483 1.293   -1.190  1.00 30.57 ? 730  HIS A O   1 
ATOM   1522 C  CB  . HIS A 1 250 ? -9.718  -0.645  -3.122  1.00 30.72 ? 730  HIS A CB  1 
ATOM   1523 C  CG  . HIS A 1 250 ? -10.736 -1.619  -2.619  1.00 30.89 ? 730  HIS A CG  1 
ATOM   1524 N  ND1 . HIS A 1 250 ? -12.061 -1.559  -2.987  1.00 31.42 ? 730  HIS A ND1 1 
ATOM   1525 C  CD2 . HIS A 1 250 ? -10.623 -2.680  -1.785  1.00 30.68 ? 730  HIS A CD2 1 
ATOM   1526 C  CE1 . HIS A 1 250 ? -12.723 -2.538  -2.398  1.00 31.63 ? 730  HIS A CE1 1 
ATOM   1527 N  NE2 . HIS A 1 250 ? -11.873 -3.233  -1.664  1.00 31.42 ? 730  HIS A NE2 1 
ATOM   1528 N  N   . ARG A 1 251 ? -10.770 2.273   -3.100  1.00 30.96 ? 731  ARG A N   1 
ATOM   1529 C  CA  . ARG A 1 251 ? -11.973 3.052   -3.321  1.00 31.32 ? 731  ARG A CA  1 
ATOM   1530 C  C   . ARG A 1 251 ? -13.043 2.100   -3.832  1.00 31.63 ? 731  ARG A C   1 
ATOM   1531 O  O   . ARG A 1 251 ? -12.856 1.474   -4.862  1.00 31.70 ? 731  ARG A O   1 
ATOM   1532 C  CB  . ARG A 1 251 ? -11.709 4.150   -4.351  1.00 31.20 ? 731  ARG A CB  1 
ATOM   1533 C  CG  . ARG A 1 251 ? -12.888 5.061   -4.612  1.00 30.98 ? 731  ARG A CG  1 
ATOM   1534 C  CD  . ARG A 1 251 ? -12.540 6.096   -5.659  1.00 30.98 ? 731  ARG A CD  1 
ATOM   1535 N  NE  . ARG A 1 251 ? -13.711 6.861   -6.082  1.00 30.40 ? 731  ARG A NE  1 
ATOM   1536 C  CZ  . ARG A 1 251 ? -13.721 7.728   -7.090  1.00 29.41 ? 731  ARG A CZ  1 
ATOM   1537 N  NH1 . ARG A 1 251 ? -12.619 7.964   -7.794  1.00 28.69 ? 731  ARG A NH1 1 
ATOM   1538 N  NH2 . ARG A 1 251 ? -14.844 8.367   -7.393  1.00 29.63 ? 731  ARG A NH2 1 
ATOM   1539 N  N   . HIS A 1 252 ? -14.150 1.981   -3.103  1.00 32.18 ? 732  HIS A N   1 
ATOM   1540 C  CA  . HIS A 1 252 ? -15.231 1.075   -3.481  1.00 32.45 ? 732  HIS A CA  1 
ATOM   1541 C  C   . HIS A 1 252 ? -16.452 1.859   -3.947  1.00 32.89 ? 732  HIS A C   1 
ATOM   1542 O  O   . HIS A 1 252 ? -16.994 1.592   -5.020  1.00 32.83 ? 732  HIS A O   1 
ATOM   1543 C  CB  . HIS A 1 252 ? -15.595 0.159   -2.310  1.00 32.47 ? 732  HIS A CB  1 
ATOM   1544 C  CG  . HIS A 1 252 ? -16.426 -1.021  -2.704  1.00 32.45 ? 732  HIS A CG  1 
ATOM   1545 N  ND1 . HIS A 1 252 ? -17.713 -1.211  -2.250  1.00 32.64 ? 732  HIS A ND1 1 
ATOM   1546 C  CD2 . HIS A 1 252 ? -16.160 -2.065  -3.524  1.00 32.82 ? 732  HIS A CD2 1 
ATOM   1547 C  CE1 . HIS A 1 252 ? -18.202 -2.323  -2.767  1.00 32.64 ? 732  HIS A CE1 1 
ATOM   1548 N  NE2 . HIS A 1 252 ? -17.280 -2.860  -3.545  1.00 32.90 ? 732  HIS A NE2 1 
ATOM   1549 N  N   . ASP A 1 253 ? -16.881 2.823   -3.135  1.00 33.37 ? 733  ASP A N   1 
ATOM   1550 C  CA  . ASP A 1 253 ? -18.000 3.695   -3.481  1.00 33.81 ? 733  ASP A CA  1 
ATOM   1551 C  C   . ASP A 1 253 ? -19.221 2.907   -3.969  1.00 33.98 ? 733  ASP A C   1 
ATOM   1552 O  O   . ASP A 1 253 ? -19.765 3.176   -5.048  1.00 34.01 ? 733  ASP A O   1 
ATOM   1553 C  CB  . ASP A 1 253 ? -17.568 4.723   -4.538  1.00 33.92 ? 733  ASP A CB  1 
ATOM   1554 C  CG  . ASP A 1 253 ? -16.549 5.717   -4.008  1.00 34.35 ? 733  ASP A CG  1 
ATOM   1555 O  OD1 . ASP A 1 253 ? -16.202 5.653   -2.805  1.00 34.66 ? 733  ASP A OD1 1 
ATOM   1556 O  OD2 . ASP A 1 253 ? -16.095 6.569   -4.806  1.00 34.63 ? 733  ASP A OD2 1 
ATOM   1557 N  N   . ASP A 1 254 ? -19.633 1.930   -3.164  1.00 34.08 ? 734  ASP A N   1 
ATOM   1558 C  CA  . ASP A 1 254 ? -20.843 1.139   -3.418  1.00 34.13 ? 734  ASP A CA  1 
ATOM   1559 C  C   . ASP A 1 254 ? -20.744 0.287   -4.691  1.00 34.01 ? 734  ASP A C   1 
ATOM   1560 O  O   . ASP A 1 254 ? -21.758 -0.003  -5.328  1.00 33.99 ? 734  ASP A O   1 
ATOM   1561 C  CB  . ASP A 1 254 ? -22.082 2.045   -3.500  1.00 34.22 ? 734  ASP A CB  1 
ATOM   1562 C  CG  . ASP A 1 254 ? -22.055 3.191   -2.493  1.00 34.68 ? 734  ASP A CG  1 
ATOM   1563 O  OD1 . ASP A 1 254 ? -21.304 3.111   -1.494  1.00 34.23 ? 734  ASP A OD1 1 
ATOM   1564 O  OD2 . ASP A 1 254 ? -22.798 4.179   -2.716  1.00 35.10 ? 734  ASP A OD2 1 
ATOM   1565 N  N   . GLY A 1 255 ? -19.526 -0.109  -5.053  1.00 33.93 ? 735  GLY A N   1 
ATOM   1566 C  CA  . GLY A 1 255 ? -19.297 -0.950  -6.229  1.00 33.75 ? 735  GLY A CA  1 
ATOM   1567 C  C   . GLY A 1 255 ? -19.325 -0.209  -7.553  1.00 33.62 ? 735  GLY A C   1 
ATOM   1568 O  O   . GLY A 1 255 ? -19.437 -0.833  -8.607  1.00 33.89 ? 735  GLY A O   1 
ATOM   1569 N  N   . ASN A 1 256 ? -19.211 1.117   -7.508  1.00 33.38 ? 736  ASN A N   1 
ATOM   1570 C  CA  . ASN A 1 256 ? -19.228 1.942   -8.718  1.00 33.17 ? 736  ASN A CA  1 
ATOM   1571 C  C   . ASN A 1 256 ? -17.837 2.462   -9.103  1.00 32.69 ? 736  ASN A C   1 
ATOM   1572 O  O   . ASN A 1 256 ? -17.708 3.527   -9.703  1.00 32.96 ? 736  ASN A O   1 
ATOM   1573 C  CB  . ASN A 1 256 ? -20.196 3.116   -8.531  1.00 33.31 ? 736  ASN A CB  1 
ATOM   1574 C  CG  . ASN A 1 256 ? -21.637 2.665   -8.374  1.00 33.93 ? 736  ASN A CG  1 
ATOM   1575 O  OD1 . ASN A 1 256 ? -22.242 2.834   -7.312  1.00 34.46 ? 736  ASN A OD1 1 
ATOM   1576 N  ND2 . ASN A 1 256 ? -22.196 2.082   -9.435  1.00 34.35 ? 736  ASN A ND2 1 
ATOM   1577 N  N   . PHE A 1 257 ? -16.801 1.707   -8.755  1.00 32.03 ? 737  PHE A N   1 
ATOM   1578 C  CA  . PHE A 1 257 ? -15.428 2.058   -9.104  1.00 31.53 ? 737  PHE A CA  1 
ATOM   1579 C  C   . PHE A 1 257 ? -14.703 0.774   -9.494  1.00 31.09 ? 737  PHE A C   1 
ATOM   1580 O  O   . PHE A 1 257 ? -14.845 -0.240  -8.819  1.00 31.14 ? 737  PHE A O   1 
ATOM   1581 C  CB  . PHE A 1 257 ? -14.738 2.738   -7.916  1.00 31.51 ? 737  PHE A CB  1 
ATOM   1582 C  CG  . PHE A 1 257 ? -13.401 3.348   -8.252  1.00 31.16 ? 737  PHE A CG  1 
ATOM   1583 C  CD1 . PHE A 1 257 ? -13.326 4.546   -8.956  1.00 30.51 ? 737  PHE A CD1 1 
ATOM   1584 C  CD2 . PHE A 1 257 ? -12.221 2.732   -7.857  1.00 30.37 ? 737  PHE A CD2 1 
ATOM   1585 C  CE1 . PHE A 1 257 ? -12.101 5.114   -9.268  1.00 30.00 ? 737  PHE A CE1 1 
ATOM   1586 C  CE2 . PHE A 1 257 ? -10.989 3.294   -8.166  1.00 30.48 ? 737  PHE A CE2 1 
ATOM   1587 C  CZ  . PHE A 1 257 ? -10.930 4.491   -8.870  1.00 30.16 ? 737  PHE A CZ  1 
ATOM   1588 N  N   . PHE A 1 258 ? -13.934 0.815   -10.578 1.00 30.56 ? 738  PHE A N   1 
ATOM   1589 C  CA  . PHE A 1 258 ? -13.323 -0.398  -11.125 1.00 30.29 ? 738  PHE A CA  1 
ATOM   1590 C  C   . PHE A 1 258 ? -12.451 -1.088  -10.077 1.00 30.00 ? 738  PHE A C   1 
ATOM   1591 O  O   . PHE A 1 258 ? -11.716 -0.420  -9.356  1.00 29.86 ? 738  PHE A O   1 
ATOM   1592 C  CB  . PHE A 1 258 ? -12.491 -0.091  -12.382 1.00 30.08 ? 738  PHE A CB  1 
ATOM   1593 C  CG  . PHE A 1 258 ? -12.013 -1.324  -13.109 1.00 29.70 ? 738  PHE A CG  1 
ATOM   1594 C  CD1 . PHE A 1 258 ? -10.843 -1.973  -12.720 1.00 29.09 ? 738  PHE A CD1 1 
ATOM   1595 C  CD2 . PHE A 1 258 ? -12.741 -1.846  -14.173 1.00 29.33 ? 738  PHE A CD2 1 
ATOM   1596 C  CE1 . PHE A 1 258 ? -10.404 -3.119  -13.382 1.00 28.96 ? 738  PHE A CE1 1 
ATOM   1597 C  CE2 . PHE A 1 258 ? -12.310 -2.989  -14.844 1.00 28.65 ? 738  PHE A CE2 1 
ATOM   1598 C  CZ  . PHE A 1 258 ? -11.139 -3.627  -14.446 1.00 28.93 ? 738  PHE A CZ  1 
ATOM   1599 N  N   . PRO A 1 259 ? -12.510 -2.432  -10.002 1.00 29.96 ? 739  PRO A N   1 
ATOM   1600 C  CA  . PRO A 1 259 ? -13.283 -3.370  -10.820 1.00 29.88 ? 739  PRO A CA  1 
ATOM   1601 C  C   . PRO A 1 259 ? -14.744 -3.554  -10.410 1.00 29.73 ? 739  PRO A C   1 
ATOM   1602 O  O   . PRO A 1 259 ? -15.494 -4.187  -11.146 1.00 29.86 ? 739  PRO A O   1 
ATOM   1603 C  CB  . PRO A 1 259 ? -12.517 -4.684  -10.643 1.00 29.91 ? 739  PRO A CB  1 
ATOM   1604 C  CG  . PRO A 1 259 ? -11.932 -4.587  -9.304  1.00 29.96 ? 739  PRO A CG  1 
ATOM   1605 C  CD  . PRO A 1 259 ? -11.587 -3.145  -9.099  1.00 30.05 ? 739  PRO A CD  1 
ATOM   1606 N  N   . GLY A 1 260 ? -15.138 -3.021  -9.257  1.00 29.69 ? 740  GLY A N   1 
ATOM   1607 C  CA  . GLY A 1 260 ? -16.497 -3.198  -8.740  1.00 29.70 ? 740  GLY A CA  1 
ATOM   1608 C  C   . GLY A 1 260 ? -16.595 -4.225  -7.623  1.00 29.82 ? 740  GLY A C   1 
ATOM   1609 O  O   . GLY A 1 260 ? -17.599 -4.283  -6.916  1.00 29.82 ? 740  GLY A O   1 
ATOM   1610 N  N   . SER A 1 261 ? -15.550 -5.035  -7.460  1.00 30.04 ? 741  SER A N   1 
ATOM   1611 C  CA  . SER A 1 261 ? -15.505 -6.057  -6.418  1.00 30.10 ? 741  SER A CA  1 
ATOM   1612 C  C   . SER A 1 261 ? -14.809 -5.523  -5.167  1.00 30.34 ? 741  SER A C   1 
ATOM   1613 O  O   . SER A 1 261 ? -14.289 -4.406  -5.158  1.00 30.44 ? 741  SER A O   1 
ATOM   1614 C  CB  . SER A 1 261 ? -14.752 -7.279  -6.934  1.00 30.09 ? 741  SER A CB  1 
ATOM   1615 O  OG  . SER A 1 261 ? -13.437 -6.920  -7.325  1.00 30.23 ? 741  SER A OG  1 
ATOM   1616 N  N   . GLY A 1 262 ? -14.807 -6.331  -4.111  1.00 30.43 ? 742  GLY A N   1 
ATOM   1617 C  CA  . GLY A 1 262 ? -14.080 -6.007  -2.889  1.00 30.51 ? 742  GLY A CA  1 
ATOM   1618 C  C   . GLY A 1 262 ? -14.918 -5.383  -1.789  1.00 30.45 ? 742  GLY A C   1 
ATOM   1619 O  O   . GLY A 1 262 ? -14.419 -4.563  -1.019  1.00 30.46 ? 742  GLY A O   1 
ATOM   1620 N  N   . ALA A 1 263 ? -16.184 -5.780  -1.700  1.00 30.41 ? 743  ALA A N   1 
ATOM   1621 C  CA  . ALA A 1 263 ? -17.052 -5.316  -0.622  1.00 30.52 ? 743  ALA A CA  1 
ATOM   1622 C  C   . ALA A 1 263 ? -16.556 -5.856  0.716   1.00 30.67 ? 743  ALA A C   1 
ATOM   1623 O  O   . ALA A 1 263 ? -15.963 -6.936  0.778   1.00 30.72 ? 743  ALA A O   1 
ATOM   1624 C  CB  . ALA A 1 263 ? -18.493 -5.747  -0.871  1.00 30.35 ? 743  ALA A CB  1 
ATOM   1625 N  N   . VAL A 1 264 ? -16.801 -5.094  1.779   1.00 30.89 ? 744  VAL A N   1 
ATOM   1626 C  CA  . VAL A 1 264 ? -16.418 -5.483  3.140   1.00 31.10 ? 744  VAL A CA  1 
ATOM   1627 C  C   . VAL A 1 264 ? -16.934 -6.882  3.511   1.00 31.29 ? 744  VAL A C   1 
ATOM   1628 O  O   . VAL A 1 264 ? -16.275 -7.613  4.247   1.00 31.23 ? 744  VAL A O   1 
ATOM   1629 C  CB  . VAL A 1 264 ? -16.938 -4.459  4.187   1.00 31.09 ? 744  VAL A CB  1 
ATOM   1630 C  CG1 . VAL A 1 264 ? -16.591 -4.907  5.593   1.00 31.65 ? 744  VAL A CG1 1 
ATOM   1631 C  CG2 . VAL A 1 264 ? -16.361 -3.079  3.927   1.00 30.96 ? 744  VAL A CG2 1 
ATOM   1632 N  N   . ASP A 1 265 ? -18.108 -7.244  2.993   1.00 31.63 ? 745  ASP A N   1 
ATOM   1633 C  CA  . ASP A 1 265 ? -18.714 -8.558  3.244   1.00 31.92 ? 745  ASP A CA  1 
ATOM   1634 C  C   . ASP A 1 265 ? -17.867 -9.723  2.748   1.00 31.54 ? 745  ASP A C   1 
ATOM   1635 O  O   . ASP A 1 265 ? -17.973 -10.827 3.274   1.00 31.62 ? 745  ASP A O   1 
ATOM   1636 C  CB  . ASP A 1 265 ? -20.071 -8.669  2.550   1.00 32.24 ? 745  ASP A CB  1 
ATOM   1637 C  CG  . ASP A 1 265 ? -21.036 -7.603  2.982   1.00 33.84 ? 745  ASP A CG  1 
ATOM   1638 O  OD1 . ASP A 1 265 ? -20.962 -6.483  2.426   1.00 36.14 ? 745  ASP A OD1 1 
ATOM   1639 O  OD2 . ASP A 1 265 ? -21.866 -7.886  3.874   1.00 35.99 ? 745  ASP A OD2 1 
ATOM   1640 N  N   . GLU A 1 266 ? -17.068 -9.478  1.711   1.00 31.24 ? 746  GLU A N   1 
ATOM   1641 C  CA  . GLU A 1 266 ? -16.250 -10.515 1.078   1.00 30.97 ? 746  GLU A CA  1 
ATOM   1642 C  C   . GLU A 1 266 ? -15.049 -10.887 1.963   1.00 30.52 ? 746  GLU A C   1 
ATOM   1643 O  O   . GLU A 1 266 ? -13.960 -10.308 1.858   1.00 30.20 ? 746  GLU A O   1 
ATOM   1644 C  CB  . GLU A 1 266 ? -15.820 -10.062 -0.328  1.00 31.20 ? 746  GLU A CB  1 
ATOM   1645 C  CG  . GLU A 1 266 ? -17.012 -9.873  -1.290  1.00 31.81 ? 746  GLU A CG  1 
ATOM   1646 C  CD  . GLU A 1 266 ? -16.666 -9.132  -2.580  1.00 32.62 ? 746  GLU A CD  1 
ATOM   1647 O  OE1 . GLU A 1 266 ? -15.491 -9.149  -3.009  1.00 32.41 ? 746  GLU A OE1 1 
ATOM   1648 O  OE2 . GLU A 1 266 ? -17.590 -8.531  -3.175  1.00 33.71 ? 746  GLU A OE2 1 
ATOM   1649 N  N   . VAL A 1 267 ? -15.277 -11.876 2.827   1.00 30.14 ? 747  VAL A N   1 
ATOM   1650 C  CA  . VAL A 1 267 ? -14.338 -12.262 3.883   1.00 29.77 ? 747  VAL A CA  1 
ATOM   1651 C  C   . VAL A 1 267 ? -13.546 -13.542 3.586   1.00 29.59 ? 747  VAL A C   1 
ATOM   1652 O  O   . VAL A 1 267 ? -12.695 -13.938 4.378   1.00 29.82 ? 747  VAL A O   1 
ATOM   1653 C  CB  . VAL A 1 267 ? -15.089 -12.478 5.220   1.00 29.89 ? 747  VAL A CB  1 
ATOM   1654 C  CG1 . VAL A 1 267 ? -15.825 -11.210 5.633   1.00 29.42 ? 747  VAL A CG1 1 
ATOM   1655 C  CG2 . VAL A 1 267 ? -16.058 -13.663 5.122   1.00 29.16 ? 747  VAL A CG2 1 
ATOM   1656 N  N   . GLY A 1 268 ? -13.818 -14.180 2.452   1.00 29.19 ? 748  GLY A N   1 
ATOM   1657 C  CA  . GLY A 1 268 ? -13.252 -15.494 2.146   1.00 28.93 ? 748  GLY A CA  1 
ATOM   1658 C  C   . GLY A 1 268 ? -14.298 -16.576 2.345   1.00 28.76 ? 748  GLY A C   1 
ATOM   1659 O  O   . GLY A 1 268 ? -15.444 -16.288 2.709   1.00 28.71 ? 748  GLY A O   1 
ATOM   1660 N  N   . ALA A 1 269 ? -13.911 -17.826 2.112   1.00 28.40 ? 749  ALA A N   1 
ATOM   1661 C  CA  . ALA A 1 269 ? -14.858 -18.941 2.176   1.00 28.14 ? 749  ALA A CA  1 
ATOM   1662 C  C   . ALA A 1 269 ? -14.160 -20.248 2.510   1.00 27.94 ? 749  ALA A C   1 
ATOM   1663 O  O   . ALA A 1 269 ? -12.962 -20.404 2.272   1.00 27.79 ? 749  ALA A O   1 
ATOM   1664 C  CB  . ALA A 1 269 ? -15.618 -19.068 0.858   1.00 27.98 ? 749  ALA A CB  1 
ATOM   1665 N  N   . GLY A 1 270 ? -14.926 -21.187 3.060   1.00 27.82 ? 750  GLY A N   1 
ATOM   1666 C  CA  . GLY A 1 270 ? -14.394 -22.480 3.469   1.00 27.57 ? 750  GLY A CA  1 
ATOM   1667 C  C   . GLY A 1 270 ? -13.372 -22.301 4.572   1.00 27.44 ? 750  GLY A C   1 
ATOM   1668 O  O   . GLY A 1 270 ? -13.627 -21.610 5.558   1.00 27.30 ? 750  GLY A O   1 
ATOM   1669 N  N   . SER A 1 271 ? -12.205 -22.908 4.395   1.00 27.27 ? 751  SER A N   1 
ATOM   1670 C  CA  . SER A 1 271 ? -11.124 -22.770 5.359   1.00 27.32 ? 751  SER A CA  1 
ATOM   1671 C  C   . SER A 1 271 ? -10.575 -21.336 5.399   1.00 27.12 ? 751  SER A C   1 
ATOM   1672 O  O   . SER A 1 271 ? -10.055 -20.901 6.425   1.00 27.18 ? 751  SER A O   1 
ATOM   1673 C  CB  . SER A 1 271 ? -10.010 -23.777 5.056   1.00 27.40 ? 751  SER A CB  1 
ATOM   1674 O  OG  . SER A 1 271 ? -10.479 -25.108 5.230   1.00 27.81 ? 751  SER A OG  1 
ATOM   1675 N  N   . GLY A 1 272 ? -10.720 -20.603 4.296   1.00 26.86 ? 752  GLY A N   1 
ATOM   1676 C  CA  . GLY A 1 272 ? -10.235 -19.228 4.200   1.00 26.62 ? 752  GLY A CA  1 
ATOM   1677 C  C   . GLY A 1 272 ? -11.155 -18.136 4.731   1.00 26.45 ? 752  GLY A C   1 
ATOM   1678 O  O   . GLY A 1 272 ? -10.870 -16.955 4.544   1.00 26.51 ? 752  GLY A O   1 
ATOM   1679 N  N   . GLU A 1 273 ? -12.250 -18.502 5.395   1.00 26.27 ? 753  GLU A N   1 
ATOM   1680 C  CA  . GLU A 1 273 ? -13.143 -17.495 5.973   1.00 26.18 ? 753  GLU A CA  1 
ATOM   1681 C  C   . GLU A 1 273 ? -12.413 -16.592 6.958   1.00 25.91 ? 753  GLU A C   1 
ATOM   1682 O  O   . GLU A 1 273 ? -11.779 -17.070 7.894   1.00 25.82 ? 753  GLU A O   1 
ATOM   1683 C  CB  . GLU A 1 273 ? -14.333 -18.137 6.684   1.00 26.33 ? 753  GLU A CB  1 
ATOM   1684 C  CG  . GLU A 1 273 ? -15.531 -18.367 5.790   1.00 26.93 ? 753  GLU A CG  1 
ATOM   1685 C  CD  . GLU A 1 273 ? -16.763 -18.770 6.562   1.00 27.71 ? 753  GLU A CD  1 
ATOM   1686 O  OE1 . GLU A 1 273 ? -16.925 -18.319 7.716   1.00 28.13 ? 753  GLU A OE1 1 
ATOM   1687 O  OE2 . GLU A 1 273 ? -17.577 -19.537 6.008   1.00 29.03 ? 753  GLU A OE2 1 
ATOM   1688 N  N   . GLY A 1 274 ? -12.516 -15.286 6.737   1.00 25.68 ? 754  GLY A N   1 
ATOM   1689 C  CA  . GLY A 1 274 ? -11.872 -14.296 7.594   1.00 25.42 ? 754  GLY A CA  1 
ATOM   1690 C  C   . GLY A 1 274 ? -10.480 -13.888 7.146   1.00 25.15 ? 754  GLY A C   1 
ATOM   1691 O  O   . GLY A 1 274 ? -9.939  -12.908 7.645   1.00 25.27 ? 754  GLY A O   1 
ATOM   1692 N  N   . PHE A 1 275 ? -9.890  -14.627 6.210   1.00 24.94 ? 755  PHE A N   1 
ATOM   1693 C  CA  . PHE A 1 275 ? -8.524  -14.338 5.759   1.00 24.86 ? 755  PHE A CA  1 
ATOM   1694 C  C   . PHE A 1 275 ? -8.511  -13.473 4.471   1.00 24.76 ? 755  PHE A C   1 
ATOM   1695 O  O   . PHE A 1 275 ? -7.495  -13.384 3.773   1.00 24.47 ? 755  PHE A O   1 
ATOM   1696 C  CB  . PHE A 1 275 ? -7.735  -15.641 5.569   1.00 24.76 ? 755  PHE A CB  1 
ATOM   1697 C  CG  . PHE A 1 275 ? -7.508  -16.429 6.837   1.00 25.00 ? 755  PHE A CG  1 
ATOM   1698 C  CD1 . PHE A 1 275 ? -6.439  -16.133 7.677   1.00 25.20 ? 755  PHE A CD1 1 
ATOM   1699 C  CD2 . PHE A 1 275 ? -8.340  -17.493 7.171   1.00 24.86 ? 755  PHE A CD2 1 
ATOM   1700 C  CE1 . PHE A 1 275 ? -6.217  -16.869 8.841   1.00 25.08 ? 755  PHE A CE1 1 
ATOM   1701 C  CE2 . PHE A 1 275 ? -8.125  -18.234 8.333   1.00 24.85 ? 755  PHE A CE2 1 
ATOM   1702 C  CZ  . PHE A 1 275 ? -7.062  -17.923 9.167   1.00 24.79 ? 755  PHE A CZ  1 
ATOM   1703 N  N   . ASN A 1 276 ? -9.649  -12.854 4.158   1.00 24.60 ? 756  ASN A N   1 
ATOM   1704 C  CA  . ASN A 1 276 ? -9.733  -11.831 3.121   1.00 24.60 ? 756  ASN A CA  1 
ATOM   1705 C  C   . ASN A 1 276 ? -10.318 -10.554 3.731   1.00 24.36 ? 756  ASN A C   1 
ATOM   1706 O  O   . ASN A 1 276 ? -11.459 -10.554 4.187   1.00 24.29 ? 756  ASN A O   1 
ATOM   1707 C  CB  . ASN A 1 276 ? -10.612 -12.323 1.969   1.00 24.77 ? 756  ASN A CB  1 
ATOM   1708 C  CG  . ASN A 1 276 ? -10.442 -11.501 0.708   1.00 24.99 ? 756  ASN A CG  1 
ATOM   1709 O  OD1 . ASN A 1 276 ? -11.239 -10.599 0.425   1.00 26.50 ? 756  ASN A OD1 1 
ATOM   1710 N  ND2 . ASN A 1 276 ? -9.403  -11.805 -0.056  1.00 24.07 ? 756  ASN A ND2 1 
ATOM   1711 N  N   . VAL A 1 277 ? -9.533  -9.479  3.756   1.00 24.09 ? 757  VAL A N   1 
ATOM   1712 C  CA  . VAL A 1 277 ? -9.938  -8.236  4.414   1.00 23.86 ? 757  VAL A CA  1 
ATOM   1713 C  C   . VAL A 1 277 ? -9.942  -7.072  3.426   1.00 24.06 ? 757  VAL A C   1 
ATOM   1714 O  O   . VAL A 1 277 ? -8.888  -6.617  2.985   1.00 24.25 ? 757  VAL A O   1 
ATOM   1715 C  CB  . VAL A 1 277 ? -9.012  -7.889  5.603   1.00 23.78 ? 757  VAL A CB  1 
ATOM   1716 C  CG1 . VAL A 1 277 ? -9.528  -6.662  6.336   1.00 23.20 ? 757  VAL A CG1 1 
ATOM   1717 C  CG2 . VAL A 1 277 ? -8.888  -9.081  6.562   1.00 23.07 ? 757  VAL A CG2 1 
ATOM   1718 N  N   . ASN A 1 278 ? -11.138 -6.602  3.085   1.00 24.07 ? 758  ASN A N   1 
ATOM   1719 C  CA  . ASN A 1 278 ? -11.312 -5.459  2.205   1.00 24.32 ? 758  ASN A CA  1 
ATOM   1720 C  C   . ASN A 1 278 ? -11.617 -4.204  3.003   1.00 24.40 ? 758  ASN A C   1 
ATOM   1721 O  O   . ASN A 1 278 ? -12.711 -4.056  3.547   1.00 24.33 ? 758  ASN A O   1 
ATOM   1722 C  CB  . ASN A 1 278 ? -12.454 -5.708  1.219   1.00 24.38 ? 758  ASN A CB  1 
ATOM   1723 C  CG  . ASN A 1 278 ? -12.098 -6.724  0.159   1.00 24.81 ? 758  ASN A CG  1 
ATOM   1724 O  OD1 . ASN A 1 278 ? -10.978 -6.736  -0.352  1.00 25.42 ? 758  ASN A OD1 1 
ATOM   1725 N  ND2 . ASN A 1 278 ? -13.055 -7.577  -0.191  1.00 24.90 ? 758  ASN A ND2 1 
ATOM   1726 N  N   . VAL A 1 279 ? -10.639 -3.311  3.092   1.00 24.75 ? 759  VAL A N   1 
ATOM   1727 C  CA  . VAL A 1 279 ? -10.886 -1.969  3.598   1.00 24.88 ? 759  VAL A CA  1 
ATOM   1728 C  C   . VAL A 1 279 ? -11.457 -1.199  2.411   1.00 25.01 ? 759  VAL A C   1 
ATOM   1729 O  O   . VAL A 1 279 ? -10.728 -0.541  1.663   1.00 25.15 ? 759  VAL A O   1 
ATOM   1730 C  CB  . VAL A 1 279 ? -9.609  -1.313  4.157   1.00 24.91 ? 759  VAL A CB  1 
ATOM   1731 C  CG1 . VAL A 1 279 ? -9.923  0.054   4.745   1.00 24.88 ? 759  VAL A CG1 1 
ATOM   1732 C  CG2 . VAL A 1 279 ? -8.975  -2.215  5.214   1.00 25.15 ? 759  VAL A CG2 1 
ATOM   1733 N  N   . ALA A 1 280 ? -12.767 -1.342  2.230   1.00 24.80 ? 760  ALA A N   1 
ATOM   1734 C  CA  . ALA A 1 280 ? -13.475 -0.765  1.104   1.00 24.80 ? 760  ALA A CA  1 
ATOM   1735 C  C   . ALA A 1 280 ? -13.973 0.629   1.467   1.00 24.69 ? 760  ALA A C   1 
ATOM   1736 O  O   . ALA A 1 280 ? -14.992 0.777   2.153   1.00 24.57 ? 760  ALA A O   1 
ATOM   1737 C  CB  . ALA A 1 280 ? -14.643 -1.667  0.704   1.00 24.74 ? 760  ALA A CB  1 
ATOM   1738 N  N   . TRP A 1 281 ? -13.248 1.647   1.011   1.00 24.65 ? 761  TRP A N   1 
ATOM   1739 C  CA  . TRP A 1 281 ? -13.637 3.042   1.257   1.00 24.50 ? 761  TRP A CA  1 
ATOM   1740 C  C   . TRP A 1 281 ? -14.919 3.386   0.519   1.00 24.56 ? 761  TRP A C   1 
ATOM   1741 O  O   . TRP A 1 281 ? -15.031 3.129   -0.678  1.00 24.59 ? 761  TRP A O   1 
ATOM   1742 C  CB  . TRP A 1 281 ? -12.562 4.011   0.777   1.00 24.30 ? 761  TRP A CB  1 
ATOM   1743 C  CG  . TRP A 1 281 ? -11.210 3.832   1.378   1.00 23.23 ? 761  TRP A CG  1 
ATOM   1744 C  CD1 . TRP A 1 281 ? -10.061 3.536   0.713   1.00 22.65 ? 761  TRP A CD1 1 
ATOM   1745 C  CD2 . TRP A 1 281 ? -10.855 3.968   2.757   1.00 22.42 ? 761  TRP A CD2 1 
ATOM   1746 N  NE1 . TRP A 1 281 ? -9.009  3.481   1.588   1.00 23.23 ? 761  TRP A NE1 1 
ATOM   1747 C  CE2 . TRP A 1 281 ? -9.468  3.743   2.852   1.00 22.16 ? 761  TRP A CE2 1 
ATOM   1748 C  CE3 . TRP A 1 281 ? -11.573 4.257   3.922   1.00 22.40 ? 761  TRP A CE3 1 
ATOM   1749 C  CZ2 . TRP A 1 281 ? -8.787  3.792   4.061   1.00 21.24 ? 761  TRP A CZ2 1 
ATOM   1750 C  CZ3 . TRP A 1 281 ? -10.891 4.313   5.125   1.00 21.60 ? 761  TRP A CZ3 1 
ATOM   1751 C  CH2 . TRP A 1 281 ? -9.513  4.080   5.184   1.00 21.62 ? 761  TRP A CH2 1 
ATOM   1752 N  N   . ALA A 1 282 ? -15.873 3.974   1.235   1.00 24.88 ? 762  ALA A N   1 
ATOM   1753 C  CA  . ALA A 1 282 ? -17.106 4.480   0.640   1.00 25.15 ? 762  ALA A CA  1 
ATOM   1754 C  C   . ALA A 1 282 ? -17.225 5.975   0.918   1.00 25.58 ? 762  ALA A C   1 
ATOM   1755 O  O   . ALA A 1 282 ? -16.388 6.546   1.620   1.00 25.67 ? 762  ALA A O   1 
ATOM   1756 C  CB  . ALA A 1 282 ? -18.300 3.741   1.206   1.00 25.03 ? 762  ALA A CB  1 
ATOM   1757 N  N   . GLY A 1 283 ? -18.262 6.600   0.360   1.00 26.06 ? 763  GLY A N   1 
ATOM   1758 C  CA  . GLY A 1 283 ? -18.560 8.013   0.613   1.00 26.27 ? 763  GLY A CA  1 
ATOM   1759 C  C   . GLY A 1 283 ? -18.033 8.976   -0.438  1.00 26.55 ? 763  GLY A C   1 
ATOM   1760 O  O   . GLY A 1 283 ? -18.363 10.162  -0.417  1.00 26.77 ? 763  GLY A O   1 
ATOM   1761 N  N   . GLY A 1 284 ? -17.206 8.479   -1.349  1.00 26.89 ? 764  GLY A N   1 
ATOM   1762 C  CA  . GLY A 1 284 ? -16.690 9.292   -2.439  1.00 27.19 ? 764  GLY A CA  1 
ATOM   1763 C  C   . GLY A 1 284 ? -15.512 10.164  -2.051  1.00 27.52 ? 764  GLY A C   1 
ATOM   1764 O  O   . GLY A 1 284 ? -14.881 9.960   -1.014  1.00 27.49 ? 764  GLY A O   1 
ATOM   1765 N  N   . LEU A 1 285 ? -15.242 11.158  -2.892  1.00 28.05 ? 765  LEU A N   1 
ATOM   1766 C  CA  . LEU A 1 285 ? -14.012 11.948  -2.827  1.00 28.26 ? 765  LEU A CA  1 
ATOM   1767 C  C   . LEU A 1 285 ? -14.072 13.135  -1.861  1.00 28.51 ? 765  LEU A C   1 
ATOM   1768 O  O   . LEU A 1 285 ? -13.038 13.735  -1.568  1.00 28.59 ? 765  LEU A O   1 
ATOM   1769 C  CB  . LEU A 1 285 ? -13.648 12.445  -4.238  1.00 28.25 ? 765  LEU A CB  1 
ATOM   1770 C  CG  . LEU A 1 285 ? -13.368 11.342  -5.272  1.00 28.02 ? 765  LEU A CG  1 
ATOM   1771 C  CD1 . LEU A 1 285 ? -13.231 11.913  -6.671  1.00 27.45 ? 765  LEU A CD1 1 
ATOM   1772 C  CD2 . LEU A 1 285 ? -12.122 10.559  -4.895  1.00 27.57 ? 765  LEU A CD2 1 
ATOM   1773 N  N   . ASP A 1 286 ? -15.266 13.462  -1.365  1.00 28.76 ? 766  ASP A N   1 
ATOM   1774 C  CA  . ASP A 1 286 ? -15.468 14.632  -0.505  1.00 28.99 ? 766  ASP A CA  1 
ATOM   1775 C  C   . ASP A 1 286 ? -16.119 14.210  0.819   1.00 28.99 ? 766  ASP A C   1 
ATOM   1776 O  O   . ASP A 1 286 ? -17.242 13.705  0.810   1.00 29.10 ? 766  ASP A O   1 
ATOM   1777 C  CB  . ASP A 1 286 ? -16.358 15.641  -1.236  1.00 29.14 ? 766  ASP A CB  1 
ATOM   1778 C  CG  . ASP A 1 286 ? -16.450 16.978  -0.524  1.00 29.75 ? 766  ASP A CG  1 
ATOM   1779 O  OD1 . ASP A 1 286 ? -15.562 17.300  0.295   1.00 30.30 ? 766  ASP A OD1 1 
ATOM   1780 O  OD2 . ASP A 1 286 ? -17.419 17.720  -0.799  1.00 31.06 ? 766  ASP A OD2 1 
ATOM   1781 N  N   . PRO A 1 287 ? -15.429 14.418  1.965   1.00 28.99 ? 767  PRO A N   1 
ATOM   1782 C  CA  . PRO A 1 287 ? -14.110 15.038  2.184   1.00 28.93 ? 767  PRO A CA  1 
ATOM   1783 C  C   . PRO A 1 287 ? -12.934 14.241  1.603   1.00 28.94 ? 767  PRO A C   1 
ATOM   1784 O  O   . PRO A 1 287 ? -13.082 13.052  1.311   1.00 28.75 ? 767  PRO A O   1 
ATOM   1785 C  CB  . PRO A 1 287 ? -13.994 15.097  3.713   1.00 28.86 ? 767  PRO A CB  1 
ATOM   1786 C  CG  . PRO A 1 287 ? -15.359 14.860  4.229   1.00 28.98 ? 767  PRO A CG  1 
ATOM   1787 C  CD  . PRO A 1 287 ? -16.029 13.989  3.239   1.00 28.92 ? 767  PRO A CD  1 
ATOM   1788 N  N   . PRO A 1 288 ? -11.766 14.895  1.439   1.00 28.99 ? 768  PRO A N   1 
ATOM   1789 C  CA  . PRO A 1 288 ? -10.618 14.254  0.792   1.00 28.99 ? 768  PRO A CA  1 
ATOM   1790 C  C   . PRO A 1 288 ? -10.139 12.990  1.502   1.00 28.97 ? 768  PRO A C   1 
ATOM   1791 O  O   . PRO A 1 288 ? -10.171 12.917  2.731   1.00 29.19 ? 768  PRO A O   1 
ATOM   1792 C  CB  . PRO A 1 288 ? -9.531  15.341  0.829   1.00 29.03 ? 768  PRO A CB  1 
ATOM   1793 C  CG  . PRO A 1 288 ? -9.980  16.320  1.854   1.00 28.93 ? 768  PRO A CG  1 
ATOM   1794 C  CD  . PRO A 1 288 ? -11.468 16.288  1.820   1.00 28.88 ? 768  PRO A CD  1 
ATOM   1795 N  N   . MET A 1 289 ? -9.716  12.009  0.714   1.00 28.96 ? 769  MET A N   1 
ATOM   1796 C  CA  . MET A 1 289 ? -9.148  10.768  1.225   1.00 29.13 ? 769  MET A CA  1 
ATOM   1797 C  C   . MET A 1 289 ? -7.639  10.827  1.049   1.00 28.80 ? 769  MET A C   1 
ATOM   1798 O  O   . MET A 1 289 ? -7.150  11.008  -0.069  1.00 28.63 ? 769  MET A O   1 
ATOM   1799 C  CB  . MET A 1 289 ? -9.708  9.563   0.459   1.00 29.34 ? 769  MET A CB  1 
ATOM   1800 C  CG  . MET A 1 289 ? -11.178 9.259   0.736   1.00 30.40 ? 769  MET A CG  1 
ATOM   1801 S  SD  . MET A 1 289 ? -11.488 8.673   2.423   1.00 33.08 ? 769  MET A SD  1 
ATOM   1802 C  CE  . MET A 1 289 ? -13.038 7.790   2.207   1.00 32.41 ? 769  MET A CE  1 
ATOM   1803 N  N   . GLY A 1 290 ? -6.905  10.670  2.147   1.00 28.49 ? 770  GLY A N   1 
ATOM   1804 C  CA  . GLY A 1 290 ? -5.452  10.761  2.107   1.00 28.47 ? 770  GLY A CA  1 
ATOM   1805 C  C   . GLY A 1 290 ? -4.773  10.145  3.314   1.00 28.51 ? 770  GLY A C   1 
ATOM   1806 O  O   . GLY A 1 290 ? -5.202  9.105   3.816   1.00 28.50 ? 770  GLY A O   1 
ATOM   1807 N  N   . ASP A 1 291 ? -3.717  10.800  3.787   1.00 28.50 ? 771  ASP A N   1 
ATOM   1808 C  CA  . ASP A 1 291 ? -2.856  10.239  4.829   1.00 28.51 ? 771  ASP A CA  1 
ATOM   1809 C  C   . ASP A 1 291 ? -3.584  9.907   6.134   1.00 28.45 ? 771  ASP A C   1 
ATOM   1810 O  O   . ASP A 1 291 ? -3.423  8.811   6.655   1.00 28.83 ? 771  ASP A O   1 
ATOM   1811 C  CB  . ASP A 1 291 ? -1.664  11.164  5.101   1.00 28.43 ? 771  ASP A CB  1 
ATOM   1812 C  CG  . ASP A 1 291 ? -0.725  11.273  3.913   1.00 28.52 ? 771  ASP A CG  1 
ATOM   1813 O  OD1 . ASP A 1 291 ? -1.013  10.680  2.852   1.00 28.42 ? 771  ASP A OD1 1 
ATOM   1814 O  OD2 . ASP A 1 291 ? 0.311   11.955  4.039   1.00 28.66 ? 771  ASP A OD2 1 
ATOM   1815 N  N   . PRO A 1 292 ? -4.401  10.834  6.661   1.00 28.37 ? 772  PRO A N   1 
ATOM   1816 C  CA  . PRO A 1 292 ? -5.052  10.524  7.938   1.00 28.30 ? 772  PRO A CA  1 
ATOM   1817 C  C   . PRO A 1 292 ? -5.852  9.227   7.896   1.00 28.27 ? 772  PRO A C   1 
ATOM   1818 O  O   . PRO A 1 292 ? -5.856  8.469   8.865   1.00 28.33 ? 772  PRO A O   1 
ATOM   1819 C  CB  . PRO A 1 292 ? -5.987  11.722  8.160   1.00 28.28 ? 772  PRO A CB  1 
ATOM   1820 C  CG  . PRO A 1 292 ? -5.378  12.829  7.379   1.00 28.31 ? 772  PRO A CG  1 
ATOM   1821 C  CD  . PRO A 1 292 ? -4.783  12.166  6.161   1.00 28.46 ? 772  PRO A CD  1 
ATOM   1822 N  N   . GLU A 1 293 ? -6.494  8.972   6.761   1.00 28.20 ? 773  GLU A N   1 
ATOM   1823 C  CA  . GLU A 1 293 ? -7.378  7.826   6.601   1.00 28.14 ? 773  GLU A CA  1 
ATOM   1824 C  C   . GLU A 1 293 ? -6.585  6.537   6.416   1.00 28.06 ? 773  GLU A C   1 
ATOM   1825 O  O   . GLU A 1 293 ? -6.943  5.496   6.972   1.00 28.00 ? 773  GLU A O   1 
ATOM   1826 C  CB  . GLU A 1 293 ? -8.312  8.037   5.405   1.00 28.11 ? 773  GLU A CB  1 
ATOM   1827 C  CG  . GLU A 1 293 ? -9.314  9.189   5.577   1.00 28.42 ? 773  GLU A CG  1 
ATOM   1828 C  CD  . GLU A 1 293 ? -8.671  10.570  5.605   1.00 28.44 ? 773  GLU A CD  1 
ATOM   1829 O  OE1 . GLU A 1 293 ? -7.676  10.787  4.884   1.00 28.78 ? 773  GLU A OE1 1 
ATOM   1830 O  OE2 . GLU A 1 293 ? -9.161  11.437  6.356   1.00 28.15 ? 773  GLU A OE2 1 
ATOM   1831 N  N   . TYR A 1 294 ? -5.517  6.611   5.623   1.00 27.98 ? 774  TYR A N   1 
ATOM   1832 C  CA  . TYR A 1 294 ? -4.678  5.446   5.342   1.00 27.82 ? 774  TYR A CA  1 
ATOM   1833 C  C   . TYR A 1 294 ? -3.831  5.066   6.557   1.00 27.69 ? 774  TYR A C   1 
ATOM   1834 O  O   . TYR A 1 294 ? -3.668  3.887   6.852   1.00 27.72 ? 774  TYR A O   1 
ATOM   1835 C  CB  . TYR A 1 294 ? -3.813  5.678   4.092   1.00 27.80 ? 774  TYR A CB  1 
ATOM   1836 C  CG  . TYR A 1 294 ? -4.525  5.260   2.825   1.00 27.91 ? 774  TYR A CG  1 
ATOM   1837 C  CD1 . TYR A 1 294 ? -5.626  5.971   2.358   1.00 27.54 ? 774  TYR A CD1 1 
ATOM   1838 C  CD2 . TYR A 1 294 ? -4.125  4.129   2.114   1.00 27.67 ? 774  TYR A CD2 1 
ATOM   1839 C  CE1 . TYR A 1 294 ? -6.303  5.578   1.209   1.00 27.12 ? 774  TYR A CE1 1 
ATOM   1840 C  CE2 . TYR A 1 294 ? -4.794  3.733   0.957   1.00 27.27 ? 774  TYR A CE2 1 
ATOM   1841 C  CZ  . TYR A 1 294 ? -5.881  4.460   0.515   1.00 27.34 ? 774  TYR A CZ  1 
ATOM   1842 O  OH  . TYR A 1 294 ? -6.553  4.072   -0.622  1.00 27.47 ? 774  TYR A OH  1 
ATOM   1843 N  N   . LEU A 1 295 ? -3.308  6.064   7.264   1.00 27.55 ? 775  LEU A N   1 
ATOM   1844 C  CA  . LEU A 1 295 ? -2.631  5.828   8.539   1.00 27.34 ? 775  LEU A CA  1 
ATOM   1845 C  C   . LEU A 1 295 ? -3.595  5.198   9.549   1.00 27.19 ? 775  LEU A C   1 
ATOM   1846 O  O   . LEU A 1 295 ? -3.238  4.247   10.242  1.00 27.06 ? 775  LEU A O   1 
ATOM   1847 C  CB  . LEU A 1 295 ? -2.067  7.136   9.100   1.00 27.37 ? 775  LEU A CB  1 
ATOM   1848 C  CG  . LEU A 1 295 ? -0.916  7.759   8.307   1.00 27.32 ? 775  LEU A CG  1 
ATOM   1849 C  CD1 . LEU A 1 295 ? -0.612  9.172   8.800   1.00 27.17 ? 775  LEU A CD1 1 
ATOM   1850 C  CD2 . LEU A 1 295 ? 0.311   6.882   8.395   1.00 27.17 ? 775  LEU A CD2 1 
ATOM   1851 N  N   . ALA A 1 296 ? -4.815  5.729   9.619   1.00 27.01 ? 776  ALA A N   1 
ATOM   1852 C  CA  . ALA A 1 296 ? -5.858  5.163   10.478  1.00 26.99 ? 776  ALA A CA  1 
ATOM   1853 C  C   . ALA A 1 296 ? -6.143  3.702   10.124  1.00 26.97 ? 776  ALA A C   1 
ATOM   1854 O  O   . ALA A 1 296 ? -6.283  2.854   11.005  1.00 26.82 ? 776  ALA A O   1 
ATOM   1855 C  CB  . ALA A 1 296 ? -7.132  5.987   10.379  1.00 26.88 ? 776  ALA A CB  1 
ATOM   1856 N  N   . ALA A 1 297 ? -6.223  3.418   8.828   1.00 27.12 ? 777  ALA A N   1 
ATOM   1857 C  CA  . ALA A 1 297 ? -6.454  2.062   8.345   1.00 27.24 ? 777  ALA A CA  1 
ATOM   1858 C  C   . ALA A 1 297 ? -5.339  1.128   8.803   1.00 27.35 ? 777  ALA A C   1 
ATOM   1859 O  O   . ALA A 1 297 ? -5.596  -0.020  9.178   1.00 27.61 ? 777  ALA A O   1 
ATOM   1860 C  CB  . ALA A 1 297 ? -6.565  2.052   6.833   1.00 27.29 ? 777  ALA A CB  1 
ATOM   1861 N  N   . PHE A 1 298 ? -4.107  1.624   8.790   1.00 27.25 ? 778  PHE A N   1 
ATOM   1862 C  CA  . PHE A 1 298 ? -2.972  0.817   9.217   1.00 27.26 ? 778  PHE A CA  1 
ATOM   1863 C  C   . PHE A 1 298 ? -2.955  0.583   10.728  1.00 27.23 ? 778  PHE A C   1 
ATOM   1864 O  O   . PHE A 1 298 ? -2.739  -0.545  11.163  1.00 27.35 ? 778  PHE A O   1 
ATOM   1865 C  CB  . PHE A 1 298 ? -1.645  1.401   8.705   1.00 27.33 ? 778  PHE A CB  1 
ATOM   1866 C  CG  . PHE A 1 298 ? -1.141  0.728   7.445   1.00 27.04 ? 778  PHE A CG  1 
ATOM   1867 C  CD1 . PHE A 1 298 ? -1.913  0.716   6.293   1.00 26.78 ? 778  PHE A CD1 1 
ATOM   1868 C  CD2 . PHE A 1 298 ? 0.091   0.094   7.421   1.00 26.23 ? 778  PHE A CD2 1 
ATOM   1869 C  CE1 . PHE A 1 298 ? -1.461  0.086   5.142   1.00 26.20 ? 778  PHE A CE1 1 
ATOM   1870 C  CE2 . PHE A 1 298 ? 0.547   -0.531  6.272   1.00 25.59 ? 778  PHE A CE2 1 
ATOM   1871 C  CZ  . PHE A 1 298 ? -0.225  -0.536  5.136   1.00 25.52 ? 778  PHE A CZ  1 
ATOM   1872 N  N   . ARG A 1 299 ? -3.201  1.629   11.517  1.00 27.18 ? 779  ARG A N   1 
ATOM   1873 C  CA  . ARG A 1 299 ? -3.256  1.500   12.977  1.00 27.07 ? 779  ARG A CA  1 
ATOM   1874 C  C   . ARG A 1 299 ? -4.322  0.515   13.425  1.00 27.14 ? 779  ARG A C   1 
ATOM   1875 O  O   . ARG A 1 299 ? -4.082  -0.305  14.310  1.00 27.65 ? 779  ARG A O   1 
ATOM   1876 C  CB  . ARG A 1 299 ? -3.549  2.846   13.653  1.00 27.06 ? 779  ARG A CB  1 
ATOM   1877 C  CG  . ARG A 1 299 ? -2.329  3.712   13.917  1.00 26.97 ? 779  ARG A CG  1 
ATOM   1878 C  CD  . ARG A 1 299 ? -2.626  4.809   14.940  1.00 26.59 ? 779  ARG A CD  1 
ATOM   1879 N  NE  . ARG A 1 299 ? -3.889  5.505   14.680  1.00 26.66 ? 779  ARG A NE  1 
ATOM   1880 C  CZ  . ARG A 1 299 ? -4.083  6.420   13.727  1.00 26.69 ? 779  ARG A CZ  1 
ATOM   1881 N  NH1 . ARG A 1 299 ? -3.104  6.777   12.903  1.00 27.11 ? 779  ARG A NH1 1 
ATOM   1882 N  NH2 . ARG A 1 299 ? -5.278  6.980   13.587  1.00 26.63 ? 779  ARG A NH2 1 
ATOM   1883 N  N   . ILE A 1 300 ? -5.496  0.605   12.809  1.00 27.02 ? 780  ILE A N   1 
ATOM   1884 C  CA  . ILE A 1 300 ? -6.700  -0.044  13.322  1.00 26.95 ? 780  ILE A CA  1 
ATOM   1885 C  C   . ILE A 1 300 ? -6.966  -1.403  12.688  1.00 27.02 ? 780  ILE A C   1 
ATOM   1886 O  O   . ILE A 1 300 ? -7.368  -2.335  13.384  1.00 27.14 ? 780  ILE A O   1 
ATOM   1887 C  CB  . ILE A 1 300 ? -7.939  0.859   13.121  1.00 26.85 ? 780  ILE A CB  1 
ATOM   1888 C  CG1 . ILE A 1 300 ? -7.832  2.103   14.008  1.00 26.85 ? 780  ILE A CG1 1 
ATOM   1889 C  CG2 . ILE A 1 300 ? -9.219  0.098   13.429  1.00 26.70 ? 780  ILE A CG2 1 
ATOM   1890 C  CD1 . ILE A 1 300 ? -8.769  3.232   13.599  1.00 26.51 ? 780  ILE A CD1 1 
ATOM   1891 N  N   . VAL A 1 301 ? -6.751  -1.521  11.379  1.00 26.94 ? 781  VAL A N   1 
ATOM   1892 C  CA  . VAL A 1 301 ? -7.069  -2.761  10.676  1.00 27.00 ? 781  VAL A CA  1 
ATOM   1893 C  C   . VAL A 1 301 ? -5.837  -3.559  10.238  1.00 27.23 ? 781  VAL A C   1 
ATOM   1894 O  O   . VAL A 1 301 ? -5.633  -4.675  10.708  1.00 27.30 ? 781  VAL A O   1 
ATOM   1895 C  CB  . VAL A 1 301 ? -7.973  -2.499  9.461   1.00 26.88 ? 781  VAL A CB  1 
ATOM   1896 C  CG1 . VAL A 1 301 ? -8.236  -3.792  8.706   1.00 26.27 ? 781  VAL A CG1 1 
ATOM   1897 C  CG2 . VAL A 1 301 ? -9.278  -1.873  9.916   1.00 26.61 ? 781  VAL A CG2 1 
ATOM   1898 N  N   . VAL A 1 302 ? -5.020  -2.983  9.361   1.00 27.50 ? 782  VAL A N   1 
ATOM   1899 C  CA  . VAL A 1 302 ? -3.972  -3.741  8.662   1.00 27.72 ? 782  VAL A CA  1 
ATOM   1900 C  C   . VAL A 1 302 ? -2.949  -4.365  9.602   1.00 27.96 ? 782  VAL A C   1 
ATOM   1901 O  O   . VAL A 1 302 ? -2.743  -5.577  9.572   1.00 27.87 ? 782  VAL A O   1 
ATOM   1902 C  CB  . VAL A 1 302 ? -3.215  -2.873  7.622   1.00 27.86 ? 782  VAL A CB  1 
ATOM   1903 C  CG1 . VAL A 1 302 ? -2.098  -3.673  6.963   1.00 27.22 ? 782  VAL A CG1 1 
ATOM   1904 C  CG2 . VAL A 1 302 ? -4.176  -2.328  6.572   1.00 27.82 ? 782  VAL A CG2 1 
ATOM   1905 N  N   . MET A 1 303 ? -2.319  -3.541  10.434  1.00 28.35 ? 783  MET A N   1 
ATOM   1906 C  CA  . MET A 1 303 ? -1.257  -4.020  11.323  1.00 28.77 ? 783  MET A CA  1 
ATOM   1907 C  C   . MET A 1 303 ? -1.738  -4.978  12.417  1.00 28.94 ? 783  MET A C   1 
ATOM   1908 O  O   . MET A 1 303 ? -1.134  -6.033  12.609  1.00 29.29 ? 783  MET A O   1 
ATOM   1909 C  CB  . MET A 1 303 ? -0.483  -2.848  11.943  1.00 28.87 ? 783  MET A CB  1 
ATOM   1910 C  CG  . MET A 1 303 ? 0.307   -2.016  10.934  1.00 29.43 ? 783  MET A CG  1 
ATOM   1911 S  SD  . MET A 1 303 ? 1.469   -2.982  9.941   1.00 30.45 ? 783  MET A SD  1 
ATOM   1912 C  CE  . MET A 1 303 ? 2.550   -3.623  11.222  1.00 30.28 ? 783  MET A CE  1 
ATOM   1913 N  N   . PRO A 1 304 ? -2.812  -4.629  13.145  1.00 29.16 ? 784  PRO A N   1 
ATOM   1914 C  CA  . PRO A 1 304 ? -3.252  -5.601  14.154  1.00 29.09 ? 784  PRO A CA  1 
ATOM   1915 C  C   . PRO A 1 304 ? -3.618  -6.969  13.566  1.00 29.07 ? 784  PRO A C   1 
ATOM   1916 O  O   . PRO A 1 304 ? -3.215  -7.990  14.119  1.00 29.24 ? 784  PRO A O   1 
ATOM   1917 C  CB  . PRO A 1 304 ? -4.469  -4.924  14.792  1.00 29.08 ? 784  PRO A CB  1 
ATOM   1918 C  CG  . PRO A 1 304 ? -4.231  -3.468  14.593  1.00 29.08 ? 784  PRO A CG  1 
ATOM   1919 C  CD  . PRO A 1 304 ? -3.555  -3.357  13.252  1.00 29.26 ? 784  PRO A CD  1 
ATOM   1920 N  N   . ILE A 1 305 ? -4.351  -7.000  12.456  1.00 29.09 ? 785  ILE A N   1 
ATOM   1921 C  CA  . ILE A 1 305 ? -4.695  -8.283  11.824  1.00 29.17 ? 785  ILE A CA  1 
ATOM   1922 C  C   . ILE A 1 305 ? -3.436  -9.002  11.319  1.00 29.33 ? 785  ILE A C   1 
ATOM   1923 O  O   . ILE A 1 305 ? -3.280  -10.206 11.519  1.00 29.52 ? 785  ILE A O   1 
ATOM   1924 C  CB  . ILE A 1 305 ? -5.714  -8.131  10.673  1.00 28.99 ? 785  ILE A CB  1 
ATOM   1925 C  CG1 . ILE A 1 305 ? -7.047  -7.602  11.199  1.00 29.09 ? 785  ILE A CG1 1 
ATOM   1926 C  CG2 . ILE A 1 305 ? -5.960  -9.474  9.993   1.00 28.78 ? 785  ILE A CG2 1 
ATOM   1927 C  CD1 . ILE A 1 305 ? -8.104  -7.423  10.120  1.00 28.70 ? 785  ILE A CD1 1 
ATOM   1928 N  N   . ALA A 1 306 ? -2.543  -8.259  10.673  1.00 29.54 ? 786  ALA A N   1 
ATOM   1929 C  CA  . ALA A 1 306 ? -1.282  -8.810  10.184  1.00 29.61 ? 786  ALA A CA  1 
ATOM   1930 C  C   . ALA A 1 306 ? -0.474  -9.448  11.314  1.00 29.64 ? 786  ALA A C   1 
ATOM   1931 O  O   . ALA A 1 306 ? 0.061   -10.547 11.161  1.00 29.37 ? 786  ALA A O   1 
ATOM   1932 C  CB  . ALA A 1 306 ? -0.466  -7.730  9.502   1.00 29.60 ? 786  ALA A CB  1 
ATOM   1933 N  N   . ARG A 1 307 ? -0.398  -8.757  12.447  1.00 29.87 ? 787  ARG A N   1 
ATOM   1934 C  CA  . ARG A 1 307 ? 0.313   -9.275  13.619  1.00 30.10 ? 787  ARG A CA  1 
ATOM   1935 C  C   . ARG A 1 307 ? -0.353  -10.519 14.209  1.00 29.85 ? 787  ARG A C   1 
ATOM   1936 O  O   . ARG A 1 307 ? 0.331   -11.438 14.656  1.00 29.93 ? 787  ARG A O   1 
ATOM   1937 C  CB  . ARG A 1 307 ? 0.437   -8.199  14.697  1.00 30.26 ? 787  ARG A CB  1 
ATOM   1938 C  CG  . ARG A 1 307 ? 1.429   -7.100  14.359  1.00 31.54 ? 787  ARG A CG  1 
ATOM   1939 C  CD  . ARG A 1 307 ? 1.649   -6.176  15.541  1.00 32.87 ? 787  ARG A CD  1 
ATOM   1940 N  NE  . ARG A 1 307 ? 1.952   -4.811  15.116  1.00 34.36 ? 787  ARG A NE  1 
ATOM   1941 C  CZ  . ARG A 1 307 ? 3.145   -4.378  14.701  1.00 35.17 ? 787  ARG A CZ  1 
ATOM   1942 N  NH1 . ARG A 1 307 ? 4.197   -5.193  14.638  1.00 35.07 ? 787  ARG A NH1 1 
ATOM   1943 N  NH2 . ARG A 1 307 ? 3.286   -3.107  14.345  1.00 35.84 ? 787  ARG A NH2 1 
ATOM   1944 N  N   . GLU A 1 308 ? -1.680  -10.540 14.218  1.00 29.68 ? 788  GLU A N   1 
ATOM   1945 C  CA  . GLU A 1 308 ? -2.421  -11.705 14.693  1.00 29.65 ? 788  GLU A CA  1 
ATOM   1946 C  C   . GLU A 1 308 ? -2.208  -12.891 13.742  1.00 29.31 ? 788  GLU A C   1 
ATOM   1947 O  O   . GLU A 1 308 ? -2.102  -14.032 14.186  1.00 29.16 ? 788  GLU A O   1 
ATOM   1948 C  CB  . GLU A 1 308 ? -3.913  -11.375 14.852  1.00 29.77 ? 788  GLU A CB  1 
ATOM   1949 C  CG  . GLU A 1 308 ? -4.685  -12.381 15.699  1.00 30.81 ? 788  GLU A CG  1 
ATOM   1950 C  CD  . GLU A 1 308 ? -6.059  -11.887 16.156  1.00 32.48 ? 788  GLU A CD  1 
ATOM   1951 O  OE1 . GLU A 1 308 ? -6.204  -10.686 16.470  1.00 33.40 ? 788  GLU A OE1 1 
ATOM   1952 O  OE2 . GLU A 1 308 ? -6.997  -12.717 16.223  1.00 33.77 ? 788  GLU A OE2 1 
ATOM   1953 N  N   . PHE A 1 309 ? -2.127  -12.607 12.443  1.00 28.94 ? 789  PHE A N   1 
ATOM   1954 C  CA  . PHE A 1 309 ? -1.822  -13.622 11.426  1.00 28.70 ? 789  PHE A CA  1 
ATOM   1955 C  C   . PHE A 1 309 ? -0.373  -14.098 11.535  1.00 28.68 ? 789  PHE A C   1 
ATOM   1956 O  O   . PHE A 1 309 ? -0.100  -15.293 11.462  1.00 28.40 ? 789  PHE A O   1 
ATOM   1957 C  CB  . PHE A 1 309 ? -2.078  -13.054 10.026  1.00 28.63 ? 789  PHE A CB  1 
ATOM   1958 C  CG  . PHE A 1 309 ? -1.883  -14.049 8.910   1.00 27.90 ? 789  PHE A CG  1 
ATOM   1959 C  CD1 . PHE A 1 309 ? -2.725  -15.153 8.789   1.00 26.83 ? 789  PHE A CD1 1 
ATOM   1960 C  CD2 . PHE A 1 309 ? -0.878  -13.865 7.960   1.00 27.20 ? 789  PHE A CD2 1 
ATOM   1961 C  CE1 . PHE A 1 309 ? -2.559  -16.068 7.751   1.00 26.44 ? 789  PHE A CE1 1 
ATOM   1962 C  CE2 . PHE A 1 309 ? -0.705  -14.775 6.915   1.00 26.72 ? 789  PHE A CE2 1 
ATOM   1963 C  CZ  . PHE A 1 309 ? -1.546  -15.882 6.812   1.00 26.57 ? 789  PHE A CZ  1 
ATOM   1964 N  N   . SER A 1 310 ? 0.546   -13.145 11.686  1.00 28.86 ? 790  SER A N   1 
ATOM   1965 C  CA  . SER A 1 310 ? 1.969   -13.435 11.904  1.00 28.92 ? 790  SER A CA  1 
ATOM   1966 C  C   . SER A 1 310 ? 2.602   -14.187 10.717  1.00 28.89 ? 790  SER A C   1 
ATOM   1967 O  O   . SER A 1 310 ? 2.906   -15.376 10.815  1.00 28.86 ? 790  SER A O   1 
ATOM   1968 C  CB  . SER A 1 310 ? 2.144   -14.209 13.213  1.00 28.77 ? 790  SER A CB  1 
ATOM   1969 O  OG  . SER A 1 310 ? 3.485   -14.167 13.645  1.00 29.41 ? 790  SER A OG  1 
ATOM   1970 N  N   . PRO A 1 311 ? 2.791   -13.490 9.584   1.00 28.92 ? 791  PRO A N   1 
ATOM   1971 C  CA  . PRO A 1 311 ? 3.317   -14.116 8.368   1.00 28.87 ? 791  PRO A CA  1 
ATOM   1972 C  C   . PRO A 1 311 ? 4.835   -14.294 8.360   1.00 28.84 ? 791  PRO A C   1 
ATOM   1973 O  O   . PRO A 1 311 ? 5.545   -13.632 9.112   1.00 28.71 ? 791  PRO A O   1 
ATOM   1974 C  CB  . PRO A 1 311 ? 2.899   -13.135 7.272   1.00 28.79 ? 791  PRO A CB  1 
ATOM   1975 C  CG  . PRO A 1 311 ? 2.895   -11.819 7.950   1.00 28.90 ? 791  PRO A CG  1 
ATOM   1976 C  CD  . PRO A 1 311 ? 2.404   -12.086 9.348   1.00 28.90 ? 791  PRO A CD  1 
ATOM   1977 N  N   . ASP A 1 312 ? 5.309   -15.188 7.497   1.00 28.98 ? 792  ASP A N   1 
ATOM   1978 C  CA  . ASP A 1 312 ? 6.743   -15.417 7.289   1.00 29.25 ? 792  ASP A CA  1 
ATOM   1979 C  C   . ASP A 1 312 ? 7.285   -14.545 6.159   1.00 28.79 ? 792  ASP A C   1 
ATOM   1980 O  O   . ASP A 1 312 ? 8.490   -14.355 6.052   1.00 28.21 ? 792  ASP A O   1 
ATOM   1981 C  CB  . ASP A 1 312 ? 7.001   -16.881 6.949   1.00 29.30 ? 792  ASP A CB  1 
ATOM   1982 C  CG  . ASP A 1 312 ? 6.347   -17.815 7.925   1.00 31.19 ? 792  ASP A CG  1 
ATOM   1983 O  OD1 . ASP A 1 312 ? 6.796   -17.860 9.094   1.00 33.39 ? 792  ASP A OD1 1 
ATOM   1984 O  OD2 . ASP A 1 312 ? 5.376   -18.495 7.527   1.00 32.99 ? 792  ASP A OD2 1 
ATOM   1985 N  N   . LEU A 1 313 ? 6.391   -14.054 5.303   1.00 28.74 ? 793  LEU A N   1 
ATOM   1986 C  CA  . LEU A 1 313 ? 6.768   -13.143 4.230   1.00 28.92 ? 793  LEU A CA  1 
ATOM   1987 C  C   . LEU A 1 313 ? 5.601   -12.242 3.857   1.00 28.79 ? 793  LEU A C   1 
ATOM   1988 O  O   . LEU A 1 313 ? 4.456   -12.690 3.818   1.00 28.68 ? 793  LEU A O   1 
ATOM   1989 C  CB  . LEU A 1 313 ? 7.250   -13.919 3.002   1.00 28.99 ? 793  LEU A CB  1 
ATOM   1990 C  CG  . LEU A 1 313 ? 7.751   -13.036 1.849   1.00 29.49 ? 793  LEU A CG  1 
ATOM   1991 C  CD1 . LEU A 1 313 ? 8.932   -13.663 1.133   1.00 29.75 ? 793  LEU A CD1 1 
ATOM   1992 C  CD2 . LEU A 1 313 ? 6.628   -12.713 0.862   1.00 29.31 ? 793  LEU A CD2 1 
ATOM   1993 N  N   . VAL A 1 314 ? 5.901   -10.972 3.587   1.00 28.89 ? 794  VAL A N   1 
ATOM   1994 C  CA  . VAL A 1 314 ? 4.891   -10.006 3.162   1.00 28.77 ? 794  VAL A CA  1 
ATOM   1995 C  C   . VAL A 1 314 ? 5.104   -9.622  1.703   1.00 29.00 ? 794  VAL A C   1 
ATOM   1996 O  O   . VAL A 1 314 ? 6.209   -9.256  1.306   1.00 29.24 ? 794  VAL A O   1 
ATOM   1997 C  CB  . VAL A 1 314 ? 4.926   -8.739  4.024   1.00 28.79 ? 794  VAL A CB  1 
ATOM   1998 C  CG1 . VAL A 1 314 ? 3.914   -7.700  3.498   1.00 28.69 ? 794  VAL A CG1 1 
ATOM   1999 C  CG2 . VAL A 1 314 ? 4.646   -9.088  5.487   1.00 28.03 ? 794  VAL A CG2 1 
ATOM   2000 N  N   . LEU A 1 315 ? 4.041   -9.731  0.911   1.00 29.10 ? 795  LEU A N   1 
ATOM   2001 C  CA  . LEU A 1 315 ? 4.024   -9.256  -0.470  1.00 29.07 ? 795  LEU A CA  1 
ATOM   2002 C  C   . LEU A 1 315 ? 3.140   -8.017  -0.561  1.00 28.89 ? 795  LEU A C   1 
ATOM   2003 O  O   . LEU A 1 315 ? 2.075   -7.958  0.055   1.00 28.81 ? 795  LEU A O   1 
ATOM   2004 C  CB  . LEU A 1 315 ? 3.476   -10.339 -1.408  1.00 29.04 ? 795  LEU A CB  1 
ATOM   2005 C  CG  . LEU A 1 315 ? 4.393   -11.532 -1.670  1.00 29.55 ? 795  LEU A CG  1 
ATOM   2006 C  CD1 . LEU A 1 315 ? 3.706   -12.601 -2.518  1.00 29.41 ? 795  LEU A CD1 1 
ATOM   2007 C  CD2 . LEU A 1 315 ? 5.688   -11.070 -2.330  1.00 29.90 ? 795  LEU A CD2 1 
ATOM   2008 N  N   . VAL A 1 316 ? 3.573   -7.030  -1.335  1.00 28.66 ? 796  VAL A N   1 
ATOM   2009 C  CA  . VAL A 1 316 ? 2.793   -5.815  -1.498  1.00 28.52 ? 796  VAL A CA  1 
ATOM   2010 C  C   . VAL A 1 316 ? 2.499   -5.536  -2.976  1.00 28.60 ? 796  VAL A C   1 
ATOM   2011 O  O   . VAL A 1 316 ? 3.413   -5.370  -3.791  1.00 28.30 ? 796  VAL A O   1 
ATOM   2012 C  CB  . VAL A 1 316 ? 3.491   -4.604  -0.849  1.00 28.58 ? 796  VAL A CB  1 
ATOM   2013 C  CG1 . VAL A 1 316 ? 2.613   -3.363  -0.948  1.00 28.57 ? 796  VAL A CG1 1 
ATOM   2014 C  CG2 . VAL A 1 316 ? 3.831   -4.899  0.611   1.00 27.93 ? 796  VAL A CG2 1 
ATOM   2015 N  N   . SER A 1 317 ? 1.210   -5.526  -3.311  1.00 28.66 ? 797  SER A N   1 
ATOM   2016 C  CA  . SER A 1 317 ? 0.749   -4.972  -4.574  1.00 28.83 ? 797  SER A CA  1 
ATOM   2017 C  C   . SER A 1 317 ? 0.782   -3.457  -4.417  1.00 29.00 ? 797  SER A C   1 
ATOM   2018 O  O   . SER A 1 317 ? -0.194  -2.851  -3.970  1.00 29.18 ? 797  SER A O   1 
ATOM   2019 C  CB  . SER A 1 317 ? -0.661  -5.459  -4.918  1.00 28.90 ? 797  SER A CB  1 
ATOM   2020 O  OG  . SER A 1 317 ? -0.618  -6.657  -5.672  1.00 28.54 ? 797  SER A OG  1 
ATOM   2021 N  N   . ALA A 1 318 ? 1.922   -2.864  -4.775  1.00 29.05 ? 798  ALA A N   1 
ATOM   2022 C  CA  . ALA A 1 318 ? 2.191   -1.456  -4.521  1.00 29.11 ? 798  ALA A CA  1 
ATOM   2023 C  C   . ALA A 1 318 ? 1.836   -0.578  -5.720  1.00 29.35 ? 798  ALA A C   1 
ATOM   2024 O  O   . ALA A 1 318 ? 2.709   -0.162  -6.486  1.00 29.52 ? 798  ALA A O   1 
ATOM   2025 C  CB  . ALA A 1 318 ? 3.651   -1.264  -4.133  1.00 29.03 ? 798  ALA A CB  1 
ATOM   2026 N  N   . GLY A 1 319 ? 0.544   -0.313  -5.882  1.00 29.30 ? 799  GLY A N   1 
ATOM   2027 C  CA  . GLY A 1 319 ? 0.084   0.699   -6.819  1.00 29.27 ? 799  GLY A CA  1 
ATOM   2028 C  C   . GLY A 1 319 ? 0.176   2.063   -6.166  1.00 29.17 ? 799  GLY A C   1 
ATOM   2029 O  O   . GLY A 1 319 ? 0.045   2.180   -4.950  1.00 29.18 ? 799  GLY A O   1 
ATOM   2030 N  N   . PHE A 1 320 ? 0.407   3.098   -6.968  1.00 29.05 ? 800  PHE A N   1 
ATOM   2031 C  CA  . PHE A 1 320 ? 0.512   4.457   -6.447  1.00 28.85 ? 800  PHE A CA  1 
ATOM   2032 C  C   . PHE A 1 320 ? -0.529  5.397   -7.048  1.00 29.03 ? 800  PHE A C   1 
ATOM   2033 O  O   . PHE A 1 320 ? -0.308  6.603   -7.138  1.00 29.17 ? 800  PHE A O   1 
ATOM   2034 C  CB  . PHE A 1 320 ? 1.926   4.976   -6.668  1.00 28.75 ? 800  PHE A CB  1 
ATOM   2035 C  CG  . PHE A 1 320 ? 2.972   4.170   -5.953  1.00 28.34 ? 800  PHE A CG  1 
ATOM   2036 C  CD1 . PHE A 1 320 ? 3.017   4.154   -4.565  1.00 27.57 ? 800  PHE A CD1 1 
ATOM   2037 C  CD2 . PHE A 1 320 ? 3.892   3.409   -6.660  1.00 27.82 ? 800  PHE A CD2 1 
ATOM   2038 C  CE1 . PHE A 1 320 ? 3.969   3.410   -3.896  1.00 27.13 ? 800  PHE A CE1 1 
ATOM   2039 C  CE2 . PHE A 1 320 ? 4.847   2.668   -5.996  1.00 27.54 ? 800  PHE A CE2 1 
ATOM   2040 C  CZ  . PHE A 1 320 ? 4.883   2.671   -4.608  1.00 27.48 ? 800  PHE A CZ  1 
ATOM   2041 N  N   . ASP A 1 321 ? -1.681  4.839   -7.418  1.00 29.12 ? 801  ASP A N   1 
ATOM   2042 C  CA  . ASP A 1 321 ? -2.786  5.621   -7.979  1.00 29.18 ? 801  ASP A CA  1 
ATOM   2043 C  C   . ASP A 1 321 ? -3.734  6.176   -6.903  1.00 29.26 ? 801  ASP A C   1 
ATOM   2044 O  O   . ASP A 1 321 ? -4.735  6.810   -7.230  1.00 29.26 ? 801  ASP A O   1 
ATOM   2045 C  CB  . ASP A 1 321 ? -3.554  4.818   -9.046  1.00 29.13 ? 801  ASP A CB  1 
ATOM   2046 C  CG  . ASP A 1 321 ? -3.827  3.376   -8.635  1.00 29.36 ? 801  ASP A CG  1 
ATOM   2047 O  OD1 . ASP A 1 321 ? -3.726  3.055   -7.430  1.00 29.85 ? 801  ASP A OD1 1 
ATOM   2048 O  OD2 . ASP A 1 321 ? -4.141  2.560   -9.527  1.00 29.00 ? 801  ASP A OD2 1 
ATOM   2049 N  N   . ALA A 1 322 ? -3.421  5.937   -5.629  1.00 29.51 ? 802  ALA A N   1 
ATOM   2050 C  CA  . ALA A 1 322 ? -4.077  6.645   -4.518  1.00 29.72 ? 802  ALA A CA  1 
ATOM   2051 C  C   . ALA A 1 322 ? -3.327  7.943   -4.216  1.00 29.97 ? 802  ALA A C   1 
ATOM   2052 O  O   . ALA A 1 322 ? -3.786  8.765   -3.422  1.00 29.89 ? 802  ALA A O   1 
ATOM   2053 C  CB  . ALA A 1 322 ? -4.145  5.764   -3.269  1.00 29.45 ? 802  ALA A CB  1 
ATOM   2054 N  N   . ALA A 1 323 ? -2.174  8.119   -4.861  1.00 30.51 ? 803  ALA A N   1 
ATOM   2055 C  CA  . ALA A 1 323 ? -1.358  9.313   -4.689  1.00 30.84 ? 803  ALA A CA  1 
ATOM   2056 C  C   . ALA A 1 323 ? -2.000  10.548  -5.304  1.00 31.29 ? 803  ALA A C   1 
ATOM   2057 O  O   . ALA A 1 323 ? -2.894  10.452  -6.154  1.00 31.17 ? 803  ALA A O   1 
ATOM   2058 C  CB  . ALA A 1 323 ? 0.030   9.104   -5.295  1.00 30.76 ? 803  ALA A CB  1 
ATOM   2059 N  N   . GLU A 1 324 ? -1.517  11.704  -4.851  1.00 31.76 ? 804  GLU A N   1 
ATOM   2060 C  CA  . GLU A 1 324 ? -1.877  12.996  -5.408  1.00 32.23 ? 804  GLU A CA  1 
ATOM   2061 C  C   . GLU A 1 324 ? -1.501  13.031  -6.888  1.00 32.45 ? 804  GLU A C   1 
ATOM   2062 O  O   . GLU A 1 324 ? -0.494  12.441  -7.287  1.00 32.78 ? 804  GLU A O   1 
ATOM   2063 C  CB  . GLU A 1 324 ? -1.132  14.100  -4.639  1.00 32.45 ? 804  GLU A CB  1 
ATOM   2064 C  CG  . GLU A 1 324 ? -1.610  15.506  -4.906  1.00 32.55 ? 804  GLU A CG  1 
ATOM   2065 C  CD  . GLU A 1 324 ? -3.006  15.756  -4.383  1.00 33.09 ? 804  GLU A CD  1 
ATOM   2066 O  OE1 . GLU A 1 324 ? -3.228  15.576  -3.170  1.00 32.65 ? 804  GLU A OE1 1 
ATOM   2067 O  OE2 . GLU A 1 324 ? -3.881  16.142  -5.190  1.00 34.47 ? 804  GLU A OE2 1 
ATOM   2068 N  N   . GLY A 1 325 ? -2.317  13.703  -7.700  1.00 32.54 ? 805  GLY A N   1 
ATOM   2069 C  CA  . GLY A 1 325 ? -2.081  13.793  -9.147  1.00 32.43 ? 805  GLY A CA  1 
ATOM   2070 C  C   . GLY A 1 325 ? -2.892  12.828  -10.001 1.00 32.57 ? 805  GLY A C   1 
ATOM   2071 O  O   . GLY A 1 325 ? -2.714  12.775  -11.218 1.00 32.51 ? 805  GLY A O   1 
ATOM   2072 N  N   . HIS A 1 326 ? -3.773  12.054  -9.371  1.00 32.66 ? 806  HIS A N   1 
ATOM   2073 C  CA  . HIS A 1 326 ? -4.692  11.178  -10.090 1.00 32.65 ? 806  HIS A CA  1 
ATOM   2074 C  C   . HIS A 1 326 ? -6.099  11.693  -9.865  1.00 33.09 ? 806  HIS A C   1 
ATOM   2075 O  O   . HIS A 1 326 ? -6.633  11.565  -8.762  1.00 33.17 ? 806  HIS A O   1 
ATOM   2076 C  CB  . HIS A 1 326 ? -4.570  9.740   -9.594  1.00 32.44 ? 806  HIS A CB  1 
ATOM   2077 C  CG  . HIS A 1 326 ? -3.187  9.189   -9.709  1.00 31.71 ? 806  HIS A CG  1 
ATOM   2078 N  ND1 . HIS A 1 326 ? -2.256  9.311   -8.704  1.00 31.72 ? 806  HIS A ND1 1 
ATOM   2079 C  CD2 . HIS A 1 326 ? -2.566  8.541   -10.721 1.00 31.44 ? 806  HIS A CD2 1 
ATOM   2080 C  CE1 . HIS A 1 326 ? -1.123  8.752   -9.087  1.00 31.36 ? 806  HIS A CE1 1 
ATOM   2081 N  NE2 . HIS A 1 326 ? -1.285  8.275   -10.305 1.00 30.87 ? 806  HIS A NE2 1 
ATOM   2082 N  N   . PRO A 1 327 ? -6.701  12.304  -10.899 1.00 33.52 ? 807  PRO A N   1 
ATOM   2083 C  CA  . PRO A 1 327 ? -8.030  12.869  -10.730 1.00 33.90 ? 807  PRO A CA  1 
ATOM   2084 C  C   . PRO A 1 327 ? -9.107  11.800  -10.850 1.00 34.32 ? 807  PRO A C   1 
ATOM   2085 O  O   . PRO A 1 327 ? -8.807  10.652  -11.188 1.00 34.54 ? 807  PRO A O   1 
ATOM   2086 C  CB  . PRO A 1 327 ? -8.127  13.868  -11.886 1.00 33.95 ? 807  PRO A CB  1 
ATOM   2087 C  CG  . PRO A 1 327 ? -7.288  13.272  -12.963 1.00 33.79 ? 807  PRO A CG  1 
ATOM   2088 C  CD  . PRO A 1 327 ? -6.211  12.455  -12.282 1.00 33.57 ? 807  PRO A CD  1 
ATOM   2089 N  N   . ALA A 1 328 ? -10.350 12.176  -10.567 1.00 34.72 ? 808  ALA A N   1 
ATOM   2090 C  CA  . ALA A 1 328 ? -11.486 11.292  -10.794 1.00 35.04 ? 808  ALA A CA  1 
ATOM   2091 C  C   . ALA A 1 328 ? -11.696 11.119  -12.307 1.00 35.26 ? 808  ALA A C   1 
ATOM   2092 O  O   . ALA A 1 328 ? -11.556 12.087  -13.059 1.00 35.35 ? 808  ALA A O   1 
ATOM   2093 C  CB  . ALA A 1 328 ? -12.738 11.872  -10.149 1.00 35.01 ? 808  ALA A CB  1 
ATOM   2094 N  N   . PRO A 1 329 ? -12.020 9.891   -12.771 1.00 35.38 ? 809  PRO A N   1 
ATOM   2095 C  CA  . PRO A 1 329 ? -12.131 8.612   -12.077 1.00 35.18 ? 809  PRO A CA  1 
ATOM   2096 C  C   . PRO A 1 329 ? -10.957 7.679   -12.371 1.00 34.92 ? 809  PRO A C   1 
ATOM   2097 O  O   . PRO A 1 329 ? -11.156 6.582   -12.891 1.00 35.05 ? 809  PRO A O   1 
ATOM   2098 C  CB  . PRO A 1 329 ? -13.418 8.033   -12.663 1.00 35.34 ? 809  PRO A CB  1 
ATOM   2099 C  CG  . PRO A 1 329 ? -13.391 8.504   -14.109 1.00 35.50 ? 809  PRO A CG  1 
ATOM   2100 C  CD  . PRO A 1 329 ? -12.563 9.788   -14.143 1.00 35.49 ? 809  PRO A CD  1 
ATOM   2101 N  N   . LEU A 1 330 ? -9.744  8.130   -12.063 1.00 34.54 ? 810  LEU A N   1 
ATOM   2102 C  CA  . LEU A 1 330 ? -8.579  7.245   -12.000 1.00 34.13 ? 810  LEU A CA  1 
ATOM   2103 C  C   . LEU A 1 330 ? -8.255  6.906   -10.550 1.00 33.59 ? 810  LEU A C   1 
ATOM   2104 O  O   . LEU A 1 330 ? -7.862  5.778   -10.246 1.00 33.48 ? 810  LEU A O   1 
ATOM   2105 C  CB  . LEU A 1 330 ? -7.357  7.887   -12.663 1.00 34.27 ? 810  LEU A CB  1 
ATOM   2106 C  CG  . LEU A 1 330 ? -6.028  7.127   -12.523 1.00 34.78 ? 810  LEU A CG  1 
ATOM   2107 C  CD1 . LEU A 1 330 ? -6.176  5.628   -12.807 1.00 34.66 ? 810  LEU A CD1 1 
ATOM   2108 C  CD2 . LEU A 1 330 ? -4.982  7.738   -13.445 1.00 35.85 ? 810  LEU A CD2 1 
ATOM   2109 N  N   . GLY A 1 331 ? -8.401  7.895   -9.670  1.00 33.04 ? 811  GLY A N   1 
ATOM   2110 C  CA  . GLY A 1 331 ? -8.145  7.725   -8.241  1.00 32.50 ? 811  GLY A CA  1 
ATOM   2111 C  C   . GLY A 1 331 ? -8.897  8.758   -7.426  1.00 32.00 ? 811  GLY A C   1 
ATOM   2112 O  O   . GLY A 1 331 ? -9.928  8.448   -6.828  1.00 31.90 ? 811  GLY A O   1 
ATOM   2113 N  N   . GLY A 1 332 ? -8.380  9.986   -7.414  1.00 31.49 ? 812  GLY A N   1 
ATOM   2114 C  CA  . GLY A 1 332 ? -9.021  11.111  -6.721  1.00 31.06 ? 812  GLY A CA  1 
ATOM   2115 C  C   . GLY A 1 332 ? -8.638  11.240  -5.256  1.00 30.69 ? 812  GLY A C   1 
ATOM   2116 O  O   . GLY A 1 332 ? -9.242  12.022  -4.518  1.00 30.36 ? 812  GLY A O   1 
ATOM   2117 N  N   . TYR A 1 333 ? -7.631  10.466  -4.840  1.00 30.41 ? 813  TYR A N   1 
ATOM   2118 C  CA  . TYR A 1 333 ? -7.170  10.419  -3.450  1.00 29.96 ? 813  TYR A CA  1 
ATOM   2119 C  C   . TYR A 1 333 ? -5.897  11.237  -3.303  1.00 29.76 ? 813  TYR A C   1 
ATOM   2120 O  O   . TYR A 1 333 ? -5.280  11.623  -4.299  1.00 29.69 ? 813  TYR A O   1 
ATOM   2121 C  CB  . TYR A 1 333 ? -6.927  8.971   -3.023  1.00 29.99 ? 813  TYR A CB  1 
ATOM   2122 C  CG  . TYR A 1 333 ? -8.175  8.194   -2.638  1.00 29.70 ? 813  TYR A CG  1 
ATOM   2123 C  CD1 . TYR A 1 333 ? -9.448  8.604   -3.041  1.00 28.96 ? 813  TYR A CD1 1 
ATOM   2124 C  CD2 . TYR A 1 333 ? -8.078  7.046   -1.856  1.00 28.99 ? 813  TYR A CD2 1 
ATOM   2125 C  CE1 . TYR A 1 333 ? -10.579 7.889   -2.682  1.00 28.93 ? 813  TYR A CE1 1 
ATOM   2126 C  CE2 . TYR A 1 333 ? -9.206  6.323   -1.500  1.00 28.95 ? 813  TYR A CE2 1 
ATOM   2127 C  CZ  . TYR A 1 333 ? -10.453 6.751   -1.913  1.00 28.85 ? 813  TYR A CZ  1 
ATOM   2128 O  OH  . TYR A 1 333 ? -11.577 6.043   -1.565  1.00 28.96 ? 813  TYR A OH  1 
ATOM   2129 N  N   . HIS A 1 334 ? -5.505  11.499  -2.058  1.00 29.56 ? 814  HIS A N   1 
ATOM   2130 C  CA  . HIS A 1 334 ? -4.435  12.457  -1.767  1.00 29.39 ? 814  HIS A CA  1 
ATOM   2131 C  C   . HIS A 1 334 ? -3.353  11.874  -0.857  1.00 29.09 ? 814  HIS A C   1 
ATOM   2132 O  O   . HIS A 1 334 ? -2.878  12.545  0.055   1.00 28.91 ? 814  HIS A O   1 
ATOM   2133 C  CB  . HIS A 1 334 ? -5.028  13.717  -1.126  1.00 29.39 ? 814  HIS A CB  1 
ATOM   2134 C  CG  . HIS A 1 334 ? -6.161  14.316  -1.900  1.00 29.84 ? 814  HIS A CG  1 
ATOM   2135 N  ND1 . HIS A 1 334 ? -5.969  15.077  -3.033  1.00 30.67 ? 814  HIS A ND1 1 
ATOM   2136 C  CD2 . HIS A 1 334 ? -7.499  14.273  -1.698  1.00 30.43 ? 814  HIS A CD2 1 
ATOM   2137 C  CE1 . HIS A 1 334 ? -7.140  15.475  -3.498  1.00 30.47 ? 814  HIS A CE1 1 
ATOM   2138 N  NE2 . HIS A 1 334 ? -8.085  15.002  -2.705  1.00 30.73 ? 814  HIS A NE2 1 
ATOM   2139 N  N   . VAL A 1 335 ? -2.949  10.633  -1.119  1.00 28.96 ? 815  VAL A N   1 
ATOM   2140 C  CA  . VAL A 1 335 ? -1.920  9.985   -0.308  1.00 28.81 ? 815  VAL A CA  1 
ATOM   2141 C  C   . VAL A 1 335 ? -0.545  10.500  -0.728  1.00 28.82 ? 815  VAL A C   1 
ATOM   2142 O  O   . VAL A 1 335 ? -0.208  10.486  -1.910  1.00 28.84 ? 815  VAL A O   1 
ATOM   2143 C  CB  . VAL A 1 335 ? -1.958  8.451   -0.440  1.00 28.79 ? 815  VAL A CB  1 
ATOM   2144 C  CG1 . VAL A 1 335 ? -0.964  7.818   0.514   1.00 28.34 ? 815  VAL A CG1 1 
ATOM   2145 C  CG2 . VAL A 1 335 ? -3.364  7.924   -0.177  1.00 28.61 ? 815  VAL A CG2 1 
ATOM   2146 N  N   . SER A 1 336 ? 0.245   10.956  0.240   1.00 28.84 ? 816  SER A N   1 
ATOM   2147 C  CA  . SER A 1 336 ? 1.560   11.521  -0.046  1.00 28.90 ? 816  SER A CA  1 
ATOM   2148 C  C   . SER A 1 336 ? 2.622   10.436  -0.142  1.00 29.00 ? 816  SER A C   1 
ATOM   2149 O  O   . SER A 1 336 ? 2.434   9.323   0.344   1.00 28.99 ? 816  SER A O   1 
ATOM   2150 C  CB  . SER A 1 336 ? 1.958   12.530  1.032   1.00 28.97 ? 816  SER A CB  1 
ATOM   2151 O  OG  . SER A 1 336 ? 2.192   11.891  2.276   1.00 29.49 ? 816  SER A OG  1 
ATOM   2152 N  N   . ALA A 1 337 ? 3.739   10.779  -0.776  1.00 29.26 ? 817  ALA A N   1 
ATOM   2153 C  CA  . ALA A 1 337 ? 4.898   9.891   -0.881  1.00 29.40 ? 817  ALA A CA  1 
ATOM   2154 C  C   . ALA A 1 337 ? 5.435   9.464   0.491   1.00 29.59 ? 817  ALA A C   1 
ATOM   2155 O  O   . ALA A 1 337 ? 5.858   8.324   0.673   1.00 29.73 ? 817  ALA A O   1 
ATOM   2156 C  CB  . ALA A 1 337 ? 6.004   10.575  -1.682  1.00 29.20 ? 817  ALA A CB  1 
ATOM   2157 N  N   . LYS A 1 338 ? 5.418   10.392  1.444   1.00 29.82 ? 818  LYS A N   1 
ATOM   2158 C  CA  . LYS A 1 338 ? 5.916   10.141  2.795   1.00 29.99 ? 818  LYS A CA  1 
ATOM   2159 C  C   . LYS A 1 338 ? 5.096   9.032   3.470   1.00 30.12 ? 818  LYS A C   1 
ATOM   2160 O  O   . LYS A 1 338 ? 5.641   8.165   4.156   1.00 29.88 ? 818  LYS A O   1 
ATOM   2161 C  CB  . LYS A 1 338 ? 5.855   11.430  3.616   1.00 29.91 ? 818  LYS A CB  1 
ATOM   2162 C  CG  . LYS A 1 338 ? 6.851   11.506  4.755   1.00 30.29 ? 818  LYS A CG  1 
ATOM   2163 C  CD  . LYS A 1 338 ? 6.919   12.922  5.314   1.00 30.45 ? 818  LYS A CD  1 
ATOM   2164 C  CE  . LYS A 1 338 ? 8.151   13.138  6.176   1.00 30.65 ? 818  LYS A CE  1 
ATOM   2165 N  NZ  . LYS A 1 338 ? 8.179   14.503  6.767   1.00 30.10 ? 818  LYS A NZ  1 
ATOM   2166 N  N   . CYS A 1 339 ? 3.786   9.073   3.245   1.00 30.21 ? 819  CYS A N   1 
ATOM   2167 C  CA  . CYS A 1 339 ? 2.860   8.097   3.798   1.00 30.42 ? 819  CYS A CA  1 
ATOM   2168 C  C   . CYS A 1 339 ? 3.075   6.693   3.217   1.00 30.34 ? 819  CYS A C   1 
ATOM   2169 O  O   . CYS A 1 339 ? 2.992   5.701   3.943   1.00 30.44 ? 819  CYS A O   1 
ATOM   2170 C  CB  . CYS A 1 339 ? 1.429   8.562   3.540   1.00 30.49 ? 819  CYS A CB  1 
ATOM   2171 S  SG  . CYS A 1 339 ? 0.161   7.553   4.313   1.00 31.55 ? 819  CYS A SG  1 
ATOM   2172 N  N   . PHE A 1 340 ? 3.347   6.615   1.915   1.00 30.16 ? 820  PHE A N   1 
ATOM   2173 C  CA  . PHE A 1 340 ? 3.652   5.338   1.257   1.00 29.98 ? 820  PHE A CA  1 
ATOM   2174 C  C   . PHE A 1 340 ? 4.910   4.691   1.832   1.00 29.94 ? 820  PHE A C   1 
ATOM   2175 O  O   . PHE A 1 340 ? 4.941   3.482   2.077   1.00 30.02 ? 820  PHE A O   1 
ATOM   2176 C  CB  . PHE A 1 340 ? 3.830   5.528   -0.255  1.00 29.92 ? 820  PHE A CB  1 
ATOM   2177 C  CG  . PHE A 1 340 ? 2.536   5.590   -1.018  1.00 29.85 ? 820  PHE A CG  1 
ATOM   2178 C  CD1 . PHE A 1 340 ? 1.764   4.446   -1.192  1.00 29.43 ? 820  PHE A CD1 1 
ATOM   2179 C  CD2 . PHE A 1 340 ? 2.095   6.786   -1.573  1.00 29.57 ? 820  PHE A CD2 1 
ATOM   2180 C  CE1 . PHE A 1 340 ? 0.572   4.494   -1.892  1.00 29.43 ? 820  PHE A CE1 1 
ATOM   2181 C  CE2 . PHE A 1 340 ? 0.903   6.842   -2.276  1.00 29.46 ? 820  PHE A CE2 1 
ATOM   2182 C  CZ  . PHE A 1 340 ? 0.139   5.691   -2.438  1.00 29.62 ? 820  PHE A CZ  1 
ATOM   2183 N  N   . GLY A 1 341 ? 5.949   5.498   2.026   1.00 29.88 ? 821  GLY A N   1 
ATOM   2184 C  CA  . GLY A 1 341 ? 7.199   5.024   2.614   1.00 29.90 ? 821  GLY A CA  1 
ATOM   2185 C  C   . GLY A 1 341 ? 7.044   4.641   4.077   1.00 29.98 ? 821  GLY A C   1 
ATOM   2186 O  O   . GLY A 1 341 ? 7.732   3.745   4.564   1.00 30.09 ? 821  GLY A O   1 
ATOM   2187 N  N   . TYR A 1 342 ? 6.142   5.322   4.781   1.00 29.86 ? 822  TYR A N   1 
ATOM   2188 C  CA  . TYR A 1 342 ? 5.866   5.004   6.172   1.00 29.92 ? 822  TYR A CA  1 
ATOM   2189 C  C   . TYR A 1 342 ? 5.080   3.703   6.304   1.00 29.90 ? 822  TYR A C   1 
ATOM   2190 O  O   . TYR A 1 342 ? 5.313   2.933   7.227   1.00 29.97 ? 822  TYR A O   1 
ATOM   2191 C  CB  . TYR A 1 342 ? 5.110   6.150   6.848   1.00 29.82 ? 822  TYR A CB  1 
ATOM   2192 C  CG  . TYR A 1 342 ? 4.994   6.014   8.351   1.00 29.67 ? 822  TYR A CG  1 
ATOM   2193 C  CD1 . TYR A 1 342 ? 6.123   5.806   9.143   1.00 29.60 ? 822  TYR A CD1 1 
ATOM   2194 C  CD2 . TYR A 1 342 ? 3.757   6.111   8.987   1.00 29.31 ? 822  TYR A CD2 1 
ATOM   2195 C  CE1 . TYR A 1 342 ? 6.024   5.695   10.517  1.00 28.99 ? 822  TYR A CE1 1 
ATOM   2196 C  CE2 . TYR A 1 342 ? 3.648   6.000   10.363  1.00 28.83 ? 822  TYR A CE2 1 
ATOM   2197 C  CZ  . TYR A 1 342 ? 4.785   5.792   11.123  1.00 29.07 ? 822  TYR A CZ  1 
ATOM   2198 O  OH  . TYR A 1 342 ? 4.690   5.678   12.490  1.00 27.76 ? 822  TYR A OH  1 
ATOM   2199 N  N   . MET A 1 343 ? 4.149   3.469   5.387   1.00 30.10 ? 823  MET A N   1 
ATOM   2200 C  CA  . MET A 1 343 ? 3.407   2.210   5.354   1.00 30.36 ? 823  MET A CA  1 
ATOM   2201 C  C   . MET A 1 343 ? 4.349   1.044   5.076   1.00 30.10 ? 823  MET A C   1 
ATOM   2202 O  O   . MET A 1 343 ? 4.198   -0.033  5.657   1.00 30.18 ? 823  MET A O   1 
ATOM   2203 C  CB  . MET A 1 343 ? 2.307   2.253   4.296   1.00 30.58 ? 823  MET A CB  1 
ATOM   2204 C  CG  . MET A 1 343 ? 1.055   2.974   4.744   1.00 31.85 ? 823  MET A CG  1 
ATOM   2205 S  SD  . MET A 1 343 ? -0.180  3.086   3.429   1.00 35.72 ? 823  MET A SD  1 
ATOM   2206 C  CE  . MET A 1 343 ? 0.322   4.591   2.602   1.00 34.64 ? 823  MET A CE  1 
ATOM   2207 N  N   . THR A 1 344 ? 5.321   1.267   4.195   1.00 29.74 ? 824  THR A N   1 
ATOM   2208 C  CA  . THR A 1 344 ? 6.344   0.266   3.907   1.00 29.49 ? 824  THR A CA  1 
ATOM   2209 C  C   . THR A 1 344 ? 7.145   -0.044  5.159   1.00 29.30 ? 824  THR A C   1 
ATOM   2210 O  O   . THR A 1 344 ? 7.390   -1.207  5.479   1.00 29.19 ? 824  THR A O   1 
ATOM   2211 C  CB  . THR A 1 344 ? 7.314   0.752   2.818   1.00 29.53 ? 824  THR A CB  1 
ATOM   2212 O  OG1 . THR A 1 344 ? 6.574   1.133   1.653   1.00 29.54 ? 824  THR A OG1 1 
ATOM   2213 C  CG2 . THR A 1 344 ? 8.307   -0.340  2.455   1.00 29.03 ? 824  THR A CG2 1 
ATOM   2214 N  N   . GLN A 1 345 ? 7.548   1.013   5.858   1.00 29.20 ? 825  GLN A N   1 
ATOM   2215 C  CA  . GLN A 1 345 ? 8.273   0.897   7.121   1.00 28.98 ? 825  GLN A CA  1 
ATOM   2216 C  C   . GLN A 1 345 ? 7.479   0.091   8.153   1.00 28.79 ? 825  GLN A C   1 
ATOM   2217 O  O   . GLN A 1 345 ? 8.058   -0.695  8.908   1.00 28.62 ? 825  GLN A O   1 
ATOM   2218 C  CB  . GLN A 1 345 ? 8.590   2.294   7.674   1.00 28.95 ? 825  GLN A CB  1 
ATOM   2219 C  CG  . GLN A 1 345 ? 9.516   2.304   8.881   1.00 28.96 ? 825  GLN A CG  1 
ATOM   2220 C  CD  . GLN A 1 345 ? 9.608   3.670   9.534   1.00 29.65 ? 825  GLN A CD  1 
ATOM   2221 O  OE1 . GLN A 1 345 ? 9.569   4.702   8.862   1.00 29.96 ? 825  GLN A OE1 1 
ATOM   2222 N  NE2 . GLN A 1 345 ? 9.735   3.683   10.854  1.00 30.85 ? 825  GLN A NE2 1 
ATOM   2223 N  N   . GLN A 1 346 ? 6.162   0.290   8.187   1.00 28.64 ? 826  GLN A N   1 
ATOM   2224 C  CA  . GLN A 1 346 ? 5.299   -0.434  9.130   1.00 28.65 ? 826  GLN A CA  1 
ATOM   2225 C  C   . GLN A 1 346 ? 5.184   -1.910  8.770   1.00 28.35 ? 826  GLN A C   1 
ATOM   2226 O  O   . GLN A 1 346 ? 5.173   -2.767  9.652   1.00 28.50 ? 826  GLN A O   1 
ATOM   2227 C  CB  . GLN A 1 346 ? 3.909   0.207   9.214   1.00 28.67 ? 826  GLN A CB  1 
ATOM   2228 C  CG  . GLN A 1 346 ? 3.897   1.503   10.006  1.00 29.28 ? 826  GLN A CG  1 
ATOM   2229 C  CD  . GLN A 1 346 ? 2.502   2.082   10.181  1.00 30.37 ? 826  GLN A CD  1 
ATOM   2230 O  OE1 . GLN A 1 346 ? 1.642   1.483   10.830  1.00 31.43 ? 826  GLN A OE1 1 
ATOM   2231 N  NE2 . GLN A 1 346 ? 2.281   3.265   9.621   1.00 30.94 ? 826  GLN A NE2 1 
ATOM   2232 N  N   . LEU A 1 347 ? 5.102   -2.210  7.476   1.00 28.13 ? 827  LEU A N   1 
ATOM   2233 C  CA  . LEU A 1 347 ? 5.075   -3.600  7.031   1.00 27.94 ? 827  LEU A CA  1 
ATOM   2234 C  C   . LEU A 1 347 ? 6.421   -4.295  7.251   1.00 27.98 ? 827  LEU A C   1 
ATOM   2235 O  O   . LEU A 1 347 ? 6.468   -5.512  7.355   1.00 27.91 ? 827  LEU A O   1 
ATOM   2236 C  CB  . LEU A 1 347 ? 4.635   -3.706  5.570   1.00 27.75 ? 827  LEU A CB  1 
ATOM   2237 C  CG  . LEU A 1 347 ? 3.164   -3.357  5.304   1.00 27.42 ? 827  LEU A CG  1 
ATOM   2238 C  CD1 . LEU A 1 347 ? 2.832   -3.494  3.825   1.00 26.50 ? 827  LEU A CD1 1 
ATOM   2239 C  CD2 . LEU A 1 347 ? 2.221   -4.214  6.134   1.00 26.19 ? 827  LEU A CD2 1 
ATOM   2240 N  N   . MET A 1 348 ? 7.504   -3.526  7.353   1.00 28.08 ? 828  MET A N   1 
ATOM   2241 C  CA  . MET A 1 348 ? 8.838   -4.099  7.590   1.00 28.27 ? 828  MET A CA  1 
ATOM   2242 C  C   . MET A 1 348 ? 9.031   -4.637  9.014   1.00 28.36 ? 828  MET A C   1 
ATOM   2243 O  O   . MET A 1 348 ? 10.001  -5.343  9.283   1.00 28.22 ? 828  MET A O   1 
ATOM   2244 C  CB  . MET A 1 348 ? 9.934   -3.074  7.272   1.00 28.35 ? 828  MET A CB  1 
ATOM   2245 C  CG  . MET A 1 348 ? 10.200  -2.873  5.793   1.00 28.10 ? 828  MET A CG  1 
ATOM   2246 S  SD  . MET A 1 348 ? 11.134  -1.356  5.473   1.00 29.44 ? 828  MET A SD  1 
ATOM   2247 C  CE  . MET A 1 348 ? 12.683  -1.694  6.319   1.00 26.30 ? 828  MET A CE  1 
ATOM   2248 N  N   . ASN A 1 349 ? 8.119   -4.303  9.924   1.00 28.58 ? 829  ASN A N   1 
ATOM   2249 C  CA  . ASN A 1 349 ? 8.139   -4.883  11.268  1.00 28.77 ? 829  ASN A CA  1 
ATOM   2250 C  C   . ASN A 1 349 ? 7.625   -6.321  11.309  1.00 28.50 ? 829  ASN A C   1 
ATOM   2251 O  O   . ASN A 1 349 ? 7.829   -7.016  12.296  1.00 28.57 ? 829  ASN A O   1 
ATOM   2252 C  CB  . ASN A 1 349 ? 7.335   -4.014  12.236  1.00 29.00 ? 829  ASN A CB  1 
ATOM   2253 C  CG  . ASN A 1 349 ? 8.014   -2.699  12.529  1.00 30.16 ? 829  ASN A CG  1 
ATOM   2254 O  OD1 . ASN A 1 349 ? 9.220   -2.655  12.782  1.00 31.78 ? 829  ASN A OD1 1 
ATOM   2255 N  ND2 . ASN A 1 349 ? 7.247   -1.614  12.499  1.00 31.80 ? 829  ASN A ND2 1 
ATOM   2256 N  N   . LEU A 1 350 ? 6.964   -6.753  10.236  1.00 28.43 ? 830  LEU A N   1 
ATOM   2257 C  CA  . LEU A 1 350 ? 6.424   -8.106  10.123  1.00 28.26 ? 830  LEU A CA  1 
ATOM   2258 C  C   . LEU A 1 350 ? 7.400   -9.051  9.421   1.00 28.18 ? 830  LEU A C   1 
ATOM   2259 O  O   . LEU A 1 350 ? 8.285   -8.612  8.681   1.00 28.28 ? 830  LEU A O   1 
ATOM   2260 C  CB  . LEU A 1 350 ? 5.124   -8.079  9.316   1.00 28.12 ? 830  LEU A CB  1 
ATOM   2261 C  CG  . LEU A 1 350 ? 4.008   -7.149  9.794   1.00 28.23 ? 830  LEU A CG  1 
ATOM   2262 C  CD1 . LEU A 1 350 ? 2.966   -6.984  8.696   1.00 26.64 ? 830  LEU A CD1 1 
ATOM   2263 C  CD2 . LEU A 1 350 ? 3.375   -7.651  11.102  1.00 27.52 ? 830  LEU A CD2 1 
ATOM   2264 N  N   . ALA A 1 351 ? 7.218   -10.349 9.655   1.00 27.78 ? 831  ALA A N   1 
ATOM   2265 C  CA  . ALA A 1 351 ? 7.900   -11.399 8.897   1.00 27.61 ? 831  ALA A CA  1 
ATOM   2266 C  C   . ALA A 1 351 ? 9.422   -11.273 8.906   1.00 27.55 ? 831  ALA A C   1 
ATOM   2267 O  O   . ALA A 1 351 ? 10.076  -11.559 7.903   1.00 27.75 ? 831  ALA A O   1 
ATOM   2268 C  CB  . ALA A 1 351 ? 7.381   -11.421 7.461   1.00 27.36 ? 831  ALA A CB  1 
ATOM   2269 N  N   . GLY A 1 352 ? 9.981   -10.848 10.036  1.00 27.47 ? 832  GLY A N   1 
ATOM   2270 C  CA  . GLY A 1 352 ? 11.419  -10.602 10.149  1.00 27.37 ? 832  GLY A CA  1 
ATOM   2271 C  C   . GLY A 1 352 ? 11.987  -9.630  9.120   1.00 27.33 ? 832  GLY A C   1 
ATOM   2272 O  O   . GLY A 1 352 ? 13.183  -9.660  8.837   1.00 27.42 ? 832  GLY A O   1 
ATOM   2273 N  N   . GLY A 1 353 ? 11.135  -8.767  8.566   1.00 27.28 ? 833  GLY A N   1 
ATOM   2274 C  CA  . GLY A 1 353 ? 11.545  -7.804  7.545   1.00 27.20 ? 833  GLY A CA  1 
ATOM   2275 C  C   . GLY A 1 353 ? 11.492  -8.336  6.124   1.00 27.24 ? 833  GLY A C   1 
ATOM   2276 O  O   . GLY A 1 353 ? 11.948  -7.671  5.197   1.00 27.26 ? 833  GLY A O   1 
ATOM   2277 N  N   . ALA A 1 354 ? 10.929  -9.531  5.947   1.00 27.22 ? 834  ALA A N   1 
ATOM   2278 C  CA  . ALA A 1 354 ? 10.808  -10.144 4.626   1.00 27.11 ? 834  ALA A CA  1 
ATOM   2279 C  C   . ALA A 1 354 ? 9.657   -9.498  3.854   1.00 27.20 ? 834  ALA A C   1 
ATOM   2280 O  O   . ALA A 1 354 ? 8.514   -9.955  3.921   1.00 27.26 ? 834  ALA A O   1 
ATOM   2281 C  CB  . ALA A 1 354 ? 10.594  -11.640 4.765   1.00 27.07 ? 834  ALA A CB  1 
ATOM   2282 N  N   . VAL A 1 355 ? 9.970   -8.425  3.132   1.00 27.26 ? 835  VAL A N   1 
ATOM   2283 C  CA  . VAL A 1 355 ? 8.966   -7.628  2.435   1.00 27.38 ? 835  VAL A CA  1 
ATOM   2284 C  C   . VAL A 1 355 ? 9.320   -7.454  0.955   1.00 27.44 ? 835  VAL A C   1 
ATOM   2285 O  O   . VAL A 1 355 ? 10.463  -7.162  0.618   1.00 27.39 ? 835  VAL A O   1 
ATOM   2286 C  CB  . VAL A 1 355 ? 8.819   -6.245  3.101   1.00 27.38 ? 835  VAL A CB  1 
ATOM   2287 C  CG1 . VAL A 1 355 ? 7.785   -5.415  2.378   1.00 27.27 ? 835  VAL A CG1 1 
ATOM   2288 C  CG2 . VAL A 1 355 ? 8.442   -6.410  4.563   1.00 27.13 ? 835  VAL A CG2 1 
ATOM   2289 N  N   . VAL A 1 356 ? 8.337   -7.651  0.079   1.00 27.47 ? 836  VAL A N   1 
ATOM   2290 C  CA  . VAL A 1 356 ? 8.532   -7.472  -1.361  1.00 27.61 ? 836  VAL A CA  1 
ATOM   2291 C  C   . VAL A 1 356 ? 7.403   -6.628  -1.940  1.00 27.74 ? 836  VAL A C   1 
ATOM   2292 O  O   . VAL A 1 356 ? 6.244   -7.013  -1.867  1.00 27.68 ? 836  VAL A O   1 
ATOM   2293 C  CB  . VAL A 1 356 ? 8.566   -8.831  -2.092  1.00 27.71 ? 836  VAL A CB  1 
ATOM   2294 C  CG1 . VAL A 1 356 ? 8.640   -8.631  -3.599  1.00 27.75 ? 836  VAL A CG1 1 
ATOM   2295 C  CG2 . VAL A 1 356 ? 9.735   -9.675  -1.604  1.00 27.11 ? 836  VAL A CG2 1 
ATOM   2296 N  N   . LEU A 1 357 ? 7.740   -5.467  -2.492  1.00 28.23 ? 837  LEU A N   1 
ATOM   2297 C  CA  . LEU A 1 357 ? 6.756   -4.634  -3.187  1.00 28.54 ? 837  LEU A CA  1 
ATOM   2298 C  C   . LEU A 1 357 ? 6.841   -4.892  -4.684  1.00 28.72 ? 837  LEU A C   1 
ATOM   2299 O  O   . LEU A 1 357 ? 7.919   -5.166  -5.217  1.00 28.58 ? 837  LEU A O   1 
ATOM   2300 C  CB  . LEU A 1 357 ? 6.984   -3.140  -2.933  1.00 28.45 ? 837  LEU A CB  1 
ATOM   2301 C  CG  . LEU A 1 357 ? 7.344   -2.642  -1.534  1.00 29.01 ? 837  LEU A CG  1 
ATOM   2302 C  CD1 . LEU A 1 357 ? 7.062   -1.143  -1.452  1.00 29.40 ? 837  LEU A CD1 1 
ATOM   2303 C  CD2 . LEU A 1 357 ? 6.613   -3.378  -0.433  1.00 28.80 ? 837  LEU A CD2 1 
ATOM   2304 N  N   . ALA A 1 358 ? 5.697   -4.796  -5.355  1.00 28.93 ? 838  ALA A N   1 
ATOM   2305 C  CA  . ALA A 1 358 ? 5.629   -4.961  -6.800  1.00 29.09 ? 838  ALA A CA  1 
ATOM   2306 C  C   . ALA A 1 358 ? 4.724   -3.884  -7.363  1.00 29.29 ? 838  ALA A C   1 
ATOM   2307 O  O   . ALA A 1 358 ? 3.572   -3.756  -6.942  1.00 29.87 ? 838  ALA A O   1 
ATOM   2308 C  CB  . ALA A 1 358 ? 5.097   -6.345  -7.159  1.00 28.79 ? 838  ALA A CB  1 
ATOM   2309 N  N   . LEU A 1 359 ? 5.242   -3.108  -8.308  1.00 29.30 ? 839  LEU A N   1 
ATOM   2310 C  CA  . LEU A 1 359 ? 4.481   -2.022  -8.911  1.00 29.22 ? 839  LEU A CA  1 
ATOM   2311 C  C   . LEU A 1 359 ? 3.229   -2.578  -9.564  1.00 29.36 ? 839  LEU A C   1 
ATOM   2312 O  O   . LEU A 1 359 ? 3.290   -3.557  -10.301 1.00 29.10 ? 839  LEU A O   1 
ATOM   2313 C  CB  . LEU A 1 359 ? 5.318   -1.296  -9.967  1.00 29.19 ? 839  LEU A CB  1 
ATOM   2314 C  CG  . LEU A 1 359 ? 4.692   -0.040  -10.576 1.00 28.93 ? 839  LEU A CG  1 
ATOM   2315 C  CD1 . LEU A 1 359 ? 4.652   1.080   -9.547  1.00 28.33 ? 839  LEU A CD1 1 
ATOM   2316 C  CD2 . LEU A 1 359 ? 5.463   0.393   -11.817 1.00 28.68 ? 839  LEU A CD2 1 
ATOM   2317 N  N   . GLU A 1 360 ? 2.093   -1.962  -9.265  1.00 29.60 ? 840  GLU A N   1 
ATOM   2318 C  CA  . GLU A 1 360 ? 0.854   -2.248  -9.963  1.00 29.64 ? 840  GLU A CA  1 
ATOM   2319 C  C   . GLU A 1 360 ? 0.515   -0.974  -10.735 1.00 29.62 ? 840  GLU A C   1 
ATOM   2320 O  O   . GLU A 1 360 ? 1.162   -0.693  -11.742 1.00 29.48 ? 840  GLU A O   1 
ATOM   2321 C  CB  . GLU A 1 360 ? -0.244  -2.677  -8.980  1.00 29.73 ? 840  GLU A CB  1 
ATOM   2322 C  CG  . GLU A 1 360 ? 0.090   -3.942  -8.186  1.00 30.26 ? 840  GLU A CG  1 
ATOM   2323 C  CD  . GLU A 1 360 ? -0.199  -5.252  -8.926  1.00 30.97 ? 840  GLU A CD  1 
ATOM   2324 O  OE1 . GLU A 1 360 ? -0.600  -5.228  -10.112 1.00 31.03 ? 840  GLU A OE1 1 
ATOM   2325 O  OE2 . GLU A 1 360 ? -0.027  -6.321  -8.301  1.00 30.74 ? 840  GLU A OE2 1 
ATOM   2326 N  N   . GLY A 1 361 ? -0.440  -0.181  -10.249 1.00 29.75 ? 841  GLY A N   1 
ATOM   2327 C  CA  . GLY A 1 361 ? -0.911  1.002   -10.973 1.00 29.82 ? 841  GLY A CA  1 
ATOM   2328 C  C   . GLY A 1 361 ? -0.194  2.278   -10.568 1.00 29.98 ? 841  GLY A C   1 
ATOM   2329 O  O   . GLY A 1 361 ? 0.747   2.252   -9.772  1.00 29.86 ? 841  GLY A O   1 
ATOM   2330 N  N   . GLY A 1 362 ? -0.664  3.398   -11.114 1.00 30.02 ? 842  GLY A N   1 
ATOM   2331 C  CA  . GLY A 1 362 ? -0.037  4.698   -10.926 1.00 30.10 ? 842  GLY A CA  1 
ATOM   2332 C  C   . GLY A 1 362 ? 0.347   5.279   -12.275 1.00 30.17 ? 842  GLY A C   1 
ATOM   2333 O  O   . GLY A 1 362 ? 1.078   4.642   -13.032 1.00 30.21 ? 842  GLY A O   1 
ATOM   2334 N  N   . HIS A 1 363 ? -0.136  6.487   -12.563 1.00 30.13 ? 843  HIS A N   1 
ATOM   2335 C  CA  . HIS A 1 363 ? 0.047   7.134   -13.864 1.00 30.34 ? 843  HIS A CA  1 
ATOM   2336 C  C   . HIS A 1 363 ? 0.888   8.416   -13.765 1.00 30.40 ? 843  HIS A C   1 
ATOM   2337 O  O   . HIS A 1 363 ? 1.942   8.514   -14.393 1.00 30.75 ? 843  HIS A O   1 
ATOM   2338 C  CB  . HIS A 1 363 ? -1.327  7.452   -14.469 1.00 30.40 ? 843  HIS A CB  1 
ATOM   2339 C  CG  . HIS A 1 363 ? -1.269  8.198   -15.766 1.00 30.36 ? 843  HIS A CG  1 
ATOM   2340 N  ND1 . HIS A 1 363 ? -0.669  7.685   -16.897 1.00 30.69 ? 843  HIS A ND1 1 
ATOM   2341 C  CD2 . HIS A 1 363 ? -1.754  9.413   -16.116 1.00 30.52 ? 843  HIS A CD2 1 
ATOM   2342 C  CE1 . HIS A 1 363 ? -0.779  8.555   -17.885 1.00 30.52 ? 843  HIS A CE1 1 
ATOM   2343 N  NE2 . HIS A 1 363 ? -1.435  9.612   -17.438 1.00 30.66 ? 843  HIS A NE2 1 
ATOM   2344 N  N   . ASP A 1 364 ? 0.416   9.396   -12.997 1.00 30.09 ? 844  ASP A N   1 
ATOM   2345 C  CA  . ASP A 1 364 ? 1.143   10.659  -12.828 1.00 30.03 ? 844  ASP A CA  1 
ATOM   2346 C  C   . ASP A 1 364 ? 2.602   10.381  -12.466 1.00 29.73 ? 844  ASP A C   1 
ATOM   2347 O  O   . ASP A 1 364 ? 2.894   9.841   -11.395 1.00 29.61 ? 844  ASP A O   1 
ATOM   2348 C  CB  . ASP A 1 364 ? 0.479   11.534  -11.756 1.00 30.03 ? 844  ASP A CB  1 
ATOM   2349 C  CG  . ASP A 1 364 ? 1.167   12.876  -11.588 1.00 30.17 ? 844  ASP A CG  1 
ATOM   2350 O  OD1 . ASP A 1 364 ? 2.202   12.948  -10.890 1.00 30.52 ? 844  ASP A OD1 1 
ATOM   2351 O  OD2 . ASP A 1 364 ? 0.672   13.864  -12.158 1.00 31.71 ? 844  ASP A OD2 1 
ATOM   2352 N  N   . LEU A 1 365 ? 3.502   10.771  -13.368 1.00 29.36 ? 845  LEU A N   1 
ATOM   2353 C  CA  . LEU A 1 365 ? 4.909   10.372  -13.308 1.00 29.20 ? 845  LEU A CA  1 
ATOM   2354 C  C   . LEU A 1 365 ? 5.624   10.813  -12.032 1.00 28.88 ? 845  LEU A C   1 
ATOM   2355 O  O   . LEU A 1 365 ? 6.277   9.992   -11.380 1.00 29.03 ? 845  LEU A O   1 
ATOM   2356 C  CB  . LEU A 1 365 ? 5.672   10.862  -14.549 1.00 29.15 ? 845  LEU A CB  1 
ATOM   2357 C  CG  . LEU A 1 365 ? 5.765   9.858   -15.704 1.00 29.58 ? 845  LEU A CG  1 
ATOM   2358 C  CD1 . LEU A 1 365 ? 4.411   9.241   -16.048 1.00 30.18 ? 845  LEU A CD1 1 
ATOM   2359 C  CD2 . LEU A 1 365 ? 6.379   10.514  -16.936 1.00 28.77 ? 845  LEU A CD2 1 
ATOM   2360 N  N   . THR A 1 366 ? 5.486   12.085  -11.666 1.00 28.35 ? 846  THR A N   1 
ATOM   2361 C  CA  . THR A 1 366 ? 6.181   12.609  -10.486 1.00 28.11 ? 846  THR A CA  1 
ATOM   2362 C  C   . THR A 1 366 ? 5.640   11.975  -9.200  1.00 27.90 ? 846  THR A C   1 
ATOM   2363 O  O   . THR A 1 366 ? 6.401   11.675  -8.286  1.00 27.65 ? 846  THR A O   1 
ATOM   2364 C  CB  . THR A 1 366 ? 6.110   14.167  -10.384 1.00 28.21 ? 846  THR A CB  1 
ATOM   2365 O  OG1 . THR A 1 366 ? 4.796   14.576  -9.985  1.00 28.41 ? 846  THR A OG1 1 
ATOM   2366 C  CG2 . THR A 1 366 ? 6.487   14.831  -11.715 1.00 27.34 ? 846  THR A CG2 1 
ATOM   2367 N  N   . ALA A 1 367 ? 4.328   11.763  -9.152  1.00 27.73 ? 847  ALA A N   1 
ATOM   2368 C  CA  . ALA A 1 367 ? 3.675   11.162  -7.993  1.00 27.60 ? 847  ALA A CA  1 
ATOM   2369 C  C   . ALA A 1 367 ? 4.130   9.717   -7.768  1.00 27.67 ? 847  ALA A C   1 
ATOM   2370 O  O   . ALA A 1 367 ? 4.448   9.325   -6.645  1.00 27.32 ? 847  ALA A O   1 
ATOM   2371 C  CB  . ALA A 1 367 ? 2.166   11.218  -8.159  1.00 27.49 ? 847  ALA A CB  1 
ATOM   2372 N  N   . ILE A 1 368 ? 4.170   8.930   -8.839  1.00 27.93 ? 848  ILE A N   1 
ATOM   2373 C  CA  . ILE A 1 368 ? 4.608   7.537   -8.729  1.00 27.98 ? 848  ILE A CA  1 
ATOM   2374 C  C   . ILE A 1 368 ? 6.124   7.462   -8.529  1.00 28.13 ? 848  ILE A C   1 
ATOM   2375 O  O   . ILE A 1 368 ? 6.624   6.522   -7.922  1.00 28.37 ? 848  ILE A O   1 
ATOM   2376 C  CB  . ILE A 1 368 ? 4.138   6.668   -9.924  1.00 27.93 ? 848  ILE A CB  1 
ATOM   2377 C  CG1 . ILE A 1 368 ? 4.849   7.055   -11.227 1.00 28.10 ? 848  ILE A CG1 1 
ATOM   2378 C  CG2 . ILE A 1 368 ? 2.623   6.776   -10.083 1.00 27.41 ? 848  ILE A CG2 1 
ATOM   2379 C  CD1 . ILE A 1 368 ? 4.520   6.137   -12.387 1.00 27.31 ? 848  ILE A CD1 1 
ATOM   2380 N  N   . CYS A 1 369 ? 6.846   8.462   -9.023  1.00 28.34 ? 849  CYS A N   1 
ATOM   2381 C  CA  . CYS A 1 369 ? 8.281   8.570   -8.767  1.00 28.33 ? 849  CYS A CA  1 
ATOM   2382 C  C   . CYS A 1 369 ? 8.566   8.985   -7.325  1.00 28.49 ? 849  CYS A C   1 
ATOM   2383 O  O   . CYS A 1 369 ? 9.449   8.417   -6.685  1.00 28.84 ? 849  CYS A O   1 
ATOM   2384 C  CB  . CYS A 1 369 ? 8.934   9.540   -9.745  1.00 28.19 ? 849  CYS A CB  1 
ATOM   2385 S  SG  . CYS A 1 369 ? 9.168   8.828   -11.382 1.00 28.29 ? 849  CYS A SG  1 
ATOM   2386 N  N   . ASP A 1 370 ? 7.825   9.975   -6.822  1.00 28.46 ? 850  ASP A N   1 
ATOM   2387 C  CA  . ASP A 1 370 ? 7.902   10.375  -5.411  1.00 28.22 ? 850  ASP A CA  1 
ATOM   2388 C  C   . ASP A 1 370 ? 7.673   9.170   -4.506  1.00 27.93 ? 850  ASP A C   1 
ATOM   2389 O  O   . ASP A 1 370 ? 8.480   8.878   -3.628  1.00 28.05 ? 850  ASP A O   1 
ATOM   2390 C  CB  . ASP A 1 370 ? 6.836   11.432  -5.076  1.00 28.21 ? 850  ASP A CB  1 
ATOM   2391 C  CG  . ASP A 1 370 ? 7.157   12.800  -5.634  1.00 28.32 ? 850  ASP A CG  1 
ATOM   2392 O  OD1 . ASP A 1 370 ? 8.235   12.971  -6.228  1.00 28.92 ? 850  ASP A OD1 1 
ATOM   2393 O  OD2 . ASP A 1 370 ? 6.319   13.714  -5.474  1.00 28.42 ? 850  ASP A OD2 1 
ATOM   2394 N  N   . ALA A 1 371 ? 6.552   8.489   -4.727  1.00 27.70 ? 851  ALA A N   1 
ATOM   2395 C  CA  . ALA A 1 371 ? 6.127   7.372   -3.886  1.00 27.33 ? 851  ALA A CA  1 
ATOM   2396 C  C   . ALA A 1 371 ? 7.132   6.224   -3.929  1.00 27.10 ? 851  ALA A C   1 
ATOM   2397 O  O   . ALA A 1 371 ? 7.573   5.738   -2.885  1.00 26.92 ? 851  ALA A O   1 
ATOM   2398 C  CB  . ALA A 1 371 ? 4.758   6.887   -4.322  1.00 27.24 ? 851  ALA A CB  1 
ATOM   2399 N  N   . SER A 1 372 ? 7.494   5.806   -5.140  1.00 26.79 ? 852  SER A N   1 
ATOM   2400 C  CA  . SER A 1 372 ? 8.465   4.727   -5.332  1.00 26.84 ? 852  SER A CA  1 
ATOM   2401 C  C   . SER A 1 372 ? 9.795   5.045   -4.651  1.00 26.79 ? 852  SER A C   1 
ATOM   2402 O  O   . SER A 1 372 ? 10.413  4.169   -4.039  1.00 26.74 ? 852  SER A O   1 
ATOM   2403 C  CB  . SER A 1 372 ? 8.683   4.452   -6.826  1.00 26.92 ? 852  SER A CB  1 
ATOM   2404 O  OG  . SER A 1 372 ? 7.499   3.941   -7.428  1.00 27.07 ? 852  SER A OG  1 
ATOM   2405 N  N   . GLU A 1 373 ? 10.219  6.303   -4.750  1.00 26.73 ? 853  GLU A N   1 
ATOM   2406 C  CA  . GLU A 1 373 ? 11.428  6.775   -4.076  1.00 26.80 ? 853  GLU A CA  1 
ATOM   2407 C  C   . GLU A 1 373 ? 11.307  6.608   -2.558  1.00 26.64 ? 853  GLU A C   1 
ATOM   2408 O  O   . GLU A 1 373 ? 12.241  6.145   -1.905  1.00 26.82 ? 853  GLU A O   1 
ATOM   2409 C  CB  . GLU A 1 373 ? 11.711  8.248   -4.431  1.00 26.85 ? 853  GLU A CB  1 
ATOM   2410 C  CG  . GLU A 1 373 ? 13.037  8.778   -3.898  1.00 27.42 ? 853  GLU A CG  1 
ATOM   2411 C  CD  . GLU A 1 373 ? 13.127  10.296  -3.903  1.00 28.10 ? 853  GLU A CD  1 
ATOM   2412 O  OE1 . GLU A 1 373 ? 12.615  10.940  -4.845  1.00 29.11 ? 853  GLU A OE1 1 
ATOM   2413 O  OE2 . GLU A 1 373 ? 13.723  10.848  -2.956  1.00 28.60 ? 853  GLU A OE2 1 
ATOM   2414 N  N   . ALA A 1 374 ? 10.160  6.985   -2.002  1.00 26.46 ? 854  ALA A N   1 
ATOM   2415 C  CA  . ALA A 1 374 ? 9.943   6.892   -0.556  1.00 26.41 ? 854  ALA A CA  1 
ATOM   2416 C  C   . ALA A 1 374 ? 9.848   5.441   -0.072  1.00 26.54 ? 854  ALA A C   1 
ATOM   2417 O  O   . ALA A 1 374 ? 10.228  5.138   1.054   1.00 26.51 ? 854  ALA A O   1 
ATOM   2418 C  CB  . ALA A 1 374 ? 8.696   7.667   -0.153  1.00 26.20 ? 854  ALA A CB  1 
ATOM   2419 N  N   . CYS A 1 375 ? 9.346   4.545   -0.917  1.00 26.84 ? 855  CYS A N   1 
ATOM   2420 C  CA  . CYS A 1 375 ? 9.238   3.134   -0.540  1.00 27.05 ? 855  CYS A CA  1 
ATOM   2421 C  C   . CYS A 1 375 ? 10.600  2.451   -0.523  1.00 26.92 ? 855  CYS A C   1 
ATOM   2422 O  O   . CYS A 1 375 ? 10.893  1.672   0.384   1.00 27.11 ? 855  CYS A O   1 
ATOM   2423 C  CB  . CYS A 1 375 ? 8.285   2.397   -1.470  1.00 27.05 ? 855  CYS A CB  1 
ATOM   2424 S  SG  . CYS A 1 375 ? 6.588   2.934   -1.272  1.00 28.06 ? 855  CYS A SG  1 
ATOM   2425 N  N   . VAL A 1 376 ? 11.430  2.752   -1.519  1.00 26.81 ? 856  VAL A N   1 
ATOM   2426 C  CA  . VAL A 1 376 ? 12.774  2.179   -1.599  1.00 26.55 ? 856  VAL A CA  1 
ATOM   2427 C  C   . VAL A 1 376 ? 13.635  2.660   -0.436  1.00 26.41 ? 856  VAL A C   1 
ATOM   2428 O  O   . VAL A 1 376 ? 14.358  1.870   0.168   1.00 26.24 ? 856  VAL A O   1 
ATOM   2429 C  CB  . VAL A 1 376 ? 13.455  2.495   -2.959  1.00 26.59 ? 856  VAL A CB  1 
ATOM   2430 C  CG1 . VAL A 1 376 ? 14.953  2.196   -2.910  1.00 26.08 ? 856  VAL A CG1 1 
ATOM   2431 C  CG2 . VAL A 1 376 ? 12.792  1.696   -4.074  1.00 25.83 ? 856  VAL A CG2 1 
ATOM   2432 N  N   . ALA A 1 377 ? 13.538  3.950   -0.121  1.00 26.44 ? 857  ALA A N   1 
ATOM   2433 C  CA  . ALA A 1 377 ? 14.249  4.535   1.024   1.00 26.45 ? 857  ALA A CA  1 
ATOM   2434 C  C   . ALA A 1 377 ? 13.872  3.850   2.338   1.00 26.37 ? 857  ALA A C   1 
ATOM   2435 O  O   . ALA A 1 377 ? 14.737  3.564   3.163   1.00 26.41 ? 857  ALA A O   1 
ATOM   2436 C  CB  . ALA A 1 377 ? 13.978  6.040   1.114   1.00 26.32 ? 857  ALA A CB  1 
ATOM   2437 N  N   . ALA A 1 378 ? 12.581  3.590   2.522   1.00 26.45 ? 858  ALA A N   1 
ATOM   2438 C  CA  . ALA A 1 378 ? 12.094  2.835   3.682   1.00 26.57 ? 858  ALA A CA  1 
ATOM   2439 C  C   . ALA A 1 378 ? 12.699  1.435   3.723   1.00 26.76 ? 858  ALA A C   1 
ATOM   2440 O  O   . ALA A 1 378 ? 13.172  0.984   4.767   1.00 26.80 ? 858  ALA A O   1 
ATOM   2441 C  CB  . ALA A 1 378 ? 10.576  2.746   3.657   1.00 26.29 ? 858  ALA A CB  1 
ATOM   2442 N  N   . LEU A 1 379 ? 12.680  0.759   2.579   1.00 27.13 ? 859  LEU A N   1 
ATOM   2443 C  CA  . LEU A 1 379 ? 13.294  -0.566  2.432   1.00 27.42 ? 859  LEU A CA  1 
ATOM   2444 C  C   . LEU A 1 379 ? 14.776  -0.563  2.824   1.00 27.74 ? 859  LEU A C   1 
ATOM   2445 O  O   . LEU A 1 379 ? 15.251  -1.514  3.442   1.00 27.83 ? 859  LEU A O   1 
ATOM   2446 C  CB  . LEU A 1 379 ? 13.118  -1.085  0.992   1.00 27.38 ? 859  LEU A CB  1 
ATOM   2447 C  CG  . LEU A 1 379 ? 11.992  -2.083  0.662   1.00 27.73 ? 859  LEU A CG  1 
ATOM   2448 C  CD1 . LEU A 1 379 ? 10.898  -2.157  1.713   1.00 27.82 ? 859  LEU A CD1 1 
ATOM   2449 C  CD2 . LEU A 1 379 ? 11.390  -1.799  -0.714  1.00 27.69 ? 859  LEU A CD2 1 
ATOM   2450 N  N   . LEU A 1 380 ? 15.494  0.509   2.481   1.00 28.15 ? 860  LEU A N   1 
ATOM   2451 C  CA  . LEU A 1 380 ? 16.921  0.624   2.805   1.00 28.37 ? 860  LEU A CA  1 
ATOM   2452 C  C   . LEU A 1 380 ? 17.172  1.007   4.265   1.00 28.96 ? 860  LEU A C   1 
ATOM   2453 O  O   . LEU A 1 380 ? 18.324  1.067   4.699   1.00 29.09 ? 860  LEU A O   1 
ATOM   2454 C  CB  . LEU A 1 380 ? 17.620  1.618   1.866   1.00 28.30 ? 860  LEU A CB  1 
ATOM   2455 C  CG  . LEU A 1 380 ? 17.898  1.108   0.444   1.00 27.84 ? 860  LEU A CG  1 
ATOM   2456 C  CD1 . LEU A 1 380 ? 18.200  2.270   -0.502  1.00 27.03 ? 860  LEU A CD1 1 
ATOM   2457 C  CD2 . LEU A 1 380 ? 19.033  0.094   0.440   1.00 26.14 ? 860  LEU A CD2 1 
ATOM   2458 N  N   . GLY A 1 381 ? 16.106  1.271   5.017   1.00 29.54 ? 861  GLY A N   1 
ATOM   2459 C  CA  . GLY A 1 381 ? 16.208  1.470   6.458   1.00 30.12 ? 861  GLY A CA  1 
ATOM   2460 C  C   . GLY A 1 381 ? 15.943  2.886   6.930   1.00 30.72 ? 861  GLY A C   1 
ATOM   2461 O  O   . GLY A 1 381 ? 15.811  3.122   8.127   1.00 30.67 ? 861  GLY A O   1 
ATOM   2462 N  N   . ASN A 1 382 ? 15.872  3.835   6.000   1.00 31.54 ? 862  ASN A N   1 
ATOM   2463 C  CA  . ASN A 1 382 ? 15.557  5.217   6.351   1.00 32.10 ? 862  ASN A CA  1 
ATOM   2464 C  C   . ASN A 1 382 ? 14.158  5.288   6.961   1.00 32.54 ? 862  ASN A C   1 
ATOM   2465 O  O   . ASN A 1 382 ? 13.232  4.633   6.481   1.00 32.62 ? 862  ASN A O   1 
ATOM   2466 C  CB  . ASN A 1 382 ? 15.675  6.127   5.124   1.00 32.21 ? 862  ASN A CB  1 
ATOM   2467 C  CG  . ASN A 1 382 ? 17.083  6.129   4.531   1.00 32.47 ? 862  ASN A CG  1 
ATOM   2468 O  OD1 . ASN A 1 382 ? 18.003  6.735   5.083   1.00 32.45 ? 862  ASN A OD1 1 
ATOM   2469 N  ND2 . ASN A 1 382 ? 17.254  5.439   3.406   1.00 32.92 ? 862  ASN A ND2 1 
ATOM   2470 N  N   . ARG A 1 383 ? 14.021  6.076   8.025   1.00 33.13 ? 863  ARG A N   1 
ATOM   2471 C  CA  . ARG A 1 383 ? 12.818  6.079   8.859   1.00 33.67 ? 863  ARG A CA  1 
ATOM   2472 C  C   . ARG A 1 383 ? 12.061  7.391   8.735   1.00 33.72 ? 863  ARG A C   1 
ATOM   2473 O  O   . ARG A 1 383 ? 12.662  8.443   8.546   1.00 33.96 ? 863  ARG A O   1 
ATOM   2474 C  CB  . ARG A 1 383 ? 13.204  5.846   10.322  1.00 33.89 ? 863  ARG A CB  1 
ATOM   2475 C  CG  . ARG A 1 383 ? 14.059  4.608   10.532  1.00 35.06 ? 863  ARG A CG  1 
ATOM   2476 C  CD  . ARG A 1 383 ? 14.639  4.529   11.940  1.00 36.87 ? 863  ARG A CD  1 
ATOM   2477 N  NE  . ARG A 1 383 ? 13.613  4.335   12.962  1.00 38.56 ? 863  ARG A NE  1 
ATOM   2478 C  CZ  . ARG A 1 383 ? 12.916  3.211   13.146  1.00 40.06 ? 863  ARG A CZ  1 
ATOM   2479 N  NH1 . ARG A 1 383 ? 13.103  2.142   12.371  1.00 40.47 ? 863  ARG A NH1 1 
ATOM   2480 N  NH2 . ARG A 1 383 ? 12.009  3.157   14.117  1.00 41.02 ? 863  ARG A NH2 1 
ATOM   2481 N  N   . VAL A 1 384 ? 10.739  7.320   8.847   1.00 33.90 ? 864  VAL A N   1 
ATOM   2482 C  CA  . VAL A 1 384 ? 9.887   8.502   8.784   1.00 33.96 ? 864  VAL A CA  1 
ATOM   2483 C  C   . VAL A 1 384 ? 9.409   8.879   10.182  1.00 34.09 ? 864  VAL A C   1 
ATOM   2484 O  O   . VAL A 1 384 ? 8.771   8.079   10.865  1.00 34.14 ? 864  VAL A O   1 
ATOM   2485 C  CB  . VAL A 1 384 ? 8.664   8.258   7.886   1.00 33.97 ? 864  VAL A CB  1 
ATOM   2486 C  CG1 . VAL A 1 384 ? 7.698   9.432   7.967   1.00 34.18 ? 864  VAL A CG1 1 
ATOM   2487 C  CG2 . VAL A 1 384 ? 9.099   8.006   6.446   1.00 33.86 ? 864  VAL A CG2 1 
ATOM   2488 N  N   . ASP A 1 385 ? 9.725   10.100  10.600  1.00 34.23 ? 865  ASP A N   1 
ATOM   2489 C  CA  . ASP A 1 385 ? 9.259   10.634  11.874  1.00 34.30 ? 865  ASP A CA  1 
ATOM   2490 C  C   . ASP A 1 385 ? 7.808   11.101  11.729  1.00 34.44 ? 865  ASP A C   1 
ATOM   2491 O  O   . ASP A 1 385 ? 7.552   12.091  11.047  1.00 34.48 ? 865  ASP A O   1 
ATOM   2492 C  CB  . ASP A 1 385 ? 10.153  11.801  12.306  1.00 34.29 ? 865  ASP A CB  1 
ATOM   2493 C  CG  . ASP A 1 385 ? 9.688   12.462  13.591  1.00 34.11 ? 865  ASP A CG  1 
ATOM   2494 O  OD1 . ASP A 1 385 ? 8.790   11.916  14.264  1.00 33.82 ? 865  ASP A OD1 1 
ATOM   2495 O  OD2 . ASP A 1 385 ? 10.232  13.535  13.929  1.00 34.17 ? 865  ASP A OD2 1 
ATOM   2496 N  N   . PRO A 1 386 ? 6.854   10.407  12.384  1.00 34.57 ? 866  PRO A N   1 
ATOM   2497 C  CA  . PRO A 1 386 ? 5.441   10.794  12.264  1.00 34.62 ? 866  PRO A CA  1 
ATOM   2498 C  C   . PRO A 1 386 ? 5.112   12.173  12.849  1.00 34.64 ? 866  PRO A C   1 
ATOM   2499 O  O   . PRO A 1 386 ? 4.083   12.753  12.505  1.00 34.76 ? 866  PRO A O   1 
ATOM   2500 C  CB  . PRO A 1 386 ? 4.703   9.701   13.051  1.00 34.63 ? 866  PRO A CB  1 
ATOM   2501 C  CG  . PRO A 1 386 ? 5.697   8.626   13.274  1.00 34.66 ? 866  PRO A CG  1 
ATOM   2502 C  CD  . PRO A 1 386 ? 7.018   9.290   13.329  1.00 34.53 ? 866  PRO A CD  1 
ATOM   2503 N  N   . LEU A 1 387 ? 5.972   12.688  13.722  1.00 34.63 ? 867  LEU A N   1 
ATOM   2504 C  CA  . LEU A 1 387 ? 5.791   14.025  14.289  1.00 34.68 ? 867  LEU A CA  1 
ATOM   2505 C  C   . LEU A 1 387 ? 6.344   15.133  13.383  1.00 34.75 ? 867  LEU A C   1 
ATOM   2506 O  O   . LEU A 1 387 ? 6.249   16.310  13.724  1.00 34.93 ? 867  LEU A O   1 
ATOM   2507 C  CB  . LEU A 1 387 ? 6.455   14.109  15.668  1.00 34.45 ? 867  LEU A CB  1 
ATOM   2508 N  N   . SER A 1 388 ? 6.911   14.770  12.235  1.00 34.77 ? 868  SER A N   1 
ATOM   2509 C  CA  . SER A 1 388 ? 7.534   15.751  11.345  1.00 34.80 ? 868  SER A CA  1 
ATOM   2510 C  C   . SER A 1 388 ? 6.553   16.372  10.351  1.00 34.91 ? 868  SER A C   1 
ATOM   2511 O  O   . SER A 1 388 ? 6.952   17.197  9.530   1.00 35.10 ? 868  SER A O   1 
ATOM   2512 C  CB  . SER A 1 388 ? 8.685   15.104  10.569  1.00 34.78 ? 868  SER A CB  1 
ATOM   2513 O  OG  . SER A 1 388 ? 8.202   14.269  9.527   1.00 34.73 ? 868  SER A OG  1 
ATOM   2514 N  N   . GLU A 1 389 ? 5.281   15.986  10.423  1.00 34.94 ? 869  GLU A N   1 
ATOM   2515 C  CA  . GLU A 1 389 ? 4.302   16.383  9.419   1.00 34.95 ? 869  GLU A CA  1 
ATOM   2516 C  C   . GLU A 1 389 ? 2.960   16.750  10.053  1.00 34.76 ? 869  GLU A C   1 
ATOM   2517 O  O   . GLU A 1 389 ? 2.242   15.882  10.545  1.00 34.90 ? 869  GLU A O   1 
ATOM   2518 C  CB  . GLU A 1 389 ? 4.115   15.238  8.417   1.00 35.14 ? 869  GLU A CB  1 
ATOM   2519 C  CG  . GLU A 1 389 ? 3.582   15.668  7.054   1.00 35.90 ? 869  GLU A CG  1 
ATOM   2520 C  CD  . GLU A 1 389 ? 4.633   16.364  6.205   1.00 36.60 ? 869  GLU A CD  1 
ATOM   2521 O  OE1 . GLU A 1 389 ? 5.684   15.745  5.933   1.00 37.28 ? 869  GLU A OE1 1 
ATOM   2522 O  OE2 . GLU A 1 389 ? 4.407   17.526  5.806   1.00 36.84 ? 869  GLU A OE2 1 
ATOM   2523 N  N   . GLU A 1 390 ? 2.629   18.040  10.052  1.00 34.50 ? 870  GLU A N   1 
ATOM   2524 C  CA  . GLU A 1 390 ? 1.278   18.485  10.388  1.00 34.21 ? 870  GLU A CA  1 
ATOM   2525 C  C   . GLU A 1 390 ? 0.351   17.950  9.300   1.00 34.11 ? 870  GLU A C   1 
ATOM   2526 O  O   . GLU A 1 390 ? 0.779   17.727  8.159   1.00 34.20 ? 870  GLU A O   1 
ATOM   2527 N  N   . GLY A 1 391 ? -0.912  17.724  9.644   1.00 33.81 ? 871  GLY A N   1 
ATOM   2528 C  CA  . GLY A 1 391 ? -1.836  17.076  8.712   1.00 33.50 ? 871  GLY A CA  1 
ATOM   2529 C  C   . GLY A 1 391 ? -2.000  15.614  9.066   1.00 33.28 ? 871  GLY A C   1 
ATOM   2530 O  O   . GLY A 1 391 ? -3.101  15.076  8.978   1.00 33.49 ? 871  GLY A O   1 
ATOM   2531 N  N   . TRP A 1 392 ? -0.903  14.968  9.465   1.00 32.83 ? 872  TRP A N   1 
ATOM   2532 C  CA  . TRP A 1 392 ? -0.965  13.651  10.098  1.00 32.46 ? 872  TRP A CA  1 
ATOM   2533 C  C   . TRP A 1 392 ? -1.572  13.786  11.494  1.00 32.40 ? 872  TRP A C   1 
ATOM   2534 O  O   . TRP A 1 392 ? -2.004  12.795  12.087  1.00 32.33 ? 872  TRP A O   1 
ATOM   2535 C  CB  . TRP A 1 392 ? 0.427   13.012  10.180  1.00 32.33 ? 872  TRP A CB  1 
ATOM   2536 C  CG  . TRP A 1 392 ? 0.967   12.540  8.853   1.00 32.05 ? 872  TRP A CG  1 
ATOM   2537 C  CD1 . TRP A 1 392 ? 0.586   12.964  7.611   1.00 31.85 ? 872  TRP A CD1 1 
ATOM   2538 C  CD2 . TRP A 1 392 ? 2.005   11.573  8.642   1.00 31.67 ? 872  TRP A CD2 1 
ATOM   2539 N  NE1 . TRP A 1 392 ? 1.311   12.313  6.642   1.00 31.83 ? 872  TRP A NE1 1 
ATOM   2540 C  CE2 . TRP A 1 392 ? 2.189   11.454  7.246   1.00 31.81 ? 872  TRP A CE2 1 
ATOM   2541 C  CE3 . TRP A 1 392 ? 2.791   10.791  9.495   1.00 31.49 ? 872  TRP A CE3 1 
ATOM   2542 C  CZ2 . TRP A 1 392 ? 3.127   10.584  6.683   1.00 31.46 ? 872  TRP A CZ2 1 
ATOM   2543 C  CZ3 . TRP A 1 392 ? 3.724   9.924   8.935   1.00 31.61 ? 872  TRP A CZ3 1 
ATOM   2544 C  CH2 . TRP A 1 392 ? 3.883   9.829   7.540   1.00 31.46 ? 872  TRP A CH2 1 
ATOM   2545 N  N   . LYS A 1 393 ? -1.596  15.018  12.009  1.00 32.23 ? 873  LYS A N   1 
ATOM   2546 C  CA  . LYS A 1 393 ? -2.274  15.343  13.264  1.00 32.10 ? 873  LYS A CA  1 
ATOM   2547 C  C   . LYS A 1 393 ? -3.793  15.455  13.101  1.00 31.91 ? 873  LYS A C   1 
ATOM   2548 O  O   . LYS A 1 393 ? -4.515  15.506  14.096  1.00 32.02 ? 873  LYS A O   1 
ATOM   2549 C  CB  . LYS A 1 393 ? -1.752  16.669  13.828  1.00 32.10 ? 873  LYS A CB  1 
ATOM   2550 C  CG  . LYS A 1 393 ? -0.256  16.715  14.106  1.00 32.45 ? 873  LYS A CG  1 
ATOM   2551 C  CD  . LYS A 1 393 ? 0.164   18.112  14.551  1.00 32.86 ? 873  LYS A CD  1 
ATOM   2552 C  CE  . LYS A 1 393 ? 1.677   18.276  14.601  1.00 33.22 ? 873  LYS A CE  1 
ATOM   2553 N  NZ  . LYS A 1 393 ? 2.075   19.666  14.995  1.00 33.45 ? 873  LYS A NZ  1 
ATOM   2554 N  N   . GLN A 1 394 ? -4.277  15.518  11.862  1.00 31.65 ? 874  GLN A N   1 
ATOM   2555 C  CA  . GLN A 1 394 ? -5.711  15.638  11.608  1.00 31.55 ? 874  GLN A CA  1 
ATOM   2556 C  C   . GLN A 1 394 ? -6.405  14.290  11.769  1.00 31.26 ? 874  GLN A C   1 
ATOM   2557 O  O   . GLN A 1 394 ? -5.888  13.262  11.336  1.00 31.18 ? 874  GLN A O   1 
ATOM   2558 C  CB  . GLN A 1 394 ? -5.982  16.193  10.201  1.00 31.60 ? 874  GLN A CB  1 
ATOM   2559 C  CG  . GLN A 1 394 ? -5.424  17.594  9.942   1.00 32.09 ? 874  GLN A CG  1 
ATOM   2560 C  CD  . GLN A 1 394 ? -6.088  18.684  10.781  1.00 32.88 ? 874  GLN A CD  1 
ATOM   2561 O  OE1 . GLN A 1 394 ? -7.061  18.441  11.498  1.00 33.46 ? 874  GLN A OE1 1 
ATOM   2562 N  NE2 . GLN A 1 394 ? -5.556  19.897  10.690  1.00 33.40 ? 874  GLN A NE2 1 
ATOM   2563 N  N   . LYS A 1 395 ? -7.578  14.307  12.397  1.00 30.99 ? 875  LYS A N   1 
ATOM   2564 C  CA  . LYS A 1 395 ? -8.400  13.113  12.532  1.00 30.70 ? 875  LYS A CA  1 
ATOM   2565 C  C   . LYS A 1 395 ? -8.883  12.675  11.150  1.00 30.48 ? 875  LYS A C   1 
ATOM   2566 O  O   . LYS A 1 395 ? -9.118  13.517  10.282  1.00 30.41 ? 875  LYS A O   1 
ATOM   2567 C  CB  . LYS A 1 395 ? -9.596  13.386  13.451  1.00 30.60 ? 875  LYS A CB  1 
ATOM   2568 N  N   . PRO A 1 396 ? -9.016  11.356  10.929  1.00 30.23 ? 876  PRO A N   1 
ATOM   2569 C  CA  . PRO A 1 396 ? -9.537  10.901  9.641   1.00 29.99 ? 876  PRO A CA  1 
ATOM   2570 C  C   . PRO A 1 396 ? -10.997 11.308  9.456   1.00 29.78 ? 876  PRO A C   1 
ATOM   2571 O  O   . PRO A 1 396 ? -11.733 11.411  10.434  1.00 29.55 ? 876  PRO A O   1 
ATOM   2572 C  CB  . PRO A 1 396 ? -9.401  9.377   9.726   1.00 30.01 ? 876  PRO A CB  1 
ATOM   2573 C  CG  . PRO A 1 396 ? -9.403  9.075   11.177  1.00 29.87 ? 876  PRO A CG  1 
ATOM   2574 C  CD  . PRO A 1 396 ? -8.726  10.231  11.836  1.00 30.07 ? 876  PRO A CD  1 
ATOM   2575 N  N   . ASN A 1 397 ? -11.408 11.530  8.210   1.00 29.76 ? 877  ASN A N   1 
ATOM   2576 C  CA  . ASN A 1 397 ? -12.762 12.007  7.929   1.00 29.60 ? 877  ASN A CA  1 
ATOM   2577 C  C   . ASN A 1 397 ? -13.833 10.955  8.224   1.00 29.52 ? 877  ASN A C   1 
ATOM   2578 O  O   . ASN A 1 397 ? -13.536 9.769   8.361   1.00 29.52 ? 877  ASN A O   1 
ATOM   2579 C  CB  . ASN A 1 397 ? -12.876 12.550  6.492   1.00 29.61 ? 877  ASN A CB  1 
ATOM   2580 C  CG  . ASN A 1 397 ? -12.948 11.455  5.437   1.00 29.52 ? 877  ASN A CG  1 
ATOM   2581 O  OD1 . ASN A 1 397 ? -13.857 10.627  5.445   1.00 29.70 ? 877  ASN A OD1 1 
ATOM   2582 N  ND2 . ASN A 1 397 ? -12.008 11.473  4.499   1.00 29.33 ? 877  ASN A ND2 1 
ATOM   2583 N  N   . LEU A 1 398 ? -15.077 11.415  8.306   1.00 29.47 ? 878  LEU A N   1 
ATOM   2584 C  CA  . LEU A 1 398 ? -16.200 10.595  8.756   1.00 29.40 ? 878  LEU A CA  1 
ATOM   2585 C  C   . LEU A 1 398 ? -16.512 9.418   7.834   1.00 29.25 ? 878  LEU A C   1 
ATOM   2586 O  O   . LEU A 1 398 ? -16.998 8.388   8.298   1.00 29.41 ? 878  LEU A O   1 
ATOM   2587 C  CB  . LEU A 1 398 ? -17.449 11.470  8.914   1.00 29.46 ? 878  LEU A CB  1 
ATOM   2588 C  CG  . LEU A 1 398 ? -18.663 10.850  9.609   1.00 29.70 ? 878  LEU A CG  1 
ATOM   2589 C  CD1 . LEU A 1 398 ? -18.283 10.241  10.955  1.00 29.45 ? 878  LEU A CD1 1 
ATOM   2590 C  CD2 . LEU A 1 398 ? -19.763 11.895  9.780   1.00 29.44 ? 878  LEU A CD2 1 
ATOM   2591 N  N   . ASN A 1 399 ? -16.243 9.568   6.538   1.00 29.01 ? 879  ASN A N   1 
ATOM   2592 C  CA  . ASN A 1 399 ? -16.448 8.474   5.582   1.00 28.79 ? 879  ASN A CA  1 
ATOM   2593 C  C   . ASN A 1 399 ? -15.474 7.328   5.815   1.00 28.79 ? 879  ASN A C   1 
ATOM   2594 O  O   . ASN A 1 399 ? -15.849 6.159   5.728   1.00 28.76 ? 879  ASN A O   1 
ATOM   2595 C  CB  . ASN A 1 399 ? -16.305 8.963   4.139   1.00 28.62 ? 879  ASN A CB  1 
ATOM   2596 C  CG  . ASN A 1 399 ? -17.396 9.935   3.734   1.00 28.32 ? 879  ASN A CG  1 
ATOM   2597 O  OD1 . ASN A 1 399 ? -17.163 10.833  2.928   1.00 28.25 ? 879  ASN A OD1 1 
ATOM   2598 N  ND2 . ASN A 1 399 ? -18.593 9.757   4.282   1.00 27.22 ? 879  ASN A ND2 1 
ATOM   2599 N  N   . ALA A 1 400 ? -14.222 7.670   6.100   1.00 28.78 ? 880  ALA A N   1 
ATOM   2600 C  CA  . ALA A 1 400 ? -13.205 6.671   6.398   1.00 28.79 ? 880  ALA A CA  1 
ATOM   2601 C  C   . ALA A 1 400 ? -13.489 5.973   7.731   1.00 28.76 ? 880  ALA A C   1 
ATOM   2602 O  O   . ALA A 1 400 ? -13.249 4.776   7.863   1.00 28.83 ? 880  ALA A O   1 
ATOM   2603 C  CB  . ALA A 1 400 ? -11.829 7.310   6.414   1.00 28.73 ? 880  ALA A CB  1 
ATOM   2604 N  N   . ILE A 1 401 ? -14.003 6.717   8.709   1.00 28.74 ? 881  ILE A N   1 
ATOM   2605 C  CA  . ILE A 1 401 ? -14.342 6.139   10.012  1.00 28.82 ? 881  ILE A CA  1 
ATOM   2606 C  C   . ILE A 1 401 ? -15.502 5.144   9.895   1.00 28.93 ? 881  ILE A C   1 
ATOM   2607 O  O   . ILE A 1 401 ? -15.458 4.068   10.490  1.00 28.83 ? 881  ILE A O   1 
ATOM   2608 C  CB  . ILE A 1 401 ? -14.666 7.228   11.065  1.00 28.78 ? 881  ILE A CB  1 
ATOM   2609 C  CG1 . ILE A 1 401 ? -13.408 8.034   11.395  1.00 28.63 ? 881  ILE A CG1 1 
ATOM   2610 C  CG2 . ILE A 1 401 ? -15.205 6.603   12.344  1.00 28.67 ? 881  ILE A CG2 1 
ATOM   2611 C  CD1 . ILE A 1 401 ? -13.609 9.065   12.484  1.00 28.23 ? 881  ILE A CD1 1 
ATOM   2612 N  N   . ARG A 1 402 ? -16.524 5.492   9.119   1.00 29.05 ? 882  ARG A N   1 
ATOM   2613 C  CA  . ARG A 1 402 ? -17.636 4.571   8.873   1.00 29.28 ? 882  ARG A CA  1 
ATOM   2614 C  C   . ARG A 1 402 ? -17.201 3.361   8.056   1.00 29.33 ? 882  ARG A C   1 
ATOM   2615 O  O   . ARG A 1 402 ? -17.695 2.256   8.270   1.00 29.50 ? 882  ARG A O   1 
ATOM   2616 C  CB  . ARG A 1 402 ? -18.780 5.279   8.155   1.00 29.29 ? 882  ARG A CB  1 
ATOM   2617 C  CG  . ARG A 1 402 ? -19.535 6.244   9.034   1.00 29.76 ? 882  ARG A CG  1 
ATOM   2618 C  CD  . ARG A 1 402 ? -20.413 7.156   8.210   1.00 30.36 ? 882  ARG A CD  1 
ATOM   2619 N  NE  . ARG A 1 402 ? -21.087 8.148   9.042   1.00 30.88 ? 882  ARG A NE  1 
ATOM   2620 C  CZ  . ARG A 1 402 ? -21.794 9.172   8.572   1.00 31.28 ? 882  ARG A CZ  1 
ATOM   2621 N  NH1 . ARG A 1 402 ? -21.932 9.358   7.260   1.00 31.54 ? 882  ARG A NH1 1 
ATOM   2622 N  NH2 . ARG A 1 402 ? -22.365 10.019  9.419   1.00 31.28 ? 882  ARG A NH2 1 
ATOM   2623 N  N   . SER A 1 403 ? -16.287 3.578   7.115   1.00 29.35 ? 883  SER A N   1 
ATOM   2624 C  CA  . SER A 1 403 ? -15.758 2.499   6.286   1.00 29.31 ? 883  SER A CA  1 
ATOM   2625 C  C   . SER A 1 403 ? -15.019 1.479   7.152   1.00 29.49 ? 883  SER A C   1 
ATOM   2626 O  O   . SER A 1 403 ? -15.258 0.270   7.056   1.00 29.10 ? 883  SER A O   1 
ATOM   2627 C  CB  . SER A 1 403 ? -14.819 3.060   5.211   1.00 29.30 ? 883  SER A CB  1 
ATOM   2628 O  OG  . SER A 1 403 ? -15.520 3.875   4.281   1.00 29.28 ? 883  SER A OG  1 
ATOM   2629 N  N   . LEU A 1 404 ? -14.129 1.983   8.005   1.00 29.63 ? 884  LEU A N   1 
ATOM   2630 C  CA  . LEU A 1 404 ? -13.379 1.138   8.925   1.00 29.76 ? 884  LEU A CA  1 
ATOM   2631 C  C   . LEU A 1 404 ? -14.304 0.486   9.949   1.00 29.83 ? 884  LEU A C   1 
ATOM   2632 O  O   . LEU A 1 404 ? -14.100 -0.667  10.324  1.00 29.64 ? 884  LEU A O   1 
ATOM   2633 C  CB  . LEU A 1 404 ? -12.287 1.945   9.632   1.00 29.76 ? 884  LEU A CB  1 
ATOM   2634 C  CG  . LEU A 1 404 ? -11.120 2.386   8.748   1.00 29.78 ? 884  LEU A CG  1 
ATOM   2635 C  CD1 . LEU A 1 404 ? -10.145 3.234   9.551   1.00 29.75 ? 884  LEU A CD1 1 
ATOM   2636 C  CD2 . LEU A 1 404 ? -10.412 1.181   8.141   1.00 29.60 ? 884  LEU A CD2 1 
ATOM   2637 N  N   . GLU A 1 405 ? -15.321 1.225   10.386  1.00 30.00 ? 885  GLU A N   1 
ATOM   2638 C  CA  . GLU A 1 405 ? -16.314 0.690   11.317  1.00 30.19 ? 885  GLU A CA  1 
ATOM   2639 C  C   . GLU A 1 405 ? -17.000 -0.544  10.729  1.00 30.21 ? 885  GLU A C   1 
ATOM   2640 O  O   . GLU A 1 405 ? -17.226 -1.526  11.438  1.00 30.51 ? 885  GLU A O   1 
ATOM   2641 C  CB  . GLU A 1 405 ? -17.350 1.761   11.677  1.00 30.21 ? 885  GLU A CB  1 
ATOM   2642 C  CG  . GLU A 1 405 ? -18.501 1.291   12.573  1.00 30.71 ? 885  GLU A CG  1 
ATOM   2643 C  CD  . GLU A 1 405 ? -18.102 1.085   14.029  1.00 31.34 ? 885  GLU A CD  1 
ATOM   2644 O  OE1 . GLU A 1 405 ? -16.898 0.937   14.320  1.00 31.40 ? 885  GLU A OE1 1 
ATOM   2645 O  OE2 . GLU A 1 405 ? -19.004 1.059   14.894  1.00 31.83 ? 885  GLU A OE2 1 
ATOM   2646 N  N   . ALA A 1 406 ? -17.319 -0.489  9.439   1.00 30.05 ? 886  ALA A N   1 
ATOM   2647 C  CA  . ALA A 1 406 ? -17.921 -1.626  8.747   1.00 29.97 ? 886  ALA A CA  1 
ATOM   2648 C  C   . ALA A 1 406 ? -16.949 -2.808  8.654   1.00 29.87 ? 886  ALA A C   1 
ATOM   2649 O  O   . ALA A 1 406 ? -17.359 -3.956  8.812   1.00 30.12 ? 886  ALA A O   1 
ATOM   2650 C  CB  . ALA A 1 406 ? -18.403 -1.214  7.353   1.00 29.81 ? 886  ALA A CB  1 
ATOM   2651 N  N   . VAL A 1 407 ? -15.671 -2.526  8.403   1.00 29.65 ? 887  VAL A N   1 
ATOM   2652 C  CA  . VAL A 1 407 ? -14.647 -3.571  8.350   1.00 29.42 ? 887  VAL A CA  1 
ATOM   2653 C  C   . VAL A 1 407 ? -14.535 -4.268  9.704   1.00 29.51 ? 887  VAL A C   1 
ATOM   2654 O  O   . VAL A 1 407 ? -14.438 -5.491  9.773   1.00 29.54 ? 887  VAL A O   1 
ATOM   2655 C  CB  . VAL A 1 407 ? -13.254 -3.015  7.966   1.00 29.33 ? 887  VAL A CB  1 
ATOM   2656 C  CG1 . VAL A 1 407 ? -12.210 -4.137  7.948   1.00 28.99 ? 887  VAL A CG1 1 
ATOM   2657 C  CG2 . VAL A 1 407 ? -13.303 -2.328  6.628   1.00 28.91 ? 887  VAL A CG2 1 
ATOM   2658 N  N   . ILE A 1 408 ? -14.561 -3.482  10.775  1.00 29.50 ? 888  ILE A N   1 
ATOM   2659 C  CA  . ILE A 1 408 ? -14.437 -4.020  12.125  1.00 29.49 ? 888  ILE A CA  1 
ATOM   2660 C  C   . ILE A 1 408 ? -15.670 -4.843  12.512  1.00 29.47 ? 888  ILE A C   1 
ATOM   2661 O  O   . ILE A 1 408 ? -15.541 -5.890  13.145  1.00 29.63 ? 888  ILE A O   1 
ATOM   2662 C  CB  . ILE A 1 408 ? -14.201 -2.898  13.153  1.00 29.49 ? 888  ILE A CB  1 
ATOM   2663 C  CG1 . ILE A 1 408 ? -12.860 -2.210  12.885  1.00 29.55 ? 888  ILE A CG1 1 
ATOM   2664 C  CG2 . ILE A 1 408 ? -14.218 -3.454  14.571  1.00 29.36 ? 888  ILE A CG2 1 
ATOM   2665 C  CD1 . ILE A 1 408 ? -12.786 -0.806  13.443  1.00 29.85 ? 888  ILE A CD1 1 
ATOM   2666 N  N   . ARG A 1 409 ? -16.856 -4.381  12.123  1.00 29.25 ? 889  ARG A N   1 
ATOM   2667 C  CA  . ARG A 1 409 ? -18.090 -5.112  12.419  1.00 29.24 ? 889  ARG A CA  1 
ATOM   2668 C  C   . ARG A 1 409 ? -18.073 -6.501  11.786  1.00 29.16 ? 889  ARG A C   1 
ATOM   2669 O  O   . ARG A 1 409 ? -18.455 -7.480  12.419  1.00 29.30 ? 889  ARG A O   1 
ATOM   2670 C  CB  . ARG A 1 409 ? -19.324 -4.334  11.944  1.00 29.10 ? 889  ARG A CB  1 
ATOM   2671 N  N   . VAL A 1 410 ? -17.612 -6.579  10.543  1.00 29.14 ? 890  VAL A N   1 
ATOM   2672 C  CA  . VAL A 1 410 ? -17.578 -7.840  9.802   1.00 29.06 ? 890  VAL A CA  1 
ATOM   2673 C  C   . VAL A 1 410 ? -16.519 -8.802  10.350  1.00 28.98 ? 890  VAL A C   1 
ATOM   2674 O  O   . VAL A 1 410 ? -16.795 -9.983  10.563  1.00 28.73 ? 890  VAL A O   1 
ATOM   2675 C  CB  . VAL A 1 410 ? -17.313 -7.594  8.298   1.00 29.04 ? 890  VAL A CB  1 
ATOM   2676 C  CG1 . VAL A 1 410 ? -17.100 -8.904  7.566   1.00 28.90 ? 890  VAL A CG1 1 
ATOM   2677 C  CG2 . VAL A 1 410 ? -18.474 -6.824  7.676   1.00 29.06 ? 890  VAL A CG2 1 
ATOM   2678 N  N   . HIS A 1 411 ? -15.317 -8.287  10.589  1.00 28.94 ? 891  HIS A N   1 
ATOM   2679 C  CA  . HIS A 1 411 ? -14.175 -9.130  10.946  1.00 28.89 ? 891  HIS A CA  1 
ATOM   2680 C  C   . HIS A 1 411 ? -14.015 -9.405  12.442  1.00 28.96 ? 891  HIS A C   1 
ATOM   2681 O  O   . HIS A 1 411 ? -13.082 -10.102 12.843  1.00 29.17 ? 891  HIS A O   1 
ATOM   2682 C  CB  . HIS A 1 411 ? -12.888 -8.559  10.345  1.00 28.77 ? 891  HIS A CB  1 
ATOM   2683 C  CG  . HIS A 1 411 ? -12.683 -8.956  8.919   1.00 28.64 ? 891  HIS A CG  1 
ATOM   2684 N  ND1 . HIS A 1 411 ? -12.163 -10.181 8.561   1.00 28.08 ? 891  HIS A ND1 1 
ATOM   2685 C  CD2 . HIS A 1 411 ? -12.966 -8.312  7.762   1.00 28.28 ? 891  HIS A CD2 1 
ATOM   2686 C  CE1 . HIS A 1 411 ? -12.119 -10.267 7.244   1.00 28.63 ? 891  HIS A CE1 1 
ATOM   2687 N  NE2 . HIS A 1 411 ? -12.599 -9.147  6.735   1.00 27.92 ? 891  HIS A NE2 1 
ATOM   2688 N  N   . SER A 1 412 ? -14.932 -8.891  13.259  1.00 29.02 ? 892  SER A N   1 
ATOM   2689 C  CA  . SER A 1 412 ? -14.979 -9.256  14.675  1.00 29.04 ? 892  SER A CA  1 
ATOM   2690 C  C   . SER A 1 412 ? -15.465 -10.697 14.852  1.00 29.15 ? 892  SER A C   1 
ATOM   2691 O  O   . SER A 1 412 ? -15.344 -11.266 15.925  1.00 29.22 ? 892  SER A O   1 
ATOM   2692 C  CB  . SER A 1 412 ? -15.874 -8.295  15.458  1.00 28.96 ? 892  SER A CB  1 
ATOM   2693 O  OG  . SER A 1 412 ? -17.199 -8.315  14.965  1.00 28.80 ? 892  SER A OG  1 
ATOM   2694 N  N   . LYS A 1 413 ? -16.026 -11.275 13.795  1.00 29.43 ? 893  LYS A N   1 
ATOM   2695 C  CA  . LYS A 1 413 ? -16.379 -12.691 13.775  1.00 29.72 ? 893  LYS A CA  1 
ATOM   2696 C  C   . LYS A 1 413 ? -15.131 -13.590 13.730  1.00 29.62 ? 893  LYS A C   1 
ATOM   2697 O  O   . LYS A 1 413 ? -15.176 -14.738 14.177  1.00 29.56 ? 893  LYS A O   1 
ATOM   2698 C  CB  . LYS A 1 413 ? -17.268 -12.975 12.557  1.00 29.94 ? 893  LYS A CB  1 
ATOM   2699 C  CG  . LYS A 1 413 ? -17.830 -14.395 12.477  1.00 30.89 ? 893  LYS A CG  1 
ATOM   2700 C  CD  . LYS A 1 413 ? -18.786 -14.556 11.296  1.00 31.64 ? 893  LYS A CD  1 
ATOM   2701 C  CE  . LYS A 1 413 ? -19.378 -15.964 11.250  1.00 32.61 ? 893  LYS A CE  1 
ATOM   2702 N  NZ  . LYS A 1 413 ? -20.508 -16.075 10.274  1.00 32.80 ? 893  LYS A NZ  1 
ATOM   2703 N  N   . TYR A 1 414 ? -14.027 -13.055 13.205  1.00 29.50 ? 894  TYR A N   1 
ATOM   2704 C  CA  . TYR A 1 414 ? -12.845 -13.849 12.875  1.00 29.40 ? 894  TYR A CA  1 
ATOM   2705 C  C   . TYR A 1 414 ? -11.555 -13.462 13.603  1.00 29.26 ? 894  TYR A C   1 
ATOM   2706 O  O   . TYR A 1 414 ? -10.675 -14.302 13.750  1.00 29.54 ? 894  TYR A O   1 
ATOM   2707 C  CB  . TYR A 1 414 ? -12.592 -13.776 11.368  1.00 29.47 ? 894  TYR A CB  1 
ATOM   2708 C  CG  . TYR A 1 414 ? -13.760 -14.233 10.523  1.00 29.59 ? 894  TYR A CG  1 
ATOM   2709 C  CD1 . TYR A 1 414 ? -14.136 -15.571 10.498  1.00 29.46 ? 894  TYR A CD1 1 
ATOM   2710 C  CD2 . TYR A 1 414 ? -14.484 -13.331 9.743   1.00 29.85 ? 894  TYR A CD2 1 
ATOM   2711 C  CE1 . TYR A 1 414 ? -15.201 -16.003 9.727   1.00 29.95 ? 894  TYR A CE1 1 
ATOM   2712 C  CE2 . TYR A 1 414 ? -15.555 -13.753 8.960   1.00 29.89 ? 894  TYR A CE2 1 
ATOM   2713 C  CZ  . TYR A 1 414 ? -15.907 -15.093 8.957   1.00 30.20 ? 894  TYR A CZ  1 
ATOM   2714 O  OH  . TYR A 1 414 ? -16.964 -15.536 8.194   1.00 30.10 ? 894  TYR A OH  1 
ATOM   2715 N  N   . TRP A 1 415 ? -11.425 -12.214 14.047  1.00 29.07 ? 895  TRP A N   1 
ATOM   2716 C  CA  . TRP A 1 415 ? -10.161 -11.743 14.627  1.00 28.88 ? 895  TRP A CA  1 
ATOM   2717 C  C   . TRP A 1 415 ? -10.333 -11.132 16.009  1.00 29.03 ? 895  TRP A C   1 
ATOM   2718 O  O   . TRP A 1 415 ? -11.155 -10.241 16.194  1.00 29.06 ? 895  TRP A O   1 
ATOM   2719 C  CB  . TRP A 1 415 ? -9.512  -10.716 13.700  1.00 28.80 ? 895  TRP A CB  1 
ATOM   2720 C  CG  . TRP A 1 415 ? -9.258  -11.244 12.331  1.00 27.98 ? 895  TRP A CG  1 
ATOM   2721 C  CD1 . TRP A 1 415 ? -10.075 -11.133 11.253  1.00 27.25 ? 895  TRP A CD1 1 
ATOM   2722 C  CD2 . TRP A 1 415 ? -8.119  -11.994 11.899  1.00 27.21 ? 895  TRP A CD2 1 
ATOM   2723 N  NE1 . TRP A 1 415 ? -9.513  -11.757 10.168  1.00 26.95 ? 895  TRP A NE1 1 
ATOM   2724 C  CE2 . TRP A 1 415 ? -8.308  -12.289 10.537  1.00 26.73 ? 895  TRP A CE2 1 
ATOM   2725 C  CE3 . TRP A 1 415 ? -6.953  -12.440 12.532  1.00 27.48 ? 895  TRP A CE3 1 
ATOM   2726 C  CZ2 . TRP A 1 415 ? -7.376  -13.010 9.792   1.00 27.02 ? 895  TRP A CZ2 1 
ATOM   2727 C  CZ3 . TRP A 1 415 ? -6.024  -13.156 11.788  1.00 27.04 ? 895  TRP A CZ3 1 
ATOM   2728 C  CH2 . TRP A 1 415 ? -6.243  -13.434 10.433  1.00 26.70 ? 895  TRP A CH2 1 
ATOM   2729 N  N   . GLY A 1 416 ? -9.534  -11.604 16.968  1.00 29.31 ? 896  GLY A N   1 
ATOM   2730 C  CA  . GLY A 1 416 ? -9.566  -11.103 18.342  1.00 29.46 ? 896  GLY A CA  1 
ATOM   2731 C  C   . GLY A 1 416 ? -9.343  -9.606  18.458  1.00 29.80 ? 896  GLY A C   1 
ATOM   2732 O  O   . GLY A 1 416 ? -10.013 -8.933  19.243  1.00 29.53 ? 896  GLY A O   1 
ATOM   2733 N  N   . CYS A 1 417 ? -8.417  -9.076  17.664  1.00 30.22 ? 897  CYS A N   1 
ATOM   2734 C  CA  . CYS A 1 417 ? -8.124  -7.645  17.686  1.00 30.79 ? 897  CYS A CA  1 
ATOM   2735 C  C   . CYS A 1 417 ? -9.258  -6.788  17.113  1.00 31.06 ? 897  CYS A C   1 
ATOM   2736 O  O   . CYS A 1 417 ? -9.258  -5.571  17.290  1.00 31.32 ? 897  CYS A O   1 
ATOM   2737 C  CB  . CYS A 1 417 ? -6.825  -7.355  16.938  1.00 30.76 ? 897  CYS A CB  1 
ATOM   2738 S  SG  . CYS A 1 417 ? -6.881  -7.800  15.196  1.00 31.53 ? 897  CYS A SG  1 
ATOM   2739 N  N   . MET A 1 418 ? -10.212 -7.412  16.424  1.00 31.43 ? 898  MET A N   1 
ATOM   2740 C  CA  . MET A 1 418 ? -11.411 -6.716  15.949  1.00 31.81 ? 898  MET A CA  1 
ATOM   2741 C  C   . MET A 1 418 ? -12.603 -6.866  16.902  1.00 32.11 ? 898  MET A C   1 
ATOM   2742 O  O   . MET A 1 418 ? -13.605 -6.172  16.742  1.00 32.50 ? 898  MET A O   1 
ATOM   2743 C  CB  . MET A 1 418 ? -11.819 -7.234  14.566  1.00 31.91 ? 898  MET A CB  1 
ATOM   2744 C  CG  . MET A 1 418 ? -10.797 -7.019  13.460  1.00 32.07 ? 898  MET A CG  1 
ATOM   2745 S  SD  . MET A 1 418 ? -10.433 -5.284  13.107  1.00 32.85 ? 898  MET A SD  1 
ATOM   2746 C  CE  . MET A 1 418 ? -8.848  -5.096  13.921  1.00 32.40 ? 898  MET A CE  1 
ATOM   2747 N  N   . GLN A 1 419 ? -12.499 -7.768  17.878  1.00 32.35 ? 899  GLN A N   1 
ATOM   2748 C  CA  . GLN A 1 419 ? -13.593 -8.055  18.813  1.00 32.51 ? 899  GLN A CA  1 
ATOM   2749 C  C   . GLN A 1 419 ? -13.612 -7.093  19.998  1.00 32.64 ? 899  GLN A C   1 
ATOM   2750 O  O   . GLN A 1 419 ? -12.954 -7.334  21.010  1.00 32.47 ? 899  GLN A O   1 
ATOM   2751 C  CB  . GLN A 1 419 ? -13.474 -9.492  19.338  1.00 32.63 ? 899  GLN A CB  1 
ATOM   2752 C  CG  . GLN A 1 419 ? -13.812 -10.556 18.308  1.00 32.93 ? 899  GLN A CG  1 
ATOM   2753 C  CD  . GLN A 1 419 ? -13.420 -11.974 18.727  1.00 33.39 ? 899  GLN A CD  1 
ATOM   2754 O  OE1 . GLN A 1 419 ? -13.491 -12.901 17.920  1.00 33.98 ? 899  GLN A OE1 1 
ATOM   2755 N  NE2 . GLN A 1 419 ? -13.014 -12.147 19.983  1.00 32.55 ? 899  GLN A NE2 1 
ATOM   2756 N  N   . ARG A 1 420 ? -14.379 -6.014  19.880  1.00 32.82 ? 900  ARG A N   1 
ATOM   2757 C  CA  . ARG A 1 420 ? -14.525 -5.055  20.976  1.00 33.00 ? 900  ARG A CA  1 
ATOM   2758 C  C   . ARG A 1 420 ? -15.838 -5.283  21.725  1.00 32.95 ? 900  ARG A C   1 
ATOM   2759 O  O   . ARG A 1 420 ? -16.596 -6.199  21.406  1.00 32.90 ? 900  ARG A O   1 
ATOM   2760 C  CB  . ARG A 1 420 ? -14.437 -3.618  20.449  1.00 33.07 ? 900  ARG A CB  1 
ATOM   2761 C  CG  . ARG A 1 420 ? -15.699 -3.137  19.771  1.00 33.85 ? 900  ARG A CG  1 
ATOM   2762 C  CD  . ARG A 1 420 ? -15.454 -1.965  18.836  1.00 34.52 ? 900  ARG A CD  1 
ATOM   2763 N  NE  . ARG A 1 420 ? -16.233 -2.112  17.610  1.00 35.15 ? 900  ARG A NE  1 
ATOM   2764 C  CZ  . ARG A 1 420 ? -16.256 -1.232  16.616  1.00 36.07 ? 900  ARG A CZ  1 
ATOM   2765 N  NH1 . ARG A 1 420 ? -15.552 -0.105  16.684  1.00 36.28 ? 900  ARG A NH1 1 
ATOM   2766 N  NH2 . ARG A 1 420 ? -16.998 -1.483  15.545  1.00 36.80 ? 900  ARG A NH2 1 
ATOM   2767 N  N   . LEU A 1 421 ? -16.093 -4.437  22.720  1.00 33.02 ? 901  LEU A N   1 
ATOM   2768 C  CA  . LEU A 1 421 ? -17.284 -4.544  23.556  1.00 33.00 ? 901  LEU A CA  1 
ATOM   2769 C  C   . LEU A 1 421 ? -18.451 -3.814  22.896  1.00 32.95 ? 901  LEU A C   1 
ATOM   2770 O  O   . LEU A 1 421 ? -19.612 -4.044  23.235  1.00 33.03 ? 901  LEU A O   1 
ATOM   2771 C  CB  . LEU A 1 421 ? -17.005 -3.956  24.945  1.00 32.98 ? 901  LEU A CB  1 
ATOM   2772 C  CG  . LEU A 1 421 ? -17.544 -4.738  26.139  1.00 32.98 ? 901  LEU A CG  1 
ATOM   2773 C  CD1 . LEU A 1 421 ? -16.858 -6.092  26.241  1.00 33.20 ? 901  LEU A CD1 1 
ATOM   2774 C  CD2 . LEU A 1 421 ? -17.346 -3.940  27.420  1.00 33.16 ? 901  LEU A CD2 1 
ATOM   2775 N  N   . PHE B 1 38  ? 52.259  3.169   0.257   1.00 34.64 ? 518  PHE B N   1 
ATOM   2776 C  CA  . PHE B 1 38  ? 51.098  3.983   -0.200  1.00 34.59 ? 518  PHE B CA  1 
ATOM   2777 C  C   . PHE B 1 38  ? 51.555  5.013   -1.234  1.00 34.29 ? 518  PHE B C   1 
ATOM   2778 O  O   . PHE B 1 38  ? 52.158  6.028   -0.886  1.00 34.51 ? 518  PHE B O   1 
ATOM   2779 C  CB  . PHE B 1 38  ? 50.438  4.682   0.991   1.00 34.77 ? 518  PHE B CB  1 
ATOM   2780 C  CG  . PHE B 1 38  ? 49.357  3.870   1.658   1.00 35.51 ? 518  PHE B CG  1 
ATOM   2781 C  CD1 . PHE B 1 38  ? 48.143  3.648   1.013   1.00 36.19 ? 518  PHE B CD1 1 
ATOM   2782 C  CD2 . PHE B 1 38  ? 49.543  3.350   2.940   1.00 36.20 ? 518  PHE B CD2 1 
ATOM   2783 C  CE1 . PHE B 1 38  ? 47.136  2.910   1.626   1.00 36.33 ? 518  PHE B CE1 1 
ATOM   2784 C  CE2 . PHE B 1 38  ? 48.541  2.612   3.562   1.00 36.22 ? 518  PHE B CE2 1 
ATOM   2785 C  CZ  . PHE B 1 38  ? 47.335  2.394   2.903   1.00 36.40 ? 518  PHE B CZ  1 
ATOM   2786 N  N   . THR B 1 39  ? 51.264  4.746   -2.505  1.00 33.70 ? 519  THR B N   1 
ATOM   2787 C  CA  . THR B 1 39  ? 51.789  5.553   -3.598  1.00 33.24 ? 519  THR B CA  1 
ATOM   2788 C  C   . THR B 1 39  ? 50.701  6.424   -4.226  1.00 33.00 ? 519  THR B C   1 
ATOM   2789 O  O   . THR B 1 39  ? 49.514  6.083   -4.207  1.00 32.88 ? 519  THR B O   1 
ATOM   2790 C  CB  . THR B 1 39  ? 52.433  4.661   -4.675  1.00 33.25 ? 519  THR B CB  1 
ATOM   2791 O  OG1 . THR B 1 39  ? 51.484  3.684   -5.113  1.00 33.14 ? 519  THR B OG1 1 
ATOM   2792 C  CG2 . THR B 1 39  ? 53.677  3.948   -4.122  1.00 33.00 ? 519  THR B CG2 1 
ATOM   2793 N  N   . THR B 1 40  ? 51.118  7.560   -4.774  1.00 32.59 ? 520  THR B N   1 
ATOM   2794 C  CA  . THR B 1 40  ? 50.197  8.487   -5.409  1.00 32.42 ? 520  THR B CA  1 
ATOM   2795 C  C   . THR B 1 40  ? 50.162  8.172   -6.898  1.00 31.93 ? 520  THR B C   1 
ATOM   2796 O  O   . THR B 1 40  ? 51.211  7.994   -7.520  1.00 31.99 ? 520  THR B O   1 
ATOM   2797 C  CB  . THR B 1 40  ? 50.628  9.951   -5.194  1.00 32.41 ? 520  THR B CB  1 
ATOM   2798 O  OG1 . THR B 1 40  ? 51.811  10.222  -5.949  1.00 33.43 ? 520  THR B OG1 1 
ATOM   2799 C  CG2 . THR B 1 40  ? 50.916  10.209  -3.734  1.00 32.34 ? 520  THR B CG2 1 
ATOM   2800 N  N   . GLY B 1 41  ? 48.958  8.087   -7.456  1.00 31.33 ? 521  GLY B N   1 
ATOM   2801 C  CA  . GLY B 1 41  ? 48.776  7.781   -8.869  1.00 31.01 ? 521  GLY B CA  1 
ATOM   2802 C  C   . GLY B 1 41  ? 48.708  9.014   -9.755  1.00 30.69 ? 521  GLY B C   1 
ATOM   2803 O  O   . GLY B 1 41  ? 48.312  10.090  -9.310  1.00 30.40 ? 521  GLY B O   1 
ATOM   2804 N  N   . LEU B 1 42  ? 49.102  8.849   -11.017 1.00 30.39 ? 522  LEU B N   1 
ATOM   2805 C  CA  . LEU B 1 42  ? 48.980  9.905   -12.019 1.00 30.20 ? 522  LEU B CA  1 
ATOM   2806 C  C   . LEU B 1 42  ? 48.366  9.354   -13.304 1.00 30.17 ? 522  LEU B C   1 
ATOM   2807 O  O   . LEU B 1 42  ? 48.692  8.244   -13.729 1.00 30.23 ? 522  LEU B O   1 
ATOM   2808 C  CB  . LEU B 1 42  ? 50.343  10.530  -12.319 1.00 30.03 ? 522  LEU B CB  1 
ATOM   2809 C  CG  . LEU B 1 42  ? 51.041  11.243  -11.159 1.00 29.77 ? 522  LEU B CG  1 
ATOM   2810 C  CD1 . LEU B 1 42  ? 52.392  11.775  -11.604 1.00 28.90 ? 522  LEU B CD1 1 
ATOM   2811 C  CD2 . LEU B 1 42  ? 50.187  12.367  -10.602 1.00 29.55 ? 522  LEU B CD2 1 
ATOM   2812 N  N   . ILE B 1 43  ? 47.471  10.131  -13.910 1.00 30.01 ? 523  ILE B N   1 
ATOM   2813 C  CA  . ILE B 1 43  ? 46.856  9.767   -15.182 1.00 29.97 ? 523  ILE B CA  1 
ATOM   2814 C  C   . ILE B 1 43  ? 47.263  10.758  -16.267 1.00 29.75 ? 523  ILE B C   1 
ATOM   2815 O  O   . ILE B 1 43  ? 47.154  11.974  -16.084 1.00 29.61 ? 523  ILE B O   1 
ATOM   2816 C  CB  . ILE B 1 43  ? 45.317  9.755   -15.090 1.00 30.04 ? 523  ILE B CB  1 
ATOM   2817 C  CG1 . ILE B 1 43  ? 44.816  8.394   -14.604 1.00 30.12 ? 523  ILE B CG1 1 
ATOM   2818 C  CG2 . ILE B 1 43  ? 44.703  10.074  -16.449 1.00 30.37 ? 523  ILE B CG2 1 
ATOM   2819 C  CD1 . ILE B 1 43  ? 44.804  7.323   -15.670 1.00 29.22 ? 523  ILE B CD1 1 
ATOM   2820 N  N   . TYR B 1 44  ? 47.726  10.221  -17.391 1.00 29.40 ? 524  TYR B N   1 
ATOM   2821 C  CA  . TYR B 1 44  ? 48.049  11.020  -18.565 1.00 29.30 ? 524  TYR B CA  1 
ATOM   2822 C  C   . TYR B 1 44  ? 48.186  10.110  -19.780 1.00 29.12 ? 524  TYR B C   1 
ATOM   2823 O  O   . TYR B 1 44  ? 48.700  8.997   -19.670 1.00 29.03 ? 524  TYR B O   1 
ATOM   2824 C  CB  . TYR B 1 44  ? 49.357  11.788  -18.361 1.00 29.40 ? 524  TYR B CB  1 
ATOM   2825 C  CG  . TYR B 1 44  ? 49.779  12.585  -19.576 1.00 29.71 ? 524  TYR B CG  1 
ATOM   2826 C  CD1 . TYR B 1 44  ? 50.584  12.018  -20.565 1.00 29.79 ? 524  TYR B CD1 1 
ATOM   2827 C  CD2 . TYR B 1 44  ? 49.360  13.901  -19.747 1.00 30.26 ? 524  TYR B CD2 1 
ATOM   2828 C  CE1 . TYR B 1 44  ? 50.969  12.744  -21.685 1.00 29.93 ? 524  TYR B CE1 1 
ATOM   2829 C  CE2 . TYR B 1 44  ? 49.741  14.638  -20.866 1.00 30.46 ? 524  TYR B CE2 1 
ATOM   2830 C  CZ  . TYR B 1 44  ? 50.544  14.053  -21.829 1.00 30.28 ? 524  TYR B CZ  1 
ATOM   2831 O  OH  . TYR B 1 44  ? 50.916  14.782  -22.932 1.00 30.98 ? 524  TYR B OH  1 
ATOM   2832 N  N   . ASP B 1 45  ? 47.735  10.592  -20.936 1.00 28.92 ? 525  ASP B N   1 
ATOM   2833 C  CA  . ASP B 1 45  ? 47.927  9.871   -22.192 1.00 28.69 ? 525  ASP B CA  1 
ATOM   2834 C  C   . ASP B 1 45  ? 47.793  10.782  -23.407 1.00 28.58 ? 525  ASP B C   1 
ATOM   2835 O  O   . ASP B 1 45  ? 46.957  11.686  -23.435 1.00 28.67 ? 525  ASP B O   1 
ATOM   2836 C  CB  . ASP B 1 45  ? 46.937  8.715   -22.304 1.00 28.63 ? 525  ASP B CB  1 
ATOM   2837 C  CG  . ASP B 1 45  ? 47.360  7.698   -23.328 1.00 28.73 ? 525  ASP B CG  1 
ATOM   2838 O  OD1 . ASP B 1 45  ? 47.059  7.896   -24.525 1.00 28.67 ? 525  ASP B OD1 1 
ATOM   2839 O  OD2 . ASP B 1 45  ? 48.020  6.712   -22.936 1.00 28.55 ? 525  ASP B OD2 1 
ATOM   2840 N  N   . SER B 1 46  ? 48.611  10.510  -24.418 1.00 28.46 ? 526  SER B N   1 
ATOM   2841 C  CA  . SER B 1 46  ? 48.648  11.300  -25.648 1.00 28.35 ? 526  SER B CA  1 
ATOM   2842 C  C   . SER B 1 46  ? 47.327  11.323  -26.429 1.00 28.28 ? 526  SER B C   1 
ATOM   2843 O  O   . SER B 1 46  ? 47.151  12.160  -27.312 1.00 28.24 ? 526  SER B O   1 
ATOM   2844 C  CB  . SER B 1 46  ? 49.753  10.764  -26.558 1.00 28.23 ? 526  SER B CB  1 
ATOM   2845 O  OG  . SER B 1 46  ? 49.523  9.398   -26.842 1.00 28.21 ? 526  SER B OG  1 
ATOM   2846 N  N   . VAL B 1 47  ? 46.418  10.399  -26.126 1.00 28.25 ? 527  VAL B N   1 
ATOM   2847 C  CA  . VAL B 1 47  ? 45.082  10.399  -26.726 1.00 28.43 ? 527  VAL B CA  1 
ATOM   2848 C  C   . VAL B 1 47  ? 44.386  11.746  -26.531 1.00 28.49 ? 527  VAL B C   1 
ATOM   2849 O  O   . VAL B 1 47  ? 43.776  12.278  -27.454 1.00 28.70 ? 527  VAL B O   1 
ATOM   2850 C  CB  . VAL B 1 47  ? 44.188  9.293   -26.116 1.00 28.48 ? 527  VAL B CB  1 
ATOM   2851 C  CG1 . VAL B 1 47  ? 42.729  9.476   -26.537 1.00 28.63 ? 527  VAL B CG1 1 
ATOM   2852 C  CG2 . VAL B 1 47  ? 44.694  7.914   -26.520 1.00 28.46 ? 527  VAL B CG2 1 
ATOM   2853 N  N   . MET B 1 48  ? 44.500  12.296  -25.328 1.00 28.52 ? 528  MET B N   1 
ATOM   2854 C  CA  . MET B 1 48  ? 43.840  13.552  -24.983 1.00 28.39 ? 528  MET B CA  1 
ATOM   2855 C  C   . MET B 1 48  ? 44.460  14.780  -25.645 1.00 28.48 ? 528  MET B C   1 
ATOM   2856 O  O   . MET B 1 48  ? 43.865  15.853  -25.612 1.00 28.45 ? 528  MET B O   1 
ATOM   2857 C  CB  . MET B 1 48  ? 43.811  13.724  -23.464 1.00 28.24 ? 528  MET B CB  1 
ATOM   2858 C  CG  . MET B 1 48  ? 42.897  12.712  -22.787 1.00 28.06 ? 528  MET B CG  1 
ATOM   2859 S  SD  . MET B 1 48  ? 42.945  12.733  -20.991 1.00 27.35 ? 528  MET B SD  1 
ATOM   2860 C  CE  . MET B 1 48  ? 44.619  12.175  -20.686 1.00 26.50 ? 528  MET B CE  1 
ATOM   2861 N  N   . LEU B 1 49  ? 45.636  14.627  -26.252 1.00 28.62 ? 529  LEU B N   1 
ATOM   2862 C  CA  . LEU B 1 49  ? 46.284  15.737  -26.957 1.00 28.87 ? 529  LEU B CA  1 
ATOM   2863 C  C   . LEU B 1 49  ? 45.603  16.066  -28.283 1.00 29.13 ? 529  LEU B C   1 
ATOM   2864 O  O   . LEU B 1 49  ? 45.698  17.196  -28.761 1.00 29.63 ? 529  LEU B O   1 
ATOM   2865 C  CB  . LEU B 1 49  ? 47.763  15.433  -27.218 1.00 28.66 ? 529  LEU B CB  1 
ATOM   2866 C  CG  . LEU B 1 49  ? 48.660  15.219  -25.996 1.00 28.80 ? 529  LEU B CG  1 
ATOM   2867 C  CD1 . LEU B 1 49  ? 50.071  14.841  -26.432 1.00 28.16 ? 529  LEU B CD1 1 
ATOM   2868 C  CD2 . LEU B 1 49  ? 48.689  16.454  -25.106 1.00 28.26 ? 529  LEU B CD2 1 
ATOM   2869 N  N   . LYS B 1 50  ? 44.918  15.087  -28.871 1.00 29.17 ? 530  LYS B N   1 
ATOM   2870 C  CA  . LYS B 1 50  ? 44.375  15.224  -30.226 1.00 29.01 ? 530  LYS B CA  1 
ATOM   2871 C  C   . LYS B 1 50  ? 43.037  15.964  -30.289 1.00 29.11 ? 530  LYS B C   1 
ATOM   2872 O  O   . LYS B 1 50  ? 42.536  16.237  -31.380 1.00 28.83 ? 530  LYS B O   1 
ATOM   2873 C  CB  . LYS B 1 50  ? 44.255  13.849  -30.886 1.00 28.88 ? 530  LYS B CB  1 
ATOM   2874 C  CG  . LYS B 1 50  ? 45.579  13.105  -30.959 1.00 28.63 ? 530  LYS B CG  1 
ATOM   2875 C  CD  . LYS B 1 50  ? 45.504  11.892  -31.868 1.00 28.56 ? 530  LYS B CD  1 
ATOM   2876 C  CE  . LYS B 1 50  ? 46.886  11.358  -32.207 1.00 28.28 ? 530  LYS B CE  1 
ATOM   2877 N  NZ  . LYS B 1 50  ? 46.847  10.472  -33.399 1.00 28.51 ? 530  LYS B NZ  1 
ATOM   2878 N  N   . HIS B 1 51  ? 42.459  16.274  -29.127 1.00 29.53 ? 531  HIS B N   1 
ATOM   2879 C  CA  . HIS B 1 51  ? 41.296  17.164  -29.052 1.00 29.75 ? 531  HIS B CA  1 
ATOM   2880 C  C   . HIS B 1 51  ? 41.742  18.569  -29.434 1.00 30.11 ? 531  HIS B C   1 
ATOM   2881 O  O   . HIS B 1 51  ? 42.277  19.311  -28.612 1.00 30.11 ? 531  HIS B O   1 
ATOM   2882 C  CB  . HIS B 1 51  ? 40.701  17.168  -27.646 1.00 29.78 ? 531  HIS B CB  1 
ATOM   2883 C  CG  . HIS B 1 51  ? 39.541  18.102  -27.480 1.00 29.57 ? 531  HIS B CG  1 
ATOM   2884 N  ND1 . HIS B 1 51  ? 38.460  18.105  -28.334 1.00 29.18 ? 531  HIS B ND1 1 
ATOM   2885 C  CD2 . HIS B 1 51  ? 39.284  19.047  -26.546 1.00 29.58 ? 531  HIS B CD2 1 
ATOM   2886 C  CE1 . HIS B 1 51  ? 37.590  19.017  -27.938 1.00 29.03 ? 531  HIS B CE1 1 
ATOM   2887 N  NE2 . HIS B 1 51  ? 38.066  19.603  -26.855 1.00 29.63 ? 531  HIS B NE2 1 
ATOM   2888 N  N   . GLN B 1 52  ? 41.549  18.906  -30.702 1.00 30.49 ? 532  GLN B N   1 
ATOM   2889 C  CA  . GLN B 1 52  ? 42.030  20.159  -31.259 1.00 30.95 ? 532  GLN B CA  1 
ATOM   2890 C  C   . GLN B 1 52  ? 41.122  20.528  -32.413 1.00 31.02 ? 532  GLN B C   1 
ATOM   2891 O  O   . GLN B 1 52  ? 40.773  19.669  -33.227 1.00 31.05 ? 532  GLN B O   1 
ATOM   2892 C  CB  . GLN B 1 52  ? 43.464  20.009  -31.798 1.00 31.04 ? 532  GLN B CB  1 
ATOM   2893 C  CG  . GLN B 1 52  ? 44.483  19.449  -30.805 1.00 31.72 ? 532  GLN B CG  1 
ATOM   2894 C  CD  . GLN B 1 52  ? 45.913  19.449  -31.342 1.00 32.72 ? 532  GLN B CD  1 
ATOM   2895 O  OE1 . GLN B 1 52  ? 46.846  19.855  -30.645 1.00 32.81 ? 532  GLN B OE1 1 
ATOM   2896 N  NE2 . GLN B 1 52  ? 46.090  18.987  -32.580 1.00 33.13 ? 532  GLN B NE2 1 
ATOM   2897 N  N   . CYS B 1 53  ? 40.758  21.805  -32.497 1.00 31.04 ? 533  CYS B N   1 
ATOM   2898 C  CA  . CYS B 1 53  ? 40.020  22.306  -33.648 1.00 30.95 ? 533  CYS B CA  1 
ATOM   2899 C  C   . CYS B 1 53  ? 40.800  22.034  -34.931 1.00 30.98 ? 533  CYS B C   1 
ATOM   2900 O  O   . CYS B 1 53  ? 42.027  21.922  -34.907 1.00 30.97 ? 533  CYS B O   1 
ATOM   2901 C  CB  . CYS B 1 53  ? 39.760  23.800  -33.514 1.00 30.77 ? 533  CYS B CB  1 
ATOM   2902 S  SG  . CYS B 1 53  ? 38.792  24.457  -34.878 1.00 30.92 ? 533  CYS B SG  1 
ATOM   2903 N  N   . SER B 1 54  ? 40.084  21.928  -36.046 1.00 31.08 ? 534  SER B N   1 
ATOM   2904 C  CA  . SER B 1 54  ? 40.708  21.618  -37.329 1.00 31.20 ? 534  SER B CA  1 
ATOM   2905 C  C   . SER B 1 54  ? 41.443  22.814  -37.947 1.00 31.36 ? 534  SER B C   1 
ATOM   2906 O  O   . SER B 1 54  ? 42.203  22.636  -38.895 1.00 31.58 ? 534  SER B O   1 
ATOM   2907 C  CB  . SER B 1 54  ? 39.671  21.071  -38.315 1.00 31.21 ? 534  SER B CB  1 
ATOM   2908 O  OG  . SER B 1 54  ? 38.727  22.059  -38.683 1.00 31.10 ? 534  SER B OG  1 
ATOM   2909 N  N   . CYS B 1 55  ? 41.213  24.020  -37.425 1.00 31.53 ? 535  CYS B N   1 
ATOM   2910 C  CA  . CYS B 1 55  ? 41.901  25.218  -37.918 1.00 31.71 ? 535  CYS B CA  1 
ATOM   2911 C  C   . CYS B 1 55  ? 43.359  25.285  -37.456 1.00 32.01 ? 535  CYS B C   1 
ATOM   2912 O  O   . CYS B 1 55  ? 44.155  26.017  -38.036 1.00 31.99 ? 535  CYS B O   1 
ATOM   2913 C  CB  . CYS B 1 55  ? 41.167  26.488  -37.485 1.00 31.69 ? 535  CYS B CB  1 
ATOM   2914 S  SG  . CYS B 1 55  ? 41.318  26.865  -35.734 1.00 31.39 ? 535  CYS B SG  1 
ATOM   2915 N  N   . GLY B 1 56  ? 43.701  24.529  -36.414 1.00 32.50 ? 536  GLY B N   1 
ATOM   2916 C  CA  . GLY B 1 56  ? 45.082  24.437  -35.946 1.00 32.84 ? 536  GLY B CA  1 
ATOM   2917 C  C   . GLY B 1 56  ? 45.585  25.756  -35.397 1.00 33.21 ? 536  GLY B C   1 
ATOM   2918 O  O   . GLY B 1 56  ? 46.525  26.346  -35.932 1.00 33.42 ? 536  GLY B O   1 
ATOM   2919 N  N   . ASP B 1 57  ? 44.945  26.223  -34.331 1.00 33.61 ? 537  ASP B N   1 
ATOM   2920 C  CA  . ASP B 1 57  ? 45.288  27.505  -33.728 1.00 33.89 ? 537  ASP B CA  1 
ATOM   2921 C  C   . ASP B 1 57  ? 44.935  27.493  -32.244 1.00 34.03 ? 537  ASP B C   1 
ATOM   2922 O  O   . ASP B 1 57  ? 43.759  27.546  -31.871 1.00 34.11 ? 537  ASP B O   1 
ATOM   2923 C  CB  . ASP B 1 57  ? 44.555  28.641  -34.450 1.00 34.01 ? 537  ASP B CB  1 
ATOM   2924 C  CG  . ASP B 1 57  ? 45.091  30.014  -34.085 1.00 34.27 ? 537  ASP B CG  1 
ATOM   2925 O  OD1 . ASP B 1 57  ? 45.856  30.124  -33.106 1.00 35.38 ? 537  ASP B OD1 1 
ATOM   2926 O  OD2 . ASP B 1 57  ? 44.746  30.989  -34.784 1.00 34.38 ? 537  ASP B OD2 1 
ATOM   2927 N  N   . ASN B 1 58  ? 45.965  27.420  -31.404 1.00 34.12 ? 538  ASN B N   1 
ATOM   2928 C  CA  . ASN B 1 58  ? 45.785  27.409  -29.956 1.00 34.24 ? 538  ASN B CA  1 
ATOM   2929 C  C   . ASN B 1 58  ? 45.602  28.813  -29.369 1.00 34.20 ? 538  ASN B C   1 
ATOM   2930 O  O   . ASN B 1 58  ? 45.348  28.956  -28.173 1.00 34.34 ? 538  ASN B O   1 
ATOM   2931 C  CB  . ASN B 1 58  ? 46.962  26.692  -29.283 1.00 34.30 ? 538  ASN B CB  1 
ATOM   2932 C  CG  . ASN B 1 58  ? 47.031  25.212  -29.642 1.00 34.42 ? 538  ASN B CG  1 
ATOM   2933 O  OD1 . ASN B 1 58  ? 46.021  24.592  -29.978 1.00 34.58 ? 538  ASN B OD1 1 
ATOM   2934 N  ND2 . ASN B 1 58  ? 48.227  24.638  -29.557 1.00 34.62 ? 538  ASN B ND2 1 
ATOM   2935 N  N   . SER B 1 59  ? 45.724  29.840  -30.210 1.00 34.06 ? 539  SER B N   1 
ATOM   2936 C  CA  . SER B 1 59  ? 45.486  31.219  -29.793 1.00 34.03 ? 539  SER B CA  1 
ATOM   2937 C  C   . SER B 1 59  ? 43.998  31.455  -29.557 1.00 33.87 ? 539  SER B C   1 
ATOM   2938 O  O   . SER B 1 59  ? 43.595  31.841  -28.457 1.00 34.24 ? 539  SER B O   1 
ATOM   2939 C  CB  . SER B 1 59  ? 46.019  32.199  -30.845 1.00 34.13 ? 539  SER B CB  1 
ATOM   2940 O  OG  . SER B 1 59  ? 45.959  33.533  -30.379 1.00 34.34 ? 539  SER B OG  1 
ATOM   2941 N  N   . ARG B 1 60  ? 43.181  31.206  -30.579 1.00 33.51 ? 540  ARG B N   1 
ATOM   2942 C  CA  . ARG B 1 60  ? 41.729  31.403  -30.464 1.00 33.20 ? 540  ARG B CA  1 
ATOM   2943 C  C   . ARG B 1 60  ? 40.998  30.242  -29.791 1.00 32.57 ? 540  ARG B C   1 
ATOM   2944 O  O   . ARG B 1 60  ? 39.808  30.358  -29.494 1.00 32.63 ? 540  ARG B O   1 
ATOM   2945 C  CB  . ARG B 1 60  ? 41.095  31.686  -31.829 1.00 33.43 ? 540  ARG B CB  1 
ATOM   2946 C  CG  . ARG B 1 60  ? 41.219  30.570  -32.854 1.00 34.19 ? 540  ARG B CG  1 
ATOM   2947 C  CD  . ARG B 1 60  ? 40.228  30.768  -33.993 1.00 35.16 ? 540  ARG B CD  1 
ATOM   2948 N  NE  . ARG B 1 60  ? 40.763  30.303  -35.272 1.00 35.83 ? 540  ARG B NE  1 
ATOM   2949 C  CZ  . ARG B 1 60  ? 41.538  31.024  -36.086 1.00 36.33 ? 540  ARG B CZ  1 
ATOM   2950 N  NH1 . ARG B 1 60  ? 41.901  32.267  -35.773 1.00 36.63 ? 540  ARG B NH1 1 
ATOM   2951 N  NH2 . ARG B 1 60  ? 41.962  30.492  -37.228 1.00 36.56 ? 540  ARG B NH2 1 
ATOM   2952 N  N   . HIS B 1 61  ? 41.697  29.129  -29.565 1.00 31.85 ? 541  HIS B N   1 
ATOM   2953 C  CA  . HIS B 1 61  ? 41.128  27.974  -28.859 1.00 31.07 ? 541  HIS B CA  1 
ATOM   2954 C  C   . HIS B 1 61  ? 41.984  27.648  -27.638 1.00 30.89 ? 541  HIS B C   1 
ATOM   2955 O  O   . HIS B 1 61  ? 42.804  26.730  -27.672 1.00 31.05 ? 541  HIS B O   1 
ATOM   2956 C  CB  . HIS B 1 61  ? 41.041  26.768  -29.785 1.00 30.75 ? 541  HIS B CB  1 
ATOM   2957 C  CG  . HIS B 1 61  ? 40.190  27.000  -30.991 1.00 29.59 ? 541  HIS B CG  1 
ATOM   2958 N  ND1 . HIS B 1 61  ? 38.902  27.481  -30.910 1.00 28.65 ? 541  HIS B ND1 1 
ATOM   2959 C  CD2 . HIS B 1 61  ? 40.440  26.812  -32.308 1.00 28.17 ? 541  HIS B CD2 1 
ATOM   2960 C  CE1 . HIS B 1 61  ? 38.397  27.584  -32.127 1.00 28.10 ? 541  HIS B CE1 1 
ATOM   2961 N  NE2 . HIS B 1 61  ? 39.309  27.182  -32.993 1.00 27.41 ? 541  HIS B NE2 1 
ATOM   2962 N  N   . PRO B 1 62  ? 41.776  28.393  -26.545 1.00 30.49 ? 542  PRO B N   1 
ATOM   2963 C  CA  . PRO B 1 62  ? 42.681  28.386  -25.401 1.00 30.42 ? 542  PRO B CA  1 
ATOM   2964 C  C   . PRO B 1 62  ? 42.656  27.122  -24.531 1.00 30.35 ? 542  PRO B C   1 
ATOM   2965 O  O   . PRO B 1 62  ? 43.597  26.908  -23.766 1.00 30.31 ? 542  PRO B O   1 
ATOM   2966 C  CB  . PRO B 1 62  ? 42.217  29.601  -24.603 1.00 30.43 ? 542  PRO B CB  1 
ATOM   2967 C  CG  . PRO B 1 62  ? 40.763  29.674  -24.879 1.00 30.40 ? 542  PRO B CG  1 
ATOM   2968 C  CD  . PRO B 1 62  ? 40.599  29.247  -26.302 1.00 30.41 ? 542  PRO B CD  1 
ATOM   2969 N  N   . GLU B 1 63  ? 41.600  26.305  -24.628 1.00 30.20 ? 543  GLU B N   1 
ATOM   2970 C  CA  . GLU B 1 63  ? 41.605  24.967  -24.021 1.00 29.88 ? 543  GLU B CA  1 
ATOM   2971 C  C   . GLU B 1 63  ? 42.375  24.049  -24.964 1.00 29.61 ? 543  GLU B C   1 
ATOM   2972 O  O   . GLU B 1 63  ? 41.784  23.282  -25.717 1.00 29.59 ? 543  GLU B O   1 
ATOM   2973 C  CB  . GLU B 1 63  ? 40.179  24.444  -23.782 1.00 29.96 ? 543  GLU B CB  1 
ATOM   2974 C  CG  . GLU B 1 63  ? 40.075  23.345  -22.709 1.00 30.04 ? 543  GLU B CG  1 
ATOM   2975 C  CD  . GLU B 1 63  ? 40.669  22.008  -23.142 1.00 30.63 ? 543  GLU B CD  1 
ATOM   2976 O  OE1 . GLU B 1 63  ? 39.950  21.208  -23.785 1.00 29.80 ? 543  GLU B OE1 1 
ATOM   2977 O  OE2 . GLU B 1 63  ? 41.854  21.753  -22.827 1.00 30.63 ? 543  GLU B OE2 1 
ATOM   2978 N  N   . HIS B 1 64  ? 43.702  24.147  -24.920 1.00 29.39 ? 544  HIS B N   1 
ATOM   2979 C  CA  . HIS B 1 64  ? 44.561  23.477  -25.892 1.00 29.13 ? 544  HIS B CA  1 
ATOM   2980 C  C   . HIS B 1 64  ? 45.406  22.366  -25.273 1.00 28.90 ? 544  HIS B C   1 
ATOM   2981 O  O   . HIS B 1 64  ? 45.518  22.260  -24.049 1.00 28.64 ? 544  HIS B O   1 
ATOM   2982 C  CB  . HIS B 1 64  ? 45.452  24.493  -26.620 1.00 29.10 ? 544  HIS B CB  1 
ATOM   2983 C  CG  . HIS B 1 64  ? 46.374  25.255  -25.722 1.00 29.40 ? 544  HIS B CG  1 
ATOM   2984 N  ND1 . HIS B 1 64  ? 47.614  24.780  -25.353 1.00 29.93 ? 544  HIS B ND1 1 
ATOM   2985 C  CD2 . HIS B 1 64  ? 46.247  26.468  -25.135 1.00 29.64 ? 544  HIS B CD2 1 
ATOM   2986 C  CE1 . HIS B 1 64  ? 48.207  25.665  -24.571 1.00 29.75 ? 544  HIS B CE1 1 
ATOM   2987 N  NE2 . HIS B 1 64  ? 47.398  26.698  -24.423 1.00 29.66 ? 544  HIS B NE2 1 
ATOM   2988 N  N   . ALA B 1 65  ? 45.992  21.552  -26.152 1.00 28.72 ? 545  ALA B N   1 
ATOM   2989 C  CA  . ALA B 1 65  ? 46.775  20.370  -25.782 1.00 28.68 ? 545  ALA B CA  1 
ATOM   2990 C  C   . ALA B 1 65  ? 47.996  20.690  -24.922 1.00 28.66 ? 545  ALA B C   1 
ATOM   2991 O  O   . ALA B 1 65  ? 48.403  19.877  -24.093 1.00 28.73 ? 545  ALA B O   1 
ATOM   2992 C  CB  . ALA B 1 65  ? 47.211  19.620  -27.044 1.00 28.55 ? 545  ALA B CB  1 
ATOM   2993 N  N   . GLY B 1 66  ? 48.582  21.867  -25.132 1.00 28.64 ? 546  GLY B N   1 
ATOM   2994 C  CA  . GLY B 1 66  ? 49.715  22.324  -24.338 1.00 28.63 ? 546  GLY B CA  1 
ATOM   2995 C  C   . GLY B 1 66  ? 49.444  22.356  -22.844 1.00 28.78 ? 546  GLY B C   1 
ATOM   2996 O  O   . GLY B 1 66  ? 50.380  22.282  -22.046 1.00 28.79 ? 546  GLY B O   1 
ATOM   2997 N  N   . ARG B 1 67  ? 48.170  22.464  -22.464 1.00 28.81 ? 547  ARG B N   1 
ATOM   2998 C  CA  . ARG B 1 67  ? 47.782  22.507  -21.053 1.00 29.01 ? 547  ARG B CA  1 
ATOM   2999 C  C   . ARG B 1 67  ? 48.255  21.271  -20.284 1.00 29.27 ? 547  ARG B C   1 
ATOM   3000 O  O   . ARG B 1 67  ? 49.009  21.394  -19.316 1.00 29.30 ? 547  ARG B O   1 
ATOM   3001 C  CB  . ARG B 1 67  ? 46.264  22.676  -20.905 1.00 28.93 ? 547  ARG B CB  1 
ATOM   3002 C  CG  . ARG B 1 67  ? 45.747  24.034  -21.366 1.00 28.56 ? 547  ARG B CG  1 
ATOM   3003 C  CD  . ARG B 1 67  ? 44.231  24.109  -21.329 1.00 27.67 ? 547  ARG B CD  1 
ATOM   3004 N  NE  . ARG B 1 67  ? 43.729  24.063  -19.957 1.00 27.56 ? 547  ARG B NE  1 
ATOM   3005 C  CZ  . ARG B 1 67  ? 43.030  23.067  -19.409 1.00 27.10 ? 547  ARG B CZ  1 
ATOM   3006 N  NH1 . ARG B 1 67  ? 42.700  21.978  -20.099 1.00 28.29 ? 547  ARG B NH1 1 
ATOM   3007 N  NH2 . ARG B 1 67  ? 42.650  23.165  -18.147 1.00 26.21 ? 547  ARG B NH2 1 
ATOM   3008 N  N   . ILE B 1 68  ? 47.817  20.087  -20.712 1.00 29.47 ? 548  ILE B N   1 
ATOM   3009 C  CA  . ILE B 1 68  ? 48.230  18.844  -20.048 1.00 29.62 ? 548  ILE B CA  1 
ATOM   3010 C  C   . ILE B 1 68  ? 49.676  18.454  -20.389 1.00 29.78 ? 548  ILE B C   1 
ATOM   3011 O  O   . ILE B 1 68  ? 50.381  17.899  -19.547 1.00 29.80 ? 548  ILE B O   1 
ATOM   3012 C  CB  . ILE B 1 68  ? 47.267  17.652  -20.330 1.00 29.66 ? 548  ILE B CB  1 
ATOM   3013 C  CG1 . ILE B 1 68  ? 47.236  17.275  -21.816 1.00 29.29 ? 548  ILE B CG1 1 
ATOM   3014 C  CG2 . ILE B 1 68  ? 45.867  17.974  -19.833 1.00 29.60 ? 548  ILE B CG2 1 
ATOM   3015 C  CD1 . ILE B 1 68  ? 46.477  15.999  -22.083 1.00 28.82 ? 548  ILE B CD1 1 
ATOM   3016 N  N   . GLN B 1 69  ? 50.117  18.757  -21.608 1.00 29.91 ? 549  GLN B N   1 
ATOM   3017 C  CA  . GLN B 1 69  ? 51.470  18.414  -22.038 1.00 30.13 ? 549  GLN B CA  1 
ATOM   3018 C  C   . GLN B 1 69  ? 52.531  19.119  -21.182 1.00 30.18 ? 549  GLN B C   1 
ATOM   3019 O  O   . GLN B 1 69  ? 53.499  18.490  -20.749 1.00 30.22 ? 549  GLN B O   1 
ATOM   3020 C  CB  . GLN B 1 69  ? 51.675  18.743  -23.524 1.00 30.17 ? 549  GLN B CB  1 
ATOM   3021 C  CG  . GLN B 1 69  ? 52.944  18.135  -24.113 1.00 30.73 ? 549  GLN B CG  1 
ATOM   3022 C  CD  . GLN B 1 69  ? 53.157  18.486  -25.580 1.00 31.53 ? 549  GLN B CD  1 
ATOM   3023 O  OE1 . GLN B 1 69  ? 52.318  18.197  -26.434 1.00 32.21 ? 549  GLN B OE1 1 
ATOM   3024 N  NE2 . GLN B 1 69  ? 54.296  19.097  -25.879 1.00 32.13 ? 549  GLN B NE2 1 
ATOM   3025 N  N   . SER B 1 70  ? 52.342  20.414  -20.933 1.00 30.22 ? 550  SER B N   1 
ATOM   3026 C  CA  . SER B 1 70  ? 53.291  21.194  -20.131 1.00 30.29 ? 550  SER B CA  1 
ATOM   3027 C  C   . SER B 1 70  ? 53.298  20.763  -18.659 1.00 30.26 ? 550  SER B C   1 
ATOM   3028 O  O   . SER B 1 70  ? 54.357  20.665  -18.045 1.00 30.21 ? 550  SER B O   1 
ATOM   3029 C  CB  . SER B 1 70  ? 52.983  22.687  -20.241 1.00 30.22 ? 550  SER B CB  1 
ATOM   3030 O  OG  . SER B 1 70  ? 51.669  22.962  -19.785 1.00 31.21 ? 550  SER B OG  1 
ATOM   3031 N  N   . ILE B 1 71  ? 52.119  20.501  -18.100 1.00 30.35 ? 551  ILE B N   1 
ATOM   3032 C  CA  . ILE B 1 71  ? 52.015  19.980  -16.734 1.00 30.44 ? 551  ILE B CA  1 
ATOM   3033 C  C   . ILE B 1 71  ? 52.782  18.661  -16.602 1.00 30.62 ? 551  ILE B C   1 
ATOM   3034 O  O   . ILE B 1 71  ? 53.525  18.457  -15.642 1.00 30.37 ? 551  ILE B O   1 
ATOM   3035 C  CB  . ILE B 1 71  ? 50.542  19.743  -16.316 1.00 30.32 ? 551  ILE B CB  1 
ATOM   3036 C  CG1 . ILE B 1 71  ? 49.797  21.070  -16.154 1.00 30.47 ? 551  ILE B CG1 1 
ATOM   3037 C  CG2 . ILE B 1 71  ? 50.466  18.974  -15.006 1.00 29.99 ? 551  ILE B CG2 1 
ATOM   3038 C  CD1 . ILE B 1 71  ? 48.283  20.907  -16.052 1.00 30.19 ? 551  ILE B CD1 1 
ATOM   3039 N  N   . TRP B 1 72  ? 52.598  17.782  -17.584 1.00 30.90 ? 552  TRP B N   1 
ATOM   3040 C  CA  . TRP B 1 72  ? 53.177  16.443  -17.553 1.00 31.15 ? 552  TRP B CA  1 
ATOM   3041 C  C   . TRP B 1 72  ? 54.709  16.464  -17.597 1.00 31.46 ? 552  TRP B C   1 
ATOM   3042 O  O   . TRP B 1 72  ? 55.363  15.661  -16.928 1.00 31.39 ? 552  TRP B O   1 
ATOM   3043 C  CB  . TRP B 1 72  ? 52.614  15.604  -18.707 1.00 31.14 ? 552  TRP B CB  1 
ATOM   3044 C  CG  . TRP B 1 72  ? 52.938  14.151  -18.603 1.00 31.23 ? 552  TRP B CG  1 
ATOM   3045 C  CD1 . TRP B 1 72  ? 53.677  13.414  -19.477 1.00 31.06 ? 552  TRP B CD1 1 
ATOM   3046 C  CD2 . TRP B 1 72  ? 52.545  13.258  -17.554 1.00 31.24 ? 552  TRP B CD2 1 
ATOM   3047 N  NE1 . TRP B 1 72  ? 53.763  12.114  -19.044 1.00 31.07 ? 552  TRP B NE1 1 
ATOM   3048 C  CE2 . TRP B 1 72  ? 53.079  11.991  -17.864 1.00 31.15 ? 552  TRP B CE2 1 
ATOM   3049 C  CE3 . TRP B 1 72  ? 51.793  13.406  -16.384 1.00 31.48 ? 552  TRP B CE3 1 
ATOM   3050 C  CZ2 . TRP B 1 72  ? 52.884  10.877  -17.048 1.00 31.16 ? 552  TRP B CZ2 1 
ATOM   3051 C  CZ3 . TRP B 1 72  ? 51.600  12.298  -15.573 1.00 31.53 ? 552  TRP B CZ3 1 
ATOM   3052 C  CH2 . TRP B 1 72  ? 52.147  11.051  -15.907 1.00 31.33 ? 552  TRP B CH2 1 
ATOM   3053 N  N   . SER B 1 73  ? 55.276  17.381  -18.377 1.00 31.83 ? 553  SER B N   1 
ATOM   3054 C  CA  . SER B 1 73  ? 56.729  17.552  -18.420 1.00 32.24 ? 553  SER B CA  1 
ATOM   3055 C  C   . SER B 1 73  ? 57.242  18.279  -17.175 1.00 32.37 ? 553  SER B C   1 
ATOM   3056 O  O   . SER B 1 73  ? 58.380  18.063  -16.754 1.00 32.55 ? 553  SER B O   1 
ATOM   3057 C  CB  . SER B 1 73  ? 57.162  18.293  -19.691 1.00 32.28 ? 553  SER B CB  1 
ATOM   3058 O  OG  . SER B 1 73  ? 56.566  19.574  -19.771 1.00 32.86 ? 553  SER B OG  1 
ATOM   3059 N  N   . ARG B 1 74  ? 56.410  19.137  -16.588 1.00 32.55 ? 554  ARG B N   1 
ATOM   3060 C  CA  . ARG B 1 74  ? 56.770  19.821  -15.344 1.00 32.62 ? 554  ARG B CA  1 
ATOM   3061 C  C   . ARG B 1 74  ? 56.941  18.818  -14.206 1.00 32.87 ? 554  ARG B C   1 
ATOM   3062 O  O   . ARG B 1 74  ? 57.885  18.920  -13.420 1.00 33.02 ? 554  ARG B O   1 
ATOM   3063 C  CB  . ARG B 1 74  ? 55.726  20.886  -14.970 1.00 32.47 ? 554  ARG B CB  1 
ATOM   3064 C  CG  . ARG B 1 74  ? 55.864  21.458  -13.555 1.00 32.19 ? 554  ARG B CG  1 
ATOM   3065 C  CD  . ARG B 1 74  ? 57.218  22.129  -13.318 1.00 32.05 ? 554  ARG B CD  1 
ATOM   3066 N  NE  . ARG B 1 74  ? 57.281  23.469  -13.900 1.00 31.73 ? 554  ARG B NE  1 
ATOM   3067 C  CZ  . ARG B 1 74  ? 56.708  24.556  -13.381 1.00 31.74 ? 554  ARG B CZ  1 
ATOM   3068 N  NH1 . ARG B 1 74  ? 56.003  24.492  -12.251 1.00 31.55 ? 554  ARG B NH1 1 
ATOM   3069 N  NH2 . ARG B 1 74  ? 56.832  25.723  -14.002 1.00 31.65 ? 554  ARG B NH2 1 
ATOM   3070 N  N   . LEU B 1 75  ? 56.028  17.853  -14.123 1.00 33.14 ? 555  LEU B N   1 
ATOM   3071 C  CA  . LEU B 1 75  ? 56.095  16.813  -13.094 1.00 33.39 ? 555  LEU B CA  1 
ATOM   3072 C  C   . LEU B 1 75  ? 57.346  15.934  -13.256 1.00 33.62 ? 555  LEU B C   1 
ATOM   3073 O  O   . LEU B 1 75  ? 57.864  15.393  -12.278 1.00 33.61 ? 555  LEU B O   1 
ATOM   3074 C  CB  . LEU B 1 75  ? 54.819  15.958  -13.104 1.00 33.27 ? 555  LEU B CB  1 
ATOM   3075 C  CG  . LEU B 1 75  ? 53.524  16.683  -12.711 1.00 33.42 ? 555  LEU B CG  1 
ATOM   3076 C  CD1 . LEU B 1 75  ? 52.293  15.826  -13.009 1.00 33.37 ? 555  LEU B CD1 1 
ATOM   3077 C  CD2 . LEU B 1 75  ? 53.539  17.102  -11.238 1.00 33.14 ? 555  LEU B CD2 1 
ATOM   3078 N  N   . GLN B 1 76  ? 57.828  15.805  -14.489 1.00 33.98 ? 556  GLN B N   1 
ATOM   3079 C  CA  . GLN B 1 76  ? 59.068  15.085  -14.759 1.00 34.33 ? 556  GLN B CA  1 
ATOM   3080 C  C   . GLN B 1 76  ? 60.274  15.940  -14.388 1.00 34.53 ? 556  GLN B C   1 
ATOM   3081 O  O   . GLN B 1 76  ? 61.192  15.463  -13.722 1.00 34.49 ? 556  GLN B O   1 
ATOM   3082 C  CB  . GLN B 1 76  ? 59.135  14.678  -16.235 1.00 34.34 ? 556  GLN B CB  1 
ATOM   3083 C  CG  . GLN B 1 76  ? 60.371  13.864  -16.641 1.00 34.87 ? 556  GLN B CG  1 
ATOM   3084 C  CD  . GLN B 1 76  ? 60.568  12.594  -15.822 1.00 35.39 ? 556  GLN B CD  1 
ATOM   3085 O  OE1 . GLN B 1 76  ? 61.698  12.161  -15.600 1.00 35.92 ? 556  GLN B OE1 1 
ATOM   3086 N  NE2 . GLN B 1 76  ? 59.473  11.993  -15.374 1.00 35.88 ? 556  GLN B NE2 1 
ATOM   3087 N  N   . GLU B 1 77  ? 60.258  17.203  -14.818 1.00 34.80 ? 557  GLU B N   1 
ATOM   3088 C  CA  . GLU B 1 77  ? 61.367  18.142  -14.584 1.00 34.97 ? 557  GLU B CA  1 
ATOM   3089 C  C   . GLU B 1 77  ? 61.736  18.280  -13.108 1.00 34.97 ? 557  GLU B C   1 
ATOM   3090 O  O   . GLU B 1 77  ? 62.915  18.390  -12.767 1.00 35.02 ? 557  GLU B O   1 
ATOM   3091 C  CB  . GLU B 1 77  ? 61.025  19.527  -15.152 1.00 35.05 ? 557  GLU B CB  1 
ATOM   3092 C  CG  . GLU B 1 77  ? 61.147  19.633  -16.676 1.00 35.42 ? 557  GLU B CG  1 
ATOM   3093 C  CD  . GLU B 1 77  ? 60.252  20.716  -17.285 1.00 36.01 ? 557  GLU B CD  1 
ATOM   3094 O  OE1 . GLU B 1 77  ? 59.737  21.579  -16.538 1.00 36.65 ? 557  GLU B OE1 1 
ATOM   3095 O  OE2 . GLU B 1 77  ? 60.061  20.701  -18.522 1.00 36.05 ? 557  GLU B OE2 1 
ATOM   3096 N  N   . ARG B 1 78  ? 60.729  18.273  -12.240 1.00 34.97 ? 558  ARG B N   1 
ATOM   3097 C  CA  . ARG B 1 78  ? 60.944  18.424  -10.802 1.00 35.03 ? 558  ARG B CA  1 
ATOM   3098 C  C   . ARG B 1 78  ? 61.076  17.081  -10.080 1.00 34.86 ? 558  ARG B C   1 
ATOM   3099 O  O   . ARG B 1 78  ? 61.210  17.046  -8.856  1.00 34.88 ? 558  ARG B O   1 
ATOM   3100 C  CB  . ARG B 1 78  ? 59.805  19.238  -10.183 1.00 35.21 ? 558  ARG B CB  1 
ATOM   3101 C  CG  . ARG B 1 78  ? 59.531  20.569  -10.878 1.00 35.78 ? 558  ARG B CG  1 
ATOM   3102 C  CD  . ARG B 1 78  ? 60.676  21.564  -10.717 1.00 36.45 ? 558  ARG B CD  1 
ATOM   3103 N  NE  . ARG B 1 78  ? 60.526  22.689  -11.638 1.00 37.27 ? 558  ARG B NE  1 
ATOM   3104 C  CZ  . ARG B 1 78  ? 61.488  23.553  -11.966 1.00 38.16 ? 558  ARG B CZ  1 
ATOM   3105 N  NH1 . ARG B 1 78  ? 62.714  23.457  -11.449 1.00 38.41 ? 558  ARG B NH1 1 
ATOM   3106 N  NH2 . ARG B 1 78  ? 61.218  24.531  -12.827 1.00 38.49 ? 558  ARG B NH2 1 
ATOM   3107 N  N   . GLY B 1 79  ? 61.034  15.983  -10.833 1.00 34.65 ? 559  GLY B N   1 
ATOM   3108 C  CA  . GLY B 1 79  ? 61.230  14.647  -10.275 1.00 34.46 ? 559  GLY B CA  1 
ATOM   3109 C  C   . GLY B 1 79  ? 60.084  14.134  -9.420  1.00 34.34 ? 559  GLY B C   1 
ATOM   3110 O  O   . GLY B 1 79  ? 60.302  13.346  -8.500  1.00 34.38 ? 559  GLY B O   1 
ATOM   3111 N  N   . LEU B 1 80  ? 58.863  14.577  -9.718  1.00 34.09 ? 560  LEU B N   1 
ATOM   3112 C  CA  . LEU B 1 80  ? 57.675  14.090  -9.020  1.00 33.85 ? 560  LEU B CA  1 
ATOM   3113 C  C   . LEU B 1 80  ? 57.074  12.881  -9.734  1.00 33.63 ? 560  LEU B C   1 
ATOM   3114 O  O   . LEU B 1 80  ? 56.547  11.974  -9.089  1.00 33.64 ? 560  LEU B O   1 
ATOM   3115 C  CB  . LEU B 1 80  ? 56.621  15.193  -8.905  1.00 33.89 ? 560  LEU B CB  1 
ATOM   3116 C  CG  . LEU B 1 80  ? 56.913  16.358  -7.961  1.00 33.95 ? 560  LEU B CG  1 
ATOM   3117 C  CD1 . LEU B 1 80  ? 55.724  17.321  -7.939  1.00 34.18 ? 560  LEU B CD1 1 
ATOM   3118 C  CD2 . LEU B 1 80  ? 57.220  15.854  -6.560  1.00 33.95 ? 560  LEU B CD2 1 
ATOM   3119 N  N   . ARG B 1 81  ? 57.145  12.882  -11.063 1.00 33.34 ? 561  ARG B N   1 
ATOM   3120 C  CA  . ARG B 1 81  ? 56.593  11.793  -11.874 1.00 33.16 ? 561  ARG B CA  1 
ATOM   3121 C  C   . ARG B 1 81  ? 57.141  10.441  -11.409 1.00 32.93 ? 561  ARG B C   1 
ATOM   3122 O  O   . ARG B 1 81  ? 56.373  9.512   -11.153 1.00 32.89 ? 561  ARG B O   1 
ATOM   3123 C  CB  . ARG B 1 81  ? 56.915  12.003  -13.363 1.00 33.21 ? 561  ARG B CB  1 
ATOM   3124 C  CG  . ARG B 1 81  ? 55.696  11.951  -14.289 1.00 33.42 ? 561  ARG B CG  1 
ATOM   3125 C  CD  . ARG B 1 81  ? 56.078  11.498  -15.705 1.00 34.00 ? 561  ARG B CD  1 
ATOM   3126 N  NE  . ARG B 1 81  ? 56.186  12.598  -16.667 1.00 34.51 ? 561  ARG B NE  1 
ATOM   3127 C  CZ  . ARG B 1 81  ? 56.761  12.500  -17.868 1.00 34.78 ? 561  ARG B CZ  1 
ATOM   3128 N  NH1 . ARG B 1 81  ? 57.307  11.358  -18.273 1.00 35.06 ? 561  ARG B NH1 1 
ATOM   3129 N  NH2 . ARG B 1 81  ? 56.805  13.559  -18.669 1.00 34.95 ? 561  ARG B NH2 1 
ATOM   3130 N  N   . SER B 1 82  ? 58.466  10.350  -11.281 1.00 32.58 ? 562  SER B N   1 
ATOM   3131 C  CA  . SER B 1 82  ? 59.134  9.104   -10.890 1.00 32.35 ? 562  SER B CA  1 
ATOM   3132 C  C   . SER B 1 82  ? 58.685  8.576   -9.523  1.00 32.05 ? 562  SER B C   1 
ATOM   3133 O  O   . SER B 1 82  ? 58.735  7.373   -9.274  1.00 32.07 ? 562  SER B O   1 
ATOM   3134 C  CB  . SER B 1 82  ? 60.656  9.278   -10.909 1.00 32.35 ? 562  SER B CB  1 
ATOM   3135 O  OG  . SER B 1 82  ? 61.066  10.318  -10.040 1.00 32.51 ? 562  SER B OG  1 
ATOM   3136 N  N   . GLN B 1 83  ? 58.233  9.469   -8.648  1.00 31.75 ? 563  GLN B N   1 
ATOM   3137 C  CA  . GLN B 1 83  ? 57.716  9.068   -7.337  1.00 31.54 ? 563  GLN B CA  1 
ATOM   3138 C  C   . GLN B 1 83  ? 56.256  8.585   -7.388  1.00 31.35 ? 563  GLN B C   1 
ATOM   3139 O  O   . GLN B 1 83  ? 55.662  8.312   -6.341  1.00 31.28 ? 563  GLN B O   1 
ATOM   3140 C  CB  . GLN B 1 83  ? 57.817  10.235  -6.349  1.00 31.53 ? 563  GLN B CB  1 
ATOM   3141 C  CG  . GLN B 1 83  ? 59.201  10.833  -6.190  1.00 31.47 ? 563  GLN B CG  1 
ATOM   3142 C  CD  . GLN B 1 83  ? 59.200  11.982  -5.197  1.00 31.49 ? 563  GLN B CD  1 
ATOM   3143 O  OE1 . GLN B 1 83  ? 58.819  11.812  -4.040  1.00 31.56 ? 563  GLN B OE1 1 
ATOM   3144 N  NE2 . GLN B 1 83  ? 59.613  13.166  -5.647  1.00 31.40 ? 563  GLN B NE2 1 
ATOM   3145 N  N   . CYS B 1 84  ? 55.684  8.478   -8.590  1.00 31.14 ? 564  CYS B N   1 
ATOM   3146 C  CA  . CYS B 1 84  ? 54.276  8.116   -8.750  1.00 30.96 ? 564  CYS B CA  1 
ATOM   3147 C  C   . CYS B 1 84  ? 54.062  6.898   -9.643  1.00 31.05 ? 564  CYS B C   1 
ATOM   3148 O  O   . CYS B 1 84  ? 54.831  6.646   -10.565 1.00 30.94 ? 564  CYS B O   1 
ATOM   3149 C  CB  . CYS B 1 84  ? 53.504  9.296   -9.334  1.00 30.95 ? 564  CYS B CB  1 
ATOM   3150 S  SG  . CYS B 1 84  ? 53.495  10.758  -8.277  1.00 30.13 ? 564  CYS B SG  1 
ATOM   3151 N  N   . GLU B 1 85  ? 52.998  6.154   -9.350  1.00 31.19 ? 565  GLU B N   1 
ATOM   3152 C  CA  . GLU B 1 85  ? 52.491  5.103   -10.230 1.00 31.30 ? 565  GLU B CA  1 
ATOM   3153 C  C   . GLU B 1 85  ? 51.744  5.751   -11.400 1.00 31.33 ? 565  GLU B C   1 
ATOM   3154 O  O   . GLU B 1 85  ? 50.659  6.296   -11.212 1.00 31.32 ? 565  GLU B O   1 
ATOM   3155 C  CB  . GLU B 1 85  ? 51.532  4.202   -9.444  1.00 31.39 ? 565  GLU B CB  1 
ATOM   3156 C  CG  . GLU B 1 85  ? 50.761  3.170   -10.273 1.00 31.60 ? 565  GLU B CG  1 
ATOM   3157 C  CD  . GLU B 1 85  ? 51.465  1.843   -10.374 1.00 31.82 ? 565  GLU B CD  1 
ATOM   3158 O  OE1 . GLU B 1 85  ? 52.111  1.428   -9.391  1.00 32.45 ? 565  GLU B OE1 1 
ATOM   3159 O  OE2 . GLU B 1 85  ? 51.359  1.203   -11.438 1.00 32.89 ? 565  GLU B OE2 1 
ATOM   3160 N  N   . CYS B 1 86  ? 52.319  5.690   -12.598 1.00 31.33 ? 566  CYS B N   1 
ATOM   3161 C  CA  . CYS B 1 86  ? 51.710  6.303   -13.786 1.00 31.37 ? 566  CYS B CA  1 
ATOM   3162 C  C   . CYS B 1 86  ? 50.776  5.342   -14.517 1.00 31.26 ? 566  CYS B C   1 
ATOM   3163 O  O   . CYS B 1 86  ? 51.094  4.168   -14.700 1.00 31.26 ? 566  CYS B O   1 
ATOM   3164 C  CB  . CYS B 1 86  ? 52.790  6.800   -14.746 1.00 31.34 ? 566  CYS B CB  1 
ATOM   3165 S  SG  . CYS B 1 86  ? 53.767  8.156   -14.069 1.00 32.11 ? 566  CYS B SG  1 
ATOM   3166 N  N   . LEU B 1 87  ? 49.632  5.863   -14.950 1.00 31.18 ? 567  LEU B N   1 
ATOM   3167 C  CA  . LEU B 1 87  ? 48.602  5.064   -15.613 1.00 31.04 ? 567  LEU B CA  1 
ATOM   3168 C  C   . LEU B 1 87  ? 48.185  5.745   -16.912 1.00 30.78 ? 567  LEU B C   1 
ATOM   3169 O  O   . LEU B 1 87  ? 48.264  6.963   -17.023 1.00 30.87 ? 567  LEU B O   1 
ATOM   3170 C  CB  . LEU B 1 87  ? 47.391  4.902   -14.687 1.00 31.02 ? 567  LEU B CB  1 
ATOM   3171 C  CG  . LEU B 1 87  ? 47.705  4.635   -13.206 1.00 31.12 ? 567  LEU B CG  1 
ATOM   3172 C  CD1 . LEU B 1 87  ? 46.437  4.678   -12.364 1.00 31.70 ? 567  LEU B CD1 1 
ATOM   3173 C  CD2 . LEU B 1 87  ? 48.416  3.312   -13.028 1.00 31.21 ? 567  LEU B CD2 1 
ATOM   3174 N  N   . ARG B 1 88  ? 47.754  4.958   -17.895 1.00 30.61 ? 568  ARG B N   1 
ATOM   3175 C  CA  . ARG B 1 88  ? 47.290  5.511   -19.171 1.00 30.42 ? 568  ARG B CA  1 
ATOM   3176 C  C   . ARG B 1 88  ? 45.824  5.935   -19.107 1.00 30.05 ? 568  ARG B C   1 
ATOM   3177 O  O   . ARG B 1 88  ? 45.410  6.857   -19.809 1.00 29.87 ? 568  ARG B O   1 
ATOM   3178 C  CB  . ARG B 1 88  ? 47.463  4.498   -20.301 1.00 30.48 ? 568  ARG B CB  1 
ATOM   3179 C  CG  . ARG B 1 88  ? 48.878  3.974   -20.442 1.00 31.27 ? 568  ARG B CG  1 
ATOM   3180 C  CD  . ARG B 1 88  ? 49.266  3.741   -21.890 1.00 31.89 ? 568  ARG B CD  1 
ATOM   3181 N  NE  . ARG B 1 88  ? 48.373  2.805   -22.578 1.00 32.98 ? 568  ARG B NE  1 
ATOM   3182 C  CZ  . ARG B 1 88  ? 47.554  3.103   -23.589 1.00 33.06 ? 568  ARG B CZ  1 
ATOM   3183 N  NH1 . ARG B 1 88  ? 47.472  4.335   -24.080 1.00 33.01 ? 568  ARG B NH1 1 
ATOM   3184 N  NH2 . ARG B 1 88  ? 46.810  2.143   -24.128 1.00 33.45 ? 568  ARG B NH2 1 
ATOM   3185 N  N   . GLY B 1 89  ? 45.052  5.255   -18.263 1.00 29.56 ? 569  GLY B N   1 
ATOM   3186 C  CA  . GLY B 1 89  ? 43.606  5.387   -18.259 1.00 29.23 ? 569  GLY B CA  1 
ATOM   3187 C  C   . GLY B 1 89  ? 43.018  4.582   -19.401 1.00 29.00 ? 569  GLY B C   1 
ATOM   3188 O  O   . GLY B 1 89  ? 43.649  3.654   -19.900 1.00 28.68 ? 569  GLY B O   1 
ATOM   3189 N  N   . ARG B 1 90  ? 41.809  4.949   -19.816 1.00 28.74 ? 570  ARG B N   1 
ATOM   3190 C  CA  . ARG B 1 90  ? 41.084  4.239   -20.870 1.00 28.53 ? 570  ARG B CA  1 
ATOM   3191 C  C   . ARG B 1 90  ? 39.846  5.036   -21.266 1.00 28.34 ? 570  ARG B C   1 
ATOM   3192 O  O   . ARG B 1 90  ? 39.516  6.030   -20.627 1.00 28.56 ? 570  ARG B O   1 
ATOM   3193 C  CB  . ARG B 1 90  ? 40.655  2.853   -20.375 1.00 28.44 ? 570  ARG B CB  1 
ATOM   3194 C  CG  . ARG B 1 90  ? 39.905  2.910   -19.058 1.00 28.25 ? 570  ARG B CG  1 
ATOM   3195 C  CD  . ARG B 1 90  ? 39.207  1.619   -18.702 1.00 27.47 ? 570  ARG B CD  1 
ATOM   3196 N  NE  . ARG B 1 90  ? 38.399  1.802   -17.490 1.00 26.62 ? 570  ARG B NE  1 
ATOM   3197 C  CZ  . ARG B 1 90  ? 37.155  2.279   -17.464 1.00 25.59 ? 570  ARG B CZ  1 
ATOM   3198 N  NH1 . ARG B 1 90  ? 36.522  2.625   -18.585 1.00 25.27 ? 570  ARG B NH1 1 
ATOM   3199 N  NH2 . ARG B 1 90  ? 36.530  2.404   -16.298 1.00 25.32 ? 570  ARG B NH2 1 
ATOM   3200 N  N   . LYS B 1 91  ? 39.160  4.597   -22.315 1.00 28.32 ? 571  LYS B N   1 
ATOM   3201 C  CA  . LYS B 1 91  ? 37.870  5.182   -22.681 1.00 28.18 ? 571  LYS B CA  1 
ATOM   3202 C  C   . LYS B 1 91  ? 36.799  4.719   -21.703 1.00 27.84 ? 571  LYS B C   1 
ATOM   3203 O  O   . LYS B 1 91  ? 36.746  3.544   -21.341 1.00 27.86 ? 571  LYS B O   1 
ATOM   3204 C  CB  . LYS B 1 91  ? 37.448  4.758   -24.090 1.00 28.37 ? 571  LYS B CB  1 
ATOM   3205 C  CG  . LYS B 1 91  ? 38.387  5.181   -25.205 1.00 28.88 ? 571  LYS B CG  1 
ATOM   3206 C  CD  . LYS B 1 91  ? 37.829  4.765   -26.553 1.00 29.78 ? 571  LYS B CD  1 
ATOM   3207 C  CE  . LYS B 1 91  ? 38.921  4.691   -27.621 1.00 30.99 ? 571  LYS B CE  1 
ATOM   3208 N  NZ  . LYS B 1 91  ? 39.830  3.505   -27.461 1.00 31.15 ? 571  LYS B NZ  1 
ATOM   3209 N  N   . ALA B 1 92  ? 35.950  5.644   -21.272 1.00 27.52 ? 572  ALA B N   1 
ATOM   3210 C  CA  . ALA B 1 92  ? 34.714  5.285   -20.589 1.00 27.11 ? 572  ALA B CA  1 
ATOM   3211 C  C   . ALA B 1 92  ? 33.807  4.533   -21.565 1.00 26.80 ? 572  ALA B C   1 
ATOM   3212 O  O   . ALA B 1 92  ? 33.771  4.852   -22.758 1.00 26.84 ? 572  ALA B O   1 
ATOM   3213 C  CB  . ALA B 1 92  ? 34.015  6.525   -20.080 1.00 27.03 ? 572  ALA B CB  1 
ATOM   3214 N  N   . SER B 1 93  ? 33.083  3.536   -21.064 1.00 26.42 ? 573  SER B N   1 
ATOM   3215 C  CA  . SER B 1 93  ? 32.092  2.835   -21.875 1.00 26.30 ? 573  SER B CA  1 
ATOM   3216 C  C   . SER B 1 93  ? 30.856  3.710   -22.047 1.00 26.50 ? 573  SER B C   1 
ATOM   3217 O  O   . SER B 1 93  ? 30.685  4.699   -21.338 1.00 26.18 ? 573  SER B O   1 
ATOM   3218 C  CB  . SER B 1 93  ? 31.703  1.503   -21.230 1.00 26.18 ? 573  SER B CB  1 
ATOM   3219 O  OG  . SER B 1 93  ? 30.975  1.696   -20.032 1.00 25.38 ? 573  SER B OG  1 
ATOM   3220 N  N   . LEU B 1 94  ? 29.995  3.344   -22.991 1.00 26.93 ? 574  LEU B N   1 
ATOM   3221 C  CA  . LEU B 1 94  ? 28.738  4.064   -23.191 1.00 27.19 ? 574  LEU B CA  1 
ATOM   3222 C  C   . LEU B 1 94  ? 27.853  3.956   -21.943 1.00 27.55 ? 574  LEU B C   1 
ATOM   3223 O  O   . LEU B 1 94  ? 27.229  4.938   -21.541 1.00 27.81 ? 574  LEU B O   1 
ATOM   3224 C  CB  . LEU B 1 94  ? 28.009  3.560   -24.442 1.00 27.19 ? 574  LEU B CB  1 
ATOM   3225 C  CG  . LEU B 1 94  ? 28.235  4.325   -25.762 1.00 27.39 ? 574  LEU B CG  1 
ATOM   3226 C  CD1 . LEU B 1 94  ? 29.614  4.991   -25.869 1.00 26.92 ? 574  LEU B CD1 1 
ATOM   3227 C  CD2 . LEU B 1 94  ? 27.988  3.414   -26.954 1.00 26.63 ? 574  LEU B CD2 1 
ATOM   3228 N  N   . GLU B 1 95  ? 27.825  2.777   -21.323 1.00 27.79 ? 575  GLU B N   1 
ATOM   3229 C  CA  . GLU B 1 95  ? 27.063  2.558   -20.087 1.00 28.00 ? 575  GLU B CA  1 
ATOM   3230 C  C   . GLU B 1 95  ? 27.547  3.450   -18.932 1.00 28.00 ? 575  GLU B C   1 
ATOM   3231 O  O   . GLU B 1 95  ? 26.739  3.976   -18.166 1.00 28.17 ? 575  GLU B O   1 
ATOM   3232 C  CB  . GLU B 1 95  ? 27.140  1.081   -19.681 1.00 28.10 ? 575  GLU B CB  1 
ATOM   3233 C  CG  . GLU B 1 95  ? 26.397  0.723   -18.389 1.00 28.86 ? 575  GLU B CG  1 
ATOM   3234 C  CD  . GLU B 1 95  ? 26.502  -0.759  -18.028 1.00 29.70 ? 575  GLU B CD  1 
ATOM   3235 O  OE1 . GLU B 1 95  ? 26.556  -1.606  -18.944 1.00 29.82 ? 575  GLU B OE1 1 
ATOM   3236 O  OE2 . GLU B 1 95  ? 26.524  -1.077  -16.819 1.00 30.92 ? 575  GLU B OE2 1 
ATOM   3237 N  N   . GLU B 1 96  ? 28.861  3.602   -18.802 1.00 27.91 ? 576  GLU B N   1 
ATOM   3238 C  CA  . GLU B 1 96  ? 29.443  4.463   -17.775 1.00 27.99 ? 576  GLU B CA  1 
ATOM   3239 C  C   . GLU B 1 96  ? 29.042  5.929   -17.970 1.00 28.05 ? 576  GLU B C   1 
ATOM   3240 O  O   . GLU B 1 96  ? 28.666  6.614   -17.014 1.00 28.29 ? 576  GLU B O   1 
ATOM   3241 C  CB  . GLU B 1 96  ? 30.972  4.344   -17.778 1.00 28.06 ? 576  GLU B CB  1 
ATOM   3242 C  CG  . GLU B 1 96  ? 31.496  3.058   -17.155 1.00 28.08 ? 576  GLU B CG  1 
ATOM   3243 C  CD  . GLU B 1 96  ? 33.010  2.937   -17.238 1.00 28.63 ? 576  GLU B CD  1 
ATOM   3244 O  OE1 . GLU B 1 96  ? 33.568  3.108   -18.342 1.00 28.46 ? 576  GLU B OE1 1 
ATOM   3245 O  OE2 . GLU B 1 96  ? 33.646  2.663   -16.195 1.00 29.35 ? 576  GLU B OE2 1 
ATOM   3246 N  N   . LEU B 1 97  ? 29.129  6.398   -19.210 1.00 27.90 ? 577  LEU B N   1 
ATOM   3247 C  CA  . LEU B 1 97  ? 28.724  7.760   -19.567 1.00 27.78 ? 577  LEU B CA  1 
ATOM   3248 C  C   . LEU B 1 97  ? 27.245  8.025   -19.265 1.00 27.75 ? 577  LEU B C   1 
ATOM   3249 O  O   . LEU B 1 97  ? 26.882  9.125   -18.829 1.00 27.41 ? 577  LEU B O   1 
ATOM   3250 C  CB  . LEU B 1 97  ? 29.001  8.025   -21.055 1.00 27.76 ? 577  LEU B CB  1 
ATOM   3251 C  CG  . LEU B 1 97  ? 30.468  8.033   -21.503 1.00 27.36 ? 577  LEU B CG  1 
ATOM   3252 C  CD1 . LEU B 1 97  ? 30.574  8.105   -23.026 1.00 27.05 ? 577  LEU B CD1 1 
ATOM   3253 C  CD2 . LEU B 1 97  ? 31.227  9.174   -20.851 1.00 26.27 ? 577  LEU B CD2 1 
ATOM   3254 N  N   . GLN B 1 98  ? 26.403  7.013   -19.485 1.00 27.70 ? 578  GLN B N   1 
ATOM   3255 C  CA  . GLN B 1 98  ? 24.953  7.151   -19.296 1.00 27.80 ? 578  GLN B CA  1 
ATOM   3256 C  C   . GLN B 1 98  ? 24.495  7.126   -17.841 1.00 27.69 ? 578  GLN B C   1 
ATOM   3257 O  O   . GLN B 1 98  ? 23.314  7.310   -17.567 1.00 27.55 ? 578  GLN B O   1 
ATOM   3258 C  CB  . GLN B 1 98  ? 24.205  6.075   -20.077 1.00 28.03 ? 578  GLN B CB  1 
ATOM   3259 C  CG  . GLN B 1 98  ? 24.193  6.309   -21.571 1.00 28.67 ? 578  GLN B CG  1 
ATOM   3260 C  CD  . GLN B 1 98  ? 23.514  5.189   -22.307 1.00 29.30 ? 578  GLN B CD  1 
ATOM   3261 O  OE1 . GLN B 1 98  ? 22.295  5.043   -22.254 1.00 30.39 ? 578  GLN B OE1 1 
ATOM   3262 N  NE2 . GLN B 1 98  ? 24.301  4.381   -22.996 1.00 30.45 ? 578  GLN B NE2 1 
ATOM   3263 N  N   . SER B 1 99  ? 25.417  6.905   -16.911 1.00 27.79 ? 579  SER B N   1 
ATOM   3264 C  CA  . SER B 1 99  ? 25.105  7.013   -15.494 1.00 27.99 ? 579  SER B CA  1 
ATOM   3265 C  C   . SER B 1 99  ? 24.974  8.477   -15.067 1.00 28.19 ? 579  SER B C   1 
ATOM   3266 O  O   . SER B 1 99  ? 24.598  8.766   -13.929 1.00 28.64 ? 579  SER B O   1 
ATOM   3267 C  CB  . SER B 1 99  ? 26.188  6.330   -14.662 1.00 28.06 ? 579  SER B CB  1 
ATOM   3268 O  OG  . SER B 1 99  ? 27.435  6.988   -14.802 1.00 28.32 ? 579  SER B OG  1 
ATOM   3269 N  N   . VAL B 1 100 ? 25.317  9.389   -15.974 1.00 28.18 ? 580  VAL B N   1 
ATOM   3270 C  CA  . VAL B 1 100 ? 25.198  10.828  -15.744 1.00 28.25 ? 580  VAL B CA  1 
ATOM   3271 C  C   . VAL B 1 100 ? 24.449  11.524  -16.883 1.00 28.45 ? 580  VAL B C   1 
ATOM   3272 O  O   . VAL B 1 100 ? 23.588  12.369  -16.633 1.00 28.59 ? 580  VAL B O   1 
ATOM   3273 C  CB  . VAL B 1 100 ? 26.596  11.474  -15.582 1.00 28.22 ? 580  VAL B CB  1 
ATOM   3274 C  CG1 . VAL B 1 100 ? 26.512  12.990  -15.700 1.00 27.58 ? 580  VAL B CG1 1 
ATOM   3275 C  CG2 . VAL B 1 100 ? 27.221  11.053  -14.250 1.00 27.58 ? 580  VAL B CG2 1 
ATOM   3276 N  N   . HIS B 1 101 ? 24.773  11.161  -18.125 1.00 28.68 ? 581  HIS B N   1 
ATOM   3277 C  CA  . HIS B 1 101 ? 24.239  11.841  -19.304 1.00 28.63 ? 581  HIS B CA  1 
ATOM   3278 C  C   . HIS B 1 101 ? 23.187  11.024  -20.019 1.00 28.82 ? 581  HIS B C   1 
ATOM   3279 O  O   . HIS B 1 101 ? 23.130  9.804   -19.880 1.00 28.84 ? 581  HIS B O   1 
ATOM   3280 C  CB  . HIS B 1 101 ? 25.363  12.167  -20.283 1.00 28.57 ? 581  HIS B CB  1 
ATOM   3281 C  CG  . HIS B 1 101 ? 26.413  13.062  -19.710 1.00 28.33 ? 581  HIS B CG  1 
ATOM   3282 N  ND1 . HIS B 1 101 ? 26.234  14.420  -19.571 1.00 27.85 ? 581  HIS B ND1 1 
ATOM   3283 C  CD2 . HIS B 1 101 ? 27.650  12.792  -19.234 1.00 28.56 ? 581  HIS B CD2 1 
ATOM   3284 C  CE1 . HIS B 1 101 ? 27.319  14.949  -19.033 1.00 29.40 ? 581  HIS B CE1 1 
ATOM   3285 N  NE2 . HIS B 1 101 ? 28.193  13.983  -18.819 1.00 29.20 ? 581  HIS B NE2 1 
ATOM   3286 N  N   . SER B 1 102 ? 22.373  11.715  -20.814 1.00 28.94 ? 582  SER B N   1 
ATOM   3287 C  CA  . SER B 1 102 ? 21.279  11.091  -21.541 1.00 28.96 ? 582  SER B CA  1 
ATOM   3288 C  C   . SER B 1 102 ? 21.796  10.221  -22.679 1.00 29.12 ? 582  SER B C   1 
ATOM   3289 O  O   . SER B 1 102 ? 22.968  10.302  -23.067 1.00 28.83 ? 582  SER B O   1 
ATOM   3290 C  CB  . SER B 1 102 ? 20.331  12.157  -22.090 1.00 28.94 ? 582  SER B CB  1 
ATOM   3291 O  OG  . SER B 1 102 ? 20.890  12.812  -23.213 1.00 29.36 ? 582  SER B OG  1 
ATOM   3292 N  N   . GLU B 1 103 ? 20.906  9.400   -23.224 1.00 29.29 ? 583  GLU B N   1 
ATOM   3293 C  CA  . GLU B 1 103 ? 21.273  8.486   -24.299 1.00 29.65 ? 583  GLU B CA  1 
ATOM   3294 C  C   . GLU B 1 103 ? 21.635  9.240   -25.576 1.00 29.85 ? 583  GLU B C   1 
ATOM   3295 O  O   . GLU B 1 103 ? 22.659  8.954   -26.196 1.00 29.76 ? 583  GLU B O   1 
ATOM   3296 C  CB  . GLU B 1 103 ? 20.143  7.494   -24.572 1.00 29.71 ? 583  GLU B CB  1 
ATOM   3297 C  CG  . GLU B 1 103 ? 20.572  6.297   -25.397 1.00 30.01 ? 583  GLU B CG  1 
ATOM   3298 C  CD  . GLU B 1 103 ? 19.515  5.214   -25.458 1.00 30.39 ? 583  GLU B CD  1 
ATOM   3299 O  OE1 . GLU B 1 103 ? 18.991  4.818   -24.393 1.00 30.73 ? 583  GLU B OE1 1 
ATOM   3300 O  OE2 . GLU B 1 103 ? 19.217  4.749   -26.574 1.00 30.74 ? 583  GLU B OE2 1 
ATOM   3301 N  N   . ARG B 1 104 ? 20.801  10.201  -25.964 1.00 30.14 ? 584  ARG B N   1 
ATOM   3302 C  CA  . ARG B 1 104 ? 21.075  11.014  -27.153 1.00 30.46 ? 584  ARG B CA  1 
ATOM   3303 C  C   . ARG B 1 104 ? 22.425  11.735  -27.044 1.00 30.04 ? 584  ARG B C   1 
ATOM   3304 O  O   . ARG B 1 104 ? 23.173  11.783  -28.018 1.00 29.85 ? 584  ARG B O   1 
ATOM   3305 C  CB  . ARG B 1 104 ? 19.937  12.013  -27.423 1.00 30.73 ? 584  ARG B CB  1 
ATOM   3306 C  CG  . ARG B 1 104 ? 19.798  13.098  -26.374 1.00 33.01 ? 584  ARG B CG  1 
ATOM   3307 C  CD  . ARG B 1 104 ? 18.444  13.807  -26.416 1.00 35.67 ? 584  ARG B CD  1 
ATOM   3308 N  NE  . ARG B 1 104 ? 18.296  14.719  -25.271 1.00 37.45 ? 584  ARG B NE  1 
ATOM   3309 C  CZ  . ARG B 1 104 ? 17.754  14.403  -24.092 1.00 39.14 ? 584  ARG B CZ  1 
ATOM   3310 N  NH1 . ARG B 1 104 ? 17.268  13.184  -23.855 1.00 39.80 ? 584  ARG B NH1 1 
ATOM   3311 N  NH2 . ARG B 1 104 ? 17.685  15.326  -23.135 1.00 39.91 ? 584  ARG B NH2 1 
ATOM   3312 N  N   . HIS B 1 105 ? 22.735  12.270  -25.861 1.00 29.77 ? 585  HIS B N   1 
ATOM   3313 C  CA  . HIS B 1 105 ? 24.006  12.979  -25.618 1.00 29.71 ? 585  HIS B CA  1 
ATOM   3314 C  C   . HIS B 1 105 ? 25.222  12.054  -25.755 1.00 29.57 ? 585  HIS B C   1 
ATOM   3315 O  O   . HIS B 1 105 ? 26.240  12.436  -26.338 1.00 29.45 ? 585  HIS B O   1 
ATOM   3316 C  CB  . HIS B 1 105 ? 23.996  13.631  -24.226 1.00 29.62 ? 585  HIS B CB  1 
ATOM   3317 C  CG  . HIS B 1 105 ? 25.247  14.387  -23.892 1.00 30.15 ? 585  HIS B CG  1 
ATOM   3318 N  ND1 . HIS B 1 105 ? 25.443  15.703  -24.252 1.00 30.20 ? 585  HIS B ND1 1 
ATOM   3319 C  CD2 . HIS B 1 105 ? 26.363  14.014  -23.217 1.00 30.47 ? 585  HIS B CD2 1 
ATOM   3320 C  CE1 . HIS B 1 105 ? 26.623  16.107  -23.815 1.00 29.80 ? 585  HIS B CE1 1 
ATOM   3321 N  NE2 . HIS B 1 105 ? 27.202  15.102  -23.183 1.00 29.45 ? 585  HIS B NE2 1 
ATOM   3322 N  N   . VAL B 1 106 ? 25.101  10.843  -25.215 1.00 29.56 ? 586  VAL B N   1 
ATOM   3323 C  CA  . VAL B 1 106 ? 26.146  9.819   -25.313 1.00 29.55 ? 586  VAL B CA  1 
ATOM   3324 C  C   . VAL B 1 106 ? 26.352  9.337   -26.754 1.00 29.68 ? 586  VAL B C   1 
ATOM   3325 O  O   . VAL B 1 106 ? 27.487  9.164   -27.198 1.00 29.52 ? 586  VAL B O   1 
ATOM   3326 C  CB  . VAL B 1 106 ? 25.836  8.614   -24.392 1.00 29.52 ? 586  VAL B CB  1 
ATOM   3327 C  CG1 . VAL B 1 106 ? 26.773  7.452   -24.678 1.00 29.22 ? 586  VAL B CG1 1 
ATOM   3328 C  CG2 . VAL B 1 106 ? 25.928  9.035   -22.937 1.00 29.05 ? 586  VAL B CG2 1 
ATOM   3329 N  N   . LEU B 1 107 ? 25.260  9.125   -27.481 1.00 30.13 ? 587  LEU B N   1 
ATOM   3330 C  CA  . LEU B 1 107 ? 25.344  8.762   -28.900 1.00 30.54 ? 587  LEU B CA  1 
ATOM   3331 C  C   . LEU B 1 107 ? 26.007  9.866   -29.726 1.00 30.92 ? 587  LEU B C   1 
ATOM   3332 O  O   . LEU B 1 107 ? 26.777  9.582   -30.643 1.00 30.68 ? 587  LEU B O   1 
ATOM   3333 C  CB  . LEU B 1 107 ? 23.955  8.456   -29.470 1.00 30.57 ? 587  LEU B CB  1 
ATOM   3334 C  CG  . LEU B 1 107 ? 23.352  7.091   -29.127 1.00 31.09 ? 587  LEU B CG  1 
ATOM   3335 C  CD1 . LEU B 1 107 ? 21.923  6.989   -29.648 1.00 31.21 ? 587  LEU B CD1 1 
ATOM   3336 C  CD2 . LEU B 1 107 ? 24.191  5.954   -29.696 1.00 31.56 ? 587  LEU B CD2 1 
ATOM   3337 N  N   . LEU B 1 108 ? 25.719  11.119  -29.375 1.00 31.62 ? 588  LEU B N   1 
ATOM   3338 C  CA  . LEU B 1 108 ? 26.203  12.280  -30.122 1.00 32.10 ? 588  LEU B CA  1 
ATOM   3339 C  C   . LEU B 1 108 ? 27.706  12.501  -29.973 1.00 32.42 ? 588  LEU B C   1 
ATOM   3340 O  O   . LEU B 1 108 ? 28.399  12.716  -30.961 1.00 32.45 ? 588  LEU B O   1 
ATOM   3341 C  CB  . LEU B 1 108 ? 25.445  13.545  -29.690 1.00 32.21 ? 588  LEU B CB  1 
ATOM   3342 C  CG  . LEU B 1 108 ? 25.579  14.783  -30.582 1.00 32.70 ? 588  LEU B CG  1 
ATOM   3343 C  CD1 . LEU B 1 108 ? 24.963  14.524  -31.944 1.00 32.79 ? 588  LEU B CD1 1 
ATOM   3344 C  CD2 . LEU B 1 108 ? 24.930  16.004  -29.929 1.00 33.12 ? 588  LEU B CD2 1 
ATOM   3345 N  N   . TYR B 1 109 ? 28.208  12.455  -28.745 1.00 32.98 ? 589  TYR B N   1 
ATOM   3346 C  CA  . TYR B 1 109 ? 29.620  12.764  -28.491 1.00 33.47 ? 589  TYR B CA  1 
ATOM   3347 C  C   . TYR B 1 109 ? 30.482  11.538  -28.168 1.00 34.06 ? 589  TYR B C   1 
ATOM   3348 O  O   . TYR B 1 109 ? 31.702  11.656  -28.080 1.00 33.66 ? 589  TYR B O   1 
ATOM   3349 C  CB  . TYR B 1 109 ? 29.734  13.796  -27.367 1.00 33.47 ? 589  TYR B CB  1 
ATOM   3350 C  CG  . TYR B 1 109 ? 28.963  15.072  -27.637 1.00 33.54 ? 589  TYR B CG  1 
ATOM   3351 C  CD1 . TYR B 1 109 ? 29.351  15.943  -28.653 1.00 33.93 ? 589  TYR B CD1 1 
ATOM   3352 C  CD2 . TYR B 1 109 ? 27.848  15.406  -26.882 1.00 33.33 ? 589  TYR B CD2 1 
ATOM   3353 C  CE1 . TYR B 1 109 ? 28.647  17.110  -28.906 1.00 33.67 ? 589  TYR B CE1 1 
ATOM   3354 C  CE2 . TYR B 1 109 ? 27.139  16.568  -27.126 1.00 33.70 ? 589  TYR B CE2 1 
ATOM   3355 C  CZ  . TYR B 1 109 ? 27.544  17.417  -28.137 1.00 33.76 ? 589  TYR B CZ  1 
ATOM   3356 O  OH  . TYR B 1 109 ? 26.836  18.569  -28.378 1.00 33.48 ? 589  TYR B OH  1 
ATOM   3357 N  N   . GLY B 1 110 ? 29.853  10.371  -28.011 1.00 35.05 ? 590  GLY B N   1 
ATOM   3358 C  CA  . GLY B 1 110 ? 30.553  9.151   -27.590 1.00 35.78 ? 590  GLY B CA  1 
ATOM   3359 C  C   . GLY B 1 110 ? 30.795  8.122   -28.678 1.00 36.53 ? 590  GLY B C   1 
ATOM   3360 O  O   . GLY B 1 110 ? 31.444  7.112   -28.433 1.00 36.62 ? 590  GLY B O   1 
ATOM   3361 N  N   . THR B 1 111 ? 30.269  8.362   -29.874 1.00 37.72 ? 591  THR B N   1 
ATOM   3362 C  CA  . THR B 1 111 ? 30.487  7.467   -31.012 1.00 38.65 ? 591  THR B CA  1 
ATOM   3363 C  C   . THR B 1 111 ? 30.994  8.270   -32.201 1.00 39.75 ? 591  THR B C   1 
ATOM   3364 O  O   . THR B 1 111 ? 30.936  9.497   -32.191 1.00 40.11 ? 591  THR B O   1 
ATOM   3365 C  CB  . THR B 1 111 ? 29.192  6.737   -31.415 1.00 38.60 ? 591  THR B CB  1 
ATOM   3366 O  OG1 . THR B 1 111 ? 28.266  7.676   -31.974 1.00 38.63 ? 591  THR B OG1 1 
ATOM   3367 C  CG2 . THR B 1 111 ? 28.555  6.050   -30.213 1.00 38.02 ? 591  THR B CG2 1 
ATOM   3368 N  N   . ASN B 1 112 ? 31.490  7.572   -33.219 1.00 41.12 ? 592  ASN B N   1 
ATOM   3369 C  CA  . ASN B 1 112 ? 31.963  8.210   -34.453 1.00 42.10 ? 592  ASN B CA  1 
ATOM   3370 C  C   . ASN B 1 112 ? 31.284  7.614   -35.688 1.00 42.72 ? 592  ASN B C   1 
ATOM   3371 O  O   . ASN B 1 112 ? 31.119  6.401   -35.770 1.00 42.72 ? 592  ASN B O   1 
ATOM   3372 C  CB  . ASN B 1 112 ? 33.482  8.052   -34.590 1.00 42.24 ? 592  ASN B CB  1 
ATOM   3373 C  CG  . ASN B 1 112 ? 34.258  9.052   -33.743 1.00 43.12 ? 592  ASN B CG  1 
ATOM   3374 O  OD1 . ASN B 1 112 ? 33.944  10.252  -33.720 1.00 44.26 ? 592  ASN B OD1 1 
ATOM   3375 N  ND2 . ASN B 1 112 ? 35.286  8.565   -33.050 1.00 43.19 ? 592  ASN B ND2 1 
ATOM   3376 N  N   . PRO B 1 113 ? 30.883  8.469   -36.650 1.00 43.44 ? 593  PRO B N   1 
ATOM   3377 C  CA  . PRO B 1 113 ? 30.376  7.964   -37.920 1.00 43.90 ? 593  PRO B CA  1 
ATOM   3378 C  C   . PRO B 1 113 ? 31.534  7.651   -38.869 1.00 44.30 ? 593  PRO B C   1 
ATOM   3379 O  O   . PRO B 1 113 ? 32.351  8.542   -39.114 1.00 44.64 ? 593  PRO B O   1 
ATOM   3380 C  CB  . PRO B 1 113 ? 29.555  9.138   -38.459 1.00 43.93 ? 593  PRO B CB  1 
ATOM   3381 C  CG  . PRO B 1 113 ? 30.214  10.351  -37.897 1.00 43.78 ? 593  PRO B CG  1 
ATOM   3382 C  CD  . PRO B 1 113 ? 30.849  9.944   -36.589 1.00 43.50 ? 593  PRO B CD  1 
ATOM   3383 N  N   . LEU B 1 114 ? 31.657  6.423   -39.383 1.00 44.62 ? 594  LEU B N   1 
ATOM   3384 C  CA  . LEU B 1 114 ? 30.828  5.266   -39.030 1.00 44.71 ? 594  LEU B CA  1 
ATOM   3385 C  C   . LEU B 1 114 ? 31.661  4.351   -38.133 1.00 44.67 ? 594  LEU B C   1 
ATOM   3386 O  O   . LEU B 1 114 ? 32.716  3.861   -38.546 1.00 44.61 ? 594  LEU B O   1 
ATOM   3387 C  CB  . LEU B 1 114 ? 30.390  4.498   -40.286 1.00 44.78 ? 594  LEU B CB  1 
ATOM   3388 C  CG  . LEU B 1 114 ? 29.951  5.302   -41.518 1.00 45.01 ? 594  LEU B CG  1 
ATOM   3389 C  CD1 . LEU B 1 114 ? 31.149  5.717   -42.365 1.00 45.19 ? 594  LEU B CD1 1 
ATOM   3390 C  CD2 . LEU B 1 114 ? 28.970  4.497   -42.366 1.00 45.26 ? 594  LEU B CD2 1 
ATOM   3391 N  N   . SER B 1 115 ? 31.199  4.138   -36.903 1.00 44.65 ? 595  SER B N   1 
ATOM   3392 C  CA  . SER B 1 115 ? 31.919  3.296   -35.945 1.00 44.64 ? 595  SER B CA  1 
ATOM   3393 C  C   . SER B 1 115 ? 31.775  1.825   -36.321 1.00 44.36 ? 595  SER B C   1 
ATOM   3394 O  O   . SER B 1 115 ? 31.106  1.481   -37.302 1.00 44.42 ? 595  SER B O   1 
ATOM   3395 C  CB  . SER B 1 115 ? 31.400  3.522   -34.513 1.00 44.77 ? 595  SER B CB  1 
ATOM   3396 O  OG  . SER B 1 115 ? 31.863  4.753   -33.972 1.00 45.42 ? 595  SER B OG  1 
ATOM   3397 N  N   . ARG B 1 116 ? 32.419  0.963   -35.540 1.00 43.97 ? 596  ARG B N   1 
ATOM   3398 C  CA  . ARG B 1 116 ? 32.181  -0.476  -35.612 1.00 43.47 ? 596  ARG B CA  1 
ATOM   3399 C  C   . ARG B 1 116 ? 31.050  -0.900  -34.670 1.00 42.88 ? 596  ARG B C   1 
ATOM   3400 O  O   . ARG B 1 116 ? 30.840  -2.092  -34.451 1.00 43.07 ? 596  ARG B O   1 
ATOM   3401 N  N   . LEU B 1 117 ? 30.327  0.078   -34.120 1.00 42.24 ? 597  LEU B N   1 
ATOM   3402 C  CA  . LEU B 1 117 ? 29.215  -0.182  -33.205 1.00 41.61 ? 597  LEU B CA  1 
ATOM   3403 C  C   . LEU B 1 117 ? 28.020  -0.782  -33.941 1.00 40.93 ? 597  LEU B C   1 
ATOM   3404 O  O   . LEU B 1 117 ? 27.713  -0.397  -35.073 1.00 40.79 ? 597  LEU B O   1 
ATOM   3405 C  CB  . LEU B 1 117 ? 28.799  1.108   -32.480 1.00 41.62 ? 597  LEU B CB  1 
ATOM   3406 C  CG  . LEU B 1 117 ? 29.656  1.476   -31.262 1.00 41.65 ? 597  LEU B CG  1 
ATOM   3407 C  CD1 . LEU B 1 117 ? 29.649  2.977   -30.995 1.00 41.71 ? 597  LEU B CD1 1 
ATOM   3408 C  CD2 . LEU B 1 117 ? 29.187  0.707   -30.032 1.00 41.69 ? 597  LEU B CD2 1 
ATOM   3409 N  N   . LYS B 1 118 ? 27.354  -1.730  -33.287 1.00 40.17 ? 598  LYS B N   1 
ATOM   3410 C  CA  . LYS B 1 118 ? 26.179  -2.382  -33.852 1.00 39.61 ? 598  LYS B CA  1 
ATOM   3411 C  C   . LYS B 1 118 ? 24.912  -1.781  -33.251 1.00 38.91 ? 598  LYS B C   1 
ATOM   3412 O  O   . LYS B 1 118 ? 24.078  -2.502  -32.694 1.00 39.07 ? 598  LYS B O   1 
ATOM   3413 C  CB  . LYS B 1 118 ? 26.224  -3.897  -33.607 1.00 39.57 ? 598  LYS B CB  1 
ATOM   3414 N  N   . LEU B 1 119 ? 24.778  -0.460  -33.367 1.00 37.87 ? 599  LEU B N   1 
ATOM   3415 C  CA  . LEU B 1 119 ? 23.547  0.231   -32.990 1.00 37.03 ? 599  LEU B CA  1 
ATOM   3416 C  C   . LEU B 1 119 ? 22.406  -0.207  -33.906 1.00 36.24 ? 599  LEU B C   1 
ATOM   3417 O  O   . LEU B 1 119 ? 22.605  -0.402  -35.102 1.00 36.13 ? 599  LEU B O   1 
ATOM   3418 C  CB  . LEU B 1 119 ? 23.716  1.747   -33.105 1.00 36.93 ? 599  LEU B CB  1 
ATOM   3419 C  CG  . LEU B 1 119 ? 24.722  2.428   -32.181 1.00 36.84 ? 599  LEU B CG  1 
ATOM   3420 C  CD1 . LEU B 1 119 ? 24.867  3.893   -32.573 1.00 36.29 ? 599  LEU B CD1 1 
ATOM   3421 C  CD2 . LEU B 1 119 ? 24.300  2.290   -30.722 1.00 36.43 ? 599  LEU B CD2 1 
ATOM   3422 N  N   . ASP B 1 120 ? 21.215  -0.358  -33.335 1.00 35.40 ? 600  ASP B N   1 
ATOM   3423 C  CA  . ASP B 1 120 ? 20.018  -0.643  -34.120 1.00 34.83 ? 600  ASP B CA  1 
ATOM   3424 C  C   . ASP B 1 120 ? 19.664  0.551   -35.000 1.00 34.17 ? 600  ASP B C   1 
ATOM   3425 O  O   . ASP B 1 120 ? 20.085  1.678   -34.731 1.00 34.03 ? 600  ASP B O   1 
ATOM   3426 C  CB  . ASP B 1 120 ? 18.839  -1.000  -33.212 1.00 34.91 ? 600  ASP B CB  1 
ATOM   3427 C  CG  . ASP B 1 120 ? 18.546  0.074   -32.185 1.00 35.23 ? 600  ASP B CG  1 
ATOM   3428 O  OD1 . ASP B 1 120 ? 19.421  0.329   -31.331 1.00 35.70 ? 600  ASP B OD1 1 
ATOM   3429 O  OD2 . ASP B 1 120 ? 17.449  0.667   -32.238 1.00 36.08 ? 600  ASP B OD2 1 
ATOM   3430 N  N   . ASN B 1 121 ? 18.886  0.297   -36.049 1.00 33.45 ? 601  ASN B N   1 
ATOM   3431 C  CA  . ASN B 1 121 ? 18.550  1.325   -37.035 1.00 32.96 ? 601  ASN B CA  1 
ATOM   3432 C  C   . ASN B 1 121 ? 17.746  2.497   -36.472 1.00 32.68 ? 601  ASN B C   1 
ATOM   3433 O  O   . ASN B 1 121 ? 17.778  3.591   -37.031 1.00 32.66 ? 601  ASN B O   1 
ATOM   3434 C  CB  . ASN B 1 121 ? 17.817  0.706   -38.228 1.00 32.83 ? 601  ASN B CB  1 
ATOM   3435 C  CG  . ASN B 1 121 ? 18.728  -0.140  -39.096 1.00 32.52 ? 601  ASN B CG  1 
ATOM   3436 O  OD1 . ASN B 1 121 ? 19.883  -0.389  -38.749 1.00 32.51 ? 601  ASN B OD1 1 
ATOM   3437 N  ND2 . ASN B 1 121 ? 18.215  -0.576  -40.239 1.00 31.44 ? 601  ASN B ND2 1 
ATOM   3438 N  N   . GLY B 1 122 ? 17.034  2.274   -35.373 1.00 32.41 ? 602  GLY B N   1 
ATOM   3439 C  CA  . GLY B 1 122 ? 16.359  3.358   -34.669 1.00 32.30 ? 602  GLY B CA  1 
ATOM   3440 C  C   . GLY B 1 122 ? 17.321  4.443   -34.217 1.00 32.16 ? 602  GLY B C   1 
ATOM   3441 O  O   . GLY B 1 122 ? 17.048  5.630   -34.391 1.00 32.11 ? 602  GLY B O   1 
ATOM   3442 N  N   . LYS B 1 123 ? 18.457  4.032   -33.655 1.00 32.02 ? 603  LYS B N   1 
ATOM   3443 C  CA  . LYS B 1 123 ? 19.482  4.972   -33.194 1.00 31.90 ? 603  LYS B CA  1 
ATOM   3444 C  C   . LYS B 1 123 ? 20.227  5.599   -34.376 1.00 31.73 ? 603  LYS B C   1 
ATOM   3445 O  O   . LYS B 1 123 ? 20.531  6.789   -34.357 1.00 31.62 ? 603  LYS B O   1 
ATOM   3446 C  CB  . LYS B 1 123 ? 20.498  4.290   -32.266 1.00 31.98 ? 603  LYS B CB  1 
ATOM   3447 C  CG  . LYS B 1 123 ? 19.916  3.426   -31.151 1.00 32.12 ? 603  LYS B CG  1 
ATOM   3448 C  CD  . LYS B 1 123 ? 19.132  4.216   -30.127 1.00 32.53 ? 603  LYS B CD  1 
ATOM   3449 C  CE  . LYS B 1 123 ? 18.376  3.278   -29.188 1.00 32.72 ? 603  LYS B CE  1 
ATOM   3450 N  NZ  . LYS B 1 123 ? 19.300  2.428   -28.383 1.00 32.55 ? 603  LYS B NZ  1 
ATOM   3451 N  N   . LEU B 1 124 ? 20.531  4.793   -35.390 1.00 31.65 ? 604  LEU B N   1 
ATOM   3452 C  CA  . LEU B 1 124 ? 21.218  5.289   -36.584 1.00 31.83 ? 604  LEU B CA  1 
ATOM   3453 C  C   . LEU B 1 124 ? 20.376  6.340   -37.309 1.00 31.95 ? 604  LEU B C   1 
ATOM   3454 O  O   . LEU B 1 124 ? 20.894  7.374   -37.725 1.00 31.76 ? 604  LEU B O   1 
ATOM   3455 C  CB  . LEU B 1 124 ? 21.560  4.140   -37.543 1.00 31.74 ? 604  LEU B CB  1 
ATOM   3456 C  CG  . LEU B 1 124 ? 22.513  3.055   -37.028 1.00 31.84 ? 604  LEU B CG  1 
ATOM   3457 C  CD1 . LEU B 1 124 ? 22.776  2.021   -38.109 1.00 31.68 ? 604  LEU B CD1 1 
ATOM   3458 C  CD2 . LEU B 1 124 ? 23.828  3.648   -36.535 1.00 32.05 ? 604  LEU B CD2 1 
ATOM   3459 N  N   . ALA B 1 125 ? 19.079  6.072   -37.441 1.00 32.22 ? 605  ALA B N   1 
ATOM   3460 C  CA  . ALA B 1 125 ? 18.150  7.007   -38.079 1.00 32.49 ? 605  ALA B CA  1 
ATOM   3461 C  C   . ALA B 1 125 ? 18.040  8.320   -37.307 1.00 32.70 ? 605  ALA B C   1 
ATOM   3462 O  O   . ALA B 1 125 ? 17.916  9.386   -37.907 1.00 32.70 ? 605  ALA B O   1 
ATOM   3463 C  CB  . ALA B 1 125 ? 16.771  6.369   -38.232 1.00 32.45 ? 605  ALA B CB  1 
ATOM   3464 N  N   . GLY B 1 126 ? 18.079  8.236   -35.980 1.00 33.02 ? 606  GLY B N   1 
ATOM   3465 C  CA  . GLY B 1 126 ? 18.037  9.419   -35.124 1.00 33.37 ? 606  GLY B CA  1 
ATOM   3466 C  C   . GLY B 1 126 ? 19.256  10.309  -35.292 1.00 33.81 ? 606  GLY B C   1 
ATOM   3467 O  O   . GLY B 1 126 ? 19.157  11.533  -35.199 1.00 33.88 ? 606  GLY B O   1 
ATOM   3468 N  N   . LEU B 1 127 ? 20.408  9.690   -35.539 1.00 34.25 ? 607  LEU B N   1 
ATOM   3469 C  CA  . LEU B 1 127 ? 21.653  10.423  -35.749 1.00 34.57 ? 607  LEU B CA  1 
ATOM   3470 C  C   . LEU B 1 127 ? 21.723  11.039  -37.148 1.00 34.87 ? 607  LEU B C   1 
ATOM   3471 O  O   . LEU B 1 127 ? 22.400  12.046  -37.344 1.00 34.81 ? 607  LEU B O   1 
ATOM   3472 C  CB  . LEU B 1 127 ? 22.858  9.510   -35.504 1.00 34.62 ? 607  LEU B CB  1 
ATOM   3473 C  CG  . LEU B 1 127 ? 23.039  9.043   -34.055 1.00 34.39 ? 607  LEU B CG  1 
ATOM   3474 C  CD1 . LEU B 1 127 ? 24.040  7.903   -33.978 1.00 34.61 ? 607  LEU B CD1 1 
ATOM   3475 C  CD2 . LEU B 1 127 ? 23.473  10.190  -33.158 1.00 34.59 ? 607  LEU B CD2 1 
ATOM   3476 N  N   . LEU B 1 128 ? 21.030  10.436  -38.114 1.00 35.40 ? 608  LEU B N   1 
ATOM   3477 C  CA  . LEU B 1 128 ? 20.890  11.024  -39.452 1.00 35.77 ? 608  LEU B CA  1 
ATOM   3478 C  C   . LEU B 1 128 ? 20.079  12.315  -39.417 1.00 36.22 ? 608  LEU B C   1 
ATOM   3479 O  O   . LEU B 1 128 ? 20.261  13.178  -40.268 1.00 36.37 ? 608  LEU B O   1 
ATOM   3480 C  CB  . LEU B 1 128 ? 20.215  10.050  -40.422 1.00 35.72 ? 608  LEU B CB  1 
ATOM   3481 C  CG  . LEU B 1 128 ? 21.017  8.850   -40.924 1.00 35.77 ? 608  LEU B CG  1 
ATOM   3482 C  CD1 . LEU B 1 128 ? 20.141  7.994   -41.836 1.00 35.10 ? 608  LEU B CD1 1 
ATOM   3483 C  CD2 . LEU B 1 128 ? 22.283  9.294   -41.647 1.00 35.54 ? 608  LEU B CD2 1 
ATOM   3484 N  N   . ALA B 1 129 ? 19.177  12.434  -38.444 1.00 36.79 ? 609  ALA B N   1 
ATOM   3485 C  CA  . ALA B 1 129 ? 18.328  13.621  -38.310 1.00 37.17 ? 609  ALA B CA  1 
ATOM   3486 C  C   . ALA B 1 129 ? 19.117  14.860  -37.865 1.00 37.56 ? 609  ALA B C   1 
ATOM   3487 O  O   . ALA B 1 129 ? 18.783  15.981  -38.256 1.00 37.67 ? 609  ALA B O   1 
ATOM   3488 C  CB  . ALA B 1 129 ? 17.179  13.345  -37.346 1.00 37.01 ? 609  ALA B CB  1 
ATOM   3489 N  N   . GLN B 1 130 ? 20.158  14.656  -37.057 1.00 38.03 ? 610  GLN B N   1 
ATOM   3490 C  CA  . GLN B 1 130 ? 21.010  15.757  -36.591 1.00 38.44 ? 610  GLN B CA  1 
ATOM   3491 C  C   . GLN B 1 130 ? 21.958  16.254  -37.679 1.00 38.42 ? 610  GLN B C   1 
ATOM   3492 O  O   . GLN B 1 130 ? 22.083  15.639  -38.739 1.00 38.70 ? 610  GLN B O   1 
ATOM   3493 C  CB  . GLN B 1 130 ? 21.829  15.326  -35.375 1.00 38.68 ? 610  GLN B CB  1 
ATOM   3494 C  CG  . GLN B 1 130 ? 20.991  14.938  -34.172 1.00 39.48 ? 610  GLN B CG  1 
ATOM   3495 C  CD  . GLN B 1 130 ? 21.724  15.139  -32.859 1.00 41.07 ? 610  GLN B CD  1 
ATOM   3496 O  OE1 . GLN B 1 130 ? 21.780  14.234  -32.023 1.00 42.46 ? 610  GLN B OE1 1 
ATOM   3497 N  NE2 . GLN B 1 130 ? 22.295  16.332  -32.670 1.00 41.49 ? 610  GLN B NE2 1 
ATOM   3498 N  N   . VAL B 1 134 ? 27.716  22.540  -35.960 1.00 34.88 ? 614  VAL B N   1 
ATOM   3499 C  CA  . VAL B 1 134 ? 27.703  23.996  -36.080 1.00 34.79 ? 614  VAL B CA  1 
ATOM   3500 C  C   . VAL B 1 134 ? 29.037  24.519  -36.614 1.00 34.59 ? 614  VAL B C   1 
ATOM   3501 O  O   . VAL B 1 134 ? 30.104  24.143  -36.133 1.00 34.51 ? 614  VAL B O   1 
ATOM   3502 C  CB  . VAL B 1 134 ? 27.368  24.660  -34.719 1.00 34.91 ? 614  VAL B CB  1 
ATOM   3503 C  CG1 . VAL B 1 134 ? 28.006  26.042  -34.600 1.00 34.71 ? 614  VAL B CG1 1 
ATOM   3504 C  CG2 . VAL B 1 134 ? 25.857  24.734  -34.528 1.00 34.97 ? 614  VAL B CG2 1 
ATOM   3505 N  N   . MET B 1 135 ? 28.958  25.389  -37.613 1.00 34.58 ? 615  MET B N   1 
ATOM   3506 C  CA  . MET B 1 135 ? 30.140  25.966  -38.248 1.00 34.60 ? 615  MET B CA  1 
ATOM   3507 C  C   . MET B 1 135 ? 30.687  27.100  -37.392 1.00 34.36 ? 615  MET B C   1 
ATOM   3508 O  O   . MET B 1 135 ? 29.920  27.857  -36.792 1.00 34.45 ? 615  MET B O   1 
ATOM   3509 C  CB  . MET B 1 135 ? 29.780  26.499  -39.635 1.00 34.71 ? 615  MET B CB  1 
ATOM   3510 C  CG  . MET B 1 135 ? 30.946  27.086  -40.427 1.00 35.33 ? 615  MET B CG  1 
ATOM   3511 S  SD  . MET B 1 135 ? 32.092  25.841  -41.048 1.00 36.64 ? 615  MET B SD  1 
ATOM   3512 C  CE  . MET B 1 135 ? 31.141  25.117  -42.388 1.00 35.37 ? 615  MET B CE  1 
ATOM   3513 N  N   . LEU B 1 136 ? 32.013  27.209  -37.343 1.00 33.99 ? 616  LEU B N   1 
ATOM   3514 C  CA  . LEU B 1 136 ? 32.685  28.263  -36.584 1.00 33.54 ? 616  LEU B CA  1 
ATOM   3515 C  C   . LEU B 1 136 ? 33.295  29.293  -37.533 1.00 33.07 ? 616  LEU B C   1 
ATOM   3516 O  O   . LEU B 1 136 ? 33.585  28.971  -38.690 1.00 33.21 ? 616  LEU B O   1 
ATOM   3517 C  CB  . LEU B 1 136 ? 33.786  27.672  -35.703 1.00 33.49 ? 616  LEU B CB  1 
ATOM   3518 C  CG  . LEU B 1 136 ? 33.362  26.633  -34.666 1.00 33.54 ? 616  LEU B CG  1 
ATOM   3519 C  CD1 . LEU B 1 136 ? 34.572  26.177  -33.869 1.00 33.16 ? 616  LEU B CD1 1 
ATOM   3520 C  CD2 . LEU B 1 136 ? 32.288  27.185  -33.742 1.00 33.69 ? 616  LEU B CD2 1 
ATOM   3521 N  N   . PRO B 1 137 ? 33.501  30.533  -37.046 1.00 32.38 ? 617  PRO B N   1 
ATOM   3522 C  CA  . PRO B 1 137 ? 34.181  31.576  -37.818 1.00 31.94 ? 617  PRO B CA  1 
ATOM   3523 C  C   . PRO B 1 137 ? 35.510  31.125  -38.434 1.00 31.45 ? 617  PRO B C   1 
ATOM   3524 O  O   . PRO B 1 137 ? 35.845  31.540  -39.543 1.00 31.46 ? 617  PRO B O   1 
ATOM   3525 C  CB  . PRO B 1 137 ? 34.433  32.666  -36.776 1.00 31.94 ? 617  PRO B CB  1 
ATOM   3526 C  CG  . PRO B 1 137 ? 33.351  32.500  -35.789 1.00 32.17 ? 617  PRO B CG  1 
ATOM   3527 C  CD  . PRO B 1 137 ? 33.029  31.039  -35.743 1.00 32.39 ? 617  PRO B CD  1 
ATOM   3528 N  N   . CYS B 1 138 ? 36.244  30.282  -37.712 1.00 30.94 ? 618  CYS B N   1 
ATOM   3529 C  CA  . CYS B 1 138 ? 37.541  29.773  -38.159 1.00 30.54 ? 618  CYS B CA  1 
ATOM   3530 C  C   . CYS B 1 138 ? 37.438  28.654  -39.192 1.00 30.30 ? 618  CYS B C   1 
ATOM   3531 O  O   . CYS B 1 138 ? 38.459  28.220  -39.730 1.00 30.22 ? 618  CYS B O   1 
ATOM   3532 C  CB  . CYS B 1 138 ? 38.329  29.252  -36.958 1.00 30.61 ? 618  CYS B CB  1 
ATOM   3533 S  SG  . CYS B 1 138 ? 37.613  27.775  -36.179 1.00 30.30 ? 618  CYS B SG  1 
ATOM   3534 N  N   . GLY B 1 139 ? 36.221  28.172  -39.446 1.00 30.00 ? 619  GLY B N   1 
ATOM   3535 C  CA  . GLY B 1 139 ? 35.994  27.105  -40.419 1.00 29.93 ? 619  GLY B CA  1 
ATOM   3536 C  C   . GLY B 1 139 ? 35.864  25.721  -39.814 1.00 29.77 ? 619  GLY B C   1 
ATOM   3537 O  O   . GLY B 1 139 ? 35.360  24.809  -40.462 1.00 29.77 ? 619  GLY B O   1 
ATOM   3538 N  N   . GLY B 1 140 ? 36.332  25.556  -38.581 1.00 29.72 ? 620  GLY B N   1 
ATOM   3539 C  CA  . GLY B 1 140 ? 36.199  24.290  -37.861 1.00 29.65 ? 620  GLY B CA  1 
ATOM   3540 C  C   . GLY B 1 140 ? 34.781  24.035  -37.386 1.00 29.52 ? 620  GLY B C   1 
ATOM   3541 O  O   . GLY B 1 140 ? 33.920  24.914  -37.462 1.00 29.70 ? 620  GLY B O   1 
ATOM   3542 N  N   . VAL B 1 141 ? 34.544  22.820  -36.899 1.00 29.34 ? 621  VAL B N   1 
ATOM   3543 C  CA  . VAL B 1 141 ? 33.244  22.415  -36.376 1.00 29.13 ? 621  VAL B CA  1 
ATOM   3544 C  C   . VAL B 1 141 ? 33.254  22.555  -34.862 1.00 28.98 ? 621  VAL B C   1 
ATOM   3545 O  O   . VAL B 1 141 ? 34.318  22.534  -34.250 1.00 28.69 ? 621  VAL B O   1 
ATOM   3546 C  CB  . VAL B 1 141 ? 32.925  20.950  -36.773 1.00 29.08 ? 621  VAL B CB  1 
ATOM   3547 C  CG1 . VAL B 1 141 ? 31.628  20.461  -36.121 1.00 29.47 ? 621  VAL B CG1 1 
ATOM   3548 C  CG2 . VAL B 1 141 ? 32.833  20.831  -38.275 1.00 28.92 ? 621  VAL B CG2 1 
ATOM   3549 N  N   . GLY B 1 142 ? 32.074  22.709  -34.265 1.00 29.17 ? 622  GLY B N   1 
ATOM   3550 C  CA  . GLY B 1 142 ? 31.946  22.722  -32.802 1.00 29.46 ? 622  GLY B CA  1 
ATOM   3551 C  C   . GLY B 1 142 ? 30.518  22.579  -32.308 1.00 29.58 ? 622  GLY B C   1 
ATOM   3552 O  O   . GLY B 1 142 ? 29.591  22.487  -33.102 1.00 29.32 ? 622  GLY B O   1 
ATOM   3553 N  N   . VAL B 1 143 ? 30.340  22.561  -30.988 1.00 30.26 ? 623  VAL B N   1 
ATOM   3554 C  CA  . VAL B 1 143 ? 28.992  22.559  -30.401 1.00 30.72 ? 623  VAL B CA  1 
ATOM   3555 C  C   . VAL B 1 143 ? 28.518  24.012  -30.257 1.00 30.90 ? 623  VAL B C   1 
ATOM   3556 O  O   . VAL B 1 143 ? 27.357  24.322  -30.508 1.00 31.00 ? 623  VAL B O   1 
ATOM   3557 C  CB  . VAL B 1 143 ? 28.908  21.789  -29.051 1.00 30.75 ? 623  VAL B CB  1 
ATOM   3558 C  CG1 . VAL B 1 143 ? 29.885  20.607  -29.028 1.00 30.86 ? 623  VAL B CG1 1 
ATOM   3559 C  CG2 . VAL B 1 143 ? 29.149  22.706  -27.870 1.00 31.18 ? 623  VAL B CG2 1 
ATOM   3560 N  N   . ASP B 1 144 ? 29.436  24.889  -29.861 1.00 31.24 ? 624  ASP B N   1 
ATOM   3561 C  CA  . ASP B 1 144 ? 29.226  26.339  -29.900 1.00 31.41 ? 624  ASP B CA  1 
ATOM   3562 C  C   . ASP B 1 144 ? 30.582  26.978  -30.200 1.00 31.36 ? 624  ASP B C   1 
ATOM   3563 O  O   . ASP B 1 144 ? 31.542  26.263  -30.480 1.00 31.70 ? 624  ASP B O   1 
ATOM   3564 C  CB  . ASP B 1 144 ? 28.610  26.852  -28.589 1.00 31.42 ? 624  ASP B CB  1 
ATOM   3565 C  CG  . ASP B 1 144 ? 29.467  26.548  -27.367 1.00 32.39 ? 624  ASP B CG  1 
ATOM   3566 O  OD1 . ASP B 1 144 ? 30.678  26.853  -27.382 1.00 34.02 ? 624  ASP B OD1 1 
ATOM   3567 O  OD2 . ASP B 1 144 ? 28.922  26.022  -26.376 1.00 33.13 ? 624  ASP B OD2 1 
ATOM   3568 N  N   . THR B 1 145 ? 30.671  28.303  -30.142 1.00 31.23 ? 625  THR B N   1 
ATOM   3569 C  CA  . THR B 1 145 ? 31.900  29.012  -30.518 1.00 31.00 ? 625  THR B CA  1 
ATOM   3570 C  C   . THR B 1 145 ? 33.133  28.672  -29.657 1.00 30.70 ? 625  THR B C   1 
ATOM   3571 O  O   . THR B 1 145 ? 34.261  28.797  -30.127 1.00 30.92 ? 625  THR B O   1 
ATOM   3572 C  CB  . THR B 1 145 ? 31.685  30.542  -30.509 1.00 31.01 ? 625  THR B CB  1 
ATOM   3573 O  OG1 . THR B 1 145 ? 31.046  30.925  -29.287 1.00 31.41 ? 625  THR B OG1 1 
ATOM   3574 C  CG2 . THR B 1 145 ? 30.817  30.976  -31.687 1.00 30.79 ? 625  THR B CG2 1 
ATOM   3575 N  N   . ASP B 1 146 ? 32.927  28.245  -28.415 1.00 30.27 ? 626  ASP B N   1 
ATOM   3576 C  CA  . ASP B 1 146 ? 34.045  27.899  -27.532 1.00 30.00 ? 626  ASP B CA  1 
ATOM   3577 C  C   . ASP B 1 146 ? 34.338  26.398  -27.526 1.00 29.63 ? 626  ASP B C   1 
ATOM   3578 O  O   . ASP B 1 146 ? 35.494  25.984  -27.561 1.00 29.62 ? 626  ASP B O   1 
ATOM   3579 C  CB  . ASP B 1 146 ? 33.769  28.380  -26.104 1.00 29.94 ? 626  ASP B CB  1 
ATOM   3580 C  CG  . ASP B 1 146 ? 33.995  29.881  -25.924 1.00 30.74 ? 626  ASP B CG  1 
ATOM   3581 O  OD1 . ASP B 1 146 ? 34.646  30.529  -26.783 1.00 32.05 ? 626  ASP B OD1 1 
ATOM   3582 O  OD2 . ASP B 1 146 ? 33.523  30.416  -24.902 1.00 31.73 ? 626  ASP B OD2 1 
ATOM   3583 N  N   . THR B 1 147 ? 33.285  25.591  -27.480 1.00 29.15 ? 627  THR B N   1 
ATOM   3584 C  CA  . THR B 1 147 ? 33.412  24.142  -27.369 1.00 28.65 ? 627  THR B CA  1 
ATOM   3585 C  C   . THR B 1 147 ? 33.584  23.514  -28.759 1.00 28.04 ? 627  THR B C   1 
ATOM   3586 O  O   . THR B 1 147 ? 32.608  23.244  -29.452 1.00 28.02 ? 627  THR B O   1 
ATOM   3587 C  CB  . THR B 1 147 ? 32.185  23.573  -26.636 1.00 28.59 ? 627  THR B CB  1 
ATOM   3588 O  OG1 . THR B 1 147 ? 32.013  24.280  -25.401 1.00 28.77 ? 627  THR B OG1 1 
ATOM   3589 C  CG2 . THR B 1 147 ? 32.344  22.096  -26.351 1.00 28.59 ? 627  THR B CG2 1 
ATOM   3590 N  N   . ILE B 1 148 ? 34.838  23.294  -29.157 1.00 27.51 ? 628  ILE B N   1 
ATOM   3591 C  CA  . ILE B 1 148 ? 35.156  22.814  -30.509 1.00 27.02 ? 628  ILE B CA  1 
ATOM   3592 C  C   . ILE B 1 148 ? 34.948  21.305  -30.646 1.00 26.65 ? 628  ILE B C   1 
ATOM   3593 O  O   . ILE B 1 148 ? 34.901  20.583  -29.652 1.00 26.61 ? 628  ILE B O   1 
ATOM   3594 C  CB  . ILE B 1 148 ? 36.612  23.172  -30.937 1.00 26.94 ? 628  ILE B CB  1 
ATOM   3595 C  CG1 . ILE B 1 148 ? 37.648  22.321  -30.183 1.00 26.70 ? 628  ILE B CG1 1 
ATOM   3596 C  CG2 . ILE B 1 148 ? 36.876  24.668  -30.759 1.00 26.87 ? 628  ILE B CG2 1 
ATOM   3597 C  CD1 . ILE B 1 148 ? 38.055  21.054  -30.914 1.00 25.65 ? 628  ILE B CD1 1 
ATOM   3598 N  N   . TRP B 1 149 ? 34.835  20.834  -31.886 1.00 26.00 ? 629  TRP B N   1 
ATOM   3599 C  CA  . TRP B 1 149 ? 34.691  19.407  -32.145 1.00 25.44 ? 629  TRP B CA  1 
ATOM   3600 C  C   . TRP B 1 149 ? 35.606  18.951  -33.268 1.00 24.72 ? 629  TRP B C   1 
ATOM   3601 O  O   . TRP B 1 149 ? 35.402  19.306  -34.425 1.00 24.36 ? 629  TRP B O   1 
ATOM   3602 C  CB  . TRP B 1 149 ? 33.243  19.076  -32.495 1.00 25.53 ? 629  TRP B CB  1 
ATOM   3603 C  CG  . TRP B 1 149 ? 32.964  17.608  -32.566 1.00 25.95 ? 629  TRP B CG  1 
ATOM   3604 C  CD1 . TRP B 1 149 ? 32.678  16.881  -33.683 1.00 26.07 ? 629  TRP B CD1 1 
ATOM   3605 C  CD2 . TRP B 1 149 ? 32.937  16.689  -31.469 1.00 26.97 ? 629  TRP B CD2 1 
ATOM   3606 N  NE1 . TRP B 1 149 ? 32.468  15.564  -33.351 1.00 26.57 ? 629  TRP B NE1 1 
ATOM   3607 C  CE2 . TRP B 1 149 ? 32.625  15.418  -31.998 1.00 27.19 ? 629  TRP B CE2 1 
ATOM   3608 C  CE3 . TRP B 1 149 ? 33.145  16.816  -30.091 1.00 27.88 ? 629  TRP B CE3 1 
ATOM   3609 C  CZ2 . TRP B 1 149 ? 32.513  14.278  -31.196 1.00 27.66 ? 629  TRP B CZ2 1 
ATOM   3610 C  CZ3 . TRP B 1 149 ? 33.033  15.679  -29.290 1.00 28.65 ? 629  TRP B CZ3 1 
ATOM   3611 C  CH2 . TRP B 1 149 ? 32.720  14.427  -29.850 1.00 28.12 ? 629  TRP B CH2 1 
ATOM   3612 N  N   . ASN B 1 150 ? 36.612  18.159  -32.914 1.00 24.22 ? 630  ASN B N   1 
ATOM   3613 C  CA  . ASN B 1 150 ? 37.399  17.428  -33.902 1.00 23.82 ? 630  ASN B CA  1 
ATOM   3614 C  C   . ASN B 1 150 ? 36.630  16.169  -34.328 1.00 23.57 ? 630  ASN B C   1 
ATOM   3615 O  O   . ASN B 1 150 ? 36.339  15.308  -33.505 1.00 23.53 ? 630  ASN B O   1 
ATOM   3616 C  CB  . ASN B 1 150 ? 38.766  17.054  -33.327 1.00 23.51 ? 630  ASN B CB  1 
ATOM   3617 C  CG  . ASN B 1 150 ? 39.701  16.500  -34.375 1.00 22.82 ? 630  ASN B CG  1 
ATOM   3618 O  OD1 . ASN B 1 150 ? 39.510  15.380  -34.859 1.00 21.03 ? 630  ASN B OD1 1 
ATOM   3619 N  ND2 . ASN B 1 150 ? 40.719  17.281  -34.739 1.00 21.37 ? 630  ASN B ND2 1 
ATOM   3620 N  N   . GLU B 1 151 ? 36.303  16.067  -35.611 1.00 23.43 ? 631  GLU B N   1 
ATOM   3621 C  CA  . GLU B 1 151 ? 35.466  14.963  -36.108 1.00 23.40 ? 631  GLU B CA  1 
ATOM   3622 C  C   . GLU B 1 151 ? 36.151  13.585  -36.070 1.00 23.35 ? 631  GLU B C   1 
ATOM   3623 O  O   . GLU B 1 151 ? 35.485  12.563  -36.214 1.00 23.39 ? 631  GLU B O   1 
ATOM   3624 C  CB  . GLU B 1 151 ? 34.979  15.265  -37.529 1.00 23.21 ? 631  GLU B CB  1 
ATOM   3625 C  CG  . GLU B 1 151 ? 34.007  16.438  -37.605 1.00 23.24 ? 631  GLU B CG  1 
ATOM   3626 C  CD  . GLU B 1 151 ? 34.021  17.134  -38.958 1.00 23.18 ? 631  GLU B CD  1 
ATOM   3627 O  OE1 . GLU B 1 151 ? 35.052  17.744  -39.316 1.00 23.07 ? 631  GLU B OE1 1 
ATOM   3628 O  OE2 . GLU B 1 151 ? 32.995  17.087  -39.663 1.00 23.08 ? 631  GLU B OE2 1 
ATOM   3629 N  N   . LEU B 1 152 ? 37.470  13.563  -35.888 1.00 23.34 ? 632  LEU B N   1 
ATOM   3630 C  CA  . LEU B 1 152 ? 38.219  12.316  -35.756 1.00 23.24 ? 632  LEU B CA  1 
ATOM   3631 C  C   . LEU B 1 152 ? 38.598  11.988  -34.320 1.00 23.16 ? 632  LEU B C   1 
ATOM   3632 O  O   . LEU B 1 152 ? 38.625  10.819  -33.956 1.00 23.15 ? 632  LEU B O   1 
ATOM   3633 C  CB  . LEU B 1 152 ? 39.510  12.371  -36.581 1.00 23.27 ? 632  LEU B CB  1 
ATOM   3634 C  CG  . LEU B 1 152 ? 39.386  12.397  -38.102 1.00 23.50 ? 632  LEU B CG  1 
ATOM   3635 C  CD1 . LEU B 1 152 ? 40.767  12.326  -38.732 1.00 23.51 ? 632  LEU B CD1 1 
ATOM   3636 C  CD2 . LEU B 1 152 ? 38.503  11.254  -38.599 1.00 23.87 ? 632  LEU B CD2 1 
ATOM   3637 N  N   . HIS B 1 153 ? 38.903  13.008  -33.515 1.00 23.18 ? 633  HIS B N   1 
ATOM   3638 C  CA  . HIS B 1 153 ? 39.651  12.805  -32.265 1.00 23.04 ? 633  HIS B CA  1 
ATOM   3639 C  C   . HIS B 1 153 ? 38.945  13.226  -30.974 1.00 23.22 ? 633  HIS B C   1 
ATOM   3640 O  O   . HIS B 1 153 ? 39.361  12.804  -29.893 1.00 23.21 ? 633  HIS B O   1 
ATOM   3641 C  CB  . HIS B 1 153 ? 40.997  13.541  -32.336 1.00 22.96 ? 633  HIS B CB  1 
ATOM   3642 C  CG  . HIS B 1 153 ? 41.869  13.116  -33.477 1.00 22.85 ? 633  HIS B CG  1 
ATOM   3643 N  ND1 . HIS B 1 153 ? 42.208  11.799  -33.709 1.00 22.85 ? 633  HIS B ND1 1 
ATOM   3644 C  CD2 . HIS B 1 153 ? 42.495  13.839  -34.436 1.00 23.40 ? 633  HIS B CD2 1 
ATOM   3645 C  CE1 . HIS B 1 153 ? 42.994  11.729  -34.769 1.00 23.10 ? 633  HIS B CE1 1 
ATOM   3646 N  NE2 . HIS B 1 153 ? 43.185  12.953  -35.229 1.00 23.30 ? 633  HIS B NE2 1 
ATOM   3647 N  N   . SER B 1 154 ? 37.901  14.049  -31.062 1.00 23.12 ? 634  SER B N   1 
ATOM   3648 C  CA  . SER B 1 154 ? 37.304  14.621  -29.855 1.00 23.28 ? 634  SER B CA  1 
ATOM   3649 C  C   . SER B 1 154 ? 36.528  13.611  -29.008 1.00 23.33 ? 634  SER B C   1 
ATOM   3650 O  O   . SER B 1 154 ? 36.575  13.667  -27.772 1.00 23.43 ? 634  SER B O   1 
ATOM   3651 C  CB  . SER B 1 154 ? 36.409  15.820  -30.191 1.00 23.27 ? 634  SER B CB  1 
ATOM   3652 O  OG  . SER B 1 154 ? 37.189  16.958  -30.504 1.00 23.03 ? 634  SER B OG  1 
ATOM   3653 N  N   . SER B 1 155 ? 35.812  12.705  -29.668 1.00 23.24 ? 635  SER B N   1 
ATOM   3654 C  CA  . SER B 1 155 ? 35.025  11.694  -28.974 1.00 23.18 ? 635  SER B CA  1 
ATOM   3655 C  C   . SER B 1 155 ? 35.926  10.780  -28.157 1.00 23.22 ? 635  SER B C   1 
ATOM   3656 O  O   . SER B 1 155 ? 35.637  10.495  -26.993 1.00 23.46 ? 635  SER B O   1 
ATOM   3657 C  CB  . SER B 1 155 ? 34.206  10.866  -29.966 1.00 23.17 ? 635  SER B CB  1 
ATOM   3658 O  OG  . SER B 1 155 ? 33.377  9.944   -29.284 1.00 23.03 ? 635  SER B OG  1 
ATOM   3659 N  N   . ASN B 1 156 ? 37.017  10.328  -28.767 1.00 23.15 ? 636  ASN B N   1 
ATOM   3660 C  CA  . ASN B 1 156 ? 38.014  9.517   -28.064 1.00 23.24 ? 636  ASN B CA  1 
ATOM   3661 C  C   . ASN B 1 156 ? 38.589  10.247  -26.846 1.00 23.24 ? 636  ASN B C   1 
ATOM   3662 O  O   . ASN B 1 156 ? 38.653  9.681   -25.757 1.00 23.40 ? 636  ASN B O   1 
ATOM   3663 C  CB  . ASN B 1 156 ? 39.154  9.106   -29.007 1.00 22.99 ? 636  ASN B CB  1 
ATOM   3664 C  CG  . ASN B 1 156 ? 38.701  8.165   -30.110 1.00 23.31 ? 636  ASN B CG  1 
ATOM   3665 O  OD1 . ASN B 1 156 ? 39.343  8.071   -31.158 1.00 24.07 ? 636  ASN B OD1 1 
ATOM   3666 N  ND2 . ASN B 1 156 ? 37.593  7.467   -29.886 1.00 23.07 ? 636  ASN B ND2 1 
ATOM   3667 N  N   . ALA B 1 157 ? 38.983  11.505  -27.035 1.00 23.21 ? 637  ALA B N   1 
ATOM   3668 C  CA  . ALA B 1 157 ? 39.640  12.288  -25.989 1.00 23.16 ? 637  ALA B CA  1 
ATOM   3669 C  C   . ALA B 1 157 ? 38.716  12.525  -24.798 1.00 23.39 ? 637  ALA B C   1 
ATOM   3670 O  O   . ALA B 1 157 ? 39.112  12.349  -23.645 1.00 23.31 ? 637  ALA B O   1 
ATOM   3671 C  CB  . ALA B 1 157 ? 40.123  13.610  -26.552 1.00 23.11 ? 637  ALA B CB  1 
ATOM   3672 N  N   . ALA B 1 158 ? 37.481  12.920  -25.086 1.00 23.65 ? 638  ALA B N   1 
ATOM   3673 C  CA  . ALA B 1 158 ? 36.491  13.162  -24.043 1.00 23.87 ? 638  ALA B CA  1 
ATOM   3674 C  C   . ALA B 1 158 ? 36.161  11.871  -23.275 1.00 24.04 ? 638  ALA B C   1 
ATOM   3675 O  O   . ALA B 1 158 ? 36.102  11.877  -22.047 1.00 24.13 ? 638  ALA B O   1 
ATOM   3676 C  CB  . ALA B 1 158 ? 35.227  13.791  -24.640 1.00 23.53 ? 638  ALA B CB  1 
ATOM   3677 N  N   . ARG B 1 159 ? 35.963  10.769  -23.996 1.00 24.21 ? 639  ARG B N   1 
ATOM   3678 C  CA  . ARG B 1 159 ? 35.735  9.472   -23.357 1.00 24.55 ? 639  ARG B CA  1 
ATOM   3679 C  C   . ARG B 1 159 ? 36.949  9.034   -22.542 1.00 24.74 ? 639  ARG B C   1 
ATOM   3680 O  O   . ARG B 1 159 ? 36.807  8.408   -21.495 1.00 24.75 ? 639  ARG B O   1 
ATOM   3681 C  CB  . ARG B 1 159 ? 35.392  8.396   -24.394 1.00 24.68 ? 639  ARG B CB  1 
ATOM   3682 C  CG  . ARG B 1 159 ? 33.977  8.491   -24.930 1.00 24.83 ? 639  ARG B CG  1 
ATOM   3683 C  CD  . ARG B 1 159 ? 33.706  7.408   -25.946 1.00 25.26 ? 639  ARG B CD  1 
ATOM   3684 N  NE  . ARG B 1 159 ? 33.620  6.080   -25.339 1.00 26.24 ? 639  ARG B NE  1 
ATOM   3685 C  CZ  . ARG B 1 159 ? 33.627  4.931   -26.017 1.00 26.26 ? 639  ARG B CZ  1 
ATOM   3686 N  NH1 . ARG B 1 159 ? 33.723  4.925   -27.340 1.00 25.67 ? 639  ARG B NH1 1 
ATOM   3687 N  NH2 . ARG B 1 159 ? 33.543  3.776   -25.363 1.00 26.33 ? 639  ARG B NH2 1 
ATOM   3688 N  N   . TRP B 1 160 ? 38.142  9.371   -23.025 1.00 25.07 ? 640  TRP B N   1 
ATOM   3689 C  CA  . TRP B 1 160 ? 39.369  9.004   -22.332 1.00 25.29 ? 640  TRP B CA  1 
ATOM   3690 C  C   . TRP B 1 160 ? 39.520  9.734   -21.000 1.00 25.51 ? 640  TRP B C   1 
ATOM   3691 O  O   . TRP B 1 160 ? 39.983  9.147   -20.018 1.00 25.57 ? 640  TRP B O   1 
ATOM   3692 C  CB  . TRP B 1 160 ? 40.596  9.265   -23.205 1.00 25.26 ? 640  TRP B CB  1 
ATOM   3693 C  CG  . TRP B 1 160 ? 41.765  8.464   -22.765 1.00 25.29 ? 640  TRP B CG  1 
ATOM   3694 C  CD1 . TRP B 1 160 ? 42.653  8.780   -21.777 1.00 24.95 ? 640  TRP B CD1 1 
ATOM   3695 C  CD2 . TRP B 1 160 ? 42.169  7.194   -23.282 1.00 24.94 ? 640  TRP B CD2 1 
ATOM   3696 N  NE1 . TRP B 1 160 ? 43.588  7.782   -21.650 1.00 25.24 ? 640  TRP B NE1 1 
ATOM   3697 C  CE2 . TRP B 1 160 ? 43.317  6.798   -22.565 1.00 25.06 ? 640  TRP B CE2 1 
ATOM   3698 C  CE3 . TRP B 1 160 ? 41.675  6.353   -24.284 1.00 25.13 ? 640  TRP B CE3 1 
ATOM   3699 C  CZ2 . TRP B 1 160 ? 43.981  5.596   -22.821 1.00 25.17 ? 640  TRP B CZ2 1 
ATOM   3700 C  CZ3 . TRP B 1 160 ? 42.338  5.153   -24.538 1.00 24.84 ? 640  TRP B CZ3 1 
ATOM   3701 C  CH2 . TRP B 1 160 ? 43.478  4.790   -23.809 1.00 24.73 ? 640  TRP B CH2 1 
ATOM   3702 N  N   . ALA B 1 161 ? 39.144  11.011  -20.975 1.00 25.66 ? 641  ALA B N   1 
ATOM   3703 C  CA  . ALA B 1 161 ? 39.165  11.803  -19.744 1.00 25.83 ? 641  ALA B CA  1 
ATOM   3704 C  C   . ALA B 1 161 ? 38.240  11.195  -18.694 1.00 25.93 ? 641  ALA B C   1 
ATOM   3705 O  O   . ALA B 1 161 ? 38.649  10.975  -17.554 1.00 26.07 ? 641  ALA B O   1 
ATOM   3706 C  CB  . ALA B 1 161 ? 38.763  13.252  -20.028 1.00 25.79 ? 641  ALA B CB  1 
ATOM   3707 N  N   . ALA B 1 162 ? 36.994  10.931  -19.084 1.00 25.97 ? 642  ALA B N   1 
ATOM   3708 C  CA  . ALA B 1 162 ? 36.010  10.329  -18.179 1.00 26.01 ? 642  ALA B CA  1 
ATOM   3709 C  C   . ALA B 1 162 ? 36.481  8.966   -17.646 1.00 25.99 ? 642  ALA B C   1 
ATOM   3710 O  O   . ALA B 1 162 ? 36.454  8.718   -16.445 1.00 25.76 ? 642  ALA B O   1 
ATOM   3711 C  CB  . ALA B 1 162 ? 34.658  10.191  -18.882 1.00 25.87 ? 642  ALA B CB  1 
ATOM   3712 N  N   . GLY B 1 163 ? 36.914  8.093   -18.547 1.00 26.15 ? 643  GLY B N   1 
ATOM   3713 C  CA  . GLY B 1 163 ? 37.396  6.770   -18.156 1.00 26.57 ? 643  GLY B CA  1 
ATOM   3714 C  C   . GLY B 1 163 ? 38.629  6.810   -17.266 1.00 26.63 ? 643  GLY B C   1 
ATOM   3715 O  O   . GLY B 1 163 ? 38.758  6.006   -16.343 1.00 26.81 ? 643  GLY B O   1 
ATOM   3716 N  N   . SER B 1 164 ? 39.526  7.752   -17.542 1.00 26.67 ? 644  SER B N   1 
ATOM   3717 C  CA  . SER B 1 164 ? 40.767  7.899   -16.786 1.00 26.78 ? 644  SER B CA  1 
ATOM   3718 C  C   . SER B 1 164 ? 40.550  8.330   -15.332 1.00 26.89 ? 644  SER B C   1 
ATOM   3719 O  O   . SER B 1 164 ? 41.116  7.727   -14.408 1.00 26.85 ? 644  SER B O   1 
ATOM   3720 C  CB  . SER B 1 164 ? 41.698  8.889   -17.486 1.00 26.80 ? 644  SER B CB  1 
ATOM   3721 O  OG  . SER B 1 164 ? 42.190  8.341   -18.698 1.00 26.82 ? 644  SER B OG  1 
ATOM   3722 N  N   . VAL B 1 165 ? 39.747  9.374   -15.135 1.00 26.95 ? 645  VAL B N   1 
ATOM   3723 C  CA  . VAL B 1 165 ? 39.396  9.828   -13.790 1.00 26.94 ? 645  VAL B CA  1 
ATOM   3724 C  C   . VAL B 1 165 ? 38.695  8.696   -13.046 1.00 26.89 ? 645  VAL B C   1 
ATOM   3725 O  O   . VAL B 1 165 ? 39.007  8.431   -11.884 1.00 27.04 ? 645  VAL B O   1 
ATOM   3726 C  CB  . VAL B 1 165 ? 38.491  11.101  -13.809 1.00 27.04 ? 645  VAL B CB  1 
ATOM   3727 C  CG1 . VAL B 1 165 ? 38.085  11.501  -12.399 1.00 26.37 ? 645  VAL B CG1 1 
ATOM   3728 C  CG2 . VAL B 1 165 ? 39.214  12.256  -14.476 1.00 27.24 ? 645  VAL B CG2 1 
ATOM   3729 N  N   . THR B 1 166 ? 37.766  8.025   -13.727 1.00 26.91 ? 646  THR B N   1 
ATOM   3730 C  CA  . THR B 1 166 ? 37.068  6.869   -13.168 1.00 26.77 ? 646  THR B CA  1 
ATOM   3731 C  C   . THR B 1 166 ? 38.055  5.802   -12.721 1.00 27.15 ? 646  THR B C   1 
ATOM   3732 O  O   . THR B 1 166 ? 37.990  5.350   -11.586 1.00 27.24 ? 646  THR B O   1 
ATOM   3733 C  CB  . THR B 1 166 ? 36.074  6.251   -14.172 1.00 26.61 ? 646  THR B CB  1 
ATOM   3734 O  OG1 . THR B 1 166 ? 34.985  7.152   -14.389 1.00 26.20 ? 646  THR B OG1 1 
ATOM   3735 C  CG2 . THR B 1 166 ? 35.521  4.940   -13.647 1.00 26.50 ? 646  THR B CG2 1 
ATOM   3736 N  N   . ASP B 1 167 ? 38.970  5.409   -13.606 1.00 27.54 ? 647  ASP B N   1 
ATOM   3737 C  CA  . ASP B 1 167 ? 39.959  4.379   -13.274 1.00 27.83 ? 647  ASP B CA  1 
ATOM   3738 C  C   . ASP B 1 167 ? 40.841  4.770   -12.094 1.00 27.79 ? 647  ASP B C   1 
ATOM   3739 O  O   . ASP B 1 167 ? 41.127  3.935   -11.235 1.00 27.61 ? 647  ASP B O   1 
ATOM   3740 C  CB  . ASP B 1 167 ? 40.841  4.024   -14.480 1.00 27.99 ? 647  ASP B CB  1 
ATOM   3741 C  CG  . ASP B 1 167 ? 40.477  2.686   -15.098 1.00 29.16 ? 647  ASP B CG  1 
ATOM   3742 O  OD1 . ASP B 1 167 ? 39.298  2.273   -15.005 1.00 30.55 ? 647  ASP B OD1 1 
ATOM   3743 O  OD2 . ASP B 1 167 ? 41.375  2.036   -15.678 1.00 31.29 ? 647  ASP B OD2 1 
ATOM   3744 N  N   . LEU B 1 168 ? 41.270  6.030   -12.054 1.00 27.87 ? 648  LEU B N   1 
ATOM   3745 C  CA  . LEU B 1 168 ? 42.097  6.515   -10.949 1.00 28.01 ? 648  LEU B CA  1 
ATOM   3746 C  C   . LEU B 1 168 ? 41.333  6.424   -9.630  1.00 28.20 ? 648  LEU B C   1 
ATOM   3747 O  O   . LEU B 1 168 ? 41.887  5.999   -8.615  1.00 28.17 ? 648  LEU B O   1 
ATOM   3748 C  CB  . LEU B 1 168 ? 42.564  7.950   -11.206 1.00 27.89 ? 648  LEU B CB  1 
ATOM   3749 C  CG  . LEU B 1 168 ? 43.461  8.591   -10.143 1.00 28.02 ? 648  LEU B CG  1 
ATOM   3750 C  CD1 . LEU B 1 168 ? 44.700  7.734   -9.835  1.00 27.61 ? 648  LEU B CD1 1 
ATOM   3751 C  CD2 . LEU B 1 168 ? 43.864  9.989   -10.592 1.00 27.93 ? 648  LEU B CD2 1 
ATOM   3752 N  N   . ALA B 1 169 ? 40.055  6.799   -9.667  1.00 28.45 ? 649  ALA B N   1 
ATOM   3753 C  CA  . ALA B 1 169 ? 39.190  6.756   -8.490  1.00 28.74 ? 649  ALA B CA  1 
ATOM   3754 C  C   . ALA B 1 169 ? 38.968  5.341   -7.950  1.00 29.02 ? 649  ALA B C   1 
ATOM   3755 O  O   . ALA B 1 169 ? 38.957  5.146   -6.737  1.00 29.12 ? 649  ALA B O   1 
ATOM   3756 C  CB  . ALA B 1 169 ? 37.847  7.420   -8.798  1.00 28.72 ? 649  ALA B CB  1 
ATOM   3757 N  N   . PHE B 1 170 ? 38.784  4.366   -8.839  1.00 29.38 ? 650  PHE B N   1 
ATOM   3758 C  CA  . PHE B 1 170 ? 38.595  2.968   -8.425  1.00 30.00 ? 650  PHE B CA  1 
ATOM   3759 C  C   . PHE B 1 170 ? 39.814  2.416   -7.688  1.00 30.06 ? 650  PHE B C   1 
ATOM   3760 O  O   . PHE B 1 170 ? 39.675  1.770   -6.647  1.00 29.93 ? 650  PHE B O   1 
ATOM   3761 C  CB  . PHE B 1 170 ? 38.290  2.068   -9.626  1.00 30.20 ? 650  PHE B CB  1 
ATOM   3762 C  CG  . PHE B 1 170 ? 36.832  2.006   -9.990  1.00 31.64 ? 650  PHE B CG  1 
ATOM   3763 C  CD1 . PHE B 1 170 ? 36.169  3.124   -10.461 1.00 33.49 ? 650  PHE B CD1 1 
ATOM   3764 C  CD2 . PHE B 1 170 ? 36.127  0.822   -9.881  1.00 33.65 ? 650  PHE B CD2 1 
ATOM   3765 C  CE1 . PHE B 1 170 ? 34.824  3.065   -10.807 1.00 34.33 ? 650  PHE B CE1 1 
ATOM   3766 C  CE2 . PHE B 1 170 ? 34.782  0.759   -10.229 1.00 34.12 ? 650  PHE B CE2 1 
ATOM   3767 C  CZ  . PHE B 1 170 ? 34.133  1.875   -10.692 1.00 33.70 ? 650  PHE B CZ  1 
ATOM   3768 N  N   . LYS B 1 171 ? 41.000  2.671   -8.234  1.00 30.32 ? 651  LYS B N   1 
ATOM   3769 C  CA  . LYS B 1 171 ? 42.248  2.216   -7.620  1.00 30.73 ? 651  LYS B CA  1 
ATOM   3770 C  C   . LYS B 1 171 ? 42.464  2.838   -6.240  1.00 30.95 ? 651  LYS B C   1 
ATOM   3771 O  O   . LYS B 1 171 ? 42.974  2.181   -5.333  1.00 30.89 ? 651  LYS B O   1 
ATOM   3772 C  CB  . LYS B 1 171 ? 43.439  2.518   -8.533  1.00 30.79 ? 651  LYS B CB  1 
ATOM   3773 C  CG  . LYS B 1 171 ? 43.420  1.722   -9.827  1.00 31.17 ? 651  LYS B CG  1 
ATOM   3774 C  CD  . LYS B 1 171 ? 44.606  2.047   -10.711 1.00 31.60 ? 651  LYS B CD  1 
ATOM   3775 C  CE  . LYS B 1 171 ? 44.406  1.510   -12.126 1.00 31.92 ? 651  LYS B CE  1 
ATOM   3776 N  NZ  . LYS B 1 171 ? 44.176  0.037   -12.163 1.00 31.97 ? 651  LYS B NZ  1 
ATOM   3777 N  N   . VAL B 1 172 ? 42.067  4.101   -6.090  1.00 31.28 ? 652  VAL B N   1 
ATOM   3778 C  CA  . VAL B 1 172 ? 42.099  4.783   -4.798  1.00 31.54 ? 652  VAL B CA  1 
ATOM   3779 C  C   . VAL B 1 172 ? 40.996  4.246   -3.879  1.00 31.80 ? 652  VAL B C   1 
ATOM   3780 O  O   . VAL B 1 172 ? 41.228  4.015   -2.693  1.00 31.79 ? 652  VAL B O   1 
ATOM   3781 C  CB  . VAL B 1 172 ? 41.945  6.310   -4.973  1.00 31.62 ? 652  VAL B CB  1 
ATOM   3782 C  CG1 . VAL B 1 172 ? 41.810  7.002   -3.626  1.00 31.70 ? 652  VAL B CG1 1 
ATOM   3783 C  CG2 . VAL B 1 172 ? 43.126  6.873   -5.753  1.00 31.57 ? 652  VAL B CG2 1 
ATOM   3784 N  N   . ALA B 1 173 ? 39.804  4.034   -4.435  1.00 32.13 ? 653  ALA B N   1 
ATOM   3785 C  CA  . ALA B 1 173 ? 38.674  3.487   -3.670  1.00 32.30 ? 653  ALA B CA  1 
ATOM   3786 C  C   . ALA B 1 173 ? 38.905  2.050   -3.186  1.00 32.44 ? 653  ALA B C   1 
ATOM   3787 O  O   . ALA B 1 173 ? 38.324  1.638   -2.180  1.00 32.60 ? 653  ALA B O   1 
ATOM   3788 C  CB  . ALA B 1 173 ? 37.393  3.563   -4.484  1.00 32.23 ? 653  ALA B CB  1 
ATOM   3789 N  N   . SER B 1 174 ? 39.738  1.292   -3.898  1.00 32.56 ? 654  SER B N   1 
ATOM   3790 C  CA  . SER B 1 174 ? 40.091  -0.070  -3.486  1.00 32.63 ? 654  SER B CA  1 
ATOM   3791 C  C   . SER B 1 174 ? 41.377  -0.101  -2.646  1.00 32.55 ? 654  SER B C   1 
ATOM   3792 O  O   . SER B 1 174 ? 41.946  -1.172  -2.414  1.00 32.56 ? 654  SER B O   1 
ATOM   3793 C  CB  . SER B 1 174 ? 40.240  -0.976  -4.713  1.00 32.78 ? 654  SER B CB  1 
ATOM   3794 O  OG  . SER B 1 174 ? 41.333  -0.578  -5.525  1.00 33.44 ? 654  SER B OG  1 
ATOM   3795 N  N   . ARG B 1 175 ? 41.827  1.077   -2.205  1.00 32.41 ? 655  ARG B N   1 
ATOM   3796 C  CA  . ARG B 1 175 ? 43.015  1.225   -1.355  1.00 32.25 ? 655  ARG B CA  1 
ATOM   3797 C  C   . ARG B 1 175 ? 44.308  0.689   -1.992  1.00 32.12 ? 655  ARG B C   1 
ATOM   3798 O  O   . ARG B 1 175 ? 45.266  0.374   -1.283  1.00 32.07 ? 655  ARG B O   1 
ATOM   3799 C  CB  . ARG B 1 175 ? 42.780  0.567   0.008   1.00 32.22 ? 655  ARG B CB  1 
ATOM   3800 N  N   . GLU B 1 176 ? 44.330  0.605   -3.323  1.00 31.76 ? 656  GLU B N   1 
ATOM   3801 C  CA  . GLU B 1 176 ? 45.521  0.194   -4.064  1.00 31.49 ? 656  GLU B CA  1 
ATOM   3802 C  C   . GLU B 1 176 ? 46.396  1.401   -4.379  1.00 31.04 ? 656  GLU B C   1 
ATOM   3803 O  O   . GLU B 1 176 ? 47.601  1.266   -4.569  1.00 31.14 ? 656  GLU B O   1 
ATOM   3804 C  CB  . GLU B 1 176 ? 45.131  -0.536  -5.349  1.00 31.59 ? 656  GLU B CB  1 
ATOM   3805 C  CG  . GLU B 1 176 ? 44.460  -1.873  -5.088  1.00 32.10 ? 656  GLU B CG  1 
ATOM   3806 C  CD  . GLU B 1 176 ? 44.185  -2.661  -6.353  1.00 32.73 ? 656  GLU B CD  1 
ATOM   3807 O  OE1 . GLU B 1 176 ? 43.731  -2.055  -7.353  1.00 32.65 ? 656  GLU B OE1 1 
ATOM   3808 O  OE2 . GLU B 1 176 ? 44.414  -3.892  -6.333  1.00 32.14 ? 656  GLU B OE2 1 
ATOM   3809 N  N   . LEU B 1 177 ? 45.782  2.576   -4.456  1.00 30.56 ? 657  LEU B N   1 
ATOM   3810 C  CA  . LEU B 1 177 ? 46.521  3.829   -4.446  1.00 30.11 ? 657  LEU B CA  1 
ATOM   3811 C  C   . LEU B 1 177 ? 46.104  4.630   -3.222  1.00 29.78 ? 657  LEU B C   1 
ATOM   3812 O  O   . LEU B 1 177 ? 45.029  4.413   -2.662  1.00 29.56 ? 657  LEU B O   1 
ATOM   3813 C  CB  . LEU B 1 177 ? 46.273  4.618   -5.727  1.00 30.05 ? 657  LEU B CB  1 
ATOM   3814 C  CG  . LEU B 1 177 ? 46.848  3.980   -6.991  1.00 29.84 ? 657  LEU B CG  1 
ATOM   3815 C  CD1 . LEU B 1 177 ? 46.314  4.679   -8.236  1.00 29.44 ? 657  LEU B CD1 1 
ATOM   3816 C  CD2 . LEU B 1 177 ? 48.372  3.999   -6.963  1.00 29.22 ? 657  LEU B CD2 1 
ATOM   3817 N  N   . LYS B 1 178 ? 46.982  5.532   -2.796  1.00 29.63 ? 658  LYS B N   1 
ATOM   3818 C  CA  . LYS B 1 178 ? 46.729  6.403   -1.648  1.00 29.61 ? 658  LYS B CA  1 
ATOM   3819 C  C   . LYS B 1 178 ? 45.798  7.525   -2.096  1.00 29.51 ? 658  LYS B C   1 
ATOM   3820 O  O   . LYS B 1 178 ? 44.711  7.731   -1.545  1.00 29.13 ? 658  LYS B O   1 
ATOM   3821 C  CB  . LYS B 1 178 ? 48.062  6.974   -1.149  1.00 29.66 ? 658  LYS B CB  1 
ATOM   3822 C  CG  . LYS B 1 178 ? 48.000  7.915   0.049   1.00 29.73 ? 658  LYS B CG  1 
ATOM   3823 C  CD  . LYS B 1 178 ? 49.366  8.566   0.262   1.00 29.86 ? 658  LYS B CD  1 
ATOM   3824 C  CE  . LYS B 1 178 ? 49.373  9.525   1.435   1.00 29.92 ? 658  LYS B CE  1 
ATOM   3825 N  NZ  . LYS B 1 178 ? 49.510  8.813   2.732   1.00 30.60 ? 658  LYS B NZ  1 
ATOM   3826 N  N   . ASN B 1 179 ? 46.245  8.219   -3.134  1.00 29.42 ? 659  ASN B N   1 
ATOM   3827 C  CA  . ASN B 1 179 ? 45.547  9.357   -3.689  1.00 29.43 ? 659  ASN B CA  1 
ATOM   3828 C  C   . ASN B 1 179 ? 46.011  9.509   -5.132  1.00 29.29 ? 659  ASN B C   1 
ATOM   3829 O  O   . ASN B 1 179 ? 46.888  8.766   -5.573  1.00 28.97 ? 659  ASN B O   1 
ATOM   3830 C  CB  . ASN B 1 179 ? 45.864  10.603  -2.862  1.00 29.42 ? 659  ASN B CB  1 
ATOM   3831 C  CG  . ASN B 1 179 ? 47.343  10.767  -2.612  1.00 29.56 ? 659  ASN B CG  1 
ATOM   3832 O  OD1 . ASN B 1 179 ? 48.145  10.649  -3.529  1.00 30.22 ? 659  ASN B OD1 1 
ATOM   3833 N  ND2 . ASN B 1 179 ? 47.715  11.041  -1.366  1.00 30.51 ? 659  ASN B ND2 1 
ATOM   3834 N  N   . GLY B 1 180 ? 45.437  10.454  -5.870  1.00 29.18 ? 660  GLY B N   1 
ATOM   3835 C  CA  . GLY B 1 180 ? 45.787  10.596  -7.279  1.00 29.15 ? 660  GLY B CA  1 
ATOM   3836 C  C   . GLY B 1 180 ? 45.504  11.946  -7.897  1.00 29.03 ? 660  GLY B C   1 
ATOM   3837 O  O   . GLY B 1 180 ? 44.713  12.731  -7.377  1.00 29.07 ? 660  GLY B O   1 
ATOM   3838 N  N   . PHE B 1 181 ? 46.176  12.210  -9.013  1.00 29.06 ? 661  PHE B N   1 
ATOM   3839 C  CA  . PHE B 1 181 ? 45.943  13.406  -9.803  1.00 29.23 ? 661  PHE B CA  1 
ATOM   3840 C  C   . PHE B 1 181 ? 45.774  13.019  -11.268 1.00 28.85 ? 661  PHE B C   1 
ATOM   3841 O  O   . PHE B 1 181 ? 46.642  12.355  -11.843 1.00 28.82 ? 661  PHE B O   1 
ATOM   3842 C  CB  . PHE B 1 181 ? 47.101  14.393  -9.642  1.00 29.42 ? 661  PHE B CB  1 
ATOM   3843 C  CG  . PHE B 1 181 ? 46.973  15.624  -10.503 1.00 31.21 ? 661  PHE B CG  1 
ATOM   3844 C  CD1 . PHE B 1 181 ? 45.781  16.341  -10.551 1.00 33.23 ? 661  PHE B CD1 1 
ATOM   3845 C  CD2 . PHE B 1 181 ? 48.035  16.058  -11.279 1.00 32.70 ? 661  PHE B CD2 1 
ATOM   3846 C  CE1 . PHE B 1 181 ? 45.656  17.468  -11.350 1.00 33.66 ? 661  PHE B CE1 1 
ATOM   3847 C  CE2 . PHE B 1 181 ? 47.916  17.190  -12.075 1.00 33.32 ? 661  PHE B CE2 1 
ATOM   3848 C  CZ  . PHE B 1 181 ? 46.729  17.894  -12.109 1.00 33.46 ? 661  PHE B CZ  1 
ATOM   3849 N  N   . ALA B 1 182 ? 44.653  13.426  -11.861 1.00 28.23 ? 662  ALA B N   1 
ATOM   3850 C  CA  . ALA B 1 182 ? 44.355  13.115  -13.256 1.00 27.86 ? 662  ALA B CA  1 
ATOM   3851 C  C   . ALA B 1 182 ? 44.640  14.318  -14.150 1.00 27.50 ? 662  ALA B C   1 
ATOM   3852 O  O   . ALA B 1 182 ? 43.894  15.294  -14.137 1.00 27.43 ? 662  ALA B O   1 
ATOM   3853 C  CB  . ALA B 1 182 ? 42.905  12.681  -13.401 1.00 27.68 ? 662  ALA B CB  1 
ATOM   3854 N  N   . VAL B 1 183 ? 45.718  14.235  -14.927 1.00 27.16 ? 663  VAL B N   1 
ATOM   3855 C  CA  . VAL B 1 183 ? 46.087  15.296  -15.860 1.00 26.84 ? 663  VAL B CA  1 
ATOM   3856 C  C   . VAL B 1 183 ? 45.318  15.093  -17.169 1.00 26.84 ? 663  VAL B C   1 
ATOM   3857 O  O   . VAL B 1 183 ? 45.859  14.602  -18.159 1.00 26.72 ? 663  VAL B O   1 
ATOM   3858 C  CB  . VAL B 1 183 ? 47.614  15.329  -16.108 1.00 26.79 ? 663  VAL B CB  1 
ATOM   3859 C  CG1 . VAL B 1 183 ? 47.993  16.556  -16.926 1.00 26.53 ? 663  VAL B CG1 1 
ATOM   3860 C  CG2 . VAL B 1 183 ? 48.364  15.318  -14.788 1.00 26.22 ? 663  VAL B CG2 1 
ATOM   3861 N  N   . VAL B 1 184 ? 44.052  15.504  -17.158 1.00 26.76 ? 664  VAL B N   1 
ATOM   3862 C  CA  . VAL B 1 184 ? 43.113  15.176  -18.220 1.00 26.77 ? 664  VAL B CA  1 
ATOM   3863 C  C   . VAL B 1 184 ? 42.509  16.394  -18.929 1.00 26.85 ? 664  VAL B C   1 
ATOM   3864 O  O   . VAL B 1 184 ? 42.350  17.467  -18.343 1.00 26.67 ? 664  VAL B O   1 
ATOM   3865 C  CB  . VAL B 1 184 ? 41.946  14.338  -17.662 1.00 26.96 ? 664  VAL B CB  1 
ATOM   3866 C  CG1 . VAL B 1 184 ? 42.438  12.959  -17.226 1.00 27.10 ? 664  VAL B CG1 1 
ATOM   3867 C  CG2 . VAL B 1 184 ? 41.261  15.072  -16.511 1.00 26.00 ? 664  VAL B CG2 1 
ATOM   3868 N  N   . ARG B 1 185 ? 42.166  16.193  -20.198 1.00 26.82 ? 665  ARG B N   1 
ATOM   3869 C  CA  . ARG B 1 185 ? 41.402  17.159  -20.981 1.00 26.76 ? 665  ARG B CA  1 
ATOM   3870 C  C   . ARG B 1 185 ? 40.650  16.394  -22.072 1.00 26.60 ? 665  ARG B C   1 
ATOM   3871 O  O   . ARG B 1 185 ? 41.083  15.317  -22.469 1.00 26.16 ? 665  ARG B O   1 
ATOM   3872 C  CB  . ARG B 1 185 ? 42.326  18.216  -21.602 1.00 26.74 ? 665  ARG B CB  1 
ATOM   3873 C  CG  . ARG B 1 185 ? 43.277  17.677  -22.661 1.00 27.19 ? 665  ARG B CG  1 
ATOM   3874 C  CD  . ARG B 1 185 ? 44.178  18.768  -23.214 1.00 27.81 ? 665  ARG B CD  1 
ATOM   3875 N  NE  . ARG B 1 185 ? 43.441  19.705  -24.062 1.00 28.04 ? 665  ARG B NE  1 
ATOM   3876 C  CZ  . ARG B 1 185 ? 43.232  19.557  -25.370 1.00 28.63 ? 665  ARG B CZ  1 
ATOM   3877 N  NH1 . ARG B 1 185 ? 43.699  18.500  -26.027 1.00 29.45 ? 665  ARG B NH1 1 
ATOM   3878 N  NH2 . ARG B 1 185 ? 42.545  20.480  -26.032 1.00 28.85 ? 665  ARG B NH2 1 
ATOM   3879 N  N   . PRO B 1 186 ? 39.516  16.933  -22.552 1.00 26.62 ? 666  PRO B N   1 
ATOM   3880 C  CA  . PRO B 1 186 ? 38.882  18.186  -22.150 1.00 26.69 ? 666  PRO B CA  1 
ATOM   3881 C  C   . PRO B 1 186 ? 38.276  18.124  -20.741 1.00 26.64 ? 666  PRO B C   1 
ATOM   3882 O  O   . PRO B 1 186 ? 38.066  17.029  -20.204 1.00 26.50 ? 666  PRO B O   1 
ATOM   3883 C  CB  . PRO B 1 186 ? 37.775  18.364  -23.194 1.00 26.67 ? 666  PRO B CB  1 
ATOM   3884 C  CG  . PRO B 1 186 ? 37.434  16.981  -23.605 1.00 26.85 ? 666  PRO B CG  1 
ATOM   3885 C  CD  . PRO B 1 186 ? 38.723  16.224  -23.574 1.00 26.69 ? 666  PRO B CD  1 
ATOM   3886 N  N   . PRO B 1 187 ? 37.990  19.295  -20.148 1.00 26.39 ? 667  PRO B N   1 
ATOM   3887 C  CA  . PRO B 1 187 ? 37.359  19.370  -18.824 1.00 26.44 ? 667  PRO B CA  1 
ATOM   3888 C  C   . PRO B 1 187 ? 35.928  18.838  -18.817 1.00 26.32 ? 667  PRO B C   1 
ATOM   3889 O  O   . PRO B 1 187 ? 35.374  18.528  -19.880 1.00 26.27 ? 667  PRO B O   1 
ATOM   3890 C  CB  . PRO B 1 187 ? 37.374  20.871  -18.513 1.00 26.14 ? 667  PRO B CB  1 
ATOM   3891 C  CG  . PRO B 1 187 ? 37.413  21.528  -19.824 1.00 26.06 ? 667  PRO B CG  1 
ATOM   3892 C  CD  . PRO B 1 187 ? 38.207  20.632  -20.723 1.00 26.46 ? 667  PRO B CD  1 
ATOM   3893 N  N   . GLY B 1 188 ? 35.334  18.757  -17.630 1.00 26.34 ? 668  GLY B N   1 
ATOM   3894 C  CA  . GLY B 1 188 ? 34.030  18.111  -17.469 1.00 26.39 ? 668  GLY B CA  1 
ATOM   3895 C  C   . GLY B 1 188 ? 32.938  18.822  -16.692 1.00 26.33 ? 668  GLY B C   1 
ATOM   3896 O  O   . GLY B 1 188 ? 31.769  18.581  -16.952 1.00 26.33 ? 668  GLY B O   1 
ATOM   3897 N  N   . HIS B 1 189 ? 33.287  19.695  -15.750 1.00 26.73 ? 669  HIS B N   1 
ATOM   3898 C  CA  . HIS B 1 189 ? 32.303  20.132  -14.744 1.00 27.32 ? 669  HIS B CA  1 
ATOM   3899 C  C   . HIS B 1 189 ? 31.155  21.026  -15.262 1.00 27.37 ? 669  HIS B C   1 
ATOM   3900 O  O   . HIS B 1 189 ? 30.186  21.240  -14.543 1.00 27.78 ? 669  HIS B O   1 
ATOM   3901 C  CB  . HIS B 1 189 ? 32.997  20.742  -13.508 1.00 27.54 ? 669  HIS B CB  1 
ATOM   3902 C  CG  . HIS B 1 189 ? 33.538  22.126  -13.711 1.00 28.50 ? 669  HIS B CG  1 
ATOM   3903 N  ND1 . HIS B 1 189 ? 33.663  23.029  -12.676 1.00 29.67 ? 669  HIS B ND1 1 
ATOM   3904 C  CD2 . HIS B 1 189 ? 33.974  22.766  -14.823 1.00 29.63 ? 669  HIS B CD2 1 
ATOM   3905 C  CE1 . HIS B 1 189 ? 34.158  24.162  -13.141 1.00 29.93 ? 669  HIS B CE1 1 
ATOM   3906 N  NE2 . HIS B 1 189 ? 34.350  24.032  -14.442 1.00 30.07 ? 669  HIS B NE2 1 
ATOM   3907 N  N   . HIS B 1 190 ? 31.243  21.511  -16.498 1.00 27.45 ? 670  HIS B N   1 
ATOM   3908 C  CA  . HIS B 1 190 ? 30.140  22.263  -17.115 1.00 27.68 ? 670  HIS B CA  1 
ATOM   3909 C  C   . HIS B 1 190 ? 29.156  21.405  -17.911 1.00 27.64 ? 670  HIS B C   1 
ATOM   3910 O  O   . HIS B 1 190 ? 28.039  21.850  -18.181 1.00 27.56 ? 670  HIS B O   1 
ATOM   3911 C  CB  . HIS B 1 190 ? 30.670  23.358  -18.042 1.00 27.45 ? 670  HIS B CB  1 
ATOM   3912 C  CG  . HIS B 1 190 ? 31.413  24.446  -17.337 1.00 27.93 ? 670  HIS B CG  1 
ATOM   3913 N  ND1 . HIS B 1 190 ? 30.973  25.007  -16.159 1.00 27.36 ? 670  HIS B ND1 1 
ATOM   3914 C  CD2 . HIS B 1 190 ? 32.546  25.110  -17.672 1.00 27.71 ? 670  HIS B CD2 1 
ATOM   3915 C  CE1 . HIS B 1 190 ? 31.817  25.953  -15.786 1.00 27.99 ? 670  HIS B CE1 1 
ATOM   3916 N  NE2 . HIS B 1 190 ? 32.778  26.037  -16.687 1.00 27.47 ? 670  HIS B NE2 1 
ATOM   3917 N  N   . ALA B 1 191 ? 29.568  20.202  -18.309 1.00 27.89 ? 671  ALA B N   1 
ATOM   3918 C  CA  . ALA B 1 191 ? 28.694  19.319  -19.078 1.00 28.13 ? 671  ALA B CA  1 
ATOM   3919 C  C   . ALA B 1 191 ? 27.598  18.810  -18.162 1.00 28.46 ? 671  ALA B C   1 
ATOM   3920 O  O   . ALA B 1 191 ? 27.894  18.233  -17.124 1.00 28.43 ? 671  ALA B O   1 
ATOM   3921 C  CB  . ALA B 1 191 ? 29.478  18.156  -19.667 1.00 28.07 ? 671  ALA B CB  1 
ATOM   3922 N  N   . ASP B 1 192 ? 26.338  19.060  -18.522 1.00 29.03 ? 672  ASP B N   1 
ATOM   3923 C  CA  . ASP B 1 192 ? 25.207  18.563  -17.727 1.00 29.44 ? 672  ASP B CA  1 
ATOM   3924 C  C   . ASP B 1 192 ? 24.507  17.395  -18.429 1.00 29.10 ? 672  ASP B C   1 
ATOM   3925 O  O   . ASP B 1 192 ? 24.977  16.917  -19.459 1.00 28.99 ? 672  ASP B O   1 
ATOM   3926 C  CB  . ASP B 1 192 ? 24.249  19.706  -17.332 1.00 29.68 ? 672  ASP B CB  1 
ATOM   3927 C  CG  . ASP B 1 192 ? 23.491  20.302  -18.503 1.00 31.26 ? 672  ASP B CG  1 
ATOM   3928 O  OD1 . ASP B 1 192 ? 23.240  19.607  -19.515 1.00 32.87 ? 672  ASP B OD1 1 
ATOM   3929 O  OD2 . ASP B 1 192 ? 23.121  21.495  -18.388 1.00 33.60 ? 672  ASP B OD2 1 
ATOM   3930 N  N   . HIS B 1 193 ? 23.402  16.929  -17.859 1.00 29.02 ? 673  HIS B N   1 
ATOM   3931 C  CA  . HIS B 1 193 ? 22.744  15.703  -18.316 1.00 28.86 ? 673  HIS B CA  1 
ATOM   3932 C  C   . HIS B 1 193 ? 22.706  15.566  -19.838 1.00 28.61 ? 673  HIS B C   1 
ATOM   3933 O  O   . HIS B 1 193 ? 23.070  14.530  -20.379 1.00 28.23 ? 673  HIS B O   1 
ATOM   3934 C  CB  . HIS B 1 193 ? 21.324  15.610  -17.746 1.00 28.87 ? 673  HIS B CB  1 
ATOM   3935 C  CG  . HIS B 1 193 ? 20.617  14.340  -18.098 1.00 29.62 ? 673  HIS B CG  1 
ATOM   3936 N  ND1 . HIS B 1 193 ? 21.118  13.096  -17.776 1.00 30.27 ? 673  HIS B ND1 1 
ATOM   3937 C  CD2 . HIS B 1 193 ? 19.448  14.119  -18.746 1.00 29.92 ? 673  HIS B CD2 1 
ATOM   3938 C  CE1 . HIS B 1 193 ? 20.289  12.164  -18.213 1.00 30.47 ? 673  HIS B CE1 1 
ATOM   3939 N  NE2 . HIS B 1 193 ? 19.267  12.757  -18.803 1.00 30.12 ? 673  HIS B NE2 1 
ATOM   3940 N  N   . SER B 1 194 ? 22.273  16.615  -20.527 1.00 28.69 ? 674  SER B N   1 
ATOM   3941 C  CA  . SER B 1 194 ? 22.148  16.560  -21.981 1.00 28.76 ? 674  SER B CA  1 
ATOM   3942 C  C   . SER B 1 194 ? 22.664  17.824  -22.661 1.00 28.59 ? 674  SER B C   1 
ATOM   3943 O  O   . SER B 1 194 ? 22.085  18.285  -23.642 1.00 28.53 ? 674  SER B O   1 
ATOM   3944 C  CB  . SER B 1 194 ? 20.691  16.286  -22.371 1.00 28.76 ? 674  SER B CB  1 
ATOM   3945 O  OG  . SER B 1 194 ? 19.821  17.229  -21.772 1.00 29.37 ? 674  SER B OG  1 
ATOM   3946 N  N   . THR B 1 195 ? 23.763  18.379  -22.156 1.00 28.49 ? 675  THR B N   1 
ATOM   3947 C  CA  . THR B 1 195 ? 24.354  19.552  -22.791 1.00 28.59 ? 675  THR B CA  1 
ATOM   3948 C  C   . THR B 1 195 ? 25.865  19.579  -22.658 1.00 28.40 ? 675  THR B C   1 
ATOM   3949 O  O   . THR B 1 195 ? 26.399  19.569  -21.557 1.00 28.57 ? 675  THR B O   1 
ATOM   3950 C  CB  . THR B 1 195 ? 23.782  20.880  -22.222 1.00 28.68 ? 675  THR B CB  1 
ATOM   3951 O  OG1 . THR B 1 195 ? 22.376  20.749  -21.978 1.00 29.65 ? 675  THR B OG1 1 
ATOM   3952 C  CG2 . THR B 1 195 ? 24.008  22.028  -23.212 1.00 28.27 ? 675  THR B CG2 1 
ATOM   3953 N  N   . ALA B 1 196 ? 26.546  19.597  -23.794 1.00 28.42 ? 676  ALA B N   1 
ATOM   3954 C  CA  . ALA B 1 196 ? 27.958  19.947  -23.832 1.00 28.52 ? 676  ALA B CA  1 
ATOM   3955 C  C   . ALA B 1 196 ? 28.045  21.478  -23.877 1.00 28.42 ? 676  ALA B C   1 
ATOM   3956 O  O   . ALA B 1 196 ? 27.330  22.116  -24.645 1.00 28.27 ? 676  ALA B O   1 
ATOM   3957 C  CB  . ALA B 1 196 ? 28.632  19.321  -25.054 1.00 28.17 ? 676  ALA B CB  1 
ATOM   3958 N  N   . MET B 1 197 ? 28.899  22.057  -23.036 1.00 28.71 ? 677  MET B N   1 
ATOM   3959 C  CA  . MET B 1 197 ? 29.074  23.519  -22.968 1.00 28.87 ? 677  MET B CA  1 
ATOM   3960 C  C   . MET B 1 197 ? 30.331  23.891  -22.195 1.00 28.43 ? 677  MET B C   1 
ATOM   3961 O  O   . MET B 1 197 ? 30.882  23.082  -21.450 1.00 27.98 ? 677  MET B O   1 
ATOM   3962 C  CB  . MET B 1 197 ? 27.866  24.191  -22.304 1.00 28.95 ? 677  MET B CB  1 
ATOM   3963 C  CG  . MET B 1 197 ? 27.504  23.595  -20.957 1.00 30.58 ? 677  MET B CG  1 
ATOM   3964 S  SD  . MET B 1 197 ? 26.289  24.556  -20.039 1.00 33.29 ? 677  MET B SD  1 
ATOM   3965 C  CE  . MET B 1 197 ? 27.334  25.810  -19.309 1.00 33.01 ? 677  MET B CE  1 
ATOM   3966 N  N   . GLY B 1 198 ? 30.767  25.133  -22.376 1.00 28.27 ? 678  GLY B N   1 
ATOM   3967 C  CA  . GLY B 1 198 ? 31.931  25.659  -21.678 1.00 28.11 ? 678  GLY B CA  1 
ATOM   3968 C  C   . GLY B 1 198 ? 33.145  24.758  -21.755 1.00 28.01 ? 678  GLY B C   1 
ATOM   3969 O  O   . GLY B 1 198 ? 33.770  24.483  -20.741 1.00 28.12 ? 678  GLY B O   1 
ATOM   3970 N  N   . PHE B 1 199 ? 33.466  24.291  -22.963 1.00 27.87 ? 679  PHE B N   1 
ATOM   3971 C  CA  . PHE B 1 199 ? 34.649  23.460  -23.219 1.00 27.72 ? 679  PHE B CA  1 
ATOM   3972 C  C   . PHE B 1 199 ? 34.514  21.999  -22.748 1.00 27.71 ? 679  PHE B C   1 
ATOM   3973 O  O   . PHE B 1 199 ? 35.457  21.213  -22.903 1.00 27.69 ? 679  PHE B O   1 
ATOM   3974 C  CB  . PHE B 1 199 ? 35.915  24.089  -22.607 1.00 27.69 ? 679  PHE B CB  1 
ATOM   3975 C  CG  . PHE B 1 199 ? 36.199  25.483  -23.092 1.00 28.22 ? 679  PHE B CG  1 
ATOM   3976 C  CD1 . PHE B 1 199 ? 36.873  25.686  -24.291 1.00 29.04 ? 679  PHE B CD1 1 
ATOM   3977 C  CD2 . PHE B 1 199 ? 35.798  26.592  -22.356 1.00 28.36 ? 679  PHE B CD2 1 
ATOM   3978 C  CE1 . PHE B 1 199 ? 37.144  26.977  -24.747 1.00 29.55 ? 679  PHE B CE1 1 
ATOM   3979 C  CE2 . PHE B 1 199 ? 36.060  27.878  -22.808 1.00 28.65 ? 679  PHE B CE2 1 
ATOM   3980 C  CZ  . PHE B 1 199 ? 36.739  28.072  -24.001 1.00 29.08 ? 679  PHE B CZ  1 
ATOM   3981 N  N   . CYS B 1 200 ? 33.354  21.634  -22.203 1.00 27.23 ? 680  CYS B N   1 
ATOM   3982 C  CA  . CYS B 1 200 ? 33.155  20.316  -21.601 1.00 27.26 ? 680  CYS B CA  1 
ATOM   3983 C  C   . CYS B 1 200 ? 32.138  19.497  -22.370 1.00 26.76 ? 680  CYS B C   1 
ATOM   3984 O  O   . CYS B 1 200 ? 31.168  20.043  -22.893 1.00 26.80 ? 680  CYS B O   1 
ATOM   3985 C  CB  . CYS B 1 200 ? 32.683  20.465  -20.153 1.00 27.43 ? 680  CYS B CB  1 
ATOM   3986 S  SG  . CYS B 1 200 ? 33.787  21.470  -19.145 1.00 28.57 ? 680  CYS B SG  1 
ATOM   3987 N  N   . PHE B 1 201 ? 32.358  18.185  -22.411 1.00 26.41 ? 681  PHE B N   1 
ATOM   3988 C  CA  . PHE B 1 201 ? 31.481  17.252  -23.126 1.00 26.38 ? 681  PHE B CA  1 
ATOM   3989 C  C   . PHE B 1 201 ? 30.873  16.187  -22.210 1.00 26.14 ? 681  PHE B C   1 
ATOM   3990 O  O   . PHE B 1 201 ? 29.662  15.953  -22.252 1.00 26.48 ? 681  PHE B O   1 
ATOM   3991 C  CB  . PHE B 1 201 ? 32.249  16.580  -24.267 1.00 26.24 ? 681  PHE B CB  1 
ATOM   3992 C  CG  . PHE B 1 201 ? 32.835  17.547  -25.232 1.00 26.11 ? 681  PHE B CG  1 
ATOM   3993 C  CD1 . PHE B 1 201 ? 34.102  18.064  -25.025 1.00 26.53 ? 681  PHE B CD1 1 
ATOM   3994 C  CD2 . PHE B 1 201 ? 32.112  17.969  -26.337 1.00 26.18 ? 681  PHE B CD2 1 
ATOM   3995 C  CE1 . PHE B 1 201 ? 34.644  18.972  -25.905 1.00 26.14 ? 681  PHE B CE1 1 
ATOM   3996 C  CE2 . PHE B 1 201 ? 32.653  18.883  -27.225 1.00 26.24 ? 681  PHE B CE2 1 
ATOM   3997 C  CZ  . PHE B 1 201 ? 33.919  19.380  -27.006 1.00 25.86 ? 681  PHE B CZ  1 
ATOM   3998 N  N   . PHE B 1 202 ? 31.715  15.525  -21.418 1.00 25.65 ? 682  PHE B N   1 
ATOM   3999 C  CA  . PHE B 1 202 ? 31.246  14.572  -20.414 1.00 25.39 ? 682  PHE B CA  1 
ATOM   4000 C  C   . PHE B 1 202 ? 31.770  15.015  -19.061 1.00 25.52 ? 682  PHE B C   1 
ATOM   4001 O  O   . PHE B 1 202 ? 32.889  15.498  -18.952 1.00 25.58 ? 682  PHE B O   1 
ATOM   4002 C  CB  . PHE B 1 202 ? 31.714  13.144  -20.732 1.00 25.33 ? 682  PHE B CB  1 
ATOM   4003 C  CG  . PHE B 1 202 ? 31.204  12.615  -22.047 1.00 24.36 ? 682  PHE B CG  1 
ATOM   4004 C  CD1 . PHE B 1 202 ? 29.850  12.516  -22.285 1.00 24.09 ? 682  PHE B CD1 1 
ATOM   4005 C  CD2 . PHE B 1 202 ? 32.082  12.214  -23.038 1.00 24.37 ? 682  PHE B CD2 1 
ATOM   4006 C  CE1 . PHE B 1 202 ? 29.371  12.027  -23.486 1.00 24.26 ? 682  PHE B CE1 1 
ATOM   4007 C  CE2 . PHE B 1 202 ? 31.615  11.726  -24.246 1.00 24.33 ? 682  PHE B CE2 1 
ATOM   4008 C  CZ  . PHE B 1 202 ? 30.257  11.636  -24.473 1.00 24.17 ? 682  PHE B CZ  1 
ATOM   4009 N  N   . ASN B 1 203 ? 30.949  14.869  -18.032 1.00 25.96 ? 683  ASN B N   1 
ATOM   4010 C  CA  . ASN B 1 203 ? 31.325  15.297  -16.696 1.00 26.27 ? 683  ASN B CA  1 
ATOM   4011 C  C   . ASN B 1 203 ? 32.082  14.165  -16.011 1.00 26.32 ? 683  ASN B C   1 
ATOM   4012 O  O   . ASN B 1 203 ? 31.504  13.345  -15.294 1.00 26.45 ? 683  ASN B O   1 
ATOM   4013 C  CB  . ASN B 1 203 ? 30.098  15.739  -15.891 1.00 26.15 ? 683  ASN B CB  1 
ATOM   4014 C  CG  . ASN B 1 203 ? 30.474  16.523  -14.653 1.00 26.77 ? 683  ASN B CG  1 
ATOM   4015 O  OD1 . ASN B 1 203 ? 31.585  16.394  -14.137 1.00 27.03 ? 683  ASN B OD1 1 
ATOM   4016 N  ND2 . ASN B 1 203 ? 29.552  17.343  -14.168 1.00 28.40 ? 683  ASN B ND2 1 
ATOM   4017 N  N   . SER B 1 204 ? 33.388  14.144  -16.263 1.00 26.24 ? 684  SER B N   1 
ATOM   4018 C  CA  . SER B 1 204 ? 34.286  13.086  -15.819 1.00 26.03 ? 684  SER B CA  1 
ATOM   4019 C  C   . SER B 1 204 ? 34.243  12.834  -14.321 1.00 25.92 ? 684  SER B C   1 
ATOM   4020 O  O   . SER B 1 204 ? 34.248  11.692  -13.887 1.00 25.79 ? 684  SER B O   1 
ATOM   4021 C  CB  . SER B 1 204 ? 35.715  13.438  -16.227 1.00 26.22 ? 684  SER B CB  1 
ATOM   4022 O  OG  . SER B 1 204 ? 35.789  13.709  -17.617 1.00 26.76 ? 684  SER B OG  1 
ATOM   4023 N  N   . VAL B 1 205 ? 34.215  13.903  -13.531 1.00 26.01 ? 685  VAL B N   1 
ATOM   4024 C  CA  . VAL B 1 205 ? 34.206  13.769  -12.076 1.00 25.91 ? 685  VAL B CA  1 
ATOM   4025 C  C   . VAL B 1 205 ? 32.876  13.185  -11.592 1.00 26.00 ? 685  VAL B C   1 
ATOM   4026 O  O   . VAL B 1 205 ? 32.871  12.313  -10.722 1.00 25.83 ? 685  VAL B O   1 
ATOM   4027 C  CB  . VAL B 1 205 ? 34.526  15.115  -11.375 1.00 25.85 ? 685  VAL B CB  1 
ATOM   4028 C  CG1 . VAL B 1 205 ? 34.345  15.005  -9.870  1.00 25.70 ? 685  VAL B CG1 1 
ATOM   4029 C  CG2 . VAL B 1 205 ? 35.942  15.543  -11.705 1.00 25.19 ? 685  VAL B CG2 1 
ATOM   4030 N  N   . ALA B 1 206 ? 31.765  13.641  -12.174 1.00 25.89 ? 686  ALA B N   1 
ATOM   4031 C  CA  . ALA B 1 206 ? 30.442  13.094  -11.849 1.00 26.00 ? 686  ALA B CA  1 
ATOM   4032 C  C   . ALA B 1 206 ? 30.333  11.614  -12.235 1.00 26.12 ? 686  ALA B C   1 
ATOM   4033 O  O   . ALA B 1 206 ? 29.744  10.809  -11.509 1.00 26.36 ? 686  ALA B O   1 
ATOM   4034 C  CB  . ALA B 1 206 ? 29.350  13.894  -12.551 1.00 25.94 ? 686  ALA B CB  1 
ATOM   4035 N  N   . ILE B 1 207 ? 30.886  11.269  -13.393 1.00 26.03 ? 687  ILE B N   1 
ATOM   4036 C  CA  . ILE B 1 207 ? 30.879  9.898   -13.866 1.00 25.92 ? 687  ILE B CA  1 
ATOM   4037 C  C   . ILE B 1 207 ? 31.668  9.013   -12.898 1.00 25.89 ? 687  ILE B C   1 
ATOM   4038 O  O   . ILE B 1 207 ? 31.181  7.959   -12.497 1.00 26.05 ? 687  ILE B O   1 
ATOM   4039 C  CB  . ILE B 1 207 ? 31.416  9.799   -15.329 1.00 25.96 ? 687  ILE B CB  1 
ATOM   4040 C  CG1 . ILE B 1 207 ? 30.393  10.417  -16.294 1.00 26.14 ? 687  ILE B CG1 1 
ATOM   4041 C  CG2 . ILE B 1 207 ? 31.678  8.342   -15.723 1.00 25.00 ? 687  ILE B CG2 1 
ATOM   4042 C  CD1 . ILE B 1 207 ? 30.908  10.685  -17.695 1.00 26.18 ? 687  ILE B CD1 1 
ATOM   4043 N  N   . ALA B 1 208 ? 32.861  9.451   -12.499 1.00 25.73 ? 688  ALA B N   1 
ATOM   4044 C  CA  . ALA B 1 208 ? 33.671  8.702   -11.529 1.00 25.81 ? 688  ALA B CA  1 
ATOM   4045 C  C   . ALA B 1 208 ? 32.896  8.468   -10.229 1.00 25.90 ? 688  ALA B C   1 
ATOM   4046 O  O   . ALA B 1 208 ? 32.871  7.358   -9.700  1.00 25.67 ? 688  ALA B O   1 
ATOM   4047 C  CB  . ALA B 1 208 ? 34.980  9.428   -11.246 1.00 25.57 ? 688  ALA B CB  1 
ATOM   4048 N  N   . CYS B 1 209 ? 32.258  9.524   -9.736  1.00 26.27 ? 689  CYS B N   1 
ATOM   4049 C  CA  . CYS B 1 209 ? 31.451  9.466   -8.525  1.00 26.70 ? 689  CYS B CA  1 
ATOM   4050 C  C   . CYS B 1 209 ? 30.352  8.407   -8.625  1.00 27.16 ? 689  CYS B C   1 
ATOM   4051 O  O   . CYS B 1 209 ? 30.215  7.558   -7.742  1.00 27.16 ? 689  CYS B O   1 
ATOM   4052 C  CB  . CYS B 1 209 ? 30.831  10.837  -8.249  1.00 26.67 ? 689  CYS B CB  1 
ATOM   4053 S  SG  . CYS B 1 209 ? 29.813  10.917  -6.773  1.00 27.63 ? 689  CYS B SG  1 
ATOM   4054 N  N   . ARG B 1 210 ? 29.576  8.465   -9.702  1.00 27.74 ? 690  ARG B N   1 
ATOM   4055 C  CA  . ARG B 1 210 ? 28.494  7.506   -9.943  1.00 28.27 ? 690  ARG B CA  1 
ATOM   4056 C  C   . ARG B 1 210 ? 28.977  6.057   -10.030 1.00 28.32 ? 690  ARG B C   1 
ATOM   4057 O  O   . ARG B 1 210 ? 28.320  5.154   -9.512  1.00 28.44 ? 690  ARG B O   1 
ATOM   4058 C  CB  . ARG B 1 210 ? 27.727  7.873   -11.222 1.00 28.52 ? 690  ARG B CB  1 
ATOM   4059 C  CG  . ARG B 1 210 ? 26.632  8.895   -10.992 1.00 29.56 ? 690  ARG B CG  1 
ATOM   4060 C  CD  . ARG B 1 210 ? 25.371  8.225   -10.472 1.00 30.80 ? 690  ARG B CD  1 
ATOM   4061 N  NE  . ARG B 1 210 ? 24.560  9.124   -9.648  1.00 32.12 ? 690  ARG B NE  1 
ATOM   4062 C  CZ  . ARG B 1 210 ? 23.741  10.071  -10.109 1.00 32.31 ? 690  ARG B CZ  1 
ATOM   4063 N  NH1 . ARG B 1 210 ? 23.600  10.288  -11.418 1.00 31.30 ? 690  ARG B NH1 1 
ATOM   4064 N  NH2 . ARG B 1 210 ? 23.051  10.809  -9.242  1.00 32.61 ? 690  ARG B NH2 1 
ATOM   4065 N  N   . GLN B 1 211 ? 30.116  5.840   -10.681 1.00 28.43 ? 691  GLN B N   1 
ATOM   4066 C  CA  . GLN B 1 211 ? 30.661  4.491   -10.848 1.00 28.68 ? 691  GLN B CA  1 
ATOM   4067 C  C   . GLN B 1 211 ? 31.187  3.930   -9.532  1.00 29.15 ? 691  GLN B C   1 
ATOM   4068 O  O   . GLN B 1 211 ? 30.914  2.777   -9.191  1.00 28.78 ? 691  GLN B O   1 
ATOM   4069 C  CB  . GLN B 1 211 ? 31.759  4.470   -11.918 1.00 28.55 ? 691  GLN B CB  1 
ATOM   4070 C  CG  . GLN B 1 211 ? 31.239  4.726   -13.326 1.00 28.12 ? 691  GLN B CG  1 
ATOM   4071 C  CD  . GLN B 1 211 ? 30.122  3.781   -13.704 1.00 26.83 ? 691  GLN B CD  1 
ATOM   4072 O  OE1 . GLN B 1 211 ? 29.002  4.203   -13.973 1.00 26.62 ? 691  GLN B OE1 1 
ATOM   4073 N  NE2 . GLN B 1 211 ? 30.416  2.496   -13.701 1.00 26.65 ? 691  GLN B NE2 1 
ATOM   4074 N  N   . LEU B 1 212 ? 31.936  4.748   -8.797  1.00 29.71 ? 692  LEU B N   1 
ATOM   4075 C  CA  . LEU B 1 212 ? 32.356  4.383   -7.447  1.00 30.31 ? 692  LEU B CA  1 
ATOM   4076 C  C   . LEU B 1 212 ? 31.167  3.915   -6.615  1.00 30.48 ? 692  LEU B C   1 
ATOM   4077 O  O   . LEU B 1 212 ? 31.256  2.912   -5.911  1.00 30.57 ? 692  LEU B O   1 
ATOM   4078 C  CB  . LEU B 1 212 ? 33.041  5.566   -6.751  1.00 30.60 ? 692  LEU B CB  1 
ATOM   4079 C  CG  . LEU B 1 212 ? 34.562  5.678   -6.904  1.00 31.41 ? 692  LEU B CG  1 
ATOM   4080 C  CD1 . LEU B 1 212 ? 35.012  5.336   -8.317  1.00 32.30 ? 692  LEU B CD1 1 
ATOM   4081 C  CD2 . LEU B 1 212 ? 35.023  7.080   -6.513  1.00 31.88 ? 692  LEU B CD2 1 
ATOM   4082 N  N   . GLN B 1 213 ? 30.055  4.637   -6.717  1.00 30.89 ? 693  GLN B N   1 
ATOM   4083 C  CA  . GLN B 1 213 ? 28.877  4.361   -5.894  1.00 31.28 ? 693  GLN B CA  1 
ATOM   4084 C  C   . GLN B 1 213 ? 28.141  3.079   -6.284  1.00 31.55 ? 693  GLN B C   1 
ATOM   4085 O  O   . GLN B 1 213 ? 27.519  2.452   -5.431  1.00 31.47 ? 693  GLN B O   1 
ATOM   4086 C  CB  . GLN B 1 213 ? 27.925  5.568   -5.883  1.00 31.10 ? 693  GLN B CB  1 
ATOM   4087 C  CG  . GLN B 1 213 ? 28.432  6.685   -4.983  1.00 31.35 ? 693  GLN B CG  1 
ATOM   4088 C  CD  . GLN B 1 213 ? 27.492  7.879   -4.888  1.00 30.75 ? 693  GLN B CD  1 
ATOM   4089 O  OE1 . GLN B 1 213 ? 26.937  8.339   -5.890  1.00 29.87 ? 693  GLN B OE1 1 
ATOM   4090 N  NE2 . GLN B 1 213 ? 27.324  8.396   -3.674  1.00 29.21 ? 693  GLN B NE2 1 
ATOM   4091 N  N   . GLN B 1 214 ? 28.214  2.687   -7.555  1.00 32.19 ? 694  GLN B N   1 
ATOM   4092 C  CA  . GLN B 1 214 ? 27.650  1.401   -7.987  1.00 32.79 ? 694  GLN B CA  1 
ATOM   4093 C  C   . GLN B 1 214 ? 28.461  0.229   -7.429  1.00 32.96 ? 694  GLN B C   1 
ATOM   4094 O  O   . GLN B 1 214 ? 27.893  -0.771  -6.989  1.00 33.02 ? 694  GLN B O   1 
ATOM   4095 C  CB  . GLN B 1 214 ? 27.575  1.300   -9.514  1.00 32.91 ? 694  GLN B CB  1 
ATOM   4096 C  CG  . GLN B 1 214 ? 26.419  2.080   -10.129 1.00 33.76 ? 694  GLN B CG  1 
ATOM   4097 C  CD  . GLN B 1 214 ? 26.336  1.927   -11.638 1.00 34.60 ? 694  GLN B CD  1 
ATOM   4098 O  OE1 . GLN B 1 214 ? 26.628  0.862   -12.183 1.00 35.90 ? 694  GLN B OE1 1 
ATOM   4099 N  NE2 . GLN B 1 214 ? 25.928  2.994   -12.321 1.00 35.32 ? 694  GLN B NE2 1 
ATOM   4100 N  N   . GLN B 1 215 ? 29.785  0.369   -7.440  1.00 33.17 ? 695  GLN B N   1 
ATOM   4101 C  CA  . GLN B 1 215 ? 30.685  -0.682  -6.960  1.00 33.38 ? 695  GLN B CA  1 
ATOM   4102 C  C   . GLN B 1 215 ? 30.756  -0.803  -5.436  1.00 33.17 ? 695  GLN B C   1 
ATOM   4103 O  O   . GLN B 1 215 ? 31.278  -1.790  -4.928  1.00 33.25 ? 695  GLN B O   1 
ATOM   4104 C  CB  . GLN B 1 215 ? 32.099  -0.495  -7.535  1.00 33.53 ? 695  GLN B CB  1 
ATOM   4105 C  CG  . GLN B 1 215 ? 32.397  -1.398  -8.732  1.00 34.11 ? 695  GLN B CG  1 
ATOM   4106 C  CD  . GLN B 1 215 ? 31.600  -1.036  -9.977  1.00 34.84 ? 695  GLN B CD  1 
ATOM   4107 O  OE1 . GLN B 1 215 ? 31.257  0.128   -10.197 1.00 35.52 ? 695  GLN B OE1 1 
ATOM   4108 N  NE2 . GLN B 1 215 ? 31.307  -2.039  -10.805 1.00 34.82 ? 695  GLN B NE2 1 
ATOM   4109 N  N   . SER B 1 216 ? 30.242  0.191   -4.717  1.00 33.05 ? 696  SER B N   1 
ATOM   4110 C  CA  . SER B 1 216 ? 30.280  0.199   -3.253  1.00 32.97 ? 696  SER B CA  1 
ATOM   4111 C  C   . SER B 1 216 ? 28.983  0.772   -2.688  1.00 32.66 ? 696  SER B C   1 
ATOM   4112 O  O   . SER B 1 216 ? 28.780  1.996   -2.676  1.00 32.60 ? 696  SER B O   1 
ATOM   4113 C  CB  . SER B 1 216 ? 31.466  1.029   -2.759  1.00 33.17 ? 696  SER B CB  1 
ATOM   4114 O  OG  . SER B 1 216 ? 32.667  0.588   -3.362  1.00 33.87 ? 696  SER B OG  1 
ATOM   4115 N  N   . LYS B 1 217 ? 28.116  -0.117  -2.213  1.00 32.10 ? 697  LYS B N   1 
ATOM   4116 C  CA  . LYS B 1 217 ? 26.772  0.265   -1.788  1.00 31.86 ? 697  LYS B CA  1 
ATOM   4117 C  C   . LYS B 1 217 ? 26.782  1.123   -0.517  1.00 31.49 ? 697  LYS B C   1 
ATOM   4118 O  O   . LYS B 1 217 ? 27.472  0.806   0.454   1.00 31.46 ? 697  LYS B O   1 
ATOM   4119 C  CB  . LYS B 1 217 ? 25.906  -0.979  -1.573  1.00 31.91 ? 697  LYS B CB  1 
ATOM   4120 C  CG  . LYS B 1 217 ? 25.827  -1.893  -2.791  1.00 32.09 ? 697  LYS B CG  1 
ATOM   4121 C  CD  . LYS B 1 217 ? 24.756  -2.952  -2.631  1.00 32.30 ? 697  LYS B CD  1 
ATOM   4122 C  CE  . LYS B 1 217 ? 24.858  -4.014  -3.718  1.00 32.67 ? 697  LYS B CE  1 
ATOM   4123 N  NZ  . LYS B 1 217 ? 24.842  -3.428  -5.094  1.00 32.76 ? 697  LYS B NZ  1 
ATOM   4124 N  N   . ALA B 1 218 ? 26.014  2.212   -0.548  1.00 31.06 ? 698  ALA B N   1 
ATOM   4125 C  CA  . ALA B 1 218 ? 25.825  3.111   0.599   1.00 30.76 ? 698  ALA B CA  1 
ATOM   4126 C  C   . ALA B 1 218 ? 26.948  4.139   0.809   1.00 30.42 ? 698  ALA B C   1 
ATOM   4127 O  O   . ALA B 1 218 ? 26.917  4.887   1.785   1.00 30.53 ? 698  ALA B O   1 
ATOM   4128 C  CB  . ALA B 1 218 ? 25.596  2.306   1.879   1.00 30.59 ? 698  ALA B CB  1 
ATOM   4129 N  N   . SER B 1 219 ? 27.913  4.204   -0.108  1.00 30.06 ? 699  SER B N   1 
ATOM   4130 C  CA  . SER B 1 219 ? 29.083  5.067   0.075   1.00 29.77 ? 699  SER B CA  1 
ATOM   4131 C  C   . SER B 1 219 ? 28.756  6.547   -0.118  1.00 29.55 ? 699  SER B C   1 
ATOM   4132 O  O   . SER B 1 219 ? 27.977  6.917   -0.996  1.00 29.69 ? 699  SER B O   1 
ATOM   4133 C  CB  . SER B 1 219 ? 30.217  4.661   -0.869  1.00 29.68 ? 699  SER B CB  1 
ATOM   4134 O  OG  . SER B 1 219 ? 29.809  4.734   -2.219  1.00 29.74 ? 699  SER B OG  1 
ATOM   4135 N  N   . LYS B 1 220 ? 29.365  7.386   0.711   1.00 29.17 ? 700  LYS B N   1 
ATOM   4136 C  CA  . LYS B 1 220 ? 29.167  8.821   0.635   1.00 29.04 ? 700  LYS B CA  1 
ATOM   4137 C  C   . LYS B 1 220 ? 30.406  9.460   0.035   1.00 28.69 ? 700  LYS B C   1 
ATOM   4138 O  O   . LYS B 1 220 ? 31.524  9.163   0.460   1.00 28.66 ? 700  LYS B O   1 
ATOM   4139 C  CB  . LYS B 1 220 ? 28.883  9.391   2.021   1.00 29.16 ? 700  LYS B CB  1 
ATOM   4140 C  CG  . LYS B 1 220 ? 27.787  8.644   2.763   1.00 29.69 ? 700  LYS B CG  1 
ATOM   4141 C  CD  . LYS B 1 220 ? 27.159  9.478   3.868   1.00 30.76 ? 700  LYS B CD  1 
ATOM   4142 C  CE  . LYS B 1 220 ? 28.170  9.903   4.923   1.00 31.36 ? 700  LYS B CE  1 
ATOM   4143 N  NZ  . LYS B 1 220 ? 27.504  10.545  6.096   1.00 31.52 ? 700  LYS B NZ  1 
ATOM   4144 N  N   . ILE B 1 221 ? 30.205  10.327  -0.955  1.00 28.26 ? 701  ILE B N   1 
ATOM   4145 C  CA  . ILE B 1 221 ? 31.313  10.958  -1.665  1.00 27.94 ? 701  ILE B CA  1 
ATOM   4146 C  C   . ILE B 1 221 ? 31.215  12.487  -1.641  1.00 27.85 ? 701  ILE B C   1 
ATOM   4147 O  O   . ILE B 1 221 ? 30.153  13.059  -1.893  1.00 27.65 ? 701  ILE B O   1 
ATOM   4148 C  CB  . ILE B 1 221 ? 31.393  10.443  -3.121  1.00 28.16 ? 701  ILE B CB  1 
ATOM   4149 C  CG1 . ILE B 1 221 ? 31.751  8.947   -3.112  1.00 27.81 ? 701  ILE B CG1 1 
ATOM   4150 C  CG2 . ILE B 1 221 ? 32.409  11.273  -3.941  1.00 27.23 ? 701  ILE B CG2 1 
ATOM   4151 C  CD1 . ILE B 1 221 ? 31.972  8.365   -4.462  1.00 27.85 ? 701  ILE B CD1 1 
ATOM   4152 N  N   . LEU B 1 222 ? 32.335  13.132  -1.317  1.00 27.84 ? 702  LEU B N   1 
ATOM   4153 C  CA  . LEU B 1 222 ? 32.457  14.587  -1.355  1.00 27.57 ? 702  LEU B CA  1 
ATOM   4154 C  C   . LEU B 1 222 ? 33.071  14.994  -2.682  1.00 27.66 ? 702  LEU B C   1 
ATOM   4155 O  O   . LEU B 1 222 ? 34.101  14.452  -3.077  1.00 27.47 ? 702  LEU B O   1 
ATOM   4156 C  CB  . LEU B 1 222 ? 33.347  15.087  -0.210  1.00 27.48 ? 702  LEU B CB  1 
ATOM   4157 C  CG  . LEU B 1 222 ? 33.743  16.576  -0.214  1.00 27.12 ? 702  LEU B CG  1 
ATOM   4158 C  CD1 . LEU B 1 222 ? 32.528  17.489  -0.089  1.00 25.43 ? 702  LEU B CD1 1 
ATOM   4159 C  CD2 . LEU B 1 222 ? 34.749  16.860  0.899   1.00 26.09 ? 702  LEU B CD2 1 
ATOM   4160 N  N   . ILE B 1 223 ? 32.430  15.941  -3.368  1.00 27.88 ? 703  ILE B N   1 
ATOM   4161 C  CA  . ILE B 1 223 ? 33.022  16.590  -4.529  1.00 27.88 ? 703  ILE B CA  1 
ATOM   4162 C  C   . ILE B 1 223 ? 33.318  18.040  -4.173  1.00 28.29 ? 703  ILE B C   1 
ATOM   4163 O  O   . ILE B 1 223 ? 32.401  18.815  -3.869  1.00 28.06 ? 703  ILE B O   1 
ATOM   4164 C  CB  . ILE B 1 223 ? 32.102  16.566  -5.761  1.00 28.17 ? 703  ILE B CB  1 
ATOM   4165 C  CG1 . ILE B 1 223 ? 31.748  15.123  -6.153  1.00 27.55 ? 703  ILE B CG1 1 
ATOM   4166 C  CG2 . ILE B 1 223 ? 32.771  17.312  -6.938  1.00 27.31 ? 703  ILE B CG2 1 
ATOM   4167 C  CD1 . ILE B 1 223 ? 30.828  15.031  -7.359  1.00 26.37 ? 703  ILE B CD1 1 
ATOM   4168 N  N   . VAL B 1 224 ? 34.602  18.396  -4.189  1.00 28.36 ? 704  VAL B N   1 
ATOM   4169 C  CA  . VAL B 1 224 ? 35.022  19.770  -3.970  1.00 28.42 ? 704  VAL B CA  1 
ATOM   4170 C  C   . VAL B 1 224 ? 35.438  20.345  -5.308  1.00 28.67 ? 704  VAL B C   1 
ATOM   4171 O  O   . VAL B 1 224 ? 36.263  19.766  -5.996  1.00 28.65 ? 704  VAL B O   1 
ATOM   4172 C  CB  . VAL B 1 224 ? 36.215  19.878  -2.998  1.00 28.46 ? 704  VAL B CB  1 
ATOM   4173 C  CG1 . VAL B 1 224 ? 36.553  21.350  -2.751  1.00 28.09 ? 704  VAL B CG1 1 
ATOM   4174 C  CG2 . VAL B 1 224 ? 35.909  19.168  -1.696  1.00 27.68 ? 704  VAL B CG2 1 
ATOM   4175 N  N   . ASP B 1 225 ? 34.870  21.487  -5.675  1.00 28.97 ? 705  ASP B N   1 
ATOM   4176 C  CA  . ASP B 1 225 ? 35.166  22.100  -6.962  1.00 29.33 ? 705  ASP B CA  1 
ATOM   4177 C  C   . ASP B 1 225 ? 35.781  23.478  -6.710  1.00 29.28 ? 705  ASP B C   1 
ATOM   4178 O  O   . ASP B 1 225 ? 35.064  24.435  -6.401  1.00 29.85 ? 705  ASP B O   1 
ATOM   4179 C  CB  . ASP B 1 225 ? 33.874  22.160  -7.798  1.00 29.46 ? 705  ASP B CB  1 
ATOM   4180 C  CG  . ASP B 1 225 ? 34.098  22.676  -9.219  1.00 30.85 ? 705  ASP B CG  1 
ATOM   4181 O  OD1 . ASP B 1 225 ? 35.196  23.219  -9.505  1.00 32.07 ? 705  ASP B OD1 1 
ATOM   4182 O  OD2 . ASP B 1 225 ? 33.165  22.556  -10.057 1.00 31.66 ? 705  ASP B OD2 1 
ATOM   4183 N  N   . TRP B 1 226 ? 37.107  23.576  -6.824  1.00 28.98 ? 706  TRP B N   1 
ATOM   4184 C  CA  . TRP B 1 226 ? 37.806  24.850  -6.605  1.00 28.56 ? 706  TRP B CA  1 
ATOM   4185 C  C   . TRP B 1 226 ? 38.220  25.586  -7.900  1.00 28.39 ? 706  TRP B C   1 
ATOM   4186 O  O   . TRP B 1 226 ? 38.925  26.598  -7.859  1.00 28.41 ? 706  TRP B O   1 
ATOM   4187 C  CB  . TRP B 1 226 ? 38.988  24.671  -5.636  1.00 28.47 ? 706  TRP B CB  1 
ATOM   4188 C  CG  . TRP B 1 226 ? 40.186  23.884  -6.123  1.00 28.21 ? 706  TRP B CG  1 
ATOM   4189 C  CD1 . TRP B 1 226 ? 40.806  23.989  -7.329  1.00 27.92 ? 706  TRP B CD1 1 
ATOM   4190 C  CD2 . TRP B 1 226 ? 40.950  22.936  -5.364  1.00 28.00 ? 706  TRP B CD2 1 
ATOM   4191 N  NE1 . TRP B 1 226 ? 41.886  23.142  -7.386  1.00 28.31 ? 706  TRP B NE1 1 
ATOM   4192 C  CE2 . TRP B 1 226 ? 42.002  22.488  -6.191  1.00 28.24 ? 706  TRP B CE2 1 
ATOM   4193 C  CE3 . TRP B 1 226 ? 40.835  22.409  -4.073  1.00 28.04 ? 706  TRP B CE3 1 
ATOM   4194 C  CZ2 . TRP B 1 226 ? 42.941  21.537  -5.769  1.00 28.40 ? 706  TRP B CZ2 1 
ATOM   4195 C  CZ3 . TRP B 1 226 ? 41.770  21.466  -3.650  1.00 27.98 ? 706  TRP B CZ3 1 
ATOM   4196 C  CH2 . TRP B 1 226 ? 42.805  21.038  -4.500  1.00 28.40 ? 706  TRP B CH2 1 
ATOM   4197 N  N   . ASP B 1 227 ? 37.765  25.087  -9.043  1.00 28.17 ? 707  ASP B N   1 
ATOM   4198 C  CA  . ASP B 1 227 ? 37.826  25.841  -10.293 1.00 27.87 ? 707  ASP B CA  1 
ATOM   4199 C  C   . ASP B 1 227 ? 37.059  27.160  -10.111 1.00 27.62 ? 707  ASP B C   1 
ATOM   4200 O  O   . ASP B 1 227 ? 36.052  27.195  -9.406  1.00 27.27 ? 707  ASP B O   1 
ATOM   4201 C  CB  . ASP B 1 227 ? 37.214  25.012  -11.424 1.00 27.71 ? 707  ASP B CB  1 
ATOM   4202 C  CG  . ASP B 1 227 ? 37.398  25.647  -12.778 1.00 27.54 ? 707  ASP B CG  1 
ATOM   4203 O  OD1 . ASP B 1 227 ? 36.698  26.642  -13.085 1.00 27.76 ? 707  ASP B OD1 1 
ATOM   4204 O  OD2 . ASP B 1 227 ? 38.242  25.148  -13.544 1.00 26.25 ? 707  ASP B OD2 1 
ATOM   4205 N  N   . VAL B 1 228 ? 37.526  28.236  -10.740 1.00 27.58 ? 708  VAL B N   1 
ATOM   4206 C  CA  . VAL B 1 228 ? 36.934  29.564  -10.519 1.00 27.48 ? 708  VAL B CA  1 
ATOM   4207 C  C   . VAL B 1 228 ? 35.475  29.667  -10.990 1.00 27.51 ? 708  VAL B C   1 
ATOM   4208 O  O   . VAL B 1 228 ? 34.719  30.500  -10.486 1.00 27.45 ? 708  VAL B O   1 
ATOM   4209 C  CB  . VAL B 1 228 ? 37.768  30.686  -11.178 1.00 27.48 ? 708  VAL B CB  1 
ATOM   4210 C  CG1 . VAL B 1 228 ? 37.510  30.750  -12.691 1.00 26.78 ? 708  VAL B CG1 1 
ATOM   4211 C  CG2 . VAL B 1 228 ? 37.463  32.021  -10.519 1.00 27.22 ? 708  VAL B CG2 1 
ATOM   4212 N  N   . HIS B 1 229 ? 35.097  28.823  -11.951 1.00 27.57 ? 709  HIS B N   1 
ATOM   4213 C  CA  . HIS B 1 229 ? 33.732  28.771  -12.477 1.00 27.54 ? 709  HIS B CA  1 
ATOM   4214 C  C   . HIS B 1 229 ? 32.894  27.753  -11.710 1.00 27.33 ? 709  HIS B C   1 
ATOM   4215 O  O   . HIS B 1 229 ? 33.420  26.761  -11.210 1.00 27.54 ? 709  HIS B O   1 
ATOM   4216 C  CB  . HIS B 1 229 ? 33.751  28.388  -13.957 1.00 27.52 ? 709  HIS B CB  1 
ATOM   4217 C  CG  . HIS B 1 229 ? 34.611  29.277  -14.802 1.00 27.62 ? 709  HIS B CG  1 
ATOM   4218 N  ND1 . HIS B 1 229 ? 35.926  28.984  -15.092 1.00 27.80 ? 709  HIS B ND1 1 
ATOM   4219 C  CD2 . HIS B 1 229 ? 34.341  30.448  -15.423 1.00 27.88 ? 709  HIS B CD2 1 
ATOM   4220 C  CE1 . HIS B 1 229 ? 36.431  29.941  -15.850 1.00 27.46 ? 709  HIS B CE1 1 
ATOM   4221 N  NE2 . HIS B 1 229 ? 35.491  30.842  -16.063 1.00 28.10 ? 709  HIS B NE2 1 
ATOM   4222 N  N   . HIS B 1 230 ? 31.591  27.994  -11.616 1.00 27.02 ? 710  HIS B N   1 
ATOM   4223 C  CA  . HIS B 1 230 ? 30.673  27.043  -10.985 1.00 26.63 ? 710  HIS B CA  1 
ATOM   4224 C  C   . HIS B 1 230 ? 30.478  25.798  -11.853 1.00 26.40 ? 710  HIS B C   1 
ATOM   4225 O  O   . HIS B 1 230 ? 30.237  25.905  -13.050 1.00 26.12 ? 710  HIS B O   1 
ATOM   4226 C  CB  . HIS B 1 230 ? 29.322  27.706  -10.719 1.00 26.61 ? 710  HIS B CB  1 
ATOM   4227 C  CG  . HIS B 1 230 ? 28.320  26.796  -10.079 1.00 26.18 ? 710  HIS B CG  1 
ATOM   4228 N  ND1 . HIS B 1 230 ? 27.138  26.443  -10.695 1.00 26.09 ? 710  HIS B ND1 1 
ATOM   4229 C  CD2 . HIS B 1 230 ? 28.327  26.162  -8.884  1.00 25.75 ? 710  HIS B CD2 1 
ATOM   4230 C  CE1 . HIS B 1 230 ? 26.455  25.637  -9.901  1.00 26.39 ? 710  HIS B CE1 1 
ATOM   4231 N  NE2 . HIS B 1 230 ? 27.155  25.449  -8.796  1.00 26.24 ? 710  HIS B NE2 1 
ATOM   4232 N  N   . GLY B 1 231 ? 30.573  24.622  -11.241 1.00 26.30 ? 711  GLY B N   1 
ATOM   4233 C  CA  . GLY B 1 231 ? 30.339  23.364  -11.950 1.00 26.20 ? 711  GLY B CA  1 
ATOM   4234 C  C   . GLY B 1 231 ? 28.858  23.043  -12.033 1.00 26.10 ? 711  GLY B C   1 
ATOM   4235 O  O   . GLY B 1 231 ? 28.368  22.180  -11.311 1.00 26.40 ? 711  GLY B O   1 
ATOM   4236 N  N   . ASN B 1 232 ? 28.150  23.747  -12.913 1.00 25.84 ? 712  ASN B N   1 
ATOM   4237 C  CA  . ASN B 1 232 ? 26.714  23.552  -13.120 1.00 25.74 ? 712  ASN B CA  1 
ATOM   4238 C  C   . ASN B 1 232 ? 26.312  22.112  -13.442 1.00 25.90 ? 712  ASN B C   1 
ATOM   4239 O  O   . ASN B 1 232 ? 25.228  21.673  -13.071 1.00 25.94 ? 712  ASN B O   1 
ATOM   4240 C  CB  . ASN B 1 232 ? 26.207  24.463  -14.242 1.00 25.54 ? 712  ASN B CB  1 
ATOM   4241 C  CG  . ASN B 1 232 ? 26.954  24.252  -15.555 1.00 25.76 ? 712  ASN B CG  1 
ATOM   4242 O  OD1 . ASN B 1 232 ? 28.142  24.562  -15.658 1.00 24.59 ? 712  ASN B OD1 1 
ATOM   4243 N  ND2 . ASN B 1 232 ? 26.257  23.728  -16.563 1.00 24.43 ? 712  ASN B ND2 1 
ATOM   4244 N  N   . GLY B 1 233 ? 27.169  21.394  -14.162 1.00 25.94 ? 713  GLY B N   1 
ATOM   4245 C  CA  . GLY B 1 233 ? 26.896  20.006  -14.494 1.00 25.83 ? 713  GLY B CA  1 
ATOM   4246 C  C   . GLY B 1 233 ? 26.881  19.151  -13.243 1.00 25.76 ? 713  GLY B C   1 
ATOM   4247 O  O   . GLY B 1 233 ? 25.936  18.397  -13.014 1.00 25.38 ? 713  GLY B O   1 
ATOM   4248 N  N   . THR B 1 234 ? 27.932  19.288  -12.433 1.00 25.72 ? 714  THR B N   1 
ATOM   4249 C  CA  . THR B 1 234 ? 28.073  18.525  -11.199 1.00 25.73 ? 714  THR B CA  1 
ATOM   4250 C  C   . THR B 1 234 ? 26.932  18.829  -10.235 1.00 25.87 ? 714  THR B C   1 
ATOM   4251 O  O   . THR B 1 234 ? 26.299  17.906  -9.731  1.00 26.02 ? 714  THR B O   1 
ATOM   4252 C  CB  . THR B 1 234 ? 29.430  18.798  -10.503 1.00 25.90 ? 714  THR B CB  1 
ATOM   4253 O  OG1 . THR B 1 234 ? 30.488  18.726  -11.466 1.00 25.19 ? 714  THR B OG1 1 
ATOM   4254 C  CG2 . THR B 1 234 ? 29.688  17.783  -9.382  1.00 25.49 ? 714  THR B CG2 1 
ATOM   4255 N  N   . GLN B 1 235 ? 26.655  20.113  -10.002 1.00 26.07 ? 715  GLN B N   1 
ATOM   4256 C  CA  . GLN B 1 235 ? 25.536  20.513  -9.139  1.00 26.35 ? 715  GLN B CA  1 
ATOM   4257 C  C   . GLN B 1 235 ? 24.217  19.889  -9.593  1.00 26.44 ? 715  GLN B C   1 
ATOM   4258 O  O   . GLN B 1 235 ? 23.450  19.391  -8.773  1.00 26.70 ? 715  GLN B O   1 
ATOM   4259 C  CB  . GLN B 1 235 ? 25.381  22.046  -9.071  1.00 26.30 ? 715  GLN B CB  1 
ATOM   4260 C  CG  . GLN B 1 235 ? 24.055  22.498  -8.416  1.00 27.10 ? 715  GLN B CG  1 
ATOM   4261 C  CD  . GLN B 1 235 ? 24.010  23.978  -8.054  1.00 28.00 ? 715  GLN B CD  1 
ATOM   4262 O  OE1 . GLN B 1 235 ? 24.938  24.513  -7.448  1.00 29.61 ? 715  GLN B OE1 1 
ATOM   4263 N  NE2 . GLN B 1 235 ? 22.916  24.639  -8.410  1.00 27.03 ? 715  GLN B NE2 1 
ATOM   4264 N  N   . GLN B 1 236 ? 23.955  19.928  -10.893 1.00 26.52 ? 716  GLN B N   1 
ATOM   4265 C  CA  . GLN B 1 236 ? 22.699  19.429  -11.429 1.00 26.91 ? 716  GLN B CA  1 
ATOM   4266 C  C   . GLN B 1 236 ? 22.552  17.924  -11.205 1.00 26.71 ? 716  GLN B C   1 
ATOM   4267 O  O   . GLN B 1 236 ? 21.490  17.461  -10.811 1.00 26.51 ? 716  GLN B O   1 
ATOM   4268 C  CB  . GLN B 1 236 ? 22.584  19.737  -12.926 1.00 26.93 ? 716  GLN B CB  1 
ATOM   4269 C  CG  . GLN B 1 236 ? 21.216  19.412  -13.523 1.00 28.11 ? 716  GLN B CG  1 
ATOM   4270 C  CD  . GLN B 1 236 ? 21.276  19.028  -15.001 1.00 30.53 ? 716  GLN B CD  1 
ATOM   4271 O  OE1 . GLN B 1 236 ? 22.070  18.167  -15.406 1.00 32.22 ? 716  GLN B OE1 1 
ATOM   4272 N  NE2 . GLN B 1 236 ? 20.417  19.648  -15.809 1.00 30.70 ? 716  GLN B NE2 1 
ATOM   4273 N  N   . THR B 1 237 ? 23.616  17.174  -11.474 1.00 26.76 ? 717  THR B N   1 
ATOM   4274 C  CA  . THR B 1 237 ? 23.574  15.715  -11.391 1.00 26.76 ? 717  THR B CA  1 
ATOM   4275 C  C   . THR B 1 237 ? 23.225  15.248  -9.982  1.00 26.82 ? 717  THR B C   1 
ATOM   4276 O  O   . THR B 1 237 ? 22.422  14.339  -9.810  1.00 26.63 ? 717  THR B O   1 
ATOM   4277 C  CB  . THR B 1 237 ? 24.921  15.098  -11.804 1.00 26.90 ? 717  THR B CB  1 
ATOM   4278 O  OG1 . THR B 1 237 ? 25.274  15.560  -13.111 1.00 26.48 ? 717  THR B OG1 1 
ATOM   4279 C  CG2 . THR B 1 237 ? 24.846  13.571  -11.806 1.00 26.66 ? 717  THR B CG2 1 
ATOM   4280 N  N   . PHE B 1 238 ? 23.806  15.893  -8.975  1.00 26.73 ? 718  PHE B N   1 
ATOM   4281 C  CA  . PHE B 1 238 ? 23.644  15.431  -7.600  1.00 26.87 ? 718  PHE B CA  1 
ATOM   4282 C  C   . PHE B 1 238 ? 22.704  16.289  -6.751  1.00 26.79 ? 718  PHE B C   1 
ATOM   4283 O  O   . PHE B 1 238 ? 22.643  16.116  -5.538  1.00 26.21 ? 718  PHE B O   1 
ATOM   4284 C  CB  . PHE B 1 238 ? 25.019  15.296  -6.942  1.00 26.65 ? 718  PHE B CB  1 
ATOM   4285 C  CG  . PHE B 1 238 ? 25.931  14.376  -7.675  1.00 27.07 ? 718  PHE B CG  1 
ATOM   4286 C  CD1 . PHE B 1 238 ? 25.697  13.010  -7.665  1.00 27.11 ? 718  PHE B CD1 1 
ATOM   4287 C  CD2 . PHE B 1 238 ? 27.008  14.867  -8.392  1.00 27.24 ? 718  PHE B CD2 1 
ATOM   4288 C  CE1 . PHE B 1 238 ? 26.531  12.150  -8.344  1.00 27.73 ? 718  PHE B CE1 1 
ATOM   4289 C  CE2 . PHE B 1 238 ? 27.843  14.014  -9.080  1.00 27.63 ? 718  PHE B CE2 1 
ATOM   4290 C  CZ  . PHE B 1 238 ? 27.606  12.650  -9.059  1.00 27.78 ? 718  PHE B CZ  1 
ATOM   4291 N  N   . TYR B 1 239 ? 21.932  17.165  -7.390  1.00 26.94 ? 719  TYR B N   1 
ATOM   4292 C  CA  . TYR B 1 239 ? 21.097  18.130  -6.668  1.00 27.09 ? 719  TYR B CA  1 
ATOM   4293 C  C   . TYR B 1 239 ? 20.094  17.510  -5.681  1.00 27.19 ? 719  TYR B C   1 
ATOM   4294 O  O   . TYR B 1 239 ? 19.785  18.124  -4.657  1.00 27.13 ? 719  TYR B O   1 
ATOM   4295 C  CB  . TYR B 1 239 ? 20.347  19.035  -7.659  1.00 27.09 ? 719  TYR B CB  1 
ATOM   4296 C  CG  . TYR B 1 239 ? 20.002  20.391  -7.091  1.00 26.82 ? 719  TYR B CG  1 
ATOM   4297 C  CD1 . TYR B 1 239 ? 21.007  21.281  -6.717  1.00 26.61 ? 719  TYR B CD1 1 
ATOM   4298 C  CD2 . TYR B 1 239 ? 18.680  20.788  -6.931  1.00 26.28 ? 719  TYR B CD2 1 
ATOM   4299 C  CE1 . TYR B 1 239 ? 20.706  22.524  -6.194  1.00 26.65 ? 719  TYR B CE1 1 
ATOM   4300 C  CE2 . TYR B 1 239 ? 18.368  22.032  -6.410  1.00 26.63 ? 719  TYR B CE2 1 
ATOM   4301 C  CZ  . TYR B 1 239 ? 19.387  22.897  -6.044  1.00 26.55 ? 719  TYR B CZ  1 
ATOM   4302 O  OH  . TYR B 1 239 ? 19.087  24.131  -5.520  1.00 26.27 ? 719  TYR B OH  1 
ATOM   4303 N  N   . GLN B 1 240 ? 19.582  16.316  -5.984  1.00 27.39 ? 720  GLN B N   1 
ATOM   4304 C  CA  . GLN B 1 240 ? 18.603  15.651  -5.105  1.00 27.65 ? 720  GLN B CA  1 
ATOM   4305 C  C   . GLN B 1 240 ? 19.128  14.318  -4.563  1.00 27.50 ? 720  GLN B C   1 
ATOM   4306 O  O   . GLN B 1 240 ? 18.358  13.397  -4.286  1.00 27.30 ? 720  GLN B O   1 
ATOM   4307 C  CB  . GLN B 1 240 ? 17.269  15.457  -5.836  1.00 27.76 ? 720  GLN B CB  1 
ATOM   4308 C  CG  . GLN B 1 240 ? 16.694  16.743  -6.436  1.00 28.60 ? 720  GLN B CG  1 
ATOM   4309 C  CD  . GLN B 1 240 ? 15.169  16.770  -6.447  1.00 29.74 ? 720  GLN B CD  1 
ATOM   4310 O  OE1 . GLN B 1 240 ? 14.524  16.622  -5.407  1.00 30.57 ? 720  GLN B OE1 1 
ATOM   4311 N  NE2 . GLN B 1 240 ? 14.587  16.971  -7.623  1.00 30.38 ? 720  GLN B NE2 1 
ATOM   4312 N  N   . ASP B 1 241 ? 20.445  14.248  -4.390  1.00 27.46 ? 721  ASP B N   1 
ATOM   4313 C  CA  . ASP B 1 241 ? 21.145  13.024  -4.003  1.00 27.55 ? 721  ASP B CA  1 
ATOM   4314 C  C   . ASP B 1 241 ? 21.900  13.260  -2.695  1.00 27.33 ? 721  ASP B C   1 
ATOM   4315 O  O   . ASP B 1 241 ? 22.958  13.888  -2.705  1.00 27.82 ? 721  ASP B O   1 
ATOM   4316 C  CB  . ASP B 1 241 ? 22.120  12.645  -5.127  1.00 27.72 ? 721  ASP B CB  1 
ATOM   4317 C  CG  . ASP B 1 241 ? 22.819  11.321  -4.895  1.00 28.12 ? 721  ASP B CG  1 
ATOM   4318 O  OD1 . ASP B 1 241 ? 22.829  10.817  -3.753  1.00 28.08 ? 721  ASP B OD1 1 
ATOM   4319 O  OD2 . ASP B 1 241 ? 23.367  10.785  -5.881  1.00 29.26 ? 721  ASP B OD2 1 
ATOM   4320 N  N   . PRO B 1 242 ? 21.374  12.761  -1.561  1.00 27.07 ? 722  PRO B N   1 
ATOM   4321 C  CA  . PRO B 1 242 ? 22.037  13.024  -0.276  1.00 26.78 ? 722  PRO B CA  1 
ATOM   4322 C  C   . PRO B 1 242 ? 23.352  12.269  -0.065  1.00 26.57 ? 722  PRO B C   1 
ATOM   4323 O  O   . PRO B 1 242 ? 24.101  12.604  0.851   1.00 26.88 ? 722  PRO B O   1 
ATOM   4324 C  CB  . PRO B 1 242 ? 21.003  12.555  0.745   1.00 26.69 ? 722  PRO B CB  1 
ATOM   4325 C  CG  . PRO B 1 242 ? 20.280  11.469  0.053   1.00 26.84 ? 722  PRO B CG  1 
ATOM   4326 C  CD  . PRO B 1 242 ? 20.210  11.872  -1.397  1.00 26.90 ? 722  PRO B CD  1 
ATOM   4327 N  N   . SER B 1 243 ? 23.621  11.258  -0.888  1.00 26.17 ? 723  SER B N   1 
ATOM   4328 C  CA  . SER B 1 243 ? 24.854  10.479  -0.779  1.00 25.90 ? 723  SER B CA  1 
ATOM   4329 C  C   . SER B 1 243 ? 26.082  11.227  -1.316  1.00 25.83 ? 723  SER B C   1 
ATOM   4330 O  O   . SER B 1 243 ? 27.219  10.829  -1.046  1.00 25.48 ? 723  SER B O   1 
ATOM   4331 C  CB  . SER B 1 243 ? 24.704  9.151   -1.525  1.00 25.80 ? 723  SER B CB  1 
ATOM   4332 O  OG  . SER B 1 243 ? 24.567  9.366   -2.920  1.00 25.67 ? 723  SER B OG  1 
ATOM   4333 N  N   . VAL B 1 244 ? 25.857  12.285  -2.093  1.00 25.68 ? 724  VAL B N   1 
ATOM   4334 C  CA  . VAL B 1 244 ? 26.953  13.095  -2.624  1.00 25.74 ? 724  VAL B CA  1 
ATOM   4335 C  C   . VAL B 1 244 ? 26.874  14.526  -2.087  1.00 25.79 ? 724  VAL B C   1 
ATOM   4336 O  O   . VAL B 1 244 ? 25.818  15.149  -2.109  1.00 25.70 ? 724  VAL B O   1 
ATOM   4337 C  CB  . VAL B 1 244 ? 26.949  13.098  -4.165  1.00 25.87 ? 724  VAL B CB  1 
ATOM   4338 C  CG1 . VAL B 1 244 ? 28.038  14.009  -4.707  1.00 25.37 ? 724  VAL B CG1 1 
ATOM   4339 C  CG2 . VAL B 1 244 ? 27.122  11.670  -4.703  1.00 25.52 ? 724  VAL B CG2 1 
ATOM   4340 N  N   . LEU B 1 245 ? 27.992  15.029  -1.584  1.00 26.28 ? 725  LEU B N   1 
ATOM   4341 C  CA  . LEU B 1 245 ? 28.098  16.408  -1.121  1.00 26.43 ? 725  LEU B CA  1 
ATOM   4342 C  C   . LEU B 1 245 ? 28.941  17.163  -2.130  1.00 26.70 ? 725  LEU B C   1 
ATOM   4343 O  O   . LEU B 1 245 ? 30.089  16.794  -2.379  1.00 26.68 ? 725  LEU B O   1 
ATOM   4344 C  CB  . LEU B 1 245 ? 28.750  16.467  0.265   1.00 26.44 ? 725  LEU B CB  1 
ATOM   4345 C  CG  . LEU B 1 245 ? 29.155  17.838  0.826   1.00 26.41 ? 725  LEU B CG  1 
ATOM   4346 C  CD1 . LEU B 1 245 ? 27.960  18.766  0.923   1.00 26.34 ? 725  LEU B CD1 1 
ATOM   4347 C  CD2 . LEU B 1 245 ? 29.820  17.676  2.189   1.00 26.34 ? 725  LEU B CD2 1 
ATOM   4348 N  N   . TYR B 1 246 ? 28.357  18.206  -2.717  1.00 27.08 ? 726  TYR B N   1 
ATOM   4349 C  CA  . TYR B 1 246 ? 29.057  19.079  -3.649  1.00 27.33 ? 726  TYR B CA  1 
ATOM   4350 C  C   . TYR B 1 246 ? 29.338  20.416  -2.968  1.00 27.48 ? 726  TYR B C   1 
ATOM   4351 O  O   . TYR B 1 246 ? 28.417  21.086  -2.501  1.00 27.18 ? 726  TYR B O   1 
ATOM   4352 C  CB  . TYR B 1 246 ? 28.223  19.293  -4.907  1.00 27.34 ? 726  TYR B CB  1 
ATOM   4353 C  CG  . TYR B 1 246 ? 28.894  20.151  -5.957  1.00 28.78 ? 726  TYR B CG  1 
ATOM   4354 C  CD1 . TYR B 1 246 ? 30.081  19.751  -6.553  1.00 29.48 ? 726  TYR B CD1 1 
ATOM   4355 C  CD2 . TYR B 1 246 ? 28.338  21.370  -6.354  1.00 29.77 ? 726  TYR B CD2 1 
ATOM   4356 C  CE1 . TYR B 1 246 ? 30.700  20.536  -7.508  1.00 30.52 ? 726  TYR B CE1 1 
ATOM   4357 C  CE2 . TYR B 1 246 ? 28.944  22.154  -7.314  1.00 29.79 ? 726  TYR B CE2 1 
ATOM   4358 C  CZ  . TYR B 1 246 ? 30.122  21.735  -7.889  1.00 30.83 ? 726  TYR B CZ  1 
ATOM   4359 O  OH  . TYR B 1 246 ? 30.726  22.515  -8.847  1.00 32.01 ? 726  TYR B OH  1 
ATOM   4360 N  N   . ILE B 1 247 ? 30.615  20.774  -2.888  1.00 27.70 ? 727  ILE B N   1 
ATOM   4361 C  CA  . ILE B 1 247 ? 31.029  22.074  -2.382  1.00 28.07 ? 727  ILE B CA  1 
ATOM   4362 C  C   . ILE B 1 247 ? 31.817  22.790  -3.478  1.00 28.67 ? 727  ILE B C   1 
ATOM   4363 O  O   . ILE B 1 247 ? 32.895  22.336  -3.886  1.00 28.60 ? 727  ILE B O   1 
ATOM   4364 C  CB  . ILE B 1 247 ? 31.897  21.969  -1.112  1.00 27.91 ? 727  ILE B CB  1 
ATOM   4365 C  CG1 . ILE B 1 247 ? 31.170  21.163  -0.027  1.00 27.42 ? 727  ILE B CG1 1 
ATOM   4366 C  CG2 . ILE B 1 247 ? 32.249  23.369  -0.611  1.00 27.77 ? 727  ILE B CG2 1 
ATOM   4367 C  CD1 . ILE B 1 247 ? 31.919  21.057  1.291   1.00 26.52 ? 727  ILE B CD1 1 
ATOM   4368 N  N   . SER B 1 248 ? 31.264  23.900  -3.961  1.00 29.09 ? 728  SER B N   1 
ATOM   4369 C  CA  . SER B 1 248 ? 31.910  24.688  -4.992  1.00 29.50 ? 728  SER B CA  1 
ATOM   4370 C  C   . SER B 1 248 ? 32.292  26.067  -4.461  1.00 29.31 ? 728  SER B C   1 
ATOM   4371 O  O   . SER B 1 248 ? 31.461  26.756  -3.878  1.00 29.29 ? 728  SER B O   1 
ATOM   4372 C  CB  . SER B 1 248 ? 30.979  24.846  -6.193  1.00 29.67 ? 728  SER B CB  1 
ATOM   4373 O  OG  . SER B 1 248 ? 31.583  25.663  -7.192  1.00 30.72 ? 728  SER B OG  1 
ATOM   4374 N  N   . LEU B 1 249 ? 33.557  26.441  -4.650  1.00 29.23 ? 729  LEU B N   1 
ATOM   4375 C  CA  . LEU B 1 249 ? 34.003  27.832  -4.507  1.00 29.01 ? 729  LEU B CA  1 
ATOM   4376 C  C   . LEU B 1 249 ? 34.120  28.416  -5.906  1.00 28.62 ? 729  LEU B C   1 
ATOM   4377 O  O   . LEU B 1 249 ? 34.764  27.824  -6.762  1.00 28.77 ? 729  LEU B O   1 
ATOM   4378 C  CB  . LEU B 1 249 ? 35.348  27.915  -3.779  1.00 29.08 ? 729  LEU B CB  1 
ATOM   4379 C  CG  . LEU B 1 249 ? 35.395  27.232  -2.404  1.00 29.42 ? 729  LEU B CG  1 
ATOM   4380 C  CD1 . LEU B 1 249 ? 35.817  25.780  -2.547  1.00 29.84 ? 729  LEU B CD1 1 
ATOM   4381 C  CD2 . LEU B 1 249 ? 36.338  27.946  -1.459  1.00 30.07 ? 729  LEU B CD2 1 
ATOM   4382 N  N   . HIS B 1 250 ? 33.468  29.545  -6.162  1.00 28.27 ? 730  HIS B N   1 
ATOM   4383 C  CA  . HIS B 1 250 ? 33.478  30.136  -7.502  1.00 28.06 ? 730  HIS B CA  1 
ATOM   4384 C  C   . HIS B 1 250 ? 33.068  31.592  -7.487  1.00 27.99 ? 730  HIS B C   1 
ATOM   4385 O  O   . HIS B 1 250 ? 32.240  32.002  -6.672  1.00 27.94 ? 730  HIS B O   1 
ATOM   4386 C  CB  . HIS B 1 250 ? 32.525  29.390  -8.442  1.00 27.86 ? 730  HIS B CB  1 
ATOM   4387 C  CG  . HIS B 1 250 ? 31.107  29.358  -7.970  1.00 27.73 ? 730  HIS B CG  1 
ATOM   4388 N  ND1 . HIS B 1 250 ? 30.186  30.318  -8.323  1.00 27.58 ? 730  HIS B ND1 1 
ATOM   4389 C  CD2 . HIS B 1 250 ? 30.454  28.488  -7.165  1.00 27.80 ? 730  HIS B CD2 1 
ATOM   4390 C  CE1 . HIS B 1 250 ? 29.025  30.038  -7.760  1.00 27.34 ? 730  HIS B CE1 1 
ATOM   4391 N  NE2 . HIS B 1 250 ? 29.160  28.932  -7.052  1.00 27.73 ? 730  HIS B NE2 1 
ATOM   4392 N  N   . ARG B 1 251 ? 33.636  32.355  -8.416  1.00 27.99 ? 731  ARG B N   1 
ATOM   4393 C  CA  . ARG B 1 251 ? 33.231  33.738  -8.640  1.00 28.11 ? 731  ARG B CA  1 
ATOM   4394 C  C   . ARG B 1 251 ? 31.796  33.736  -9.152  1.00 28.21 ? 731  ARG B C   1 
ATOM   4395 O  O   . ARG B 1 251 ? 31.502  33.106  -10.164 1.00 28.15 ? 731  ARG B O   1 
ATOM   4396 C  CB  . ARG B 1 251 ? 34.156  34.393  -9.664  1.00 27.96 ? 731  ARG B CB  1 
ATOM   4397 C  CG  . ARG B 1 251 ? 33.798  35.811  -10.033 1.00 27.94 ? 731  ARG B CG  1 
ATOM   4398 C  CD  . ARG B 1 251 ? 34.854  36.382  -10.958 1.00 28.27 ? 731  ARG B CD  1 
ATOM   4399 N  NE  . ARG B 1 251 ? 34.477  37.681  -11.509 1.00 27.87 ? 731  ARG B NE  1 
ATOM   4400 C  CZ  . ARG B 1 251 ? 35.120  38.297  -12.498 1.00 27.85 ? 731  ARG B CZ  1 
ATOM   4401 N  NH1 . ARG B 1 251 ? 36.195  37.750  -13.059 1.00 27.86 ? 731  ARG B NH1 1 
ATOM   4402 N  NH2 . ARG B 1 251 ? 34.689  39.477  -12.924 1.00 28.49 ? 731  ARG B NH2 1 
ATOM   4403 N  N   . HIS B 1 252 ? 30.908  34.420  -8.437  1.00 28.50 ? 732  HIS B N   1 
ATOM   4404 C  CA  . HIS B 1 252 ? 29.497  34.469  -8.803  1.00 28.80 ? 732  HIS B CA  1 
ATOM   4405 C  C   . HIS B 1 252 ? 29.082  35.862  -9.266  1.00 29.18 ? 732  HIS B C   1 
ATOM   4406 O  O   . HIS B 1 252 ? 28.478  36.007  -10.325 1.00 29.21 ? 732  HIS B O   1 
ATOM   4407 C  CB  . HIS B 1 252 ? 28.624  34.021  -7.633  1.00 28.76 ? 732  HIS B CB  1 
ATOM   4408 C  CG  . HIS B 1 252 ? 27.242  33.621  -8.043  1.00 28.69 ? 732  HIS B CG  1 
ATOM   4409 N  ND1 . HIS B 1 252 ? 26.127  34.370  -7.734  1.00 28.18 ? 732  HIS B ND1 1 
ATOM   4410 C  CD2 . HIS B 1 252 ? 26.799  32.565  -8.765  1.00 27.84 ? 732  HIS B CD2 1 
ATOM   4411 C  CE1 . HIS B 1 252 ? 25.054  33.782  -8.235  1.00 28.39 ? 732  HIS B CE1 1 
ATOM   4412 N  NE2 . HIS B 1 252 ? 25.435  32.686  -8.865  1.00 28.50 ? 732  HIS B NE2 1 
ATOM   4413 N  N   . ASP B 1 253 ? 29.403  36.877  -8.466  1.00 29.74 ? 733  ASP B N   1 
ATOM   4414 C  CA  . ASP B 1 253 ? 29.128  38.280  -8.814  1.00 30.30 ? 733  ASP B CA  1 
ATOM   4415 C  C   . ASP B 1 253 ? 27.696  38.525  -9.288  1.00 30.46 ? 733  ASP B C   1 
ATOM   4416 O  O   . ASP B 1 253 ? 27.477  39.181  -10.309 1.00 30.60 ? 733  ASP B O   1 
ATOM   4417 C  CB  . ASP B 1 253 ? 30.113  38.768  -9.882  1.00 30.36 ? 733  ASP B CB  1 
ATOM   4418 C  CG  . ASP B 1 253 ? 31.550  38.754  -9.404  1.00 31.16 ? 733  ASP B CG  1 
ATOM   4419 O  OD1 . ASP B 1 253 ? 31.784  38.648  -8.176  1.00 31.80 ? 733  ASP B OD1 1 
ATOM   4420 O  OD2 . ASP B 1 253 ? 32.451  38.863  -10.267 1.00 31.99 ? 733  ASP B OD2 1 
ATOM   4421 N  N   . ASP B 1 254 ? 26.731  37.983  -8.548  1.00 30.73 ? 734  ASP B N   1 
ATOM   4422 C  CA  . ASP B 1 254 ? 25.310  38.230  -8.801  1.00 31.01 ? 734  ASP B CA  1 
ATOM   4423 C  C   . ASP B 1 254 ? 24.872  37.814  -10.214 1.00 30.99 ? 734  ASP B C   1 
ATOM   4424 O  O   . ASP B 1 254 ? 24.191  38.572  -10.919 1.00 31.12 ? 734  ASP B O   1 
ATOM   4425 C  CB  . ASP B 1 254 ? 24.986  39.713  -8.550  1.00 31.19 ? 734  ASP B CB  1 
ATOM   4426 C  CG  . ASP B 1 254 ? 23.526  39.947  -8.191  1.00 31.91 ? 734  ASP B CG  1 
ATOM   4427 O  OD1 . ASP B 1 254 ? 22.972  39.145  -7.407  1.00 33.37 ? 734  ASP B OD1 1 
ATOM   4428 O  OD2 . ASP B 1 254 ? 22.939  40.943  -8.675  1.00 32.41 ? 734  ASP B OD2 1 
ATOM   4429 N  N   . GLY B 1 255 ? 25.280  36.615  -10.622 1.00 30.73 ? 735  GLY B N   1 
ATOM   4430 C  CA  . GLY B 1 255 ? 24.811  36.012  -11.863 1.00 30.66 ? 735  GLY B CA  1 
ATOM   4431 C  C   . GLY B 1 255 ? 25.587  36.373  -13.117 1.00 30.73 ? 735  GLY B C   1 
ATOM   4432 O  O   . GLY B 1 255 ? 25.257  35.887  -14.197 1.00 30.94 ? 735  GLY B O   1 
ATOM   4433 N  N   . ASN B 1 256 ? 26.631  37.192  -12.986 1.00 30.62 ? 736  ASN B N   1 
ATOM   4434 C  CA  . ASN B 1 256 ? 27.309  37.782  -14.154 1.00 30.52 ? 736  ASN B CA  1 
ATOM   4435 C  C   . ASN B 1 256 ? 28.690  37.209  -14.475 1.00 30.02 ? 736  ASN B C   1 
ATOM   4436 O  O   . ASN B 1 256 ? 29.548  37.901  -15.026 1.00 30.41 ? 736  ASN B O   1 
ATOM   4437 C  CB  . ASN B 1 256 ? 27.414  39.298  -13.966 1.00 30.54 ? 736  ASN B CB  1 
ATOM   4438 C  CG  . ASN B 1 256 ? 26.066  39.965  -13.960 1.00 31.35 ? 736  ASN B CG  1 
ATOM   4439 O  OD1 . ASN B 1 256 ? 25.629  40.496  -12.938 1.00 33.29 ? 736  ASN B OD1 1 
ATOM   4440 N  ND2 . ASN B 1 256 ? 25.381  39.928  -15.100 1.00 31.72 ? 736  ASN B ND2 1 
ATOM   4441 N  N   . PHE B 1 257 ? 28.902  35.948  -14.136 1.00 29.37 ? 737  PHE B N   1 
ATOM   4442 C  CA  . PHE B 1 257 ? 30.133  35.256  -14.495 1.00 28.98 ? 737  PHE B CA  1 
ATOM   4443 C  C   . PHE B 1 257 ? 29.765  33.851  -14.952 1.00 28.51 ? 737  PHE B C   1 
ATOM   4444 O  O   . PHE B 1 257 ? 28.867  33.239  -14.382 1.00 28.60 ? 737  PHE B O   1 
ATOM   4445 C  CB  . PHE B 1 257 ? 31.080  35.220  -13.298 1.00 28.96 ? 737  PHE B CB  1 
ATOM   4446 C  CG  . PHE B 1 257 ? 32.493  34.857  -13.652 1.00 28.64 ? 737  PHE B CG  1 
ATOM   4447 C  CD1 . PHE B 1 257 ? 33.284  35.734  -14.387 1.00 27.74 ? 737  PHE B CD1 1 
ATOM   4448 C  CD2 . PHE B 1 257 ? 33.040  33.647  -13.240 1.00 27.55 ? 737  PHE B CD2 1 
ATOM   4449 C  CE1 . PHE B 1 257 ? 34.593  35.408  -14.716 1.00 27.41 ? 737  PHE B CE1 1 
ATOM   4450 C  CE2 . PHE B 1 257 ? 34.345  33.319  -13.562 1.00 27.63 ? 737  PHE B CE2 1 
ATOM   4451 C  CZ  . PHE B 1 257 ? 35.125  34.202  -14.301 1.00 27.45 ? 737  PHE B CZ  1 
ATOM   4452 N  N   . PHE B 1 258 ? 30.433  33.350  -15.988 1.00 28.15 ? 738  PHE B N   1 
ATOM   4453 C  CA  . PHE B 1 258 ? 30.082  32.049  -16.561 1.00 27.73 ? 738  PHE B CA  1 
ATOM   4454 C  C   . PHE B 1 258 ? 30.144  30.944  -15.499 1.00 27.63 ? 738  PHE B C   1 
ATOM   4455 O  O   . PHE B 1 258 ? 31.086  30.902  -14.702 1.00 27.32 ? 738  PHE B O   1 
ATOM   4456 C  CB  . PHE B 1 258 ? 30.991  31.690  -17.744 1.00 27.60 ? 738  PHE B CB  1 
ATOM   4457 C  CG  . PHE B 1 258 ? 30.548  30.453  -18.489 1.00 27.70 ? 738  PHE B CG  1 
ATOM   4458 C  CD1 . PHE B 1 258 ? 30.967  29.188  -18.083 1.00 26.88 ? 738  PHE B CD1 1 
ATOM   4459 C  CD2 . PHE B 1 258 ? 29.687  30.553  -19.581 1.00 27.38 ? 738  PHE B CD2 1 
ATOM   4460 C  CE1 . PHE B 1 258 ? 30.544  28.045  -18.760 1.00 27.58 ? 738  PHE B CE1 1 
ATOM   4461 C  CE2 . PHE B 1 258 ? 29.257  29.417  -20.261 1.00 27.15 ? 738  PHE B CE2 1 
ATOM   4462 C  CZ  . PHE B 1 258 ? 29.689  28.162  -19.854 1.00 27.49 ? 738  PHE B CZ  1 
ATOM   4463 N  N   . PRO B 1 259 ? 29.143  30.041  -15.480 1.00 27.61 ? 739  PRO B N   1 
ATOM   4464 C  CA  . PRO B 1 259 ? 27.951  29.924  -16.324 1.00 27.61 ? 739  PRO B CA  1 
ATOM   4465 C  C   . PRO B 1 259 ? 26.714  30.671  -15.807 1.00 27.47 ? 739  PRO B C   1 
ATOM   4466 O  O   . PRO B 1 259 ? 25.649  30.557  -16.408 1.00 27.32 ? 739  PRO B O   1 
ATOM   4467 C  CB  . PRO B 1 259 ? 27.683  28.420  -16.308 1.00 27.53 ? 739  PRO B CB  1 
ATOM   4468 C  CG  . PRO B 1 259 ? 28.089  28.005  -14.955 1.00 27.93 ? 739  PRO B CG  1 
ATOM   4469 C  CD  . PRO B 1 259 ? 29.210  28.930  -14.515 1.00 27.74 ? 739  PRO B CD  1 
ATOM   4470 N  N   . GLY B 1 260 ? 26.848  31.410  -14.707 1.00 27.43 ? 740  GLY B N   1 
ATOM   4471 C  CA  . GLY B 1 260 ? 25.740  32.198  -14.167 1.00 27.79 ? 740  GLY B CA  1 
ATOM   4472 C  C   . GLY B 1 260 ? 24.886  31.480  -13.141 1.00 27.98 ? 740  GLY B C   1 
ATOM   4473 O  O   . GLY B 1 260 ? 23.937  32.052  -12.610 1.00 28.25 ? 740  GLY B O   1 
ATOM   4474 N  N   . SER B 1 261 ? 25.235  30.232  -12.852 1.00 28.32 ? 741  SER B N   1 
ATOM   4475 C  CA  . SER B 1 261 ? 24.521  29.408  -11.883 1.00 28.44 ? 741  SER B CA  1 
ATOM   4476 C  C   . SER B 1 261 ? 25.279  29.359  -10.558 1.00 28.62 ? 741  SER B C   1 
ATOM   4477 O  O   . SER B 1 261 ? 26.387  29.876  -10.449 1.00 28.80 ? 741  SER B O   1 
ATOM   4478 C  CB  . SER B 1 261 ? 24.397  27.991  -12.436 1.00 28.58 ? 741  SER B CB  1 
ATOM   4479 O  OG  . SER B 1 261 ? 25.676  27.492  -12.785 1.00 27.96 ? 741  SER B OG  1 
ATOM   4480 N  N   . GLY B 1 262 ? 24.684  28.720  -9.556  1.00 28.67 ? 742  GLY B N   1 
ATOM   4481 C  CA  . GLY B 1 262 ? 25.380  28.452  -8.298  1.00 28.65 ? 742  GLY B CA  1 
ATOM   4482 C  C   . GLY B 1 262 ? 25.278  29.556  -7.261  1.00 28.54 ? 742  GLY B C   1 
ATOM   4483 O  O   . GLY B 1 262 ? 26.253  29.852  -6.569  1.00 28.31 ? 742  GLY B O   1 
ATOM   4484 N  N   . ALA B 1 263 ? 24.098  30.158  -7.142  1.00 28.52 ? 743  ALA B N   1 
ATOM   4485 C  CA  . ALA B 1 263 ? 23.827  31.118  -6.069  1.00 28.76 ? 743  ALA B CA  1 
ATOM   4486 C  C   . ALA B 1 263 ? 23.911  30.427  -4.709  1.00 28.89 ? 743  ALA B C   1 
ATOM   4487 O  O   . ALA B 1 263 ? 23.692  29.214  -4.599  1.00 29.01 ? 743  ALA B O   1 
ATOM   4488 C  CB  . ALA B 1 263 ? 22.454  31.759  -6.254  1.00 28.53 ? 743  ALA B CB  1 
ATOM   4489 N  N   . VAL B 1 264 ? 24.220  31.205  -3.675  1.00 29.06 ? 744  VAL B N   1 
ATOM   4490 C  CA  . VAL B 1 264 ? 24.420  30.664  -2.325  1.00 29.00 ? 744  VAL B CA  1 
ATOM   4491 C  C   . VAL B 1 264 ? 23.170  29.962  -1.770  1.00 29.09 ? 744  VAL B C   1 
ATOM   4492 O  O   . VAL B 1 264 ? 23.286  29.053  -0.955  1.00 29.22 ? 744  VAL B O   1 
ATOM   4493 C  CB  . VAL B 1 264 ? 24.880  31.767  -1.335  1.00 29.17 ? 744  VAL B CB  1 
ATOM   4494 C  CG1 . VAL B 1 264 ? 23.811  32.837  -1.188  1.00 28.31 ? 744  VAL B CG1 1 
ATOM   4495 C  CG2 . VAL B 1 264 ? 25.233  31.163  0.019   1.00 28.98 ? 744  VAL B CG2 1 
ATOM   4496 N  N   . ASP B 1 265 ? 21.986  30.371  -2.221  1.00 29.02 ? 745  ASP B N   1 
ATOM   4497 C  CA  . ASP B 1 265 ? 20.731  29.780  -1.734  1.00 29.16 ? 745  ASP B CA  1 
ATOM   4498 C  C   . ASP B 1 265 ? 20.325  28.490  -2.464  1.00 28.81 ? 745  ASP B C   1 
ATOM   4499 O  O   . ASP B 1 265 ? 19.263  27.939  -2.184  1.00 28.90 ? 745  ASP B O   1 
ATOM   4500 C  CB  . ASP B 1 265 ? 19.585  30.802  -1.798  1.00 29.18 ? 745  ASP B CB  1 
ATOM   4501 C  CG  . ASP B 1 265 ? 19.246  31.217  -3.219  1.00 30.37 ? 745  ASP B CG  1 
ATOM   4502 O  OD1 . ASP B 1 265 ? 20.141  31.146  -4.087  1.00 32.20 ? 745  ASP B OD1 1 
ATOM   4503 O  OD2 . ASP B 1 265 ? 18.087  31.614  -3.475  1.00 32.35 ? 745  ASP B OD2 1 
ATOM   4504 N  N   . GLU B 1 266 ? 21.152  28.020  -3.397  1.00 28.51 ? 746  GLU B N   1 
ATOM   4505 C  CA  . GLU B 1 266 ? 20.932  26.718  -4.047  1.00 28.11 ? 746  GLU B CA  1 
ATOM   4506 C  C   . GLU B 1 266 ? 21.553  25.610  -3.186  1.00 27.63 ? 746  GLU B C   1 
ATOM   4507 O  O   . GLU B 1 266 ? 22.740  25.319  -3.287  1.00 26.92 ? 746  GLU B O   1 
ATOM   4508 C  CB  . GLU B 1 266 ? 21.497  26.713  -5.474  1.00 28.22 ? 746  GLU B CB  1 
ATOM   4509 C  CG  . GLU B 1 266 ? 20.723  27.620  -6.429  1.00 28.52 ? 746  GLU B CG  1 
ATOM   4510 C  CD  . GLU B 1 266 ? 21.493  27.987  -7.689  1.00 29.52 ? 746  GLU B CD  1 
ATOM   4511 O  OE1 . GLU B 1 266 ? 22.427  27.258  -8.074  1.00 30.08 ? 746  GLU B OE1 1 
ATOM   4512 O  OE2 . GLU B 1 266 ? 21.155  29.014  -8.314  1.00 30.73 ? 746  GLU B OE2 1 
ATOM   4513 N  N   . VAL B 1 267 ? 20.722  25.012  -2.331  1.00 27.60 ? 747  VAL B N   1 
ATOM   4514 C  CA  . VAL B 1 267 ? 21.166  24.056  -1.310  1.00 27.36 ? 747  VAL B CA  1 
ATOM   4515 C  C   . VAL B 1 267 ? 20.896  22.586  -1.669  1.00 27.37 ? 747  VAL B C   1 
ATOM   4516 O  O   . VAL B 1 267 ? 21.301  21.680  -0.935  1.00 27.41 ? 747  VAL B O   1 
ATOM   4517 C  CB  . VAL B 1 267 ? 20.498  24.357  0.056   1.00 27.34 ? 747  VAL B CB  1 
ATOM   4518 C  CG1 . VAL B 1 267 ? 20.962  25.704  0.589   1.00 26.92 ? 747  VAL B CG1 1 
ATOM   4519 C  CG2 . VAL B 1 267 ? 18.978  24.311  -0.057  1.00 26.57 ? 747  VAL B CG2 1 
ATOM   4520 N  N   . GLY B 1 268 ? 20.248  22.357  -2.807  1.00 27.20 ? 748  GLY B N   1 
ATOM   4521 C  CA  . GLY B 1 268 ? 19.749  21.031  -3.169  1.00 27.14 ? 748  GLY B CA  1 
ATOM   4522 C  C   . GLY B 1 268 ? 18.250  20.971  -2.945  1.00 27.02 ? 748  GLY B C   1 
ATOM   4523 O  O   . GLY B 1 268 ? 17.660  21.910  -2.405  1.00 27.04 ? 748  GLY B O   1 
ATOM   4524 N  N   . ALA B 1 269 ? 17.633  19.866  -3.354  1.00 26.98 ? 749  ALA B N   1 
ATOM   4525 C  CA  . ALA B 1 269 ? 16.177  19.714  -3.277  1.00 26.97 ? 749  ALA B CA  1 
ATOM   4526 C  C   . ALA B 1 269 ? 15.798  18.286  -2.900  1.00 26.93 ? 749  ALA B C   1 
ATOM   4527 O  O   . ALA B 1 269 ? 16.559  17.353  -3.139  1.00 27.10 ? 749  ALA B O   1 
ATOM   4528 C  CB  . ALA B 1 269 ? 15.538  20.098  -4.612  1.00 26.83 ? 749  ALA B CB  1 
ATOM   4529 N  N   . GLY B 1 270 ? 14.613  18.121  -2.321  1.00 26.95 ? 750  GLY B N   1 
ATOM   4530 C  CA  . GLY B 1 270 ? 14.158  16.813  -1.858  1.00 27.00 ? 750  GLY B CA  1 
ATOM   4531 C  C   . GLY B 1 270 ? 15.098  16.256  -0.805  1.00 27.06 ? 750  GLY B C   1 
ATOM   4532 O  O   . GLY B 1 270 ? 15.589  16.996  0.052   1.00 27.07 ? 750  GLY B O   1 
ATOM   4533 N  N   . SER B 1 271 ? 15.368  14.956  -0.883  1.00 27.02 ? 751  SER B N   1 
ATOM   4534 C  CA  . SER B 1 271 ? 16.360  14.316  -0.018  1.00 26.99 ? 751  SER B CA  1 
ATOM   4535 C  C   . SER B 1 271 ? 17.720  15.008  -0.075  1.00 26.74 ? 751  SER B C   1 
ATOM   4536 O  O   . SER B 1 271 ? 18.452  15.016  0.915   1.00 27.12 ? 751  SER B O   1 
ATOM   4537 C  CB  . SER B 1 271 ? 16.531  12.845  -0.398  1.00 27.01 ? 751  SER B CB  1 
ATOM   4538 O  OG  . SER B 1 271 ? 15.384  12.101  -0.035  1.00 27.89 ? 751  SER B OG  1 
ATOM   4539 N  N   . GLY B 1 272 ? 18.060  15.583  -1.225  1.00 26.36 ? 752  GLY B N   1 
ATOM   4540 C  CA  . GLY B 1 272 ? 19.340  16.270  -1.391  1.00 26.19 ? 752  GLY B CA  1 
ATOM   4541 C  C   . GLY B 1 272 ? 19.470  17.622  -0.701  1.00 25.91 ? 752  GLY B C   1 
ATOM   4542 O  O   . GLY B 1 272 ? 20.550  18.203  -0.691  1.00 25.84 ? 752  GLY B O   1 
ATOM   4543 N  N   . GLU B 1 273 ? 18.387  18.123  -0.112  1.00 25.77 ? 753  GLU B N   1 
ATOM   4544 C  CA  . GLU B 1 273 ? 18.389  19.448  0.494   1.00 25.74 ? 753  GLU B CA  1 
ATOM   4545 C  C   . GLU B 1 273 ? 19.420  19.558  1.620   1.00 25.74 ? 753  GLU B C   1 
ATOM   4546 O  O   . GLU B 1 273 ? 19.365  18.810  2.599   1.00 25.77 ? 753  GLU B O   1 
ATOM   4547 C  CB  . GLU B 1 273 ? 16.993  19.796  1.012   1.00 25.81 ? 753  GLU B CB  1 
ATOM   4548 C  CG  . GLU B 1 273 ? 16.822  21.260  1.367   1.00 26.12 ? 753  GLU B CG  1 
ATOM   4549 C  CD  . GLU B 1 273 ? 15.439  21.583  1.893   1.00 26.04 ? 753  GLU B CD  1 
ATOM   4550 O  OE1 . GLU B 1 273 ? 14.453  21.071  1.332   1.00 26.83 ? 753  GLU B OE1 1 
ATOM   4551 O  OE2 . GLU B 1 273 ? 15.340  22.366  2.858   1.00 26.50 ? 753  GLU B OE2 1 
ATOM   4552 N  N   . GLY B 1 274 ? 20.363  20.487  1.458   1.00 25.67 ? 754  GLY B N   1 
ATOM   4553 C  CA  . GLY B 1 274 ? 21.444  20.696  2.420   1.00 25.67 ? 754  GLY B CA  1 
ATOM   4554 C  C   . GLY B 1 274 ? 22.796  20.146  1.979   1.00 25.72 ? 754  GLY B C   1 
ATOM   4555 O  O   . GLY B 1 274 ? 23.819  20.510  2.552   1.00 25.57 ? 754  GLY B O   1 
ATOM   4556 N  N   . PHE B 1 275 ? 22.810  19.283  0.960   1.00 25.69 ? 755  PHE B N   1 
ATOM   4557 C  CA  . PHE B 1 275 ? 24.046  18.622  0.522   1.00 25.75 ? 755  PHE B CA  1 
ATOM   4558 C  C   . PHE B 1 275 ? 24.652  19.259  -0.745  1.00 25.93 ? 755  PHE B C   1 
ATOM   4559 O  O   . PHE B 1 275 ? 25.472  18.641  -1.431  1.00 25.75 ? 755  PHE B O   1 
ATOM   4560 C  CB  . PHE B 1 275 ? 23.802  17.119  0.307   1.00 25.73 ? 755  PHE B CB  1 
ATOM   4561 C  CG  . PHE B 1 275 ? 23.363  16.375  1.544   1.00 25.17 ? 755  PHE B CG  1 
ATOM   4562 C  CD1 . PHE B 1 275 ? 22.014  16.252  1.856   1.00 24.56 ? 755  PHE B CD1 1 
ATOM   4563 C  CD2 . PHE B 1 275 ? 24.297  15.777  2.380   1.00 24.50 ? 755  PHE B CD2 1 
ATOM   4564 C  CE1 . PHE B 1 275 ? 21.607  15.557  2.992   1.00 24.06 ? 755  PHE B CE1 1 
ATOM   4565 C  CE2 . PHE B 1 275 ? 23.894  15.078  3.519   1.00 23.99 ? 755  PHE B CE2 1 
ATOM   4566 C  CZ  . PHE B 1 275 ? 22.550  14.974  3.825   1.00 23.47 ? 755  PHE B CZ  1 
ATOM   4567 N  N   . ASN B 1 276 ? 24.241  20.492  -1.050  1.00 26.00 ? 756  ASN B N   1 
ATOM   4568 C  CA  . ASN B 1 276 ? 24.850  21.292  -2.107  1.00 25.90 ? 756  ASN B CA  1 
ATOM   4569 C  C   . ASN B 1 276 ? 25.260  22.648  -1.519  1.00 25.87 ? 756  ASN B C   1 
ATOM   4570 O  O   . ASN B 1 276 ? 24.401  23.414  -1.066  1.00 25.78 ? 756  ASN B O   1 
ATOM   4571 C  CB  . ASN B 1 276 ? 23.870  21.486  -3.268  1.00 25.95 ? 756  ASN B CB  1 
ATOM   4572 C  CG  . ASN B 1 276 ? 24.524  22.110  -4.489  1.00 26.51 ? 756  ASN B CG  1 
ATOM   4573 O  OD1 . ASN B 1 276 ? 25.127  21.415  -5.312  1.00 26.44 ? 756  ASN B OD1 1 
ATOM   4574 N  ND2 . ASN B 1 276 ? 24.412  23.433  -4.611  1.00 26.81 ? 756  ASN B ND2 1 
ATOM   4575 N  N   . VAL B 1 277 ? 26.566  22.926  -1.515  1.00 25.54 ? 757  VAL B N   1 
ATOM   4576 C  CA  . VAL B 1 277 ? 27.108  24.133  -0.897  1.00 25.59 ? 757  VAL B CA  1 
ATOM   4577 C  C   . VAL B 1 277 ? 27.878  24.980  -1.914  1.00 25.61 ? 757  VAL B C   1 
ATOM   4578 O  O   . VAL B 1 277 ? 28.921  24.579  -2.430  1.00 25.42 ? 757  VAL B O   1 
ATOM   4579 C  CB  . VAL B 1 277 ? 28.023  23.807  0.298   1.00 25.68 ? 757  VAL B CB  1 
ATOM   4580 C  CG1 . VAL B 1 277 ? 28.537  25.085  0.933   1.00 25.89 ? 757  VAL B CG1 1 
ATOM   4581 C  CG2 . VAL B 1 277 ? 27.280  22.972  1.330   1.00 25.85 ? 757  VAL B CG2 1 
ATOM   4582 N  N   . ASN B 1 278 ? 27.327  26.157  -2.196  1.00 25.66 ? 758  ASN B N   1 
ATOM   4583 C  CA  . ASN B 1 278 ? 27.925  27.114  -3.107  1.00 25.35 ? 758  ASN B CA  1 
ATOM   4584 C  C   . ASN B 1 278 ? 28.555  28.247  -2.309  1.00 25.14 ? 758  ASN B C   1 
ATOM   4585 O  O   . ASN B 1 278 ? 27.854  29.111  -1.795  1.00 24.61 ? 758  ASN B O   1 
ATOM   4586 C  CB  . ASN B 1 278 ? 26.859  27.688  -4.046  1.00 25.41 ? 758  ASN B CB  1 
ATOM   4587 C  CG  . ASN B 1 278 ? 26.469  26.729  -5.161  1.00 25.31 ? 758  ASN B CG  1 
ATOM   4588 O  OD1 . ASN B 1 278 ? 27.329  26.080  -5.767  1.00 25.81 ? 758  ASN B OD1 1 
ATOM   4589 N  ND2 . ASN B 1 278 ? 25.167  26.664  -5.462  1.00 23.25 ? 758  ASN B ND2 1 
ATOM   4590 N  N   . VAL B 1 279 ? 29.878  28.221  -2.188  1.00 25.15 ? 759  VAL B N   1 
ATOM   4591 C  CA  . VAL B 1 279 ? 30.617  29.369  -1.678  1.00 25.13 ? 759  VAL B CA  1 
ATOM   4592 C  C   . VAL B 1 279 ? 30.736  30.352  -2.840  1.00 25.17 ? 759  VAL B C   1 
ATOM   4593 O  O   . VAL B 1 279 ? 31.754  30.400  -3.537  1.00 25.28 ? 759  VAL B O   1 
ATOM   4594 C  CB  . VAL B 1 279 ? 32.001  28.969  -1.145  1.00 25.17 ? 759  VAL B CB  1 
ATOM   4595 C  CG1 . VAL B 1 279 ? 32.765  30.196  -0.653  1.00 24.99 ? 759  VAL B CG1 1 
ATOM   4596 C  CG2 . VAL B 1 279 ? 31.857  27.928  -0.032  1.00 25.20 ? 759  VAL B CG2 1 
ATOM   4597 N  N   . ALA B 1 280 ? 29.663  31.107  -3.052  1.00 24.97 ? 760  ALA B N   1 
ATOM   4598 C  CA  . ALA B 1 280 ? 29.534  31.999  -4.196  1.00 24.99 ? 760  ALA B CA  1 
ATOM   4599 C  C   . ALA B 1 280 ? 30.105  33.378  -3.864  1.00 25.19 ? 760  ALA B C   1 
ATOM   4600 O  O   . ALA B 1 280 ? 29.456  34.174  -3.189  1.00 25.02 ? 760  ALA B O   1 
ATOM   4601 C  CB  . ALA B 1 280 ? 28.063  32.112  -4.593  1.00 24.61 ? 760  ALA B CB  1 
ATOM   4602 N  N   . TRP B 1 281 ? 31.322  33.655  -4.330  1.00 25.70 ? 761  TRP B N   1 
ATOM   4603 C  CA  . TRP B 1 281 ? 31.961  34.952  -4.076  1.00 25.99 ? 761  TRP B CA  1 
ATOM   4604 C  C   . TRP B 1 281 ? 31.202  36.065  -4.792  1.00 26.25 ? 761  TRP B C   1 
ATOM   4605 O  O   . TRP B 1 281 ? 31.036  36.019  -6.013  1.00 26.48 ? 761  TRP B O   1 
ATOM   4606 C  CB  . TRP B 1 281 ? 33.411  34.975  -4.562  1.00 25.97 ? 761  TRP B CB  1 
ATOM   4607 C  CG  . TRP B 1 281 ? 34.310  33.905  -3.997  1.00 26.30 ? 761  TRP B CG  1 
ATOM   4608 C  CD1 . TRP B 1 281 ? 34.934  32.916  -4.697  1.00 26.11 ? 761  TRP B CD1 1 
ATOM   4609 C  CD2 . TRP B 1 281 ? 34.705  33.735  -2.630  1.00 25.84 ? 761  TRP B CD2 1 
ATOM   4610 N  NE1 . TRP B 1 281 ? 35.689  32.140  -3.858  1.00 25.82 ? 761  TRP B NE1 1 
ATOM   4611 C  CE2 . TRP B 1 281 ? 35.566  32.617  -2.581  1.00 25.71 ? 761  TRP B CE2 1 
ATOM   4612 C  CE3 . TRP B 1 281 ? 34.408  34.412  -1.442  1.00 25.44 ? 761  TRP B CE3 1 
ATOM   4613 C  CZ2 . TRP B 1 281 ? 36.139  32.160  -1.390  1.00 25.93 ? 761  TRP B CZ2 1 
ATOM   4614 C  CZ3 . TRP B 1 281 ? 34.980  33.959  -0.254  1.00 25.76 ? 761  TRP B CZ3 1 
ATOM   4615 C  CH2 . TRP B 1 281 ? 35.834  32.845  -0.239  1.00 26.09 ? 761  TRP B CH2 1 
ATOM   4616 N  N   . ALA B 1 282 ? 30.735  37.048  -4.030  1.00 26.40 ? 762  ALA B N   1 
ATOM   4617 C  CA  . ALA B 1 282 ? 30.097  38.230  -4.585  1.00 26.90 ? 762  ALA B CA  1 
ATOM   4618 C  C   . ALA B 1 282 ? 31.018  39.430  -4.397  1.00 27.18 ? 762  ALA B C   1 
ATOM   4619 O  O   . ALA B 1 282 ? 31.979  39.367  -3.628  1.00 27.14 ? 762  ALA B O   1 
ATOM   4620 C  CB  . ALA B 1 282 ? 28.756  38.485  -3.896  1.00 26.97 ? 762  ALA B CB  1 
ATOM   4621 N  N   . GLY B 1 283 ? 30.721  40.515  -5.104  1.00 27.59 ? 763  GLY B N   1 
ATOM   4622 C  CA  . GLY B 1 283 ? 31.441  41.776  -4.925  1.00 27.98 ? 763  GLY B CA  1 
ATOM   4623 C  C   . GLY B 1 283 ? 32.385  42.147  -6.052  1.00 28.24 ? 763  GLY B C   1 
ATOM   4624 O  O   . GLY B 1 283 ? 32.725  43.317  -6.207  1.00 28.72 ? 763  GLY B O   1 
ATOM   4625 N  N   . GLY B 1 284 ? 32.817  41.163  -6.834  1.00 28.63 ? 764  GLY B N   1 
ATOM   4626 C  CA  . GLY B 1 284 ? 33.696  41.410  -7.976  1.00 28.92 ? 764  GLY B CA  1 
ATOM   4627 C  C   . GLY B 1 284 ? 35.170  41.310  -7.631  1.00 29.28 ? 764  GLY B C   1 
ATOM   4628 O  O   . GLY B 1 284 ? 35.539  40.746  -6.604  1.00 29.45 ? 764  GLY B O   1 
ATOM   4629 N  N   . LEU B 1 285 ? 36.009  41.885  -8.490  1.00 29.75 ? 765  LEU B N   1 
ATOM   4630 C  CA  . LEU B 1 285 ? 37.466  41.677  -8.444  1.00 29.99 ? 765  LEU B CA  1 
ATOM   4631 C  C   . LEU B 1 285 ? 38.199  42.513  -7.402  1.00 30.25 ? 765  LEU B C   1 
ATOM   4632 O  O   . LEU B 1 285 ? 39.336  42.193  -7.041  1.00 30.39 ? 765  LEU B O   1 
ATOM   4633 C  CB  . LEU B 1 285 ? 38.080  41.939  -9.830  1.00 29.92 ? 765  LEU B CB  1 
ATOM   4634 C  CG  . LEU B 1 285 ? 38.152  40.735  -10.775 1.00 29.64 ? 765  LEU B CG  1 
ATOM   4635 C  CD1 . LEU B 1 285 ? 37.011  39.751  -10.525 1.00 29.91 ? 765  LEU B CD1 1 
ATOM   4636 C  CD2 . LEU B 1 285 ? 38.171  41.184  -12.227 1.00 29.19 ? 765  LEU B CD2 1 
ATOM   4637 N  N   . ASP B 1 286 ? 37.556  43.581  -6.935  1.00 30.39 ? 766  ASP B N   1 
ATOM   4638 C  CA  . ASP B 1 286 ? 38.158  44.486  -5.968  1.00 30.44 ? 766  ASP B CA  1 
ATOM   4639 C  C   . ASP B 1 286 ? 37.358  44.448  -4.672  1.00 30.30 ? 766  ASP B C   1 
ATOM   4640 O  O   . ASP B 1 286 ? 36.154  44.703  -4.693  1.00 30.24 ? 766  ASP B O   1 
ATOM   4641 C  CB  . ASP B 1 286 ? 38.181  45.901  -6.534  1.00 30.68 ? 766  ASP B CB  1 
ATOM   4642 C  CG  . ASP B 1 286 ? 38.742  45.949  -7.943  1.00 31.03 ? 766  ASP B CG  1 
ATOM   4643 O  OD1 . ASP B 1 286 ? 38.200  45.257  -8.832  1.00 31.83 ? 766  ASP B OD1 1 
ATOM   4644 O  OD2 . ASP B 1 286 ? 39.737  46.663  -8.156  1.00 31.15 ? 766  ASP B OD2 1 
ATOM   4645 N  N   . PRO B 1 287 ? 38.014  44.137  -3.538  1.00 30.21 ? 767  PRO B N   1 
ATOM   4646 C  CA  . PRO B 1 287 ? 39.442  43.864  -3.340  1.00 30.25 ? 767  PRO B CA  1 
ATOM   4647 C  C   . PRO B 1 287 ? 39.909  42.524  -3.919  1.00 30.32 ? 767  PRO B C   1 
ATOM   4648 O  O   . PRO B 1 287 ? 39.077  41.720  -4.367  1.00 30.34 ? 767  PRO B O   1 
ATOM   4649 C  CB  . PRO B 1 287 ? 39.591  43.852  -1.811  1.00 30.35 ? 767  PRO B CB  1 
ATOM   4650 C  CG  . PRO B 1 287 ? 38.334  44.449  -1.278  1.00 30.52 ? 767  PRO B CG  1 
ATOM   4651 C  CD  . PRO B 1 287 ? 37.287  44.085  -2.261  1.00 30.26 ? 767  PRO B CD  1 
ATOM   4652 N  N   . PRO B 1 288 ? 41.236  42.276  -3.900  1.00 30.16 ? 768  PRO B N   1 
ATOM   4653 C  CA  . PRO B 1 288 ? 41.770  41.079  -4.547  1.00 29.99 ? 768  PRO B CA  1 
ATOM   4654 C  C   . PRO B 1 288 ? 41.297  39.817  -3.848  1.00 29.57 ? 768  PRO B C   1 
ATOM   4655 O  O   . PRO B 1 288 ? 41.406  39.721  -2.622  1.00 29.76 ? 768  PRO B O   1 
ATOM   4656 C  CB  . PRO B 1 288 ? 43.298  41.236  -4.405  1.00 30.00 ? 768  PRO B CB  1 
ATOM   4657 C  CG  . PRO B 1 288 ? 43.529  42.617  -3.920  1.00 30.07 ? 768  PRO B CG  1 
ATOM   4658 C  CD  . PRO B 1 288 ? 42.291  43.004  -3.177  1.00 30.18 ? 768  PRO B CD  1 
ATOM   4659 N  N   . MET B 1 289 ? 40.759  38.878  -4.620  1.00 29.02 ? 769  MET B N   1 
ATOM   4660 C  CA  . MET B 1 289 ? 40.318  37.590  -4.092  1.00 28.73 ? 769  MET B CA  1 
ATOM   4661 C  C   . MET B 1 289 ? 41.467  36.592  -4.277  1.00 28.34 ? 769  MET B C   1 
ATOM   4662 O  O   . MET B 1 289 ? 41.852  36.279  -5.406  1.00 28.15 ? 769  MET B O   1 
ATOM   4663 C  CB  . MET B 1 289 ? 39.042  37.126  -4.812  1.00 28.69 ? 769  MET B CB  1 
ATOM   4664 C  CG  . MET B 1 289 ? 38.057  36.347  -3.930  1.00 29.37 ? 769  MET B CG  1 
ATOM   4665 S  SD  . MET B 1 289 ? 37.210  37.354  -2.682  1.00 29.64 ? 769  MET B SD  1 
ATOM   4666 C  CE  . MET B 1 289 ? 35.717  37.851  -3.533  1.00 30.33 ? 769  MET B CE  1 
ATOM   4667 N  N   . GLY B 1 290 ? 42.032  36.120  -3.167  1.00 27.96 ? 770  GLY B N   1 
ATOM   4668 C  CA  . GLY B 1 290 ? 43.222  35.265  -3.206  1.00 27.68 ? 770  GLY B CA  1 
ATOM   4669 C  C   . GLY B 1 290 ? 43.362  34.326  -2.017  1.00 27.41 ? 770  GLY B C   1 
ATOM   4670 O  O   . GLY B 1 290 ? 42.371  33.781  -1.532  1.00 27.28 ? 770  GLY B O   1 
ATOM   4671 N  N   . ASP B 1 291 ? 44.599  34.147  -1.551  1.00 27.10 ? 771  ASP B N   1 
ATOM   4672 C  CA  . ASP B 1 291 ? 44.923  33.138  -0.530  1.00 26.88 ? 771  ASP B CA  1 
ATOM   4673 C  C   . ASP B 1 291 ? 44.192  33.312  0.806   1.00 26.64 ? 771  ASP B C   1 
ATOM   4674 O  O   . ASP B 1 291 ? 43.635  32.349  1.321   1.00 26.40 ? 771  ASP B O   1 
ATOM   4675 C  CB  . ASP B 1 291 ? 46.437  33.071  -0.287  1.00 26.91 ? 771  ASP B CB  1 
ATOM   4676 C  CG  . ASP B 1 291 ? 47.197  32.438  -1.448  1.00 27.07 ? 771  ASP B CG  1 
ATOM   4677 O  OD1 . ASP B 1 291 ? 46.579  32.112  -2.480  1.00 26.21 ? 771  ASP B OD1 1 
ATOM   4678 O  OD2 . ASP B 1 291 ? 48.429  32.267  -1.324  1.00 27.59 ? 771  ASP B OD2 1 
ATOM   4679 N  N   . PRO B 1 292 ? 44.186  34.533  1.372   1.00 26.52 ? 772  PRO B N   1 
ATOM   4680 C  CA  . PRO B 1 292 ? 43.473  34.713  2.642   1.00 26.54 ? 772  PRO B CA  1 
ATOM   4681 C  C   . PRO B 1 292 ? 41.997  34.334  2.558   1.00 26.61 ? 772  PRO B C   1 
ATOM   4682 O  O   . PRO B 1 292 ? 41.421  33.849  3.537   1.00 26.88 ? 772  PRO B O   1 
ATOM   4683 C  CB  . PRO B 1 292 ? 43.614  36.218  2.919   1.00 26.45 ? 772  PRO B CB  1 
ATOM   4684 C  CG  . PRO B 1 292 ? 44.808  36.635  2.167   1.00 26.36 ? 772  PRO B CG  1 
ATOM   4685 C  CD  . PRO B 1 292 ? 44.827  35.784  0.928   1.00 26.44 ? 772  PRO B CD  1 
ATOM   4686 N  N   . GLU B 1 293 ? 41.405  34.544  1.386   1.00 26.43 ? 773  GLU B N   1 
ATOM   4687 C  CA  . GLU B 1 293 ? 39.987  34.303  1.173   1.00 26.18 ? 773  GLU B CA  1 
ATOM   4688 C  C   . GLU B 1 293 ? 39.701  32.811  1.030   1.00 26.23 ? 773  GLU B C   1 
ATOM   4689 O  O   . GLU B 1 293 ? 38.738  32.299  1.610   1.00 26.19 ? 773  GLU B O   1 
ATOM   4690 C  CB  . GLU B 1 293 ? 39.509  35.060  -0.070  1.00 26.11 ? 773  GLU B CB  1 
ATOM   4691 C  CG  . GLU B 1 293 ? 39.456  36.577  0.110   1.00 25.83 ? 773  GLU B CG  1 
ATOM   4692 C  CD  . GLU B 1 293 ? 40.823  37.238  0.199   1.00 25.30 ? 773  GLU B CD  1 
ATOM   4693 O  OE1 . GLU B 1 293 ? 41.713  36.938  -0.624  1.00 24.70 ? 773  GLU B OE1 1 
ATOM   4694 O  OE2 . GLU B 1 293 ? 41.001  38.077  1.096   1.00 25.69 ? 773  GLU B OE2 1 
ATOM   4695 N  N   . TYR B 1 294 ? 40.542  32.120  0.263   1.00 26.12 ? 774  TYR B N   1 
ATOM   4696 C  CA  . TYR B 1 294 ? 40.399  30.677  0.072   1.00 26.13 ? 774  TYR B CA  1 
ATOM   4697 C  C   . TYR B 1 294 ? 40.739  29.890  1.338   1.00 26.17 ? 774  TYR B C   1 
ATOM   4698 O  O   . TYR B 1 294 ? 40.038  28.931  1.677   1.00 26.19 ? 774  TYR B O   1 
ATOM   4699 C  CB  . TYR B 1 294 ? 41.198  30.192  -1.152  1.00 26.10 ? 774  TYR B CB  1 
ATOM   4700 C  CG  . TYR B 1 294 ? 40.398  30.389  -2.414  1.00 25.94 ? 774  TYR B CG  1 
ATOM   4701 C  CD1 . TYR B 1 294 ? 40.149  31.671  -2.894  1.00 25.83 ? 774  TYR B CD1 1 
ATOM   4702 C  CD2 . TYR B 1 294 ? 39.824  29.311  -3.084  1.00 26.05 ? 774  TYR B CD2 1 
ATOM   4703 C  CE1 . TYR B 1 294 ? 39.385  31.881  -4.022  1.00 25.93 ? 774  TYR B CE1 1 
ATOM   4704 C  CE2 . TYR B 1 294 ? 39.052  29.510  -4.229  1.00 26.08 ? 774  TYR B CE2 1 
ATOM   4705 C  CZ  . TYR B 1 294 ? 38.838  30.805  -4.688  1.00 26.22 ? 774  TYR B CZ  1 
ATOM   4706 O  OH  . TYR B 1 294 ? 38.083  31.049  -5.808  1.00 25.71 ? 774  TYR B OH  1 
ATOM   4707 N  N   . LEU B 1 295 ? 41.781  30.313  2.050   1.00 26.09 ? 775  LEU B N   1 
ATOM   4708 C  CA  . LEU B 1 295 ? 42.122  29.702  3.334   1.00 26.05 ? 775  LEU B CA  1 
ATOM   4709 C  C   . LEU B 1 295 ? 40.973  29.861  4.333   1.00 26.05 ? 775  LEU B C   1 
ATOM   4710 O  O   . LEU B 1 295 ? 40.629  28.915  5.040   1.00 26.19 ? 775  LEU B O   1 
ATOM   4711 C  CB  . LEU B 1 295 ? 43.414  30.299  3.904   1.00 25.92 ? 775  LEU B CB  1 
ATOM   4712 C  CG  . LEU B 1 295 ? 44.690  29.974  3.124   1.00 26.09 ? 775  LEU B CG  1 
ATOM   4713 C  CD1 . LEU B 1 295 ? 45.884  30.749  3.683   1.00 25.46 ? 775  LEU B CD1 1 
ATOM   4714 C  CD2 . LEU B 1 295 ? 44.960  28.474  3.139   1.00 26.20 ? 775  LEU B CD2 1 
ATOM   4715 N  N   . ALA B 1 296 ? 40.376  31.050  4.379   1.00 25.98 ? 776  ALA B N   1 
ATOM   4716 C  CA  . ALA B 1 296 ? 39.233  31.295  5.256   1.00 25.96 ? 776  ALA B CA  1 
ATOM   4717 C  C   . ALA B 1 296 ? 38.047  30.392  4.893   1.00 25.94 ? 776  ALA B C   1 
ATOM   4718 O  O   . ALA B 1 296 ? 37.379  29.860  5.770   1.00 25.91 ? 776  ALA B O   1 
ATOM   4719 C  CB  . ALA B 1 296 ? 38.830  32.764  5.214   1.00 25.85 ? 776  ALA B CB  1 
ATOM   4720 N  N   . ALA B 1 297 ? 37.801  30.214  3.600   1.00 26.10 ? 777  ALA B N   1 
ATOM   4721 C  CA  . ALA B 1 297 ? 36.705  29.369  3.126   1.00 26.19 ? 777  ALA B CA  1 
ATOM   4722 C  C   . ALA B 1 297 ? 36.879  27.917  3.574   1.00 26.46 ? 777  ALA B C   1 
ATOM   4723 O  O   . ALA B 1 297 ? 35.913  27.259  3.960   1.00 25.95 ? 777  ALA B O   1 
ATOM   4724 C  CB  . ALA B 1 297 ? 36.602  29.444  1.607   1.00 26.27 ? 777  ALA B CB  1 
ATOM   4725 N  N   . PHE B 1 298 ? 38.121  27.435  3.522   1.00 26.90 ? 778  PHE B N   1 
ATOM   4726 C  CA  . PHE B 1 298 ? 38.464  26.102  4.016   1.00 27.23 ? 778  PHE B CA  1 
ATOM   4727 C  C   . PHE B 1 298 ? 38.327  25.981  5.535   1.00 27.40 ? 778  PHE B C   1 
ATOM   4728 O  O   . PHE B 1 298 ? 37.758  25.004  6.029   1.00 27.44 ? 778  PHE B O   1 
ATOM   4729 C  CB  . PHE B 1 298 ? 39.870  25.685  3.554   1.00 27.30 ? 778  PHE B CB  1 
ATOM   4730 C  CG  . PHE B 1 298 ? 39.859  24.815  2.326   1.00 27.76 ? 778  PHE B CG  1 
ATOM   4731 C  CD1 . PHE B 1 298 ? 39.258  25.258  1.156   1.00 28.17 ? 778  PHE B CD1 1 
ATOM   4732 C  CD2 . PHE B 1 298 ? 40.419  23.540  2.350   1.00 28.12 ? 778  PHE B CD2 1 
ATOM   4733 C  CE1 . PHE B 1 298 ? 39.222  24.450  0.021   1.00 28.66 ? 778  PHE B CE1 1 
ATOM   4734 C  CE2 . PHE B 1 298 ? 40.393  22.729  1.224   1.00 28.28 ? 778  PHE B CE2 1 
ATOM   4735 C  CZ  . PHE B 1 298 ? 39.793  23.183  0.055   1.00 28.62 ? 778  PHE B CZ  1 
ATOM   4736 N  N   . ARG B 1 299 ? 38.828  26.974  6.268   1.00 27.52 ? 779  ARG B N   1 
ATOM   4737 C  CA  . ARG B 1 299 ? 38.712  26.977  7.731   1.00 27.61 ? 779  ARG B CA  1 
ATOM   4738 C  C   . ARG B 1 299 ? 37.263  26.985  8.221   1.00 27.57 ? 779  ARG B C   1 
ATOM   4739 O  O   . ARG B 1 299 ? 36.909  26.236  9.130   1.00 27.70 ? 779  ARG B O   1 
ATOM   4740 C  CB  . ARG B 1 299 ? 39.426  28.186  8.334   1.00 27.76 ? 779  ARG B CB  1 
ATOM   4741 C  CG  . ARG B 1 299 ? 40.940  28.064  8.442   1.00 27.84 ? 779  ARG B CG  1 
ATOM   4742 C  CD  . ARG B 1 299 ? 41.484  29.084  9.446   1.00 28.15 ? 779  ARG B CD  1 
ATOM   4743 N  NE  . ARG B 1 299 ? 40.929  30.421  9.230   1.00 27.81 ? 779  ARG B NE  1 
ATOM   4744 C  CZ  . ARG B 1 299 ? 41.320  31.266  8.276   1.00 27.80 ? 779  ARG B CZ  1 
ATOM   4745 N  NH1 . ARG B 1 299 ? 42.283  30.939  7.418   1.00 27.49 ? 779  ARG B NH1 1 
ATOM   4746 N  NH2 . ARG B 1 299 ? 40.737  32.453  8.172   1.00 28.10 ? 779  ARG B NH2 1 
ATOM   4747 N  N   . ILE B 1 300 ? 36.436  27.832  7.611   1.00 27.54 ? 780  ILE B N   1 
ATOM   4748 C  CA  . ILE B 1 300 ? 35.106  28.146  8.139   1.00 27.31 ? 780  ILE B CA  1 
ATOM   4749 C  C   . ILE B 1 300 ? 33.994  27.274  7.558   1.00 27.25 ? 780  ILE B C   1 
ATOM   4750 O  O   . ILE B 1 300 ? 33.040  26.937  8.258   1.00 27.25 ? 780  ILE B O   1 
ATOM   4751 C  CB  . ILE B 1 300 ? 34.773  29.644  7.914   1.00 27.29 ? 780  ILE B CB  1 
ATOM   4752 C  CG1 . ILE B 1 300 ? 35.830  30.526  8.591   1.00 27.02 ? 780  ILE B CG1 1 
ATOM   4753 C  CG2 . ILE B 1 300 ? 33.394  29.991  8.466   1.00 27.39 ? 780  ILE B CG2 1 
ATOM   4754 C  CD1 . ILE B 1 300 ? 35.599  32.006  8.412   1.00 26.75 ? 780  ILE B CD1 1 
ATOM   4755 N  N   . VAL B 1 301 ? 34.118  26.897  6.289   1.00 27.39 ? 781  VAL B N   1 
ATOM   4756 C  CA  . VAL B 1 301 ? 33.038  26.206  5.583   1.00 27.42 ? 781  VAL B CA  1 
ATOM   4757 C  C   . VAL B 1 301 ? 33.421  24.815  5.060   1.00 27.42 ? 781  VAL B C   1 
ATOM   4758 O  O   . VAL B 1 301 ? 32.783  23.829  5.420   1.00 27.47 ? 781  VAL B O   1 
ATOM   4759 C  CB  . VAL B 1 301 ? 32.508  27.066  4.413   1.00 27.42 ? 781  VAL B CB  1 
ATOM   4760 C  CG1 . VAL B 1 301 ? 31.484  26.290  3.591   1.00 27.70 ? 781  VAL B CG1 1 
ATOM   4761 C  CG2 . VAL B 1 301 ? 31.902  28.368  4.945   1.00 27.35 ? 781  VAL B CG2 1 
ATOM   4762 N  N   . VAL B 1 302 ? 34.446  24.729  4.219   1.00 27.40 ? 782  VAL B N   1 
ATOM   4763 C  CA  . VAL B 1 302 ? 34.703  23.483  3.493   1.00 27.47 ? 782  VAL B CA  1 
ATOM   4764 C  C   . VAL B 1 302 ? 34.989  22.335  4.451   1.00 27.61 ? 782  VAL B C   1 
ATOM   4765 O  O   . VAL B 1 302 ? 34.295  21.319  4.430   1.00 27.22 ? 782  VAL B O   1 
ATOM   4766 C  CB  . VAL B 1 302 ? 35.864  23.602  2.469   1.00 27.47 ? 782  VAL B CB  1 
ATOM   4767 C  CG1 . VAL B 1 302 ? 36.059  22.283  1.731   1.00 26.67 ? 782  VAL B CG1 1 
ATOM   4768 C  CG2 . VAL B 1 302 ? 35.593  24.724  1.474   1.00 27.47 ? 782  VAL B CG2 1 
ATOM   4769 N  N   . MET B 1 303 ? 35.992  22.510  5.304   1.00 27.86 ? 783  MET B N   1 
ATOM   4770 C  CA  . MET B 1 303 ? 36.426  21.430  6.183   1.00 28.13 ? 783  MET B CA  1 
ATOM   4771 C  C   . MET B 1 303 ? 35.401  21.060  7.259   1.00 28.06 ? 783  MET B C   1 
ATOM   4772 O  O   . MET B 1 303 ? 35.124  19.878  7.448   1.00 28.30 ? 783  MET B O   1 
ATOM   4773 C  CB  . MET B 1 303 ? 37.796  21.739  6.797   1.00 28.23 ? 783  MET B CB  1 
ATOM   4774 C  CG  . MET B 1 303 ? 38.911  21.834  5.757   1.00 28.98 ? 783  MET B CG  1 
ATOM   4775 S  SD  . MET B 1 303 ? 39.105  20.329  4.764   1.00 30.97 ? 783  MET B SD  1 
ATOM   4776 C  CE  . MET B 1 303 ? 39.700  19.211  6.030   1.00 29.78 ? 783  MET B CE  1 
ATOM   4777 N  N   . PRO B 1 304 ? 34.821  22.052  7.953   1.00 28.09 ? 784  PRO B N   1 
ATOM   4778 C  CA  . PRO B 1 304 ? 33.827  21.681  8.974   1.00 27.99 ? 784  PRO B CA  1 
ATOM   4779 C  C   . PRO B 1 304 ? 32.611  20.929  8.423   1.00 27.92 ? 784  PRO B C   1 
ATOM   4780 O  O   . PRO B 1 304 ? 32.111  20.014  9.074   1.00 28.13 ? 784  PRO B O   1 
ATOM   4781 C  CB  . PRO B 1 304 ? 33.408  23.030  9.567   1.00 27.86 ? 784  PRO B CB  1 
ATOM   4782 C  CG  . PRO B 1 304 ? 34.562  23.929  9.312   1.00 27.86 ? 784  PRO B CG  1 
ATOM   4783 C  CD  . PRO B 1 304 ? 35.144  23.491  8.003   1.00 28.05 ? 784  PRO B CD  1 
ATOM   4784 N  N   . ILE B 1 305 ? 32.133  21.309  7.243   1.00 27.94 ? 785  ILE B N   1 
ATOM   4785 C  CA  . ILE B 1 305 ? 31.028  20.586  6.609   1.00 27.85 ? 785  ILE B CA  1 
ATOM   4786 C  C   . ILE B 1 305 ? 31.513  19.220  6.093   1.00 27.88 ? 785  ILE B C   1 
ATOM   4787 O  O   . ILE B 1 305 ? 30.808  18.212  6.220   1.00 27.76 ? 785  ILE B O   1 
ATOM   4788 C  CB  . ILE B 1 305 ? 30.362  21.411  5.471   1.00 27.80 ? 785  ILE B CB  1 
ATOM   4789 C  CG1 . ILE B 1 305 ? 29.733  22.690  6.047   1.00 27.68 ? 785  ILE B CG1 1 
ATOM   4790 C  CG2 . ILE B 1 305 ? 29.295  20.573  4.754   1.00 27.03 ? 785  ILE B CG2 1 
ATOM   4791 C  CD1 . ILE B 1 305 ? 28.851  23.462  5.067   1.00 26.88 ? 785  ILE B CD1 1 
ATOM   4792 N  N   . ALA B 1 306 ? 32.722  19.191  5.534   1.00 27.84 ? 786  ALA B N   1 
ATOM   4793 C  CA  . ALA B 1 306 ? 33.316  17.949  5.035   1.00 27.82 ? 786  ALA B CA  1 
ATOM   4794 C  C   . ALA B 1 306 ? 33.492  16.928  6.158   1.00 27.85 ? 786  ALA B C   1 
ATOM   4795 O  O   . ALA B 1 306 ? 33.165  15.763  5.982   1.00 28.07 ? 786  ALA B O   1 
ATOM   4796 C  CB  . ALA B 1 306 ? 34.647  18.223  4.344   1.00 27.42 ? 786  ALA B CB  1 
ATOM   4797 N  N   . ARG B 1 307 ? 33.986  17.371  7.312   1.00 27.99 ? 787  ARG B N   1 
ATOM   4798 C  CA  . ARG B 1 307 ? 34.132  16.489  8.479   1.00 28.00 ? 787  ARG B CA  1 
ATOM   4799 C  C   . ARG B 1 307 ? 32.790  16.001  9.019   1.00 27.76 ? 787  ARG B C   1 
ATOM   4800 O  O   . ARG B 1 307 ? 32.666  14.842  9.413   1.00 28.05 ? 787  ARG B O   1 
ATOM   4801 C  CB  . ARG B 1 307 ? 34.905  17.185  9.600   1.00 28.12 ? 787  ARG B CB  1 
ATOM   4802 C  CG  . ARG B 1 307 ? 36.369  17.393  9.284   1.00 29.16 ? 787  ARG B CG  1 
ATOM   4803 C  CD  . ARG B 1 307 ? 37.148  17.818  10.515  1.00 31.02 ? 787  ARG B CD  1 
ATOM   4804 N  NE  . ARG B 1 307 ? 38.325  18.610  10.163  1.00 33.23 ? 787  ARG B NE  1 
ATOM   4805 C  CZ  . ARG B 1 307 ? 39.446  18.121  9.627   1.00 35.63 ? 787  ARG B CZ  1 
ATOM   4806 N  NH1 . ARG B 1 307 ? 39.576  16.822  9.360   1.00 35.95 ? 787  ARG B NH1 1 
ATOM   4807 N  NH2 . ARG B 1 307 ? 40.455  18.944  9.350   1.00 36.89 ? 787  ARG B NH2 1 
ATOM   4808 N  N   . GLU B 1 308 ? 31.791  16.878  9.042   1.00 27.42 ? 788  GLU B N   1 
ATOM   4809 C  CA  . GLU B 1 308 ? 30.456  16.498  9.507   1.00 27.37 ? 788  GLU B CA  1 
ATOM   4810 C  C   . GLU B 1 308 ? 29.796  15.489  8.559   1.00 27.08 ? 788  GLU B C   1 
ATOM   4811 O  O   . GLU B 1 308 ? 29.142  14.556  9.005   1.00 26.94 ? 788  GLU B O   1 
ATOM   4812 C  CB  . GLU B 1 308 ? 29.569  17.734  9.675   1.00 27.51 ? 788  GLU B CB  1 
ATOM   4813 C  CG  . GLU B 1 308 ? 28.271  17.464  10.431  1.00 27.92 ? 788  GLU B CG  1 
ATOM   4814 C  CD  . GLU B 1 308 ? 27.552  18.738  10.873  1.00 28.81 ? 788  GLU B CD  1 
ATOM   4815 O  OE1 . GLU B 1 308 ? 28.215  19.751  11.185  1.00 28.55 ? 788  GLU B OE1 1 
ATOM   4816 O  OE2 . GLU B 1 308 ? 26.307  18.719  10.918  1.00 29.98 ? 788  GLU B OE2 1 
ATOM   4817 N  N   . PHE B 1 309 ? 29.974  15.688  7.256   1.00 26.89 ? 789  PHE B N   1 
ATOM   4818 C  CA  . PHE B 1 309 ? 29.481  14.749  6.247   1.00 26.60 ? 789  PHE B CA  1 
ATOM   4819 C  C   . PHE B 1 309 ? 30.184  13.397  6.375   1.00 26.46 ? 789  PHE B C   1 
ATOM   4820 O  O   . PHE B 1 309 ? 29.539  12.350  6.344   1.00 26.45 ? 789  PHE B O   1 
ATOM   4821 C  CB  . PHE B 1 309 ? 29.709  15.328  4.850   1.00 26.66 ? 789  PHE B CB  1 
ATOM   4822 C  CG  . PHE B 1 309 ? 29.130  14.499  3.737   1.00 26.25 ? 789  PHE B CG  1 
ATOM   4823 C  CD1 . PHE B 1 309 ? 27.772  14.194  3.713   1.00 25.97 ? 789  PHE B CD1 1 
ATOM   4824 C  CD2 . PHE B 1 309 ? 29.934  14.046  2.704   1.00 25.26 ? 789  PHE B CD2 1 
ATOM   4825 C  CE1 . PHE B 1 309 ? 27.234  13.442  2.688   1.00 25.56 ? 789  PHE B CE1 1 
ATOM   4826 C  CE2 . PHE B 1 309 ? 29.400  13.296  1.669   1.00 25.70 ? 789  PHE B CE2 1 
ATOM   4827 C  CZ  . PHE B 1 309 ? 28.049  12.995  1.661   1.00 25.85 ? 789  PHE B CZ  1 
ATOM   4828 N  N   . SER B 1 310 ? 31.506  13.444  6.519   1.00 26.24 ? 790  SER B N   1 
ATOM   4829 C  CA  . SER B 1 310 ? 32.337  12.263  6.748   1.00 26.20 ? 790  SER B CA  1 
ATOM   4830 C  C   . SER B 1 310 ? 32.356  11.342  5.526   1.00 26.16 ? 790  SER B C   1 
ATOM   4831 O  O   . SER B 1 310 ? 31.812  10.235  5.564   1.00 26.10 ? 790  SER B O   1 
ATOM   4832 C  CB  . SER B 1 310 ? 31.885  11.516  8.010   1.00 26.12 ? 790  SER B CB  1 
ATOM   4833 O  OG  . SER B 1 310 ? 32.907  10.655  8.462   1.00 26.03 ? 790  SER B OG  1 
ATOM   4834 N  N   . PRO B 1 311 ? 32.996  11.802  4.435   1.00 26.13 ? 791  PRO B N   1 
ATOM   4835 C  CA  . PRO B 1 311 ? 32.981  11.103  3.152   1.00 26.16 ? 791  PRO B CA  1 
ATOM   4836 C  C   . PRO B 1 311 ? 33.925  9.898   3.092   1.00 26.18 ? 791  PRO B C   1 
ATOM   4837 O  O   . PRO B 1 311 ? 34.975  9.900   3.740   1.00 26.16 ? 791  PRO B O   1 
ATOM   4838 C  CB  . PRO B 1 311 ? 33.456  12.182  2.177   1.00 26.17 ? 791  PRO B CB  1 
ATOM   4839 C  CG  . PRO B 1 311 ? 34.380  13.005  2.980   1.00 26.12 ? 791  PRO B CG  1 
ATOM   4840 C  CD  . PRO B 1 311 ? 33.777  13.050  4.359   1.00 25.95 ? 791  PRO B CD  1 
ATOM   4841 N  N   . ASP B 1 312 ? 33.548  8.893   2.304   1.00 26.11 ? 792  ASP B N   1 
ATOM   4842 C  CA  . ASP B 1 312 ? 34.381  7.700   2.082   1.00 26.00 ? 792  ASP B CA  1 
ATOM   4843 C  C   . ASP B 1 312 ? 35.455  7.962   1.023   1.00 25.86 ? 792  ASP B C   1 
ATOM   4844 O  O   . ASP B 1 312 ? 36.460  7.264   0.964   1.00 25.80 ? 792  ASP B O   1 
ATOM   4845 C  CB  . ASP B 1 312 ? 33.516  6.515   1.647   1.00 25.94 ? 792  ASP B CB  1 
ATOM   4846 C  CG  . ASP B 1 312 ? 32.447  6.167   2.664   1.00 26.32 ? 792  ASP B CG  1 
ATOM   4847 O  OD1 . ASP B 1 312 ? 32.793  5.934   3.843   1.00 27.94 ? 792  ASP B OD1 1 
ATOM   4848 O  OD2 . ASP B 1 312 ? 31.258  6.120   2.287   1.00 26.23 ? 792  ASP B OD2 1 
ATOM   4849 N  N   . LEU B 1 313 ? 35.227  8.960   0.176   1.00 25.92 ? 793  LEU B N   1 
ATOM   4850 C  CA  . LEU B 1 313 ? 36.214  9.376   -0.815  1.00 25.95 ? 793  LEU B CA  1 
ATOM   4851 C  C   . LEU B 1 313 ? 35.943  10.815  -1.227  1.00 26.16 ? 793  LEU B C   1 
ATOM   4852 O  O   . LEU B 1 313 ? 34.794  11.266  -1.213  1.00 25.76 ? 793  LEU B O   1 
ATOM   4853 C  CB  . LEU B 1 313 ? 36.188  8.447   -2.035  1.00 25.91 ? 793  LEU B CB  1 
ATOM   4854 C  CG  . LEU B 1 313 ? 37.225  8.728   -3.131  1.00 25.77 ? 793  LEU B CG  1 
ATOM   4855 C  CD1 . LEU B 1 313 ? 37.705  7.447   -3.782  1.00 25.86 ? 793  LEU B CD1 1 
ATOM   4856 C  CD2 . LEU B 1 313 ? 36.659  9.666   -4.184  1.00 26.19 ? 793  LEU B CD2 1 
ATOM   4857 N  N   . VAL B 1 314 ? 37.012  11.528  -1.574  1.00 26.60 ? 794  VAL B N   1 
ATOM   4858 C  CA  . VAL B 1 314 ? 36.924  12.917  -2.000  1.00 26.89 ? 794  VAL B CA  1 
ATOM   4859 C  C   . VAL B 1 314 ? 37.378  13.057  -3.448  1.00 27.26 ? 794  VAL B C   1 
ATOM   4860 O  O   . VAL B 1 314 ? 38.525  12.748  -3.770  1.00 27.27 ? 794  VAL B O   1 
ATOM   4861 C  CB  . VAL B 1 314 ? 37.797  13.837  -1.109  1.00 27.07 ? 794  VAL B CB  1 
ATOM   4862 C  CG1 . VAL B 1 314 ? 37.595  15.299  -1.494  1.00 26.97 ? 794  VAL B CG1 1 
ATOM   4863 C  CG2 . VAL B 1 314 ? 37.479  13.622  0.379   1.00 26.41 ? 794  VAL B CG2 1 
ATOM   4864 N  N   . LEU B 1 315 ? 36.468  13.504  -4.316  1.00 27.74 ? 795  LEU B N   1 
ATOM   4865 C  CA  . LEU B 1 315 ? 36.807  13.901  -5.692  1.00 28.05 ? 795  LEU B CA  1 
ATOM   4866 C  C   . LEU B 1 315 ? 36.938  15.421  -5.741  1.00 28.15 ? 795  LEU B C   1 
ATOM   4867 O  O   . LEU B 1 315 ? 36.108  16.137  -5.184  1.00 27.94 ? 795  LEU B O   1 
ATOM   4868 C  CB  . LEU B 1 315 ? 35.725  13.454  -6.685  1.00 27.98 ? 795  LEU B CB  1 
ATOM   4869 C  CG  . LEU B 1 315 ? 35.500  11.946  -6.877  1.00 28.50 ? 795  LEU B CG  1 
ATOM   4870 C  CD1 . LEU B 1 315 ? 34.209  11.690  -7.650  1.00 28.27 ? 795  LEU B CD1 1 
ATOM   4871 C  CD2 . LEU B 1 315 ? 36.676  11.281  -7.570  1.00 27.56 ? 795  LEU B CD2 1 
ATOM   4872 N  N   . VAL B 1 316 ? 37.979  15.912  -6.400  1.00 28.46 ? 796  VAL B N   1 
ATOM   4873 C  CA  . VAL B 1 316 ? 38.174  17.356  -6.549  1.00 28.57 ? 796  VAL B CA  1 
ATOM   4874 C  C   . VAL B 1 316 ? 38.142  17.754  -8.017  1.00 28.77 ? 796  VAL B C   1 
ATOM   4875 O  O   . VAL B 1 316 ? 38.893  17.215  -8.835  1.00 28.73 ? 796  VAL B O   1 
ATOM   4876 C  CB  . VAL B 1 316 ? 39.511  17.823  -5.953  1.00 28.66 ? 796  VAL B CB  1 
ATOM   4877 C  CG1 . VAL B 1 316 ? 39.643  19.343  -6.064  1.00 28.50 ? 796  VAL B CG1 1 
ATOM   4878 C  CG2 . VAL B 1 316 ? 39.638  17.364  -4.500  1.00 28.46 ? 796  VAL B CG2 1 
ATOM   4879 N  N   . SER B 1 317 ? 37.245  18.676  -8.351  1.00 28.96 ? 797  SER B N   1 
ATOM   4880 C  CA  . SER B 1 317 ? 37.314  19.362  -9.633  1.00 28.94 ? 797  SER B CA  1 
ATOM   4881 C  C   . SER B 1 317 ? 38.414  20.412  -9.495  1.00 28.83 ? 797  SER B C   1 
ATOM   4882 O  O   . SER B 1 317 ? 38.178  21.538  -9.047  1.00 28.66 ? 797  SER B O   1 
ATOM   4883 C  CB  . SER B 1 317 ? 35.964  19.975  -10.014 1.00 29.14 ? 797  SER B CB  1 
ATOM   4884 O  OG  . SER B 1 317 ? 35.182  19.047  -10.751 1.00 29.23 ? 797  SER B OG  1 
ATOM   4885 N  N   . ALA B 1 318 ? 39.622  19.998  -9.867  1.00 28.65 ? 798  ALA B N   1 
ATOM   4886 C  CA  . ALA B 1 318 ? 40.833  20.774  -9.672  1.00 28.57 ? 798  ALA B CA  1 
ATOM   4887 C  C   . ALA B 1 318 ? 41.127  21.691  -10.857 1.00 28.53 ? 798  ALA B C   1 
ATOM   4888 O  O   . ALA B 1 318 ? 42.026  21.427  -11.660 1.00 28.37 ? 798  ALA B O   1 
ATOM   4889 C  CB  . ALA B 1 318 ? 42.011  19.828  -9.432  1.00 28.60 ? 798  ALA B CB  1 
ATOM   4890 N  N   . GLY B 1 319 ? 40.358  22.765  -10.970 1.00 28.47 ? 799  GLY B N   1 
ATOM   4891 C  CA  . GLY B 1 319 ? 40.688  23.831  -11.908 1.00 28.47 ? 799  GLY B CA  1 
ATOM   4892 C  C   . GLY B 1 319 ? 41.709  24.752  -11.265 1.00 28.52 ? 799  GLY B C   1 
ATOM   4893 O  O   . GLY B 1 319 ? 41.765  24.867  -10.044 1.00 28.24 ? 799  GLY B O   1 
ATOM   4894 N  N   . PHE B 1 320 ? 42.528  25.404  -12.080 1.00 28.60 ? 800  PHE B N   1 
ATOM   4895 C  CA  . PHE B 1 320 ? 43.504  26.359  -11.567 1.00 28.75 ? 800  PHE B CA  1 
ATOM   4896 C  C   . PHE B 1 320 ? 43.328  27.730  -12.216 1.00 28.53 ? 800  PHE B C   1 
ATOM   4897 O  O   . PHE B 1 320 ? 44.278  28.514  -12.299 1.00 28.31 ? 800  PHE B O   1 
ATOM   4898 C  CB  . PHE B 1 320 ? 44.923  25.827  -11.776 1.00 28.93 ? 800  PHE B CB  1 
ATOM   4899 C  CG  . PHE B 1 320 ? 45.188  24.525  -11.069 1.00 29.30 ? 800  PHE B CG  1 
ATOM   4900 C  CD1 . PHE B 1 320 ? 45.159  24.460  -9.682  1.00 29.77 ? 800  PHE B CD1 1 
ATOM   4901 C  CD2 . PHE B 1 320 ? 45.446  23.369  -11.784 1.00 29.67 ? 800  PHE B CD2 1 
ATOM   4902 C  CE1 . PHE B 1 320 ? 45.396  23.269  -9.021  1.00 29.87 ? 800  PHE B CE1 1 
ATOM   4903 C  CE2 . PHE B 1 320 ? 45.689  22.171  -11.129 1.00 30.20 ? 800  PHE B CE2 1 
ATOM   4904 C  CZ  . PHE B 1 320 ? 45.668  22.123  -9.743  1.00 30.05 ? 800  PHE B CZ  1 
ATOM   4905 N  N   . ASP B 1 321 ? 42.103  28.020  -12.655 1.00 28.21 ? 801  ASP B N   1 
ATOM   4906 C  CA  . ASP B 1 321 ? 41.792  29.322  -13.251 1.00 28.11 ? 801  ASP B CA  1 
ATOM   4907 C  C   . ASP B 1 321 ? 41.521  30.410  -12.193 1.00 28.09 ? 801  ASP B C   1 
ATOM   4908 O  O   . ASP B 1 321 ? 41.337  31.573  -12.543 1.00 28.32 ? 801  ASP B O   1 
ATOM   4909 C  CB  . ASP B 1 321 ? 40.661  29.231  -14.299 1.00 27.90 ? 801  ASP B CB  1 
ATOM   4910 C  CG  . ASP B 1 321 ? 39.484  28.360  -13.857 1.00 27.91 ? 801  ASP B CG  1 
ATOM   4911 O  OD1 . ASP B 1 321 ? 39.430  27.936  -12.683 1.00 27.61 ? 801  ASP B OD1 1 
ATOM   4912 O  OD2 . ASP B 1 321 ? 38.599  28.110  -14.702 1.00 26.76 ? 801  ASP B OD2 1 
ATOM   4913 N  N   . ALA B 1 322 ? 41.529  30.040  -10.911 1.00 27.99 ? 802  ALA B N   1 
ATOM   4914 C  CA  . ALA B 1 322 ? 41.558  31.019  -9.814  1.00 28.06 ? 802  ALA B CA  1 
ATOM   4915 C  C   . ALA B 1 322 ? 42.990  31.481  -9.512  1.00 28.22 ? 802  ALA B C   1 
ATOM   4916 O  O   . ALA B 1 322 ? 43.200  32.345  -8.655  1.00 28.06 ? 802  ALA B O   1 
ATOM   4917 C  CB  . ALA B 1 322 ? 40.911  30.441  -8.553  1.00 27.79 ? 802  ALA B CB  1 
ATOM   4918 N  N   . ALA B 1 323 ? 43.968  30.906  -10.214 1.00 28.48 ? 803  ALA B N   1 
ATOM   4919 C  CA  . ALA B 1 323 ? 45.376  31.257  -10.016 1.00 28.83 ? 803  ALA B CA  1 
ATOM   4920 C  C   . ALA B 1 323 ? 45.760  32.585  -10.661 1.00 29.08 ? 803  ALA B C   1 
ATOM   4921 O  O   . ALA B 1 323 ? 45.021  33.145  -11.470 1.00 29.01 ? 803  ALA B O   1 
ATOM   4922 C  CB  . ALA B 1 323 ? 46.285  30.146  -10.542 1.00 28.52 ? 803  ALA B CB  1 
ATOM   4923 N  N   . GLU B 1 324 ? 46.935  33.073  -10.277 1.00 29.74 ? 804  GLU B N   1 
ATOM   4924 C  CA  . GLU B 1 324 ? 47.557  34.245  -10.892 1.00 30.13 ? 804  GLU B CA  1 
ATOM   4925 C  C   . GLU B 1 324 ? 47.695  34.044  -12.406 1.00 30.35 ? 804  GLU B C   1 
ATOM   4926 O  O   . GLU B 1 324 ? 47.805  32.911  -12.884 1.00 30.55 ? 804  GLU B O   1 
ATOM   4927 C  CB  . GLU B 1 324 ? 48.937  34.464  -10.266 1.00 30.24 ? 804  GLU B CB  1 
ATOM   4928 C  CG  . GLU B 1 324 ? 49.584  35.822  -10.544 1.00 30.76 ? 804  GLU B CG  1 
ATOM   4929 C  CD  . GLU B 1 324 ? 49.176  36.889  -9.553  1.00 30.77 ? 804  GLU B CD  1 
ATOM   4930 O  OE1 . GLU B 1 324 ? 48.043  36.821  -9.037  1.00 29.75 ? 804  GLU B OE1 1 
ATOM   4931 O  OE2 . GLU B 1 324 ? 49.999  37.802  -9.296  1.00 32.31 ? 804  GLU B OE2 1 
ATOM   4932 N  N   . GLY B 1 325 ? 47.667  35.139  -13.159 1.00 30.61 ? 805  GLY B N   1 
ATOM   4933 C  CA  . GLY B 1 325 ? 47.856  35.084  -14.612 1.00 30.78 ? 805  GLY B CA  1 
ATOM   4934 C  C   . GLY B 1 325 ? 46.603  34.792  -15.421 1.00 30.99 ? 805  GLY B C   1 
ATOM   4935 O  O   . GLY B 1 325 ? 46.689  34.501  -16.615 1.00 31.25 ? 805  GLY B O   1 
ATOM   4936 N  N   . HIS B 1 326 ? 45.438  34.859  -14.782 1.00 31.19 ? 806  HIS B N   1 
ATOM   4937 C  CA  . HIS B 1 326 ? 44.166  34.743  -15.488 1.00 31.25 ? 806  HIS B CA  1 
ATOM   4938 C  C   . HIS B 1 326 ? 43.455  36.090  -15.377 1.00 31.43 ? 806  HIS B C   1 
ATOM   4939 O  O   . HIS B 1 326 ? 42.973  36.442  -14.299 1.00 31.28 ? 806  HIS B O   1 
ATOM   4940 C  CB  . HIS B 1 326 ? 43.327  33.613  -14.895 1.00 31.25 ? 806  HIS B CB  1 
ATOM   4941 C  CG  . HIS B 1 326 ? 44.020  32.288  -14.914 1.00 31.21 ? 806  HIS B CG  1 
ATOM   4942 N  ND1 . HIS B 1 326 ? 44.861  31.877  -13.904 1.00 31.36 ? 806  HIS B ND1 1 
ATOM   4943 C  CD2 . HIS B 1 326 ? 44.018  31.291  -15.831 1.00 31.10 ? 806  HIS B CD2 1 
ATOM   4944 C  CE1 . HIS B 1 326 ? 45.340  30.680  -14.192 1.00 31.45 ? 806  HIS B CE1 1 
ATOM   4945 N  NE2 . HIS B 1 326 ? 44.845  30.302  -15.356 1.00 30.93 ? 806  HIS B NE2 1 
ATOM   4946 N  N   . PRO B 1 327 ? 43.413  36.866  -16.482 1.00 31.64 ? 807  PRO B N   1 
ATOM   4947 C  CA  . PRO B 1 327 ? 42.844  38.217  -16.413 1.00 31.73 ? 807  PRO B CA  1 
ATOM   4948 C  C   . PRO B 1 327 ? 41.339  38.222  -16.162 1.00 31.81 ? 807  PRO B C   1 
ATOM   4949 O  O   . PRO B 1 327 ? 40.692  37.179  -16.269 1.00 31.88 ? 807  PRO B O   1 
ATOM   4950 C  CB  . PRO B 1 327 ? 43.155  38.809  -17.794 1.00 31.70 ? 807  PRO B CB  1 
ATOM   4951 C  CG  . PRO B 1 327 ? 44.169  37.908  -18.404 1.00 31.67 ? 807  PRO B CG  1 
ATOM   4952 C  CD  . PRO B 1 327 ? 43.915  36.561  -17.834 1.00 31.67 ? 807  PRO B CD  1 
ATOM   4953 N  N   . ALA B 1 328 ? 40.802  39.401  -15.849 1.00 31.87 ? 808  ALA B N   1 
ATOM   4954 C  CA  . ALA B 1 328 ? 39.402  39.568  -15.437 1.00 31.86 ? 808  ALA B CA  1 
ATOM   4955 C  C   . ALA B 1 328 ? 38.403  38.650  -16.161 1.00 31.87 ? 808  ALA B C   1 
ATOM   4956 O  O   . ALA B 1 328 ? 37.681  37.895  -15.506 1.00 31.82 ? 808  ALA B O   1 
ATOM   4957 C  CB  . ALA B 1 328 ? 38.982  41.036  -15.577 1.00 31.82 ? 808  ALA B CB  1 
ATOM   4958 N  N   . PRO B 1 329 ? 38.366  38.700  -17.510 1.00 31.90 ? 809  PRO B N   1 
ATOM   4959 C  CA  . PRO B 1 329 ? 37.434  37.867  -18.275 1.00 31.74 ? 809  PRO B CA  1 
ATOM   4960 C  C   . PRO B 1 329 ? 37.418  36.386  -17.892 1.00 31.78 ? 809  PRO B C   1 
ATOM   4961 O  O   . PRO B 1 329 ? 36.347  35.782  -17.864 1.00 31.89 ? 809  PRO B O   1 
ATOM   4962 C  CB  . PRO B 1 329 ? 37.933  38.022  -19.713 1.00 31.74 ? 809  PRO B CB  1 
ATOM   4963 C  CG  . PRO B 1 329 ? 38.531  39.362  -19.756 1.00 31.81 ? 809  PRO B CG  1 
ATOM   4964 C  CD  . PRO B 1 329 ? 39.117  39.617  -18.392 1.00 31.87 ? 809  PRO B CD  1 
ATOM   4965 N  N   . LEU B 1 330 ? 38.585  35.812  -17.606 1.00 31.70 ? 810  LEU B N   1 
ATOM   4966 C  CA  . LEU B 1 330 ? 38.700  34.369  -17.364 1.00 31.71 ? 810  LEU B CA  1 
ATOM   4967 C  C   . LEU B 1 330 ? 38.624  33.997  -15.883 1.00 31.40 ? 810  LEU B C   1 
ATOM   4968 O  O   . LEU B 1 330 ? 38.160  32.907  -15.541 1.00 31.67 ? 810  LEU B O   1 
ATOM   4969 C  CB  . LEU B 1 330 ? 40.003  33.833  -17.968 1.00 31.94 ? 810  LEU B CB  1 
ATOM   4970 C  CG  . LEU B 1 330 ? 40.352  32.355  -17.731 1.00 32.59 ? 810  LEU B CG  1 
ATOM   4971 C  CD1 . LEU B 1 330 ? 39.249  31.408  -18.195 1.00 32.37 ? 810  LEU B CD1 1 
ATOM   4972 C  CD2 . LEU B 1 330 ? 41.662  32.045  -18.440 1.00 33.44 ? 810  LEU B CD2 1 
ATOM   4973 N  N   . GLY B 1 331 ? 39.088  34.887  -15.011 1.00 30.84 ? 811  GLY B N   1 
ATOM   4974 C  CA  . GLY B 1 331 ? 39.068  34.627  -13.575 1.00 30.26 ? 811  GLY B CA  1 
ATOM   4975 C  C   . GLY B 1 331 ? 39.336  35.874  -12.763 1.00 29.75 ? 811  GLY B C   1 
ATOM   4976 O  O   . GLY B 1 331 ? 38.489  36.304  -11.981 1.00 29.79 ? 811  GLY B O   1 
ATOM   4977 N  N   . GLY B 1 332 ? 40.520  36.454  -12.953 1.00 29.18 ? 812  GLY B N   1 
ATOM   4978 C  CA  . GLY B 1 332 ? 40.916  37.678  -12.254 1.00 28.53 ? 812  GLY B CA  1 
ATOM   4979 C  C   . GLY B 1 332 ? 41.246  37.518  -10.780 1.00 28.07 ? 812  GLY B C   1 
ATOM   4980 O  O   . GLY B 1 332 ? 41.225  38.499  -10.042 1.00 28.56 ? 812  GLY B O   1 
ATOM   4981 N  N   . TYR B 1 333 ? 41.552  36.295  -10.347 1.00 27.57 ? 813  TYR B N   1 
ATOM   4982 C  CA  . TYR B 1 333 ? 41.896  36.006  -8.946  1.00 27.11 ? 813  TYR B CA  1 
ATOM   4983 C  C   . TYR B 1 333 ? 43.401  35.780  -8.804  1.00 27.12 ? 813  TYR B C   1 
ATOM   4984 O  O   . TYR B 1 333 ? 44.116  35.704  -9.802  1.00 26.90 ? 813  TYR B O   1 
ATOM   4985 C  CB  . TYR B 1 333 ? 41.111  34.787  -8.438  1.00 26.94 ? 813  TYR B CB  1 
ATOM   4986 C  CG  . TYR B 1 333 ? 39.654  35.047  -8.079  1.00 25.98 ? 813  TYR B CG  1 
ATOM   4987 C  CD1 . TYR B 1 333 ? 39.031  36.263  -8.366  1.00 25.47 ? 813  TYR B CD1 1 
ATOM   4988 C  CD2 . TYR B 1 333 ? 38.900  34.071  -7.436  1.00 25.64 ? 813  TYR B CD2 1 
ATOM   4989 C  CE1 . TYR B 1 333 ? 37.704  36.492  -8.033  1.00 24.70 ? 813  TYR B CE1 1 
ATOM   4990 C  CE2 . TYR B 1 333 ? 37.568  34.294  -7.103  1.00 25.54 ? 813  TYR B CE2 1 
ATOM   4991 C  CZ  . TYR B 1 333 ? 36.981  35.511  -7.406  1.00 24.94 ? 813  TYR B CZ  1 
ATOM   4992 O  OH  . TYR B 1 333 ? 35.673  35.750  -7.081  1.00 24.76 ? 813  TYR B OH  1 
ATOM   4993 N  N   . HIS B 1 334 ? 43.873  35.684  -7.560  1.00 27.31 ? 814  HIS B N   1 
ATOM   4994 C  CA  . HIS B 1 334 ? 45.309  35.633  -7.262  1.00 27.50 ? 814  HIS B CA  1 
ATOM   4995 C  C   . HIS B 1 334 ? 45.673  34.507  -6.290  1.00 27.27 ? 814  HIS B C   1 
ATOM   4996 O  O   . HIS B 1 334 ? 46.483  34.707  -5.389  1.00 27.46 ? 814  HIS B O   1 
ATOM   4997 C  CB  . HIS B 1 334 ? 45.768  36.970  -6.656  1.00 27.74 ? 814  HIS B CB  1 
ATOM   4998 C  CG  . HIS B 1 334 ? 45.319  38.178  -7.419  1.00 28.87 ? 814  HIS B CG  1 
ATOM   4999 N  ND1 . HIS B 1 334 ? 44.020  38.638  -7.386  1.00 30.38 ? 814  HIS B ND1 1 
ATOM   5000 C  CD2 . HIS B 1 334 ? 46.002  39.036  -8.214  1.00 30.03 ? 814  HIS B CD2 1 
ATOM   5001 C  CE1 . HIS B 1 334 ? 43.919  39.719  -8.138  1.00 30.83 ? 814  HIS B CE1 1 
ATOM   5002 N  NE2 . HIS B 1 334 ? 45.107  39.983  -8.651  1.00 30.70 ? 814  HIS B NE2 1 
ATOM   5003 N  N   . VAL B 1 335 ? 45.088  33.328  -6.465  1.00 27.24 ? 815  VAL B N   1 
ATOM   5004 C  CA  . VAL B 1 335 ? 45.386  32.199  -5.578  1.00 27.11 ? 815  VAL B CA  1 
ATOM   5005 C  C   . VAL B 1 335 ? 46.740  31.590  -5.956  1.00 27.15 ? 815  VAL B C   1 
ATOM   5006 O  O   . VAL B 1 335 ? 47.006  31.338  -7.130  1.00 27.02 ? 815  VAL B O   1 
ATOM   5007 C  CB  . VAL B 1 335 ? 44.295  31.101  -5.627  1.00 26.99 ? 815  VAL B CB  1 
ATOM   5008 C  CG1 . VAL B 1 335 ? 44.622  29.990  -4.639  1.00 26.53 ? 815  VAL B CG1 1 
ATOM   5009 C  CG2 . VAL B 1 335 ? 42.922  31.686  -5.334  1.00 26.69 ? 815  VAL B CG2 1 
ATOM   5010 N  N   . SER B 1 336 ? 47.583  31.352  -4.955  1.00 27.26 ? 816  SER B N   1 
ATOM   5011 C  CA  . SER B 1 336 ? 48.947  30.865  -5.180  1.00 27.41 ? 816  SER B CA  1 
ATOM   5012 C  C   . SER B 1 336 ? 49.005  29.345  -5.325  1.00 27.55 ? 816  SER B C   1 
ATOM   5013 O  O   . SER B 1 336 ? 48.053  28.638  -4.988  1.00 27.63 ? 816  SER B O   1 
ATOM   5014 C  CB  . SER B 1 336 ? 49.860  31.290  -4.029  1.00 27.30 ? 816  SER B CB  1 
ATOM   5015 O  OG  . SER B 1 336 ? 49.621  30.499  -2.875  1.00 27.39 ? 816  SER B OG  1 
ATOM   5016 N  N   . ALA B 1 337 ? 50.142  28.861  -5.816  1.00 27.67 ? 817  ALA B N   1 
ATOM   5017 C  CA  . ALA B 1 337 ? 50.405  27.427  -5.956  1.00 27.91 ? 817  ALA B CA  1 
ATOM   5018 C  C   . ALA B 1 337 ? 50.456  26.734  -4.595  1.00 28.09 ? 817  ALA B C   1 
ATOM   5019 O  O   . ALA B 1 337 ? 49.891  25.658  -4.424  1.00 28.39 ? 817  ALA B O   1 
ATOM   5020 C  CB  . ALA B 1 337 ? 51.717  27.199  -6.716  1.00 27.62 ? 817  ALA B CB  1 
ATOM   5021 N  N   . LYS B 1 338 ? 51.134  27.354  -3.632  1.00 28.50 ? 818  LYS B N   1 
ATOM   5022 C  CA  . LYS B 1 338 ? 51.240  26.796  -2.280  1.00 28.58 ? 818  LYS B CA  1 
ATOM   5023 C  C   . LYS B 1 338 ? 49.867  26.687  -1.626  1.00 28.51 ? 818  LYS B C   1 
ATOM   5024 O  O   . LYS B 1 338 ? 49.595  25.730  -0.901  1.00 28.44 ? 818  LYS B O   1 
ATOM   5025 C  CB  . LYS B 1 338 ? 52.168  27.640  -1.410  1.00 28.45 ? 818  LYS B CB  1 
ATOM   5026 C  CG  . LYS B 1 338 ? 53.617  27.590  -1.843  1.00 29.09 ? 818  LYS B CG  1 
ATOM   5027 N  N   . CYS B 1 339 ? 49.010  27.670  -1.892  1.00 28.51 ? 819  CYS B N   1 
ATOM   5028 C  CA  . CYS B 1 339 ? 47.635  27.647  -1.410  1.00 28.56 ? 819  CYS B CA  1 
ATOM   5029 C  C   . CYS B 1 339 ? 46.871  26.457  -1.977  1.00 28.50 ? 819  CYS B C   1 
ATOM   5030 O  O   . CYS B 1 339 ? 46.172  25.768  -1.240  1.00 28.42 ? 819  CYS B O   1 
ATOM   5031 C  CB  . CYS B 1 339 ? 46.920  28.944  -1.773  1.00 28.61 ? 819  CYS B CB  1 
ATOM   5032 S  SG  . CYS B 1 339 ? 45.297  29.106  -1.023  1.00 29.19 ? 819  CYS B SG  1 
ATOM   5033 N  N   . PHE B 1 340 ? 47.006  26.211  -3.280  1.00 28.68 ? 820  PHE B N   1 
ATOM   5034 C  CA  . PHE B 1 340 ? 46.409  25.018  -3.886  1.00 28.89 ? 820  PHE B CA  1 
ATOM   5035 C  C   . PHE B 1 340 ? 46.991  23.757  -3.254  1.00 28.85 ? 820  PHE B C   1 
ATOM   5036 O  O   . PHE B 1 340 ? 46.257  22.829  -2.932  1.00 28.82 ? 820  PHE B O   1 
ATOM   5037 C  CB  . PHE B 1 340 ? 46.614  24.981  -5.405  1.00 29.03 ? 820  PHE B CB  1 
ATOM   5038 C  CG  . PHE B 1 340 ? 45.683  25.877  -6.171  1.00 29.04 ? 820  PHE B CG  1 
ATOM   5039 C  CD1 . PHE B 1 340 ? 44.322  25.614  -6.206  1.00 29.14 ? 820  PHE B CD1 1 
ATOM   5040 C  CD2 . PHE B 1 340 ? 46.171  26.968  -6.879  1.00 28.96 ? 820  PHE B CD2 1 
ATOM   5041 C  CE1 . PHE B 1 340 ? 43.459  26.433  -6.919  1.00 29.30 ? 820  PHE B CE1 1 
ATOM   5042 C  CE2 . PHE B 1 340 ? 45.316  27.790  -7.593  1.00 29.10 ? 820  PHE B CE2 1 
ATOM   5043 C  CZ  . PHE B 1 340 ? 43.958  27.528  -7.611  1.00 29.31 ? 820  PHE B CZ  1 
ATOM   5044 N  N   . GLY B 1 341 ? 48.309  23.730  -3.081  1.00 28.96 ? 821  GLY B N   1 
ATOM   5045 C  CA  . GLY B 1 341 ? 48.976  22.626  -2.387  1.00 29.19 ? 821  GLY B CA  1 
ATOM   5046 C  C   . GLY B 1 341 ? 48.444  22.419  -0.975  1.00 29.32 ? 821  GLY B C   1 
ATOM   5047 O  O   . GLY B 1 341 ? 48.197  21.286  -0.550  1.00 29.33 ? 821  GLY B O   1 
ATOM   5048 N  N   . TYR B 1 342 ? 48.253  23.523  -0.256  1.00 29.40 ? 822  TYR B N   1 
ATOM   5049 C  CA  . TYR B 1 342 ? 47.757  23.480  1.113   1.00 29.54 ? 822  TYR B CA  1 
ATOM   5050 C  C   . TYR B 1 342 ? 46.280  23.081  1.178   1.00 29.68 ? 822  TYR B C   1 
ATOM   5051 O  O   . TYR B 1 342 ? 45.866  22.393  2.113   1.00 29.60 ? 822  TYR B O   1 
ATOM   5052 C  CB  . TYR B 1 342 ? 47.974  24.834  1.797   1.00 29.65 ? 822  TYR B CB  1 
ATOM   5053 C  CG  . TYR B 1 342 ? 47.872  24.785  3.305   1.00 29.75 ? 822  TYR B CG  1 
ATOM   5054 C  CD1 . TYR B 1 342 ? 48.643  23.892  4.041   1.00 29.86 ? 822  TYR B CD1 1 
ATOM   5055 C  CD2 . TYR B 1 342 ? 47.026  25.643  3.997   1.00 30.06 ? 822  TYR B CD2 1 
ATOM   5056 C  CE1 . TYR B 1 342 ? 48.560  23.840  5.414   1.00 29.48 ? 822  TYR B CE1 1 
ATOM   5057 C  CE2 . TYR B 1 342 ? 46.943  25.601  5.382   1.00 29.73 ? 822  TYR B CE2 1 
ATOM   5058 C  CZ  . TYR B 1 342 ? 47.712  24.694  6.078   1.00 29.28 ? 822  TYR B CZ  1 
ATOM   5059 O  OH  . TYR B 1 342 ? 47.649  24.631  7.443   1.00 29.54 ? 822  TYR B OH  1 
ATOM   5060 N  N   . MET B 1 343 ? 45.488  23.509  0.197   1.00 29.77 ? 823  MET B N   1 
ATOM   5061 C  CA  . MET B 1 343 ? 44.098  23.058  0.098   1.00 30.07 ? 823  MET B CA  1 
ATOM   5062 C  C   . MET B 1 343 ? 44.036  21.548  -0.171  1.00 29.87 ? 823  MET B C   1 
ATOM   5063 O  O   . MET B 1 343 ? 43.207  20.853  0.412   1.00 29.94 ? 823  MET B O   1 
ATOM   5064 C  CB  . MET B 1 343 ? 43.324  23.834  -0.979  1.00 30.36 ? 823  MET B CB  1 
ATOM   5065 C  CG  . MET B 1 343 ? 42.935  25.258  -0.570  1.00 31.01 ? 823  MET B CG  1 
ATOM   5066 S  SD  . MET B 1 343 ? 41.829  26.075  -1.745  1.00 34.14 ? 823  MET B SD  1 
ATOM   5067 C  CE  . MET B 1 343 ? 42.778  26.011  -3.264  1.00 33.72 ? 823  MET B CE  1 
ATOM   5068 N  N   . THR B 1 344 ? 44.914  21.051  -1.041  1.00 29.64 ? 824  THR B N   1 
ATOM   5069 C  CA  . THR B 1 344 ? 45.044  19.610  -1.276  1.00 29.60 ? 824  THR B CA  1 
ATOM   5070 C  C   . THR B 1 344 ? 45.433  18.898  0.019   1.00 29.51 ? 824  THR B C   1 
ATOM   5071 O  O   . THR B 1 344 ? 44.827  17.892  0.380   1.00 29.51 ? 824  THR B O   1 
ATOM   5072 C  CB  . THR B 1 344 ? 46.113  19.284  -2.362  1.00 29.76 ? 824  THR B CB  1 
ATOM   5073 O  OG1 . THR B 1 344 ? 45.737  19.872  -3.614  1.00 29.82 ? 824  THR B OG1 1 
ATOM   5074 C  CG2 . THR B 1 344 ? 46.278  17.771  -2.542  1.00 29.43 ? 824  THR B CG2 1 
ATOM   5075 N  N   . GLN B 1 345 ? 46.435  19.434  0.715   1.00 29.33 ? 825  GLN B N   1 
ATOM   5076 C  CA  . GLN B 1 345 ? 46.897  18.866  1.991   1.00 29.14 ? 825  GLN B CA  1 
ATOM   5077 C  C   . GLN B 1 345 ? 45.778  18.750  3.036   1.00 28.82 ? 825  GLN B C   1 
ATOM   5078 O  O   . GLN B 1 345 ? 45.744  17.796  3.809   1.00 28.75 ? 825  GLN B O   1 
ATOM   5079 C  CB  . GLN B 1 345 ? 48.055  19.697  2.566   1.00 29.11 ? 825  GLN B CB  1 
ATOM   5080 C  CG  . GLN B 1 345 ? 48.704  19.098  3.819   1.00 29.30 ? 825  GLN B CG  1 
ATOM   5081 C  CD  . GLN B 1 345 ? 49.603  20.081  4.550   1.00 29.92 ? 825  GLN B CD  1 
ATOM   5082 O  OE1 . GLN B 1 345 ? 49.606  20.141  5.781   1.00 30.13 ? 825  GLN B OE1 1 
ATOM   5083 N  NE2 . GLN B 1 345 ? 50.367  20.857  3.796   1.00 29.93 ? 825  GLN B NE2 1 
ATOM   5084 N  N   . GLN B 1 346 ? 44.871  19.720  3.065   1.00 28.62 ? 826  GLN B N   1 
ATOM   5085 C  CA  . GLN B 1 346 ? 43.774  19.698  4.035   1.00 28.43 ? 826  GLN B CA  1 
ATOM   5086 C  C   . GLN B 1 346 ? 42.723  18.644  3.699   1.00 28.19 ? 826  GLN B C   1 
ATOM   5087 O  O   . GLN B 1 346 ? 42.242  17.940  4.587   1.00 28.24 ? 826  GLN B O   1 
ATOM   5088 C  CB  . GLN B 1 346 ? 43.133  21.077  4.152   1.00 28.32 ? 826  GLN B CB  1 
ATOM   5089 C  CG  . GLN B 1 346 ? 44.027  22.068  4.877   1.00 28.34 ? 826  GLN B CG  1 
ATOM   5090 C  CD  . GLN B 1 346 ? 43.450  23.460  4.892   1.00 28.02 ? 826  GLN B CD  1 
ATOM   5091 O  OE1 . GLN B 1 346 ? 42.296  23.653  5.262   1.00 27.42 ? 826  GLN B OE1 1 
ATOM   5092 N  NE2 . GLN B 1 346 ? 44.254  24.442  4.496   1.00 27.82 ? 826  GLN B NE2 1 
ATOM   5093 N  N   . LEU B 1 347 ? 42.381  18.527  2.420   1.00 27.93 ? 827  LEU B N   1 
ATOM   5094 C  CA  . LEU B 1 347 ? 41.434  17.504  1.969   1.00 27.68 ? 827  LEU B CA  1 
ATOM   5095 C  C   . LEU B 1 347 ? 41.968  16.099  2.225   1.00 27.61 ? 827  LEU B C   1 
ATOM   5096 O  O   . LEU B 1 347 ? 41.189  15.164  2.408   1.00 27.35 ? 827  LEU B O   1 
ATOM   5097 C  CB  . LEU B 1 347 ? 41.104  17.675  0.484   1.00 27.45 ? 827  LEU B CB  1 
ATOM   5098 C  CG  . LEU B 1 347 ? 40.356  18.953  0.097   1.00 26.97 ? 827  LEU B CG  1 
ATOM   5099 C  CD1 . LEU B 1 347 ? 40.168  19.007  -1.412  1.00 26.65 ? 827  LEU B CD1 1 
ATOM   5100 C  CD2 . LEU B 1 347 ? 39.012  19.056  0.811   1.00 25.34 ? 827  LEU B CD2 1 
ATOM   5101 N  N   . MET B 1 348 ? 43.294  15.966  2.254   1.00 27.69 ? 828  MET B N   1 
ATOM   5102 C  CA  . MET B 1 348 ? 43.950  14.682  2.518   1.00 27.86 ? 828  MET B CA  1 
ATOM   5103 C  C   . MET B 1 348 ? 43.693  14.154  3.931   1.00 27.77 ? 828  MET B C   1 
ATOM   5104 O  O   . MET B 1 348 ? 43.915  12.976  4.193   1.00 28.08 ? 828  MET B O   1 
ATOM   5105 C  CB  . MET B 1 348 ? 45.462  14.777  2.256   1.00 27.83 ? 828  MET B CB  1 
ATOM   5106 C  CG  . MET B 1 348 ? 45.837  14.723  0.776   1.00 28.23 ? 828  MET B CG  1 
ATOM   5107 S  SD  . MET B 1 348 ? 47.526  15.272  0.435   1.00 29.78 ? 828  MET B SD  1 
ATOM   5108 C  CE  . MET B 1 348 ? 48.485  14.138  1.443   1.00 28.71 ? 828  MET B CE  1 
ATOM   5109 N  N   . ASN B 1 349 ? 43.236  15.017  4.836   1.00 27.62 ? 829  ASN B N   1 
ATOM   5110 C  CA  . ASN B 1 349 ? 42.805  14.585  6.166   1.00 27.59 ? 829  ASN B CA  1 
ATOM   5111 C  C   . ASN B 1 349 ? 41.429  13.919  6.176   1.00 27.33 ? 829  ASN B C   1 
ATOM   5112 O  O   . ASN B 1 349 ? 41.040  13.316  7.174   1.00 27.69 ? 829  ASN B O   1 
ATOM   5113 C  CB  . ASN B 1 349 ? 42.786  15.769  7.134   1.00 27.83 ? 829  ASN B CB  1 
ATOM   5114 C  CG  . ASN B 1 349 ? 44.170  16.286  7.447   1.00 28.42 ? 829  ASN B CG  1 
ATOM   5115 O  OD1 . ASN B 1 349 ? 45.047  15.527  7.847   1.00 30.04 ? 829  ASN B OD1 1 
ATOM   5116 N  ND2 . ASN B 1 349 ? 44.371  17.586  7.276   1.00 29.67 ? 829  ASN B ND2 1 
ATOM   5117 N  N   . LEU B 1 350 ? 40.685  14.044  5.081   1.00 26.98 ? 830  LEU B N   1 
ATOM   5118 C  CA  . LEU B 1 350 ? 39.368  13.427  4.967   1.00 26.67 ? 830  LEU B CA  1 
ATOM   5119 C  C   . LEU B 1 350 ? 39.477  12.029  4.357   1.00 26.65 ? 830  LEU B C   1 
ATOM   5120 O  O   . LEU B 1 350 ? 40.461  11.711  3.679   1.00 26.68 ? 830  LEU B O   1 
ATOM   5121 C  CB  . LEU B 1 350 ? 38.455  14.292  4.096   1.00 26.51 ? 830  LEU B CB  1 
ATOM   5122 C  CG  . LEU B 1 350 ? 38.284  15.761  4.498   1.00 26.07 ? 830  LEU B CG  1 
ATOM   5123 C  CD1 . LEU B 1 350 ? 37.586  16.550  3.389   1.00 24.84 ? 830  LEU B CD1 1 
ATOM   5124 C  CD2 . LEU B 1 350 ? 37.522  15.876  5.805   1.00 25.13 ? 830  LEU B CD2 1 
ATOM   5125 N  N   . ALA B 1 351 ? 38.470  11.199  4.621   1.00 26.50 ? 831  ALA B N   1 
ATOM   5126 C  CA  . ALA B 1 351 ? 38.318  9.889   3.976   1.00 26.39 ? 831  ALA B CA  1 
ATOM   5127 C  C   . ALA B 1 351 ? 39.576  9.019   4.019   1.00 26.30 ? 831  ALA B C   1 
ATOM   5128 O  O   . ALA B 1 351 ? 39.867  8.303   3.065   1.00 26.66 ? 831  ALA B O   1 
ATOM   5129 C  CB  . ALA B 1 351 ? 37.863  10.077  2.530   1.00 26.19 ? 831  ALA B CB  1 
ATOM   5130 N  N   . GLY B 1 352 ? 40.321  9.094   5.118   1.00 26.25 ? 832  GLY B N   1 
ATOM   5131 C  CA  . GLY B 1 352 ? 41.552  8.321   5.289   1.00 26.13 ? 832  GLY B CA  1 
ATOM   5132 C  C   . GLY B 1 352 ? 42.644  8.596   4.265   1.00 26.06 ? 832  GLY B C   1 
ATOM   5133 O  O   . GLY B 1 352 ? 43.542  7.772   4.080   1.00 26.23 ? 832  GLY B O   1 
ATOM   5134 N  N   . GLY B 1 353 ? 42.584  9.755   3.614   1.00 25.87 ? 833  GLY B N   1 
ATOM   5135 C  CA  . GLY B 1 353 ? 43.543  10.111  2.569   1.00 25.73 ? 833  GLY B CA  1 
ATOM   5136 C  C   . GLY B 1 353 ? 43.070  9.826   1.155   1.00 25.66 ? 833  GLY B C   1 
ATOM   5137 O  O   . GLY B 1 353 ? 43.768  10.154  0.203   1.00 25.66 ? 833  GLY B O   1 
ATOM   5138 N  N   . ALA B 1 354 ? 41.885  9.235   1.010   1.00 25.64 ? 834  ALA B N   1 
ATOM   5139 C  CA  . ALA B 1 354 ? 41.379  8.839   -0.306  1.00 25.80 ? 834  ALA B CA  1 
ATOM   5140 C  C   . ALA B 1 354 ? 40.894  10.068  -1.086  1.00 25.97 ? 834  ALA B C   1 
ATOM   5141 O  O   . ALA B 1 354 ? 39.726  10.468  -1.000  1.00 25.74 ? 834  ALA B O   1 
ATOM   5142 C  CB  . ALA B 1 354 ? 40.267  7.801   -0.163  1.00 25.67 ? 834  ALA B CB  1 
ATOM   5143 N  N   . VAL B 1 355 ? 41.822  10.661  -1.835  1.00 26.20 ? 835  VAL B N   1 
ATOM   5144 C  CA  . VAL B 1 355 ? 41.591  11.904  -2.561  1.00 26.22 ? 835  VAL B CA  1 
ATOM   5145 C  C   . VAL B 1 355 ? 42.025  11.759  -4.018  1.00 26.37 ? 835  VAL B C   1 
ATOM   5146 O  O   . VAL B 1 355 ? 43.116  11.277  -4.302  1.00 26.31 ? 835  VAL B O   1 
ATOM   5147 C  CB  . VAL B 1 355 ? 42.384  13.064  -1.920  1.00 26.29 ? 835  VAL B CB  1 
ATOM   5148 C  CG1 . VAL B 1 355 ? 42.187  14.358  -2.708  1.00 26.08 ? 835  VAL B CG1 1 
ATOM   5149 C  CG2 . VAL B 1 355 ? 41.972  13.247  -0.462  1.00 26.24 ? 835  VAL B CG2 1 
ATOM   5150 N  N   . VAL B 1 356 ? 41.160  12.181  -4.935  1.00 26.67 ? 836  VAL B N   1 
ATOM   5151 C  CA  . VAL B 1 356 ? 41.468  12.168  -6.355  1.00 26.88 ? 836  VAL B CA  1 
ATOM   5152 C  C   . VAL B 1 356 ? 41.230  13.558  -6.934  1.00 27.06 ? 836  VAL B C   1 
ATOM   5153 O  O   . VAL B 1 356 ? 40.114  14.057  -6.904  1.00 26.99 ? 836  VAL B O   1 
ATOM   5154 C  CB  . VAL B 1 356 ? 40.590  11.148  -7.117  1.00 27.02 ? 836  VAL B CB  1 
ATOM   5155 C  CG1 . VAL B 1 356 ? 40.990  11.097  -8.585  1.00 26.70 ? 836  VAL B CG1 1 
ATOM   5156 C  CG2 . VAL B 1 356 ? 40.696  9.759   -6.484  1.00 26.58 ? 836  VAL B CG2 1 
ATOM   5157 N  N   . LEU B 1 357 ? 42.283  14.185  -7.445  1.00 27.42 ? 837  LEU B N   1 
ATOM   5158 C  CA  . LEU B 1 357 ? 42.138  15.460  -8.134  1.00 27.90 ? 837  LEU B CA  1 
ATOM   5159 C  C   . LEU B 1 357 ? 42.027  15.221  -9.644  1.00 28.16 ? 837  LEU B C   1 
ATOM   5160 O  O   . LEU B 1 357 ? 42.730  14.371  -10.205 1.00 28.64 ? 837  LEU B O   1 
ATOM   5161 C  CB  . LEU B 1 357 ? 43.315  16.391  -7.824  1.00 27.90 ? 837  LEU B CB  1 
ATOM   5162 C  CG  . LEU B 1 357 ? 43.725  16.632  -6.362  1.00 28.01 ? 837  LEU B CG  1 
ATOM   5163 C  CD1 . LEU B 1 357 ? 44.314  18.030  -6.207  1.00 28.26 ? 837  LEU B CD1 1 
ATOM   5164 C  CD2 . LEU B 1 357 ? 42.594  16.438  -5.386  1.00 27.58 ? 837  LEU B CD2 1 
ATOM   5165 N  N   . ALA B 1 358 ? 41.126  15.958  -10.286 1.00 28.18 ? 838  ALA B N   1 
ATOM   5166 C  CA  . ALA B 1 358 ? 40.947  15.907  -11.738 1.00 28.33 ? 838  ALA B CA  1 
ATOM   5167 C  C   . ALA B 1 358 ? 41.083  17.321  -12.310 1.00 28.55 ? 838  ALA B C   1 
ATOM   5168 O  O   . ALA B 1 358 ? 40.414  18.252  -11.849 1.00 28.52 ? 838  ALA B O   1 
ATOM   5169 C  CB  . ALA B 1 358 ? 39.579  15.327  -12.086 1.00 28.00 ? 838  ALA B CB  1 
ATOM   5170 N  N   . LEU B 1 359 ? 41.945  17.475  -13.312 1.00 28.72 ? 839  LEU B N   1 
ATOM   5171 C  CA  . LEU B 1 359 ? 42.152  18.769  -13.947 1.00 29.00 ? 839  LEU B CA  1 
ATOM   5172 C  C   . LEU B 1 359 ? 40.839  19.236  -14.580 1.00 29.27 ? 839  LEU B C   1 
ATOM   5173 O  O   . LEU B 1 359 ? 40.190  18.470  -15.286 1.00 29.14 ? 839  LEU B O   1 
ATOM   5174 C  CB  . LEU B 1 359 ? 43.229  18.665  -15.031 1.00 29.02 ? 839  LEU B CB  1 
ATOM   5175 C  CG  . LEU B 1 359 ? 44.122  19.882  -15.318 1.00 29.41 ? 839  LEU B CG  1 
ATOM   5176 C  CD1 . LEU B 1 359 ? 44.521  19.892  -16.799 1.00 29.00 ? 839  LEU B CD1 1 
ATOM   5177 C  CD2 . LEU B 1 359 ? 43.476  21.202  -14.935 1.00 29.13 ? 839  LEU B CD2 1 
ATOM   5178 N  N   . GLU B 1 360 ? 40.441  20.475  -14.303 1.00 29.53 ? 840  GLU B N   1 
ATOM   5179 C  CA  . GLU B 1 360 ? 39.327  21.109  -15.011 1.00 29.81 ? 840  GLU B CA  1 
ATOM   5180 C  C   . GLU B 1 360 ? 39.881  22.300  -15.809 1.00 29.74 ? 840  GLU B C   1 
ATOM   5181 O  O   . GLU B 1 360 ? 40.507  22.094  -16.847 1.00 29.71 ? 840  GLU B O   1 
ATOM   5182 C  CB  . GLU B 1 360 ? 38.209  21.523  -14.044 1.00 29.98 ? 840  GLU B CB  1 
ATOM   5183 C  CG  . GLU B 1 360 ? 37.590  20.371  -13.231 1.00 31.16 ? 840  GLU B CG  1 
ATOM   5184 C  CD  . GLU B 1 360 ? 36.542  19.544  -13.985 1.00 32.39 ? 840  GLU B CD  1 
ATOM   5185 O  OE1 . GLU B 1 360 ? 36.276  19.809  -15.180 1.00 33.20 ? 840  GLU B OE1 1 
ATOM   5186 O  OE2 . GLU B 1 360 ? 35.975  18.621  -13.361 1.00 32.56 ? 840  GLU B OE2 1 
ATOM   5187 N  N   . GLY B 1 361 ? 39.681  23.527  -15.321 1.00 29.78 ? 841  GLY B N   1 
ATOM   5188 C  CA  . GLY B 1 361 ? 40.131  24.736  -16.016 1.00 29.63 ? 841  GLY B CA  1 
ATOM   5189 C  C   . GLY B 1 361 ? 41.545  25.163  -15.674 1.00 29.67 ? 841  GLY B C   1 
ATOM   5190 O  O   . GLY B 1 361 ? 42.274  24.456  -14.975 1.00 29.55 ? 841  GLY B O   1 
ATOM   5191 N  N   . GLY B 1 362 ? 41.919  26.339  -16.177 1.00 29.84 ? 842  GLY B N   1 
ATOM   5192 C  CA  . GLY B 1 362 ? 43.275  26.873  -16.061 1.00 29.76 ? 842  GLY B CA  1 
ATOM   5193 C  C   . GLY B 1 362 ? 43.878  27.015  -17.447 1.00 29.80 ? 842  GLY B C   1 
ATOM   5194 O  O   . GLY B 1 362 ? 43.834  26.081  -18.240 1.00 29.92 ? 842  GLY B O   1 
ATOM   5195 N  N   . HIS B 1 363 ? 44.442  28.186  -17.735 1.00 29.91 ? 843  HIS B N   1 
ATOM   5196 C  CA  . HIS B 1 363 ? 44.955  28.515  -19.067 1.00 29.90 ? 843  HIS B CA  1 
ATOM   5197 C  C   . HIS B 1 363 ? 46.437  28.879  -19.040 1.00 29.88 ? 843  HIS B C   1 
ATOM   5198 O  O   . HIS B 1 363 ? 47.229  28.335  -19.809 1.00 29.78 ? 843  HIS B O   1 
ATOM   5199 C  CB  . HIS B 1 363 ? 44.157  29.682  -19.650 1.00 29.90 ? 843  HIS B CB  1 
ATOM   5200 C  CG  . HIS B 1 363 ? 44.680  30.170  -20.964 1.00 30.16 ? 843  HIS B CG  1 
ATOM   5201 N  ND1 . HIS B 1 363 ? 44.632  29.409  -22.112 1.00 30.49 ? 843  HIS B ND1 1 
ATOM   5202 C  CD2 . HIS B 1 363 ? 45.272  31.336  -21.310 1.00 30.53 ? 843  HIS B CD2 1 
ATOM   5203 C  CE1 . HIS B 1 363 ? 45.171  30.087  -23.110 1.00 30.62 ? 843  HIS B CE1 1 
ATOM   5204 N  NE2 . HIS B 1 363 ? 45.568  31.260  -22.650 1.00 30.46 ? 843  HIS B NE2 1 
ATOM   5205 N  N   . ASP B 1 364 ? 46.799  29.815  -18.166 1.00 30.04 ? 844  ASP B N   1 
ATOM   5206 C  CA  . ASP B 1 364 ? 48.190  30.258  -18.034 1.00 30.13 ? 844  ASP B CA  1 
ATOM   5207 C  C   . ASP B 1 364 ? 49.095  29.072  -17.698 1.00 30.13 ? 844  ASP B C   1 
ATOM   5208 O  O   . ASP B 1 364 ? 49.020  28.516  -16.602 1.00 30.07 ? 844  ASP B O   1 
ATOM   5209 C  CB  . ASP B 1 364 ? 48.312  31.338  -16.957 1.00 30.02 ? 844  ASP B CB  1 
ATOM   5210 C  CG  . ASP B 1 364 ? 49.652  32.036  -16.986 1.00 30.36 ? 844  ASP B CG  1 
ATOM   5211 O  OD1 . ASP B 1 364 ? 49.791  33.026  -17.737 1.00 31.03 ? 844  ASP B OD1 1 
ATOM   5212 O  OD2 . ASP B 1 364 ? 50.565  31.602  -16.253 1.00 30.32 ? 844  ASP B OD2 1 
ATOM   5213 N  N   . LEU B 1 365 ? 49.944  28.690  -18.650 1.00 30.29 ? 845  LEU B N   1 
ATOM   5214 C  CA  . LEU B 1 365 ? 50.753  27.476  -18.522 1.00 30.34 ? 845  LEU B CA  1 
ATOM   5215 C  C   . LEU B 1 365 ? 51.652  27.490  -17.281 1.00 30.42 ? 845  LEU B C   1 
ATOM   5216 O  O   . LEU B 1 365 ? 51.777  26.474  -16.604 1.00 30.48 ? 845  LEU B O   1 
ATOM   5217 C  CB  . LEU B 1 365 ? 51.584  27.231  -19.787 1.00 30.12 ? 845  LEU B CB  1 
ATOM   5218 C  CG  . LEU B 1 365 ? 50.809  27.054  -21.103 1.00 30.21 ? 845  LEU B CG  1 
ATOM   5219 C  CD1 . LEU B 1 365 ? 51.747  26.664  -22.237 1.00 29.32 ? 845  LEU B CD1 1 
ATOM   5220 C  CD2 . LEU B 1 365 ? 49.685  26.024  -20.973 1.00 30.34 ? 845  LEU B CD2 1 
ATOM   5221 N  N   . THR B 1 366 ? 52.252  28.635  -16.967 1.00 30.57 ? 846  THR B N   1 
ATOM   5222 C  CA  . THR B 1 366 ? 53.120  28.726  -15.792 1.00 30.76 ? 846  THR B CA  1 
ATOM   5223 C  C   . THR B 1 366 ? 52.303  28.571  -14.503 1.00 30.71 ? 846  THR B C   1 
ATOM   5224 O  O   . THR B 1 366 ? 52.712  27.853  -13.588 1.00 30.71 ? 846  THR B O   1 
ATOM   5225 C  CB  . THR B 1 366 ? 53.972  30.037  -15.778 1.00 30.86 ? 846  THR B CB  1 
ATOM   5226 O  OG1 . THR B 1 366 ? 55.141  29.839  -14.977 1.00 30.96 ? 846  THR B OG1 1 
ATOM   5227 C  CG2 . THR B 1 366 ? 53.194  31.227  -15.222 1.00 31.26 ? 846  THR B CG2 1 
ATOM   5228 N  N   . ALA B 1 367 ? 51.137  29.213  -14.453 1.00 30.72 ? 847  ALA B N   1 
ATOM   5229 C  CA  . ALA B 1 367 ? 50.257  29.139  -13.287 1.00 30.63 ? 847  ALA B CA  1 
ATOM   5230 C  C   . ALA B 1 367 ? 49.808  27.705  -13.013 1.00 30.62 ? 847  ALA B C   1 
ATOM   5231 O  O   . ALA B 1 367 ? 49.985  27.203  -11.903 1.00 30.61 ? 847  ALA B O   1 
ATOM   5232 C  CB  . ALA B 1 367 ? 49.049  30.043  -13.475 1.00 30.52 ? 847  ALA B CB  1 
ATOM   5233 N  N   . ILE B 1 368 ? 49.245  27.046  -14.025 1.00 30.67 ? 848  ILE B N   1 
ATOM   5234 C  CA  . ILE B 1 368 ? 48.694  25.692  -13.844 1.00 30.78 ? 848  ILE B CA  1 
ATOM   5235 C  C   . ILE B 1 368 ? 49.789  24.645  -13.614 1.00 30.77 ? 848  ILE B C   1 
ATOM   5236 O  O   . ILE B 1 368 ? 49.547  23.637  -12.959 1.00 30.84 ? 848  ILE B O   1 
ATOM   5237 C  CB  . ILE B 1 368 ? 47.734  25.255  -15.004 1.00 30.61 ? 848  ILE B CB  1 
ATOM   5238 C  CG1 . ILE B 1 368 ? 48.489  24.971  -16.307 1.00 30.89 ? 848  ILE B CG1 1 
ATOM   5239 C  CG2 . ILE B 1 368 ? 46.676  26.314  -15.247 1.00 30.57 ? 848  ILE B CG2 1 
ATOM   5240 C  CD1 . ILE B 1 368 ? 47.575  24.526  -17.442 1.00 29.88 ? 848  ILE B CD1 1 
ATOM   5241 N  N   . CYS B 1 369 ? 50.986  24.892  -14.138 1.00 30.93 ? 849  CYS B N   1 
ATOM   5242 C  CA  . CYS B 1 369 ? 52.133  24.032  -13.849 1.00 31.03 ? 849  CYS B CA  1 
ATOM   5243 C  C   . CYS B 1 369 ? 52.616  24.208  -12.407 1.00 31.18 ? 849  CYS B C   1 
ATOM   5244 O  O   . CYS B 1 369 ? 52.925  23.222  -11.738 1.00 31.43 ? 849  CYS B O   1 
ATOM   5245 C  CB  . CYS B 1 369 ? 53.276  24.289  -14.834 1.00 31.12 ? 849  CYS B CB  1 
ATOM   5246 S  SG  . CYS B 1 369 ? 53.003  23.564  -16.471 1.00 31.07 ? 849  CYS B SG  1 
ATOM   5247 N  N   . ASP B 1 370 ? 52.675  25.452  -11.931 1.00 31.20 ? 850  ASP B N   1 
ATOM   5248 C  CA  . ASP B 1 370 ? 53.037  25.732  -10.535 1.00 31.19 ? 850  ASP B CA  1 
ATOM   5249 C  C   . ASP B 1 370 ? 52.014  25.147  -9.550  1.00 31.28 ? 850  ASP B C   1 
ATOM   5250 O  O   . ASP B 1 370 ? 52.382  24.568  -8.525  1.00 31.21 ? 850  ASP B O   1 
ATOM   5251 C  CB  . ASP B 1 370 ? 53.180  27.244  -10.294 1.00 31.15 ? 850  ASP B CB  1 
ATOM   5252 C  CG  . ASP B 1 370 ? 54.423  27.840  -10.947 1.00 31.00 ? 850  ASP B CG  1 
ATOM   5253 O  OD1 . ASP B 1 370 ? 55.237  27.091  -11.529 1.00 30.78 ? 850  ASP B OD1 1 
ATOM   5254 O  OD2 . ASP B 1 370 ? 54.584  29.076  -10.879 1.00 30.53 ? 850  ASP B OD2 1 
ATOM   5255 N  N   . ALA B 1 371 ? 50.731  25.302  -9.860  1.00 31.41 ? 851  ALA B N   1 
ATOM   5256 C  CA  . ALA B 1 371 ? 49.672  24.758  -9.011  1.00 31.61 ? 851  ALA B CA  1 
ATOM   5257 C  C   . ALA B 1 371 ? 49.711  23.225  -8.989  1.00 31.95 ? 851  ALA B C   1 
ATOM   5258 O  O   . ALA B 1 371 ? 49.628  22.619  -7.918  1.00 31.93 ? 851  ALA B O   1 
ATOM   5259 C  CB  . ALA B 1 371 ? 48.311  25.252  -9.474  1.00 31.41 ? 851  ALA B CB  1 
ATOM   5260 N  N   . SER B 1 372 ? 49.849  22.612  -10.167 1.00 32.25 ? 852  SER B N   1 
ATOM   5261 C  CA  . SER B 1 372 ? 49.895  21.149  -10.289 1.00 32.49 ? 852  SER B CA  1 
ATOM   5262 C  C   . SER B 1 372 ? 51.079  20.550  -9.530  1.00 32.58 ? 852  SER B C   1 
ATOM   5263 O  O   . SER B 1 372 ? 50.927  19.558  -8.817  1.00 32.72 ? 852  SER B O   1 
ATOM   5264 C  CB  . SER B 1 372 ? 49.963  20.731  -11.763 1.00 32.52 ? 852  SER B CB  1 
ATOM   5265 O  OG  . SER B 1 372 ? 48.755  21.052  -12.434 1.00 33.12 ? 852  SER B OG  1 
ATOM   5266 N  N   . GLU B 1 373 ? 52.254  21.154  -9.692  1.00 32.62 ? 853  GLU B N   1 
ATOM   5267 C  CA  . GLU B 1 373 ? 53.450  20.744  -8.955  1.00 32.66 ? 853  GLU B CA  1 
ATOM   5268 C  C   . GLU B 1 373 ? 53.207  20.783  -7.449  1.00 32.58 ? 853  GLU B C   1 
ATOM   5269 O  O   . GLU B 1 373 ? 53.618  19.872  -6.730  1.00 32.80 ? 853  GLU B O   1 
ATOM   5270 C  CB  . GLU B 1 373 ? 54.639  21.642  -9.320  1.00 32.70 ? 853  GLU B CB  1 
ATOM   5271 C  CG  . GLU B 1 373 ? 55.897  21.429  -8.467  1.00 33.12 ? 853  GLU B CG  1 
ATOM   5272 C  CD  . GLU B 1 373 ? 57.075  22.282  -8.916  1.00 33.81 ? 853  GLU B CD  1 
ATOM   5273 O  OE1 . GLU B 1 373 ? 56.957  22.974  -9.951  1.00 33.96 ? 853  GLU B OE1 1 
ATOM   5274 O  OE2 . GLU B 1 373 ? 58.128  22.257  -8.236  1.00 34.65 ? 853  GLU B OE2 1 
ATOM   5275 N  N   . ALA B 1 374 ? 52.546  21.841  -6.980  1.00 32.31 ? 854  ALA B N   1 
ATOM   5276 C  CA  . ALA B 1 374 ? 52.247  21.996  -5.556  1.00 32.11 ? 854  ALA B CA  1 
ATOM   5277 C  C   . ALA B 1 374 ? 51.265  20.929  -5.063  1.00 31.89 ? 854  ALA B C   1 
ATOM   5278 O  O   . ALA B 1 374 ? 51.452  20.358  -3.984  1.00 32.05 ? 854  ALA B O   1 
ATOM   5279 C  CB  . ALA B 1 374 ? 51.700  23.395  -5.271  1.00 31.97 ? 854  ALA B CB  1 
ATOM   5280 N  N   . CYS B 1 375 ? 50.227  20.667  -5.855  1.00 31.41 ? 855  CYS B N   1 
ATOM   5281 C  CA  . CYS B 1 375 ? 49.202  19.688  -5.488  1.00 31.20 ? 855  CYS B CA  1 
ATOM   5282 C  C   . CYS B 1 375 ? 49.751  18.269  -5.466  1.00 30.99 ? 855  CYS B C   1 
ATOM   5283 O  O   . CYS B 1 375 ? 49.471  17.506  -4.545  1.00 31.13 ? 855  CYS B O   1 
ATOM   5284 C  CB  . CYS B 1 375 ? 48.009  19.764  -6.445  1.00 31.28 ? 855  CYS B CB  1 
ATOM   5285 S  SG  . CYS B 1 375 ? 47.026  21.271  -6.255  1.00 31.12 ? 855  CYS B SG  1 
ATOM   5286 N  N   . VAL B 1 376 ? 50.537  17.922  -6.480  1.00 30.72 ? 856  VAL B N   1 
ATOM   5287 C  CA  . VAL B 1 376 ? 51.128  16.596  -6.566  1.00 30.39 ? 856  VAL B CA  1 
ATOM   5288 C  C   . VAL B 1 376 ? 52.160  16.417  -5.453  1.00 30.32 ? 856  VAL B C   1 
ATOM   5289 O  O   . VAL B 1 376 ? 52.287  15.330  -4.887  1.00 30.34 ? 856  VAL B O   1 
ATOM   5290 C  CB  . VAL B 1 376 ? 51.751  16.347  -7.959  1.00 30.36 ? 856  VAL B CB  1 
ATOM   5291 C  CG1 . VAL B 1 376 ? 52.478  15.011  -7.997  1.00 30.11 ? 856  VAL B CG1 1 
ATOM   5292 C  CG2 . VAL B 1 376 ? 50.667  16.389  -9.034  1.00 30.00 ? 856  VAL B CG2 1 
ATOM   5293 N  N   . ALA B 1 377 ? 52.884  17.489  -5.135  1.00 30.20 ? 857  ALA B N   1 
ATOM   5294 C  CA  . ALA B 1 377 ? 53.807  17.488  -4.000  1.00 30.04 ? 857  ALA B CA  1 
ATOM   5295 C  C   . ALA B 1 377 ? 53.049  17.221  -2.703  1.00 30.00 ? 857  ALA B C   1 
ATOM   5296 O  O   . ALA B 1 377 ? 53.508  16.457  -1.857  1.00 29.89 ? 857  ALA B O   1 
ATOM   5297 C  CB  . ALA B 1 377 ? 54.553  18.809  -3.914  1.00 29.98 ? 857  ALA B CB  1 
ATOM   5298 N  N   . ALA B 1 378 ? 51.878  17.843  -2.561  1.00 29.98 ? 858  ALA B N   1 
ATOM   5299 C  CA  . ALA B 1 378 ? 51.028  17.622  -1.390  1.00 29.88 ? 858  ALA B CA  1 
ATOM   5300 C  C   . ALA B 1 378 ? 50.567  16.167  -1.328  1.00 29.77 ? 858  ALA B C   1 
ATOM   5301 O  O   . ALA B 1 378 ? 50.634  15.532  -0.273  1.00 29.74 ? 858  ALA B O   1 
ATOM   5302 C  CB  . ALA B 1 378 ? 49.833  18.560  -1.408  1.00 29.69 ? 858  ALA B CB  1 
ATOM   5303 N  N   . LEU B 1 379 ? 50.124  15.642  -2.468  1.00 29.61 ? 859  LEU B N   1 
ATOM   5304 C  CA  . LEU B 1 379 ? 49.634  14.263  -2.549  1.00 29.61 ? 859  LEU B CA  1 
ATOM   5305 C  C   . LEU B 1 379 ? 50.663  13.233  -2.084  1.00 29.65 ? 859  LEU B C   1 
ATOM   5306 O  O   . LEU B 1 379 ? 50.302  12.225  -1.479  1.00 29.59 ? 859  LEU B O   1 
ATOM   5307 C  CB  . LEU B 1 379 ? 49.190  13.931  -3.976  1.00 29.51 ? 859  LEU B CB  1 
ATOM   5308 C  CG  . LEU B 1 379 ? 47.860  14.505  -4.461  1.00 29.16 ? 859  LEU B CG  1 
ATOM   5309 C  CD1 . LEU B 1 379 ? 47.609  13.999  -5.872  1.00 29.14 ? 859  LEU B CD1 1 
ATOM   5310 C  CD2 . LEU B 1 379 ? 46.707  14.140  -3.540  1.00 28.00 ? 859  LEU B CD2 1 
ATOM   5311 N  N   . LEU B 1 380 ? 51.937  13.496  -2.365  1.00 29.79 ? 860  LEU B N   1 
ATOM   5312 C  CA  . LEU B 1 380 ? 53.025  12.593  -1.981  1.00 30.05 ? 860  LEU B CA  1 
ATOM   5313 C  C   . LEU B 1 380 ? 53.356  12.644  -0.481  1.00 30.37 ? 860  LEU B C   1 
ATOM   5314 O  O   . LEU B 1 380 ? 54.102  11.799  0.012   1.00 30.44 ? 860  LEU B O   1 
ATOM   5315 C  CB  . LEU B 1 380 ? 54.280  12.893  -2.816  1.00 29.98 ? 860  LEU B CB  1 
ATOM   5316 C  CG  . LEU B 1 380 ? 54.171  12.558  -4.311  1.00 29.70 ? 860  LEU B CG  1 
ATOM   5317 C  CD1 . LEU B 1 380 ? 55.094  13.428  -5.158  1.00 28.97 ? 860  LEU B CD1 1 
ATOM   5318 C  CD2 . LEU B 1 380 ? 54.455  11.084  -4.547  1.00 29.51 ? 860  LEU B CD2 1 
ATOM   5319 N  N   . GLY B 1 381 ? 52.811  13.628  0.236   1.00 30.78 ? 861  GLY B N   1 
ATOM   5320 C  CA  . GLY B 1 381 ? 52.984  13.730  1.689   1.00 31.04 ? 861  GLY B CA  1 
ATOM   5321 C  C   . GLY B 1 381 ? 53.798  14.928  2.154   1.00 31.44 ? 861  GLY B C   1 
ATOM   5322 O  O   . GLY B 1 381 ? 54.025  15.099  3.356   1.00 31.35 ? 861  GLY B O   1 
ATOM   5323 N  N   . ASN B 1 382 ? 54.244  15.752  1.208   1.00 31.96 ? 862  ASN B N   1 
ATOM   5324 C  CA  . ASN B 1 382 ? 54.961  16.990  1.526   1.00 32.44 ? 862  ASN B CA  1 
ATOM   5325 C  C   . ASN B 1 382 ? 54.014  18.029  2.147   1.00 32.59 ? 862  ASN B C   1 
ATOM   5326 O  O   . ASN B 1 382 ? 52.881  18.196  1.692   1.00 32.67 ? 862  ASN B O   1 
ATOM   5327 C  CB  . ASN B 1 382 ? 55.674  17.528  0.268   1.00 32.58 ? 862  ASN B CB  1 
ATOM   5328 C  CG  . ASN B 1 382 ? 55.921  19.029  0.312   1.00 33.13 ? 862  ASN B CG  1 
ATOM   5329 O  OD1 . ASN B 1 382 ? 54.981  19.830  0.245   1.00 33.15 ? 862  ASN B OD1 1 
ATOM   5330 N  ND2 . ASN B 1 382 ? 57.192  19.417  0.392   1.00 33.45 ? 862  ASN B ND2 1 
ATOM   5331 N  N   . ARG B 1 383 ? 54.492  18.717  3.184   1.00 32.90 ? 863  ARG B N   1 
ATOM   5332 C  CA  . ARG B 1 383 ? 53.675  19.658  3.956   1.00 33.07 ? 863  ARG B CA  1 
ATOM   5333 C  C   . ARG B 1 383 ? 54.115  21.110  3.761   1.00 33.14 ? 863  ARG B C   1 
ATOM   5334 O  O   . ARG B 1 383 ? 55.299  21.430  3.876   1.00 33.04 ? 863  ARG B O   1 
ATOM   5335 C  CB  . ARG B 1 383 ? 53.716  19.300  5.450   1.00 33.09 ? 863  ARG B CB  1 
ATOM   5336 C  CG  . ARG B 1 383 ? 52.584  18.381  5.888   1.00 33.53 ? 863  ARG B CG  1 
ATOM   5337 C  CD  . ARG B 1 383 ? 52.734  17.903  7.328   1.00 34.00 ? 863  ARG B CD  1 
ATOM   5338 N  NE  . ARG B 1 383 ? 53.565  16.702  7.416   1.00 34.91 ? 863  ARG B NE  1 
ATOM   5339 C  CZ  . ARG B 1 383 ? 53.179  15.475  7.057   1.00 35.52 ? 863  ARG B CZ  1 
ATOM   5340 N  NH1 . ARG B 1 383 ? 51.957  15.250  6.575   1.00 35.27 ? 863  ARG B NH1 1 
ATOM   5341 N  NH2 . ARG B 1 383 ? 54.028  14.458  7.179   1.00 35.73 ? 863  ARG B NH2 1 
ATOM   5342 N  N   . VAL B 1 384 ? 53.149  21.973  3.448   1.00 33.23 ? 864  VAL B N   1 
ATOM   5343 C  CA  . VAL B 1 384 ? 53.351  23.417  3.448   1.00 33.31 ? 864  VAL B CA  1 
ATOM   5344 C  C   . VAL B 1 384 ? 53.265  23.936  4.880   1.00 33.40 ? 864  VAL B C   1 
ATOM   5345 O  O   . VAL B 1 384 ? 52.362  23.561  5.627   1.00 33.45 ? 864  VAL B O   1 
ATOM   5346 C  CB  . VAL B 1 384 ? 52.287  24.139  2.592   1.00 33.40 ? 864  VAL B CB  1 
ATOM   5347 C  CG1 . VAL B 1 384 ? 52.379  25.654  2.772   1.00 33.44 ? 864  VAL B CG1 1 
ATOM   5348 C  CG2 . VAL B 1 384 ? 52.431  23.757  1.122   1.00 33.27 ? 864  VAL B CG2 1 
ATOM   5349 N  N   . ASP B 1 385 ? 54.218  24.787  5.254   1.00 33.46 ? 865  ASP B N   1 
ATOM   5350 C  CA  . ASP B 1 385 ? 54.211  25.450  6.550   1.00 33.51 ? 865  ASP B CA  1 
ATOM   5351 C  C   . ASP B 1 385 ? 53.467  26.777  6.396   1.00 33.51 ? 865  ASP B C   1 
ATOM   5352 O  O   . ASP B 1 385 ? 53.940  27.664  5.688   1.00 33.57 ? 865  ASP B O   1 
ATOM   5353 C  CB  . ASP B 1 385 ? 55.648  25.700  7.023   1.00 33.55 ? 865  ASP B CB  1 
ATOM   5354 C  CG  . ASP B 1 385 ? 55.720  26.313  8.419   1.00 33.85 ? 865  ASP B CG  1 
ATOM   5355 O  OD1 . ASP B 1 385 ? 54.673  26.431  9.095   1.00 33.98 ? 865  ASP B OD1 1 
ATOM   5356 O  OD2 . ASP B 1 385 ? 56.840  26.673  8.844   1.00 34.48 ? 865  ASP B OD2 1 
ATOM   5357 N  N   . PRO B 1 386 ? 52.297  26.921  7.049   1.00 33.51 ? 866  PRO B N   1 
ATOM   5358 C  CA  . PRO B 1 386 ? 51.530  28.164  6.910   1.00 33.41 ? 866  PRO B CA  1 
ATOM   5359 C  C   . PRO B 1 386 ? 52.251  29.412  7.425   1.00 33.28 ? 866  PRO B C   1 
ATOM   5360 O  O   . PRO B 1 386 ? 51.938  30.520  6.994   1.00 33.23 ? 866  PRO B O   1 
ATOM   5361 C  CB  . PRO B 1 386 ? 50.275  27.892  7.747   1.00 33.38 ? 866  PRO B CB  1 
ATOM   5362 C  CG  . PRO B 1 386 ? 50.165  26.426  7.786   1.00 33.43 ? 866  PRO B CG  1 
ATOM   5363 C  CD  . PRO B 1 386 ? 51.563  25.935  7.861   1.00 33.56 ? 866  PRO B CD  1 
ATOM   5364 N  N   . LEU B 1 387 ? 53.206  29.232  8.333   1.00 33.17 ? 867  LEU B N   1 
ATOM   5365 C  CA  . LEU B 1 387 ? 53.976  30.354  8.866   1.00 33.10 ? 867  LEU B CA  1 
ATOM   5366 C  C   . LEU B 1 387 ? 55.015  30.894  7.874   1.00 32.95 ? 867  LEU B C   1 
ATOM   5367 O  O   . LEU B 1 387 ? 55.575  31.964  8.095   1.00 32.98 ? 867  LEU B O   1 
ATOM   5368 C  CB  . LEU B 1 387 ? 54.671  29.954  10.173  1.00 33.11 ? 867  LEU B CB  1 
ATOM   5369 C  CG  . LEU B 1 387 ? 53.802  29.328  11.272  1.00 33.21 ? 867  LEU B CG  1 
ATOM   5370 C  CD1 . LEU B 1 387 ? 54.577  29.267  12.582  1.00 32.64 ? 867  LEU B CD1 1 
ATOM   5371 C  CD2 . LEU B 1 387 ? 52.495  30.088  11.459  1.00 33.12 ? 867  LEU B CD2 1 
ATOM   5372 N  N   . SER B 1 388 ? 55.271  30.166  6.789   1.00 32.83 ? 868  SER B N   1 
ATOM   5373 C  CA  . SER B 1 388 ? 56.283  30.582  5.812   1.00 32.79 ? 868  SER B CA  1 
ATOM   5374 C  C   . SER B 1 388 ? 55.817  31.717  4.892   1.00 32.69 ? 868  SER B C   1 
ATOM   5375 O  O   . SER B 1 388 ? 56.648  32.437  4.344   1.00 32.78 ? 868  SER B O   1 
ATOM   5376 C  CB  . SER B 1 388 ? 56.752  29.390  4.973   1.00 32.71 ? 868  SER B CB  1 
ATOM   5377 O  OG  . SER B 1 388 ? 55.697  28.868  4.194   1.00 32.71 ? 868  SER B OG  1 
ATOM   5378 N  N   . GLU B 1 389 ? 54.506  31.871  4.713   1.00 32.57 ? 869  GLU B N   1 
ATOM   5379 C  CA  . GLU B 1 389 ? 53.968  32.956  3.889   1.00 32.52 ? 869  GLU B CA  1 
ATOM   5380 C  C   . GLU B 1 389 ? 53.460  34.100  4.769   1.00 32.29 ? 869  GLU B C   1 
ATOM   5381 O  O   . GLU B 1 389 ? 52.598  33.901  5.626   1.00 32.22 ? 869  GLU B O   1 
ATOM   5382 C  CB  . GLU B 1 389 ? 52.839  32.453  2.979   1.00 32.65 ? 869  GLU B CB  1 
ATOM   5383 C  CG  . GLU B 1 389 ? 53.203  31.262  2.064   1.00 33.18 ? 869  GLU B CG  1 
ATOM   5384 C  CD  . GLU B 1 389 ? 54.304  31.562  1.041   1.00 34.03 ? 869  GLU B CD  1 
ATOM   5385 O  OE1 . GLU B 1 389 ? 54.696  32.737  0.877   1.00 34.11 ? 869  GLU B OE1 1 
ATOM   5386 O  OE2 . GLU B 1 389 ? 54.781  30.604  0.389   1.00 35.26 ? 869  GLU B OE2 1 
ATOM   5387 N  N   . GLU B 1 390 ? 54.012  35.294  4.558   1.00 32.01 ? 870  GLU B N   1 
ATOM   5388 C  CA  . GLU B 1 390 ? 53.585  36.487  5.287   1.00 31.83 ? 870  GLU B CA  1 
ATOM   5389 C  C   . GLU B 1 390 ? 52.217  36.962  4.810   1.00 31.50 ? 870  GLU B C   1 
ATOM   5390 O  O   . GLU B 1 390 ? 51.419  37.464  5.600   1.00 31.53 ? 870  GLU B O   1 
ATOM   5391 C  CB  . GLU B 1 390 ? 54.614  37.611  5.136   1.00 31.90 ? 870  GLU B CB  1 
ATOM   5392 C  CG  . GLU B 1 390 ? 55.883  37.396  5.953   1.00 32.30 ? 870  GLU B CG  1 
ATOM   5393 C  CD  . GLU B 1 390 ? 55.688  37.643  7.442   1.00 32.91 ? 870  GLU B CD  1 
ATOM   5394 O  OE1 . GLU B 1 390 ? 54.837  38.479  7.812   1.00 33.21 ? 870  GLU B OE1 1 
ATOM   5395 O  OE2 . GLU B 1 390 ? 56.397  37.004  8.249   1.00 33.53 ? 870  GLU B OE2 1 
ATOM   5396 N  N   . GLY B 1 391 ? 51.947  36.789  3.520   1.00 31.16 ? 871  GLY B N   1 
ATOM   5397 C  CA  . GLY B 1 391 ? 50.645  37.114  2.947   1.00 30.92 ? 871  GLY B CA  1 
ATOM   5398 C  C   . GLY B 1 391 ? 49.484  36.332  3.544   1.00 30.68 ? 871  GLY B C   1 
ATOM   5399 O  O   . GLY B 1 391 ? 48.329  36.739  3.405   1.00 30.80 ? 871  GLY B O   1 
ATOM   5400 N  N   . TRP B 1 392 ? 49.782  35.213  4.205   1.00 30.28 ? 872  TRP B N   1 
ATOM   5401 C  CA  . TRP B 1 392 ? 48.754  34.389  4.852   1.00 29.93 ? 872  TRP B CA  1 
ATOM   5402 C  C   . TRP B 1 392 ? 48.428  34.882  6.269   1.00 29.77 ? 872  TRP B C   1 
ATOM   5403 O  O   . TRP B 1 392 ? 47.613  34.281  6.963   1.00 29.73 ? 872  TRP B O   1 
ATOM   5404 C  CB  . TRP B 1 392 ? 49.180  32.911  4.875   1.00 29.81 ? 872  TRP B CB  1 
ATOM   5405 C  CG  . TRP B 1 392 ? 49.205  32.241  3.509   1.00 29.45 ? 872  TRP B CG  1 
ATOM   5406 C  CD1 . TRP B 1 392 ? 49.183  32.855  2.285   1.00 29.24 ? 872  TRP B CD1 1 
ATOM   5407 C  CD2 . TRP B 1 392 ? 49.295  30.834  3.244   1.00 29.05 ? 872  TRP B CD2 1 
ATOM   5408 N  NE1 . TRP B 1 392 ? 49.227  31.919  1.282   1.00 29.04 ? 872  TRP B NE1 1 
ATOM   5409 C  CE2 . TRP B 1 392 ? 49.300  30.671  1.841   1.00 29.07 ? 872  TRP B CE2 1 
ATOM   5410 C  CE3 . TRP B 1 392 ? 49.362  29.695  4.056   1.00 28.90 ? 872  TRP B CE3 1 
ATOM   5411 C  CZ2 . TRP B 1 392 ? 49.373  29.416  1.231   1.00 29.32 ? 872  TRP B CZ2 1 
ATOM   5412 C  CZ3 . TRP B 1 392 ? 49.433  28.447  3.451   1.00 29.16 ? 872  TRP B CZ3 1 
ATOM   5413 C  CH2 . TRP B 1 392 ? 49.439  28.319  2.050   1.00 29.58 ? 872  TRP B CH2 1 
ATOM   5414 N  N   . LYS B 1 393 ? 49.068  35.969  6.697   1.00 29.70 ? 873  LYS B N   1 
ATOM   5415 C  CA  . LYS B 1 393 ? 48.709  36.638  7.948   1.00 29.59 ? 873  LYS B CA  1 
ATOM   5416 C  C   . LYS B 1 393 ? 47.655  37.728  7.716   1.00 29.50 ? 873  LYS B C   1 
ATOM   5417 O  O   . LYS B 1 393 ? 47.219  38.387  8.661   1.00 29.31 ? 873  LYS B O   1 
ATOM   5418 C  CB  . LYS B 1 393 ? 49.948  37.254  8.601   1.00 29.50 ? 873  LYS B CB  1 
ATOM   5419 C  CG  . LYS B 1 393 ? 51.046  36.255  8.934   1.00 29.60 ? 873  LYS B CG  1 
ATOM   5420 C  CD  . LYS B 1 393 ? 52.238  36.947  9.584   1.00 29.38 ? 873  LYS B CD  1 
ATOM   5421 C  CE  . LYS B 1 393 ? 53.412  35.999  9.783   1.00 29.45 ? 873  LYS B CE  1 
ATOM   5422 N  NZ  . LYS B 1 393 ? 54.583  36.691  10.431  1.00 29.51 ? 873  LYS B NZ  1 
ATOM   5423 N  N   . GLN B 1 394 ? 47.246  37.907  6.462   1.00 29.49 ? 874  GLN B N   1 
ATOM   5424 C  CA  . GLN B 1 394 ? 46.275  38.931  6.100   1.00 29.58 ? 874  GLN B CA  1 
ATOM   5425 C  C   . GLN B 1 394 ? 44.858  38.418  6.334   1.00 29.32 ? 874  GLN B C   1 
ATOM   5426 O  O   . GLN B 1 394 ? 44.586  37.237  6.151   1.00 29.36 ? 874  GLN B O   1 
ATOM   5427 C  CB  . GLN B 1 394 ? 46.438  39.319  4.627   1.00 29.77 ? 874  GLN B CB  1 
ATOM   5428 C  CG  . GLN B 1 394 ? 46.055  40.759  4.315   1.00 30.30 ? 874  GLN B CG  1 
ATOM   5429 C  CD  . GLN B 1 394 ? 47.261  41.642  4.106   1.00 30.94 ? 874  GLN B CD  1 
ATOM   5430 O  OE1 . GLN B 1 394 ? 47.590  42.486  4.943   1.00 31.59 ? 874  GLN B OE1 1 
ATOM   5431 N  NE2 . GLN B 1 394 ? 47.939  41.447  2.980   1.00 31.75 ? 874  GLN B NE2 1 
ATOM   5432 N  N   . LYS B 1 395 ? 43.964  39.312  6.746   1.00 29.21 ? 875  LYS B N   1 
ATOM   5433 C  CA  . LYS B 1 395 ? 42.556  38.972  6.922   1.00 29.04 ? 875  LYS B CA  1 
ATOM   5434 C  C   . LYS B 1 395 ? 41.906  38.805  5.558   1.00 28.78 ? 875  LYS B C   1 
ATOM   5435 O  O   . LYS B 1 395 ? 42.319  39.453  4.598   1.00 28.87 ? 875  LYS B O   1 
ATOM   5436 C  CB  . LYS B 1 395 ? 41.813  40.070  7.692   1.00 29.06 ? 875  LYS B CB  1 
ATOM   5437 C  CG  . LYS B 1 395 ? 42.024  40.055  9.195   1.00 29.57 ? 875  LYS B CG  1 
ATOM   5438 C  CD  . LYS B 1 395 ? 41.417  41.295  9.837   1.00 30.69 ? 875  LYS B CD  1 
ATOM   5439 C  CE  . LYS B 1 395 ? 41.388  41.198  11.358  1.00 31.55 ? 875  LYS B CE  1 
ATOM   5440 N  NZ  . LYS B 1 395 ? 40.365  40.217  11.836  1.00 32.37 ? 875  LYS B NZ  1 
ATOM   5441 N  N   . PRO B 1 396 ? 40.882  37.941  5.464   1.00 28.46 ? 876  PRO B N   1 
ATOM   5442 C  CA  . PRO B 1 396 ? 40.109  37.922  4.228   1.00 28.22 ? 876  PRO B CA  1 
ATOM   5443 C  C   . PRO B 1 396 ? 39.400  39.259  4.017   1.00 27.96 ? 876  PRO B C   1 
ATOM   5444 O  O   . PRO B 1 396 ? 38.972  39.889  4.990   1.00 27.75 ? 876  PRO B O   1 
ATOM   5445 C  CB  . PRO B 1 396 ? 39.094  36.796  4.458   1.00 28.22 ? 876  PRO B CB  1 
ATOM   5446 C  CG  . PRO B 1 396 ? 39.019  36.635  5.931   1.00 28.18 ? 876  PRO B CG  1 
ATOM   5447 C  CD  . PRO B 1 396 ? 40.378  36.965  6.446   1.00 28.45 ? 876  PRO B CD  1 
ATOM   5448 N  N   . ASN B 1 397 ? 39.288  39.690  2.763   1.00 27.61 ? 877  ASN B N   1 
ATOM   5449 C  CA  . ASN B 1 397 ? 38.605  40.943  2.457   1.00 27.35 ? 877  ASN B CA  1 
ATOM   5450 C  C   . ASN B 1 397 ? 37.125  40.893  2.840   1.00 27.28 ? 877  ASN B C   1 
ATOM   5451 O  O   . ASN B 1 397 ? 36.563  39.820  3.055   1.00 27.17 ? 877  ASN B O   1 
ATOM   5452 C  CB  . ASN B 1 397 ? 38.793  41.341  0.984   1.00 27.33 ? 877  ASN B CB  1 
ATOM   5453 C  CG  . ASN B 1 397 ? 38.106  40.396  0.015   1.00 26.95 ? 877  ASN B CG  1 
ATOM   5454 O  OD1 . ASN B 1 397 ? 36.931  40.065  0.171   1.00 26.83 ? 877  ASN B OD1 1 
ATOM   5455 N  ND2 . ASN B 1 397 ? 38.835  39.976  -1.011  1.00 26.51 ? 877  ASN B ND2 1 
ATOM   5456 N  N   . LEU B 1 398 ? 36.507  42.066  2.921   1.00 27.39 ? 878  LEU B N   1 
ATOM   5457 C  CA  . LEU B 1 398 ? 35.154  42.198  3.466   1.00 27.48 ? 878  LEU B CA  1 
ATOM   5458 C  C   . LEU B 1 398 ? 34.124  41.489  2.580   1.00 27.37 ? 878  LEU B C   1 
ATOM   5459 O  O   . LEU B 1 398 ? 33.174  40.891  3.088   1.00 27.15 ? 878  LEU B O   1 
ATOM   5460 C  CB  . LEU B 1 398 ? 34.777  43.678  3.643   1.00 27.41 ? 878  LEU B CB  1 
ATOM   5461 C  CG  . LEU B 1 398 ? 33.952  44.090  4.873   1.00 28.01 ? 878  LEU B CG  1 
ATOM   5462 C  CD1 . LEU B 1 398 ? 33.087  42.947  5.410   1.00 27.97 ? 878  LEU B CD1 1 
ATOM   5463 C  CD2 . LEU B 1 398 ? 34.858  44.635  5.980   1.00 28.16 ? 878  LEU B CD2 1 
ATOM   5464 N  N   . ASN B 1 399 ? 34.320  41.557  1.263   1.00 27.36 ? 879  ASN B N   1 
ATOM   5465 C  CA  . ASN B 1 399 ? 33.480  40.814  0.314   1.00 27.46 ? 879  ASN B CA  1 
ATOM   5466 C  C   . ASN B 1 399 ? 33.493  39.307  0.572   1.00 27.55 ? 879  ASN B C   1 
ATOM   5467 O  O   . ASN B 1 399 ? 32.440  38.666  0.572   1.00 27.59 ? 879  ASN B O   1 
ATOM   5468 C  CB  . ASN B 1 399 ? 33.903  41.091  -1.138  1.00 27.28 ? 879  ASN B CB  1 
ATOM   5469 C  CG  . ASN B 1 399 ? 33.433  42.452  -1.648  1.00 27.15 ? 879  ASN B CG  1 
ATOM   5470 O  OD1 . ASN B 1 399 ? 33.840  42.886  -2.724  1.00 27.53 ? 879  ASN B OD1 1 
ATOM   5471 N  ND2 . ASN B 1 399 ? 32.575  43.121  -0.886  1.00 25.43 ? 879  ASN B ND2 1 
ATOM   5472 N  N   . ALA B 1 400 ? 34.679  38.746  0.791   1.00 27.69 ? 880  ALA B N   1 
ATOM   5473 C  CA  . ALA B 1 400 ? 34.799  37.315  1.070   1.00 27.94 ? 880  ALA B CA  1 
ATOM   5474 C  C   . ALA B 1 400 ? 34.088  36.965  2.382   1.00 28.24 ? 880  ALA B C   1 
ATOM   5475 O  O   . ALA B 1 400 ? 33.405  35.937  2.470   1.00 28.10 ? 880  ALA B O   1 
ATOM   5476 C  CB  . ALA B 1 400 ? 36.257  36.899  1.124   1.00 27.77 ? 880  ALA B CB  1 
ATOM   5477 N  N   . ILE B 1 401 ? 34.248  37.832  3.384   1.00 28.36 ? 881  ILE B N   1 
ATOM   5478 C  CA  . ILE B 1 401 ? 33.576  37.673  4.675   1.00 28.60 ? 881  ILE B CA  1 
ATOM   5479 C  C   . ILE B 1 401 ? 32.055  37.748  4.509   1.00 28.84 ? 881  ILE B C   1 
ATOM   5480 O  O   . ILE B 1 401 ? 31.325  36.920  5.058   1.00 28.98 ? 881  ILE B O   1 
ATOM   5481 C  CB  . ILE B 1 401 ? 34.048  38.742  5.701   1.00 28.65 ? 881  ILE B CB  1 
ATOM   5482 C  CG1 . ILE B 1 401 ? 35.506  38.488  6.097   1.00 28.61 ? 881  ILE B CG1 1 
ATOM   5483 C  CG2 . ILE B 1 401 ? 33.165  38.731  6.944   1.00 28.15 ? 881  ILE B CG2 1 
ATOM   5484 C  CD1 . ILE B 1 401 ? 36.063  39.503  7.077   1.00 28.78 ? 881  ILE B CD1 1 
ATOM   5485 N  N   . ARG B 1 402 ? 31.597  38.740  3.747   1.00 28.97 ? 882  ARG B N   1 
ATOM   5486 C  CA  . ARG B 1 402 ? 30.174  38.903  3.417   1.00 29.14 ? 882  ARG B CA  1 
ATOM   5487 C  C   . ARG B 1 402 ? 29.624  37.656  2.729   1.00 29.09 ? 882  ARG B C   1 
ATOM   5488 O  O   . ARG B 1 402 ? 28.507  37.222  3.011   1.00 29.17 ? 882  ARG B O   1 
ATOM   5489 C  CB  . ARG B 1 402 ? 29.979  40.116  2.498   1.00 29.31 ? 882  ARG B CB  1 
ATOM   5490 C  CG  . ARG B 1 402 ? 28.629  40.822  2.631   1.00 30.15 ? 882  ARG B CG  1 
ATOM   5491 C  CD  . ARG B 1 402 ? 28.692  42.246  2.051   1.00 30.98 ? 882  ARG B CD  1 
ATOM   5492 N  NE  . ARG B 1 402 ? 27.614  43.109  2.539   1.00 31.72 ? 882  ARG B NE  1 
ATOM   5493 C  CZ  . ARG B 1 402 ? 27.568  43.670  3.750   1.00 32.45 ? 882  ARG B CZ  1 
ATOM   5494 N  NH1 . ARG B 1 402 ? 28.535  43.462  4.641   1.00 32.75 ? 882  ARG B NH1 1 
ATOM   5495 N  NH2 . ARG B 1 402 ? 26.538  44.443  4.081   1.00 33.08 ? 882  ARG B NH2 1 
ATOM   5496 N  N   . SER B 1 403 ? 30.420  37.088  1.825   1.00 28.89 ? 883  SER B N   1 
ATOM   5497 C  CA  . SER B 1 403 ? 30.022  35.904  1.078   1.00 28.82 ? 883  SER B CA  1 
ATOM   5498 C  C   . SER B 1 403 ? 29.962  34.661  1.968   1.00 28.84 ? 883  SER B C   1 
ATOM   5499 O  O   . SER B 1 403 ? 29.038  33.856  1.849   1.00 28.99 ? 883  SER B O   1 
ATOM   5500 C  CB  . SER B 1 403 ? 30.980  35.669  -0.094  1.00 28.78 ? 883  SER B CB  1 
ATOM   5501 O  OG  . SER B 1 403 ? 30.947  36.758  -0.999  1.00 28.64 ? 883  SER B OG  1 
ATOM   5502 N  N   . LEU B 1 404 ? 30.949  34.505  2.850   1.00 28.79 ? 884  LEU B N   1 
ATOM   5503 C  CA  . LEU B 1 404 ? 30.978  33.373  3.774   1.00 28.74 ? 884  LEU B CA  1 
ATOM   5504 C  C   . LEU B 1 404 ? 29.849  33.492  4.779   1.00 28.79 ? 884  LEU B C   1 
ATOM   5505 O  O   . LEU B 1 404 ? 29.259  32.495  5.164   1.00 28.90 ? 884  LEU B O   1 
ATOM   5506 C  CB  . LEU B 1 404 ? 32.322  33.266  4.504   1.00 28.55 ? 884  LEU B CB  1 
ATOM   5507 C  CG  . LEU B 1 404 ? 33.512  32.794  3.673   1.00 28.58 ? 884  LEU B CG  1 
ATOM   5508 C  CD1 . LEU B 1 404 ? 34.775  32.773  4.519   1.00 27.70 ? 884  LEU B CD1 1 
ATOM   5509 C  CD2 . LEU B 1 404 ? 33.246  31.416  3.046   1.00 28.29 ? 884  LEU B CD2 1 
ATOM   5510 N  N   . GLU B 1 405 ? 29.539  34.716  5.185   1.00 29.05 ? 885  GLU B N   1 
ATOM   5511 C  CA  . GLU B 1 405 ? 28.427  34.948  6.100   1.00 29.39 ? 885  GLU B CA  1 
ATOM   5512 C  C   . GLU B 1 405 ? 27.082  34.531  5.484   1.00 29.04 ? 885  GLU B C   1 
ATOM   5513 O  O   . GLU B 1 405 ? 26.219  33.995  6.178   1.00 28.99 ? 885  GLU B O   1 
ATOM   5514 C  CB  . GLU B 1 405 ? 28.396  36.413  6.540   1.00 29.60 ? 885  GLU B CB  1 
ATOM   5515 C  CG  . GLU B 1 405 ? 27.514  36.678  7.750   1.00 31.61 ? 885  GLU B CG  1 
ATOM   5516 C  CD  . GLU B 1 405 ? 27.873  35.803  8.949   1.00 34.25 ? 885  GLU B CD  1 
ATOM   5517 O  OE1 . GLU B 1 405 ? 29.082  35.698  9.280   1.00 35.23 ? 885  GLU B OE1 1 
ATOM   5518 O  OE2 . GLU B 1 405 ? 26.941  35.211  9.547   1.00 35.53 ? 885  GLU B OE2 1 
ATOM   5519 N  N   . ALA B 1 406 ? 26.916  34.766  4.184   1.00 28.85 ? 886  ALA B N   1 
ATOM   5520 C  CA  . ALA B 1 406 ? 25.713  34.330  3.465   1.00 28.77 ? 886  ALA B CA  1 
ATOM   5521 C  C   . ALA B 1 406 ? 25.605  32.804  3.459   1.00 28.58 ? 886  ALA B C   1 
ATOM   5522 O  O   . ALA B 1 406 ? 24.517  32.254  3.661   1.00 28.45 ? 886  ALA B O   1 
ATOM   5523 C  CB  . ALA B 1 406 ? 25.710  34.870  2.032   1.00 28.52 ? 886  ALA B CB  1 
ATOM   5524 N  N   . VAL B 1 407 ? 26.739  32.139  3.235   1.00 28.25 ? 887  VAL B N   1 
ATOM   5525 C  CA  . VAL B 1 407 ? 26.808  30.681  3.210   1.00 28.25 ? 887  VAL B CA  1 
ATOM   5526 C  C   . VAL B 1 407 ? 26.456  30.100  4.575   1.00 28.52 ? 887  VAL B C   1 
ATOM   5527 O  O   . VAL B 1 407 ? 25.652  29.176  4.671   1.00 28.44 ? 887  VAL B O   1 
ATOM   5528 C  CB  . VAL B 1 407 ? 28.219  30.184  2.791   1.00 28.20 ? 887  VAL B CB  1 
ATOM   5529 C  CG1 . VAL B 1 407 ? 28.319  28.674  2.921   1.00 27.73 ? 887  VAL B CG1 1 
ATOM   5530 C  CG2 . VAL B 1 407 ? 28.546  30.625  1.363   1.00 27.53 ? 887  VAL B CG2 1 
ATOM   5531 N  N   . ILE B 1 408 ? 27.050  30.664  5.623   1.00 28.74 ? 888  ILE B N   1 
ATOM   5532 C  CA  . ILE B 1 408 ? 26.817  30.217  6.997   1.00 28.95 ? 888  ILE B CA  1 
ATOM   5533 C  C   . ILE B 1 408 ? 25.336  30.342  7.349   1.00 29.21 ? 888  ILE B C   1 
ATOM   5534 O  O   . ILE B 1 408 ? 24.728  29.406  7.874   1.00 29.35 ? 888  ILE B O   1 
ATOM   5535 C  CB  . ILE B 1 408 ? 27.660  31.041  8.017   1.00 28.82 ? 888  ILE B CB  1 
ATOM   5536 C  CG1 . ILE B 1 408 ? 29.158  30.815  7.795   1.00 28.97 ? 888  ILE B CG1 1 
ATOM   5537 C  CG2 . ILE B 1 408 ? 27.317  30.655  9.444   1.00 28.29 ? 888  ILE B CG2 1 
ATOM   5538 C  CD1 . ILE B 1 408 ? 30.020  31.933  8.326   1.00 28.40 ? 888  ILE B CD1 1 
ATOM   5539 N  N   . ARG B 1 409 ? 24.777  31.510  7.044   1.00 29.40 ? 889  ARG B N   1 
ATOM   5540 C  CA  . ARG B 1 409 ? 23.381  31.834  7.324   1.00 29.66 ? 889  ARG B CA  1 
ATOM   5541 C  C   . ARG B 1 409 ? 22.421  30.851  6.657   1.00 29.42 ? 889  ARG B C   1 
ATOM   5542 O  O   . ARG B 1 409 ? 21.466  30.379  7.275   1.00 29.42 ? 889  ARG B O   1 
ATOM   5543 C  CB  . ARG B 1 409 ? 23.095  33.257  6.832   1.00 29.90 ? 889  ARG B CB  1 
ATOM   5544 C  CG  . ARG B 1 409 ? 21.725  33.815  7.193   1.00 31.46 ? 889  ARG B CG  1 
ATOM   5545 C  CD  . ARG B 1 409 ? 21.416  35.107  6.423   1.00 33.23 ? 889  ARG B CD  1 
ATOM   5546 N  NE  . ARG B 1 409 ? 21.808  35.017  5.010   1.00 34.72 ? 889  ARG B NE  1 
ATOM   5547 C  CZ  . ARG B 1 409 ? 21.176  34.298  4.078   1.00 35.66 ? 889  ARG B CZ  1 
ATOM   5548 N  NH1 . ARG B 1 409 ? 20.090  33.586  4.376   1.00 36.34 ? 889  ARG B NH1 1 
ATOM   5549 N  NH2 . ARG B 1 409 ? 21.637  34.292  2.828   1.00 35.84 ? 889  ARG B NH2 1 
ATOM   5550 N  N   . VAL B 1 410 ? 22.683  30.550  5.391   1.00 29.23 ? 890  VAL B N   1 
ATOM   5551 C  CA  . VAL B 1 410 ? 21.850  29.628  4.623   1.00 29.10 ? 890  VAL B CA  1 
ATOM   5552 C  C   . VAL B 1 410 ? 21.976  28.193  5.141   1.00 28.80 ? 890  VAL B C   1 
ATOM   5553 O  O   . VAL B 1 410 ? 20.961  27.515  5.343   1.00 28.53 ? 890  VAL B O   1 
ATOM   5554 C  CB  . VAL B 1 410 ? 22.202  29.689  3.110   1.00 29.22 ? 890  VAL B CB  1 
ATOM   5555 C  CG1 . VAL B 1 410 ? 21.831  28.391  2.399   1.00 29.65 ? 890  VAL B CG1 1 
ATOM   5556 C  CG2 . VAL B 1 410 ? 21.514  30.881  2.460   1.00 29.24 ? 890  VAL B CG2 1 
ATOM   5557 N  N   . HIS B 1 411 ? 23.215  27.753  5.377   1.00 28.28 ? 891  HIS B N   1 
ATOM   5558 C  CA  . HIS B 1 411 ? 23.485  26.359  5.739   1.00 28.06 ? 891  HIS B CA  1 
ATOM   5559 C  C   . HIS B 1 411 ? 23.440  26.046  7.237   1.00 28.12 ? 891  HIS B C   1 
ATOM   5560 O  O   . HIS B 1 411 ? 23.589  24.887  7.629   1.00 27.92 ? 891  HIS B O   1 
ATOM   5561 C  CB  . HIS B 1 411 ? 24.803  25.887  5.122   1.00 27.88 ? 891  HIS B CB  1 
ATOM   5562 C  CG  . HIS B 1 411 ? 24.658  25.435  3.706   1.00 27.66 ? 891  HIS B CG  1 
ATOM   5563 N  ND1 . HIS B 1 411 ? 24.074  24.232  3.371   1.00 26.97 ? 891  HIS B ND1 1 
ATOM   5564 C  CD2 . HIS B 1 411 ? 24.978  26.038  2.537   1.00 27.11 ? 891  HIS B CD2 1 
ATOM   5565 C  CE1 . HIS B 1 411 ? 24.061  24.105  2.057   1.00 26.75 ? 891  HIS B CE1 1 
ATOM   5566 N  NE2 . HIS B 1 411 ? 24.602  25.187  1.527   1.00 26.67 ? 891  HIS B NE2 1 
ATOM   5567 N  N   . SER B 1 412 ? 23.207  27.063  8.065   1.00 28.11 ? 892  SER B N   1 
ATOM   5568 C  CA  . SER B 1 412 ? 22.910  26.842  9.479   1.00 28.26 ? 892  SER B CA  1 
ATOM   5569 C  C   . SER B 1 412 ? 21.673  25.948  9.670   1.00 28.40 ? 892  SER B C   1 
ATOM   5570 O  O   . SER B 1 412 ? 21.511  25.313  10.710  1.00 28.51 ? 892  SER B O   1 
ATOM   5571 C  CB  . SER B 1 412 ? 22.686  28.175  10.189  1.00 28.28 ? 892  SER B CB  1 
ATOM   5572 O  OG  . SER B 1 412 ? 21.584  28.868  9.627   1.00 27.98 ? 892  SER B OG  1 
ATOM   5573 N  N   . LYS B 1 413 ? 20.804  25.905  8.664   1.00 28.52 ? 893  LYS B N   1 
ATOM   5574 C  CA  . LYS B 1 413 ? 19.620  25.053  8.698   1.00 28.75 ? 893  LYS B CA  1 
ATOM   5575 C  C   . LYS B 1 413 ? 19.962  23.561  8.598   1.00 28.68 ? 893  LYS B C   1 
ATOM   5576 O  O   . LYS B 1 413 ? 19.197  22.718  9.061   1.00 28.75 ? 893  LYS B O   1 
ATOM   5577 C  CB  . LYS B 1 413 ? 18.671  25.450  7.557   1.00 28.91 ? 893  LYS B CB  1 
ATOM   5578 C  CG  . LYS B 1 413 ? 17.279  24.851  7.642   1.00 29.25 ? 893  LYS B CG  1 
ATOM   5579 C  CD  . LYS B 1 413 ? 16.466  25.192  6.401   1.00 30.26 ? 893  LYS B CD  1 
ATOM   5580 C  CE  . LYS B 1 413 ? 15.075  24.555  6.441   1.00 31.35 ? 893  LYS B CE  1 
ATOM   5581 N  NZ  . LYS B 1 413 ? 14.347  24.701  5.140   1.00 32.07 ? 893  LYS B NZ  1 
ATOM   5582 N  N   . TYR B 1 414 ? 21.111  23.243  8.006   1.00 28.77 ? 894  TYR B N   1 
ATOM   5583 C  CA  . TYR B 1 414 ? 21.453  21.861  7.662   1.00 28.67 ? 894  TYR B CA  1 
ATOM   5584 C  C   . TYR B 1 414 ? 22.682  21.284  8.374   1.00 28.75 ? 894  TYR B C   1 
ATOM   5585 O  O   . TYR B 1 414 ? 22.785  20.070  8.496   1.00 28.81 ? 894  TYR B O   1 
ATOM   5586 C  CB  . TYR B 1 414 ? 21.656  21.754  6.150   1.00 28.62 ? 894  TYR B CB  1 
ATOM   5587 C  CG  . TYR B 1 414 ? 20.537  22.372  5.344   1.00 28.24 ? 894  TYR B CG  1 
ATOM   5588 C  CD1 . TYR B 1 414 ? 19.302  21.743  5.238   1.00 27.87 ? 894  TYR B CD1 1 
ATOM   5589 C  CD2 . TYR B 1 414 ? 20.712  23.589  4.690   1.00 28.17 ? 894  TYR B CD2 1 
ATOM   5590 C  CE1 . TYR B 1 414 ? 18.273  22.308  4.500   1.00 28.07 ? 894  TYR B CE1 1 
ATOM   5591 C  CE2 . TYR B 1 414 ? 19.687  24.163  3.946   1.00 27.57 ? 894  TYR B CE2 1 
ATOM   5592 C  CZ  . TYR B 1 414 ? 18.475  23.517  3.851   1.00 28.02 ? 894  TYR B CZ  1 
ATOM   5593 O  OH  . TYR B 1 414 ? 17.453  24.084  3.121   1.00 28.20 ? 894  TYR B OH  1 
ATOM   5594 N  N   . TRP B 1 415 ? 23.603  22.127  8.839   1.00 28.85 ? 895  TRP B N   1 
ATOM   5595 C  CA  . TRP B 1 415 ? 24.864  21.647  9.424   1.00 29.05 ? 895  TRP B CA  1 
ATOM   5596 C  C   . TRP B 1 415 ? 25.145  22.266  10.797  1.00 29.40 ? 895  TRP B C   1 
ATOM   5597 O  O   . TRP B 1 415 ? 25.106  23.493  10.957  1.00 29.17 ? 895  TRP B O   1 
ATOM   5598 C  CB  . TRP B 1 415 ? 26.030  21.931  8.473   1.00 29.03 ? 895  TRP B CB  1 
ATOM   5599 C  CG  . TRP B 1 415 ? 25.820  21.387  7.084   1.00 29.17 ? 895  TRP B CG  1 
ATOM   5600 C  CD1 . TRP B 1 415 ? 25.301  22.057  6.013   1.00 29.66 ? 895  TRP B CD1 1 
ATOM   5601 C  CD2 . TRP B 1 415 ? 26.107  20.061  6.623   1.00 29.00 ? 895  TRP B CD2 1 
ATOM   5602 N  NE1 . TRP B 1 415 ? 25.251  21.234  4.913   1.00 29.43 ? 895  TRP B NE1 1 
ATOM   5603 C  CE2 . TRP B 1 415 ? 25.741  20.004  5.257   1.00 28.98 ? 895  TRP B CE2 1 
ATOM   5604 C  CE3 . TRP B 1 415 ? 26.637  18.915  7.228   1.00 28.70 ? 895  TRP B CE3 1 
ATOM   5605 C  CZ2 . TRP B 1 415 ? 25.893  18.850  4.487   1.00 28.21 ? 895  TRP B CZ2 1 
ATOM   5606 C  CZ3 . TRP B 1 415 ? 26.788  17.765  6.462   1.00 28.57 ? 895  TRP B CZ3 1 
ATOM   5607 C  CH2 . TRP B 1 415 ? 26.416  17.742  5.104   1.00 28.32 ? 895  TRP B CH2 1 
ATOM   5608 N  N   . GLY B 1 416 ? 25.433  21.405  11.777  1.00 29.75 ? 896  GLY B N   1 
ATOM   5609 C  CA  . GLY B 1 416 ? 25.679  21.824  13.158  1.00 30.15 ? 896  GLY B CA  1 
ATOM   5610 C  C   . GLY B 1 416 ? 26.875  22.746  13.312  1.00 30.59 ? 896  GLY B C   1 
ATOM   5611 O  O   . GLY B 1 416 ? 26.868  23.658  14.142  1.00 30.44 ? 896  GLY B O   1 
ATOM   5612 N  N   . CYS B 1 417 ? 27.905  22.515  12.504  1.00 31.13 ? 897  CYS B N   1 
ATOM   5613 C  CA  . CYS B 1 417 ? 29.086  23.368  12.513  1.00 31.67 ? 897  CYS B CA  1 
ATOM   5614 C  C   . CYS B 1 417 ? 28.767  24.788  12.028  1.00 31.88 ? 897  CYS B C   1 
ATOM   5615 O  O   . CYS B 1 417 ? 29.453  25.737  12.403  1.00 32.09 ? 897  CYS B O   1 
ATOM   5616 C  CB  . CYS B 1 417 ? 30.191  22.745  11.661  1.00 31.56 ? 897  CYS B CB  1 
ATOM   5617 S  SG  . CYS B 1 417 ? 29.702  22.450  9.957   1.00 32.96 ? 897  CYS B SG  1 
ATOM   5618 N  N   . MET B 1 418 ? 27.725  24.927  11.207  1.00 32.26 ? 898  MET B N   1 
ATOM   5619 C  CA  . MET B 1 418 ? 27.258  26.240  10.743  1.00 32.56 ? 898  MET B CA  1 
ATOM   5620 C  C   . MET B 1 418 ? 26.278  26.922  11.707  1.00 32.57 ? 898  MET B C   1 
ATOM   5621 O  O   . MET B 1 418 ? 25.877  28.057  11.463  1.00 32.57 ? 898  MET B O   1 
ATOM   5622 C  CB  . MET B 1 418 ? 26.581  26.117  9.372   1.00 32.60 ? 898  MET B CB  1 
ATOM   5623 C  CG  . MET B 1 418 ? 27.468  25.611  8.253   1.00 33.26 ? 898  MET B CG  1 
ATOM   5624 S  SD  . MET B 1 418 ? 28.840  26.716  7.883   1.00 34.34 ? 898  MET B SD  1 
ATOM   5625 C  CE  . MET B 1 418 ? 30.110  26.075  8.978   1.00 34.72 ? 898  MET B CE  1 
ATOM   5626 N  N   . GLN B 1 419 ? 25.889  26.248  12.787  1.00 32.76 ? 899  GLN B N   1 
ATOM   5627 C  CA  . GLN B 1 419 ? 24.860  26.781  13.682  1.00 32.98 ? 899  GLN B CA  1 
ATOM   5628 C  C   . GLN B 1 419 ? 25.411  27.715  14.763  1.00 33.01 ? 899  GLN B C   1 
ATOM   5629 O  O   . GLN B 1 419 ? 26.186  27.300  15.620  1.00 32.76 ? 899  GLN B O   1 
ATOM   5630 C  CB  . GLN B 1 419 ? 24.039  25.651  14.310  1.00 33.04 ? 899  GLN B CB  1 
ATOM   5631 C  CG  . GLN B 1 419 ? 23.001  25.102  13.349  1.00 33.68 ? 899  GLN B CG  1 
ATOM   5632 C  CD  . GLN B 1 419 ? 22.185  23.946  13.906  1.00 34.37 ? 899  GLN B CD  1 
ATOM   5633 O  OE1 . GLN B 1 419 ? 21.740  23.079  13.153  1.00 34.95 ? 899  GLN B OE1 1 
ATOM   5634 N  NE2 . GLN B 1 419 ? 21.974  23.934  15.218  1.00 34.44 ? 899  GLN B NE2 1 
ATOM   5635 N  N   . ARG B 1 420 ? 24.981  28.976  14.685  1.00 33.26 ? 900  ARG B N   1 
ATOM   5636 C  CA  . ARG B 1 420 ? 25.257  30.036  15.673  1.00 33.30 ? 900  ARG B CA  1 
ATOM   5637 C  C   . ARG B 1 420 ? 26.743  30.337  15.849  1.00 33.33 ? 900  ARG B C   1 
ATOM   5638 O  O   . ARG B 1 420 ? 27.355  30.978  14.987  1.00 33.38 ? 900  ARG B O   1 
ATOM   5639 C  CB  . ARG B 1 420 ? 24.544  29.756  17.013  1.00 33.28 ? 900  ARG B CB  1 
ATOM   5640 C  CG  . ARG B 1 420 ? 25.325  28.998  18.082  1.00 33.44 ? 900  ARG B CG  1 
ATOM   5641 C  CD  . ARG B 1 420 ? 24.498  28.883  19.363  1.00 33.13 ? 900  ARG B CD  1 
ATOM   5642 N  N   . THR C 1 39  ? 25.157  -10.168 23.604  1.00 29.55 ? 519  THR C N   1 
ATOM   5643 C  CA  . THR C 1 39  ? 24.850  -11.109 22.490  1.00 29.59 ? 519  THR C CA  1 
ATOM   5644 C  C   . THR C 1 39  ? 26.128  -11.681 21.870  1.00 29.63 ? 519  THR C C   1 
ATOM   5645 O  O   . THR C 1 39  ? 27.141  -10.989 21.754  1.00 29.68 ? 519  THR C O   1 
ATOM   5646 C  CB  . THR C 1 39  ? 24.037  -10.413 21.381  1.00 29.57 ? 519  THR C CB  1 
ATOM   5647 O  OG1 . THR C 1 39  ? 22.909  -9.738  21.953  1.00 29.89 ? 519  THR C OG1 1 
ATOM   5648 C  CG2 . THR C 1 39  ? 23.549  -11.424 20.357  1.00 29.63 ? 519  THR C CG2 1 
ATOM   5649 N  N   . THR C 1 40  ? 26.067  -12.952 21.478  1.00 29.60 ? 520  THR C N   1 
ATOM   5650 C  CA  . THR C 1 40  ? 27.145  -13.598 20.736  1.00 29.48 ? 520  THR C CA  1 
ATOM   5651 C  C   . THR C 1 40  ? 27.123  -13.127 19.285  1.00 29.66 ? 520  THR C C   1 
ATOM   5652 O  O   . THR C 1 40  ? 26.051  -12.974 18.697  1.00 29.54 ? 520  THR C O   1 
ATOM   5653 C  CB  . THR C 1 40  ? 26.979  -15.127 20.748  1.00 29.44 ? 520  THR C CB  1 
ATOM   5654 O  OG1 . THR C 1 40  ? 26.993  -15.604 22.099  1.00 29.05 ? 520  THR C OG1 1 
ATOM   5655 C  CG2 . THR C 1 40  ? 28.088  -15.803 19.949  1.00 29.27 ? 520  THR C CG2 1 
ATOM   5656 N  N   . GLY C 1 41  ? 28.304  -12.909 18.709  1.00 29.86 ? 521  GLY C N   1 
ATOM   5657 C  CA  . GLY C 1 41  ? 28.424  -12.450 17.321  1.00 30.02 ? 521  GLY C CA  1 
ATOM   5658 C  C   . GLY C 1 41  ? 28.972  -13.514 16.385  1.00 30.11 ? 521  GLY C C   1 
ATOM   5659 O  O   . GLY C 1 41  ? 29.738  -14.378 16.806  1.00 30.15 ? 521  GLY C O   1 
ATOM   5660 N  N   . LEU C 1 42  ? 28.571  -13.451 15.116  1.00 30.26 ? 522  LEU C N   1 
ATOM   5661 C  CA  . LEU C 1 42  ? 29.112  -14.334 14.080  1.00 30.40 ? 522  LEU C CA  1 
ATOM   5662 C  C   . LEU C 1 42  ? 29.527  -13.534 12.848  1.00 30.56 ? 522  LEU C C   1 
ATOM   5663 O  O   . LEU C 1 42  ? 28.813  -12.626 12.416  1.00 30.68 ? 522  LEU C O   1 
ATOM   5664 C  CB  . LEU C 1 42  ? 28.088  -15.399 13.680  1.00 30.40 ? 522  LEU C CB  1 
ATOM   5665 C  CG  . LEU C 1 42  ? 27.656  -16.401 14.753  1.00 30.43 ? 522  LEU C CG  1 
ATOM   5666 C  CD1 . LEU C 1 42  ? 26.632  -17.368 14.171  1.00 30.34 ? 522  LEU C CD1 1 
ATOM   5667 C  CD2 . LEU C 1 42  ? 28.842  -17.163 15.325  1.00 30.36 ? 522  LEU C CD2 1 
ATOM   5668 N  N   . ILE C 1 43  ? 30.682  -13.885 12.287  1.00 30.81 ? 523  ILE C N   1 
ATOM   5669 C  CA  . ILE C 1 43  ? 31.224  -13.218 11.105  1.00 31.09 ? 523  ILE C CA  1 
ATOM   5670 C  C   . ILE C 1 43  ? 31.272  -14.184 9.923   1.00 31.20 ? 523  ILE C C   1 
ATOM   5671 O  O   . ILE C 1 43  ? 31.740  -15.318 10.053  1.00 31.33 ? 523  ILE C O   1 
ATOM   5672 C  CB  . ILE C 1 43  ? 32.644  -12.654 11.382  1.00 31.20 ? 523  ILE C CB  1 
ATOM   5673 C  CG1 . ILE C 1 43  ? 32.578  -11.158 11.694  1.00 31.20 ? 523  ILE C CG1 1 
ATOM   5674 C  CG2 . ILE C 1 43  ? 33.567  -12.880 10.188  1.00 31.47 ? 523  ILE C CG2 1 
ATOM   5675 C  CD1 . ILE C 1 43  ? 32.263  -10.301 10.486  1.00 31.09 ? 523  ILE C CD1 1 
ATOM   5676 N  N   . TYR C 1 44  ? 30.780  -13.724 8.776   1.00 31.36 ? 524  TYR C N   1 
ATOM   5677 C  CA  . TYR C 1 44  ? 30.785  -14.513 7.544   1.00 31.45 ? 524  TYR C CA  1 
ATOM   5678 C  C   . TYR C 1 44  ? 30.506  -13.623 6.335   1.00 31.53 ? 524  TYR C C   1 
ATOM   5679 O  O   . TYR C 1 44  ? 29.773  -12.637 6.441   1.00 31.67 ? 524  TYR C O   1 
ATOM   5680 C  CB  . TYR C 1 44  ? 29.734  -15.628 7.610   1.00 31.43 ? 524  TYR C CB  1 
ATOM   5681 C  CG  . TYR C 1 44  ? 29.678  -16.489 6.364   1.00 31.54 ? 524  TYR C CG  1 
ATOM   5682 C  CD1 . TYR C 1 44  ? 30.594  -17.519 6.167   1.00 31.42 ? 524  TYR C CD1 1 
ATOM   5683 C  CD2 . TYR C 1 44  ? 28.717  -16.264 5.376   1.00 31.38 ? 524  TYR C CD2 1 
ATOM   5684 C  CE1 . TYR C 1 44  ? 30.554  -18.309 5.025   1.00 31.43 ? 524  TYR C CE1 1 
ATOM   5685 C  CE2 . TYR C 1 44  ? 28.671  -17.049 4.226   1.00 31.23 ? 524  TYR C CE2 1 
ATOM   5686 C  CZ  . TYR C 1 44  ? 29.591  -18.071 4.059   1.00 31.28 ? 524  TYR C CZ  1 
ATOM   5687 O  OH  . TYR C 1 44  ? 29.555  -18.856 2.930   1.00 30.90 ? 524  TYR C OH  1 
ATOM   5688 N  N   . ASP C 1 45  ? 31.096  -13.974 5.194   1.00 31.56 ? 525  ASP C N   1 
ATOM   5689 C  CA  . ASP C 1 45  ? 30.777  -13.323 3.921   1.00 31.45 ? 525  ASP C CA  1 
ATOM   5690 C  C   . ASP C 1 45  ? 31.225  -14.188 2.744   1.00 31.49 ? 525  ASP C C   1 
ATOM   5691 O  O   . ASP C 1 45  ? 32.199  -14.940 2.849   1.00 31.40 ? 525  ASP C O   1 
ATOM   5692 C  CB  . ASP C 1 45  ? 31.428  -11.941 3.839   1.00 31.41 ? 525  ASP C CB  1 
ATOM   5693 C  CG  . ASP C 1 45  ? 30.816  -11.074 2.759   1.00 31.42 ? 525  ASP C CG  1 
ATOM   5694 O  OD1 . ASP C 1 45  ? 31.202  -11.224 1.581   1.00 30.93 ? 525  ASP C OD1 1 
ATOM   5695 O  OD2 . ASP C 1 45  ? 29.932  -10.252 3.087   1.00 31.64 ? 525  ASP C OD2 1 
ATOM   5696 N  N   . SER C 1 46  ? 30.508  -14.071 1.628   1.00 31.50 ? 526  SER C N   1 
ATOM   5697 C  CA  . SER C 1 46  ? 30.791  -14.862 0.428   1.00 31.51 ? 526  SER C CA  1 
ATOM   5698 C  C   . SER C 1 46  ? 32.143  -14.523 -0.206  1.00 31.48 ? 526  SER C C   1 
ATOM   5699 O  O   . SER C 1 46  ? 32.766  -15.385 -0.825  1.00 31.50 ? 526  SER C O   1 
ATOM   5700 C  CB  . SER C 1 46  ? 29.675  -14.685 -0.603  1.00 31.46 ? 526  SER C CB  1 
ATOM   5701 O  OG  . SER C 1 46  ? 29.495  -13.318 -0.928  1.00 31.69 ? 526  SER C OG  1 
ATOM   5702 N  N   . VAL C 1 47  ? 32.592  -13.277 -0.048  1.00 31.43 ? 527  VAL C N   1 
ATOM   5703 C  CA  . VAL C 1 47  ? 33.909  -12.842 -0.531  1.00 31.41 ? 527  VAL C CA  1 
ATOM   5704 C  C   . VAL C 1 47  ? 34.979  -13.917 -0.316  1.00 31.39 ? 527  VAL C C   1 
ATOM   5705 O  O   . VAL C 1 47  ? 35.759  -14.216 -1.219  1.00 31.41 ? 527  VAL C O   1 
ATOM   5706 C  CB  . VAL C 1 47  ? 34.364  -11.530 0.178   1.00 31.43 ? 527  VAL C CB  1 
ATOM   5707 C  CG1 . VAL C 1 47  ? 35.854  -11.274 -0.038  1.00 31.77 ? 527  VAL C CG1 1 
ATOM   5708 C  CG2 . VAL C 1 47  ? 33.553  -10.345 -0.310  1.00 31.42 ? 527  VAL C CG2 1 
ATOM   5709 N  N   . MET C 1 48  ? 34.990  -14.501 0.881   1.00 31.32 ? 528  MET C N   1 
ATOM   5710 C  CA  . MET C 1 48  ? 35.995  -15.493 1.270   1.00 31.31 ? 528  MET C CA  1 
ATOM   5711 C  C   . MET C 1 48  ? 35.820  -16.870 0.618   1.00 31.30 ? 528  MET C C   1 
ATOM   5712 O  O   . MET C 1 48  ? 36.706  -17.712 0.720   1.00 31.27 ? 528  MET C O   1 
ATOM   5713 C  CB  . MET C 1 48  ? 36.014  -15.639 2.796   1.00 31.27 ? 528  MET C CB  1 
ATOM   5714 C  CG  . MET C 1 48  ? 36.436  -14.365 3.518   1.00 31.19 ? 528  MET C CG  1 
ATOM   5715 S  SD  . MET C 1 48  ? 36.440  -14.514 5.314   1.00 31.09 ? 528  MET C SD  1 
ATOM   5716 C  CE  . MET C 1 48  ? 34.687  -14.668 5.659   1.00 29.99 ? 528  MET C CE  1 
ATOM   5717 N  N   . LEU C 1 49  ? 34.688  -17.103 -0.043  1.00 31.44 ? 529  LEU C N   1 
ATOM   5718 C  CA  . LEU C 1 49  ? 34.495  -18.327 -0.833  1.00 31.48 ? 529  LEU C CA  1 
ATOM   5719 C  C   . LEU C 1 49  ? 35.291  -18.283 -2.139  1.00 31.58 ? 529  LEU C C   1 
ATOM   5720 O  O   . LEU C 1 49  ? 35.615  -19.327 -2.706  1.00 31.54 ? 529  LEU C O   1 
ATOM   5721 C  CB  . LEU C 1 49  ? 33.013  -18.545 -1.160  1.00 31.39 ? 529  LEU C CB  1 
ATOM   5722 C  CG  . LEU C 1 49  ? 32.038  -18.644 0.015   1.00 31.33 ? 529  LEU C CG  1 
ATOM   5723 C  CD1 . LEU C 1 49  ? 30.611  -18.780 -0.493  1.00 30.55 ? 529  LEU C CD1 1 
ATOM   5724 C  CD2 . LEU C 1 49  ? 32.398  -19.808 0.930   1.00 31.22 ? 529  LEU C CD2 1 
ATOM   5725 N  N   . LYS C 1 50  ? 35.602  -17.076 -2.608  1.00 31.73 ? 530  LYS C N   1 
ATOM   5726 C  CA  . LYS C 1 50  ? 36.252  -16.889 -3.906  1.00 31.78 ? 530  LYS C CA  1 
ATOM   5727 C  C   . LYS C 1 50  ? 37.755  -17.173 -3.899  1.00 31.92 ? 530  LYS C C   1 
ATOM   5728 O  O   . LYS C 1 50  ? 38.368  -17.219 -4.966  1.00 32.03 ? 530  LYS C O   1 
ATOM   5729 C  CB  . LYS C 1 50  ? 35.994  -15.478 -4.435  1.00 31.69 ? 530  LYS C CB  1 
ATOM   5730 C  CG  . LYS C 1 50  ? 34.533  -15.195 -4.685  1.00 31.71 ? 530  LYS C CG  1 
ATOM   5731 C  CD  . LYS C 1 50  ? 34.333  -13.883 -5.414  1.00 31.86 ? 530  LYS C CD  1 
ATOM   5732 C  CE  . LYS C 1 50  ? 32.866  -13.665 -5.760  1.00 31.73 ? 530  LYS C CE  1 
ATOM   5733 N  NZ  . LYS C 1 50  ? 32.665  -12.429 -6.562  1.00 31.57 ? 530  LYS C NZ  1 
ATOM   5734 N  N   . HIS C 1 51  ? 38.354  -17.346 -2.719  1.00 32.05 ? 531  HIS C N   1 
ATOM   5735 C  CA  . HIS C 1 51  ? 39.740  -17.821 -2.642  1.00 32.08 ? 531  HIS C CA  1 
ATOM   5736 C  C   . HIS C 1 51  ? 39.771  -19.293 -3.032  1.00 32.20 ? 531  HIS C C   1 
ATOM   5737 O  O   . HIS C 1 51  ? 39.556  -20.179 -2.200  1.00 32.21 ? 531  HIS C O   1 
ATOM   5738 C  CB  . HIS C 1 51  ? 40.336  -17.625 -1.246  1.00 32.01 ? 531  HIS C CB  1 
ATOM   5739 C  CG  . HIS C 1 51  ? 41.708  -18.210 -1.087  1.00 31.90 ? 531  HIS C CG  1 
ATOM   5740 N  ND1 . HIS C 1 51  ? 42.774  -17.832 -1.874  1.00 31.68 ? 531  HIS C ND1 1 
ATOM   5741 C  CD2 . HIS C 1 51  ? 42.187  -19.142 -0.227  1.00 31.56 ? 531  HIS C CD2 1 
ATOM   5742 C  CE1 . HIS C 1 51  ? 43.850  -18.506 -1.507  1.00 31.22 ? 531  HIS C CE1 1 
ATOM   5743 N  NE2 . HIS C 1 51  ? 43.521  -19.307 -0.509  1.00 30.81 ? 531  HIS C NE2 1 
ATOM   5744 N  N   . GLN C 1 52  ? 40.008  -19.540 -4.314  1.00 32.27 ? 532  GLN C N   1 
ATOM   5745 C  CA  . GLN C 1 52  ? 40.102  -20.895 -4.831  1.00 32.44 ? 532  GLN C CA  1 
ATOM   5746 C  C   . GLN C 1 52  ? 40.905  -20.902 -6.126  1.00 32.44 ? 532  GLN C C   1 
ATOM   5747 O  O   . GLN C 1 52  ? 40.796  -19.981 -6.936  1.00 32.57 ? 532  GLN C O   1 
ATOM   5748 C  CB  . GLN C 1 52  ? 38.706  -21.493 -5.042  1.00 32.47 ? 532  GLN C CB  1 
ATOM   5749 C  CG  . GLN C 1 52  ? 37.786  -20.675 -5.935  1.00 32.74 ? 532  GLN C CG  1 
ATOM   5750 C  CD  . GLN C 1 52  ? 36.357  -21.200 -5.941  1.00 33.08 ? 532  GLN C CD  1 
ATOM   5751 O  OE1 . GLN C 1 52  ? 35.689  -21.223 -4.907  1.00 32.85 ? 532  GLN C OE1 1 
ATOM   5752 N  NE2 . GLN C 1 52  ? 35.881  -21.616 -7.113  1.00 32.90 ? 532  GLN C NE2 1 
ATOM   5753 N  N   . CYS C 1 53  ? 41.717  -21.942 -6.302  1.00 32.44 ? 533  CYS C N   1 
ATOM   5754 C  CA  . CYS C 1 53  ? 42.624  -22.056 -7.443  1.00 32.42 ? 533  CYS C CA  1 
ATOM   5755 C  C   . CYS C 1 53  ? 41.854  -22.116 -8.758  1.00 32.33 ? 533  CYS C C   1 
ATOM   5756 O  O   . CYS C 1 53  ? 40.706  -22.560 -8.793  1.00 32.36 ? 533  CYS C O   1 
ATOM   5757 C  CB  . CYS C 1 53  ? 43.496  -23.309 -7.295  1.00 32.45 ? 533  CYS C CB  1 
ATOM   5758 S  SG  . CYS C 1 53  ? 44.816  -23.463 -8.512  1.00 32.58 ? 533  CYS C SG  1 
ATOM   5759 N  N   . SER C 1 54  ? 42.492  -21.662 -9.834  1.00 32.29 ? 534  SER C N   1 
ATOM   5760 C  CA  . SER C 1 54  ? 41.855  -21.620 -11.154 1.00 32.23 ? 534  SER C CA  1 
ATOM   5761 C  C   . SER C 1 54  ? 41.584  -23.018 -11.723 1.00 32.16 ? 534  SER C C   1 
ATOM   5762 O  O   . SER C 1 54  ? 40.635  -23.197 -12.492 1.00 32.15 ? 534  SER C O   1 
ATOM   5763 C  CB  . SER C 1 54  ? 42.697  -20.796 -12.137 1.00 32.23 ? 534  SER C CB  1 
ATOM   5764 O  OG  . SER C 1 54  ? 44.070  -21.146 -12.065 1.00 32.32 ? 534  SER C OG  1 
ATOM   5765 N  N   . CYS C 1 55  ? 42.402  -24.000 -11.337 1.00 32.04 ? 535  CYS C N   1 
ATOM   5766 C  CA  . CYS C 1 55  ? 42.220  -25.383 -11.795 1.00 31.96 ? 535  CYS C CA  1 
ATOM   5767 C  C   . CYS C 1 55  ? 40.926  -25.997 -11.254 1.00 31.95 ? 535  CYS C C   1 
ATOM   5768 O  O   . CYS C 1 55  ? 40.395  -26.937 -11.841 1.00 32.00 ? 535  CYS C O   1 
ATOM   5769 C  CB  . CYS C 1 55  ? 43.429  -26.256 -11.431 1.00 31.93 ? 535  CYS C CB  1 
ATOM   5770 S  SG  . CYS C 1 55  ? 43.544  -26.756 -9.696  1.00 31.90 ? 535  CYS C SG  1 
ATOM   5771 N  N   . GLY C 1 56  ? 40.431  -25.467 -10.137 1.00 32.00 ? 536  GLY C N   1 
ATOM   5772 C  CA  . GLY C 1 56  ? 39.101  -25.809 -9.632  1.00 32.11 ? 536  GLY C CA  1 
ATOM   5773 C  C   . GLY C 1 56  ? 38.972  -27.247 -9.169  1.00 32.23 ? 536  GLY C C   1 
ATOM   5774 O  O   . GLY C 1 56  ? 38.078  -27.972 -9.611  1.00 32.36 ? 536  GLY C O   1 
ATOM   5775 N  N   . ASP C 1 57  ? 39.868  -27.653 -8.276  1.00 32.27 ? 537  ASP C N   1 
ATOM   5776 C  CA  . ASP C 1 57  ? 39.911  -29.020 -7.771  1.00 32.30 ? 537  ASP C CA  1 
ATOM   5777 C  C   . ASP C 1 57  ? 40.074  -28.975 -6.256  1.00 32.41 ? 537  ASP C C   1 
ATOM   5778 O  O   . ASP C 1 57  ? 41.157  -28.679 -5.744  1.00 32.42 ? 537  ASP C O   1 
ATOM   5779 C  CB  . ASP C 1 57  ? 41.064  -29.777 -8.437  1.00 32.27 ? 537  ASP C CB  1 
ATOM   5780 C  CG  . ASP C 1 57  ? 41.134  -31.238 -8.020  1.00 32.24 ? 537  ASP C CG  1 
ATOM   5781 O  OD1 . ASP C 1 57  ? 41.128  -31.526 -6.804  1.00 32.03 ? 537  ASP C OD1 1 
ATOM   5782 O  OD2 . ASP C 1 57  ? 41.211  -32.104 -8.918  1.00 32.13 ? 537  ASP C OD2 1 
ATOM   5783 N  N   . ASN C 1 58  ? 38.989  -29.277 -5.546  1.00 32.55 ? 538  ASN C N   1 
ATOM   5784 C  CA  . ASN C 1 58  ? 38.951  -29.158 -4.088  1.00 32.64 ? 538  ASN C CA  1 
ATOM   5785 C  C   . ASN C 1 58  ? 39.624  -30.332 -3.373  1.00 32.74 ? 538  ASN C C   1 
ATOM   5786 O  O   . ASN C 1 58  ? 39.861  -30.276 -2.165  1.00 32.67 ? 538  ASN C O   1 
ATOM   5787 C  CB  . ASN C 1 58  ? 37.504  -28.999 -3.612  1.00 32.66 ? 538  ASN C CB  1 
ATOM   5788 C  CG  . ASN C 1 58  ? 36.807  -27.804 -4.254  1.00 32.77 ? 538  ASN C CG  1 
ATOM   5789 O  OD1 . ASN C 1 58  ? 37.235  -26.658 -4.097  1.00 32.72 ? 538  ASN C OD1 1 
ATOM   5790 N  ND2 . ASN C 1 58  ? 35.730  -28.070 -4.983  1.00 32.61 ? 538  ASN C ND2 1 
ATOM   5791 N  N   . SER C 1 59  ? 39.926  -31.393 -4.121  1.00 32.85 ? 539  SER C N   1 
ATOM   5792 C  CA  . SER C 1 59  ? 40.696  -32.512 -3.589  1.00 32.90 ? 539  SER C CA  1 
ATOM   5793 C  C   . SER C 1 59  ? 42.167  -32.122 -3.479  1.00 32.85 ? 539  SER C C   1 
ATOM   5794 O  O   . SER C 1 59  ? 42.740  -32.160 -2.391  1.00 32.99 ? 539  SER C O   1 
ATOM   5795 C  CB  . SER C 1 59  ? 40.541  -33.751 -4.470  1.00 32.91 ? 539  SER C CB  1 
ATOM   5796 O  OG  . SER C 1 59  ? 41.343  -34.813 -3.988  1.00 33.28 ? 539  SER C OG  1 
ATOM   5797 N  N   . ARG C 1 60  ? 42.766  -31.724 -4.601  1.00 32.71 ? 540  ARG C N   1 
ATOM   5798 C  CA  . ARG C 1 60  ? 44.183  -31.342 -4.623  1.00 32.68 ? 540  ARG C CA  1 
ATOM   5799 C  C   . ARG C 1 60  ? 44.453  -30.009 -3.916  1.00 32.39 ? 540  ARG C C   1 
ATOM   5800 O  O   . ARG C 1 60  ? 45.610  -29.668 -3.662  1.00 32.39 ? 540  ARG C O   1 
ATOM   5801 C  CB  . ARG C 1 60  ? 44.718  -31.300 -6.060  1.00 32.78 ? 540  ARG C CB  1 
ATOM   5802 C  CG  . ARG C 1 60  ? 44.271  -30.095 -6.863  1.00 33.57 ? 540  ARG C CG  1 
ATOM   5803 C  CD  . ARG C 1 60  ? 44.525  -30.269 -8.358  1.00 34.52 ? 540  ARG C CD  1 
ATOM   5804 N  NE  . ARG C 1 60  ? 45.954  -30.216 -8.674  1.00 35.41 ? 540  ARG C NE  1 
ATOM   5805 C  CZ  . ARG C 1 60  ? 46.746  -31.274 -8.860  1.00 35.92 ? 540  ARG C CZ  1 
ATOM   5806 N  NH1 . ARG C 1 60  ? 46.282  -32.519 -8.761  1.00 36.21 ? 540  ARG C NH1 1 
ATOM   5807 N  NH2 . ARG C 1 60  ? 48.030  -31.082 -9.143  1.00 36.05 ? 540  ARG C NH2 1 
ATOM   5808 N  N   . HIS C 1 61  ? 43.392  -29.260 -3.613  1.00 32.13 ? 541  HIS C N   1 
ATOM   5809 C  CA  . HIS C 1 61  ? 43.484  -28.052 -2.790  1.00 31.87 ? 541  HIS C CA  1 
ATOM   5810 C  C   . HIS C 1 61  ? 42.488  -28.139 -1.628  1.00 31.91 ? 541  HIS C C   1 
ATOM   5811 O  O   . HIS C 1 61  ? 41.403  -27.560 -1.692  1.00 31.86 ? 541  HIS C O   1 
ATOM   5812 C  CB  . HIS C 1 61  ? 43.227  -26.812 -3.639  1.00 31.67 ? 541  HIS C CB  1 
ATOM   5813 C  CG  . HIS C 1 61  ? 44.158  -26.684 -4.802  1.00 31.00 ? 541  HIS C CG  1 
ATOM   5814 N  ND1 . HIS C 1 61  ? 45.522  -26.551 -4.651  1.00 30.21 ? 541  HIS C ND1 1 
ATOM   5815 C  CD2 . HIS C 1 61  ? 43.924  -26.679 -6.134  1.00 30.32 ? 541  HIS C CD2 1 
ATOM   5816 C  CE1 . HIS C 1 61  ? 46.086  -26.466 -5.842  1.00 29.93 ? 541  HIS C CE1 1 
ATOM   5817 N  NE2 . HIS C 1 61  ? 45.139  -26.538 -6.759  1.00 29.88 ? 541  HIS C NE2 1 
ATOM   5818 N  N   . PRO C 1 62  ? 42.861  -28.870 -0.560  1.00 31.94 ? 542  PRO C N   1 
ATOM   5819 C  CA  . PRO C 1 62  ? 41.984  -29.162 0.580   1.00 32.01 ? 542  PRO C CA  1 
ATOM   5820 C  C   . PRO C 1 62  ? 41.465  -27.947 1.356   1.00 32.05 ? 542  PRO C C   1 
ATOM   5821 O  O   . PRO C 1 62  ? 40.416  -28.041 1.991   1.00 32.14 ? 542  PRO C O   1 
ATOM   5822 C  CB  . PRO C 1 62  ? 42.873  -30.006 1.501   1.00 32.01 ? 542  PRO C CB  1 
ATOM   5823 C  CG  . PRO C 1 62  ? 43.962  -30.506 0.654   1.00 32.14 ? 542  PRO C CG  1 
ATOM   5824 C  CD  . PRO C 1 62  ? 44.195  -29.467 -0.379  1.00 31.93 ? 542  PRO C CD  1 
ATOM   5825 N  N   . GLU C 1 63  ? 42.195  -26.833 1.335   1.00 32.07 ? 543  GLU C N   1 
ATOM   5826 C  CA  . GLU C 1 63  ? 41.723  -25.608 1.979   1.00 32.11 ? 543  GLU C CA  1 
ATOM   5827 C  C   . GLU C 1 63  ? 40.759  -24.920 1.021   1.00 32.07 ? 543  GLU C C   1 
ATOM   5828 O  O   . GLU C 1 63  ? 41.123  -23.955 0.347   1.00 32.12 ? 543  GLU C O   1 
ATOM   5829 C  CB  . GLU C 1 63  ? 42.898  -24.693 2.358   1.00 32.12 ? 543  GLU C CB  1 
ATOM   5830 C  CG  . GLU C 1 63  ? 42.575  -23.674 3.462   1.00 32.30 ? 543  GLU C CG  1 
ATOM   5831 C  CD  . GLU C 1 63  ? 41.700  -22.520 2.982   1.00 32.47 ? 543  GLU C CD  1 
ATOM   5832 O  OE1 . GLU C 1 63  ? 42.179  -21.701 2.169   1.00 32.48 ? 543  GLU C OE1 1 
ATOM   5833 O  OE2 . GLU C 1 63  ? 40.536  -22.430 3.421   1.00 32.37 ? 543  GLU C OE2 1 
ATOM   5834 N  N   . HIS C 1 64  ? 39.529  -25.433 0.965   1.00 32.09 ? 544  HIS C N   1 
ATOM   5835 C  CA  . HIS C 1 64  ? 38.539  -24.996 -0.029  1.00 32.13 ? 544  HIS C CA  1 
ATOM   5836 C  C   . HIS C 1 64  ? 37.381  -24.220 0.592   1.00 32.15 ? 544  HIS C C   1 
ATOM   5837 O  O   . HIS C 1 64  ? 37.216  -24.197 1.809   1.00 32.25 ? 544  HIS C O   1 
ATOM   5838 C  CB  . HIS C 1 64  ? 38.008  -26.195 -0.831  1.00 32.13 ? 544  HIS C CB  1 
ATOM   5839 C  CG  . HIS C 1 64  ? 37.309  -27.229 -0.002  1.00 31.94 ? 544  HIS C CG  1 
ATOM   5840 N  ND1 . HIS C 1 64  ? 35.986  -27.118 0.368   1.00 31.92 ? 544  HIS C ND1 1 
ATOM   5841 C  CD2 . HIS C 1 64  ? 37.745  -28.402 0.514   1.00 31.66 ? 544  HIS C CD2 1 
ATOM   5842 C  CE1 . HIS C 1 64  ? 35.640  -28.172 1.085   1.00 31.59 ? 544  HIS C CE1 1 
ATOM   5843 N  NE2 . HIS C 1 64  ? 36.690  -28.967 1.188   1.00 31.62 ? 544  HIS C NE2 1 
ATOM   5844 N  N   . ALA C 1 65  ? 36.583  -23.593 -0.268  1.00 32.31 ? 545  ALA C N   1 
ATOM   5845 C  CA  . ALA C 1 65  ? 35.492  -22.710 0.151   1.00 32.42 ? 545  ALA C CA  1 
ATOM   5846 C  C   . ALA C 1 65  ? 34.410  -23.426 0.951   1.00 32.59 ? 545  ALA C C   1 
ATOM   5847 O  O   . ALA C 1 65  ? 33.808  -22.833 1.848   1.00 32.77 ? 545  ALA C O   1 
ATOM   5848 C  CB  . ALA C 1 65  ? 34.876  -22.030 -1.062  1.00 32.35 ? 545  ALA C CB  1 
ATOM   5849 N  N   . GLY C 1 66  ? 34.163  -24.692 0.620   1.00 32.67 ? 546  GLY C N   1 
ATOM   5850 C  CA  . GLY C 1 66  ? 33.183  -25.515 1.330   1.00 32.81 ? 546  GLY C CA  1 
ATOM   5851 C  C   . GLY C 1 66  ? 33.399  -25.644 2.831   1.00 33.04 ? 546  GLY C C   1 
ATOM   5852 O  O   . GLY C 1 66  ? 32.467  -25.976 3.566   1.00 32.88 ? 546  GLY C O   1 
ATOM   5853 N  N   . ARG C 1 67  ? 34.625  -25.394 3.287   1.00 33.36 ? 547  ARG C N   1 
ATOM   5854 C  CA  . ARG C 1 67  ? 34.940  -25.410 4.714   1.00 33.63 ? 547  ARG C CA  1 
ATOM   5855 C  C   . ARG C 1 67  ? 34.073  -24.422 5.495   1.00 33.63 ? 547  ARG C C   1 
ATOM   5856 O  O   . ARG C 1 67  ? 33.357  -24.819 6.416   1.00 33.72 ? 547  ARG C O   1 
ATOM   5857 C  CB  . ARG C 1 67  ? 36.428  -25.113 4.945   1.00 33.77 ? 547  ARG C CB  1 
ATOM   5858 C  CG  . ARG C 1 67  ? 37.354  -26.241 4.509   1.00 34.34 ? 547  ARG C CG  1 
ATOM   5859 C  CD  . ARG C 1 67  ? 38.809  -25.806 4.463   1.00 35.12 ? 547  ARG C CD  1 
ATOM   5860 N  NE  . ARG C 1 67  ? 39.339  -25.484 5.789   1.00 35.80 ? 547  ARG C NE  1 
ATOM   5861 C  CZ  . ARG C 1 67  ? 39.421  -24.261 6.321   1.00 36.35 ? 547  ARG C CZ  1 
ATOM   5862 N  NH1 . ARG C 1 67  ? 39.004  -23.183 5.659   1.00 36.73 ? 547  ARG C NH1 1 
ATOM   5863 N  NH2 . ARG C 1 67  ? 39.928  -24.112 7.540   1.00 36.34 ? 547  ARG C NH2 1 
ATOM   5864 N  N   . ILE C 1 68  ? 34.132  -23.145 5.122   1.00 33.63 ? 548  ILE C N   1 
ATOM   5865 C  CA  . ILE C 1 68  ? 33.341  -22.111 5.808   1.00 33.69 ? 548  ILE C CA  1 
ATOM   5866 C  C   . ILE C 1 68  ? 31.846  -22.175 5.466   1.00 33.77 ? 548  ILE C C   1 
ATOM   5867 O  O   . ILE C 1 68  ? 31.003  -21.818 6.292   1.00 33.78 ? 548  ILE C O   1 
ATOM   5868 C  CB  . ILE C 1 68  ? 33.874  -20.668 5.546   1.00 33.71 ? 548  ILE C CB  1 
ATOM   5869 C  CG1 . ILE C 1 68  ? 33.823  -20.304 4.054   1.00 33.46 ? 548  ILE C CG1 1 
ATOM   5870 C  CG2 . ILE C 1 68  ? 35.290  -20.512 6.101   1.00 33.38 ? 548  ILE C CG2 1 
ATOM   5871 C  CD1 . ILE C 1 68  ? 34.200  -18.865 3.768   1.00 33.17 ? 548  ILE C CD1 1 
ATOM   5872 N  N   . GLN C 1 69  ? 31.526  -22.631 4.256   1.00 33.82 ? 549  GLN C N   1 
ATOM   5873 C  CA  . GLN C 1 69  ? 30.138  -22.701 3.793   1.00 33.93 ? 549  GLN C CA  1 
ATOM   5874 C  C   . GLN C 1 69  ? 29.330  -23.745 4.567   1.00 33.75 ? 549  GLN C C   1 
ATOM   5875 O  O   . GLN C 1 69  ? 28.193  -23.483 4.967   1.00 33.64 ? 549  GLN C O   1 
ATOM   5876 C  CB  . GLN C 1 69  ? 30.093  -22.999 2.286   1.00 34.02 ? 549  GLN C CB  1 
ATOM   5877 C  CG  . GLN C 1 69  ? 28.693  -23.228 1.707   1.00 34.61 ? 549  GLN C CG  1 
ATOM   5878 C  CD  . GLN C 1 69  ? 27.715  -22.110 2.044   1.00 35.43 ? 549  GLN C CD  1 
ATOM   5879 O  OE1 . GLN C 1 69  ? 28.071  -20.930 2.032   1.00 36.08 ? 549  GLN C OE1 1 
ATOM   5880 N  NE2 . GLN C 1 69  ? 26.471  -22.480 2.338   1.00 36.00 ? 549  GLN C NE2 1 
ATOM   5881 N  N   . SER C 1 70  ? 29.922  -24.920 4.767   1.00 33.62 ? 550  SER C N   1 
ATOM   5882 C  CA  . SER C 1 70  ? 29.256  -26.017 5.470   1.00 33.56 ? 550  SER C CA  1 
ATOM   5883 C  C   . SER C 1 70  ? 29.038  -25.696 6.949   1.00 33.52 ? 550  SER C C   1 
ATOM   5884 O  O   . SER C 1 70  ? 28.027  -26.089 7.526   1.00 33.59 ? 550  SER C O   1 
ATOM   5885 C  CB  . SER C 1 70  ? 30.057  -27.314 5.328   1.00 33.51 ? 550  SER C CB  1 
ATOM   5886 O  OG  . SER C 1 70  ? 31.330  -27.199 5.939   1.00 33.75 ? 550  SER C OG  1 
ATOM   5887 N  N   . ILE C 1 71  ? 29.988  -24.986 7.556   1.00 33.49 ? 551  ILE C N   1 
ATOM   5888 C  CA  . ILE C 1 71  ? 29.828  -24.500 8.927   1.00 33.43 ? 551  ILE C CA  1 
ATOM   5889 C  C   . ILE C 1 71  ? 28.708  -23.462 9.002   1.00 33.40 ? 551  ILE C C   1 
ATOM   5890 O  O   . ILE C 1 71  ? 27.867  -23.513 9.901   1.00 33.46 ? 551  ILE C O   1 
ATOM   5891 C  CB  . ILE C 1 71  ? 31.132  -23.872 9.476   1.00 33.45 ? 551  ILE C CB  1 
ATOM   5892 C  CG1 . ILE C 1 71  ? 32.216  -24.941 9.645   1.00 33.35 ? 551  ILE C CG1 1 
ATOM   5893 C  CG2 . ILE C 1 71  ? 30.881  -23.191 10.817  1.00 33.36 ? 551  ILE C CG2 1 
ATOM   5894 C  CD1 . ILE C 1 71  ? 33.561  -24.378 10.035  1.00 32.88 ? 551  ILE C CD1 1 
ATOM   5895 N  N   . TRP C 1 72  ? 28.696  -22.531 8.051   1.00 33.31 ? 552  TRP C N   1 
ATOM   5896 C  CA  . TRP C 1 72  ? 27.719  -21.441 8.048   1.00 33.25 ? 552  TRP C CA  1 
ATOM   5897 C  C   . TRP C 1 72  ? 26.285  -21.957 7.966   1.00 33.28 ? 552  TRP C C   1 
ATOM   5898 O  O   . TRP C 1 72  ? 25.411  -21.492 8.698   1.00 33.21 ? 552  TRP C O   1 
ATOM   5899 C  CB  . TRP C 1 72  ? 27.994  -20.477 6.893   1.00 33.21 ? 552  TRP C CB  1 
ATOM   5900 C  CG  . TRP C 1 72  ? 27.210  -19.210 6.977   1.00 32.99 ? 552  TRP C CG  1 
ATOM   5901 C  CD1 . TRP C 1 72  ? 26.304  -18.747 6.071   1.00 32.81 ? 552  TRP C CD1 1 
ATOM   5902 C  CD2 . TRP C 1 72  ? 27.258  -18.240 8.030   1.00 32.79 ? 552  TRP C CD2 1 
ATOM   5903 N  NE1 . TRP C 1 72  ? 25.786  -17.546 6.490   1.00 32.83 ? 552  TRP C NE1 1 
ATOM   5904 C  CE2 . TRP C 1 72  ? 26.355  -17.211 7.690   1.00 32.83 ? 552  TRP C CE2 1 
ATOM   5905 C  CE3 . TRP C 1 72  ? 27.978  -18.139 9.227   1.00 32.62 ? 552  TRP C CE3 1 
ATOM   5906 C  CZ2 . TRP C 1 72  ? 26.152  -16.094 8.505   1.00 32.75 ? 552  TRP C CZ2 1 
ATOM   5907 C  CZ3 . TRP C 1 72  ? 27.777  -17.029 10.035  1.00 32.55 ? 552  TRP C CZ3 1 
ATOM   5908 C  CH2 . TRP C 1 72  ? 26.870  -16.021 9.669   1.00 32.61 ? 552  TRP C CH2 1 
ATOM   5909 N  N   . SER C 1 73  ? 26.053  -22.917 7.078   1.00 33.31 ? 553  SER C N   1 
ATOM   5910 C  CA  . SER C 1 73  ? 24.739  -23.542 6.957   1.00 33.47 ? 553  SER C CA  1 
ATOM   5911 C  C   . SER C 1 73  ? 24.431  -24.436 8.162   1.00 33.47 ? 553  SER C C   1 
ATOM   5912 O  O   . SER C 1 73  ? 23.275  -24.561 8.564   1.00 33.43 ? 553  SER C O   1 
ATOM   5913 C  CB  . SER C 1 73  ? 24.632  -24.339 5.649   1.00 33.47 ? 553  SER C CB  1 
ATOM   5914 O  OG  . SER C 1 73  ? 25.722  -25.229 5.497   1.00 33.66 ? 553  SER C OG  1 
ATOM   5915 N  N   . ARG C 1 74  ? 25.465  -25.044 8.740   1.00 33.55 ? 554  ARG C N   1 
ATOM   5916 C  CA  . ARG C 1 74  ? 25.298  -25.905 9.913   1.00 33.60 ? 554  ARG C CA  1 
ATOM   5917 C  C   . ARG C 1 74  ? 24.724  -25.149 11.108  1.00 33.71 ? 554  ARG C C   1 
ATOM   5918 O  O   . ARG C 1 74  ? 23.897  -25.687 11.844  1.00 33.82 ? 554  ARG C O   1 
ATOM   5919 C  CB  . ARG C 1 74  ? 26.628  -26.556 10.295  1.00 33.51 ? 554  ARG C CB  1 
ATOM   5920 C  CG  . ARG C 1 74  ? 26.613  -27.311 11.615  1.00 33.48 ? 554  ARG C CG  1 
ATOM   5921 C  CD  . ARG C 1 74  ? 25.635  -28.470 11.611  1.00 33.29 ? 554  ARG C CD  1 
ATOM   5922 N  NE  . ARG C 1 74  ? 26.167  -29.589 12.387  1.00 33.34 ? 554  ARG C NE  1 
ATOM   5923 C  CZ  . ARG C 1 74  ? 26.841  -30.625 11.886  1.00 33.11 ? 554  ARG C CZ  1 
ATOM   5924 N  NH1 . ARG C 1 74  ? 27.077  -30.734 10.581  1.00 33.16 ? 554  ARG C NH1 1 
ATOM   5925 N  NH2 . ARG C 1 74  ? 27.281  -31.572 12.705  1.00 32.93 ? 554  ARG C NH2 1 
ATOM   5926 N  N   . LEU C 1 75  ? 25.162  -23.908 11.296  1.00 33.84 ? 555  LEU C N   1 
ATOM   5927 C  CA  . LEU C 1 75  ? 24.665  -23.077 12.394  1.00 33.98 ? 555  LEU C CA  1 
ATOM   5928 C  C   . LEU C 1 75  ? 23.215  -22.620 12.175  1.00 34.14 ? 555  LEU C C   1 
ATOM   5929 O  O   . LEU C 1 75  ? 22.504  -22.338 13.141  1.00 34.15 ? 555  LEU C O   1 
ATOM   5930 C  CB  . LEU C 1 75  ? 25.585  -21.869 12.613  1.00 33.95 ? 555  LEU C CB  1 
ATOM   5931 C  CG  . LEU C 1 75  ? 27.027  -22.194 13.030  1.00 33.84 ? 555  LEU C CG  1 
ATOM   5932 C  CD1 . LEU C 1 75  ? 27.884  -20.937 13.040  1.00 33.40 ? 555  LEU C CD1 1 
ATOM   5933 C  CD2 . LEU C 1 75  ? 27.065  -22.880 14.389  1.00 33.83 ? 555  LEU C CD2 1 
ATOM   5934 N  N   . GLN C 1 76  ? 22.786  -22.549 10.914  1.00 34.39 ? 556  GLN C N   1 
ATOM   5935 C  CA  . GLN C 1 76  ? 21.396  -22.215 10.571  1.00 34.53 ? 556  GLN C CA  1 
ATOM   5936 C  C   . GLN C 1 76  ? 20.487  -23.427 10.766  1.00 34.75 ? 556  GLN C C   1 
ATOM   5937 O  O   . GLN C 1 76  ? 19.389  -23.300 11.307  1.00 34.83 ? 556  GLN C O   1 
ATOM   5938 C  CB  . GLN C 1 76  ? 21.306  -21.718 9.121   1.00 34.51 ? 556  GLN C CB  1 
ATOM   5939 C  CG  . GLN C 1 76  ? 19.900  -21.320 8.642   1.00 34.38 ? 556  GLN C CG  1 
ATOM   5940 C  CD  . GLN C 1 76  ? 19.354  -20.072 9.319   1.00 34.28 ? 556  GLN C CD  1 
ATOM   5941 O  OE1 . GLN C 1 76  ? 20.089  -19.318 9.955   1.00 34.18 ? 556  GLN C OE1 1 
ATOM   5942 N  NE2 . GLN C 1 76  ? 18.052  -19.846 9.174   1.00 33.99 ? 556  GLN C NE2 1 
ATOM   5943 N  N   . GLU C 1 77  ? 20.949  -24.593 10.313  1.00 35.02 ? 557  GLU C N   1 
ATOM   5944 C  CA  . GLU C 1 77  ? 20.230  -25.862 10.499  1.00 35.17 ? 557  GLU C CA  1 
ATOM   5945 C  C   . GLU C 1 77  ? 19.951  -26.139 11.976  1.00 35.39 ? 557  GLU C C   1 
ATOM   5946 O  O   . GLU C 1 77  ? 18.891  -26.662 12.324  1.00 35.40 ? 557  GLU C O   1 
ATOM   5947 C  CB  . GLU C 1 77  ? 21.045  -27.031 9.932   1.00 35.15 ? 557  GLU C CB  1 
ATOM   5948 C  CG  . GLU C 1 77  ? 21.200  -27.040 8.412   1.00 35.13 ? 557  GLU C CG  1 
ATOM   5949 C  CD  . GLU C 1 77  ? 22.445  -27.790 7.937   1.00 35.20 ? 557  GLU C CD  1 
ATOM   5950 O  OE1 . GLU C 1 77  ? 23.113  -28.451 8.762   1.00 35.46 ? 557  GLU C OE1 1 
ATOM   5951 O  OE2 . GLU C 1 77  ? 22.758  -27.714 6.731   1.00 34.84 ? 557  GLU C OE2 1 
ATOM   5952 N  N   . ARG C 1 78  ? 20.912  -25.788 12.832  1.00 35.65 ? 558  ARG C N   1 
ATOM   5953 C  CA  . ARG C 1 78  ? 20.826  -26.047 14.272  1.00 35.83 ? 558  ARG C CA  1 
ATOM   5954 C  C   . ARG C 1 78  ? 20.264  -24.865 15.076  1.00 35.87 ? 558  ARG C C   1 
ATOM   5955 O  O   . ARG C 1 78  ? 20.264  -24.899 16.307  1.00 35.87 ? 558  ARG C O   1 
ATOM   5956 C  CB  . ARG C 1 78  ? 22.207  -26.425 14.808  1.00 35.91 ? 558  ARG C CB  1 
ATOM   5957 C  CG  . ARG C 1 78  ? 22.767  -27.722 14.237  1.00 36.32 ? 558  ARG C CG  1 
ATOM   5958 C  CD  . ARG C 1 78  ? 22.151  -28.958 14.890  1.00 37.01 ? 558  ARG C CD  1 
ATOM   5959 N  NE  . ARG C 1 78  ? 23.164  -29.976 15.180  1.00 37.89 ? 558  ARG C NE  1 
ATOM   5960 C  CZ  . ARG C 1 78  ? 22.963  -31.064 15.925  1.00 38.46 ? 558  ARG C CZ  1 
ATOM   5961 N  NH1 . ARG C 1 78  ? 21.771  -31.316 16.465  1.00 38.59 ? 558  ARG C NH1 1 
ATOM   5962 N  NH2 . ARG C 1 78  ? 23.968  -31.914 16.129  1.00 38.46 ? 558  ARG C NH2 1 
ATOM   5963 N  N   . GLY C 1 79  ? 19.797  -23.825 14.386  1.00 35.98 ? 559  GLY C N   1 
ATOM   5964 C  CA  . GLY C 1 79  ? 19.125  -22.699 15.033  1.00 36.01 ? 559  GLY C CA  1 
ATOM   5965 C  C   . GLY C 1 79  ? 20.016  -21.761 15.833  1.00 36.13 ? 559  GLY C C   1 
ATOM   5966 O  O   . GLY C 1 79  ? 19.516  -20.960 16.625  1.00 36.09 ? 559  GLY C O   1 
ATOM   5967 N  N   . LEU C 1 80  ? 21.330  -21.843 15.629  1.00 36.23 ? 560  LEU C N   1 
ATOM   5968 C  CA  . LEU C 1 80  ? 22.275  -21.007 16.376  1.00 36.34 ? 560  LEU C CA  1 
ATOM   5969 C  C   . LEU C 1 80  ? 22.394  -19.596 15.794  1.00 36.42 ? 560  LEU C C   1 
ATOM   5970 O  O   . LEU C 1 80  ? 22.537  -18.631 16.545  1.00 36.52 ? 560  LEU C O   1 
ATOM   5971 C  CB  . LEU C 1 80  ? 23.662  -21.663 16.443  1.00 36.31 ? 560  LEU C CB  1 
ATOM   5972 C  CG  . LEU C 1 80  ? 23.761  -23.049 17.091  1.00 36.27 ? 560  LEU C CG  1 
ATOM   5973 C  CD1 . LEU C 1 80  ? 25.222  -23.423 17.306  1.00 36.48 ? 560  LEU C CD1 1 
ATOM   5974 C  CD2 . LEU C 1 80  ? 22.998  -23.114 18.406  1.00 36.33 ? 560  LEU C CD2 1 
ATOM   5975 N  N   . ARG C 1 81  ? 22.331  -19.473 14.469  1.00 36.46 ? 561  ARG C N   1 
ATOM   5976 C  CA  . ARG C 1 81  ? 22.482  -18.168 13.815  1.00 36.52 ? 561  ARG C CA  1 
ATOM   5977 C  C   . ARG C 1 81  ? 21.392  -17.185 14.232  1.00 36.47 ? 561  ARG C C   1 
ATOM   5978 O  O   . ARG C 1 81  ? 21.650  -15.989 14.365  1.00 36.48 ? 561  ARG C O   1 
ATOM   5979 C  CB  . ARG C 1 81  ? 22.498  -18.308 12.289  1.00 36.57 ? 561  ARG C CB  1 
ATOM   5980 C  CG  . ARG C 1 81  ? 23.639  -19.168 11.765  1.00 36.96 ? 561  ARG C CG  1 
ATOM   5981 C  CD  . ARG C 1 81  ? 24.388  -18.539 10.595  1.00 37.49 ? 561  ARG C CD  1 
ATOM   5982 N  NE  . ARG C 1 81  ? 23.782  -18.835 9.294   1.00 37.89 ? 561  ARG C NE  1 
ATOM   5983 C  CZ  . ARG C 1 81  ? 22.991  -18.017 8.597   1.00 38.17 ? 561  ARG C CZ  1 
ATOM   5984 N  NH1 . ARG C 1 81  ? 22.661  -16.808 9.052   1.00 38.30 ? 561  ARG C NH1 1 
ATOM   5985 N  NH2 . ARG C 1 81  ? 22.520  -18.417 7.421   1.00 38.23 ? 561  ARG C NH2 1 
ATOM   5986 N  N   . SER C 1 82  ? 20.184  -17.698 14.447  1.00 36.46 ? 562  SER C N   1 
ATOM   5987 C  CA  . SER C 1 82  ? 19.042  -16.877 14.856  1.00 36.46 ? 562  SER C CA  1 
ATOM   5988 C  C   . SER C 1 82  ? 19.226  -16.237 16.232  1.00 36.42 ? 562  SER C C   1 
ATOM   5989 O  O   . SER C 1 82  ? 18.644  -15.188 16.510  1.00 36.52 ? 562  SER C O   1 
ATOM   5990 C  CB  . SER C 1 82  ? 17.767  -17.720 14.859  1.00 36.43 ? 562  SER C CB  1 
ATOM   5991 O  OG  . SER C 1 82  ? 17.632  -18.429 13.641  1.00 36.50 ? 562  SER C OG  1 
ATOM   5992 N  N   . GLN C 1 83  ? 20.027  -16.873 17.085  1.00 36.36 ? 563  GLN C N   1 
ATOM   5993 C  CA  . GLN C 1 83  ? 20.309  -16.357 18.425  1.00 36.30 ? 563  GLN C CA  1 
ATOM   5994 C  C   . GLN C 1 83  ? 21.471  -15.362 18.450  1.00 36.20 ? 563  GLN C C   1 
ATOM   5995 O  O   . GLN C 1 83  ? 21.756  -14.778 19.496  1.00 36.19 ? 563  GLN C O   1 
ATOM   5996 C  CB  . GLN C 1 83  ? 20.624  -17.513 19.376  1.00 36.34 ? 563  GLN C CB  1 
ATOM   5997 C  CG  . GLN C 1 83  ? 19.516  -18.548 19.486  1.00 36.47 ? 563  GLN C CG  1 
ATOM   5998 C  CD  . GLN C 1 83  ? 19.881  -19.687 20.416  1.00 36.72 ? 563  GLN C CD  1 
ATOM   5999 O  OE1 . GLN C 1 83  ? 20.343  -19.464 21.536  1.00 37.16 ? 563  GLN C OE1 1 
ATOM   6000 N  NE2 . GLN C 1 83  ? 19.676  -20.916 19.958  1.00 36.64 ? 563  GLN C NE2 1 
ATOM   6001 N  N   . CYS C 1 84  ? 22.137  -15.172 17.310  1.00 36.07 ? 564  CYS C N   1 
ATOM   6002 C  CA  . CYS C 1 84  ? 23.326  -14.318 17.230  1.00 35.98 ? 564  CYS C CA  1 
ATOM   6003 C  C   . CYS C 1 84  ? 23.117  -13.084 16.354  1.00 35.84 ? 564  CYS C C   1 
ATOM   6004 O  O   . CYS C 1 84  ? 22.242  -13.059 15.488  1.00 35.93 ? 564  CYS C O   1 
ATOM   6005 C  CB  . CYS C 1 84  ? 24.512  -15.116 16.675  1.00 36.02 ? 564  CYS C CB  1 
ATOM   6006 S  SG  . CYS C 1 84  ? 25.107  -16.441 17.753  1.00 36.01 ? 564  CYS C SG  1 
ATOM   6007 N  N   . GLU C 1 85  ? 23.931  -12.062 16.605  1.00 35.66 ? 565  GLU C N   1 
ATOM   6008 C  CA  . GLU C 1 85  ? 24.084  -10.931 15.697  1.00 35.61 ? 565  GLU C CA  1 
ATOM   6009 C  C   . GLU C 1 85  ? 24.996  -11.390 14.562  1.00 35.59 ? 565  GLU C C   1 
ATOM   6010 O  O   . GLU C 1 85  ? 26.020  -12.035 14.810  1.00 35.64 ? 565  GLU C O   1 
ATOM   6011 C  CB  . GLU C 1 85  ? 24.706  -9.742  16.438  1.00 35.62 ? 565  GLU C CB  1 
ATOM   6012 C  CG  . GLU C 1 85  ? 25.032  -8.515  15.577  1.00 35.72 ? 565  GLU C CG  1 
ATOM   6013 C  CD  . GLU C 1 85  ? 23.814  -7.691  15.202  1.00 35.99 ? 565  GLU C CD  1 
ATOM   6014 O  OE1 . GLU C 1 85  ? 22.699  -7.988  15.685  1.00 36.22 ? 565  GLU C OE1 1 
ATOM   6015 O  OE2 . GLU C 1 85  ? 23.980  -6.732  14.420  1.00 36.27 ? 565  GLU C OE2 1 
ATOM   6016 N  N   . CYS C 1 86  ? 24.626  -11.065 13.325  1.00 35.55 ? 566  CYS C N   1 
ATOM   6017 C  CA  . CYS C 1 86  ? 25.378  -11.507 12.149  1.00 35.58 ? 566  CYS C CA  1 
ATOM   6018 C  C   . CYS C 1 86  ? 25.934  -10.329 11.361  1.00 35.69 ? 566  CYS C C   1 
ATOM   6019 O  O   . CYS C 1 86  ? 25.180  -9.540  10.791  1.00 35.83 ? 566  CYS C O   1 
ATOM   6020 C  CB  . CYS C 1 86  ? 24.498  -12.366 11.245  1.00 35.57 ? 566  CYS C CB  1 
ATOM   6021 S  SG  . CYS C 1 86  ? 24.216  -14.021 11.894  1.00 35.44 ? 566  CYS C SG  1 
ATOM   6022 N  N   . LEU C 1 87  ? 27.261  -10.234 11.327  1.00 35.85 ? 567  LEU C N   1 
ATOM   6023 C  CA  . LEU C 1 87  ? 27.961  -9.148  10.653  1.00 35.89 ? 567  LEU C CA  1 
ATOM   6024 C  C   . LEU C 1 87  ? 28.681  -9.677  9.419   1.00 35.96 ? 567  LEU C C   1 
ATOM   6025 O  O   . LEU C 1 87  ? 29.059  -10.849 9.366   1.00 35.98 ? 567  LEU C O   1 
ATOM   6026 C  CB  . LEU C 1 87  ? 28.967  -8.503  11.609  1.00 35.86 ? 567  LEU C CB  1 
ATOM   6027 C  CG  . LEU C 1 87  ? 28.355  -7.928  12.890  1.00 35.69 ? 567  LEU C CG  1 
ATOM   6028 C  CD1 . LEU C 1 87  ? 29.436  -7.616  13.906  1.00 35.24 ? 567  LEU C CD1 1 
ATOM   6029 C  CD2 . LEU C 1 87  ? 27.521  -6.690  12.577  1.00 35.40 ? 567  LEU C CD2 1 
ATOM   6030 N  N   . ARG C 1 88  ? 28.878  -8.796  8.442   1.00 36.01 ? 568  ARG C N   1 
ATOM   6031 C  CA  . ARG C 1 88  ? 29.479  -9.160  7.158   1.00 36.01 ? 568  ARG C CA  1 
ATOM   6032 C  C   . ARG C 1 88  ? 31.005  -9.094  7.184   1.00 35.71 ? 568  ARG C C   1 
ATOM   6033 O  O   . ARG C 1 88  ? 31.669  -9.766  6.394   1.00 35.55 ? 568  ARG C O   1 
ATOM   6034 C  CB  . ARG C 1 88  ? 28.969  -8.235  6.053   1.00 36.18 ? 568  ARG C CB  1 
ATOM   6035 C  CG  . ARG C 1 88  ? 27.459  -8.041  6.031   1.00 37.14 ? 568  ARG C CG  1 
ATOM   6036 C  CD  . ARG C 1 88  ? 26.980  -7.375  4.741   1.00 38.64 ? 568  ARG C CD  1 
ATOM   6037 N  NE  . ARG C 1 88  ? 27.878  -6.306  4.286   1.00 39.63 ? 568  ARG C NE  1 
ATOM   6038 C  CZ  . ARG C 1 88  ? 28.831  -6.433  3.359   1.00 40.27 ? 568  ARG C CZ  1 
ATOM   6039 N  NH1 . ARG C 1 88  ? 29.054  -7.596  2.745   1.00 40.39 ? 568  ARG C NH1 1 
ATOM   6040 N  NH2 . ARG C 1 88  ? 29.576  -5.378  3.041   1.00 40.72 ? 568  ARG C NH2 1 
ATOM   6041 N  N   . GLY C 1 89  ? 31.551  -8.268  8.075   1.00 35.42 ? 569  GLY C N   1 
ATOM   6042 C  CA  . GLY C 1 89  ? 32.996  -8.061  8.161   1.00 35.19 ? 569  GLY C CA  1 
ATOM   6043 C  C   . GLY C 1 89  ? 33.461  -6.956  7.235   1.00 34.92 ? 569  GLY C C   1 
ATOM   6044 O  O   . GLY C 1 89  ? 32.668  -6.117  6.813   1.00 34.96 ? 569  GLY C O   1 
ATOM   6045 N  N   . ARG C 1 90  ? 34.753  -6.958  6.921   1.00 34.67 ? 570  ARG C N   1 
ATOM   6046 C  CA  . ARG C 1 90  ? 35.350  -5.939  6.054   1.00 34.44 ? 570  ARG C CA  1 
ATOM   6047 C  C   . ARG C 1 90  ? 36.776  -6.310  5.650   1.00 34.20 ? 570  ARG C C   1 
ATOM   6048 O  O   . ARG C 1 90  ? 37.408  -7.161  6.283   1.00 34.15 ? 570  ARG C O   1 
ATOM   6049 C  CB  . ARG C 1 90  ? 35.365  -4.574  6.757   1.00 34.43 ? 570  ARG C CB  1 
ATOM   6050 C  CG  . ARG C 1 90  ? 36.064  -4.562  8.120   1.00 34.40 ? 570  ARG C CG  1 
ATOM   6051 C  CD  . ARG C 1 90  ? 36.117  -3.151  8.701   1.00 34.62 ? 570  ARG C CD  1 
ATOM   6052 N  NE  . ARG C 1 90  ? 36.797  -3.101  9.994   1.00 34.60 ? 570  ARG C NE  1 
ATOM   6053 C  CZ  . ARG C 1 90  ? 38.119  -3.155  10.166  1.00 35.34 ? 570  ARG C CZ  1 
ATOM   6054 N  NH1 . ARG C 1 90  ? 38.944  -3.268  9.126   1.00 35.40 ? 570  ARG C NH1 1 
ATOM   6055 N  NH2 . ARG C 1 90  ? 38.626  -3.102  11.394  1.00 35.33 ? 570  ARG C NH2 1 
ATOM   6056 N  N   . LYS C 1 91  ? 37.275  -5.666  4.596   1.00 33.89 ? 571  LYS C N   1 
ATOM   6057 C  CA  . LYS C 1 91  ? 38.684  -5.774  4.229   1.00 33.65 ? 571  LYS C CA  1 
ATOM   6058 C  C   . LYS C 1 91  ? 39.514  -5.018  5.249   1.00 33.30 ? 571  LYS C C   1 
ATOM   6059 O  O   . LYS C 1 91  ? 39.182  -3.885  5.602   1.00 33.29 ? 571  LYS C O   1 
ATOM   6060 C  CB  . LYS C 1 91  ? 38.959  -5.169  2.851   1.00 33.70 ? 571  LYS C CB  1 
ATOM   6061 C  CG  . LYS C 1 91  ? 38.445  -5.978  1.680   1.00 34.11 ? 571  LYS C CG  1 
ATOM   6062 C  CD  . LYS C 1 91  ? 39.116  -5.561  0.368   1.00 34.61 ? 571  LYS C CD  1 
ATOM   6063 C  CE  . LYS C 1 91  ? 38.866  -4.095  0.014   1.00 35.10 ? 571  LYS C CE  1 
ATOM   6064 N  NZ  . LYS C 1 91  ? 37.412  -3.759  -0.123  1.00 35.40 ? 571  LYS C NZ  1 
ATOM   6065 N  N   . ALA C 1 92  ? 40.587  -5.647  5.722   1.00 32.84 ? 572  ALA C N   1 
ATOM   6066 C  CA  . ALA C 1 92  ? 41.562  -4.967  6.557   1.00 32.46 ? 572  ALA C CA  1 
ATOM   6067 C  C   . ALA C 1 92  ? 42.277  -3.942  5.691   1.00 32.16 ? 572  ALA C C   1 
ATOM   6068 O  O   . ALA C 1 92  ? 42.558  -4.211  4.522   1.00 31.98 ? 572  ALA C O   1 
ATOM   6069 C  CB  . ALA C 1 92  ? 42.565  -5.966  7.140   1.00 32.51 ? 572  ALA C CB  1 
ATOM   6070 N  N   . SER C 1 93  ? 42.560  -2.772  6.255   1.00 31.89 ? 573  SER C N   1 
ATOM   6071 C  CA  . SER C 1 93  ? 43.314  -1.745  5.543   1.00 31.76 ? 573  SER C CA  1 
ATOM   6072 C  C   . SER C 1 93  ? 44.772  -2.166  5.415   1.00 31.69 ? 573  SER C C   1 
ATOM   6073 O  O   . SER C 1 93  ? 45.251  -3.013  6.170   1.00 31.80 ? 573  SER C O   1 
ATOM   6074 C  CB  . SER C 1 93  ? 43.231  -0.405  6.276   1.00 31.75 ? 573  SER C CB  1 
ATOM   6075 O  OG  . SER C 1 93  ? 43.933  -0.455  7.509   1.00 31.71 ? 573  SER C OG  1 
ATOM   6076 N  N   . LEU C 1 94  ? 45.474  -1.572  4.456   1.00 31.60 ? 574  LEU C N   1 
ATOM   6077 C  CA  . LEU C 1 94  ? 46.912  -1.804  4.298   1.00 31.58 ? 574  LEU C CA  1 
ATOM   6078 C  C   . LEU C 1 94  ? 47.689  -1.425  5.569   1.00 31.52 ? 574  LEU C C   1 
ATOM   6079 O  O   . LEU C 1 94  ? 48.628  -2.121  5.944   1.00 31.48 ? 574  LEU C O   1 
ATOM   6080 C  CB  . LEU C 1 94  ? 47.455  -1.044  3.076   1.00 31.53 ? 574  LEU C CB  1 
ATOM   6081 C  CG  . LEU C 1 94  ? 47.434  -1.757  1.715   1.00 31.33 ? 574  LEU C CG  1 
ATOM   6082 C  CD1 . LEU C 1 94  ? 46.163  -2.553  1.496   1.00 31.01 ? 574  LEU C CD1 1 
ATOM   6083 C  CD2 . LEU C 1 94  ? 47.626  -0.756  0.588   1.00 30.60 ? 574  LEU C CD2 1 
ATOM   6084 N  N   . GLU C 1 95  ? 47.284  -0.336  6.227   1.00 31.50 ? 575  GLU C N   1 
ATOM   6085 C  CA  . GLU C 1 95  ? 47.913  0.102   7.481   1.00 31.49 ? 575  GLU C CA  1 
ATOM   6086 C  C   . GLU C 1 95  ? 47.689  -0.908  8.611   1.00 31.56 ? 575  GLU C C   1 
ATOM   6087 O  O   . GLU C 1 95  ? 48.586  -1.145  9.433   1.00 31.70 ? 575  GLU C O   1 
ATOM   6088 C  CB  . GLU C 1 95  ? 47.396  1.483   7.900   1.00 31.38 ? 575  GLU C CB  1 
ATOM   6089 N  N   . GLU C 1 96  ? 46.498  -1.504  8.653   1.00 31.48 ? 576  GLU C N   1 
ATOM   6090 C  CA  . GLU C 1 96  ? 46.221  -2.584  9.601   1.00 31.42 ? 576  GLU C CA  1 
ATOM   6091 C  C   . GLU C 1 96  ? 47.126  -3.787  9.340   1.00 31.28 ? 576  GLU C C   1 
ATOM   6092 O  O   . GLU C 1 96  ? 47.605  -4.413  10.282  1.00 31.39 ? 576  GLU C O   1 
ATOM   6093 C  CB  . GLU C 1 96  ? 44.750  -3.009  9.551   1.00 31.42 ? 576  GLU C CB  1 
ATOM   6094 C  CG  . GLU C 1 96  ? 43.819  -2.088  10.322  1.00 31.73 ? 576  GLU C CG  1 
ATOM   6095 C  CD  . GLU C 1 96  ? 42.355  -2.456  10.160  1.00 32.21 ? 576  GLU C CD  1 
ATOM   6096 O  OE1 . GLU C 1 96  ? 41.941  -2.802  9.033   1.00 32.12 ? 576  GLU C OE1 1 
ATOM   6097 O  OE2 . GLU C 1 96  ? 41.610  -2.389  11.160  1.00 32.84 ? 576  GLU C OE2 1 
ATOM   6098 N  N   . LEU C 1 97  ? 47.358  -4.103  8.066   1.00 31.09 ? 577  LEU C N   1 
ATOM   6099 C  CA  . LEU C 1 97  ? 48.277  -5.184  7.691   1.00 30.95 ? 577  LEU C CA  1 
ATOM   6100 C  C   . LEU C 1 97  ? 49.727  -4.851  8.057   1.00 30.87 ? 577  LEU C C   1 
ATOM   6101 O  O   . LEU C 1 97  ? 50.491  -5.735  8.440   1.00 30.76 ? 577  LEU C O   1 
ATOM   6102 C  CB  . LEU C 1 97  ? 48.186  -5.482  6.191   1.00 30.92 ? 577  LEU C CB  1 
ATOM   6103 C  CG  . LEU C 1 97  ? 46.872  -6.052  5.660   1.00 30.69 ? 577  LEU C CG  1 
ATOM   6104 C  CD1 . LEU C 1 97  ? 46.955  -6.209  4.151   1.00 30.45 ? 577  LEU C CD1 1 
ATOM   6105 C  CD2 . LEU C 1 97  ? 46.541  -7.378  6.324   1.00 30.12 ? 577  LEU C CD2 1 
ATOM   6106 N  N   . GLN C 1 98  ? 50.093  -3.575  7.934   1.00 30.81 ? 578  GLN C N   1 
ATOM   6107 C  CA  . GLN C 1 98  ? 51.434  -3.105  8.307   1.00 30.76 ? 578  GLN C CA  1 
ATOM   6108 C  C   . GLN C 1 98  ? 51.761  -3.315  9.787   1.00 30.72 ? 578  GLN C C   1 
ATOM   6109 O  O   . GLN C 1 98  ? 52.929  -3.390  10.150  1.00 30.82 ? 578  GLN C O   1 
ATOM   6110 C  CB  . GLN C 1 98  ? 51.610  -1.619  7.969   1.00 30.72 ? 578  GLN C CB  1 
ATOM   6111 C  CG  . GLN C 1 98  ? 52.270  -1.337  6.632   1.00 30.62 ? 578  GLN C CG  1 
ATOM   6112 C  CD  . GLN C 1 98  ? 52.431  0.150   6.384   1.00 30.64 ? 578  GLN C CD  1 
ATOM   6113 O  OE1 . GLN C 1 98  ? 53.528  0.696   6.498   1.00 30.67 ? 578  GLN C OE1 1 
ATOM   6114 N  NE2 . GLN C 1 98  ? 51.330  0.818   6.060   1.00 31.38 ? 578  GLN C NE2 1 
ATOM   6115 N  N   . SER C 1 99  ? 50.740  -3.388  10.638  1.00 30.71 ? 579  SER C N   1 
ATOM   6116 C  CA  . SER C 1 99  ? 50.957  -3.577  12.072  1.00 30.73 ? 579  SER C CA  1 
ATOM   6117 C  C   . SER C 1 99  ? 51.628  -4.919  12.363  1.00 30.79 ? 579  SER C C   1 
ATOM   6118 O  O   . SER C 1 99  ? 52.398  -5.031  13.314  1.00 30.73 ? 579  SER C O   1 
ATOM   6119 C  CB  . SER C 1 99  ? 49.636  -3.478  12.843  1.00 30.69 ? 579  SER C CB  1 
ATOM   6120 O  OG  . SER C 1 99  ? 48.796  -4.587  12.578  1.00 30.66 ? 579  SER C OG  1 
ATOM   6121 N  N   . VAL C 1 100 ? 51.322  -5.923  11.541  1.00 30.82 ? 580  VAL C N   1 
ATOM   6122 C  CA  . VAL C 1 100 ? 51.885  -7.260  11.685  1.00 30.85 ? 580  VAL C CA  1 
ATOM   6123 C  C   . VAL C 1 100 ? 52.925  -7.586  10.611  1.00 30.96 ? 580  VAL C C   1 
ATOM   6124 O  O   . VAL C 1 100 ? 53.927  -8.232  10.913  1.00 30.92 ? 580  VAL C O   1 
ATOM   6125 C  CB  . VAL C 1 100 ? 50.778  -8.334  11.651  1.00 30.86 ? 580  VAL C CB  1 
ATOM   6126 C  CG1 . VAL C 1 100 ? 51.379  -9.735  11.573  1.00 30.85 ? 580  VAL C CG1 1 
ATOM   6127 C  CG2 . VAL C 1 100 ? 49.887  -8.204  12.871  1.00 30.77 ? 580  VAL C CG2 1 
ATOM   6128 N  N   . HIS C 1 101 ? 52.698  -7.141  9.374   1.00 31.05 ? 581  HIS C N   1 
ATOM   6129 C  CA  . HIS C 1 101 ? 53.537  -7.555  8.243   1.00 31.23 ? 581  HIS C CA  1 
ATOM   6130 C  C   . HIS C 1 101 ? 54.392  -6.447  7.639   1.00 31.37 ? 581  HIS C C   1 
ATOM   6131 O  O   . HIS C 1 101 ? 54.144  -5.260  7.861   1.00 31.55 ? 581  HIS C O   1 
ATOM   6132 C  CB  . HIS C 1 101 ? 52.668  -8.155  7.140   1.00 31.26 ? 581  HIS C CB  1 
ATOM   6133 C  CG  . HIS C 1 101 ? 51.857  -9.327  7.586   1.00 31.54 ? 581  HIS C CG  1 
ATOM   6134 N  ND1 . HIS C 1 101 ? 52.319  -10.623 7.511   1.00 32.17 ? 581  HIS C ND1 1 
ATOM   6135 C  CD2 . HIS C 1 101 ? 50.616  -9.400  8.121   1.00 31.88 ? 581  HIS C CD2 1 
ATOM   6136 C  CE1 . HIS C 1 101 ? 51.395  -11.444 7.975   1.00 32.57 ? 581  HIS C CE1 1 
ATOM   6137 N  NE2 . HIS C 1 101 ? 50.350  -10.727 8.350   1.00 32.03 ? 581  HIS C NE2 1 
ATOM   6138 N  N   . SER C 1 102 ? 55.385  -6.856  6.849   1.00 31.51 ? 582  SER C N   1 
ATOM   6139 C  CA  . SER C 1 102 ? 56.303  -5.927  6.187   1.00 31.66 ? 582  SER C CA  1 
ATOM   6140 C  C   . SER C 1 102 ? 55.628  -5.213  5.020   1.00 31.98 ? 582  SER C C   1 
ATOM   6141 O  O   . SER C 1 102 ? 54.527  -5.583  4.611   1.00 31.96 ? 582  SER C O   1 
ATOM   6142 C  CB  . SER C 1 102 ? 57.549  -6.665  5.688   1.00 31.61 ? 582  SER C CB  1 
ATOM   6143 O  OG  . SER C 1 102 ? 57.256  -7.505  4.585   1.00 31.23 ? 582  SER C OG  1 
ATOM   6144 N  N   . GLU C 1 103 ? 56.301  -4.196  4.487   1.00 32.45 ? 583  GLU C N   1 
ATOM   6145 C  CA  . GLU C 1 103 ? 55.757  -3.383  3.392   1.00 32.93 ? 583  GLU C CA  1 
ATOM   6146 C  C   . GLU C 1 103 ? 55.678  -4.160  2.081   1.00 33.14 ? 583  GLU C C   1 
ATOM   6147 O  O   . GLU C 1 103 ? 54.684  -4.061  1.363   1.00 33.23 ? 583  GLU C O   1 
ATOM   6148 C  CB  . GLU C 1 103 ? 56.587  -2.108  3.186   1.00 32.97 ? 583  GLU C CB  1 
ATOM   6149 C  CG  . GLU C 1 103 ? 56.479  -1.102  4.327   1.00 33.51 ? 583  GLU C CG  1 
ATOM   6150 C  CD  . GLU C 1 103 ? 57.282  0.170   4.084   1.00 34.53 ? 583  GLU C CD  1 
ATOM   6151 O  OE1 . GLU C 1 103 ? 57.688  0.425   2.929   1.00 35.05 ? 583  GLU C OE1 1 
ATOM   6152 O  OE2 . GLU C 1 103 ? 57.505  0.926   5.054   1.00 35.20 ? 583  GLU C OE2 1 
ATOM   6153 N  N   . ARG C 1 104 ? 56.724  -4.921  1.771   1.00 33.49 ? 584  ARG C N   1 
ATOM   6154 C  CA  . ARG C 1 104 ? 56.750  -5.744  0.561   1.00 33.86 ? 584  ARG C CA  1 
ATOM   6155 C  C   . ARG C 1 104 ? 55.722  -6.875  0.626   1.00 34.04 ? 584  ARG C C   1 
ATOM   6156 O  O   . ARG C 1 104 ? 55.130  -7.240  -0.388  1.00 34.27 ? 584  ARG C O   1 
ATOM   6157 C  CB  . ARG C 1 104 ? 58.146  -6.322  0.340   1.00 34.00 ? 584  ARG C CB  1 
ATOM   6158 C  CG  . ARG C 1 104 ? 58.276  -7.238  -0.871  1.00 34.49 ? 584  ARG C CG  1 
ATOM   6159 C  CD  . ARG C 1 104 ? 59.730  -7.362  -1.284  1.00 35.44 ? 584  ARG C CD  1 
ATOM   6160 N  NE  . ARG C 1 104 ? 60.022  -8.602  -1.999  1.00 36.59 ? 584  ARG C NE  1 
ATOM   6161 C  CZ  . ARG C 1 104 ? 60.162  -9.800  -1.430  1.00 38.28 ? 584  ARG C CZ  1 
ATOM   6162 N  NH1 . ARG C 1 104 ? 60.015  -9.959  -0.114  1.00 38.63 ? 584  ARG C NH1 1 
ATOM   6163 N  NH2 . ARG C 1 104 ? 60.445  -10.858 -2.185  1.00 38.94 ? 584  ARG C NH2 1 
ATOM   6164 N  N   . HIS C 1 105 ? 55.517  -7.426  1.818   1.00 34.16 ? 585  HIS C N   1 
ATOM   6165 C  CA  . HIS C 1 105 ? 54.496  -8.445  2.030   1.00 34.38 ? 585  HIS C CA  1 
ATOM   6166 C  C   . HIS C 1 105 ? 53.101  -7.862  1.790   1.00 34.71 ? 585  HIS C C   1 
ATOM   6167 O  O   . HIS C 1 105 ? 52.289  -8.446  1.067   1.00 34.48 ? 585  HIS C O   1 
ATOM   6168 C  CB  . HIS C 1 105 ? 54.594  -8.996  3.453   1.00 34.34 ? 585  HIS C CB  1 
ATOM   6169 C  CG  . HIS C 1 105 ? 53.687  -10.156 3.721   1.00 34.43 ? 585  HIS C CG  1 
ATOM   6170 N  ND1 . HIS C 1 105 ? 54.009  -11.450 3.372   1.00 34.43 ? 585  HIS C ND1 1 
ATOM   6171 C  CD2 . HIS C 1 105 ? 52.471  -10.218 4.315   1.00 34.43 ? 585  HIS C CD2 1 
ATOM   6172 C  CE1 . HIS C 1 105 ? 53.029  -12.258 3.734   1.00 34.52 ? 585  HIS C CE1 1 
ATOM   6173 N  NE2 . HIS C 1 105 ? 52.084  -11.536 4.309   1.00 34.66 ? 585  HIS C NE2 1 
ATOM   6174 N  N   . VAL C 1 106 ? 52.842  -6.705  2.401   1.00 35.07 ? 586  VAL C N   1 
ATOM   6175 C  CA  . VAL C 1 106 ? 51.547  -6.040  2.294   1.00 35.36 ? 586  VAL C CA  1 
ATOM   6176 C  C   . VAL C 1 106 ? 51.270  -5.608  0.853   1.00 35.53 ? 586  VAL C C   1 
ATOM   6177 O  O   . VAL C 1 106 ? 50.160  -5.785  0.366   1.00 35.48 ? 586  VAL C O   1 
ATOM   6178 C  CB  . VAL C 1 106 ? 51.445  -4.829  3.258   1.00 35.46 ? 586  VAL C CB  1 
ATOM   6179 C  CG1 . VAL C 1 106 ? 50.193  -4.004  2.972   1.00 35.55 ? 586  VAL C CG1 1 
ATOM   6180 C  CG2 . VAL C 1 106 ? 51.447  -5.302  4.706   1.00 35.51 ? 586  VAL C CG2 1 
ATOM   6181 N  N   . LEU C 1 107 ? 52.275  -5.061  0.171   1.00 35.84 ? 587  LEU C N   1 
ATOM   6182 C  CA  . LEU C 1 107 ? 52.128  -4.706  -1.243  1.00 36.15 ? 587  LEU C CA  1 
ATOM   6183 C  C   . LEU C 1 107 ? 51.824  -5.935  -2.102  1.00 36.58 ? 587  LEU C C   1 
ATOM   6184 O  O   . LEU C 1 107 ? 50.830  -5.954  -2.835  1.00 36.62 ? 587  LEU C O   1 
ATOM   6185 C  CB  . LEU C 1 107 ? 53.382  -4.001  -1.782  1.00 36.07 ? 587  LEU C CB  1 
ATOM   6186 C  CG  . LEU C 1 107 ? 53.557  -2.509  -1.481  1.00 35.98 ? 587  LEU C CG  1 
ATOM   6187 C  CD1 . LEU C 1 107 ? 54.727  -1.959  -2.285  1.00 35.94 ? 587  LEU C CD1 1 
ATOM   6188 C  CD2 . LEU C 1 107 ? 52.298  -1.712  -1.783  1.00 35.13 ? 587  LEU C CD2 1 
ATOM   6189 N  N   . LEU C 1 108 ? 52.672  -6.957  -1.993  1.00 37.00 ? 588  LEU C N   1 
ATOM   6190 C  CA  . LEU C 1 108 ? 52.568  -8.156  -2.830  1.00 37.36 ? 588  LEU C CA  1 
ATOM   6191 C  C   . LEU C 1 108 ? 51.224  -8.874  -2.697  1.00 37.71 ? 588  LEU C C   1 
ATOM   6192 O  O   . LEU C 1 108 ? 50.626  -9.260  -3.701  1.00 37.78 ? 588  LEU C O   1 
ATOM   6193 C  CB  . LEU C 1 108 ? 53.705  -9.130  -2.501  1.00 37.44 ? 588  LEU C CB  1 
ATOM   6194 C  CG  . LEU C 1 108 ? 53.877  -10.356 -3.403  1.00 37.45 ? 588  LEU C CG  1 
ATOM   6195 C  CD1 . LEU C 1 108 ? 54.080  -9.939  -4.850  1.00 37.40 ? 588  LEU C CD1 1 
ATOM   6196 C  CD2 . LEU C 1 108 ? 55.044  -11.199 -2.922  1.00 37.08 ? 588  LEU C CD2 1 
ATOM   6197 N  N   . TYR C 1 109 ? 50.753  -9.049  -1.465  1.00 38.12 ? 589  TYR C N   1 
ATOM   6198 C  CA  . TYR C 1 109 ? 49.530  -9.818  -1.210  1.00 38.53 ? 589  TYR C CA  1 
ATOM   6199 C  C   . TYR C 1 109 ? 48.296  -8.964  -0.887  1.00 38.88 ? 589  TYR C C   1 
ATOM   6200 O  O   . TYR C 1 109 ? 47.178  -9.476  -0.888  1.00 38.75 ? 589  TYR C O   1 
ATOM   6201 C  CB  . TYR C 1 109 ? 49.769  -10.823 -0.079  1.00 38.54 ? 589  TYR C CB  1 
ATOM   6202 C  CG  . TYR C 1 109 ? 50.870  -11.820 -0.372  1.00 38.60 ? 589  TYR C CG  1 
ATOM   6203 C  CD1 . TYR C 1 109 ? 50.725  -12.766 -1.383  1.00 38.68 ? 589  TYR C CD1 1 
ATOM   6204 C  CD2 . TYR C 1 109 ? 52.054  -11.821 0.364   1.00 38.61 ? 589  TYR C CD2 1 
ATOM   6205 C  CE1 . TYR C 1 109 ? 51.731  -13.684 -1.659  1.00 38.43 ? 589  TYR C CE1 1 
ATOM   6206 C  CE2 . TYR C 1 109 ? 53.064  -12.736 0.096   1.00 38.70 ? 589  TYR C CE2 1 
ATOM   6207 C  CZ  . TYR C 1 109 ? 52.896  -13.664 -0.917  1.00 38.57 ? 589  TYR C CZ  1 
ATOM   6208 O  OH  . TYR C 1 109 ? 53.894  -14.574 -1.185  1.00 38.76 ? 589  TYR C OH  1 
ATOM   6209 N  N   . GLY C 1 110 ? 48.493  -7.674  -0.616  1.00 39.41 ? 590  GLY C N   1 
ATOM   6210 C  CA  . GLY C 1 110 ? 47.392  -6.787  -0.228  1.00 39.80 ? 590  GLY C CA  1 
ATOM   6211 C  C   . GLY C 1 110 ? 46.808  -5.943  -1.348  1.00 40.25 ? 590  GLY C C   1 
ATOM   6212 O  O   . GLY C 1 110 ? 45.817  -5.238  -1.137  1.00 40.16 ? 590  GLY C O   1 
ATOM   6213 N  N   . THR C 1 111 ? 47.420  -6.004  -2.531  1.00 40.83 ? 591  THR C N   1 
ATOM   6214 C  CA  . THR C 1 111 ? 46.945  -5.262  -3.702  1.00 41.21 ? 591  THR C CA  1 
ATOM   6215 C  C   . THR C 1 111 ? 47.101  -6.085  -4.981  1.00 41.68 ? 591  THR C C   1 
ATOM   6216 O  O   . THR C 1 111 ? 47.996  -6.930  -5.079  1.00 41.75 ? 591  THR C O   1 
ATOM   6217 C  CB  . THR C 1 111 ? 47.715  -3.930  -3.883  1.00 41.21 ? 591  THR C CB  1 
ATOM   6218 O  OG1 . THR C 1 111 ? 49.095  -4.196  -4.166  1.00 41.06 ? 591  THR C OG1 1 
ATOM   6219 C  CG2 . THR C 1 111 ? 47.612  -3.064  -2.633  1.00 41.20 ? 591  THR C CG2 1 
ATOM   6220 N  N   . ASN C 1 112 ? 46.234  -5.820  -5.959  1.00 42.23 ? 592  ASN C N   1 
ATOM   6221 C  CA  . ASN C 1 112 ? 46.286  -6.492  -7.266  1.00 42.63 ? 592  ASN C CA  1 
ATOM   6222 C  C   . ASN C 1 112 ? 47.295  -5.742  -8.181  1.00 42.87 ? 592  ASN C C   1 
ATOM   6223 O  O   . ASN C 1 112 ? 48.410  -5.474  -7.720  1.00 42.91 ? 592  ASN C O   1 
ATOM   6224 C  CB  . ASN C 1 112 ? 44.867  -6.648  -7.832  1.00 42.70 ? 592  ASN C CB  1 
ATOM   6225 C  CG  . ASN C 1 112 ? 43.919  -7.335  -6.856  1.00 43.00 ? 592  ASN C CG  1 
ATOM   6226 O  OD1 . ASN C 1 112 ? 44.216  -8.411  -6.334  1.00 43.04 ? 592  ASN C OD1 1 
ATOM   6227 N  ND2 . ASN C 1 112 ? 42.769  -6.715  -6.611  1.00 43.58 ? 592  ASN C ND2 1 
ATOM   6228 N  N   . PRO C 1 113 ? 46.961  -5.409  -9.457  1.00 43.12 ? 593  PRO C N   1 
ATOM   6229 C  CA  . PRO C 1 113 ? 45.826  -5.602  -10.372 1.00 43.21 ? 593  PRO C CA  1 
ATOM   6230 C  C   . PRO C 1 113 ? 45.868  -6.953  -11.090 1.00 43.21 ? 593  PRO C C   1 
ATOM   6231 O  O   . PRO C 1 113 ? 46.850  -7.687  -10.968 1.00 43.29 ? 593  PRO C O   1 
ATOM   6232 C  CB  . PRO C 1 113 ? 46.005  -4.468  -11.381 1.00 43.27 ? 593  PRO C CB  1 
ATOM   6233 C  CG  . PRO C 1 113 ? 47.464  -4.310  -11.484 1.00 43.29 ? 593  PRO C CG  1 
ATOM   6234 C  CD  . PRO C 1 113 ? 48.035  -4.641  -10.124 1.00 43.12 ? 593  PRO C CD  1 
ATOM   6235 N  N   . LEU C 1 136 ? 52.244  -23.422 -10.599 1.00 33.09 ? 616  LEU C N   1 
ATOM   6236 C  CA  . LEU C 1 136 ? 51.852  -24.709 -10.031 1.00 33.10 ? 616  LEU C CA  1 
ATOM   6237 C  C   . LEU C 1 136 ? 51.704  -25.768 -11.129 1.00 33.07 ? 616  LEU C C   1 
ATOM   6238 O  O   . LEU C 1 136 ? 51.455  -25.427 -12.288 1.00 33.19 ? 616  LEU C O   1 
ATOM   6239 C  CB  . LEU C 1 136 ? 50.535  -24.570 -9.256  1.00 33.07 ? 616  LEU C CB  1 
ATOM   6240 C  CG  . LEU C 1 136 ? 50.536  -23.610 -8.061  1.00 33.15 ? 616  LEU C CG  1 
ATOM   6241 C  CD1 . LEU C 1 136 ? 49.174  -23.585 -7.374  1.00 32.54 ? 616  LEU C CD1 1 
ATOM   6242 C  CD2 . LEU C 1 136 ? 51.621  -23.987 -7.068  1.00 33.24 ? 616  LEU C CD2 1 
ATOM   6243 N  N   . PRO C 1 137 ? 51.851  -27.058 -10.767 1.00 32.96 ? 617  PRO C N   1 
ATOM   6244 C  CA  . PRO C 1 137 ? 51.741  -28.142 -11.751 1.00 32.92 ? 617  PRO C CA  1 
ATOM   6245 C  C   . PRO C 1 137 ? 50.328  -28.353 -12.306 1.00 32.85 ? 617  PRO C C   1 
ATOM   6246 O  O   . PRO C 1 137 ? 50.176  -28.952 -13.371 1.00 32.90 ? 617  PRO C O   1 
ATOM   6247 C  CB  . PRO C 1 137 ? 52.204  -29.379 -10.969 1.00 32.90 ? 617  PRO C CB  1 
ATOM   6248 C  CG  . PRO C 1 137 ? 51.954  -29.049 -9.544  1.00 33.02 ? 617  PRO C CG  1 
ATOM   6249 C  CD  . PRO C 1 137 ? 52.164  -27.570 -9.418  1.00 33.01 ? 617  PRO C CD  1 
ATOM   6250 N  N   . CYS C 1 138 ? 49.312  -27.876 -11.591 1.00 32.82 ? 618  CYS C N   1 
ATOM   6251 C  CA  . CYS C 1 138 ? 47.929  -27.934 -12.071 1.00 32.81 ? 618  CYS C CA  1 
ATOM   6252 C  C   . CYS C 1 138 ? 47.609  -26.824 -13.077 1.00 32.89 ? 618  CYS C C   1 
ATOM   6253 O  O   . CYS C 1 138 ? 46.581  -26.881 -13.752 1.00 32.81 ? 618  CYS C O   1 
ATOM   6254 C  CB  . CYS C 1 138 ? 46.961  -27.839 -10.896 1.00 32.80 ? 618  CYS C CB  1 
ATOM   6255 S  SG  . CYS C 1 138 ? 47.092  -26.297 -9.966  1.00 32.46 ? 618  CYS C SG  1 
ATOM   6256 N  N   . GLY C 1 139 ? 48.479  -25.818 -13.161 1.00 33.04 ? 619  GLY C N   1 
ATOM   6257 C  CA  . GLY C 1 139 ? 48.301  -24.704 -14.095 1.00 33.22 ? 619  GLY C CA  1 
ATOM   6258 C  C   . GLY C 1 139 ? 48.077  -23.360 -13.419 1.00 33.33 ? 619  GLY C C   1 
ATOM   6259 O  O   . GLY C 1 139 ? 48.297  -22.313 -14.027 1.00 33.42 ? 619  GLY C O   1 
ATOM   6260 N  N   . GLY C 1 140 ? 47.634  -23.381 -12.165 1.00 33.44 ? 620  GLY C N   1 
ATOM   6261 C  CA  . GLY C 1 140 ? 47.388  -22.150 -11.418 1.00 33.64 ? 620  GLY C CA  1 
ATOM   6262 C  C   . GLY C 1 140 ? 48.656  -21.509 -10.885 1.00 33.82 ? 620  GLY C C   1 
ATOM   6263 O  O   . GLY C 1 140 ? 49.765  -21.971 -11.160 1.00 33.96 ? 620  GLY C O   1 
ATOM   6264 N  N   . VAL C 1 141 ? 48.481  -20.437 -10.118 1.00 34.01 ? 621  VAL C N   1 
ATOM   6265 C  CA  . VAL C 1 141 ? 49.585  -19.721 -9.482  1.00 34.21 ? 621  VAL C CA  1 
ATOM   6266 C  C   . VAL C 1 141 ? 49.478  -19.873 -7.965  1.00 34.34 ? 621  VAL C C   1 
ATOM   6267 O  O   . VAL C 1 141 ? 48.384  -20.079 -7.434  1.00 34.34 ? 621  VAL C O   1 
ATOM   6268 C  CB  . VAL C 1 141 ? 49.557  -18.219 -9.851  1.00 34.24 ? 621  VAL C CB  1 
ATOM   6269 C  CG1 . VAL C 1 141 ? 50.765  -17.487 -9.271  1.00 34.37 ? 621  VAL C CG1 1 
ATOM   6270 C  CG2 . VAL C 1 141 ? 49.503  -18.045 -11.361 1.00 34.22 ? 621  VAL C CG2 1 
ATOM   6271 N  N   . GLY C 1 142 ? 50.614  -19.781 -7.276  1.00 34.52 ? 622  GLY C N   1 
ATOM   6272 C  CA  . GLY C 1 142 ? 50.641  -19.800 -5.809  1.00 34.72 ? 622  GLY C CA  1 
ATOM   6273 C  C   . GLY C 1 142 ? 51.950  -19.264 -5.260  1.00 34.89 ? 622  GLY C C   1 
ATOM   6274 O  O   . GLY C 1 142 ? 52.829  -18.872 -6.026  1.00 34.92 ? 622  GLY C O   1 
ATOM   6275 N  N   . VAL C 1 143 ? 52.076  -19.229 -3.934  1.00 35.17 ? 623  VAL C N   1 
ATOM   6276 C  CA  . VAL C 1 143 ? 53.364  -18.917 -3.296  1.00 35.32 ? 623  VAL C CA  1 
ATOM   6277 C  C   . VAL C 1 143 ? 54.150  -20.214 -3.101  1.00 35.39 ? 623  VAL C C   1 
ATOM   6278 O  O   . VAL C 1 143 ? 55.376  -20.202 -3.029  1.00 35.50 ? 623  VAL C O   1 
ATOM   6279 C  CB  . VAL C 1 143 ? 53.210  -18.153 -1.951  1.00 35.34 ? 623  VAL C CB  1 
ATOM   6280 C  CG1 . VAL C 1 143 ? 52.119  -17.084 -2.056  1.00 35.15 ? 623  VAL C CG1 1 
ATOM   6281 C  CG2 . VAL C 1 143 ? 52.923  -19.102 -0.808  1.00 35.44 ? 623  VAL C CG2 1 
ATOM   6282 N  N   . ASP C 1 144 ? 53.426  -21.325 -3.002  1.00 35.49 ? 624  ASP C N   1 
ATOM   6283 C  CA  . ASP C 1 144 ? 54.014  -22.660 -3.082  1.00 35.56 ? 624  ASP C CA  1 
ATOM   6284 C  C   . ASP C 1 144 ? 52.929  -23.645 -3.523  1.00 35.49 ? 624  ASP C C   1 
ATOM   6285 O  O   . ASP C 1 144 ? 51.804  -23.233 -3.817  1.00 35.52 ? 624  ASP C O   1 
ATOM   6286 C  CB  . ASP C 1 144 ? 54.666  -23.064 -1.746  1.00 35.65 ? 624  ASP C CB  1 
ATOM   6287 C  CG  . ASP C 1 144 ? 53.702  -23.010 -0.567  1.00 36.13 ? 624  ASP C CG  1 
ATOM   6288 O  OD1 . ASP C 1 144 ? 52.624  -23.636 -0.634  1.00 36.84 ? 624  ASP C OD1 1 
ATOM   6289 O  OD2 . ASP C 1 144 ? 54.037  -22.357 0.446   1.00 36.75 ? 624  ASP C OD2 1 
ATOM   6290 N  N   . THR C 1 145 ? 53.265  -24.933 -3.578  1.00 35.45 ? 625  THR C N   1 
ATOM   6291 C  CA  . THR C 1 145 ? 52.320  -25.970 -4.009  1.00 35.38 ? 625  THR C CA  1 
ATOM   6292 C  C   . THR C 1 145 ? 51.026  -25.957 -3.193  1.00 35.31 ? 625  THR C C   1 
ATOM   6293 O  O   . THR C 1 145 ? 49.942  -26.128 -3.749  1.00 35.31 ? 625  THR C O   1 
ATOM   6294 C  CB  . THR C 1 145 ? 52.948  -27.384 -3.933  1.00 35.41 ? 625  THR C CB  1 
ATOM   6295 O  OG1 . THR C 1 145 ? 53.501  -27.597 -2.628  1.00 35.59 ? 625  THR C OG1 1 
ATOM   6296 C  CG2 . THR C 1 145 ? 54.045  -27.549 -4.981  1.00 35.19 ? 625  THR C CG2 1 
ATOM   6297 N  N   . ASP C 1 146 ? 51.146  -25.746 -1.882  1.00 35.20 ? 626  ASP C N   1 
ATOM   6298 C  CA  . ASP C 1 146 ? 49.984  -25.705 -0.991  1.00 35.15 ? 626  ASP C CA  1 
ATOM   6299 C  C   . ASP C 1 146 ? 49.245  -24.365 -1.061  1.00 35.02 ? 626  ASP C C   1 
ATOM   6300 O  O   . ASP C 1 146 ? 48.050  -24.326 -1.353  1.00 35.20 ? 626  ASP C O   1 
ATOM   6301 C  CB  . ASP C 1 146 ? 50.401  -25.988 0.460   1.00 35.10 ? 626  ASP C CB  1 
ATOM   6302 C  CG  . ASP C 1 146 ? 50.798  -27.443 0.690   1.00 35.35 ? 626  ASP C CG  1 
ATOM   6303 O  OD1 . ASP C 1 146 ? 50.556  -28.292 -0.195  1.00 35.60 ? 626  ASP C OD1 1 
ATOM   6304 O  OD2 . ASP C 1 146 ? 51.350  -27.742 1.771   1.00 35.38 ? 626  ASP C OD2 1 
ATOM   6305 N  N   . THR C 1 147 ? 49.961  -23.274 -0.796  1.00 34.76 ? 627  THR C N   1 
ATOM   6306 C  CA  . THR C 1 147 ? 49.349  -21.948 -0.677  1.00 34.54 ? 627  THR C CA  1 
ATOM   6307 C  C   . THR C 1 147 ? 49.011  -21.356 -2.051  1.00 34.25 ? 627  THR C C   1 
ATOM   6308 O  O   . THR C 1 147 ? 49.883  -20.839 -2.751  1.00 34.32 ? 627  THR C O   1 
ATOM   6309 C  CB  . THR C 1 147 ? 50.258  -20.979 0.113   1.00 34.56 ? 627  THR C CB  1 
ATOM   6310 O  OG1 . THR C 1 147 ? 50.807  -21.650 1.257   1.00 34.93 ? 627  THR C OG1 1 
ATOM   6311 C  CG2 . THR C 1 147 ? 49.478  -19.756 0.573   1.00 34.24 ? 627  THR C CG2 1 
ATOM   6312 N  N   . ILE C 1 148 ? 47.732  -21.433 -2.411  1.00 33.92 ? 628  ILE C N   1 
ATOM   6313 C  CA  . ILE C 1 148 ? 47.231  -21.015 -3.727  1.00 33.68 ? 628  ILE C CA  1 
ATOM   6314 C  C   . ILE C 1 148 ? 47.163  -19.496 -3.877  1.00 33.34 ? 628  ILE C C   1 
ATOM   6315 O  O   . ILE C 1 148 ? 47.121  -18.775 -2.885  1.00 33.30 ? 628  ILE C O   1 
ATOM   6316 C  CB  . ILE C 1 148 ? 45.809  -21.594 -3.962  1.00 33.69 ? 628  ILE C CB  1 
ATOM   6317 C  CG1 . ILE C 1 148 ? 45.858  -23.121 -3.973  1.00 33.67 ? 628  ILE C CG1 1 
ATOM   6318 C  CG2 . ILE C 1 148 ? 45.202  -21.079 -5.255  1.00 33.74 ? 628  ILE C CG2 1 
ATOM   6319 C  CD1 . ILE C 1 148 ? 46.945  -23.681 -4.852  1.00 34.14 ? 628  ILE C CD1 1 
ATOM   6320 N  N   . TRP C 1 149 ? 47.165  -19.015 -5.120  1.00 32.94 ? 629  TRP C N   1 
ATOM   6321 C  CA  . TRP C 1 149 ? 46.933  -17.594 -5.391  1.00 32.69 ? 629  TRP C CA  1 
ATOM   6322 C  C   . TRP C 1 149 ? 45.996  -17.354 -6.574  1.00 32.17 ? 629  TRP C C   1 
ATOM   6323 O  O   . TRP C 1 149 ? 46.393  -17.468 -7.731  1.00 32.09 ? 629  TRP C O   1 
ATOM   6324 C  CB  . TRP C 1 149 ? 48.254  -16.858 -5.623  1.00 32.75 ? 629  TRP C CB  1 
ATOM   6325 C  CG  . TRP C 1 149 ? 48.080  -15.369 -5.690  1.00 33.04 ? 629  TRP C CG  1 
ATOM   6326 C  CD1 . TRP C 1 149 ? 48.192  -14.578 -6.795  1.00 33.38 ? 629  TRP C CD1 1 
ATOM   6327 C  CD2 . TRP C 1 149 ? 47.744  -14.499 -4.605  1.00 33.59 ? 629  TRP C CD2 1 
ATOM   6328 N  NE1 . TRP C 1 149 ? 47.959  -13.266 -6.465  1.00 33.49 ? 629  TRP C NE1 1 
ATOM   6329 C  CE2 . TRP C 1 149 ? 47.679  -13.188 -5.127  1.00 33.62 ? 629  TRP C CE2 1 
ATOM   6330 C  CE3 . TRP C 1 149 ? 47.497  -14.698 -3.240  1.00 33.96 ? 629  TRP C CE3 1 
ATOM   6331 C  CZ2 . TRP C 1 149 ? 47.378  -12.078 -4.332  1.00 33.79 ? 629  TRP C CZ2 1 
ATOM   6332 C  CZ3 . TRP C 1 149 ? 47.196  -13.593 -2.449  1.00 34.19 ? 629  TRP C CZ3 1 
ATOM   6333 C  CH2 . TRP C 1 149 ? 47.141  -12.299 -3.000  1.00 34.02 ? 629  TRP C CH2 1 
ATOM   6334 N  N   . ASN C 1 150 ? 44.750  -17.015 -6.265  1.00 31.75 ? 630  ASN C N   1 
ATOM   6335 C  CA  . ASN C 1 150 ? 43.798  -16.555 -7.267  1.00 31.43 ? 630  ASN C CA  1 
ATOM   6336 C  C   . ASN C 1 150 ? 44.080  -15.084 -7.578  1.00 31.13 ? 630  ASN C C   1 
ATOM   6337 O  O   . ASN C 1 150 ? 44.050  -14.237 -6.685  1.00 30.88 ? 630  ASN C O   1 
ATOM   6338 C  CB  . ASN C 1 150 ? 42.368  -16.734 -6.754  1.00 31.40 ? 630  ASN C CB  1 
ATOM   6339 C  CG  . ASN C 1 150 ? 41.324  -16.488 -7.826  1.00 31.43 ? 630  ASN C CG  1 
ATOM   6340 O  OD1 . ASN C 1 150 ? 41.141  -15.358 -8.289  1.00 31.39 ? 630  ASN C OD1 1 
ATOM   6341 N  ND2 . ASN C 1 150 ? 40.617  -17.546 -8.215  1.00 30.87 ? 630  ASN C ND2 1 
ATOM   6342 N  N   . GLU C 1 151 ? 44.344  -14.792 -8.849  1.00 30.83 ? 631  GLU C N   1 
ATOM   6343 C  CA  . GLU C 1 151 ? 44.822  -13.472 -9.274  1.00 30.62 ? 631  GLU C CA  1 
ATOM   6344 C  C   . GLU C 1 151 ? 43.804  -12.335 -9.118  1.00 30.34 ? 631  GLU C C   1 
ATOM   6345 O  O   . GLU C 1 151 ? 44.184  -11.166 -9.089  1.00 30.21 ? 631  GLU C O   1 
ATOM   6346 C  CB  . GLU C 1 151 ? 45.307  -13.540 -10.726 1.00 30.66 ? 631  GLU C CB  1 
ATOM   6347 C  CG  . GLU C 1 151 ? 46.598  -14.334 -10.893 1.00 30.88 ? 631  GLU C CG  1 
ATOM   6348 C  CD  . GLU C 1 151 ? 46.797  -14.849 -12.304 1.00 31.10 ? 631  GLU C CD  1 
ATOM   6349 O  OE1 . GLU C 1 151 ? 46.184  -15.882 -12.651 1.00 31.36 ? 631  GLU C OE1 1 
ATOM   6350 O  OE2 . GLU C 1 151 ? 47.578  -14.234 -13.061 1.00 31.23 ? 631  GLU C OE2 1 
ATOM   6351 N  N   . LEU C 1 152 ? 42.524  -12.680 -9.021  1.00 30.03 ? 632  LEU C N   1 
ATOM   6352 C  CA  . LEU C 1 152 ? 41.465  -11.692 -8.835  1.00 29.86 ? 632  LEU C CA  1 
ATOM   6353 C  C   . LEU C 1 152 ? 40.972  -11.619 -7.389  1.00 29.65 ? 632  LEU C C   1 
ATOM   6354 O  O   . LEU C 1 152 ? 40.656  -10.536 -6.901  1.00 29.80 ? 632  LEU C O   1 
ATOM   6355 C  CB  . LEU C 1 152 ? 40.276  -12.019 -9.747  1.00 29.86 ? 632  LEU C CB  1 
ATOM   6356 C  CG  . LEU C 1 152 ? 40.526  -11.909 -11.250 1.00 29.75 ? 632  LEU C CG  1 
ATOM   6357 C  CD1 . LEU C 1 152 ? 39.577  -12.810 -12.020 1.00 29.70 ? 632  LEU C CD1 1 
ATOM   6358 C  CD2 . LEU C 1 152 ? 40.394  -10.467 -11.705 1.00 29.97 ? 632  LEU C CD2 1 
ATOM   6359 N  N   . HIS C 1 153 ? 40.909  -12.762 -6.708  1.00 29.37 ? 633  HIS C N   1 
ATOM   6360 C  CA  . HIS C 1 153 ? 40.124  -12.878 -5.475  1.00 29.05 ? 633  HIS C CA  1 
ATOM   6361 C  C   . HIS C 1 153 ? 40.896  -13.156 -4.190  1.00 28.87 ? 633  HIS C C   1 
ATOM   6362 O  O   . HIS C 1 153 ? 40.409  -12.825 -3.116  1.00 28.96 ? 633  HIS C O   1 
ATOM   6363 C  CB  . HIS C 1 153 ? 39.060  -13.961 -5.656  1.00 28.99 ? 633  HIS C CB  1 
ATOM   6364 C  CG  . HIS C 1 153 ? 38.195  -13.757 -6.860  1.00 28.58 ? 633  HIS C CG  1 
ATOM   6365 N  ND1 . HIS C 1 153 ? 37.375  -12.660 -7.009  1.00 28.08 ? 633  HIS C ND1 1 
ATOM   6366 C  CD2 . HIS C 1 153 ? 38.021  -14.510 -7.972  1.00 28.17 ? 633  HIS C CD2 1 
ATOM   6367 C  CE1 . HIS C 1 153 ? 36.733  -12.746 -8.161  1.00 27.86 ? 633  HIS C CE1 1 
ATOM   6368 N  NE2 . HIS C 1 153 ? 37.107  -13.859 -8.764  1.00 27.73 ? 633  HIS C NE2 1 
ATOM   6369 N  N   . SER C 1 154 ? 42.076  -13.766 -4.277  1.00 28.75 ? 634  SER C N   1 
ATOM   6370 C  CA  . SER C 1 154 ? 42.799  -14.188 -3.065  1.00 28.70 ? 634  SER C CA  1 
ATOM   6371 C  C   . SER C 1 154 ? 43.125  -13.025 -2.132  1.00 28.56 ? 634  SER C C   1 
ATOM   6372 O  O   . SER C 1 154 ? 42.917  -13.114 -0.919  1.00 28.45 ? 634  SER C O   1 
ATOM   6373 C  CB  . SER C 1 154 ? 44.080  -14.955 -3.415  1.00 28.69 ? 634  SER C CB  1 
ATOM   6374 O  OG  . SER C 1 154 ? 43.777  -16.281 -3.816  1.00 28.63 ? 634  SER C OG  1 
ATOM   6375 N  N   . SER C 1 155 ? 43.628  -11.938 -2.705  1.00 28.56 ? 635  SER C N   1 
ATOM   6376 C  CA  . SER C 1 155 ? 43.958  -10.739 -1.937  1.00 28.50 ? 635  SER C CA  1 
ATOM   6377 C  C   . SER C 1 155 ? 42.741  -10.212 -1.173  1.00 28.46 ? 635  SER C C   1 
ATOM   6378 O  O   . SER C 1 155 ? 42.858  -9.807  -0.018  1.00 28.28 ? 635  SER C O   1 
ATOM   6379 C  CB  . SER C 1 155 ? 44.516  -9.658  -2.865  1.00 28.56 ? 635  SER C CB  1 
ATOM   6380 O  OG  . SER C 1 155 ? 44.977  -8.537  -2.135  1.00 28.86 ? 635  SER C OG  1 
ATOM   6381 N  N   . ASN C 1 156 ? 41.575  -10.234 -1.814  1.00 28.49 ? 636  ASN C N   1 
ATOM   6382 C  CA  . ASN C 1 156 ? 40.338  -9.786  -1.172  1.00 28.54 ? 636  ASN C CA  1 
ATOM   6383 C  C   . ASN C 1 156 ? 39.896  -10.724 -0.057  1.00 28.71 ? 636  ASN C C   1 
ATOM   6384 O  O   . ASN C 1 156 ? 39.429  -10.269 0.990   1.00 28.93 ? 636  ASN C O   1 
ATOM   6385 C  CB  . ASN C 1 156 ? 39.208  -9.644  -2.195  1.00 28.43 ? 636  ASN C CB  1 
ATOM   6386 C  CG  . ASN C 1 156 ? 39.468  -8.548  -3.214  1.00 28.35 ? 636  ASN C CG  1 
ATOM   6387 O  OD1 . ASN C 1 156 ? 38.954  -8.598  -4.333  1.00 29.12 ? 636  ASN C OD1 1 
ATOM   6388 N  ND2 . ASN C 1 156 ? 40.259  -7.552  -2.835  1.00 27.31 ? 636  ASN C ND2 1 
ATOM   6389 N  N   . ALA C 1 157 ? 40.039  -12.027 -0.285  1.00 28.76 ? 637  ALA C N   1 
ATOM   6390 C  CA  . ALA C 1 157 ? 39.652  -13.030 0.704   1.00 28.92 ? 637  ALA C CA  1 
ATOM   6391 C  C   . ALA C 1 157 ? 40.533  -12.932 1.942   1.00 29.10 ? 637  ALA C C   1 
ATOM   6392 O  O   . ALA C 1 157 ? 40.030  -12.910 3.068   1.00 29.23 ? 637  ALA C O   1 
ATOM   6393 C  CB  . ALA C 1 157 ? 39.735  -14.426 0.109   1.00 28.88 ? 637  ALA C CB  1 
ATOM   6394 N  N   . ALA C 1 158 ? 41.846  -12.868 1.723   1.00 29.18 ? 638  ALA C N   1 
ATOM   6395 C  CA  . ALA C 1 158 ? 42.816  -12.740 2.810   1.00 29.20 ? 638  ALA C CA  1 
ATOM   6396 C  C   . ALA C 1 158 ? 42.575  -11.471 3.632   1.00 29.28 ? 638  ALA C C   1 
ATOM   6397 O  O   . ALA C 1 158 ? 42.571  -11.507 4.864   1.00 29.11 ? 638  ALA C O   1 
ATOM   6398 C  CB  . ALA C 1 158 ? 44.234  -12.747 2.248   1.00 29.19 ? 638  ALA C CB  1 
ATOM   6399 N  N   . ARG C 1 159 ? 42.360  -10.354 2.943   1.00 29.47 ? 639  ARG C N   1 
ATOM   6400 C  CA  . ARG C 1 159 ? 42.107  -9.078  3.610   1.00 29.66 ? 639  ARG C CA  1 
ATOM   6401 C  C   . ARG C 1 159 ? 40.762  -9.056  4.325   1.00 29.73 ? 639  ARG C C   1 
ATOM   6402 O  O   . ARG C 1 159 ? 40.607  -8.359  5.329   1.00 29.65 ? 639  ARG C O   1 
ATOM   6403 C  CB  . ARG C 1 159 ? 42.192  -7.924  2.617   1.00 29.74 ? 639  ARG C CB  1 
ATOM   6404 C  CG  . ARG C 1 159 ? 43.604  -7.665  2.140   1.00 30.23 ? 639  ARG C CG  1 
ATOM   6405 C  CD  . ARG C 1 159 ? 43.645  -6.550  1.131   1.00 30.98 ? 639  ARG C CD  1 
ATOM   6406 N  NE  . ARG C 1 159 ? 43.336  -5.268  1.751   1.00 31.85 ? 639  ARG C NE  1 
ATOM   6407 C  CZ  . ARG C 1 159 ? 43.254  -4.113  1.099   1.00 32.65 ? 639  ARG C CZ  1 
ATOM   6408 N  NH1 . ARG C 1 159 ? 43.460  -4.055  -0.213  1.00 33.04 ? 639  ARG C NH1 1 
ATOM   6409 N  NH2 . ARG C 1 159 ? 42.968  -3.003  1.768   1.00 33.52 ? 639  ARG C NH2 1 
ATOM   6410 N  N   . TRP C 1 160 ? 39.797  -9.818  3.815   1.00 29.81 ? 640  TRP C N   1 
ATOM   6411 C  CA  . TRP C 1 160 ? 38.506  -9.943  4.486   1.00 29.88 ? 640  TRP C CA  1 
ATOM   6412 C  C   . TRP C 1 160 ? 38.659  -10.720 5.797   1.00 30.04 ? 640  TRP C C   1 
ATOM   6413 O  O   . TRP C 1 160 ? 38.133  -10.301 6.832   1.00 30.18 ? 640  TRP C O   1 
ATOM   6414 C  CB  . TRP C 1 160 ? 37.468  -10.616 3.587   1.00 29.81 ? 640  TRP C CB  1 
ATOM   6415 C  CG  . TRP C 1 160 ? 36.071  -10.230 3.929   1.00 29.85 ? 640  TRP C CG  1 
ATOM   6416 C  CD1 . TRP C 1 160 ? 35.226  -10.874 4.786   1.00 29.85 ? 640  TRP C CD1 1 
ATOM   6417 C  CD2 . TRP C 1 160 ? 35.351  -9.099  3.428   1.00 29.53 ? 640  TRP C CD2 1 
ATOM   6418 N  NE1 . TRP C 1 160 ? 34.022  -10.214 4.846   1.00 29.79 ? 640  TRP C NE1 1 
ATOM   6419 C  CE2 . TRP C 1 160 ? 34.073  -9.120  4.023   1.00 29.64 ? 640  TRP C CE2 1 
ATOM   6420 C  CE3 . TRP C 1 160 ? 35.662  -8.072  2.529   1.00 29.41 ? 640  TRP C CE3 1 
ATOM   6421 C  CZ2 . TRP C 1 160 ? 33.104  -8.153  3.749   1.00 29.72 ? 640  TRP C CZ2 1 
ATOM   6422 C  CZ3 . TRP C 1 160 ? 34.700  -7.110  2.258   1.00 29.49 ? 640  TRP C CZ3 1 
ATOM   6423 C  CH2 . TRP C 1 160 ? 33.436  -7.159  2.866   1.00 29.52 ? 640  TRP C CH2 1 
ATOM   6424 N  N   . ALA C 1 161 ? 39.386  -11.837 5.752   1.00 29.98 ? 641  ALA C N   1 
ATOM   6425 C  CA  . ALA C 1 161 ? 39.630  -12.652 6.949   1.00 30.08 ? 641  ALA C CA  1 
ATOM   6426 C  C   . ALA C 1 161 ? 40.240  -11.824 8.072   1.00 30.22 ? 641  ALA C C   1 
ATOM   6427 O  O   . ALA C 1 161 ? 39.776  -11.876 9.214   1.00 30.16 ? 641  ALA C O   1 
ATOM   6428 C  CB  . ALA C 1 161 ? 40.538  -13.834 6.622   1.00 29.89 ? 641  ALA C CB  1 
ATOM   6429 N  N   . ALA C 1 162 ? 41.279  -11.064 7.733   1.00 30.50 ? 642  ALA C N   1 
ATOM   6430 C  CA  . ALA C 1 162 ? 42.005  -10.244 8.703   1.00 30.60 ? 642  ALA C CA  1 
ATOM   6431 C  C   . ALA C 1 162 ? 41.158  -9.077  9.205   1.00 30.76 ? 642  ALA C C   1 
ATOM   6432 O  O   . ALA C 1 162 ? 41.117  -8.810  10.404  1.00 30.90 ? 642  ALA C O   1 
ATOM   6433 C  CB  . ALA C 1 162 ? 43.308  -9.730  8.091   1.00 30.47 ? 642  ALA C CB  1 
ATOM   6434 N  N   . GLY C 1 163 ? 40.485  -8.390  8.286   1.00 30.98 ? 643  GLY C N   1 
ATOM   6435 C  CA  . GLY C 1 163 ? 39.644  -7.242  8.636   1.00 31.16 ? 643  GLY C CA  1 
ATOM   6436 C  C   . GLY C 1 163 ? 38.373  -7.594  9.395   1.00 31.30 ? 643  GLY C C   1 
ATOM   6437 O  O   . GLY C 1 163 ? 37.813  -6.751  10.097  1.00 31.15 ? 643  GLY C O   1 
ATOM   6438 N  N   . SER C 1 164 ? 37.921  -8.839  9.261   1.00 31.50 ? 644  SER C N   1 
ATOM   6439 C  CA  . SER C 1 164 ? 36.703  -9.298  9.924   1.00 31.63 ? 644  SER C CA  1 
ATOM   6440 C  C   . SER C 1 164 ? 36.966  -9.713  11.364  1.00 31.75 ? 644  SER C C   1 
ATOM   6441 O  O   . SER C 1 164 ? 36.206  -9.353  12.261  1.00 31.69 ? 644  SER C O   1 
ATOM   6442 C  CB  . SER C 1 164 ? 36.088  -10.463 9.151   1.00 31.67 ? 644  SER C CB  1 
ATOM   6443 O  OG  . SER C 1 164 ? 35.760  -10.063 7.830   1.00 31.93 ? 644  SER C OG  1 
ATOM   6444 N  N   . VAL C 1 165 ? 38.038  -10.476 11.579  1.00 32.00 ? 645  VAL C N   1 
ATOM   6445 C  CA  . VAL C 1 165 ? 38.431  -10.901 12.925  1.00 32.15 ? 645  VAL C CA  1 
ATOM   6446 C  C   . VAL C 1 165 ? 38.771  -9.687  13.792  1.00 32.34 ? 645  VAL C C   1 
ATOM   6447 O  O   . VAL C 1 165 ? 38.490  -9.681  14.992  1.00 32.43 ? 645  VAL C O   1 
ATOM   6448 C  CB  . VAL C 1 165 ? 39.633  -11.884 12.894  1.00 32.12 ? 645  VAL C CB  1 
ATOM   6449 C  CG1 . VAL C 1 165 ? 40.180  -12.136 14.297  1.00 31.85 ? 645  VAL C CG1 1 
ATOM   6450 C  CG2 . VAL C 1 165 ? 39.223  -13.197 12.252  1.00 32.45 ? 645  VAL C CG2 1 
ATOM   6451 N  N   . THR C 1 166 ? 39.368  -8.669  13.175  1.00 32.58 ? 646  THR C N   1 
ATOM   6452 C  CA  . THR C 1 166 ? 39.676  -7.405  13.847  1.00 32.78 ? 646  THR C CA  1 
ATOM   6453 C  C   . THR C 1 166 ? 38.404  -6.684  14.289  1.00 33.09 ? 646  THR C C   1 
ATOM   6454 O  O   . THR C 1 166 ? 38.306  -6.234  15.431  1.00 33.11 ? 646  THR C O   1 
ATOM   6455 C  CB  . THR C 1 166 ? 40.476  -6.462  12.923  1.00 32.69 ? 646  THR C CB  1 
ATOM   6456 O  OG1 . THR C 1 166 ? 41.761  -7.036  12.653  1.00 32.86 ? 646  THR C OG1 1 
ATOM   6457 C  CG2 . THR C 1 166 ? 40.654  -5.090  13.564  1.00 32.41 ? 646  THR C CG2 1 
ATOM   6458 N  N   . ASP C 1 167 ? 37.442  -6.579  13.373  1.00 33.35 ? 647  ASP C N   1 
ATOM   6459 C  CA  . ASP C 1 167 ? 36.191  -5.871  13.632  1.00 33.57 ? 647  ASP C CA  1 
ATOM   6460 C  C   . ASP C 1 167 ? 35.420  -6.554  14.765  1.00 33.66 ? 647  ASP C C   1 
ATOM   6461 O  O   . ASP C 1 167 ? 34.886  -5.882  15.653  1.00 33.66 ? 647  ASP C O   1 
ATOM   6462 C  CB  . ASP C 1 167 ? 35.338  -5.814  12.351  1.00 33.72 ? 647  ASP C CB  1 
ATOM   6463 C  CG  . ASP C 1 167 ? 34.406  -4.605  12.298  1.00 34.39 ? 647  ASP C CG  1 
ATOM   6464 O  OD1 . ASP C 1 167 ? 34.550  -3.673  13.120  1.00 35.42 ? 647  ASP C OD1 1 
ATOM   6465 O  OD2 . ASP C 1 167 ? 33.527  -4.580  11.408  1.00 35.63 ? 647  ASP C OD2 1 
ATOM   6466 N  N   . LEU C 1 168 ? 35.382  -7.886  14.737  1.00 33.71 ? 648  LEU C N   1 
ATOM   6467 C  CA  . LEU C 1 168 ? 34.700  -8.672  15.768  1.00 33.81 ? 648  LEU C CA  1 
ATOM   6468 C  C   . LEU C 1 168 ? 35.350  -8.483  17.139  1.00 34.05 ? 648  LEU C C   1 
ATOM   6469 O  O   . LEU C 1 168 ? 34.661  -8.295  18.144  1.00 33.99 ? 648  LEU C O   1 
ATOM   6470 C  CB  . LEU C 1 168 ? 34.701  -10.157 15.389  1.00 33.75 ? 648  LEU C CB  1 
ATOM   6471 C  CG  . LEU C 1 168 ? 34.087  -11.142 16.391  1.00 33.68 ? 648  LEU C CG  1 
ATOM   6472 C  CD1 . LEU C 1 168 ? 32.640  -10.784 16.700  1.00 32.78 ? 648  LEU C CD1 1 
ATOM   6473 C  CD2 . LEU C 1 168 ? 34.193  -12.568 15.869  1.00 33.46 ? 648  LEU C CD2 1 
ATOM   6474 N  N   . ALA C 1 169 ? 36.679  -8.539  17.170  1.00 34.38 ? 649  ALA C N   1 
ATOM   6475 C  CA  . ALA C 1 169 ? 37.437  -8.349  18.408  1.00 34.61 ? 649  ALA C CA  1 
ATOM   6476 C  C   . ALA C 1 169 ? 37.169  -6.975  19.024  1.00 34.88 ? 649  ALA C C   1 
ATOM   6477 O  O   . ALA C 1 169 ? 37.085  -6.844  20.247  1.00 34.94 ? 649  ALA C O   1 
ATOM   6478 C  CB  . ALA C 1 169 ? 38.925  -8.530  18.151  1.00 34.49 ? 649  ALA C CB  1 
ATOM   6479 N  N   . PHE C 1 170 ? 37.035  -5.960  18.174  1.00 35.16 ? 650  PHE C N   1 
ATOM   6480 C  CA  . PHE C 1 170 ? 36.749  -4.601  18.637  1.00 35.44 ? 650  PHE C CA  1 
ATOM   6481 C  C   . PHE C 1 170 ? 35.382  -4.513  19.309  1.00 35.43 ? 650  PHE C C   1 
ATOM   6482 O  O   . PHE C 1 170 ? 35.261  -3.965  20.401  1.00 35.40 ? 650  PHE C O   1 
ATOM   6483 C  CB  . PHE C 1 170 ? 36.850  -3.592  17.484  1.00 35.50 ? 650  PHE C CB  1 
ATOM   6484 C  CG  . PHE C 1 170 ? 38.190  -2.908  17.396  1.00 36.13 ? 650  PHE C CG  1 
ATOM   6485 C  CD1 . PHE C 1 170 ? 39.350  -3.645  17.187  1.00 36.78 ? 650  PHE C CD1 1 
ATOM   6486 C  CD2 . PHE C 1 170 ? 38.293  -1.527  17.529  1.00 36.56 ? 650  PHE C CD2 1 
ATOM   6487 C  CE1 . PHE C 1 170 ? 40.591  -3.017  17.110  1.00 36.89 ? 650  PHE C CE1 1 
ATOM   6488 C  CE2 . PHE C 1 170 ? 39.529  -0.893  17.451  1.00 36.66 ? 650  PHE C CE2 1 
ATOM   6489 C  CZ  . PHE C 1 170 ? 40.678  -1.640  17.242  1.00 36.72 ? 650  PHE C CZ  1 
ATOM   6490 N  N   . LYS C 1 171 ? 34.363  -5.071  18.663  1.00 35.60 ? 651  LYS C N   1 
ATOM   6491 C  CA  . LYS C 1 171 ? 33.002  -5.038  19.201  1.00 35.74 ? 651  LYS C CA  1 
ATOM   6492 C  C   . LYS C 1 171 ? 32.903  -5.784  20.533  1.00 35.85 ? 651  LYS C C   1 
ATOM   6493 O  O   . LYS C 1 171 ? 32.173  -5.364  21.432  1.00 35.85 ? 651  LYS C O   1 
ATOM   6494 C  CB  . LYS C 1 171 ? 32.005  -5.610  18.188  1.00 35.76 ? 651  LYS C CB  1 
ATOM   6495 C  CG  . LYS C 1 171 ? 31.874  -4.769  16.926  1.00 35.76 ? 651  LYS C CG  1 
ATOM   6496 C  CD  . LYS C 1 171 ? 30.776  -5.281  16.008  1.00 35.76 ? 651  LYS C CD  1 
ATOM   6497 C  CE  . LYS C 1 171 ? 30.904  -4.701  14.598  1.00 35.79 ? 651  LYS C CE  1 
ATOM   6498 N  NZ  . LYS C 1 171 ? 31.014  -3.217  14.592  1.00 35.92 ? 651  LYS C NZ  1 
ATOM   6499 N  N   . VAL C 1 172 ? 33.641  -6.885  20.656  1.00 36.01 ? 652  VAL C N   1 
ATOM   6500 C  CA  . VAL C 1 172 ? 33.721  -7.623  21.917  1.00 36.08 ? 652  VAL C CA  1 
ATOM   6501 C  C   . VAL C 1 172 ? 34.568  -6.857  22.940  1.00 36.11 ? 652  VAL C C   1 
ATOM   6502 O  O   . VAL C 1 172 ? 34.276  -6.893  24.137  1.00 36.20 ? 652  VAL C O   1 
ATOM   6503 C  CB  . VAL C 1 172 ? 34.276  -9.052  21.708  1.00 36.10 ? 652  VAL C CB  1 
ATOM   6504 C  CG1 . VAL C 1 172 ? 34.503  -9.753  23.045  1.00 36.14 ? 652  VAL C CG1 1 
ATOM   6505 C  CG2 . VAL C 1 172 ? 33.323  -9.860  20.842  1.00 36.13 ? 652  VAL C CG2 1 
ATOM   6506 N  N   . ALA C 1 173 ? 35.601  -6.159  22.463  1.00 36.09 ? 653  ALA C N   1 
ATOM   6507 C  CA  . ALA C 1 173 ? 36.425  -5.291  23.315  1.00 36.10 ? 653  ALA C CA  1 
ATOM   6508 C  C   . ALA C 1 173 ? 35.643  -4.090  23.856  1.00 36.13 ? 653  ALA C C   1 
ATOM   6509 O  O   . ALA C 1 173 ? 35.915  -3.615  24.961  1.00 36.11 ? 653  ALA C O   1 
ATOM   6510 C  CB  . ALA C 1 173 ? 37.655  -4.810  22.554  1.00 36.07 ? 653  ALA C CB  1 
ATOM   6511 N  N   . SER C 1 174 ? 34.672  -3.609  23.079  1.00 36.14 ? 654  SER C N   1 
ATOM   6512 C  CA  . SER C 1 174 ? 33.851  -2.460  23.468  1.00 36.20 ? 654  SER C CA  1 
ATOM   6513 C  C   . SER C 1 174 ? 32.620  -2.851  24.291  1.00 36.25 ? 654  SER C C   1 
ATOM   6514 O  O   . SER C 1 174 ? 31.747  -2.019  24.520  1.00 36.24 ? 654  SER C O   1 
ATOM   6515 C  CB  . SER C 1 174 ? 33.394  -1.701  22.218  1.00 36.15 ? 654  SER C CB  1 
ATOM   6516 O  OG  . SER C 1 174 ? 34.494  -1.393  21.380  1.00 36.12 ? 654  SER C OG  1 
ATOM   6517 N  N   . ARG C 1 175 ? 32.552  -4.111  24.727  1.00 36.38 ? 655  ARG C N   1 
ATOM   6518 C  CA  . ARG C 1 175 ? 31.371  -4.660  25.406  1.00 36.40 ? 655  ARG C CA  1 
ATOM   6519 C  C   . ARG C 1 175 ? 30.103  -4.512  24.555  1.00 36.42 ? 655  ARG C C   1 
ATOM   6520 O  O   . ARG C 1 175 ? 28.985  -4.539  25.075  1.00 36.44 ? 655  ARG C O   1 
ATOM   6521 C  CB  . ARG C 1 175 ? 31.169  -4.006  26.777  1.00 36.43 ? 655  ARG C CB  1 
ATOM   6522 C  CG  . ARG C 1 175 ? 32.426  -3.926  27.638  1.00 36.56 ? 655  ARG C CG  1 
ATOM   6523 C  CD  . ARG C 1 175 ? 32.120  -3.371  29.033  1.00 37.00 ? 655  ARG C CD  1 
ATOM   6524 N  NE  . ARG C 1 175 ? 31.245  -2.195  28.993  1.00 37.16 ? 655  ARG C NE  1 
ATOM   6525 C  CZ  . ARG C 1 175 ? 31.628  -0.962  28.656  1.00 37.28 ? 655  ARG C CZ  1 
ATOM   6526 N  NH1 . ARG C 1 175 ? 32.891  -0.701  28.323  1.00 37.52 ? 655  ARG C NH1 1 
ATOM   6527 N  NH2 . ARG C 1 175 ? 30.737  0.025   28.652  1.00 36.97 ? 655  ARG C NH2 1 
ATOM   6528 N  N   . GLU C 1 176 ? 30.291  -4.377  23.243  1.00 36.42 ? 656  GLU C N   1 
ATOM   6529 C  CA  . GLU C 1 176 ? 29.191  -4.201  22.304  1.00 36.36 ? 656  GLU C CA  1 
ATOM   6530 C  C   . GLU C 1 176 ? 28.586  -5.574  22.040  1.00 36.20 ? 656  GLU C C   1 
ATOM   6531 O  O   . GLU C 1 176 ? 27.371  -5.753  22.105  1.00 36.21 ? 656  GLU C O   1 
ATOM   6532 C  CB  . GLU C 1 176 ? 29.707  -3.561  21.012  1.00 36.43 ? 656  GLU C CB  1 
ATOM   6533 C  CG  . GLU C 1 176 ? 28.704  -2.664  20.308  1.00 36.94 ? 656  GLU C CG  1 
ATOM   6534 C  CD  . GLU C 1 176 ? 29.351  -1.733  19.292  1.00 37.58 ? 656  GLU C CD  1 
ATOM   6535 O  OE1 . GLU C 1 176 ? 30.582  -1.830  19.078  1.00 37.67 ? 656  GLU C OE1 1 
ATOM   6536 O  OE2 . GLU C 1 176 ? 28.622  -0.900  18.708  1.00 37.98 ? 656  GLU C OE2 1 
ATOM   6537 N  N   . LEU C 1 177 ? 29.455  -6.540  21.751  1.00 36.05 ? 657  LEU C N   1 
ATOM   6538 C  CA  . LEU C 1 177 ? 29.090  -7.954  21.742  1.00 35.90 ? 657  LEU C CA  1 
ATOM   6539 C  C   . LEU C 1 177 ? 29.667  -8.608  23.001  1.00 35.77 ? 657  LEU C C   1 
ATOM   6540 O  O   . LEU C 1 177 ? 30.658  -8.128  23.556  1.00 35.74 ? 657  LEU C O   1 
ATOM   6541 C  CB  . LEU C 1 177 ? 29.632  -8.642  20.484  1.00 35.91 ? 657  LEU C CB  1 
ATOM   6542 C  CG  . LEU C 1 177 ? 28.896  -8.407  19.156  1.00 35.86 ? 657  LEU C CG  1 
ATOM   6543 C  CD1 . LEU C 1 177 ? 28.641  -6.933  18.888  1.00 35.88 ? 657  LEU C CD1 1 
ATOM   6544 C  CD2 . LEU C 1 177 ? 29.681  -9.025  18.006  1.00 35.64 ? 657  LEU C CD2 1 
ATOM   6545 N  N   . LYS C 1 178 ? 29.037  -9.686  23.461  1.00 35.59 ? 658  LYS C N   1 
ATOM   6546 C  CA  . LYS C 1 178 ? 29.543  -10.444 24.610  1.00 35.46 ? 658  LYS C CA  1 
ATOM   6547 C  C   . LYS C 1 178 ? 30.735  -11.302 24.188  1.00 35.15 ? 658  LYS C C   1 
ATOM   6548 O  O   . LYS C 1 178 ? 31.752  -11.360 24.884  1.00 35.26 ? 658  LYS C O   1 
ATOM   6549 C  CB  . LYS C 1 178 ? 28.441  -11.332 25.201  1.00 35.59 ? 658  LYS C CB  1 
ATOM   6550 C  CG  . LYS C 1 178 ? 28.872  -12.142 26.432  1.00 35.95 ? 658  LYS C CG  1 
ATOM   6551 C  CD  . LYS C 1 178 ? 27.917  -13.301 26.704  1.00 36.53 ? 658  LYS C CD  1 
ATOM   6552 C  CE  . LYS C 1 178 ? 28.475  -14.259 27.752  1.00 36.70 ? 658  LYS C CE  1 
ATOM   6553 N  NZ  . LYS C 1 178 ? 27.614  -15.470 27.915  1.00 36.73 ? 658  LYS C NZ  1 
ATOM   6554 N  N   . ASN C 1 179 ? 30.589  -11.979 23.052  1.00 34.72 ? 659  ASN C N   1 
ATOM   6555 C  CA  . ASN C 1 179 ? 31.652  -12.798 22.480  1.00 34.35 ? 659  ASN C CA  1 
ATOM   6556 C  C   . ASN C 1 179 ? 31.404  -13.010 20.985  1.00 34.11 ? 659  ASN C C   1 
ATOM   6557 O  O   . ASN C 1 179 ? 30.441  -12.471 20.441  1.00 34.06 ? 659  ASN C O   1 
ATOM   6558 C  CB  . ASN C 1 179 ? 31.775  -14.130 23.236  1.00 34.30 ? 659  ASN C CB  1 
ATOM   6559 C  CG  . ASN C 1 179 ? 30.447  -14.838 23.412  1.00 34.15 ? 659  ASN C CG  1 
ATOM   6560 O  OD1 . ASN C 1 179 ? 29.696  -15.029 22.458  1.00 33.87 ? 659  ASN C OD1 1 
ATOM   6561 N  ND2 . ASN C 1 179 ? 30.164  -15.260 24.638  1.00 34.46 ? 659  ASN C ND2 1 
ATOM   6562 N  N   . GLY C 1 180 ? 32.274  -13.766 20.316  1.00 33.83 ? 660  GLY C N   1 
ATOM   6563 C  CA  . GLY C 1 180 ? 32.139  -13.969 18.877  1.00 33.56 ? 660  GLY C CA  1 
ATOM   6564 C  C   . GLY C 1 180 ? 32.901  -15.139 18.281  1.00 33.35 ? 660  GLY C C   1 
ATOM   6565 O  O   . GLY C 1 180 ? 33.785  -15.719 18.913  1.00 33.30 ? 660  GLY C O   1 
ATOM   6566 N  N   . PHE C 1 181 ? 32.533  -15.478 17.047  1.00 33.19 ? 661  PHE C N   1 
ATOM   6567 C  CA  . PHE C 1 181 ? 33.189  -16.528 16.268  1.00 32.95 ? 661  PHE C CA  1 
ATOM   6568 C  C   . PHE C 1 181 ? 33.191  -16.118 14.799  1.00 32.62 ? 661  PHE C C   1 
ATOM   6569 O  O   . PHE C 1 181 ? 32.129  -15.943 14.199  1.00 32.48 ? 661  PHE C O   1 
ATOM   6570 C  CB  . PHE C 1 181 ? 32.459  -17.863 16.452  1.00 33.05 ? 661  PHE C CB  1 
ATOM   6571 C  CG  . PHE C 1 181 ? 32.972  -18.979 15.572  1.00 33.28 ? 661  PHE C CG  1 
ATOM   6572 C  CD1 . PHE C 1 181 ? 34.331  -19.216 15.432  1.00 34.04 ? 661  PHE C CD1 1 
ATOM   6573 C  CD2 . PHE C 1 181 ? 32.088  -19.800 14.892  1.00 34.01 ? 661  PHE C CD2 1 
ATOM   6574 C  CE1 . PHE C 1 181 ? 34.799  -20.247 14.628  1.00 34.14 ? 661  PHE C CE1 1 
ATOM   6575 C  CE2 . PHE C 1 181 ? 32.549  -20.836 14.086  1.00 34.29 ? 661  PHE C CE2 1 
ATOM   6576 C  CZ  . PHE C 1 181 ? 33.905  -21.057 13.956  1.00 34.27 ? 661  PHE C CZ  1 
ATOM   6577 N  N   . ALA C 1 182 ? 34.383  -15.950 14.233  1.00 32.23 ? 662  ALA C N   1 
ATOM   6578 C  CA  . ALA C 1 182 ? 34.527  -15.517 12.849  1.00 31.89 ? 662  ALA C CA  1 
ATOM   6579 C  C   . ALA C 1 182 ? 34.778  -16.720 11.949  1.00 31.57 ? 662  ALA C C   1 
ATOM   6580 O  O   . ALA C 1 182 ? 35.828  -17.350 12.028  1.00 31.48 ? 662  ALA C O   1 
ATOM   6581 C  CB  . ALA C 1 182 ? 35.654  -14.510 12.728  1.00 31.79 ? 662  ALA C CB  1 
ATOM   6582 N  N   . VAL C 1 183 ? 33.798  -17.043 11.107  1.00 31.40 ? 663  VAL C N   1 
ATOM   6583 C  CA  . VAL C 1 183 ? 33.922  -18.150 10.159  1.00 31.14 ? 663  VAL C CA  1 
ATOM   6584 C  C   . VAL C 1 183 ? 34.586  -17.622 8.891   1.00 30.88 ? 663  VAL C C   1 
ATOM   6585 O  O   . VAL C 1 183 ? 33.913  -17.271 7.919   1.00 30.83 ? 663  VAL C O   1 
ATOM   6586 C  CB  . VAL C 1 183 ? 32.550  -18.772 9.837   1.00 31.25 ? 663  VAL C CB  1 
ATOM   6587 C  CG1 . VAL C 1 183 ? 32.711  -20.010 8.951   1.00 31.04 ? 663  VAL C CG1 1 
ATOM   6588 C  CG2 . VAL C 1 183 ? 31.819  -19.118 11.128  1.00 31.37 ? 663  VAL C CG2 1 
ATOM   6589 N  N   . VAL C 1 184 ? 35.916  -17.562 8.921   1.00 30.56 ? 664  VAL C N   1 
ATOM   6590 C  CA  . VAL C 1 184 ? 36.694  -16.918 7.868   1.00 30.31 ? 664  VAL C CA  1 
ATOM   6591 C  C   . VAL C 1 184 ? 37.679  -17.866 7.198   1.00 30.15 ? 664  VAL C C   1 
ATOM   6592 O  O   . VAL C 1 184 ? 38.053  -18.898 7.761   1.00 30.04 ? 664  VAL C O   1 
ATOM   6593 C  CB  . VAL C 1 184 ? 37.495  -15.705 8.415   1.00 30.32 ? 664  VAL C CB  1 
ATOM   6594 C  CG1 . VAL C 1 184 ? 36.554  -14.655 8.990   1.00 30.39 ? 664  VAL C CG1 1 
ATOM   6595 C  CG2 . VAL C 1 184 ? 38.523  -16.148 9.459   1.00 30.29 ? 664  VAL C CG2 1 
ATOM   6596 N  N   . ARG C 1 185 ? 38.083  -17.497 5.985   1.00 30.00 ? 665  ARG C N   1 
ATOM   6597 C  CA  . ARG C 1 185 ? 39.183  -18.149 5.283   1.00 29.89 ? 665  ARG C CA  1 
ATOM   6598 C  C   . ARG C 1 185 ? 39.781  -17.176 4.261   1.00 29.69 ? 665  ARG C C   1 
ATOM   6599 O  O   . ARG C 1 185 ? 39.100  -16.251 3.814   1.00 29.58 ? 665  ARG C O   1 
ATOM   6600 C  CB  . ARG C 1 185 ? 38.706  -19.432 4.594   1.00 29.89 ? 665  ARG C CB  1 
ATOM   6601 C  CG  . ARG C 1 185 ? 37.718  -19.206 3.457   1.00 30.10 ? 665  ARG C CG  1 
ATOM   6602 C  CD  . ARG C 1 185 ? 37.227  -20.526 2.886   1.00 30.44 ? 665  ARG C CD  1 
ATOM   6603 N  NE  . ARG C 1 185 ? 38.259  -21.205 2.103   1.00 30.60 ? 665  ARG C NE  1 
ATOM   6604 C  CZ  . ARG C 1 185 ? 38.520  -20.976 0.814   1.00 30.74 ? 665  ARG C CZ  1 
ATOM   6605 N  NH1 . ARG C 1 185 ? 37.829  -20.075 0.119   1.00 30.59 ? 665  ARG C NH1 1 
ATOM   6606 N  NH2 . ARG C 1 185 ? 39.483  -21.662 0.209   1.00 30.70 ? 665  ARG C NH2 1 
ATOM   6607 N  N   . PRO C 1 186 ? 41.053  -17.372 3.884   1.00 29.58 ? 666  PRO C N   1 
ATOM   6608 C  CA  . PRO C 1 186 ? 41.986  -18.400 4.342   1.00 29.52 ? 666  PRO C CA  1 
ATOM   6609 C  C   . PRO C 1 186 ? 42.472  -18.183 5.780   1.00 29.42 ? 666  PRO C C   1 
ATOM   6610 O  O   . PRO C 1 186 ? 42.294  -17.096 6.336   1.00 29.31 ? 666  PRO C O   1 
ATOM   6611 C  CB  . PRO C 1 186 ? 43.154  -18.266 3.362   1.00 29.58 ? 666  PRO C CB  1 
ATOM   6612 C  CG  . PRO C 1 186 ? 43.104  -16.861 2.906   1.00 29.54 ? 666  PRO C CG  1 
ATOM   6613 C  CD  . PRO C 1 186 ? 41.656  -16.513 2.850   1.00 29.71 ? 666  PRO C CD  1 
ATOM   6614 N  N   . PRO C 1 187 ? 43.082  -19.217 6.381   1.00 29.26 ? 667  PRO C N   1 
ATOM   6615 C  CA  . PRO C 1 187 ? 43.625  -19.112 7.733   1.00 29.27 ? 667  PRO C CA  1 
ATOM   6616 C  C   . PRO C 1 187 ? 44.850  -18.196 7.792   1.00 29.31 ? 667  PRO C C   1 
ATOM   6617 O  O   . PRO C 1 187 ? 45.328  -17.749 6.750   1.00 29.19 ? 667  PRO C O   1 
ATOM   6618 C  CB  . PRO C 1 187 ? 43.998  -20.557 8.075   1.00 29.16 ? 667  PRO C CB  1 
ATOM   6619 C  CG  . PRO C 1 187 ? 44.216  -21.208 6.774   1.00 29.12 ? 667  PRO C CG  1 
ATOM   6620 C  CD  . PRO C 1 187 ? 43.288  -20.559 5.809   1.00 29.28 ? 667  PRO C CD  1 
ATOM   6621 N  N   . GLY C 1 188 ? 45.348  -17.925 8.998   1.00 29.45 ? 668  GLY C N   1 
ATOM   6622 C  CA  . GLY C 1 188 ? 46.388  -16.913 9.180   1.00 29.71 ? 668  GLY C CA  1 
ATOM   6623 C  C   . GLY C 1 188 ? 47.569  -17.190 10.099  1.00 29.81 ? 668  GLY C C   1 
ATOM   6624 O  O   . GLY C 1 188 ? 48.591  -16.519 9.982   1.00 29.82 ? 668  GLY C O   1 
ATOM   6625 N  N   . HIS C 1 189 ? 47.457  -18.152 11.010  1.00 30.00 ? 669  HIS C N   1 
ATOM   6626 C  CA  . HIS C 1 189 ? 48.435  -18.253 12.104  1.00 30.34 ? 669  HIS C CA  1 
ATOM   6627 C  C   . HIS C 1 189 ? 49.852  -18.698 11.691  1.00 30.44 ? 669  HIS C C   1 
ATOM   6628 O  O   . HIS C 1 189 ? 50.789  -18.572 12.483  1.00 30.31 ? 669  HIS C O   1 
ATOM   6629 C  CB  . HIS C 1 189 ? 47.887  -19.107 13.266  1.00 30.44 ? 669  HIS C CB  1 
ATOM   6630 C  CG  . HIS C 1 189 ? 47.869  -20.583 13.004  1.00 30.87 ? 669  HIS C CG  1 
ATOM   6631 N  ND1 . HIS C 1 189 ? 48.098  -21.512 13.995  1.00 30.62 ? 669  HIS C ND1 1 
ATOM   6632 C  CD2 . HIS C 1 189 ? 47.633  -21.291 11.874  1.00 31.48 ? 669  HIS C CD2 1 
ATOM   6633 C  CE1 . HIS C 1 189 ? 48.010  -22.728 13.486  1.00 31.25 ? 669  HIS C CE1 1 
ATOM   6634 N  NE2 . HIS C 1 189 ? 47.730  -22.623 12.201  1.00 31.21 ? 669  HIS C NE2 1 
ATOM   6635 N  N   . HIS C 1 190 ? 50.006  -19.190 10.460  1.00 30.61 ? 670  HIS C N   1 
ATOM   6636 C  CA  . HIS C 1 190 ? 51.326  -19.527 9.922   1.00 30.84 ? 670  HIS C CA  1 
ATOM   6637 C  C   . HIS C 1 190 ? 52.029  -18.334 9.270   1.00 30.96 ? 670  HIS C C   1 
ATOM   6638 O  O   . HIS C 1 190 ? 53.264  -18.316 9.183   1.00 30.87 ? 670  HIS C O   1 
ATOM   6639 C  CB  . HIS C 1 190 ? 51.230  -20.675 8.915   1.00 30.83 ? 670  HIS C CB  1 
ATOM   6640 C  CG  . HIS C 1 190 ? 50.818  -21.979 9.524   1.00 31.35 ? 670  HIS C CG  1 
ATOM   6641 N  ND1 . HIS C 1 190 ? 51.520  -22.581 10.548  1.00 31.22 ? 670  HIS C ND1 1 
ATOM   6642 C  CD2 . HIS C 1 190 ? 49.782  -22.805 9.244   1.00 31.48 ? 670  HIS C CD2 1 
ATOM   6643 C  CE1 . HIS C 1 190 ? 50.931  -23.717 10.875  1.00 31.08 ? 670  HIS C CE1 1 
ATOM   6644 N  NE2 . HIS C 1 190 ? 49.875  -23.876 10.098  1.00 31.39 ? 670  HIS C NE2 1 
ATOM   6645 N  N   . ALA C 1 191 ? 51.250  -17.353 8.814   1.00 31.01 ? 671  ALA C N   1 
ATOM   6646 C  CA  . ALA C 1 191 ? 51.797  -16.172 8.140   1.00 31.27 ? 671  ALA C CA  1 
ATOM   6647 C  C   . ALA C 1 191 ? 52.653  -15.330 9.086   1.00 31.49 ? 671  ALA C C   1 
ATOM   6648 O  O   . ALA C 1 191 ? 52.151  -14.801 10.075  1.00 31.44 ? 671  ALA C O   1 
ATOM   6649 C  CB  . ALA C 1 191 ? 50.669  -15.321 7.555   1.00 31.05 ? 671  ALA C CB  1 
ATOM   6650 N  N   . ASP C 1 192 ? 53.944  -15.217 8.775   1.00 31.97 ? 672  ASP C N   1 
ATOM   6651 C  CA  . ASP C 1 192 ? 54.891  -14.441 9.584   1.00 32.30 ? 672  ASP C CA  1 
ATOM   6652 C  C   . ASP C 1 192 ? 55.043  -13.038 8.988   1.00 32.22 ? 672  ASP C C   1 
ATOM   6653 O  O   . ASP C 1 192 ? 54.621  -12.792 7.857   1.00 32.13 ? 672  ASP C O   1 
ATOM   6654 C  CB  . ASP C 1 192 ? 56.252  -15.159 9.644   1.00 32.41 ? 672  ASP C CB  1 
ATOM   6655 C  CG  . ASP C 1 192 ? 57.150  -14.666 10.788  1.00 33.25 ? 672  ASP C CG  1 
ATOM   6656 O  OD1 . ASP C 1 192 ? 56.728  -13.778 11.565  1.00 34.08 ? 672  ASP C OD1 1 
ATOM   6657 O  OD2 . ASP C 1 192 ? 58.292  -15.175 10.911  1.00 33.77 ? 672  ASP C OD2 1 
ATOM   6658 N  N   . HIS C 1 193 ? 55.645  -12.132 9.758   1.00 32.35 ? 673  HIS C N   1 
ATOM   6659 C  CA  . HIS C 1 193 ? 55.871  -10.734 9.357   1.00 32.46 ? 673  HIS C CA  1 
ATOM   6660 C  C   . HIS C 1 193 ? 56.074  -10.514 7.851   1.00 32.61 ? 673  HIS C C   1 
ATOM   6661 O  O   . HIS C 1 193 ? 55.520  -9.568  7.286   1.00 32.63 ? 673  HIS C O   1 
ATOM   6662 C  CB  . HIS C 1 193 ? 57.061  -10.164 10.140  1.00 32.47 ? 673  HIS C CB  1 
ATOM   6663 C  CG  . HIS C 1 193 ? 57.474  -8.786  9.718   1.00 32.32 ? 673  HIS C CG  1 
ATOM   6664 N  ND1 . HIS C 1 193 ? 58.715  -8.516  9.180   1.00 32.25 ? 673  HIS C ND1 1 
ATOM   6665 C  CD2 . HIS C 1 193 ? 56.821  -7.601  9.768   1.00 32.02 ? 673  HIS C CD2 1 
ATOM   6666 C  CE1 . HIS C 1 193 ? 58.806  -7.226  8.913   1.00 32.36 ? 673  HIS C CE1 1 
ATOM   6667 N  NE2 . HIS C 1 193 ? 57.669  -6.648  9.257   1.00 32.30 ? 673  HIS C NE2 1 
ATOM   6668 N  N   . SER C 1 194 ? 56.860  -11.371 7.202   1.00 32.61 ? 674  SER C N   1 
ATOM   6669 C  CA  . SER C 1 194 ? 57.078  -11.244 5.759   1.00 32.68 ? 674  SER C CA  1 
ATOM   6670 C  C   . SER C 1 194 ? 57.187  -12.593 5.063   1.00 32.75 ? 674  SER C C   1 
ATOM   6671 O  O   . SER C 1 194 ? 58.088  -12.810 4.258   1.00 32.78 ? 674  SER C O   1 
ATOM   6672 C  CB  . SER C 1 194 ? 58.320  -10.387 5.487   1.00 32.72 ? 674  SER C CB  1 
ATOM   6673 O  OG  . SER C 1 194 ? 59.487  -10.988 6.005   1.00 32.62 ? 674  SER C OG  1 
ATOM   6674 N  N   . THR C 1 195 ? 56.250  -13.487 5.367   1.00 33.10 ? 675  THR C N   1 
ATOM   6675 C  CA  . THR C 1 195 ? 56.237  -14.839 4.808   1.00 33.31 ? 675  THR C CA  1 
ATOM   6676 C  C   . THR C 1 195 ? 54.819  -15.399 4.758   1.00 33.59 ? 675  THR C C   1 
ATOM   6677 O  O   . THR C 1 195 ? 54.183  -15.576 5.799   1.00 33.77 ? 675  THR C O   1 
ATOM   6678 C  CB  . THR C 1 195 ? 57.089  -15.810 5.658   1.00 33.35 ? 675  THR C CB  1 
ATOM   6679 O  OG1 . THR C 1 195 ? 58.423  -15.303 5.793   1.00 33.20 ? 675  THR C OG1 1 
ATOM   6680 C  CG2 . THR C 1 195 ? 57.132  -17.192 5.013   1.00 33.35 ? 675  THR C CG2 1 
ATOM   6681 N  N   . ALA C 1 196 ? 54.327  -15.661 3.547   1.00 33.84 ? 676  ALA C N   1 
ATOM   6682 C  CA  . ALA C 1 196 ? 53.073  -16.385 3.350   1.00 33.88 ? 676  ALA C CA  1 
ATOM   6683 C  C   . ALA C 1 196 ? 53.415  -17.854 3.184   1.00 34.12 ? 676  ALA C C   1 
ATOM   6684 O  O   . ALA C 1 196 ? 54.290  -18.199 2.390   1.00 34.27 ? 676  ALA C O   1 
ATOM   6685 C  CB  . ALA C 1 196 ? 52.356  -15.880 2.129   1.00 33.85 ? 676  ALA C CB  1 
ATOM   6686 N  N   . MET C 1 197 ? 52.729  -18.717 3.929   1.00 34.28 ? 677  MET C N   1 
ATOM   6687 C  CA  . MET C 1 197 ? 53.029  -20.149 3.919   1.00 34.39 ? 677  MET C CA  1 
ATOM   6688 C  C   . MET C 1 197 ? 51.892  -20.960 4.523   1.00 34.30 ? 677  MET C C   1 
ATOM   6689 O  O   . MET C 1 197 ? 50.961  -20.399 5.104   1.00 34.43 ? 677  MET C O   1 
ATOM   6690 C  CB  . MET C 1 197 ? 54.312  -20.415 4.709   1.00 34.50 ? 677  MET C CB  1 
ATOM   6691 C  CG  . MET C 1 197 ? 54.267  -19.869 6.130   1.00 35.00 ? 677  MET C CG  1 
ATOM   6692 S  SD  . MET C 1 197 ? 55.715  -20.275 7.100   1.00 35.72 ? 677  MET C SD  1 
ATOM   6693 C  CE  . MET C 1 197 ? 55.611  -22.064 7.152   1.00 35.79 ? 677  MET C CE  1 
ATOM   6694 N  N   . GLY C 1 198 ? 51.984  -22.282 4.389   1.00 34.09 ? 678  GLY C N   1 
ATOM   6695 C  CA  . GLY C 1 198 ? 51.005  -23.204 4.961   1.00 33.84 ? 678  GLY C CA  1 
ATOM   6696 C  C   . GLY C 1 198 ? 49.581  -22.684 4.915   1.00 33.61 ? 678  GLY C C   1 
ATOM   6697 O  O   . GLY C 1 198 ? 48.945  -22.523 5.953   1.00 33.42 ? 678  GLY C O   1 
ATOM   6698 N  N   . PHE C 1 199 ? 49.104  -22.400 3.703   1.00 33.43 ? 679  PHE C N   1 
ATOM   6699 C  CA  . PHE C 1 199 ? 47.728  -21.946 3.454   1.00 33.27 ? 679  PHE C CA  1 
ATOM   6700 C  C   . PHE C 1 199 ? 47.380  -20.568 4.044   1.00 33.14 ? 679  PHE C C   1 
ATOM   6701 O  O   . PHE C 1 199 ? 46.207  -20.198 4.086   1.00 33.04 ? 679  PHE C O   1 
ATOM   6702 C  CB  . PHE C 1 199 ? 46.714  -22.996 3.938   1.00 33.24 ? 679  PHE C CB  1 
ATOM   6703 C  CG  . PHE C 1 199 ? 46.921  -24.359 3.339   1.00 33.55 ? 679  PHE C CG  1 
ATOM   6704 C  CD1 . PHE C 1 199 ? 46.370  -24.679 2.105   1.00 33.73 ? 679  PHE C CD1 1 
ATOM   6705 C  CD2 . PHE C 1 199 ? 47.670  -25.321 4.004   1.00 33.45 ? 679  PHE C CD2 1 
ATOM   6706 C  CE1 . PHE C 1 199 ? 46.561  -25.934 1.544   1.00 33.61 ? 679  PHE C CE1 1 
ATOM   6707 C  CE2 . PHE C 1 199 ? 47.866  -26.576 3.446   1.00 33.75 ? 679  PHE C CE2 1 
ATOM   6708 C  CZ  . PHE C 1 199 ? 47.307  -26.883 2.217   1.00 33.70 ? 679  PHE C CZ  1 
ATOM   6709 N  N   . CYS C 1 200 ? 48.388  -19.806 4.468   1.00 32.99 ? 680  CYS C N   1 
ATOM   6710 C  CA  . CYS C 1 200 ? 48.169  -18.503 5.093   1.00 32.93 ? 680  CYS C CA  1 
ATOM   6711 C  C   . CYS C 1 200 ? 48.870  -17.383 4.341   1.00 32.88 ? 680  CYS C C   1 
ATOM   6712 O  O   . CYS C 1 200 ? 49.890  -17.604 3.680   1.00 33.21 ? 680  CYS C O   1 
ATOM   6713 C  CB  . CYS C 1 200 ? 48.666  -18.515 6.534   1.00 33.03 ? 680  CYS C CB  1 
ATOM   6714 S  SG  . CYS C 1 200 ? 47.836  -19.712 7.580   1.00 33.28 ? 680  CYS C SG  1 
ATOM   6715 N  N   . PHE C 1 201 ? 48.310  -16.179 4.458   1.00 32.60 ? 681  PHE C N   1 
ATOM   6716 C  CA  . PHE C 1 201 ? 48.863  -14.970 3.842   1.00 32.28 ? 681  PHE C CA  1 
ATOM   6717 C  C   . PHE C 1 201 ? 49.034  -13.871 4.883   1.00 31.98 ? 681  PHE C C   1 
ATOM   6718 O  O   . PHE C 1 201 ? 50.098  -13.259 4.977   1.00 31.90 ? 681  PHE C O   1 
ATOM   6719 C  CB  . PHE C 1 201 ? 47.946  -14.484 2.718   1.00 32.34 ? 681  PHE C CB  1 
ATOM   6720 C  CG  . PHE C 1 201 ? 47.589  -15.554 1.741   1.00 32.55 ? 681  PHE C CG  1 
ATOM   6721 C  CD1 . PHE C 1 201 ? 46.480  -16.357 1.956   1.00 32.96 ? 681  PHE C CD1 1 
ATOM   6722 C  CD2 . PHE C 1 201 ? 48.375  -15.784 0.622   1.00 32.86 ? 681  PHE C CD2 1 
ATOM   6723 C  CE1 . PHE C 1 201 ? 46.151  -17.367 1.066   1.00 33.04 ? 681  PHE C CE1 1 
ATOM   6724 C  CE2 . PHE C 1 201 ? 48.049  -16.790 -0.275  1.00 33.03 ? 681  PHE C CE2 1 
ATOM   6725 C  CZ  . PHE C 1 201 ? 46.933  -17.584 -0.047  1.00 32.90 ? 681  PHE C CZ  1 
ATOM   6726 N  N   . PHE C 1 202 ? 47.977  -13.622 5.653   1.00 31.63 ? 682  PHE C N   1 
ATOM   6727 C  CA  . PHE C 1 202 ? 48.003  -12.639 6.726   1.00 31.57 ? 682  PHE C CA  1 
ATOM   6728 C  C   . PHE C 1 202 ? 47.552  -13.271 8.037   1.00 31.55 ? 682  PHE C C   1 
ATOM   6729 O  O   . PHE C 1 202 ? 46.634  -14.085 8.052   1.00 31.38 ? 682  PHE C O   1 
ATOM   6730 C  CB  . PHE C 1 202 ? 47.096  -11.458 6.378   1.00 31.59 ? 682  PHE C CB  1 
ATOM   6731 C  CG  . PHE C 1 202 ? 47.501  -10.734 5.127   1.00 31.46 ? 682  PHE C CG  1 
ATOM   6732 C  CD1 . PHE C 1 202 ? 48.691  -10.025 5.078   1.00 31.30 ? 682  PHE C CD1 1 
ATOM   6733 C  CD2 . PHE C 1 202 ? 46.691  -10.755 4.002   1.00 32.04 ? 682  PHE C CD2 1 
ATOM   6734 C  CE1 . PHE C 1 202 ? 49.074  -9.357  3.929   1.00 31.50 ? 682  PHE C CE1 1 
ATOM   6735 C  CE2 . PHE C 1 202 ? 47.062  -10.081 2.848   1.00 32.18 ? 682  PHE C CE2 1 
ATOM   6736 C  CZ  . PHE C 1 202 ? 48.259  -9.384  2.812   1.00 32.03 ? 682  PHE C CZ  1 
ATOM   6737 N  N   . ASN C 1 203 ? 48.202  -12.893 9.136   1.00 31.71 ? 683  ASN C N   1 
ATOM   6738 C  CA  . ASN C 1 203 ? 47.859  -13.427 10.449  1.00 31.90 ? 683  ASN C CA  1 
ATOM   6739 C  C   . ASN C 1 203 ? 46.715  -12.625 11.054  1.00 31.98 ? 683  ASN C C   1 
ATOM   6740 O  O   . ASN C 1 203 ? 46.927  -11.666 11.804  1.00 31.97 ? 683  ASN C O   1 
ATOM   6741 C  CB  . ASN C 1 203 ? 49.084  -13.451 11.371  1.00 31.98 ? 683  ASN C CB  1 
ATOM   6742 C  CG  . ASN C 1 203 ? 48.918  -14.411 12.536  1.00 32.29 ? 683  ASN C CG  1 
ATOM   6743 O  OD1 . ASN C 1 203 ? 47.827  -14.556 13.084  1.00 32.78 ? 683  ASN C OD1 1 
ATOM   6744 N  ND2 . ASN C 1 203 ? 50.004  -15.074 12.920  1.00 32.79 ? 683  ASN C ND2 1 
ATOM   6745 N  N   . SER C 1 204 ? 45.498  -13.037 10.705  1.00 32.01 ? 684  SER C N   1 
ATOM   6746 C  CA  . SER C 1 204 ? 44.278  -12.354 11.119  1.00 32.06 ? 684  SER C CA  1 
ATOM   6747 C  C   . SER C 1 204 ? 44.248  -12.096 12.622  1.00 32.15 ? 684  SER C C   1 
ATOM   6748 O  O   . SER C 1 204 ? 44.009  -10.973 13.063  1.00 32.05 ? 684  SER C O   1 
ATOM   6749 C  CB  . SER C 1 204 ? 43.053  -13.182 10.716  1.00 32.08 ? 684  SER C CB  1 
ATOM   6750 O  OG  . SER C 1 204 ? 43.061  -13.467 9.328   1.00 31.89 ? 684  SER C OG  1 
ATOM   6751 N  N   . VAL C 1 205 ? 44.505  -13.143 13.399  1.00 32.24 ? 685  VAL C N   1 
ATOM   6752 C  CA  . VAL C 1 205 ? 44.434  -13.053 14.856  1.00 32.26 ? 685  VAL C CA  1 
ATOM   6753 C  C   . VAL C 1 205 ? 45.498  -12.102 15.413  1.00 32.27 ? 685  VAL C C   1 
ATOM   6754 O  O   . VAL C 1 205 ? 45.218  -11.330 16.333  1.00 32.22 ? 685  VAL C O   1 
ATOM   6755 C  CB  . VAL C 1 205 ? 44.533  -14.455 15.510  1.00 32.16 ? 685  VAL C CB  1 
ATOM   6756 C  CG1 . VAL C 1 205 ? 44.749  -14.350 17.010  1.00 32.31 ? 685  VAL C CG1 1 
ATOM   6757 C  CG2 . VAL C 1 205 ? 43.271  -15.252 15.216  1.00 32.03 ? 685  VAL C CG2 1 
ATOM   6758 N  N   . ALA C 1 206 ? 46.698  -12.144 14.837  1.00 32.31 ? 686  ALA C N   1 
ATOM   6759 C  CA  . ALA C 1 206 ? 47.793  -11.258 15.251  1.00 32.32 ? 686  ALA C CA  1 
ATOM   6760 C  C   . ALA C 1 206 ? 47.480  -9.802  14.938  1.00 32.39 ? 686  ALA C C   1 
ATOM   6761 O  O   . ALA C 1 206 ? 47.787  -8.911  15.730  1.00 32.33 ? 686  ALA C O   1 
ATOM   6762 C  CB  . ALA C 1 206 ? 49.093  -11.665 14.578  1.00 32.35 ? 686  ALA C CB  1 
ATOM   6763 N  N   . ILE C 1 207 ? 46.868  -9.567  13.779  1.00 32.51 ? 687  ILE C N   1 
ATOM   6764 C  CA  . ILE C 1 207 ? 46.470  -8.221  13.374  1.00 32.40 ? 687  ILE C CA  1 
ATOM   6765 C  C   . ILE C 1 207 ? 45.412  -7.676  14.333  1.00 32.51 ? 687  ILE C C   1 
ATOM   6766 O  O   . ILE C 1 207 ? 45.529  -6.551  14.828  1.00 32.30 ? 687  ILE C O   1 
ATOM   6767 C  CB  . ILE C 1 207 ? 45.947  -8.208  11.926  1.00 32.37 ? 687  ILE C CB  1 
ATOM   6768 C  CG1 . ILE C 1 207 ? 47.095  -8.499  10.951  1.00 32.31 ? 687  ILE C CG1 1 
ATOM   6769 C  CG2 . ILE C 1 207 ? 45.313  -6.859  11.597  1.00 32.25 ? 687  ILE C CG2 1 
ATOM   6770 C  CD1 . ILE C 1 207 ? 46.645  -8.919  9.573   1.00 31.68 ? 687  ILE C CD1 1 
ATOM   6771 N  N   . ALA C 1 208 ? 44.396  -8.490  14.606  1.00 32.67 ? 688  ALA C N   1 
ATOM   6772 C  CA  . ALA C 1 208 ? 43.342  -8.130  15.550  1.00 32.88 ? 688  ALA C CA  1 
ATOM   6773 C  C   . ALA C 1 208 ? 43.915  -7.774  16.926  1.00 33.11 ? 688  ALA C C   1 
ATOM   6774 O  O   . ALA C 1 208 ? 43.498  -6.792  17.543  1.00 32.98 ? 688  ALA C O   1 
ATOM   6775 C  CB  . ALA C 1 208 ? 42.331  -9.269  15.670  1.00 32.82 ? 688  ALA C CB  1 
ATOM   6776 N  N   . CYS C 1 209 ? 44.877  -8.569  17.392  1.00 33.48 ? 689  CYS C N   1 
ATOM   6777 C  CA  . CYS C 1 209 ? 45.535  -8.321  18.676  1.00 33.70 ? 689  CYS C CA  1 
ATOM   6778 C  C   . CYS C 1 209 ? 46.312  -7.005  18.670  1.00 33.92 ? 689  CYS C C   1 
ATOM   6779 O  O   . CYS C 1 209 ? 46.204  -6.215  19.607  1.00 33.95 ? 689  CYS C O   1 
ATOM   6780 C  CB  . CYS C 1 209 ? 46.473  -9.476  19.030  1.00 33.82 ? 689  CYS C CB  1 
ATOM   6781 S  SG  . CYS C 1 209 ? 47.159  -9.391  20.703  1.00 33.85 ? 689  CYS C SG  1 
ATOM   6782 N  N   . ARG C 1 210 ? 47.087  -6.775  17.612  1.00 34.24 ? 690  ARG C N   1 
ATOM   6783 C  CA  . ARG C 1 210 ? 47.849  -5.529  17.461  1.00 34.62 ? 690  ARG C CA  1 
ATOM   6784 C  C   . ARG C 1 210 ? 46.955  -4.291  17.462  1.00 34.79 ? 690  ARG C C   1 
ATOM   6785 O  O   . ARG C 1 210 ? 47.259  -3.301  18.131  1.00 34.65 ? 690  ARG C O   1 
ATOM   6786 C  CB  . ARG C 1 210 ? 48.697  -5.551  16.179  1.00 34.67 ? 690  ARG C CB  1 
ATOM   6787 C  CG  . ARG C 1 210 ? 50.086  -6.149  16.364  1.00 35.24 ? 690  ARG C CG  1 
ATOM   6788 C  CD  . ARG C 1 210 ? 51.030  -5.170  17.060  1.00 35.56 ? 690  ARG C CD  1 
ATOM   6789 N  NE  . ARG C 1 210 ? 51.956  -5.846  17.970  1.00 35.81 ? 690  ARG C NE  1 
ATOM   6790 C  CZ  . ARG C 1 210 ? 53.068  -6.485  17.605  1.00 36.00 ? 690  ARG C CZ  1 
ATOM   6791 N  NH1 . ARG C 1 210 ? 53.430  -6.560  16.325  1.00 36.14 ? 690  ARG C NH1 1 
ATOM   6792 N  NH2 . ARG C 1 210 ? 53.826  -7.058  18.534  1.00 35.53 ? 690  ARG C NH2 1 
ATOM   6793 N  N   . GLN C 1 211 ? 45.856  -4.348  16.715  1.00 35.12 ? 691  GLN C N   1 
ATOM   6794 C  CA  . GLN C 1 211 ? 44.958  -3.197  16.596  1.00 35.42 ? 691  GLN C CA  1 
ATOM   6795 C  C   . GLN C 1 211 ? 44.238  -2.886  17.911  1.00 35.78 ? 691  GLN C C   1 
ATOM   6796 O  O   . GLN C 1 211 ? 43.943  -1.724  18.190  1.00 35.90 ? 691  GLN C O   1 
ATOM   6797 C  CB  . GLN C 1 211 ? 43.950  -3.402  15.460  1.00 35.39 ? 691  GLN C CB  1 
ATOM   6798 C  CG  . GLN C 1 211 ? 44.587  -3.519  14.069  1.00 35.16 ? 691  GLN C CG  1 
ATOM   6799 C  CD  . GLN C 1 211 ? 45.428  -2.312  13.685  1.00 35.11 ? 691  GLN C CD  1 
ATOM   6800 O  OE1 . GLN C 1 211 ? 46.536  -2.454  13.168  1.00 35.28 ? 691  GLN C OE1 1 
ATOM   6801 N  NE2 . GLN C 1 211 ? 44.905  -1.118  13.935  1.00 35.17 ? 691  GLN C NE2 1 
ATOM   6802 N  N   . LEU C 1 212 ? 43.968  -3.915  18.715  1.00 36.20 ? 692  LEU C N   1 
ATOM   6803 C  CA  . LEU C 1 212 ? 43.425  -3.724  20.068  1.00 36.53 ? 692  LEU C CA  1 
ATOM   6804 C  C   . LEU C 1 212 ? 44.378  -2.914  20.956  1.00 36.90 ? 692  LEU C C   1 
ATOM   6805 O  O   . LEU C 1 212 ? 43.945  -2.033  21.707  1.00 36.89 ? 692  LEU C O   1 
ATOM   6806 C  CB  . LEU C 1 212 ? 43.120  -5.074  20.732  1.00 36.53 ? 692  LEU C CB  1 
ATOM   6807 C  CG  . LEU C 1 212 ? 41.732  -5.687  20.511  1.00 36.54 ? 692  LEU C CG  1 
ATOM   6808 C  CD1 . LEU C 1 212 ? 41.256  -5.518  19.082  1.00 36.67 ? 692  LEU C CD1 1 
ATOM   6809 C  CD2 . LEU C 1 212 ? 41.737  -7.160  20.908  1.00 36.33 ? 692  LEU C CD2 1 
ATOM   6810 N  N   . GLN C 1 213 ? 45.671  -3.216  20.859  1.00 37.33 ? 693  GLN C N   1 
ATOM   6811 C  CA  . GLN C 1 213 ? 46.699  -2.526  21.640  1.00 37.69 ? 693  GLN C CA  1 
ATOM   6812 C  C   . GLN C 1 213 ? 46.868  -1.076  21.199  1.00 38.03 ? 693  GLN C C   1 
ATOM   6813 O  O   . GLN C 1 213 ? 46.941  -0.171  22.033  1.00 38.08 ? 693  GLN C O   1 
ATOM   6814 C  CB  . GLN C 1 213 ? 48.048  -3.244  21.513  1.00 37.71 ? 693  GLN C CB  1 
ATOM   6815 C  CG  . GLN C 1 213 ? 48.085  -4.646  22.105  1.00 37.80 ? 693  GLN C CG  1 
ATOM   6816 C  CD  . GLN C 1 213 ? 49.392  -5.369  21.812  1.00 38.16 ? 693  GLN C CD  1 
ATOM   6817 O  OE1 . GLN C 1 213 ? 49.856  -5.396  20.670  1.00 38.69 ? 693  GLN C OE1 1 
ATOM   6818 N  NE2 . GLN C 1 213 ? 49.989  -5.964  22.843  1.00 37.63 ? 693  GLN C NE2 1 
ATOM   6819 N  N   . GLN C 1 214 ? 46.937  -0.868  19.886  1.00 38.46 ? 694  GLN C N   1 
ATOM   6820 C  CA  . GLN C 1 214 ? 47.190  0.461   19.323  1.00 38.81 ? 694  GLN C CA  1 
ATOM   6821 C  C   . GLN C 1 214 ? 46.016  1.418   19.501  1.00 38.92 ? 694  GLN C C   1 
ATOM   6822 O  O   . GLN C 1 214 ? 46.222  2.615   19.703  1.00 38.88 ? 694  GLN C O   1 
ATOM   6823 C  CB  . GLN C 1 214 ? 47.561  0.350   17.842  1.00 38.93 ? 694  GLN C CB  1 
ATOM   6824 C  CG  . GLN C 1 214 ? 48.906  -0.335  17.618  1.00 39.36 ? 694  GLN C CG  1 
ATOM   6825 C  CD  . GLN C 1 214 ? 49.236  -0.541  16.152  1.00 39.83 ? 694  GLN C CD  1 
ATOM   6826 O  OE1 . GLN C 1 214 ? 48.637  0.079   15.273  1.00 40.12 ? 694  GLN C OE1 1 
ATOM   6827 N  NE2 . GLN C 1 214 ? 50.202  -1.416  15.883  1.00 40.16 ? 694  GLN C NE2 1 
ATOM   6828 N  N   . GLN C 1 215 ? 44.795  0.891   19.432  1.00 39.13 ? 695  GLN C N   1 
ATOM   6829 C  CA  . GLN C 1 215 ? 43.588  1.706   19.627  1.00 39.29 ? 695  GLN C CA  1 
ATOM   6830 C  C   . GLN C 1 215 ? 43.104  1.727   21.082  1.00 39.26 ? 695  GLN C C   1 
ATOM   6831 O  O   . GLN C 1 215 ? 42.017  2.230   21.366  1.00 39.31 ? 695  GLN C O   1 
ATOM   6832 C  CB  . GLN C 1 215 ? 42.462  1.232   18.698  1.00 39.36 ? 695  GLN C CB  1 
ATOM   6833 C  CG  . GLN C 1 215 ? 42.563  1.789   17.290  1.00 39.76 ? 695  GLN C CG  1 
ATOM   6834 C  CD  . GLN C 1 215 ? 42.260  3.278   17.234  1.00 40.58 ? 695  GLN C CD  1 
ATOM   6835 O  OE1 . GLN C 1 215 ? 43.140  4.093   16.949  1.00 41.20 ? 695  GLN C OE1 1 
ATOM   6836 N  NE2 . GLN C 1 215 ? 41.012  3.643   17.524  1.00 40.75 ? 695  GLN C NE2 1 
ATOM   6837 N  N   . SER C 1 216 ? 43.912  1.183   21.992  1.00 39.23 ? 696  SER C N   1 
ATOM   6838 C  CA  . SER C 1 216 ? 43.629  1.218   23.430  1.00 39.21 ? 696  SER C CA  1 
ATOM   6839 C  C   . SER C 1 216 ? 42.384  0.417   23.824  1.00 39.09 ? 696  SER C C   1 
ATOM   6840 O  O   . SER C 1 216 ? 41.767  0.696   24.853  1.00 39.12 ? 696  SER C O   1 
ATOM   6841 C  CB  . SER C 1 216 ? 43.489  2.667   23.917  1.00 39.26 ? 696  SER C CB  1 
ATOM   6842 O  OG  . SER C 1 216 ? 44.442  3.513   23.297  1.00 39.52 ? 696  SER C OG  1 
ATOM   6843 N  N   . LYS C 1 217 ? 42.025  -0.581  23.016  1.00 38.94 ? 697  LYS C N   1 
ATOM   6844 C  CA  . LYS C 1 217 ? 40.862  -1.426  23.300  1.00 38.74 ? 697  LYS C CA  1 
ATOM   6845 C  C   . LYS C 1 217 ? 41.161  -2.430  24.416  1.00 38.57 ? 697  LYS C C   1 
ATOM   6846 O  O   . LYS C 1 217 ? 40.252  -2.883  25.113  1.00 38.43 ? 697  LYS C O   1 
ATOM   6847 C  CB  . LYS C 1 217 ? 40.412  -2.162  22.036  1.00 38.71 ? 697  LYS C CB  1 
ATOM   6848 N  N   . ALA C 1 218 ? 42.437  -2.775  24.573  1.00 38.49 ? 698  ALA C N   1 
ATOM   6849 C  CA  . ALA C 1 218 ? 42.872  -3.716  25.601  1.00 38.39 ? 698  ALA C CA  1 
ATOM   6850 C  C   . ALA C 1 218 ? 44.378  -3.606  25.797  1.00 38.36 ? 698  ALA C C   1 
ATOM   6851 O  O   . ALA C 1 218 ? 45.101  -3.213  24.878  1.00 38.45 ? 698  ALA C O   1 
ATOM   6852 C  CB  . ALA C 1 218 ? 42.495  -5.137  25.211  1.00 38.42 ? 698  ALA C CB  1 
ATOM   6853 N  N   . SER C 1 219 ? 44.840  -3.950  26.998  1.00 38.14 ? 699  SER C N   1 
ATOM   6854 C  CA  . SER C 1 219 ? 46.263  -3.926  27.322  1.00 37.91 ? 699  SER C CA  1 
ATOM   6855 C  C   . SER C 1 219 ? 46.828  -5.340  27.279  1.00 37.59 ? 699  SER C C   1 
ATOM   6856 O  O   . SER C 1 219 ? 47.695  -5.642  26.458  1.00 37.56 ? 699  SER C O   1 
ATOM   6857 C  CB  . SER C 1 219 ? 46.490  -3.303  28.702  1.00 37.95 ? 699  SER C CB  1 
ATOM   6858 O  OG  . SER C 1 219 ? 46.111  -1.938  28.712  1.00 38.13 ? 699  SER C OG  1 
ATOM   6859 N  N   . LYS C 1 220 ? 46.320  -6.204  28.155  1.00 37.16 ? 700  LYS C N   1 
ATOM   6860 C  CA  . LYS C 1 220 ? 46.786  -7.585  28.239  1.00 36.80 ? 700  LYS C CA  1 
ATOM   6861 C  C   . LYS C 1 220 ? 45.863  -8.534  27.474  1.00 36.26 ? 700  LYS C C   1 
ATOM   6862 O  O   . LYS C 1 220 ? 44.677  -8.648  27.786  1.00 36.00 ? 700  LYS C O   1 
ATOM   6863 C  CB  . LYS C 1 220 ? 46.924  -8.018  29.700  1.00 36.87 ? 700  LYS C CB  1 
ATOM   6864 C  CG  . LYS C 1 220 ? 47.869  -7.121  30.501  1.00 37.21 ? 700  LYS C CG  1 
ATOM   6865 C  CD  . LYS C 1 220 ? 48.799  -7.911  31.405  1.00 37.60 ? 700  LYS C CD  1 
ATOM   6866 C  CE  . LYS C 1 220 ? 48.074  -8.537  32.583  1.00 37.82 ? 700  LYS C CE  1 
ATOM   6867 N  NZ  . LYS C 1 220 ? 49.015  -9.354  33.414  1.00 37.98 ? 700  LYS C NZ  1 
ATOM   6868 N  N   . ILE C 1 221 ? 46.430  -9.214  26.478  1.00 35.83 ? 701  ILE C N   1 
ATOM   6869 C  CA  . ILE C 1 221 ? 45.682  -10.108 25.597  1.00 35.39 ? 701  ILE C CA  1 
ATOM   6870 C  C   . ILE C 1 221 ? 46.242  -11.532 25.645  1.00 35.08 ? 701  ILE C C   1 
ATOM   6871 O  O   . ILE C 1 221 ? 47.457  -11.736 25.632  1.00 35.15 ? 701  ILE C O   1 
ATOM   6872 C  CB  . ILE C 1 221 ? 45.715  -9.601  24.138  1.00 35.34 ? 701  ILE C CB  1 
ATOM   6873 C  CG1 . ILE C 1 221 ? 45.069  -8.214  24.046  1.00 35.26 ? 701  ILE C CG1 1 
ATOM   6874 C  CG2 . ILE C 1 221 ? 45.002  -10.583 23.209  1.00 35.23 ? 701  ILE C CG2 1 
ATOM   6875 C  CD1 . ILE C 1 221 ? 45.142  -7.586  22.674  1.00 34.95 ? 701  ILE C CD1 1 
ATOM   6876 N  N   . LEU C 1 222 ? 45.339  -12.507 25.702  1.00 34.59 ? 702  LEU C N   1 
ATOM   6877 C  CA  . LEU C 1 222 ? 45.693  -13.920 25.639  1.00 34.09 ? 702  LEU C CA  1 
ATOM   6878 C  C   . LEU C 1 222 ? 45.305  -14.465 24.271  1.00 33.77 ? 702  LEU C C   1 
ATOM   6879 O  O   . LEU C 1 222 ? 44.191  -14.226 23.802  1.00 33.64 ? 702  LEU C O   1 
ATOM   6880 C  CB  . LEU C 1 222 ? 44.957  -14.700 26.738  1.00 34.00 ? 702  LEU C CB  1 
ATOM   6881 C  CG  . LEU C 1 222 ? 44.875  -16.225 26.604  1.00 33.82 ? 702  LEU C CG  1 
ATOM   6882 C  CD1 . LEU C 1 222 ? 46.258  -16.840 26.482  1.00 33.42 ? 702  LEU C CD1 1 
ATOM   6883 C  CD2 . LEU C 1 222 ? 44.122  -16.826 27.779  1.00 33.97 ? 702  LEU C CD2 1 
ATOM   6884 N  N   . ILE C 1 223 ? 46.222  -15.190 23.634  1.00 33.33 ? 703  ILE C N   1 
ATOM   6885 C  CA  . ILE C 1 223 ? 45.896  -15.959 22.440  1.00 33.13 ? 703  ILE C CA  1 
ATOM   6886 C  C   . ILE C 1 223 ? 46.056  -17.441 22.744  1.00 32.98 ? 703  ILE C C   1 
ATOM   6887 O  O   . ILE C 1 223 ? 47.154  -17.900 23.052  1.00 32.96 ? 703  ILE C O   1 
ATOM   6888 C  CB  . ILE C 1 223 ? 46.788  -15.606 21.235  1.00 33.15 ? 703  ILE C CB  1 
ATOM   6889 C  CG1 . ILE C 1 223 ? 46.621  -14.139 20.840  1.00 33.10 ? 703  ILE C CG1 1 
ATOM   6890 C  CG2 . ILE C 1 223 ? 46.444  -16.502 20.040  1.00 32.56 ? 703  ILE C CG2 1 
ATOM   6891 C  CD1 . ILE C 1 223 ? 47.589  -13.695 19.760  1.00 32.92 ? 703  ILE C CD1 1 
ATOM   6892 N  N   . VAL C 1 224 ? 44.950  -18.176 22.680  1.00 32.80 ? 704  VAL C N   1 
ATOM   6893 C  CA  . VAL C 1 224 ? 44.979  -19.627 22.755  1.00 32.63 ? 704  VAL C CA  1 
ATOM   6894 C  C   . VAL C 1 224 ? 44.876  -20.145 21.335  1.00 32.62 ? 704  VAL C C   1 
ATOM   6895 O  O   . VAL C 1 224 ? 43.963  -19.776 20.603  1.00 32.70 ? 704  VAL C O   1 
ATOM   6896 C  CB  . VAL C 1 224 ? 43.807  -20.196 23.582  1.00 32.65 ? 704  VAL C CB  1 
ATOM   6897 C  CG1 . VAL C 1 224 ? 43.853  -21.727 23.598  1.00 32.43 ? 704  VAL C CG1 1 
ATOM   6898 C  CG2 . VAL C 1 224 ? 43.831  -19.645 24.999  1.00 32.44 ? 704  VAL C CG2 1 
ATOM   6899 N  N   . ASP C 1 225 ? 45.820  -20.993 20.944  1.00 32.62 ? 705  ASP C N   1 
ATOM   6900 C  CA  . ASP C 1 225 ? 45.827  -21.576 19.609  1.00 32.54 ? 705  ASP C CA  1 
ATOM   6901 C  C   . ASP C 1 225 ? 45.745  -23.097 19.743  1.00 32.46 ? 705  ASP C C   1 
ATOM   6902 O  O   . ASP C 1 225 ? 46.757  -23.759 19.977  1.00 32.52 ? 705  ASP C O   1 
ATOM   6903 C  CB  . ASP C 1 225 ? 47.087  -21.117 18.861  1.00 32.55 ? 705  ASP C CB  1 
ATOM   6904 C  CG  . ASP C 1 225 ? 47.169  -21.652 17.432  1.00 32.54 ? 705  ASP C CG  1 
ATOM   6905 O  OD1 . ASP C 1 225 ? 46.383  -22.547 17.068  1.00 33.00 ? 705  ASP C OD1 1 
ATOM   6906 O  OD2 . ASP C 1 225 ? 48.046  -21.194 16.671  1.00 32.08 ? 705  ASP C OD2 1 
ATOM   6907 N  N   . TRP C 1 226 ? 44.540  -23.649 19.603  1.00 32.41 ? 706  TRP C N   1 
ATOM   6908 C  CA  . TRP C 1 226 ? 44.346  -25.097 19.759  1.00 32.35 ? 706  TRP C CA  1 
ATOM   6909 C  C   . TRP C 1 226 ? 44.303  -25.871 18.435  1.00 32.17 ? 706  TRP C C   1 
ATOM   6910 O  O   . TRP C 1 226 ? 44.055  -27.075 18.431  1.00 32.31 ? 706  TRP C O   1 
ATOM   6911 C  CB  . TRP C 1 226 ? 43.123  -25.414 20.642  1.00 32.29 ? 706  TRP C CB  1 
ATOM   6912 C  CG  . TRP C 1 226 ? 41.772  -25.035 20.106  1.00 32.58 ? 706  TRP C CG  1 
ATOM   6913 C  CD1 . TRP C 1 226 ? 41.269  -25.303 18.868  1.00 32.87 ? 706  TRP C CD1 1 
ATOM   6914 C  CD2 . TRP C 1 226 ? 40.724  -24.369 20.827  1.00 32.57 ? 706  TRP C CD2 1 
ATOM   6915 N  NE1 . TRP C 1 226 ? 39.983  -24.827 18.763  1.00 32.73 ? 706  TRP C NE1 1 
ATOM   6916 C  CE2 . TRP C 1 226 ? 39.625  -24.248 19.950  1.00 32.53 ? 706  TRP C CE2 1 
ATOM   6917 C  CE3 . TRP C 1 226 ? 40.614  -23.850 22.123  1.00 32.39 ? 706  TRP C CE3 1 
ATOM   6918 C  CZ2 . TRP C 1 226 ? 38.431  -23.628 20.327  1.00 32.51 ? 706  TRP C CZ2 1 
ATOM   6919 C  CZ3 . TRP C 1 226 ? 39.425  -23.237 22.497  1.00 32.19 ? 706  TRP C CZ3 1 
ATOM   6920 C  CH2 . TRP C 1 226 ? 38.351  -23.132 21.601  1.00 32.20 ? 706  TRP C CH2 1 
ATOM   6921 N  N   . ASP C 1 227 ? 44.554  -25.182 17.322  1.00 31.87 ? 707  ASP C N   1 
ATOM   6922 C  CA  . ASP C 1 227 ? 44.798  -25.836 16.034  1.00 31.67 ? 707  ASP C CA  1 
ATOM   6923 C  C   . ASP C 1 227 ? 45.930  -26.849 16.218  1.00 31.44 ? 707  ASP C C   1 
ATOM   6924 O  O   . ASP C 1 227 ? 46.890  -26.580 16.939  1.00 31.50 ? 707  ASP C O   1 
ATOM   6925 C  CB  . ASP C 1 227 ? 45.178  -24.778 14.982  1.00 31.65 ? 707  ASP C CB  1 
ATOM   6926 C  CG  . ASP C 1 227 ? 45.415  -25.363 13.602  1.00 31.70 ? 707  ASP C CG  1 
ATOM   6927 O  OD1 . ASP C 1 227 ? 46.338  -26.194 13.443  1.00 31.83 ? 707  ASP C OD1 1 
ATOM   6928 O  OD2 . ASP C 1 227 ? 44.696  -24.968 12.660  1.00 31.59 ? 707  ASP C OD2 1 
ATOM   6929 N  N   . VAL C 1 228 ? 45.835  -28.003 15.572  1.00 31.09 ? 708  VAL C N   1 
ATOM   6930 C  CA  . VAL C 1 228 ? 46.833  -29.057 15.769  1.00 30.93 ? 708  VAL C CA  1 
ATOM   6931 C  C   . VAL C 1 228 ? 48.262  -28.649 15.339  1.00 30.71 ? 708  VAL C C   1 
ATOM   6932 O  O   . VAL C 1 228 ? 49.239  -29.236 15.807  1.00 30.62 ? 708  VAL C O   1 
ATOM   6933 C  CB  . VAL C 1 228 ? 46.417  -30.367 15.053  1.00 30.90 ? 708  VAL C CB  1 
ATOM   6934 C  CG1 . VAL C 1 228 ? 46.777  -30.314 13.577  1.00 30.80 ? 708  VAL C CG1 1 
ATOM   6935 C  CG2 . VAL C 1 228 ? 47.071  -31.563 15.721  1.00 31.13 ? 708  VAL C CG2 1 
ATOM   6936 N  N   . HIS C 1 229 ? 48.374  -27.649 14.462  1.00 30.50 ? 709  HIS C N   1 
ATOM   6937 C  CA  . HIS C 1 229 ? 49.671  -27.135 13.986  1.00 30.23 ? 709  HIS C CA  1 
ATOM   6938 C  C   . HIS C 1 229 ? 50.121  -25.915 14.783  1.00 29.97 ? 709  HIS C C   1 
ATOM   6939 O  O   . HIS C 1 229 ? 49.292  -25.188 15.324  1.00 29.94 ? 709  HIS C O   1 
ATOM   6940 C  CB  . HIS C 1 229 ? 49.570  -26.747 12.508  1.00 30.18 ? 709  HIS C CB  1 
ATOM   6941 C  CG  . HIS C 1 229 ? 49.125  -27.868 11.622  1.00 30.02 ? 709  HIS C CG  1 
ATOM   6942 N  ND1 . HIS C 1 229 ? 47.798  -28.123 11.356  1.00 29.72 ? 709  HIS C ND1 1 
ATOM   6943 C  CD2 . HIS C 1 229 ? 49.832  -28.808 10.952  1.00 29.81 ? 709  HIS C CD2 1 
ATOM   6944 C  CE1 . HIS C 1 229 ? 47.706  -29.171 10.556  1.00 29.68 ? 709  HIS C CE1 1 
ATOM   6945 N  NE2 . HIS C 1 229 ? 48.926  -29.603 10.294  1.00 29.84 ? 709  HIS C NE2 1 
ATOM   6946 N  N   . HIS C 1 230 ? 51.430  -25.683 14.848  1.00 29.81 ? 710  HIS C N   1 
ATOM   6947 C  CA  . HIS C 1 230 ? 51.976  -24.548 15.592  1.00 29.62 ? 710  HIS C CA  1 
ATOM   6948 C  C   . HIS C 1 230 ? 51.789  -23.244 14.824  1.00 29.64 ? 710  HIS C C   1 
ATOM   6949 O  O   . HIS C 1 230 ? 52.152  -23.150 13.654  1.00 29.57 ? 710  HIS C O   1 
ATOM   6950 C  CB  . HIS C 1 230 ? 53.455  -24.760 15.905  1.00 29.64 ? 710  HIS C CB  1 
ATOM   6951 C  CG  . HIS C 1 230 ? 54.076  -23.644 16.685  1.00 29.48 ? 710  HIS C CG  1 
ATOM   6952 N  ND1 . HIS C 1 230 ? 55.115  -22.882 16.194  1.00 28.99 ? 710  HIS C ND1 1 
ATOM   6953 C  CD2 . HIS C 1 230 ? 53.801  -23.155 17.918  1.00 29.43 ? 710  HIS C CD2 1 
ATOM   6954 C  CE1 . HIS C 1 230 ? 55.459  -21.979 17.093  1.00 29.13 ? 710  HIS C CE1 1 
ATOM   6955 N  NE2 . HIS C 1 230 ? 54.679  -22.125 18.150  1.00 29.54 ? 710  HIS C NE2 1 
ATOM   6956 N  N   . GLY C 1 231 ? 51.230  -22.238 15.494  1.00 29.60 ? 711  GLY C N   1 
ATOM   6957 C  CA  . GLY C 1 231 ? 51.080  -20.912 14.909  1.00 29.64 ? 711  GLY C CA  1 
ATOM   6958 C  C   . GLY C 1 231 ? 52.391  -20.151 14.920  1.00 29.55 ? 711  GLY C C   1 
ATOM   6959 O  O   . GLY C 1 231 ? 52.571  -19.223 15.708  1.00 29.62 ? 711  GLY C O   1 
ATOM   6960 N  N   . ASN C 1 232 ? 53.304  -20.541 14.037  1.00 29.52 ? 712  ASN C N   1 
ATOM   6961 C  CA  . ASN C 1 232 ? 54.647  -19.946 13.994  1.00 29.62 ? 712  ASN C CA  1 
ATOM   6962 C  C   . ASN C 1 232 ? 54.632  -18.423 13.872  1.00 29.60 ? 712  ASN C C   1 
ATOM   6963 O  O   . ASN C 1 232 ? 55.367  -17.731 14.580  1.00 29.39 ? 712  ASN C O   1 
ATOM   6964 C  CB  . ASN C 1 232 ? 55.495  -20.560 12.869  1.00 29.70 ? 712  ASN C CB  1 
ATOM   6965 C  CG  . ASN C 1 232 ? 54.743  -20.673 11.550  1.00 29.69 ? 712  ASN C CG  1 
ATOM   6966 O  OD1 . ASN C 1 232 ? 53.661  -21.254 11.490  1.00 29.59 ? 712  ASN C OD1 1 
ATOM   6967 N  ND2 . ASN C 1 232 ? 55.328  -20.136 10.485  1.00 30.32 ? 712  ASN C ND2 1 
ATOM   6968 N  N   . GLY C 1 233 ? 53.785  -17.910 12.985  1.00 29.79 ? 713  GLY C N   1 
ATOM   6969 C  CA  . GLY C 1 233 ? 53.664  -16.470 12.771  1.00 29.96 ? 713  GLY C CA  1 
ATOM   6970 C  C   . GLY C 1 233 ? 53.236  -15.733 14.027  1.00 30.08 ? 713  GLY C C   1 
ATOM   6971 O  O   . GLY C 1 233 ? 53.817  -14.706 14.385  1.00 30.00 ? 713  GLY C O   1 
ATOM   6972 N  N   . THR C 1 234 ? 52.224  -16.273 14.701  1.00 30.17 ? 714  THR C N   1 
ATOM   6973 C  CA  . THR C 1 234 ? 51.714  -15.680 15.929  1.00 30.20 ? 714  THR C CA  1 
ATOM   6974 C  C   . THR C 1 234 ? 52.786  -15.664 17.023  1.00 30.30 ? 714  THR C C   1 
ATOM   6975 O  O   . THR C 1 234 ? 52.955  -14.649 17.710  1.00 30.26 ? 714  THR C O   1 
ATOM   6976 C  CB  . THR C 1 234 ? 50.453  -16.417 16.424  1.00 30.29 ? 714  THR C CB  1 
ATOM   6977 O  OG1 . THR C 1 234 ? 49.544  -16.592 15.330  1.00 30.23 ? 714  THR C OG1 1 
ATOM   6978 C  CG2 . THR C 1 234 ? 49.766  -15.630 17.538  1.00 29.73 ? 714  THR C CG2 1 
ATOM   6979 N  N   . GLN C 1 235 ? 53.518  -16.769 17.173  1.00 30.38 ? 715  GLN C N   1 
ATOM   6980 C  CA  . GLN C 1 235 ? 54.622  -16.821 18.139  1.00 30.56 ? 715  GLN C CA  1 
ATOM   6981 C  C   . GLN C 1 235 ? 55.681  -15.777 17.820  1.00 30.62 ? 715  GLN C C   1 
ATOM   6982 O  O   . GLN C 1 235 ? 56.128  -15.059 18.713  1.00 30.72 ? 715  GLN C O   1 
ATOM   6983 C  CB  . GLN C 1 235 ? 55.286  -18.202 18.191  1.00 30.55 ? 715  GLN C CB  1 
ATOM   6984 C  CG  . GLN C 1 235 ? 56.556  -18.209 19.051  1.00 30.65 ? 715  GLN C CG  1 
ATOM   6985 C  CD  . GLN C 1 235 ? 57.126  -19.589 19.288  1.00 30.80 ? 715  GLN C CD  1 
ATOM   6986 O  OE1 . GLN C 1 235 ? 56.407  -20.525 19.644  1.00 31.16 ? 715  GLN C OE1 1 
ATOM   6987 N  NE2 . GLN C 1 235 ? 58.435  -19.719 19.112  1.00 30.31 ? 715  GLN C NE2 1 
ATOM   6988 N  N   . GLN C 1 236 ? 56.086  -15.712 16.551  1.00 30.72 ? 716  GLN C N   1 
ATOM   6989 C  CA  . GLN C 1 236 ? 57.107  -14.760 16.105  1.00 30.85 ? 716  GLN C CA  1 
ATOM   6990 C  C   . GLN C 1 236 ? 56.706  -13.319 16.405  1.00 31.07 ? 716  GLN C C   1 
ATOM   6991 O  O   . GLN C 1 236 ? 57.512  -12.536 16.906  1.00 31.28 ? 716  GLN C O   1 
ATOM   6992 C  CB  . GLN C 1 236 ? 57.378  -14.914 14.603  1.00 30.57 ? 716  GLN C CB  1 
ATOM   6993 N  N   . THR C 1 237 ? 55.453  -12.983 16.118  1.00 31.25 ? 717  THR C N   1 
ATOM   6994 C  CA  . THR C 1 237 ? 54.986  -11.599 16.197  1.00 31.37 ? 717  THR C CA  1 
ATOM   6995 C  C   . THR C 1 237 ? 55.007  -11.017 17.614  1.00 31.42 ? 717  THR C C   1 
ATOM   6996 O  O   . THR C 1 237 ? 55.386  -9.856  17.801  1.00 31.41 ? 717  THR C O   1 
ATOM   6997 C  CB  . THR C 1 237 ? 53.555  -11.455 15.620  1.00 31.48 ? 717  THR C CB  1 
ATOM   6998 O  OG1 . THR C 1 237 ? 53.489  -12.086 14.334  1.00 31.40 ? 717  THR C OG1 1 
ATOM   6999 C  CG2 . THR C 1 237 ? 53.174  -9.978  15.484  1.00 31.25 ? 717  THR C CG2 1 
ATOM   7000 N  N   . PHE C 1 238 ? 54.607  -11.814 18.602  1.00 31.40 ? 718  PHE C N   1 
ATOM   7001 C  CA  . PHE C 1 238 ? 54.471  -11.322 19.975  1.00 31.43 ? 718  PHE C CA  1 
ATOM   7002 C  C   . PHE C 1 238 ? 55.532  -11.888 20.938  1.00 31.30 ? 718  PHE C C   1 
ATOM   7003 O  O   . PHE C 1 238 ? 55.303  -11.951 22.151  1.00 30.95 ? 718  PHE C O   1 
ATOM   7004 C  CB  . PHE C 1 238 ? 53.060  -11.628 20.493  1.00 31.46 ? 718  PHE C CB  1 
ATOM   7005 C  CG  . PHE C 1 238 ? 51.966  -11.076 19.634  1.00 32.02 ? 718  PHE C CG  1 
ATOM   7006 C  CD1 . PHE C 1 238 ? 51.629  -9.732  19.700  1.00 32.34 ? 718  PHE C CD1 1 
ATOM   7007 C  CD2 . PHE C 1 238 ? 51.269  -11.902 18.765  1.00 32.32 ? 718  PHE C CD2 1 
ATOM   7008 C  CE1 . PHE C 1 238 ? 50.617  -9.217  18.907  1.00 33.16 ? 718  PHE C CE1 1 
ATOM   7009 C  CE2 . PHE C 1 238 ? 50.263  -11.402 17.971  1.00 32.92 ? 718  PHE C CE2 1 
ATOM   7010 C  CZ  . PHE C 1 238 ? 49.931  -10.054 18.040  1.00 33.23 ? 718  PHE C CZ  1 
ATOM   7011 N  N   . TYR C 1 239 ? 56.691  -12.266 20.407  1.00 31.31 ? 719  TYR C N   1 
ATOM   7012 C  CA  . TYR C 1 239 ? 57.733  -12.935 21.201  1.00 31.54 ? 719  TYR C CA  1 
ATOM   7013 C  C   . TYR C 1 239 ? 58.382  -12.028 22.261  1.00 31.77 ? 719  TYR C C   1 
ATOM   7014 O  O   . TYR C 1 239 ? 58.692  -12.482 23.365  1.00 31.80 ? 719  TYR C O   1 
ATOM   7015 C  CB  . TYR C 1 239 ? 58.811  -13.510 20.276  1.00 31.48 ? 719  TYR C CB  1 
ATOM   7016 C  CG  . TYR C 1 239 ? 59.505  -14.740 20.818  1.00 31.50 ? 719  TYR C CG  1 
ATOM   7017 C  CD1 . TYR C 1 239 ? 58.827  -15.952 20.915  1.00 31.34 ? 719  TYR C CD1 1 
ATOM   7018 C  CD2 . TYR C 1 239 ? 60.843  -14.701 21.208  1.00 31.52 ? 719  TYR C CD2 1 
ATOM   7019 C  CE1 . TYR C 1 239 ? 59.453  -17.088 21.402  1.00 31.55 ? 719  TYR C CE1 1 
ATOM   7020 C  CE2 . TYR C 1 239 ? 61.483  -15.838 21.696  1.00 31.56 ? 719  TYR C CE2 1 
ATOM   7021 C  CZ  . TYR C 1 239 ? 60.781  -17.029 21.784  1.00 31.48 ? 719  TYR C CZ  1 
ATOM   7022 O  OH  . TYR C 1 239 ? 61.393  -18.161 22.268  1.00 31.41 ? 719  TYR C OH  1 
ATOM   7023 N  N   . GLN C 1 240 ? 58.581  -10.755 21.921  1.00 32.06 ? 720  GLN C N   1 
ATOM   7024 C  CA  . GLN C 1 240 ? 59.184  -9.777  22.841  1.00 32.26 ? 720  GLN C CA  1 
ATOM   7025 C  C   . GLN C 1 240 ? 58.155  -9.043  23.717  1.00 32.42 ? 720  GLN C C   1 
ATOM   7026 O  O   . GLN C 1 240 ? 58.536  -8.239  24.573  1.00 32.47 ? 720  GLN C O   1 
ATOM   7027 C  CB  . GLN C 1 240 ? 60.001  -8.743  22.053  1.00 32.23 ? 720  GLN C CB  1 
ATOM   7028 C  CG  . GLN C 1 240 ? 61.372  -9.229  21.596  1.00 32.35 ? 720  GLN C CG  1 
ATOM   7029 C  CD  . GLN C 1 240 ? 62.505  -8.732  22.486  1.00 32.58 ? 720  GLN C CD  1 
ATOM   7030 O  OE1 . GLN C 1 240 ? 62.640  -7.530  22.732  1.00 31.86 ? 720  GLN C OE1 1 
ATOM   7031 N  NE2 . GLN C 1 240 ? 63.332  -9.658  22.963  1.00 33.22 ? 720  GLN C NE2 1 
ATOM   7032 N  N   . ASP C 1 241 ? 56.867  -9.328  23.514  1.00 32.49 ? 721  ASP C N   1 
ATOM   7033 C  CA  . ASP C 1 241 ? 55.786  -8.549  24.120  1.00 32.68 ? 721  ASP C CA  1 
ATOM   7034 C  C   . ASP C 1 241 ? 55.249  -9.211  25.401  1.00 32.77 ? 721  ASP C C   1 
ATOM   7035 O  O   . ASP C 1 241 ? 54.673  -10.303 25.342  1.00 32.99 ? 721  ASP C O   1 
ATOM   7036 C  CB  . ASP C 1 241 ? 54.650  -8.374  23.097  1.00 32.76 ? 721  ASP C CB  1 
ATOM   7037 C  CG  . ASP C 1 241 ? 53.745  -7.188  23.405  1.00 32.89 ? 721  ASP C CG  1 
ATOM   7038 O  OD1 . ASP C 1 241 ? 53.707  -6.731  24.565  1.00 33.27 ? 721  ASP C OD1 1 
ATOM   7039 O  OD2 . ASP C 1 241 ? 53.062  -6.715  22.473  1.00 32.67 ? 721  ASP C OD2 1 
ATOM   7040 N  N   . PRO C 1 242 ? 55.433  -8.550  26.564  1.00 32.79 ? 722  PRO C N   1 
ATOM   7041 C  CA  . PRO C 1 242 ? 54.879  -9.053  27.827  1.00 32.75 ? 722  PRO C CA  1 
ATOM   7042 C  C   . PRO C 1 242 ? 53.373  -8.811  28.003  1.00 32.65 ? 722  PRO C C   1 
ATOM   7043 O  O   . PRO C 1 242 ? 52.762  -9.386  28.907  1.00 32.68 ? 722  PRO C O   1 
ATOM   7044 C  CB  . PRO C 1 242 ? 55.657  -8.261  28.882  1.00 32.76 ? 722  PRO C CB  1 
ATOM   7045 C  CG  . PRO C 1 242 ? 55.987  -6.989  28.217  1.00 32.71 ? 722  PRO C CG  1 
ATOM   7046 C  CD  . PRO C 1 242 ? 56.234  -7.330  26.777  1.00 32.75 ? 722  PRO C CD  1 
ATOM   7047 N  N   . SER C 1 243 ? 52.794  -7.958  27.160  1.00 32.49 ? 723  SER C N   1 
ATOM   7048 C  CA  . SER C 1 243 ? 51.361  -7.665  27.203  1.00 32.36 ? 723  SER C CA  1 
ATOM   7049 C  C   . SER C 1 243 ? 50.530  -8.690  26.420  1.00 32.10 ? 723  SER C C   1 
ATOM   7050 O  O   . SER C 1 243 ? 49.299  -8.653  26.468  1.00 31.80 ? 723  SER C O   1 
ATOM   7051 C  CB  . SER C 1 243 ? 51.099  -6.264  26.653  1.00 32.35 ? 723  SER C CB  1 
ATOM   7052 O  OG  . SER C 1 243 ? 51.260  -6.240  25.246  1.00 32.72 ? 723  SER C OG  1 
ATOM   7053 N  N   . VAL C 1 244 ? 51.200  -9.591  25.699  1.00 31.93 ? 724  VAL C N   1 
ATOM   7054 C  CA  . VAL C 1 244 ? 50.524  -10.667 24.971  1.00 31.77 ? 724  VAL C CA  1 
ATOM   7055 C  C   . VAL C 1 244 ? 51.016  -12.037 25.431  1.00 31.74 ? 724  VAL C C   1 
ATOM   7056 O  O   . VAL C 1 244 ? 52.226  -12.300 25.445  1.00 31.86 ? 724  VAL C O   1 
ATOM   7057 C  CB  . VAL C 1 244 ? 50.735  -10.538 23.452  1.00 31.77 ? 724  VAL C CB  1 
ATOM   7058 C  CG1 . VAL C 1 244 ? 50.188  -11.763 22.734  1.00 31.66 ? 724  VAL C CG1 1 
ATOM   7059 C  CG2 . VAL C 1 244 ? 50.071  -9.263  22.933  1.00 31.41 ? 724  VAL C CG2 1 
ATOM   7060 N  N   . LEU C 1 245 ? 50.075  -12.905 25.799  1.00 31.59 ? 725  LEU C N   1 
ATOM   7061 C  CA  . LEU C 1 245 ? 50.377  -14.278 26.199  1.00 31.38 ? 725  LEU C CA  1 
ATOM   7062 C  C   . LEU C 1 245 ? 49.939  -15.230 25.092  1.00 31.34 ? 725  LEU C C   1 
ATOM   7063 O  O   . LEU C 1 245 ? 48.775  -15.232 24.707  1.00 31.26 ? 725  LEU C O   1 
ATOM   7064 C  CB  . LEU C 1 245 ? 49.658  -14.624 27.511  1.00 31.22 ? 725  LEU C CB  1 
ATOM   7065 C  CG  . LEU C 1 245 ? 49.729  -16.077 27.999  1.00 30.88 ? 725  LEU C CG  1 
ATOM   7066 C  CD1 . LEU C 1 245 ? 51.168  -16.533 28.179  1.00 29.87 ? 725  LEU C CD1 1 
ATOM   7067 C  CD2 . LEU C 1 245 ? 48.942  -16.246 29.290  1.00 30.45 ? 725  LEU C CD2 1 
ATOM   7068 N  N   . TYR C 1 246 ? 50.868  -16.041 24.593  1.00 31.36 ? 726  TYR C N   1 
ATOM   7069 C  CA  . TYR C 1 246 ? 50.560  -17.025 23.560  1.00 31.40 ? 726  TYR C CA  1 
ATOM   7070 C  C   . TYR C 1 246 ? 50.671  -18.425 24.150  1.00 31.58 ? 726  TYR C C   1 
ATOM   7071 O  O   . TYR C 1 246 ? 51.757  -18.841 24.578  1.00 31.66 ? 726  TYR C O   1 
ATOM   7072 C  CB  . TYR C 1 246 ? 51.506  -16.885 22.368  1.00 31.25 ? 726  TYR C CB  1 
ATOM   7073 C  CG  . TYR C 1 246 ? 51.176  -17.803 21.210  1.00 31.13 ? 726  TYR C CG  1 
ATOM   7074 C  CD1 . TYR C 1 246 ? 49.976  -17.670 20.513  1.00 31.64 ? 726  TYR C CD1 1 
ATOM   7075 C  CD2 . TYR C 1 246 ? 52.063  -18.795 20.799  1.00 31.14 ? 726  TYR C CD2 1 
ATOM   7076 C  CE1 . TYR C 1 246 ? 49.666  -18.504 19.442  1.00 31.19 ? 726  TYR C CE1 1 
ATOM   7077 C  CE2 . TYR C 1 246 ? 51.763  -19.633 19.729  1.00 30.84 ? 726  TYR C CE2 1 
ATOM   7078 C  CZ  . TYR C 1 246 ? 50.563  -19.481 19.056  1.00 31.06 ? 726  TYR C CZ  1 
ATOM   7079 O  OH  . TYR C 1 246 ? 50.251  -20.309 18.002  1.00 31.36 ? 726  TYR C OH  1 
ATOM   7080 N  N   . ILE C 1 247 ? 49.544  -19.133 24.192  1.00 31.54 ? 727  ILE C N   1 
ATOM   7081 C  CA  . ILE C 1 247 ? 49.524  -20.530 24.600  1.00 31.59 ? 727  ILE C CA  1 
ATOM   7082 C  C   . ILE C 1 247 ? 49.072  -21.364 23.410  1.00 31.98 ? 727  ILE C C   1 
ATOM   7083 O  O   . ILE C 1 247 ? 47.972  -21.177 22.891  1.00 31.92 ? 727  ILE C O   1 
ATOM   7084 C  CB  . ILE C 1 247 ? 48.591  -20.787 25.804  1.00 31.53 ? 727  ILE C CB  1 
ATOM   7085 C  CG1 . ILE C 1 247 ? 48.889  -19.800 26.941  1.00 31.32 ? 727  ILE C CG1 1 
ATOM   7086 C  CG2 . ILE C 1 247 ? 48.739  -22.224 26.290  1.00 30.69 ? 727  ILE C CG2 1 
ATOM   7087 C  CD1 . ILE C 1 247 ? 48.091  -20.060 28.212  1.00 31.08 ? 727  ILE C CD1 1 
ATOM   7088 N  N   . SER C 1 248 ? 49.933  -22.277 22.973  1.00 32.44 ? 728  SER C N   1 
ATOM   7089 C  CA  . SER C 1 248 ? 49.647  -23.121 21.824  1.00 32.67 ? 728  SER C CA  1 
ATOM   7090 C  C   . SER C 1 248 ? 49.757  -24.592 22.202  1.00 32.78 ? 728  SER C C   1 
ATOM   7091 O  O   . SER C 1 248 ? 50.761  -25.008 22.778  1.00 32.92 ? 728  SER C O   1 
ATOM   7092 C  CB  . SER C 1 248 ? 50.628  -22.802 20.701  1.00 32.76 ? 728  SER C CB  1 
ATOM   7093 O  OG  . SER C 1 248 ? 50.413  -23.646 19.581  1.00 33.11 ? 728  SER C OG  1 
ATOM   7094 N  N   . LEU C 1 249 ? 48.714  -25.360 21.883  1.00 32.87 ? 729  LEU C N   1 
ATOM   7095 C  CA  . LEU C 1 249 ? 48.715  -26.817 22.020  1.00 32.91 ? 729  LEU C CA  1 
ATOM   7096 C  C   . LEU C 1 249 ? 48.828  -27.437 20.626  1.00 32.95 ? 729  LEU C C   1 
ATOM   7097 O  O   . LEU C 1 249 ? 47.892  -27.346 19.832  1.00 33.29 ? 729  LEU C O   1 
ATOM   7098 C  CB  . LEU C 1 249 ? 47.422  -27.309 22.694  1.00 32.86 ? 729  LEU C CB  1 
ATOM   7099 C  CG  . LEU C 1 249 ? 46.955  -26.645 23.995  1.00 32.93 ? 729  LEU C CG  1 
ATOM   7100 C  CD1 . LEU C 1 249 ? 46.185  -25.360 23.716  1.00 32.93 ? 729  LEU C CD1 1 
ATOM   7101 C  CD2 . LEU C 1 249 ? 46.092  -27.601 24.798  1.00 32.73 ? 729  LEU C CD2 1 
ATOM   7102 N  N   . HIS C 1 250 ? 49.968  -28.048 20.313  1.00 32.96 ? 730  HIS C N   1 
ATOM   7103 C  CA  . HIS C 1 250 ? 50.177  -28.637 18.983  1.00 32.90 ? 730  HIS C CA  1 
ATOM   7104 C  C   . HIS C 1 250 ? 50.916  -29.962 19.014  1.00 32.92 ? 730  HIS C C   1 
ATOM   7105 O  O   . HIS C 1 250 ? 51.666  -30.254 19.948  1.00 32.81 ? 730  HIS C O   1 
ATOM   7106 C  CB  . HIS C 1 250 ? 50.947  -27.678 18.065  1.00 32.84 ? 730  HIS C CB  1 
ATOM   7107 C  CG  . HIS C 1 250 ? 52.226  -27.170 18.647  1.00 32.52 ? 730  HIS C CG  1 
ATOM   7108 N  ND1 . HIS C 1 250 ? 53.452  -27.709 18.324  1.00 32.63 ? 730  HIS C ND1 1 
ATOM   7109 C  CD2 . HIS C 1 250 ? 52.473  -26.172 19.528  1.00 32.44 ? 730  HIS C CD2 1 
ATOM   7110 C  CE1 . HIS C 1 250 ? 54.399  -27.066 18.981  1.00 32.63 ? 730  HIS C CE1 1 
ATOM   7111 N  NE2 . HIS C 1 250 ? 53.833  -26.130 19.721  1.00 32.54 ? 730  HIS C NE2 1 
ATOM   7112 N  N   . ARG C 1 251 ? 50.685  -30.750 17.968  1.00 33.04 ? 731  ARG C N   1 
ATOM   7113 C  CA  . ARG C 1 251 ? 51.473  -31.937 17.685  1.00 33.28 ? 731  ARG C CA  1 
ATOM   7114 C  C   . ARG C 1 251 ? 52.867  -31.467 17.269  1.00 33.69 ? 731  ARG C C   1 
ATOM   7115 O  O   . ARG C 1 251 ? 52.999  -30.697 16.319  1.00 33.54 ? 731  ARG C O   1 
ATOM   7116 C  CB  . ARG C 1 251 ? 50.812  -32.738 16.560  1.00 33.15 ? 731  ARG C CB  1 
ATOM   7117 C  CG  . ARG C 1 251 ? 51.473  -34.064 16.235  1.00 33.04 ? 731  ARG C CG  1 
ATOM   7118 C  CD  . ARG C 1 251 ? 50.793  -34.734 15.055  1.00 32.78 ? 731  ARG C CD  1 
ATOM   7119 N  NE  . ARG C 1 251 ? 51.541  -35.892 14.563  1.00 32.78 ? 731  ARG C NE  1 
ATOM   7120 C  CZ  . ARG C 1 251 ? 51.205  -36.612 13.494  1.00 32.30 ? 731  ARG C CZ  1 
ATOM   7121 N  NH1 . ARG C 1 251 ? 50.120  -36.312 12.787  1.00 32.25 ? 731  ARG C NH1 1 
ATOM   7122 N  NH2 . ARG C 1 251 ? 51.955  -37.646 13.132  1.00 32.11 ? 731  ARG C NH2 1 
ATOM   7123 N  N   . HIS C 1 252 ? 53.894  -31.912 17.992  1.00 34.21 ? 732  HIS C N   1 
ATOM   7124 C  CA  . HIS C 1 252 ? 55.270  -31.475 17.740  1.00 34.65 ? 732  HIS C CA  1 
ATOM   7125 C  C   . HIS C 1 252 ? 56.144  -32.643 17.291  1.00 35.03 ? 732  HIS C C   1 
ATOM   7126 O  O   . HIS C 1 252 ? 56.777  -32.576 16.236  1.00 35.20 ? 732  HIS C O   1 
ATOM   7127 C  CB  . HIS C 1 252 ? 55.860  -30.810 18.990  1.00 34.70 ? 732  HIS C CB  1 
ATOM   7128 C  CG  . HIS C 1 252 ? 57.116  -30.037 18.728  1.00 34.72 ? 732  HIS C CG  1 
ATOM   7129 N  ND1 . HIS C 1 252 ? 58.344  -30.415 19.228  1.00 35.45 ? 732  HIS C ND1 1 
ATOM   7130 C  CD2 . HIS C 1 252 ? 57.335  -28.911 18.009  1.00 34.93 ? 732  HIS C CD2 1 
ATOM   7131 C  CE1 . HIS C 1 252 ? 59.264  -29.552 18.832  1.00 35.00 ? 732  HIS C CE1 1 
ATOM   7132 N  NE2 . HIS C 1 252 ? 58.677  -28.630 18.091  1.00 34.99 ? 732  HIS C NE2 1 
ATOM   7133 N  N   . ASP C 1 253 ? 56.174  -33.705 18.096  1.00 35.47 ? 733  ASP C N   1 
ATOM   7134 C  CA  . ASP C 1 253 ? 56.923  -34.922 17.776  1.00 35.74 ? 733  ASP C CA  1 
ATOM   7135 C  C   . ASP C 1 253 ? 58.379  -34.621 17.421  1.00 36.05 ? 733  ASP C C   1 
ATOM   7136 O  O   . ASP C 1 253 ? 58.835  -34.916 16.313  1.00 36.25 ? 733  ASP C O   1 
ATOM   7137 C  CB  . ASP C 1 253 ? 56.239  -35.686 16.636  1.00 35.73 ? 733  ASP C CB  1 
ATOM   7138 C  CG  . ASP C 1 253 ? 54.803  -36.054 16.959  1.00 35.80 ? 733  ASP C CG  1 
ATOM   7139 O  OD1 . ASP C 1 253 ? 54.374  -35.852 18.116  1.00 35.49 ? 733  ASP C OD1 1 
ATOM   7140 O  OD2 . ASP C 1 253 ? 54.101  -36.546 16.049  1.00 36.05 ? 733  ASP C OD2 1 
ATOM   7141 N  N   . ASP C 1 254 ? 59.090  -34.011 18.366  1.00 36.31 ? 734  ASP C N   1 
ATOM   7142 C  CA  . ASP C 1 254 ? 60.517  -33.705 18.217  1.00 36.49 ? 734  ASP C CA  1 
ATOM   7143 C  C   . ASP C 1 254 ? 60.819  -32.888 16.946  1.00 36.39 ? 734  ASP C C   1 
ATOM   7144 O  O   . ASP C 1 254 ? 61.864  -33.057 16.322  1.00 36.50 ? 734  ASP C O   1 
ATOM   7145 C  CB  . ASP C 1 254 ? 61.336  -35.009 18.245  1.00 36.62 ? 734  ASP C CB  1 
ATOM   7146 C  CG  . ASP C 1 254 ? 62.789  -34.804 18.699  1.00 37.19 ? 734  ASP C CG  1 
ATOM   7147 O  OD1 . ASP C 1 254 ? 63.213  -33.650 18.932  1.00 37.92 ? 734  ASP C OD1 1 
ATOM   7148 O  OD2 . ASP C 1 254 ? 63.514  -35.815 18.824  1.00 38.09 ? 734  ASP C OD2 1 
ATOM   7149 N  N   . GLY C 1 255 ? 59.900  -32.002 16.575  1.00 36.30 ? 735  GLY C N   1 
ATOM   7150 C  CA  . GLY C 1 255 ? 60.090  -31.120 15.420  1.00 36.27 ? 735  GLY C CA  1 
ATOM   7151 C  C   . GLY C 1 255 ? 59.860  -31.764 14.061  1.00 36.17 ? 735  GLY C C   1 
ATOM   7152 O  O   . GLY C 1 255 ? 60.331  -31.245 13.043  1.00 35.90 ? 735  GLY C O   1 
ATOM   7153 N  N   . ASN C 1 256 ? 59.123  -32.877 14.040  1.00 36.07 ? 736  ASN C N   1 
ATOM   7154 C  CA  . ASN C 1 256 ? 58.855  -33.623 12.805  1.00 36.01 ? 736  ASN C CA  1 
ATOM   7155 C  C   . ASN C 1 256 ? 57.415  -33.474 12.317  1.00 35.63 ? 736  ASN C C   1 
ATOM   7156 O  O   . ASN C 1 256 ? 56.859  -34.392 11.710  1.00 35.62 ? 736  ASN C O   1 
ATOM   7157 C  CB  . ASN C 1 256 ? 59.174  -35.107 13.011  1.00 36.06 ? 736  ASN C CB  1 
ATOM   7158 C  CG  . ASN C 1 256 ? 60.620  -35.341 13.370  1.00 36.54 ? 736  ASN C CG  1 
ATOM   7159 O  OD1 . ASN C 1 256 ? 60.932  -35.776 14.479  1.00 37.18 ? 736  ASN C OD1 1 
ATOM   7160 N  ND2 . ASN C 1 256 ? 61.519  -35.042 12.436  1.00 37.23 ? 736  ASN C ND2 1 
ATOM   7161 N  N   . PHE C 1 257 ? 56.818  -32.317 12.579  1.00 35.25 ? 737  PHE C N   1 
ATOM   7162 C  CA  . PHE C 1 257 ? 55.458  -32.031 12.132  1.00 34.97 ? 737  PHE C CA  1 
ATOM   7163 C  C   . PHE C 1 257 ? 55.351  -30.555 11.783  1.00 34.74 ? 737  PHE C C   1 
ATOM   7164 O  O   . PHE C 1 257 ? 55.858  -29.704 12.518  1.00 34.70 ? 737  PHE C O   1 
ATOM   7165 C  CB  . PHE C 1 257 ? 54.455  -32.398 13.225  1.00 34.98 ? 737  PHE C CB  1 
ATOM   7166 C  CG  . PHE C 1 257 ? 53.030  -32.466 12.747  1.00 34.95 ? 737  PHE C CG  1 
ATOM   7167 C  CD1 . PHE C 1 257 ? 52.607  -33.513 11.940  1.00 34.56 ? 737  PHE C CD1 1 
ATOM   7168 C  CD2 . PHE C 1 257 ? 52.109  -31.490 13.112  1.00 34.97 ? 737  PHE C CD2 1 
ATOM   7169 C  CE1 . PHE C 1 257 ? 51.296  -33.585 11.497  1.00 34.39 ? 737  PHE C CE1 1 
ATOM   7170 C  CE2 . PHE C 1 257 ? 50.790  -31.556 12.675  1.00 34.74 ? 737  PHE C CE2 1 
ATOM   7171 C  CZ  . PHE C 1 257 ? 50.385  -32.605 11.865  1.00 34.59 ? 737  PHE C CZ  1 
ATOM   7172 N  N   . PHE C 1 258 ? 54.698  -30.253 10.662  1.00 34.44 ? 738  PHE C N   1 
ATOM   7173 C  CA  . PHE C 1 258 ? 54.601  -28.877 10.179  1.00 34.13 ? 738  PHE C CA  1 
ATOM   7174 C  C   . PHE C 1 258 ? 54.080  -27.947 11.276  1.00 33.87 ? 738  PHE C C   1 
ATOM   7175 O  O   . PHE C 1 258 ? 53.120  -28.290 11.968  1.00 33.80 ? 738  PHE C O   1 
ATOM   7176 C  CB  . PHE C 1 258 ? 53.683  -28.785 8.957   1.00 34.12 ? 738  PHE C CB  1 
ATOM   7177 C  CG  . PHE C 1 258 ? 53.652  -27.415 8.325   1.00 34.45 ? 738  PHE C CG  1 
ATOM   7178 C  CD1 . PHE C 1 258 ? 52.771  -26.438 8.783   1.00 34.38 ? 738  PHE C CD1 1 
ATOM   7179 C  CD2 . PHE C 1 258 ? 54.518  -27.098 7.279   1.00 34.62 ? 738  PHE C CD2 1 
ATOM   7180 C  CE1 . PHE C 1 258 ? 52.747  -25.171 8.203   1.00 34.81 ? 738  PHE C CE1 1 
ATOM   7181 C  CE2 . PHE C 1 258 ? 54.501  -25.833 6.694   1.00 34.76 ? 738  PHE C CE2 1 
ATOM   7182 C  CZ  . PHE C 1 258 ? 53.613  -24.869 7.156   1.00 34.92 ? 738  PHE C CZ  1 
ATOM   7183 N  N   . PRO C 1 259 ? 54.692  -26.756 11.425  1.00 33.57 ? 739  PRO C N   1 
ATOM   7184 C  CA  . PRO C 1 259 ? 55.816  -26.188 10.666  1.00 33.30 ? 739  PRO C CA  1 
ATOM   7185 C  C   . PRO C 1 259 ? 57.213  -26.600 11.153  1.00 33.04 ? 739  PRO C C   1 
ATOM   7186 O  O   . PRO C 1 259 ? 58.206  -26.173 10.563  1.00 33.18 ? 739  PRO C O   1 
ATOM   7187 C  CB  . PRO C 1 259 ? 55.620  -24.684 10.850  1.00 33.31 ? 739  PRO C CB  1 
ATOM   7188 C  CG  . PRO C 1 259 ? 54.992  -24.564 12.184  1.00 33.54 ? 739  PRO C CG  1 
ATOM   7189 C  CD  . PRO C 1 259 ? 54.106  -25.765 12.345  1.00 33.55 ? 739  PRO C CD  1 
ATOM   7190 N  N   . GLY C 1 260 ? 57.291  -27.412 12.208  1.00 32.65 ? 740  GLY C N   1 
ATOM   7191 C  CA  . GLY C 1 260 ? 58.575  -27.841 12.770  1.00 32.19 ? 740  GLY C CA  1 
ATOM   7192 C  C   . GLY C 1 260 ? 59.036  -26.974 13.934  1.00 31.91 ? 740  GLY C C   1 
ATOM   7193 O  O   . GLY C 1 260 ? 60.061  -27.263 14.565  1.00 31.69 ? 740  GLY C O   1 
ATOM   7194 N  N   . SER C 1 261 ? 58.271  -25.920 14.222  1.00 31.39 ? 741  SER C N   1 
ATOM   7195 C  CA  . SER C 1 261 ? 58.593  -24.980 15.291  1.00 31.08 ? 741  SER C CA  1 
ATOM   7196 C  C   . SER C 1 261 ? 57.721  -25.224 16.524  1.00 31.07 ? 741  SER C C   1 
ATOM   7197 O  O   . SER C 1 261 ? 56.873  -26.121 16.535  1.00 31.02 ? 741  SER C O   1 
ATOM   7198 C  CB  . SER C 1 261 ? 58.386  -23.549 14.794  1.00 31.09 ? 741  SER C CB  1 
ATOM   7199 O  OG  . SER C 1 261 ? 57.025  -23.313 14.480  1.00 30.23 ? 741  SER C OG  1 
ATOM   7200 N  N   . GLY C 1 262 ? 57.949  -24.420 17.559  1.00 31.00 ? 742  GLY C N   1 
ATOM   7201 C  CA  . GLY C 1 262 ? 57.098  -24.405 18.743  1.00 31.07 ? 742  GLY C CA  1 
ATOM   7202 C  C   . GLY C 1 262 ? 57.504  -25.381 19.829  1.00 31.13 ? 742  GLY C C   1 
ATOM   7203 O  O   . GLY C 1 262 ? 56.647  -25.939 20.509  1.00 31.15 ? 742  GLY C O   1 
ATOM   7204 N  N   . ALA C 1 263 ? 58.807  -25.583 20.008  1.00 31.19 ? 743  ALA C N   1 
ATOM   7205 C  CA  . ALA C 1 263 ? 59.297  -26.455 21.075  1.00 31.35 ? 743  ALA C CA  1 
ATOM   7206 C  C   . ALA C 1 263 ? 59.001  -25.833 22.436  1.00 31.45 ? 743  ALA C C   1 
ATOM   7207 O  O   . ALA C 1 263 ? 58.933  -24.609 22.570  1.00 31.51 ? 743  ALA C O   1 
ATOM   7208 C  CB  . ALA C 1 263 ? 60.793  -26.721 20.922  1.00 31.15 ? 743  ALA C CB  1 
ATOM   7209 N  N   . VAL C 1 264 ? 58.817  -26.688 23.437  1.00 31.58 ? 744  VAL C N   1 
ATOM   7210 C  CA  . VAL C 1 264 ? 58.552  -26.252 24.805  1.00 31.77 ? 744  VAL C CA  1 
ATOM   7211 C  C   . VAL C 1 264 ? 59.585  -25.230 25.309  1.00 32.04 ? 744  VAL C C   1 
ATOM   7212 O  O   . VAL C 1 264 ? 59.248  -24.333 26.083  1.00 31.96 ? 744  VAL C O   1 
ATOM   7213 C  CB  . VAL C 1 264 ? 58.508  -27.468 25.771  1.00 31.89 ? 744  VAL C CB  1 
ATOM   7214 C  CG1 . VAL C 1 264 ? 59.863  -28.189 25.813  1.00 31.63 ? 744  VAL C CG1 1 
ATOM   7215 C  CG2 . VAL C 1 264 ? 58.084  -27.034 27.163  1.00 32.04 ? 744  VAL C CG2 1 
ATOM   7216 N  N   . ASP C 1 265 ? 60.830  -25.369 24.853  1.00 32.33 ? 745  ASP C N   1 
ATOM   7217 C  CA  . ASP C 1 265 ? 61.939  -24.504 25.278  1.00 32.60 ? 745  ASP C CA  1 
ATOM   7218 C  C   . ASP C 1 265 ? 61.780  -23.039 24.870  1.00 32.60 ? 745  ASP C C   1 
ATOM   7219 O  O   . ASP C 1 265 ? 62.322  -22.151 25.527  1.00 32.74 ? 745  ASP C O   1 
ATOM   7220 C  CB  . ASP C 1 265 ? 63.261  -25.036 24.716  1.00 32.66 ? 745  ASP C CB  1 
ATOM   7221 C  CG  . ASP C 1 265 ? 63.559  -26.453 25.174  1.00 33.44 ? 745  ASP C CG  1 
ATOM   7222 O  OD1 . ASP C 1 265 ? 64.087  -26.624 26.300  1.00 34.43 ? 745  ASP C OD1 1 
ATOM   7223 O  OD2 . ASP C 1 265 ? 63.257  -27.395 24.407  1.00 34.23 ? 745  ASP C OD2 1 
ATOM   7224 N  N   . GLU C 1 266 ? 61.051  -22.791 23.784  1.00 32.59 ? 746  GLU C N   1 
ATOM   7225 C  CA  . GLU C 1 266 ? 60.857  -21.438 23.268  1.00 32.53 ? 746  GLU C CA  1 
ATOM   7226 C  C   . GLU C 1 266 ? 59.817  -20.699 24.115  1.00 32.58 ? 746  GLU C C   1 
ATOM   7227 O  O   . GLU C 1 266 ? 58.620  -20.977 24.027  1.00 32.58 ? 746  GLU C O   1 
ATOM   7228 C  CB  . GLU C 1 266 ? 60.429  -21.498 21.801  1.00 32.60 ? 746  GLU C CB  1 
ATOM   7229 C  CG  . GLU C 1 266 ? 61.462  -22.163 20.883  1.00 32.36 ? 746  GLU C CG  1 
ATOM   7230 C  CD  . GLU C 1 266 ? 60.852  -22.770 19.626  1.00 32.44 ? 746  GLU C CD  1 
ATOM   7231 O  OE1 . GLU C 1 266 ? 59.838  -22.226 19.127  1.00 32.28 ? 746  GLU C OE1 1 
ATOM   7232 O  OE2 . GLU C 1 266 ? 61.393  -23.793 19.137  1.00 31.68 ? 746  GLU C OE2 1 
ATOM   7233 N  N   . VAL C 1 267 ? 60.289  -19.753 24.925  1.00 32.65 ? 747  VAL C N   1 
ATOM   7234 C  CA  . VAL C 1 267 ? 59.489  -19.162 26.004  1.00 32.59 ? 747  VAL C CA  1 
ATOM   7235 C  C   . VAL C 1 267 ? 59.243  -17.653 25.878  1.00 32.68 ? 747  VAL C C   1 
ATOM   7236 O  O   . VAL C 1 267 ? 58.580  -17.063 26.734  1.00 32.79 ? 747  VAL C O   1 
ATOM   7237 C  CB  . VAL C 1 267 ? 60.157  -19.436 27.379  1.00 32.65 ? 747  VAL C CB  1 
ATOM   7238 C  CG1 . VAL C 1 267 ? 60.240  -20.935 27.643  1.00 32.25 ? 747  VAL C CG1 1 
ATOM   7239 C  CG2 . VAL C 1 267 ? 61.544  -18.790 27.450  1.00 32.22 ? 747  VAL C CG2 1 
ATOM   7240 N  N   . GLY C 1 268 ? 59.754  -17.039 24.813  1.00 32.70 ? 748  GLY C N   1 
ATOM   7241 C  CA  . GLY C 1 268 ? 59.707  -15.585 24.648  1.00 32.70 ? 748  GLY C CA  1 
ATOM   7242 C  C   . GLY C 1 268 ? 61.044  -14.955 25.004  1.00 32.88 ? 748  GLY C C   1 
ATOM   7243 O  O   . GLY C 1 268 ? 61.871  -15.578 25.677  1.00 32.81 ? 748  GLY C O   1 
ATOM   7244 N  N   . ALA C 1 269 ? 61.251  -13.715 24.558  1.00 32.94 ? 749  ALA C N   1 
ATOM   7245 C  CA  . ALA C 1 269 ? 62.508  -12.994 24.788  1.00 32.84 ? 749  ALA C CA  1 
ATOM   7246 C  C   . ALA C 1 269 ? 62.260  -11.615 25.398  1.00 32.87 ? 749  ALA C C   1 
ATOM   7247 O  O   . ALA C 1 269 ? 61.146  -11.085 25.338  1.00 33.00 ? 749  ALA C O   1 
ATOM   7248 C  CB  . ALA C 1 269 ? 63.278  -12.857 23.487  1.00 32.74 ? 749  ALA C CB  1 
ATOM   7249 N  N   . GLY C 1 270 ? 63.312  -11.047 25.985  1.00 32.82 ? 750  GLY C N   1 
ATOM   7250 C  CA  . GLY C 1 270 ? 63.262  -9.713  26.588  1.00 32.81 ? 750  GLY C CA  1 
ATOM   7251 C  C   . GLY C 1 270 ? 62.259  -9.586  27.724  1.00 32.80 ? 750  GLY C C   1 
ATOM   7252 O  O   . GLY C 1 270 ? 62.145  -10.479 28.571  1.00 32.70 ? 750  GLY C O   1 
ATOM   7253 N  N   . SER C 1 271 ? 61.529  -8.471  27.736  1.00 32.74 ? 751  SER C N   1 
ATOM   7254 C  CA  . SER C 1 271 ? 60.462  -8.244  28.713  1.00 32.61 ? 751  SER C CA  1 
ATOM   7255 C  C   . SER C 1 271 ? 59.377  -9.319  28.622  1.00 32.49 ? 751  SER C C   1 
ATOM   7256 O  O   . SER C 1 271 ? 58.747  -9.647  29.628  1.00 32.41 ? 751  SER C O   1 
ATOM   7257 C  CB  . SER C 1 271 ? 59.836  -6.856  28.520  1.00 32.60 ? 751  SER C CB  1 
ATOM   7258 O  OG  . SER C 1 271 ? 60.780  -5.825  28.762  1.00 32.72 ? 751  SER C OG  1 
ATOM   7259 N  N   . GLY C 1 272 ? 59.175  -9.866  27.421  1.00 32.39 ? 752  GLY C N   1 
ATOM   7260 C  CA  . GLY C 1 272 ? 58.164  -10.897 27.182  1.00 32.33 ? 752  GLY C CA  1 
ATOM   7261 C  C   . GLY C 1 272 ? 58.614  -12.330 27.428  1.00 32.32 ? 752  GLY C C   1 
ATOM   7262 O  O   . GLY C 1 272 ? 57.932  -13.267 27.020  1.00 32.43 ? 752  GLY C O   1 
ATOM   7263 N  N   . GLU C 1 273 ? 59.750  -12.507 28.100  1.00 32.30 ? 753  GLU C N   1 
ATOM   7264 C  CA  . GLU C 1 273 ? 60.265  -13.837 28.421  1.00 32.17 ? 753  GLU C CA  1 
ATOM   7265 C  C   . GLU C 1 273 ? 59.378  -14.496 29.480  1.00 32.06 ? 753  GLU C C   1 
ATOM   7266 O  O   . GLU C 1 273 ? 59.234  -13.971 30.586  1.00 32.21 ? 753  GLU C O   1 
ATOM   7267 C  CB  . GLU C 1 273 ? 61.709  -13.726 28.917  1.00 32.27 ? 753  GLU C CB  1 
ATOM   7268 C  CG  . GLU C 1 273 ? 62.455  -15.050 29.038  1.00 32.35 ? 753  GLU C CG  1 
ATOM   7269 C  CD  . GLU C 1 273 ? 63.869  -14.875 29.556  1.00 32.16 ? 753  GLU C CD  1 
ATOM   7270 O  OE1 . GLU C 1 273 ? 64.559  -13.935 29.103  1.00 32.21 ? 753  GLU C OE1 1 
ATOM   7271 O  OE2 . GLU C 1 273 ? 64.292  -15.680 30.415  1.00 32.14 ? 753  GLU C OE2 1 
ATOM   7272 N  N   . GLY C 1 274 ? 58.784  -15.637 29.130  1.00 31.77 ? 754  GLY C N   1 
ATOM   7273 C  CA  . GLY C 1 274 ? 57.826  -16.329 30.001  1.00 31.57 ? 754  GLY C CA  1 
ATOM   7274 C  C   . GLY C 1 274 ? 56.391  -16.259 29.494  1.00 31.42 ? 754  GLY C C   1 
ATOM   7275 O  O   . GLY C 1 274 ? 55.545  -17.071 29.878  1.00 31.39 ? 754  GLY C O   1 
ATOM   7276 N  N   . PHE C 1 275 ? 56.116  -15.298 28.618  1.00 31.13 ? 755  PHE C N   1 
ATOM   7277 C  CA  . PHE C 1 275 ? 54.766  -15.102 28.089  1.00 31.01 ? 755  PHE C CA  1 
ATOM   7278 C  C   . PHE C 1 275 ? 54.524  -15.873 26.775  1.00 30.79 ? 755  PHE C C   1 
ATOM   7279 O  O   . PHE C 1 275 ? 53.658  -15.500 25.987  1.00 30.58 ? 755  PHE C O   1 
ATOM   7280 C  CB  . PHE C 1 275 ? 54.490  -13.602 27.907  1.00 30.88 ? 755  PHE C CB  1 
ATOM   7281 C  CG  . PHE C 1 275 ? 54.503  -12.822 29.192  1.00 30.91 ? 755  PHE C CG  1 
ATOM   7282 C  CD1 . PHE C 1 275 ? 53.348  -12.691 29.955  1.00 31.01 ? 755  PHE C CD1 1 
ATOM   7283 C  CD2 . PHE C 1 275 ? 55.670  -12.213 29.641  1.00 31.33 ? 755  PHE C CD2 1 
ATOM   7284 C  CE1 . PHE C 1 275 ? 53.356  -11.963 31.147  1.00 31.22 ? 755  PHE C CE1 1 
ATOM   7285 C  CE2 . PHE C 1 275 ? 55.689  -11.487 30.832  1.00 31.15 ? 755  PHE C CE2 1 
ATOM   7286 C  CZ  . PHE C 1 275 ? 54.530  -11.362 31.585  1.00 31.12 ? 755  PHE C CZ  1 
ATOM   7287 N  N   . ASN C 1 276 ? 55.293  -16.940 26.543  1.00 30.62 ? 756  ASN C N   1 
ATOM   7288 C  CA  . ASN C 1 276 ? 55.071  -17.838 25.404  1.00 30.33 ? 756  ASN C CA  1 
ATOM   7289 C  C   . ASN C 1 276 ? 55.082  -19.295 25.874  1.00 30.24 ? 756  ASN C C   1 
ATOM   7290 O  O   . ASN C 1 276 ? 56.131  -19.820 26.241  1.00 30.20 ? 756  ASN C O   1 
ATOM   7291 C  CB  . ASN C 1 276 ? 56.145  -17.634 24.332  1.00 30.15 ? 756  ASN C CB  1 
ATOM   7292 C  CG  . ASN C 1 276 ? 55.792  -18.303 23.022  1.00 29.70 ? 756  ASN C CG  1 
ATOM   7293 O  OD1 . ASN C 1 276 ? 56.227  -19.419 22.748  1.00 29.51 ? 756  ASN C OD1 1 
ATOM   7294 N  ND2 . ASN C 1 276 ? 54.981  -17.634 22.217  1.00 28.03 ? 756  ASN C ND2 1 
ATOM   7295 N  N   . VAL C 1 277 ? 53.917  -19.938 25.859  1.00 30.01 ? 757  VAL C N   1 
ATOM   7296 C  CA  . VAL C 1 277 ? 53.778  -21.297 26.370  1.00 29.90 ? 757  VAL C CA  1 
ATOM   7297 C  C   . VAL C 1 277 ? 53.366  -22.261 25.262  1.00 29.68 ? 757  VAL C C   1 
ATOM   7298 O  O   . VAL C 1 277 ? 52.211  -22.281 24.844  1.00 29.54 ? 757  VAL C O   1 
ATOM   7299 C  CB  . VAL C 1 277 ? 52.742  -21.359 27.517  1.00 29.98 ? 757  VAL C CB  1 
ATOM   7300 C  CG1 . VAL C 1 277 ? 52.540  -22.795 27.989  1.00 30.10 ? 757  VAL C CG1 1 
ATOM   7301 C  CG2 . VAL C 1 277 ? 53.186  -20.478 28.673  1.00 29.94 ? 757  VAL C CG2 1 
ATOM   7302 N  N   . ASN C 1 278 ? 54.321  -23.059 24.793  1.00 29.47 ? 758  ASN C N   1 
ATOM   7303 C  CA  . ASN C 1 278 ? 54.046  -24.099 23.813  1.00 29.41 ? 758  ASN C CA  1 
ATOM   7304 C  C   . ASN C 1 278 ? 53.803  -25.432 24.495  1.00 29.31 ? 758  ASN C C   1 
ATOM   7305 O  O   . ASN C 1 278 ? 54.719  -26.010 25.088  1.00 29.30 ? 758  ASN C O   1 
ATOM   7306 C  CB  . ASN C 1 278 ? 55.209  -24.235 22.832  1.00 29.44 ? 758  ASN C CB  1 
ATOM   7307 C  CG  . ASN C 1 278 ? 55.381  -23.010 21.962  1.00 29.67 ? 758  ASN C CG  1 
ATOM   7308 O  OD1 . ASN C 1 278 ? 54.408  -22.348 21.611  1.00 29.92 ? 758  ASN C OD1 1 
ATOM   7309 N  ND2 . ASN C 1 278 ? 56.624  -22.699 21.609  1.00 30.29 ? 758  ASN C ND2 1 
ATOM   7310 N  N   . VAL C 1 279 ? 52.567  -25.915 24.424  1.00 29.20 ? 759  VAL C N   1 
ATOM   7311 C  CA  . VAL C 1 279 ? 52.264  -27.272 24.857  1.00 29.21 ? 759  VAL C CA  1 
ATOM   7312 C  C   . VAL C 1 279 ? 52.519  -28.182 23.659  1.00 29.12 ? 759  VAL C C   1 
ATOM   7313 O  O   . VAL C 1 279 ? 51.610  -28.509 22.897  1.00 28.81 ? 759  VAL C O   1 
ATOM   7314 C  CB  . VAL C 1 279 ? 50.822  -27.416 25.394  1.00 29.17 ? 759  VAL C CB  1 
ATOM   7315 C  CG1 . VAL C 1 279 ? 50.554  -28.856 25.814  1.00 29.20 ? 759  VAL C CG1 1 
ATOM   7316 C  CG2 . VAL C 1 279 ? 50.598  -26.469 26.568  1.00 28.93 ? 759  VAL C CG2 1 
ATOM   7317 N  N   . ALA C 1 280 ? 53.784  -28.556 23.496  1.00 29.19 ? 760  ALA C N   1 
ATOM   7318 C  CA  . ALA C 1 280 ? 54.225  -29.370 22.370  1.00 29.45 ? 760  ALA C CA  1 
ATOM   7319 C  C   . ALA C 1 280 ? 54.037  -30.843 22.693  1.00 29.64 ? 760  ALA C C   1 
ATOM   7320 O  O   . ALA C 1 280 ? 54.766  -31.393 23.514  1.00 29.54 ? 760  ALA C O   1 
ATOM   7321 C  CB  . ALA C 1 280 ? 55.685  -29.085 22.058  1.00 29.45 ? 760  ALA C CB  1 
ATOM   7322 N  N   . TRP C 1 281 ? 53.053  -31.471 22.053  1.00 30.03 ? 761  TRP C N   1 
ATOM   7323 C  CA  . TRP C 1 281 ? 52.793  -32.898 22.240  1.00 30.28 ? 761  TRP C CA  1 
ATOM   7324 C  C   . TRP C 1 281 ? 53.859  -33.719 21.523  1.00 30.38 ? 761  TRP C C   1 
ATOM   7325 O  O   . TRP C 1 281 ? 54.058  -33.558 20.320  1.00 30.62 ? 761  TRP C O   1 
ATOM   7326 C  CB  . TRP C 1 281 ? 51.421  -33.287 21.680  1.00 30.31 ? 761  TRP C CB  1 
ATOM   7327 C  CG  . TRP C 1 281 ? 50.249  -32.599 22.315  1.00 30.41 ? 761  TRP C CG  1 
ATOM   7328 C  CD1 . TRP C 1 281 ? 49.329  -31.808 21.689  1.00 30.55 ? 761  TRP C CD1 1 
ATOM   7329 C  CD2 . TRP C 1 281 ? 49.859  -32.652 23.693  1.00 30.73 ? 761  TRP C CD2 1 
ATOM   7330 N  NE1 . TRP C 1 281 ? 48.392  -31.362 22.590  1.00 30.73 ? 761  TRP C NE1 1 
ATOM   7331 C  CE2 . TRP C 1 281 ? 48.693  -31.864 23.828  1.00 30.64 ? 761  TRP C CE2 1 
ATOM   7332 C  CE3 . TRP C 1 281 ? 50.382  -33.287 24.828  1.00 30.83 ? 761  TRP C CE3 1 
ATOM   7333 C  CZ2 . TRP C 1 281 ? 48.043  -31.692 25.051  1.00 30.87 ? 761  TRP C CZ2 1 
ATOM   7334 C  CZ3 . TRP C 1 281 ? 49.734  -33.115 26.046  1.00 30.76 ? 761  TRP C CZ3 1 
ATOM   7335 C  CH2 . TRP C 1 281 ? 48.576  -32.325 26.146  1.00 31.04 ? 761  TRP C CH2 1 
ATOM   7336 N  N   . ALA C 1 282 ? 54.539  -34.592 22.260  1.00 30.56 ? 762  ALA C N   1 
ATOM   7337 C  CA  . ALA C 1 282 ? 55.531  -35.499 21.680  1.00 30.75 ? 762  ALA C CA  1 
ATOM   7338 C  C   . ALA C 1 282 ? 55.107  -36.949 21.888  1.00 30.89 ? 762  ALA C C   1 
ATOM   7339 O  O   . ALA C 1 282 ? 54.268  -37.239 22.738  1.00 30.77 ? 762  ALA C O   1 
ATOM   7340 C  CB  . ALA C 1 282 ? 56.891  -35.254 22.300  1.00 30.67 ? 762  ALA C CB  1 
ATOM   7341 N  N   . GLY C 1 283 ? 55.691  -37.850 21.105  1.00 31.26 ? 763  GLY C N   1 
ATOM   7342 C  CA  . GLY C 1 283 ? 55.431  -39.286 21.237  1.00 31.53 ? 763  GLY C CA  1 
ATOM   7343 C  C   . GLY C 1 283 ? 54.826  -39.914 19.998  1.00 31.75 ? 763  GLY C C   1 
ATOM   7344 O  O   . GLY C 1 283 ? 55.094  -41.073 19.693  1.00 31.80 ? 763  GLY C O   1 
ATOM   7345 N  N   . GLY C 1 284 ? 54.004  -39.152 19.284  1.00 32.12 ? 764  GLY C N   1 
ATOM   7346 C  CA  . GLY C 1 284 ? 53.348  -39.645 18.079  1.00 32.41 ? 764  GLY C CA  1 
ATOM   7347 C  C   . GLY C 1 284 ? 51.901  -40.005 18.337  1.00 32.74 ? 764  GLY C C   1 
ATOM   7348 O  O   . GLY C 1 284 ? 51.370  -39.760 19.425  1.00 32.82 ? 764  GLY C O   1 
ATOM   7349 N  N   . LEU C 1 285 ? 51.267  -40.603 17.334  1.00 33.08 ? 765  LEU C N   1 
ATOM   7350 C  CA  . LEU C 1 285 ? 49.820  -40.836 17.355  1.00 33.30 ? 765  LEU C CA  1 
ATOM   7351 C  C   . LEU C 1 285 ? 49.380  -41.993 18.257  1.00 33.53 ? 765  LEU C C   1 
ATOM   7352 O  O   . LEU C 1 285 ? 48.209  -42.070 18.628  1.00 33.62 ? 765  LEU C O   1 
ATOM   7353 C  CB  . LEU C 1 285 ? 49.300  -41.049 15.925  1.00 33.31 ? 765  LEU C CB  1 
ATOM   7354 C  CG  . LEU C 1 285 ? 48.916  -39.787 15.134  1.00 33.33 ? 765  LEU C CG  1 
ATOM   7355 C  CD1 . LEU C 1 285 ? 49.678  -38.549 15.589  1.00 33.13 ? 765  LEU C CD1 1 
ATOM   7356 C  CD2 . LEU C 1 285 ? 49.110  -40.019 13.643  1.00 33.04 ? 765  LEU C CD2 1 
ATOM   7357 N  N   . ASP C 1 286 ? 50.316  -42.872 18.614  1.00 33.73 ? 766  ASP C N   1 
ATOM   7358 C  CA  . ASP C 1 286 ? 50.020  -44.071 19.395  1.00 33.83 ? 766  ASP C CA  1 
ATOM   7359 C  C   . ASP C 1 286 ? 50.759  -44.012 20.741  1.00 33.95 ? 766  ASP C C   1 
ATOM   7360 O  O   . ASP C 1 286 ? 51.987  -43.909 20.758  1.00 33.97 ? 766  ASP C O   1 
ATOM   7361 C  CB  . ASP C 1 286 ? 50.462  -45.302 18.593  1.00 33.84 ? 766  ASP C CB  1 
ATOM   7362 C  CG  . ASP C 1 286 ? 50.011  -46.613 19.211  1.00 33.69 ? 766  ASP C CG  1 
ATOM   7363 O  OD1 . ASP C 1 286 ? 49.057  -46.613 20.016  1.00 33.41 ? 766  ASP C OD1 1 
ATOM   7364 O  OD2 . ASP C 1 286 ? 50.613  -47.655 18.874  1.00 33.79 ? 766  ASP C OD2 1 
ATOM   7365 N  N   . PRO C 1 287 ? 50.027  -44.077 21.876  1.00 34.05 ? 767  PRO C N   1 
ATOM   7366 C  CA  . PRO C 1 287 ? 48.574  -44.185 22.062  1.00 34.07 ? 767  PRO C CA  1 
ATOM   7367 C  C   . PRO C 1 287 ? 47.820  -42.932 21.623  1.00 34.08 ? 767  PRO C C   1 
ATOM   7368 O  O   . PRO C 1 287 ? 48.450  -41.905 21.367  1.00 34.10 ? 767  PRO C O   1 
ATOM   7369 C  CB  . PRO C 1 287 ? 48.431  -44.396 23.575  1.00 34.09 ? 767  PRO C CB  1 
ATOM   7370 C  CG  . PRO C 1 287 ? 49.648  -43.801 24.151  1.00 34.08 ? 767  PRO C CG  1 
ATOM   7371 C  CD  . PRO C 1 287 ? 50.727  -44.117 23.172  1.00 34.11 ? 767  PRO C CD  1 
ATOM   7372 N  N   . PRO C 1 288 ? 46.476  -43.014 21.538  1.00 34.08 ? 768  PRO C N   1 
ATOM   7373 C  CA  . PRO C 1 288 ? 45.676  -41.925 20.970  1.00 34.08 ? 768  PRO C CA  1 
ATOM   7374 C  C   . PRO C 1 288 ? 45.725  -40.624 21.768  1.00 34.03 ? 768  PRO C C   1 
ATOM   7375 O  O   . PRO C 1 288 ? 45.766  -40.652 23.000  1.00 34.04 ? 768  PRO C O   1 
ATOM   7376 C  CB  . PRO C 1 288 ? 44.244  -42.488 20.978  1.00 34.11 ? 768  PRO C CB  1 
ATOM   7377 C  CG  . PRO C 1 288 ? 44.390  -43.953 21.149  1.00 34.10 ? 768  PRO C CG  1 
ATOM   7378 C  CD  . PRO C 1 288 ? 45.628  -44.145 21.953  1.00 34.13 ? 768  PRO C CD  1 
ATOM   7379 N  N   . MET C 1 289 ? 45.718  -39.502 21.048  1.00 33.98 ? 769  MET C N   1 
ATOM   7380 C  CA  . MET C 1 289 ? 45.612  -38.168 21.643  1.00 33.89 ? 769  MET C CA  1 
ATOM   7381 C  C   . MET C 1 289 ? 44.174  -37.679 21.506  1.00 33.52 ? 769  MET C C   1 
ATOM   7382 O  O   . MET C 1 289 ? 43.658  -37.575 20.395  1.00 33.59 ? 769  MET C O   1 
ATOM   7383 C  CB  . MET C 1 289 ? 46.552  -37.191 20.934  1.00 33.95 ? 769  MET C CB  1 
ATOM   7384 C  CG  . MET C 1 289 ? 48.028  -37.433 21.208  1.00 34.36 ? 769  MET C CG  1 
ATOM   7385 S  SD  . MET C 1 289 ? 48.520  -37.059 22.904  1.00 35.49 ? 769  MET C SD  1 
ATOM   7386 C  CE  . MET C 1 289 ? 47.987  -35.353 23.054  1.00 34.68 ? 769  MET C CE  1 
ATOM   7387 N  N   . GLY C 1 290 ? 43.539  -37.374 22.635  1.00 33.14 ? 770  GLY C N   1 
ATOM   7388 C  CA  . GLY C 1 290 ? 42.125  -37.005 22.649  1.00 32.85 ? 770  GLY C CA  1 
ATOM   7389 C  C   . GLY C 1 290 ? 41.760  -36.038 23.759  1.00 32.53 ? 770  GLY C C   1 
ATOM   7390 O  O   . GLY C 1 290 ? 42.533  -35.144 24.099  1.00 32.36 ? 770  GLY C O   1 
ATOM   7391 N  N   . ASP C 1 291 ? 40.571  -36.224 24.322  1.00 32.25 ? 771  ASP C N   1 
ATOM   7392 C  CA  . ASP C 1 291 ? 40.021  -35.297 25.311  1.00 32.01 ? 771  ASP C CA  1 
ATOM   7393 C  C   . ASP C 1 291 ? 40.754  -35.317 26.657  1.00 31.84 ? 771  ASP C C   1 
ATOM   7394 O  O   . ASP C 1 291 ? 41.033  -34.251 27.214  1.00 31.77 ? 771  ASP C O   1 
ATOM   7395 C  CB  . ASP C 1 291 ? 38.528  -35.567 25.520  1.00 31.93 ? 771  ASP C CB  1 
ATOM   7396 C  CG  . ASP C 1 291 ? 37.729  -35.462 24.231  1.00 32.01 ? 771  ASP C CG  1 
ATOM   7397 O  OD1 . ASP C 1 291 ? 38.225  -34.850 23.263  1.00 31.70 ? 771  ASP C OD1 1 
ATOM   7398 O  OD2 . ASP C 1 291 ? 36.601  -35.994 24.184  1.00 32.48 ? 771  ASP C OD2 1 
ATOM   7399 N  N   . PRO C 1 292 ? 41.076  -36.518 27.184  1.00 31.67 ? 772  PRO C N   1 
ATOM   7400 C  CA  . PRO C 1 292 ? 41.784  -36.563 28.467  1.00 31.63 ? 772  PRO C CA  1 
ATOM   7401 C  C   . PRO C 1 292 ? 43.066  -35.730 28.456  1.00 31.61 ? 772  PRO C C   1 
ATOM   7402 O  O   . PRO C 1 292 ? 43.400  -35.088 29.456  1.00 31.39 ? 772  PRO C O   1 
ATOM   7403 C  CB  . PRO C 1 292 ? 42.119  -38.050 28.637  1.00 31.64 ? 772  PRO C CB  1 
ATOM   7404 C  CG  . PRO C 1 292 ? 41.126  -38.766 27.805  1.00 31.56 ? 772  PRO C CG  1 
ATOM   7405 C  CD  . PRO C 1 292 ? 40.868  -37.871 26.634  1.00 31.67 ? 772  PRO C CD  1 
ATOM   7406 N  N   . GLU C 1 293 ? 43.753  -35.731 27.315  1.00 31.50 ? 773  GLU C N   1 
ATOM   7407 C  CA  . GLU C 1 293 ? 45.020  -35.026 27.170  1.00 31.59 ? 773  GLU C CA  1 
ATOM   7408 C  C   . GLU C 1 293 ? 44.801  -33.517 27.090  1.00 31.58 ? 773  GLU C C   1 
ATOM   7409 O  O   . GLU C 1 293 ? 45.487  -32.752 27.771  1.00 31.50 ? 773  GLU C O   1 
ATOM   7410 C  CB  . GLU C 1 293 ? 45.782  -35.532 25.939  1.00 31.56 ? 773  GLU C CB  1 
ATOM   7411 C  CG  . GLU C 1 293 ? 46.267  -36.988 26.064  1.00 31.57 ? 773  GLU C CG  1 
ATOM   7412 C  CD  . GLU C 1 293 ? 45.158  -38.031 25.939  1.00 31.10 ? 773  GLU C CD  1 
ATOM   7413 O  OE1 . GLU C 1 293 ? 44.071  -37.714 25.414  1.00 30.37 ? 773  GLU C OE1 1 
ATOM   7414 O  OE2 . GLU C 1 293 ? 45.382  -39.178 26.371  1.00 31.35 ? 773  GLU C OE2 1 
ATOM   7415 N  N   . TYR C 1 294 ? 43.837  -33.095 26.275  1.00 31.64 ? 774  TYR C N   1 
ATOM   7416 C  CA  . TYR C 1 294 ? 43.521  -31.669 26.137  1.00 31.81 ? 774  TYR C CA  1 
ATOM   7417 C  C   . TYR C 1 294 ? 42.874  -31.098 27.403  1.00 31.73 ? 774  TYR C C   1 
ATOM   7418 O  O   . TYR C 1 294 ? 43.193  -29.982 27.817  1.00 31.66 ? 774  TYR C O   1 
ATOM   7419 C  CB  . TYR C 1 294 ? 42.657  -31.411 24.891  1.00 31.86 ? 774  TYR C CB  1 
ATOM   7420 C  CG  . TYR C 1 294 ? 43.490  -31.242 23.633  1.00 32.33 ? 774  TYR C CG  1 
ATOM   7421 C  CD1 . TYR C 1 294 ? 44.230  -32.306 23.115  1.00 32.64 ? 774  TYR C CD1 1 
ATOM   7422 C  CD2 . TYR C 1 294 ? 43.562  -30.014 22.978  1.00 32.71 ? 774  TYR C CD2 1 
ATOM   7423 C  CE1 . TYR C 1 294 ? 45.011  -32.153 21.970  1.00 32.84 ? 774  TYR C CE1 1 
ATOM   7424 C  CE2 . TYR C 1 294 ? 44.337  -29.851 21.833  1.00 32.73 ? 774  TYR C CE2 1 
ATOM   7425 C  CZ  . TYR C 1 294 ? 45.061  -30.923 21.335  1.00 33.14 ? 774  TYR C CZ  1 
ATOM   7426 O  OH  . TYR C 1 294 ? 45.833  -30.764 20.202  1.00 33.55 ? 774  TYR C OH  1 
ATOM   7427 N  N   . LEU C 1 295 ? 41.981  -31.865 28.024  1.00 31.76 ? 775  LEU C N   1 
ATOM   7428 C  CA  . LEU C 1 295 ? 41.399  -31.465 29.309  1.00 31.62 ? 775  LEU C CA  1 
ATOM   7429 C  C   . LEU C 1 295 ? 42.497  -31.291 30.360  1.00 31.43 ? 775  LEU C C   1 
ATOM   7430 O  O   . LEU C 1 295 ? 42.560  -30.265 31.038  1.00 31.25 ? 775  LEU C O   1 
ATOM   7431 C  CB  . LEU C 1 295 ? 40.369  -32.493 29.788  1.00 31.65 ? 775  LEU C CB  1 
ATOM   7432 C  CG  . LEU C 1 295 ? 39.026  -32.518 29.052  1.00 31.66 ? 775  LEU C CG  1 
ATOM   7433 C  CD1 . LEU C 1 295 ? 38.252  -33.785 29.397  1.00 31.65 ? 775  LEU C CD1 1 
ATOM   7434 C  CD2 . LEU C 1 295 ? 38.199  -31.282 29.383  1.00 31.45 ? 775  LEU C CD2 1 
ATOM   7435 N  N   . ALA C 1 296 ? 43.359  -32.301 30.477  1.00 31.37 ? 776  ALA C N   1 
ATOM   7436 C  CA  . ALA C 1 296 ? 44.520  -32.251 31.373  1.00 31.25 ? 776  ALA C CA  1 
ATOM   7437 C  C   . ALA C 1 296 ? 45.353  -30.996 31.142  1.00 31.26 ? 776  ALA C C   1 
ATOM   7438 O  O   . ALA C 1 296 ? 45.723  -30.303 32.093  1.00 31.27 ? 776  ALA C O   1 
ATOM   7439 C  CB  . ALA C 1 296 ? 45.383  -33.487 31.187  1.00 31.15 ? 776  ALA C CB  1 
ATOM   7440 N  N   . ALA C 1 297 ? 45.637  -30.717 29.871  1.00 31.30 ? 777  ALA C N   1 
ATOM   7441 C  CA  . ALA C 1 297 ? 46.382  -29.525 29.463  1.00 31.29 ? 777  ALA C CA  1 
ATOM   7442 C  C   . ALA C 1 297 ? 45.707  -28.231 29.931  1.00 31.33 ? 777  ALA C C   1 
ATOM   7443 O  O   . ALA C 1 297 ? 46.379  -27.291 30.366  1.00 31.28 ? 777  ALA C O   1 
ATOM   7444 C  CB  . ALA C 1 297 ? 46.555  -29.512 27.948  1.00 31.19 ? 777  ALA C CB  1 
ATOM   7445 N  N   . PHE C 1 298 ? 44.381  -28.188 29.839  1.00 31.45 ? 778  PHE C N   1 
ATOM   7446 C  CA  . PHE C 1 298 ? 43.622  -27.022 30.297  1.00 31.63 ? 778  PHE C CA  1 
ATOM   7447 C  C   . PHE C 1 298 ? 43.622  -26.882 31.825  1.00 31.77 ? 778  PHE C C   1 
ATOM   7448 O  O   . PHE C 1 298 ? 43.754  -25.773 32.345  1.00 31.83 ? 778  PHE C O   1 
ATOM   7449 C  CB  . PHE C 1 298 ? 42.191  -27.040 29.741  1.00 31.61 ? 778  PHE C CB  1 
ATOM   7450 C  CG  . PHE C 1 298 ? 42.015  -26.187 28.514  1.00 31.50 ? 778  PHE C CG  1 
ATOM   7451 C  CD1 . PHE C 1 298 ? 42.768  -26.428 27.373  1.00 31.15 ? 778  PHE C CD1 1 
ATOM   7452 C  CD2 . PHE C 1 298 ? 41.101  -25.135 28.503  1.00 31.36 ? 778  PHE C CD2 1 
ATOM   7453 C  CE1 . PHE C 1 298 ? 42.613  -25.636 26.239  1.00 31.04 ? 778  PHE C CE1 1 
ATOM   7454 C  CE2 . PHE C 1 298 ? 40.942  -24.340 27.374  1.00 30.78 ? 778  PHE C CE2 1 
ATOM   7455 C  CZ  . PHE C 1 298 ? 41.698  -24.590 26.243  1.00 30.78 ? 778  PHE C CZ  1 
ATOM   7456 N  N   . ARG C 1 299 ? 43.491  -27.997 32.538  1.00 31.94 ? 779  ARG C N   1 
ATOM   7457 C  CA  . ARG C 1 299 ? 43.550  -27.973 33.999  1.00 32.24 ? 779  ARG C CA  1 
ATOM   7458 C  C   . ARG C 1 299 ? 44.915  -27.529 34.514  1.00 32.59 ? 779  ARG C C   1 
ATOM   7459 O  O   . ARG C 1 299 ? 45.017  -26.595 35.315  1.00 32.89 ? 779  ARG C O   1 
ATOM   7460 C  CB  . ARG C 1 299 ? 43.245  -29.350 34.585  1.00 32.25 ? 779  ARG C CB  1 
ATOM   7461 C  CG  . ARG C 1 299 ? 41.775  -29.681 34.687  1.00 32.16 ? 779  ARG C CG  1 
ATOM   7462 C  CD  . ARG C 1 299 ? 41.539  -30.832 35.658  1.00 32.16 ? 779  ARG C CD  1 
ATOM   7463 N  NE  . ARG C 1 299 ? 42.557  -31.876 35.549  1.00 32.22 ? 779  ARG C NE  1 
ATOM   7464 C  CZ  . ARG C 1 299 ? 42.657  -32.746 34.542  1.00 32.32 ? 779  ARG C CZ  1 
ATOM   7465 N  NH1 . ARG C 1 299 ? 41.808  -32.715 33.518  1.00 31.98 ? 779  ARG C NH1 1 
ATOM   7466 N  NH2 . ARG C 1 299 ? 43.630  -33.653 34.550  1.00 32.36 ? 779  ARG C NH2 1 
ATOM   7467 N  N   . ILE C 1 300 ? 45.958  -28.204 34.045  1.00 32.70 ? 780  ILE C N   1 
ATOM   7468 C  CA  . ILE C 1 300 ? 47.288  -28.073 34.628  1.00 32.72 ? 780  ILE C CA  1 
ATOM   7469 C  C   . ILE C 1 300 ? 48.046  -26.844 34.122  1.00 32.76 ? 780  ILE C C   1 
ATOM   7470 O  O   . ILE C 1 300 ? 48.707  -26.161 34.908  1.00 32.81 ? 780  ILE C O   1 
ATOM   7471 C  CB  . ILE C 1 300 ? 48.126  -29.355 34.378  1.00 32.76 ? 780  ILE C CB  1 
ATOM   7472 C  CG1 . ILE C 1 300 ? 47.403  -30.578 34.954  1.00 32.85 ? 780  ILE C CG1 1 
ATOM   7473 C  CG2 . ILE C 1 300 ? 49.505  -29.230 35.011  1.00 32.76 ? 780  ILE C CG2 1 
ATOM   7474 C  CD1 . ILE C 1 300 ? 48.014  -31.900 34.564  1.00 32.96 ? 780  ILE C CD1 1 
ATOM   7475 N  N   . VAL C 1 301 ? 47.945  -26.556 32.825  1.00 32.82 ? 781  VAL C N   1 
ATOM   7476 C  CA  . VAL C 1 301 ? 48.760  -25.504 32.206  1.00 32.83 ? 781  VAL C CA  1 
ATOM   7477 C  C   . VAL C 1 301 ? 47.970  -24.264 31.790  1.00 32.79 ? 781  VAL C C   1 
ATOM   7478 O  O   . VAL C 1 301 ? 48.205  -23.180 32.321  1.00 32.89 ? 781  VAL C O   1 
ATOM   7479 C  CB  . VAL C 1 301 ? 49.526  -26.034 30.971  1.00 32.84 ? 781  VAL C CB  1 
ATOM   7480 C  CG1 . VAL C 1 301 ? 50.383  -24.929 30.354  1.00 32.71 ? 781  VAL C CG1 1 
ATOM   7481 C  CG2 . VAL C 1 301 ? 50.389  -27.220 31.358  1.00 32.83 ? 781  VAL C CG2 1 
ATOM   7482 N  N   . VAL C 1 302 ? 47.043  -24.421 30.849  1.00 32.80 ? 782  VAL C N   1 
ATOM   7483 C  CA  . VAL C 1 302 ? 46.462  -23.263 30.147  1.00 32.75 ? 782  VAL C CA  1 
ATOM   7484 C  C   . VAL C 1 302 ? 45.704  -22.304 31.066  1.00 32.65 ? 782  VAL C C   1 
ATOM   7485 O  O   . VAL C 1 302 ? 45.979  -21.108 31.073  1.00 32.55 ? 782  VAL C O   1 
ATOM   7486 C  CB  . VAL C 1 302 ? 45.526  -23.687 28.988  1.00 32.80 ? 782  VAL C CB  1 
ATOM   7487 C  CG1 . VAL C 1 302 ? 44.969  -22.459 28.274  1.00 32.75 ? 782  VAL C CG1 1 
ATOM   7488 C  CG2 . VAL C 1 302 ? 46.262  -24.580 27.996  1.00 32.75 ? 782  VAL C CG2 1 
ATOM   7489 N  N   . MET C 1 303 ? 44.760  -22.829 31.837  1.00 32.71 ? 783  MET C N   1 
ATOM   7490 C  CA  . MET C 1 303 ? 43.883  -21.984 32.657  1.00 32.69 ? 783  MET C CA  1 
ATOM   7491 C  C   . MET C 1 303 ? 44.580  -21.365 33.873  1.00 32.56 ? 783  MET C C   1 
ATOM   7492 O  O   . MET C 1 303 ? 44.325  -20.206 34.201  1.00 32.59 ? 783  MET C O   1 
ATOM   7493 C  CB  . MET C 1 303 ? 42.632  -22.758 33.087  1.00 32.64 ? 783  MET C CB  1 
ATOM   7494 C  CG  . MET C 1 303 ? 41.753  -23.183 31.921  1.00 32.90 ? 783  MET C CG  1 
ATOM   7495 S  SD  . MET C 1 303 ? 41.092  -21.788 30.981  1.00 33.76 ? 783  MET C SD  1 
ATOM   7496 C  CE  . MET C 1 303 ? 40.044  -21.012 32.210  1.00 32.82 ? 783  MET C CE  1 
ATOM   7497 N  N   . PRO C 1 304 ? 45.447  -22.129 34.555  1.00 32.45 ? 784  PRO C N   1 
ATOM   7498 C  CA  . PRO C 1 304 ? 46.215  -21.504 35.633  1.00 32.50 ? 784  PRO C CA  1 
ATOM   7499 C  C   . PRO C 1 304 ? 47.097  -20.345 35.157  1.00 32.50 ? 784  PRO C C   1 
ATOM   7500 O  O   . PRO C 1 304 ? 47.070  -19.268 35.759  1.00 32.44 ? 784  PRO C O   1 
ATOM   7501 C  CB  . PRO C 1 304 ? 47.066  -22.659 36.161  1.00 32.55 ? 784  PRO C CB  1 
ATOM   7502 C  CG  . PRO C 1 304 ? 46.240  -23.866 35.887  1.00 32.40 ? 784  PRO C CG  1 
ATOM   7503 C  CD  . PRO C 1 304 ? 45.585  -23.597 34.569  1.00 32.43 ? 784  PRO C CD  1 
ATOM   7504 N  N   . ILE C 1 305 ? 47.855  -20.563 34.083  1.00 32.43 ? 785  ILE C N   1 
ATOM   7505 C  CA  . ILE C 1 305 ? 48.694  -19.510 33.508  1.00 32.39 ? 785  ILE C CA  1 
ATOM   7506 C  C   . ILE C 1 305 ? 47.832  -18.358 32.994  1.00 32.37 ? 785  ILE C C   1 
ATOM   7507 O  O   . ILE C 1 305 ? 48.170  -17.191 33.195  1.00 32.43 ? 785  ILE C O   1 
ATOM   7508 C  CB  . ILE C 1 305 ? 49.605  -20.046 32.373  1.00 32.34 ? 785  ILE C CB  1 
ATOM   7509 C  CG1 . ILE C 1 305 ? 50.672  -20.975 32.956  1.00 32.72 ? 785  ILE C CG1 1 
ATOM   7510 C  CG2 . ILE C 1 305 ? 50.272  -18.896 31.626  1.00 32.10 ? 785  ILE C CG2 1 
ATOM   7511 C  CD1 . ILE C 1 305 ? 51.716  -21.446 31.948  1.00 33.15 ? 785  ILE C CD1 1 
ATOM   7512 N  N   . ALA C 1 306 ? 46.719  -18.696 32.346  1.00 32.29 ? 786  ALA C N   1 
ATOM   7513 C  CA  . ALA C 1 306 ? 45.770  -17.703 31.855  1.00 32.27 ? 786  ALA C CA  1 
ATOM   7514 C  C   . ALA C 1 306 ? 45.232  -16.844 32.995  1.00 32.38 ? 786  ALA C C   1 
ATOM   7515 O  O   . ALA C 1 306 ? 45.242  -15.620 32.906  1.00 32.40 ? 786  ALA C O   1 
ATOM   7516 C  CB  . ALA C 1 306 ? 44.624  -18.386 31.128  1.00 32.24 ? 786  ALA C CB  1 
ATOM   7517 N  N   . ARG C 1 307 ? 44.770  -17.490 34.064  1.00 32.56 ? 787  ARG C N   1 
ATOM   7518 C  CA  . ARG C 1 307 ? 44.248  -16.781 35.239  1.00 32.66 ? 787  ARG C CA  1 
ATOM   7519 C  C   . ARG C 1 307 ? 45.321  -15.960 35.955  1.00 32.62 ? 787  ARG C C   1 
ATOM   7520 O  O   . ARG C 1 307 ? 45.035  -14.869 36.449  1.00 32.66 ? 787  ARG C O   1 
ATOM   7521 C  CB  . ARG C 1 307 ? 43.594  -17.757 36.225  1.00 32.73 ? 787  ARG C CB  1 
ATOM   7522 C  CG  . ARG C 1 307 ? 42.241  -18.265 35.765  1.00 33.58 ? 787  ARG C CG  1 
ATOM   7523 C  CD  . ARG C 1 307 ? 41.655  -19.298 36.720  1.00 34.39 ? 787  ARG C CD  1 
ATOM   7524 N  NE  . ARG C 1 307 ? 40.507  -19.985 36.121  1.00 35.31 ? 787  ARG C NE  1 
ATOM   7525 C  CZ  . ARG C 1 307 ? 39.274  -19.481 36.017  1.00 35.83 ? 787  ARG C CZ  1 
ATOM   7526 N  NH1 . ARG C 1 307 ? 38.984  -18.264 36.474  1.00 36.06 ? 787  ARG C NH1 1 
ATOM   7527 N  NH2 . ARG C 1 307 ? 38.313  -20.205 35.449  1.00 35.90 ? 787  ARG C NH2 1 
ATOM   7528 N  N   . GLU C 1 308 ? 46.545  -16.483 36.020  1.00 32.60 ? 788  GLU C N   1 
ATOM   7529 C  CA  . GLU C 1 308 ? 47.657  -15.751 36.638  1.00 32.63 ? 788  GLU C CA  1 
ATOM   7530 C  C   . GLU C 1 308 ? 47.996  -14.512 35.802  1.00 32.73 ? 788  GLU C C   1 
ATOM   7531 O  O   . GLU C 1 308 ? 48.191  -13.420 36.338  1.00 32.65 ? 788  GLU C O   1 
ATOM   7532 C  CB  . GLU C 1 308 ? 48.887  -16.655 36.802  1.00 32.52 ? 788  GLU C CB  1 
ATOM   7533 C  CG  . GLU C 1 308 ? 49.951  -16.107 37.754  1.00 32.30 ? 788  GLU C CG  1 
ATOM   7534 C  CD  . GLU C 1 308 ? 51.062  -17.115 38.071  1.00 32.07 ? 788  GLU C CD  1 
ATOM   7535 O  OE1 . GLU C 1 308 ? 50.787  -18.335 38.102  1.00 32.19 ? 788  GLU C OE1 1 
ATOM   7536 O  OE2 . GLU C 1 308 ? 52.212  -16.682 38.299  1.00 30.76 ? 788  GLU C OE2 1 
ATOM   7537 N  N   . PHE C 1 309 ? 48.052  -14.699 34.486  1.00 32.88 ? 789  PHE C N   1 
ATOM   7538 C  CA  . PHE C 1 309 ? 48.235  -13.604 33.533  1.00 33.04 ? 789  PHE C CA  1 
ATOM   7539 C  C   . PHE C 1 309 ? 47.066  -12.617 33.614  1.00 33.14 ? 789  PHE C C   1 
ATOM   7540 O  O   . PHE C 1 309 ? 47.275  -11.407 33.658  1.00 33.05 ? 789  PHE C O   1 
ATOM   7541 C  CB  . PHE C 1 309 ? 48.356  -14.177 32.116  1.00 33.04 ? 789  PHE C CB  1 
ATOM   7542 C  CG  . PHE C 1 309 ? 48.477  -13.138 31.038  1.00 33.17 ? 789  PHE C CG  1 
ATOM   7543 C  CD1 . PHE C 1 309 ? 49.669  -12.453 30.851  1.00 33.22 ? 789  PHE C CD1 1 
ATOM   7544 C  CD2 . PHE C 1 309 ? 47.406  -12.866 30.188  1.00 33.36 ? 789  PHE C CD2 1 
ATOM   7545 C  CE1 . PHE C 1 309 ? 49.791  -11.499 29.847  1.00 33.58 ? 789  PHE C CE1 1 
ATOM   7546 C  CE2 . PHE C 1 309 ? 47.519  -11.914 29.179  1.00 33.20 ? 789  PHE C CE2 1 
ATOM   7547 C  CZ  . PHE C 1 309 ? 48.712  -11.231 29.007  1.00 33.45 ? 789  PHE C CZ  1 
ATOM   7548 N  N   . SER C 1 310 ? 45.844  -13.150 33.626  1.00 33.26 ? 790  SER C N   1 
ATOM   7549 C  CA  . SER C 1 310 ? 44.628  -12.353 33.821  1.00 33.38 ? 790  SER C CA  1 
ATOM   7550 C  C   . SER C 1 310 ? 44.393  -11.374 32.656  1.00 33.50 ? 790  SER C C   1 
ATOM   7551 O  O   . SER C 1 310 ? 44.544  -10.163 32.816  1.00 33.45 ? 790  SER C O   1 
ATOM   7552 C  CB  . SER C 1 310 ? 44.688  -11.620 35.174  1.00 33.35 ? 790  SER C CB  1 
ATOM   7553 O  OG  . SER C 1 310 ? 43.400  -11.246 35.627  1.00 33.14 ? 790  SER C OG  1 
ATOM   7554 N  N   . PRO C 1 311 ? 44.021  -11.901 31.476  1.00 33.75 ? 791  PRO C N   1 
ATOM   7555 C  CA  . PRO C 1 311 ? 43.854  -11.060 30.288  1.00 33.85 ? 791  PRO C CA  1 
ATOM   7556 C  C   . PRO C 1 311 ? 42.601  -10.185 30.331  1.00 33.95 ? 791  PRO C C   1 
ATOM   7557 O  O   . PRO C 1 311 ? 41.696  -10.426 31.136  1.00 34.01 ? 791  PRO C O   1 
ATOM   7558 C  CB  . PRO C 1 311 ? 43.740  -12.083 29.153  1.00 33.77 ? 791  PRO C CB  1 
ATOM   7559 C  CG  . PRO C 1 311 ? 43.139  -13.270 29.790  1.00 33.83 ? 791  PRO C CG  1 
ATOM   7560 C  CD  . PRO C 1 311 ? 43.709  -13.313 31.187  1.00 33.82 ? 791  PRO C CD  1 
ATOM   7561 N  N   . ASP C 1 312 ? 42.569  -9.174  29.466  1.00 34.01 ? 792  ASP C N   1 
ATOM   7562 C  CA  . ASP C 1 312 ? 41.394  -8.322  29.288  1.00 34.01 ? 792  ASP C CA  1 
ATOM   7563 C  C   . ASP C 1 312 ? 40.492  -8.916  28.212  1.00 33.87 ? 792  ASP C C   1 
ATOM   7564 O  O   . ASP C 1 312 ? 39.266  -8.840  28.307  1.00 33.95 ? 792  ASP C O   1 
ATOM   7565 C  CB  . ASP C 1 312 ? 41.805  -6.907  28.878  1.00 34.13 ? 792  ASP C CB  1 
ATOM   7566 C  CG  . ASP C 1 312 ? 42.813  -6.290  29.829  1.00 34.71 ? 792  ASP C CG  1 
ATOM   7567 O  OD1 . ASP C 1 312 ? 42.634  -6.420  31.060  1.00 35.41 ? 792  ASP C OD1 1 
ATOM   7568 O  OD2 . ASP C 1 312 ? 43.787  -5.673  29.343  1.00 35.67 ? 792  ASP C OD2 1 
ATOM   7569 N  N   . LEU C 1 313 ? 41.110  -9.494  27.184  1.00 33.60 ? 793  LEU C N   1 
ATOM   7570 C  CA  . LEU C 1 313 ? 40.380  -10.153 26.109  1.00 33.41 ? 793  LEU C CA  1 
ATOM   7571 C  C   . LEU C 1 313 ? 41.143  -11.381 25.614  1.00 33.15 ? 793  LEU C C   1 
ATOM   7572 O  O   . LEU C 1 313 ? 42.373  -11.415 25.655  1.00 33.01 ? 793  LEU C O   1 
ATOM   7573 C  CB  . LEU C 1 313 ? 40.133  -9.171  24.961  1.00 33.46 ? 793  LEU C CB  1 
ATOM   7574 C  CG  . LEU C 1 313 ? 39.289  -9.696  23.792  1.00 33.49 ? 793  LEU C CG  1 
ATOM   7575 C  CD1 . LEU C 1 313 ? 38.372  -8.609  23.246  1.00 33.37 ? 793  LEU C CD1 1 
ATOM   7576 C  CD2 . LEU C 1 313 ? 40.176  -10.266 22.687  1.00 33.30 ? 793  LEU C CD2 1 
ATOM   7577 N  N   . VAL C 1 314 ? 40.395  -12.383 25.151  1.00 32.89 ? 794  VAL C N   1 
ATOM   7578 C  CA  . VAL C 1 314 ? 40.962  -13.645 24.685  1.00 32.71 ? 794  VAL C CA  1 
ATOM   7579 C  C   . VAL C 1 314 ? 40.661  -13.870 23.203  1.00 32.59 ? 794  VAL C C   1 
ATOM   7580 O  O   . VAL C 1 314 ? 39.498  -13.964 22.810  1.00 32.66 ? 794  VAL C O   1 
ATOM   7581 C  CB  . VAL C 1 314 ? 40.389  -14.835 25.480  1.00 32.69 ? 794  VAL C CB  1 
ATOM   7582 C  CG1 . VAL C 1 314 ? 41.057  -16.128 25.050  1.00 32.79 ? 794  VAL C CG1 1 
ATOM   7583 C  CG2 . VAL C 1 314 ? 40.556  -14.614 26.980  1.00 32.66 ? 794  VAL C CG2 1 
ATOM   7584 N  N   . LEU C 1 315 ? 41.711  -13.943 22.388  1.00 32.43 ? 795  LEU C N   1 
ATOM   7585 C  CA  . LEU C 1 315 ? 41.589  -14.331 20.984  1.00 32.31 ? 795  LEU C CA  1 
ATOM   7586 C  C   . LEU C 1 315 ? 41.912  -15.812 20.868  1.00 32.33 ? 795  LEU C C   1 
ATOM   7587 O  O   . LEU C 1 315 ? 42.845  -16.289 21.508  1.00 32.56 ? 795  LEU C O   1 
ATOM   7588 C  CB  . LEU C 1 315 ? 42.559  -13.531 20.117  1.00 32.27 ? 795  LEU C CB  1 
ATOM   7589 C  CG  . LEU C 1 315 ? 42.218  -12.060 19.903  1.00 32.06 ? 795  LEU C CG  1 
ATOM   7590 C  CD1 . LEU C 1 315 ? 43.457  -11.266 19.512  1.00 31.42 ? 795  LEU C CD1 1 
ATOM   7591 C  CD2 . LEU C 1 315 ? 41.124  -11.917 18.852  1.00 32.06 ? 795  LEU C CD2 1 
ATOM   7592 N  N   . VAL C 1 316 ? 41.155  -16.541 20.057  1.00 32.29 ? 796  VAL C N   1 
ATOM   7593 C  CA  . VAL C 1 316 ? 41.396  -17.969 19.896  1.00 32.35 ? 796  VAL C CA  1 
ATOM   7594 C  C   . VAL C 1 316 ? 41.583  -18.355 18.439  1.00 32.53 ? 796  VAL C C   1 
ATOM   7595 O  O   . VAL C 1 316 ? 40.688  -18.156 17.617  1.00 32.41 ? 796  VAL C O   1 
ATOM   7596 C  CB  . VAL C 1 316 ? 40.252  -18.815 20.465  1.00 32.32 ? 796  VAL C CB  1 
ATOM   7597 C  CG1 . VAL C 1 316 ? 40.562  -20.301 20.297  1.00 32.18 ? 796  VAL C CG1 1 
ATOM   7598 C  CG2 . VAL C 1 316 ? 40.011  -18.476 21.927  1.00 32.39 ? 796  VAL C CG2 1 
ATOM   7599 N  N   . SER C 1 317 ? 42.754  -18.910 18.132  1.00 32.63 ? 797  SER C N   1 
ATOM   7600 C  CA  . SER C 1 317 ? 42.992  -19.544 16.843  1.00 32.76 ? 797  SER C CA  1 
ATOM   7601 C  C   . SER C 1 317 ? 42.361  -20.932 16.878  1.00 32.76 ? 797  SER C C   1 
ATOM   7602 O  O   . SER C 1 317 ? 43.019  -21.928 17.199  1.00 32.79 ? 797  SER C O   1 
ATOM   7603 C  CB  . SER C 1 317 ? 44.489  -19.612 16.536  1.00 32.82 ? 797  SER C CB  1 
ATOM   7604 O  OG  . SER C 1 317 ? 44.932  -18.381 15.995  1.00 33.16 ? 797  SER C OG  1 
ATOM   7605 N  N   . ALA C 1 318 ? 41.072  -20.973 16.553  1.00 32.82 ? 798  ALA C N   1 
ATOM   7606 C  CA  . ALA C 1 318 ? 40.263  -22.177 16.688  1.00 32.91 ? 798  ALA C CA  1 
ATOM   7607 C  C   . ALA C 1 318 ? 40.318  -23.032 15.431  1.00 32.94 ? 798  ALA C C   1 
ATOM   7608 O  O   . ALA C 1 318 ? 39.396  -23.015 14.613  1.00 33.02 ? 798  ALA C O   1 
ATOM   7609 C  CB  . ALA C 1 318 ? 38.815  -21.809 17.020  1.00 32.87 ? 798  ALA C CB  1 
ATOM   7610 N  N   . GLY C 1 319 ? 41.413  -23.767 15.282  1.00 32.98 ? 799  GLY C N   1 
ATOM   7611 C  CA  . GLY C 1 319 ? 41.520  -24.786 14.247  1.00 33.03 ? 799  GLY C CA  1 
ATOM   7612 C  C   . GLY C 1 319 ? 40.907  -26.063 14.776  1.00 33.06 ? 799  GLY C C   1 
ATOM   7613 O  O   . GLY C 1 319 ? 40.991  -26.338 15.968  1.00 33.25 ? 799  GLY C O   1 
ATOM   7614 N  N   . PHE C 1 320 ? 40.282  -26.843 13.901  1.00 33.06 ? 800  PHE C N   1 
ATOM   7615 C  CA  . PHE C 1 320 ? 39.655  -28.097 14.317  1.00 33.10 ? 800  PHE C CA  1 
ATOM   7616 C  C   . PHE C 1 320 ? 40.272  -29.315 13.624  1.00 33.15 ? 800  PHE C C   1 
ATOM   7617 O  O   . PHE C 1 320 ? 39.625  -30.346 13.470  1.00 33.07 ? 800  PHE C O   1 
ATOM   7618 C  CB  . PHE C 1 320 ? 38.143  -28.013 14.098  1.00 33.09 ? 800  PHE C CB  1 
ATOM   7619 C  CG  . PHE C 1 320 ? 37.503  -26.869 14.834  1.00 33.12 ? 800  PHE C CG  1 
ATOM   7620 C  CD1 . PHE C 1 320 ? 37.478  -26.856 16.224  1.00 33.15 ? 800  PHE C CD1 1 
ATOM   7621 C  CD2 . PHE C 1 320 ? 36.963  -25.790 14.147  1.00 33.16 ? 800  PHE C CD2 1 
ATOM   7622 C  CE1 . PHE C 1 320 ? 36.903  -25.799 16.917  1.00 33.15 ? 800  PHE C CE1 1 
ATOM   7623 C  CE2 . PHE C 1 320 ? 36.386  -24.728 14.833  1.00 33.18 ? 800  PHE C CE2 1 
ATOM   7624 C  CZ  . PHE C 1 320 ? 36.356  -24.733 16.220  1.00 33.28 ? 800  PHE C CZ  1 
ATOM   7625 N  N   . ASP C 1 321 ? 41.544  -29.194 13.247  1.00 33.27 ? 801  ASP C N   1 
ATOM   7626 C  CA  . ASP C 1 321 ? 42.285  -30.300 12.635  1.00 33.43 ? 801  ASP C CA  1 
ATOM   7627 C  C   . ASP C 1 321 ? 42.841  -31.281 13.675  1.00 33.74 ? 801  ASP C C   1 
ATOM   7628 O  O   . ASP C 1 321 ? 43.403  -32.315 13.314  1.00 33.77 ? 801  ASP C O   1 
ATOM   7629 C  CB  . ASP C 1 321 ? 43.402  -29.789 11.702  1.00 33.41 ? 801  ASP C CB  1 
ATOM   7630 C  CG  . ASP C 1 321 ? 44.178  -28.606 12.273  1.00 32.96 ? 801  ASP C CG  1 
ATOM   7631 O  OD1 . ASP C 1 321 ? 43.983  -28.247 13.451  1.00 32.85 ? 801  ASP C OD1 1 
ATOM   7632 O  OD2 . ASP C 1 321 ? 44.984  -28.024 11.522  1.00 31.95 ? 801  ASP C OD2 1 
ATOM   7633 N  N   . ALA C 1 322 ? 42.684  -30.955 14.958  1.00 34.11 ? 802  ALA C N   1 
ATOM   7634 C  CA  . ALA C 1 322 ? 42.941  -31.906 16.039  1.00 34.48 ? 802  ALA C CA  1 
ATOM   7635 C  C   . ALA C 1 322 ? 41.720  -32.795 16.286  1.00 34.87 ? 802  ALA C C   1 
ATOM   7636 O  O   . ALA C 1 322 ? 41.790  -33.751 17.064  1.00 34.90 ? 802  ALA C O   1 
ATOM   7637 C  CB  . ALA C 1 322 ? 43.322  -31.170 17.318  1.00 34.45 ? 802  ALA C CB  1 
ATOM   7638 N  N   . ALA C 1 323 ? 40.605  -32.475 15.627  1.00 35.35 ? 803  ALA C N   1 
ATOM   7639 C  CA  . ALA C 1 323 ? 39.366  -33.241 15.762  1.00 35.69 ? 803  ALA C CA  1 
ATOM   7640 C  C   . ALA C 1 323 ? 39.433  -34.583 15.041  1.00 36.06 ? 803  ALA C C   1 
ATOM   7641 O  O   . ALA C 1 323 ? 40.396  -34.877 14.329  1.00 36.12 ? 803  ALA C O   1 
ATOM   7642 C  CB  . ALA C 1 323 ? 38.181  -32.429 15.238  1.00 35.58 ? 803  ALA C CB  1 
ATOM   7643 N  N   . GLU C 1 324 ? 38.387  -35.384 15.236  1.00 36.59 ? 804  GLU C N   1 
ATOM   7644 C  CA  . GLU C 1 324 ? 38.247  -36.691 14.593  1.00 36.92 ? 804  GLU C CA  1 
ATOM   7645 C  C   . GLU C 1 324 ? 38.202  -36.538 13.074  1.00 37.22 ? 804  GLU C C   1 
ATOM   7646 O  O   . GLU C 1 324 ? 37.705  -35.535 12.559  1.00 37.25 ? 804  GLU C O   1 
ATOM   7647 C  CB  . GLU C 1 324 ? 36.961  -37.377 15.079  1.00 36.93 ? 804  GLU C CB  1 
ATOM   7648 C  CG  . GLU C 1 324 ? 36.885  -38.881 14.811  1.00 37.04 ? 804  GLU C CG  1 
ATOM   7649 C  CD  . GLU C 1 324 ? 37.669  -39.718 15.812  1.00 37.21 ? 804  GLU C CD  1 
ATOM   7650 O  OE1 . GLU C 1 324 ? 38.028  -39.203 16.892  1.00 37.35 ? 804  GLU C OE1 1 
ATOM   7651 O  OE2 . GLU C 1 324 ? 37.917  -40.907 15.520  1.00 37.42 ? 804  GLU C OE2 1 
ATOM   7652 N  N   . GLY C 1 325 ? 38.729  -37.533 12.365  1.00 37.60 ? 805  GLY C N   1 
ATOM   7653 C  CA  . GLY C 1 325 ? 38.705  -37.547 10.904  1.00 37.87 ? 805  GLY C CA  1 
ATOM   7654 C  C   . GLY C 1 325 ? 39.786  -36.690 10.272  1.00 38.11 ? 805  GLY C C   1 
ATOM   7655 O  O   . GLY C 1 325 ? 39.524  -35.948 9.323   1.00 38.22 ? 805  GLY C O   1 
ATOM   7656 N  N   . HIS C 1 326 ? 41.002  -36.791 10.802  1.00 38.32 ? 806  HIS C N   1 
ATOM   7657 C  CA  . HIS C 1 326 ? 42.159  -36.094 10.243  1.00 38.55 ? 806  HIS C CA  1 
ATOM   7658 C  C   . HIS C 1 326 ? 43.395  -36.987 10.367  1.00 38.74 ? 806  HIS C C   1 
ATOM   7659 O  O   . HIS C 1 326 ? 44.167  -36.847 11.314  1.00 38.83 ? 806  HIS C O   1 
ATOM   7660 C  CB  . HIS C 1 326 ? 42.388  -34.759 10.963  1.00 38.52 ? 806  HIS C CB  1 
ATOM   7661 C  CG  . HIS C 1 326 ? 41.240  -33.803 10.844  1.00 38.71 ? 806  HIS C CG  1 
ATOM   7662 N  ND1 . HIS C 1 326 ? 40.268  -33.684 11.815  1.00 38.78 ? 806  HIS C ND1 1 
ATOM   7663 C  CD2 . HIS C 1 326 ? 40.901  -32.933 9.864   1.00 38.51 ? 806  HIS C CD2 1 
ATOM   7664 C  CE1 . HIS C 1 326 ? 39.383  -32.778 11.440  1.00 38.63 ? 806  HIS C CE1 1 
ATOM   7665 N  NE2 . HIS C 1 326 ? 39.744  -32.307 10.261  1.00 38.55 ? 806  HIS C NE2 1 
ATOM   7666 N  N   . PRO C 1 327 ? 43.581  -37.923 9.418   1.00 38.92 ? 807  PRO C N   1 
ATOM   7667 C  CA  . PRO C 1 327 ? 44.734  -38.828 9.504   1.00 39.02 ? 807  PRO C CA  1 
ATOM   7668 C  C   . PRO C 1 327 ? 46.056  -38.124 9.194   1.00 39.12 ? 807  PRO C C   1 
ATOM   7669 O  O   . PRO C 1 327 ? 46.058  -37.066 8.570   1.00 39.09 ? 807  PRO C O   1 
ATOM   7670 C  CB  . PRO C 1 327 ? 44.434  -39.903 8.444   1.00 39.01 ? 807  PRO C CB  1 
ATOM   7671 C  CG  . PRO C 1 327 ? 43.039  -39.634 7.956   1.00 39.06 ? 807  PRO C CG  1 
ATOM   7672 C  CD  . PRO C 1 327 ? 42.752  -38.199 8.234   1.00 38.91 ? 807  PRO C CD  1 
ATOM   7673 N  N   . ALA C 1 328 ? 47.167  -38.712 9.631   1.00 39.29 ? 808  ALA C N   1 
ATOM   7674 C  CA  . ALA C 1 328 ? 48.494  -38.166 9.334   1.00 39.36 ? 808  ALA C CA  1 
ATOM   7675 C  C   . ALA C 1 328 ? 48.742  -38.169 7.818   1.00 39.35 ? 808  ALA C C   1 
ATOM   7676 O  O   . ALA C 1 328 ? 48.266  -39.062 7.116   1.00 39.30 ? 808  ALA C O   1 
ATOM   7677 C  CB  . ALA C 1 328 ? 49.577  -38.968 10.053  1.00 39.38 ? 808  ALA C CB  1 
ATOM   7678 N  N   . PRO C 1 329 ? 49.487  -37.172 7.303   1.00 39.39 ? 809  PRO C N   1 
ATOM   7679 C  CA  . PRO C 1 329 ? 50.165  -36.091 8.014   1.00 39.33 ? 809  PRO C CA  1 
ATOM   7680 C  C   . PRO C 1 329 ? 49.303  -34.840 8.239   1.00 39.16 ? 809  PRO C C   1 
ATOM   7681 O  O   . PRO C 1 329 ? 49.844  -33.732 8.302   1.00 39.37 ? 809  PRO C O   1 
ATOM   7682 C  CB  . PRO C 1 329 ? 51.337  -35.768 7.082   1.00 39.40 ? 809  PRO C CB  1 
ATOM   7683 C  CG  . PRO C 1 329 ? 50.787  -36.006 5.719   1.00 39.47 ? 809  PRO C CG  1 
ATOM   7684 C  CD  . PRO C 1 329 ? 49.743  -37.100 5.852   1.00 39.43 ? 809  PRO C CD  1 
ATOM   7685 N  N   . LEU C 1 330 ? 47.986  -35.003 8.366   1.00 38.86 ? 810  LEU C N   1 
ATOM   7686 C  CA  . LEU C 1 330 ? 47.113  -33.868 8.659   1.00 38.61 ? 810  LEU C CA  1 
ATOM   7687 C  C   . LEU C 1 330 ? 46.955  -33.641 10.164  1.00 38.35 ? 810  LEU C C   1 
ATOM   7688 O  O   . LEU C 1 330 ? 47.091  -32.507 10.632  1.00 38.41 ? 810  LEU C O   1 
ATOM   7689 C  CB  . LEU C 1 330 ? 45.739  -34.036 7.999   1.00 38.59 ? 810  LEU C CB  1 
ATOM   7690 C  CG  . LEU C 1 330 ? 44.820  -32.812 8.065   1.00 38.64 ? 810  LEU C CG  1 
ATOM   7691 C  CD1 . LEU C 1 330 ? 45.524  -31.551 7.573   1.00 38.25 ? 810  LEU C CD1 1 
ATOM   7692 C  CD2 . LEU C 1 330 ? 43.550  -33.066 7.268   1.00 38.91 ? 810  LEU C CD2 1 
ATOM   7693 N  N   . GLY C 1 331 ? 46.673  -34.707 10.915  1.00 37.91 ? 811  GLY C N   1 
ATOM   7694 C  CA  . GLY C 1 331 ? 46.424  -34.587 12.360  1.00 37.55 ? 811  GLY C CA  1 
ATOM   7695 C  C   . GLY C 1 331 ? 46.681  -35.853 13.160  1.00 37.20 ? 811  GLY C C   1 
ATOM   7696 O  O   . GLY C 1 331 ? 47.711  -35.977 13.828  1.00 37.22 ? 811  GLY C O   1 
ATOM   7697 N  N   . GLY C 1 332 ? 45.731  -36.783 13.109  1.00 36.64 ? 812  GLY C N   1 
ATOM   7698 C  CA  . GLY C 1 332 ? 45.843  -38.064 13.806  1.00 36.24 ? 812  GLY C CA  1 
ATOM   7699 C  C   . GLY C 1 332 ? 45.316  -38.044 15.231  1.00 35.83 ? 812  GLY C C   1 
ATOM   7700 O  O   . GLY C 1 332 ? 45.444  -39.035 15.955  1.00 35.77 ? 812  GLY C O   1 
ATOM   7701 N  N   . TYR C 1 333 ? 44.716  -36.921 15.627  1.00 35.34 ? 813  TYR C N   1 
ATOM   7702 C  CA  . TYR C 1 333 ? 44.188  -36.733 16.979  1.00 34.97 ? 813  TYR C CA  1 
ATOM   7703 C  C   . TYR C 1 333 ? 42.681  -36.990 17.006  1.00 34.81 ? 813  TYR C C   1 
ATOM   7704 O  O   . TYR C 1 333 ? 42.045  -37.102 15.957  1.00 34.69 ? 813  TYR C O   1 
ATOM   7705 C  CB  . TYR C 1 333 ? 44.500  -35.315 17.473  1.00 34.87 ? 813  TYR C CB  1 
ATOM   7706 C  CG  . TYR C 1 333 ? 45.930  -35.090 17.937  1.00 34.28 ? 813  TYR C CG  1 
ATOM   7707 C  CD1 . TYR C 1 333 ? 46.958  -35.975 17.600  1.00 33.40 ? 813  TYR C CD1 1 
ATOM   7708 C  CD2 . TYR C 1 333 ? 46.251  -33.989 18.728  1.00 33.78 ? 813  TYR C CD2 1 
ATOM   7709 C  CE1 . TYR C 1 333 ? 48.253  -35.765 18.028  1.00 32.97 ? 813  TYR C CE1 1 
ATOM   7710 C  CE2 . TYR C 1 333 ? 47.552  -33.770 19.156  1.00 33.64 ? 813  TYR C CE2 1 
ATOM   7711 C  CZ  . TYR C 1 333 ? 48.547  -34.667 18.803  1.00 33.13 ? 813  TYR C CZ  1 
ATOM   7712 O  OH  . TYR C 1 333 ? 49.840  -34.472 19.222  1.00 32.74 ? 813  TYR C OH  1 
ATOM   7713 N  N   . HIS C 1 334 ? 42.122  -37.087 18.211  1.00 34.64 ? 814  HIS C N   1 
ATOM   7714 C  CA  . HIS C 1 334 ? 40.725  -37.482 18.395  1.00 34.59 ? 814  HIS C CA  1 
ATOM   7715 C  C   . HIS C 1 334 ? 40.005  -36.585 19.400  1.00 34.46 ? 814  HIS C C   1 
ATOM   7716 O  O   . HIS C 1 334 ? 39.336  -37.079 20.308  1.00 34.69 ? 814  HIS C O   1 
ATOM   7717 C  CB  . HIS C 1 334 ? 40.650  -38.938 18.869  1.00 34.55 ? 814  HIS C CB  1 
ATOM   7718 C  CG  . HIS C 1 334 ? 41.433  -39.893 18.023  1.00 34.86 ? 814  HIS C CG  1 
ATOM   7719 N  ND1 . HIS C 1 334 ? 42.663  -40.383 18.403  1.00 35.28 ? 814  HIS C ND1 1 
ATOM   7720 C  CD2 . HIS C 1 334 ? 41.163  -40.445 16.816  1.00 34.87 ? 814  HIS C CD2 1 
ATOM   7721 C  CE1 . HIS C 1 334 ? 43.117  -41.199 17.467  1.00 35.33 ? 814  HIS C CE1 1 
ATOM   7722 N  NE2 . HIS C 1 334 ? 42.226  -41.253 16.494  1.00 35.13 ? 814  HIS C NE2 1 
ATOM   7723 N  N   . VAL C 1 335 ? 40.133  -35.272 19.238  1.00 34.24 ? 815  VAL C N   1 
ATOM   7724 C  CA  . VAL C 1 335 ? 39.453  -34.334 20.130  1.00 34.08 ? 815  VAL C CA  1 
ATOM   7725 C  C   . VAL C 1 335 ? 37.981  -34.211 19.729  1.00 34.02 ? 815  VAL C C   1 
ATOM   7726 O  O   . VAL C 1 335 ? 37.667  -33.773 18.623  1.00 33.89 ? 815  VAL C O   1 
ATOM   7727 C  CB  . VAL C 1 335 ? 40.111  -32.943 20.121  1.00 34.01 ? 815  VAL C CB  1 
ATOM   7728 C  CG1 . VAL C 1 335 ? 39.387  -32.010 21.082  1.00 33.98 ? 815  VAL C CG1 1 
ATOM   7729 C  CG2 . VAL C 1 335 ? 41.572  -33.051 20.491  1.00 33.87 ? 815  VAL C CG2 1 
ATOM   7730 N  N   . SER C 1 336 ? 37.089  -34.602 20.635  1.00 34.01 ? 816  SER C N   1 
ATOM   7731 C  CA  . SER C 1 336 ? 35.649  -34.587 20.372  1.00 34.04 ? 816  SER C CA  1 
ATOM   7732 C  C   . SER C 1 336 ? 35.105  -33.162 20.278  1.00 34.10 ? 816  SER C C   1 
ATOM   7733 O  O   . SER C 1 336 ? 35.739  -32.214 20.738  1.00 34.05 ? 816  SER C O   1 
ATOM   7734 C  CB  . SER C 1 336 ? 34.900  -35.345 21.468  1.00 33.99 ? 816  SER C CB  1 
ATOM   7735 O  OG  . SER C 1 336 ? 34.910  -34.615 22.682  1.00 33.81 ? 816  SER C OG  1 
ATOM   7736 N  N   . ALA C 1 337 ? 33.919  -33.032 19.689  1.00 34.18 ? 817  ALA C N   1 
ATOM   7737 C  CA  . ALA C 1 337 ? 33.278  -31.732 19.498  1.00 34.29 ? 817  ALA C CA  1 
ATOM   7738 C  C   . ALA C 1 337 ? 32.923  -31.080 20.828  1.00 34.44 ? 817  ALA C C   1 
ATOM   7739 O  O   . ALA C 1 337 ? 33.141  -29.884 21.018  1.00 34.46 ? 817  ALA C O   1 
ATOM   7740 C  CB  . ALA C 1 337 ? 32.034  -31.884 18.644  1.00 34.22 ? 817  ALA C CB  1 
ATOM   7741 N  N   . LYS C 1 338 ? 32.381  -31.871 21.749  1.00 34.68 ? 818  LYS C N   1 
ATOM   7742 C  CA  . LYS C 1 338 ? 31.999  -31.366 23.068  1.00 34.88 ? 818  LYS C CA  1 
ATOM   7743 C  C   . LYS C 1 338 ? 33.224  -30.922 23.872  1.00 34.99 ? 818  LYS C C   1 
ATOM   7744 O  O   . LYS C 1 338 ? 33.116  -30.062 24.746  1.00 35.14 ? 818  LYS C O   1 
ATOM   7745 C  CB  . LYS C 1 338 ? 31.192  -32.417 23.844  1.00 34.94 ? 818  LYS C CB  1 
ATOM   7746 C  CG  . LYS C 1 338 ? 29.853  -32.768 23.193  1.00 35.29 ? 818  LYS C CG  1 
ATOM   7747 C  CD  . LYS C 1 338 ? 29.032  -33.737 24.036  1.00 35.61 ? 818  LYS C CD  1 
ATOM   7748 C  CE  . LYS C 1 338 ? 27.811  -34.232 23.271  1.00 35.75 ? 818  LYS C CE  1 
ATOM   7749 N  NZ  . LYS C 1 338 ? 26.907  -35.085 24.097  1.00 36.03 ? 818  LYS C NZ  1 
ATOM   7750 N  N   . CYS C 1 339 ? 34.384  -31.505 23.569  1.00 35.06 ? 819  CYS C N   1 
ATOM   7751 C  CA  . CYS C 1 339 ? 35.646  -31.088 24.184  1.00 35.00 ? 819  CYS C CA  1 
ATOM   7752 C  C   . CYS C 1 339 ? 36.071  -29.687 23.729  1.00 34.71 ? 819  CYS C C   1 
ATOM   7753 O  O   . CYS C 1 339 ? 36.614  -28.918 24.522  1.00 34.64 ? 819  CYS C O   1 
ATOM   7754 C  CB  . CYS C 1 339 ? 36.750  -32.102 23.875  1.00 35.08 ? 819  CYS C CB  1 
ATOM   7755 S  SG  . CYS C 1 339 ? 38.246  -31.898 24.867  1.00 36.18 ? 819  CYS C SG  1 
ATOM   7756 N  N   . PHE C 1 340 ? 35.830  -29.362 22.458  1.00 34.53 ? 820  PHE C N   1 
ATOM   7757 C  CA  . PHE C 1 340 ? 36.089  -28.008 21.945  1.00 34.36 ? 820  PHE C CA  1 
ATOM   7758 C  C   . PHE C 1 340 ? 35.148  -26.996 22.594  1.00 34.14 ? 820  PHE C C   1 
ATOM   7759 O  O   . PHE C 1 340 ? 35.572  -25.909 22.992  1.00 33.95 ? 820  PHE C O   1 
ATOM   7760 C  CB  . PHE C 1 340 ? 35.944  -27.944 20.420  1.00 34.40 ? 820  PHE C CB  1 
ATOM   7761 C  CG  . PHE C 1 340 ? 37.113  -28.528 19.665  1.00 34.76 ? 820  PHE C CG  1 
ATOM   7762 C  CD1 . PHE C 1 340 ? 38.321  -27.843 19.590  1.00 35.19 ? 820  PHE C CD1 1 
ATOM   7763 C  CD2 . PHE C 1 340 ? 36.998  -29.747 19.008  1.00 34.92 ? 820  PHE C CD2 1 
ATOM   7764 C  CE1 . PHE C 1 340 ? 39.401  -28.376 18.886  1.00 35.20 ? 820  PHE C CE1 1 
ATOM   7765 C  CE2 . PHE C 1 340 ? 38.072  -30.284 18.302  1.00 34.89 ? 820  PHE C CE2 1 
ATOM   7766 C  CZ  . PHE C 1 340 ? 39.272  -29.598 18.240  1.00 35.09 ? 820  PHE C CZ  1 
ATOM   7767 N  N   . GLY C 1 341 ? 33.872  -27.362 22.694  1.00 34.02 ? 821  GLY C N   1 
ATOM   7768 C  CA  . GLY C 1 341 ? 32.879  -26.533 23.366  1.00 33.97 ? 821  GLY C CA  1 
ATOM   7769 C  C   . GLY C 1 341 ? 33.218  -26.282 24.825  1.00 33.93 ? 821  GLY C C   1 
ATOM   7770 O  O   . GLY C 1 341 ? 33.028  -25.174 25.330  1.00 33.87 ? 821  GLY C O   1 
ATOM   7771 N  N   . TYR C 1 342 ? 33.728  -27.309 25.502  1.00 33.93 ? 822  TYR C N   1 
ATOM   7772 C  CA  . TYR C 1 342 ? 34.116  -27.187 26.909  1.00 33.99 ? 822  TYR C CA  1 
ATOM   7773 C  C   . TYR C 1 342 ? 35.388  -26.354 27.088  1.00 33.90 ? 822  TYR C C   1 
ATOM   7774 O  O   . TYR C 1 342 ? 35.529  -25.649 28.088  1.00 33.93 ? 822  TYR C O   1 
ATOM   7775 C  CB  . TYR C 1 342 ? 34.297  -28.566 27.552  1.00 34.02 ? 822  TYR C CB  1 
ATOM   7776 C  CG  . TYR C 1 342 ? 34.346  -28.520 29.066  1.00 34.30 ? 822  TYR C CG  1 
ATOM   7777 C  CD1 . TYR C 1 342 ? 33.267  -28.029 29.797  1.00 34.53 ? 822  TYR C CD1 1 
ATOM   7778 C  CD2 . TYR C 1 342 ? 35.466  -28.965 29.766  1.00 34.48 ? 822  TYR C CD2 1 
ATOM   7779 C  CE1 . TYR C 1 342 ? 33.297  -27.980 31.180  1.00 34.59 ? 822  TYR C CE1 1 
ATOM   7780 C  CE2 . TYR C 1 342 ? 35.505  -28.920 31.156  1.00 34.80 ? 822  TYR C CE2 1 
ATOM   7781 C  CZ  . TYR C 1 342 ? 34.414  -28.425 31.853  1.00 34.77 ? 822  TYR C CZ  1 
ATOM   7782 O  OH  . TYR C 1 342 ? 34.431  -28.375 33.228  1.00 35.66 ? 822  TYR C OH  1 
ATOM   7783 N  N   . MET C 1 343 ? 36.308  -26.438 26.128  1.00 33.73 ? 823  MET C N   1 
ATOM   7784 C  CA  . MET C 1 343 ? 37.482  -25.566 26.127  1.00 33.75 ? 823  MET C CA  1 
ATOM   7785 C  C   . MET C 1 343 ? 37.064  -24.119 25.918  1.00 33.51 ? 823  MET C C   1 
ATOM   7786 O  O   . MET C 1 343 ? 37.630  -23.212 26.531  1.00 33.60 ? 823  MET C O   1 
ATOM   7787 C  CB  . MET C 1 343 ? 38.487  -25.984 25.053  1.00 33.86 ? 823  MET C CB  1 
ATOM   7788 C  CG  . MET C 1 343 ? 39.378  -27.126 25.482  1.00 34.39 ? 823  MET C CG  1 
ATOM   7789 S  SD  . MET C 1 343 ? 40.532  -27.615 24.193  1.00 36.05 ? 823  MET C SD  1 
ATOM   7790 C  CE  . MET C 1 343 ? 39.425  -28.429 23.042  1.00 35.49 ? 823  MET C CE  1 
ATOM   7791 N  N   . THR C 1 344 ? 36.072  -23.913 25.056  1.00 33.22 ? 824  THR C N   1 
ATOM   7792 C  CA  . THR C 1 344 ? 35.500  -22.588 24.834  1.00 33.00 ? 824  THR C CA  1 
ATOM   7793 C  C   . THR C 1 344 ? 34.825  -22.070 26.104  1.00 32.99 ? 824  THR C C   1 
ATOM   7794 O  O   . THR C 1 344 ? 35.061  -20.934 26.521  1.00 32.83 ? 824  THR C O   1 
ATOM   7795 C  CB  . THR C 1 344 ? 34.472  -22.610 23.686  1.00 32.98 ? 824  THR C CB  1 
ATOM   7796 O  OG1 . THR C 1 344 ? 35.045  -23.266 22.548  1.00 32.59 ? 824  THR C OG1 1 
ATOM   7797 C  CG2 . THR C 1 344 ? 34.050  -21.196 23.307  1.00 32.47 ? 824  THR C CG2 1 
ATOM   7798 N  N   . GLN C 1 345 ? 33.993  -22.912 26.714  1.00 33.00 ? 825  GLN C N   1 
ATOM   7799 C  CA  . GLN C 1 345 ? 33.322  -22.569 27.968  1.00 33.07 ? 825  GLN C CA  1 
ATOM   7800 C  C   . GLN C 1 345 ? 34.334  -22.210 29.058  1.00 33.13 ? 825  GLN C C   1 
ATOM   7801 O  O   . GLN C 1 345 ? 34.138  -21.245 29.798  1.00 33.06 ? 825  GLN C O   1 
ATOM   7802 C  CB  . GLN C 1 345 ? 32.449  -23.730 28.443  1.00 33.10 ? 825  GLN C CB  1 
ATOM   7803 C  CG  . GLN C 1 345 ? 31.515  -23.376 29.592  1.00 33.23 ? 825  GLN C CG  1 
ATOM   7804 C  CD  . GLN C 1 345 ? 30.812  -24.588 30.164  1.00 33.65 ? 825  GLN C CD  1 
ATOM   7805 O  OE1 . GLN C 1 345 ? 30.878  -25.681 29.603  1.00 34.11 ? 825  GLN C OE1 1 
ATOM   7806 N  NE2 . GLN C 1 345 ? 30.130  -24.401 31.290  1.00 34.22 ? 825  GLN C NE2 1 
ATOM   7807 N  N   . GLN C 1 346 ? 35.411  -22.989 29.150  1.00 33.10 ? 826  GLN C N   1 
ATOM   7808 C  CA  . GLN C 1 346 ? 36.460  -22.725 30.131  1.00 33.14 ? 826  GLN C CA  1 
ATOM   7809 C  C   . GLN C 1 346 ? 37.098  -21.360 29.901  1.00 32.97 ? 826  GLN C C   1 
ATOM   7810 O  O   . GLN C 1 346 ? 37.317  -20.606 30.851  1.00 32.98 ? 826  GLN C O   1 
ATOM   7811 C  CB  . GLN C 1 346 ? 37.524  -23.830 30.119  1.00 33.32 ? 826  GLN C CB  1 
ATOM   7812 C  CG  . GLN C 1 346 ? 37.102  -25.092 30.876  1.00 33.77 ? 826  GLN C CG  1 
ATOM   7813 C  CD  . GLN C 1 346 ? 38.232  -26.094 31.033  1.00 34.45 ? 826  GLN C CD  1 
ATOM   7814 O  OE1 . GLN C 1 346 ? 39.193  -25.856 31.769  1.00 34.99 ? 826  GLN C OE1 1 
ATOM   7815 N  NE2 . GLN C 1 346 ? 38.116  -27.228 30.353  1.00 34.85 ? 826  GLN C NE2 1 
ATOM   7816 N  N   . LEU C 1 347 ? 37.365  -21.031 28.639  1.00 32.78 ? 827  LEU C N   1 
ATOM   7817 C  CA  . LEU C 1 347 ? 37.960  -19.737 28.299  1.00 32.66 ? 827  LEU C CA  1 
ATOM   7818 C  C   . LEU C 1 347 ? 37.017  -18.554 28.545  1.00 32.63 ? 827  LEU C C   1 
ATOM   7819 O  O   . LEU C 1 347 ? 37.476  -17.428 28.729  1.00 32.64 ? 827  LEU C O   1 
ATOM   7820 C  CB  . LEU C 1 347 ? 38.461  -19.728 26.846  1.00 32.57 ? 827  LEU C CB  1 
ATOM   7821 C  CG  . LEU C 1 347 ? 39.659  -20.640 26.533  1.00 32.39 ? 827  LEU C CG  1 
ATOM   7822 C  CD1 . LEU C 1 347 ? 40.138  -20.444 25.095  1.00 31.79 ? 827  LEU C CD1 1 
ATOM   7823 C  CD2 . LEU C 1 347 ? 40.804  -20.411 27.502  1.00 31.45 ? 827  LEU C CD2 1 
ATOM   7824 N  N   . MET C 1 348 ? 35.709  -18.801 28.564  1.00 32.63 ? 828  MET C N   1 
ATOM   7825 C  CA  . MET C 1 348 ? 34.741  -17.723 28.801  1.00 32.73 ? 828  MET C CA  1 
ATOM   7826 C  C   . MET C 1 348 ? 34.749  -17.217 30.244  1.00 32.70 ? 828  MET C C   1 
ATOM   7827 O  O   . MET C 1 348 ? 34.313  -16.099 30.511  1.00 32.60 ? 828  MET C O   1 
ATOM   7828 C  CB  . MET C 1 348 ? 33.337  -18.162 28.403  1.00 32.77 ? 828  MET C CB  1 
ATOM   7829 C  CG  . MET C 1 348 ? 33.161  -18.254 26.908  1.00 32.98 ? 828  MET C CG  1 
ATOM   7830 S  SD  . MET C 1 348 ? 31.702  -19.190 26.464  1.00 33.88 ? 828  MET C SD  1 
ATOM   7831 C  CE  . MET C 1 348 ? 30.412  -18.028 26.924  1.00 32.84 ? 828  MET C CE  1 
ATOM   7832 N  N   . ASN C 1 349 ? 35.250  -18.032 31.169  1.00 32.71 ? 829  ASN C N   1 
ATOM   7833 C  CA  . ASN C 1 349 ? 35.450  -17.579 32.544  1.00 32.71 ? 829  ASN C CA  1 
ATOM   7834 C  C   . ASN C 1 349 ? 36.526  -16.495 32.628  1.00 32.70 ? 829  ASN C C   1 
ATOM   7835 O  O   . ASN C 1 349 ? 36.529  -15.697 33.567  1.00 32.85 ? 829  ASN C O   1 
ATOM   7836 C  CB  . ASN C 1 349 ? 35.798  -18.755 33.463  1.00 32.67 ? 829  ASN C CB  1 
ATOM   7837 C  CG  . ASN C 1 349 ? 34.634  -19.714 33.649  1.00 32.75 ? 829  ASN C CG  1 
ATOM   7838 O  OD1 . ASN C 1 349 ? 33.484  -19.293 33.785  1.00 32.98 ? 829  ASN C OD1 1 
ATOM   7839 N  ND2 . ASN C 1 349 ? 34.926  -21.010 33.659  1.00 32.60 ? 829  ASN C ND2 1 
ATOM   7840 N  N   . LEU C 1 350 ? 37.426  -16.467 31.642  1.00 32.58 ? 830  LEU C N   1 
ATOM   7841 C  CA  . LEU C 1 350 ? 38.480  -15.454 31.572  1.00 32.46 ? 830  LEU C CA  1 
ATOM   7842 C  C   . LEU C 1 350 ? 37.974  -14.130 31.003  1.00 32.34 ? 830  LEU C C   1 
ATOM   7843 O  O   . LEU C 1 350 ? 36.904  -14.070 30.387  1.00 32.45 ? 830  LEU C O   1 
ATOM   7844 C  CB  . LEU C 1 350 ? 39.653  -15.951 30.720  1.00 32.51 ? 830  LEU C CB  1 
ATOM   7845 C  CG  . LEU C 1 350 ? 40.400  -17.192 31.223  1.00 32.48 ? 830  LEU C CG  1 
ATOM   7846 C  CD1 . LEU C 1 350 ? 41.274  -17.778 30.122  1.00 32.31 ? 830  LEU C CD1 1 
ATOM   7847 C  CD2 . LEU C 1 350 ? 41.230  -16.854 32.452  1.00 32.21 ? 830  LEU C CD2 1 
ATOM   7848 N  N   . ALA C 1 351 ? 38.751  -13.072 31.244  1.00 32.11 ? 831  ALA C N   1 
ATOM   7849 C  CA  . ALA C 1 351 ? 38.521  -11.743 30.672  1.00 31.92 ? 831  ALA C CA  1 
ATOM   7850 C  C   . ALA C 1 351 ? 37.091  -11.217 30.854  1.00 31.82 ? 831  ALA C C   1 
ATOM   7851 O  O   . ALA C 1 351 ? 36.612  -10.420 30.045  1.00 31.67 ? 831  ALA C O   1 
ATOM   7852 C  CB  . ALA C 1 351 ? 38.896  -11.752 29.197  1.00 31.90 ? 831  ALA C CB  1 
ATOM   7853 N  N   . GLY C 1 352 ? 36.424  -11.659 31.917  1.00 31.75 ? 832  GLY C N   1 
ATOM   7854 C  CA  . GLY C 1 352 ? 35.032  -11.293 32.174  1.00 31.72 ? 832  GLY C CA  1 
ATOM   7855 C  C   . GLY C 1 352 ? 34.048  -11.727 31.100  1.00 31.66 ? 832  GLY C C   1 
ATOM   7856 O  O   . GLY C 1 352 ? 32.977  -11.132 30.970  1.00 31.74 ? 832  GLY C O   1 
ATOM   7857 N  N   . GLY C 1 353 ? 34.399  -12.762 30.336  1.00 31.57 ? 833  GLY C N   1 
ATOM   7858 C  CA  . GLY C 1 353 ? 33.542  -13.265 29.257  1.00 31.54 ? 833  GLY C CA  1 
ATOM   7859 C  C   . GLY C 1 353 ? 33.935  -12.846 27.847  1.00 31.49 ? 833  GLY C C   1 
ATOM   7860 O  O   . GLY C 1 353 ? 33.344  -13.328 26.877  1.00 31.41 ? 833  GLY C O   1 
ATOM   7861 N  N   . ALA C 1 354 ? 34.927  -11.960 27.729  1.00 31.42 ? 834  ALA C N   1 
ATOM   7862 C  CA  . ALA C 1 354 ? 35.349  -11.421 26.432  1.00 31.35 ? 834  ALA C CA  1 
ATOM   7863 C  C   . ALA C 1 354 ? 36.237  -12.407 25.676  1.00 31.47 ? 834  ALA C C   1 
ATOM   7864 O  O   . ALA C 1 354 ? 37.465  -12.402 25.824  1.00 31.51 ? 834  ALA C O   1 
ATOM   7865 C  CB  . ALA C 1 354 ? 36.072  -10.094 26.618  1.00 31.20 ? 834  ALA C CB  1 
ATOM   7866 N  N   . VAL C 1 355 ? 35.606  -13.252 24.865  1.00 31.56 ? 835  VAL C N   1 
ATOM   7867 C  CA  . VAL C 1 355 ? 36.318  -14.246 24.061  1.00 31.54 ? 835  VAL C CA  1 
ATOM   7868 C  C   . VAL C 1 355 ? 35.903  -14.123 22.594  1.00 31.48 ? 835  VAL C C   1 
ATOM   7869 O  O   . VAL C 1 355 ? 34.736  -13.876 22.288  1.00 31.31 ? 835  VAL C O   1 
ATOM   7870 C  CB  . VAL C 1 355 ? 36.052  -15.686 24.570  1.00 31.56 ? 835  VAL C CB  1 
ATOM   7871 C  CG1 . VAL C 1 355 ? 36.780  -16.711 23.712  1.00 31.40 ? 835  VAL C CG1 1 
ATOM   7872 C  CG2 . VAL C 1 355 ? 36.472  -15.821 26.029  1.00 31.57 ? 835  VAL C CG2 1 
ATOM   7873 N  N   . VAL C 1 356 ? 36.876  -14.281 21.700  1.00 31.46 ? 836  VAL C N   1 
ATOM   7874 C  CA  . VAL C 1 356 ? 36.649  -14.222 20.261  1.00 31.45 ? 836  VAL C CA  1 
ATOM   7875 C  C   . VAL C 1 356 ? 37.380  -15.377 19.596  1.00 31.55 ? 836  VAL C C   1 
ATOM   7876 O  O   . VAL C 1 356 ? 38.607  -15.432 19.632  1.00 31.20 ? 836  VAL C O   1 
ATOM   7877 C  CB  . VAL C 1 356 ? 37.176  -12.900 19.668  1.00 31.46 ? 836  VAL C CB  1 
ATOM   7878 C  CG1 . VAL C 1 356 ? 37.177  -12.953 18.145  1.00 31.24 ? 836  VAL C CG1 1 
ATOM   7879 C  CG2 . VAL C 1 356 ? 36.349  -11.726 20.169  1.00 31.48 ? 836  VAL C CG2 1 
ATOM   7880 N  N   . LEU C 1 357 ? 36.626  -16.304 19.006  1.00 31.74 ? 837  LEU C N   1 
ATOM   7881 C  CA  . LEU C 1 357 ? 37.226  -17.398 18.241  1.00 31.90 ? 837  LEU C CA  1 
ATOM   7882 C  C   . LEU C 1 357 ? 37.363  -16.991 16.773  1.00 32.00 ? 837  LEU C C   1 
ATOM   7883 O  O   . LEU C 1 357 ? 36.547  -16.233 16.248  1.00 31.94 ? 837  LEU C O   1 
ATOM   7884 C  CB  . LEU C 1 357 ? 36.401  -18.687 18.356  1.00 31.93 ? 837  LEU C CB  1 
ATOM   7885 C  CG  . LEU C 1 357 ? 36.015  -19.250 19.734  1.00 32.07 ? 837  LEU C CG  1 
ATOM   7886 C  CD1 . LEU C 1 357 ? 35.867  -20.765 19.652  1.00 32.15 ? 837  LEU C CD1 1 
ATOM   7887 C  CD2 . LEU C 1 357 ? 36.997  -18.894 20.825  1.00 31.70 ? 837  LEU C CD2 1 
ATOM   7888 N  N   . ALA C 1 358 ? 38.416  -17.482 16.129  1.00 32.20 ? 838  ALA C N   1 
ATOM   7889 C  CA  . ALA C 1 358 ? 38.655  -17.245 14.707  1.00 32.42 ? 838  ALA C CA  1 
ATOM   7890 C  C   . ALA C 1 358 ? 39.086  -18.558 14.068  1.00 32.63 ? 838  ALA C C   1 
ATOM   7891 O  O   . ALA C 1 358 ? 39.965  -19.245 14.597  1.00 32.64 ? 838  ALA C O   1 
ATOM   7892 C  CB  . ALA C 1 358 ? 39.723  -16.184 14.516  1.00 32.36 ? 838  ALA C CB  1 
ATOM   7893 N  N   . LEU C 1 359 ? 38.464  -18.909 12.943  1.00 32.79 ? 839  LEU C N   1 
ATOM   7894 C  CA  . LEU C 1 359 ? 38.715  -20.198 12.297  1.00 32.95 ? 839  LEU C CA  1 
ATOM   7895 C  C   . LEU C 1 359 ? 40.116  -20.246 11.711  1.00 33.04 ? 839  LEU C C   1 
ATOM   7896 O  O   . LEU C 1 359 ? 40.560  -19.292 11.074  1.00 32.89 ? 839  LEU C O   1 
ATOM   7897 C  CB  . LEU C 1 359 ? 37.690  -20.465 11.192  1.00 32.97 ? 839  LEU C CB  1 
ATOM   7898 C  CG  . LEU C 1 359 ? 37.757  -21.834 10.503  1.00 33.25 ? 839  LEU C CG  1 
ATOM   7899 C  CD1 . LEU C 1 359 ? 37.483  -22.957 11.490  1.00 33.42 ? 839  LEU C CD1 1 
ATOM   7900 C  CD2 . LEU C 1 359 ? 36.777  -21.904 9.329   1.00 33.16 ? 839  LEU C CD2 1 
ATOM   7901 N  N   . GLU C 1 360 ? 40.809  -21.357 11.948  1.00 33.30 ? 840  GLU C N   1 
ATOM   7902 C  CA  . GLU C 1 360 ? 42.097  -21.622 11.320  1.00 33.39 ? 840  GLU C CA  1 
ATOM   7903 C  C   . GLU C 1 360 ? 41.959  -22.883 10.451  1.00 33.32 ? 840  GLU C C   1 
ATOM   7904 O  O   . GLU C 1 360 ? 41.361  -22.813 9.382   1.00 33.13 ? 840  GLU C O   1 
ATOM   7905 C  CB  . GLU C 1 360 ? 43.202  -21.742 12.378  1.00 33.52 ? 840  GLU C CB  1 
ATOM   7906 C  CG  . GLU C 1 360 ? 43.400  -20.479 13.241  1.00 34.05 ? 840  GLU C CG  1 
ATOM   7907 C  CD  . GLU C 1 360 ? 44.252  -19.384 12.593  1.00 34.63 ? 840  GLU C CD  1 
ATOM   7908 O  OE1 . GLU C 1 360 ? 44.790  -19.588 11.481  1.00 35.19 ? 840  GLU C OE1 1 
ATOM   7909 O  OE2 . GLU C 1 360 ? 44.387  -18.304 13.213  1.00 34.94 ? 840  GLU C OE2 1 
ATOM   7910 N  N   . GLY C 1 361 ? 42.473  -24.026 10.910  1.00 33.40 ? 841  GLY C N   1 
ATOM   7911 C  CA  . GLY C 1 361 ? 42.451  -25.264 10.127  1.00 33.49 ? 841  GLY C CA  1 
ATOM   7912 C  C   . GLY C 1 361 ? 41.265  -26.176 10.400  1.00 33.63 ? 841  GLY C C   1 
ATOM   7913 O  O   . GLY C 1 361 ? 40.291  -25.777 11.042  1.00 33.52 ? 841  GLY C O   1 
ATOM   7914 N  N   . GLY C 1 362 ? 41.372  -27.413 9.914   1.00 33.73 ? 842  GLY C N   1 
ATOM   7915 C  CA  . GLY C 1 362 ? 40.291  -28.395 9.979   1.00 33.87 ? 842  GLY C CA  1 
ATOM   7916 C  C   . GLY C 1 362 ? 39.722  -28.630 8.591   1.00 34.02 ? 842  GLY C C   1 
ATOM   7917 O  O   . GLY C 1 362 ? 39.275  -27.683 7.942   1.00 34.11 ? 842  GLY C O   1 
ATOM   7918 N  N   . HIS C 1 363 ? 39.742  -29.886 8.137   1.00 34.09 ? 843  HIS C N   1 
ATOM   7919 C  CA  . HIS C 1 363 ? 39.326  -30.241 6.774   1.00 34.25 ? 843  HIS C CA  1 
ATOM   7920 C  C   . HIS C 1 363 ? 37.991  -30.991 6.713   1.00 34.23 ? 843  HIS C C   1 
ATOM   7921 O  O   . HIS C 1 363 ? 37.071  -30.569 6.005   1.00 34.02 ? 843  HIS C O   1 
ATOM   7922 C  CB  . HIS C 1 363 ? 40.407  -31.085 6.096   1.00 34.36 ? 843  HIS C CB  1 
ATOM   7923 C  CG  . HIS C 1 363 ? 40.040  -31.524 4.712   1.00 34.76 ? 843  HIS C CG  1 
ATOM   7924 N  ND1 . HIS C 1 363 ? 40.013  -30.658 3.640   1.00 35.29 ? 843  HIS C ND1 1 
ATOM   7925 C  CD2 . HIS C 1 363 ? 39.665  -32.732 4.230   1.00 35.07 ? 843  HIS C CD2 1 
ATOM   7926 C  CE1 . HIS C 1 363 ? 39.643  -31.315 2.555   1.00 35.44 ? 843  HIS C CE1 1 
ATOM   7927 N  NE2 . HIS C 1 363 ? 39.426  -32.576 2.886   1.00 35.29 ? 843  HIS C NE2 1 
ATOM   7928 N  N   . ASP C 1 364 ? 37.909  -32.114 7.427   1.00 34.23 ? 844  ASP C N   1 
ATOM   7929 C  CA  . ASP C 1 364 ? 36.688  -32.924 7.483   1.00 34.25 ? 844  ASP C CA  1 
ATOM   7930 C  C   . ASP C 1 364 ? 35.498  -32.054 7.874   1.00 34.24 ? 844  ASP C C   1 
ATOM   7931 O  O   . ASP C 1 364 ? 35.477  -31.482 8.967   1.00 34.17 ? 844  ASP C O   1 
ATOM   7932 C  CB  . ASP C 1 364 ? 36.850  -34.078 8.479   1.00 34.30 ? 844  ASP C CB  1 
ATOM   7933 C  CG  . ASP C 1 364 ? 35.619  -34.971 8.552   1.00 34.41 ? 844  ASP C CG  1 
ATOM   7934 O  OD1 . ASP C 1 364 ? 34.575  -34.523 9.076   1.00 34.50 ? 844  ASP C OD1 1 
ATOM   7935 O  OD2 . ASP C 1 364 ? 35.695  -36.124 8.081   1.00 34.87 ? 844  ASP C OD2 1 
ATOM   7936 N  N   . LEU C 1 365 ? 34.512  -31.971 6.982   1.00 34.19 ? 845  LEU C N   1 
ATOM   7937 C  CA  . LEU C 1 365 ? 33.405  -31.028 7.137   1.00 34.14 ? 845  LEU C CA  1 
ATOM   7938 C  C   . LEU C 1 365 ? 32.532  -31.330 8.351   1.00 34.17 ? 845  LEU C C   1 
ATOM   7939 O  O   . LEU C 1 365 ? 32.231  -30.427 9.134   1.00 34.30 ? 845  LEU C O   1 
ATOM   7940 C  CB  . LEU C 1 365 ? 32.538  -30.993 5.874   1.00 34.11 ? 845  LEU C CB  1 
ATOM   7941 C  CG  . LEU C 1 365 ? 33.222  -30.536 4.583   1.00 33.94 ? 845  LEU C CG  1 
ATOM   7942 C  CD1 . LEU C 1 365 ? 32.181  -30.341 3.494   1.00 33.41 ? 845  LEU C CD1 1 
ATOM   7943 C  CD2 . LEU C 1 365 ? 34.022  -29.257 4.797   1.00 33.59 ? 845  LEU C CD2 1 
ATOM   7944 N  N   . THR C 1 366 ? 32.131  -32.590 8.512   1.00 34.07 ? 846  THR C N   1 
ATOM   7945 C  CA  . THR C 1 366 ? 31.260  -32.965 9.626   1.00 34.08 ? 846  THR C CA  1 
ATOM   7946 C  C   . THR C 1 366 ? 31.972  -32.742 10.961  1.00 34.11 ? 846  THR C C   1 
ATOM   7947 O  O   . THR C 1 366 ? 31.358  -32.286 11.925  1.00 34.18 ? 846  THR C O   1 
ATOM   7948 C  CB  . THR C 1 366 ? 30.764  -34.433 9.533   1.00 34.06 ? 846  THR C CB  1 
ATOM   7949 O  OG1 . THR C 1 366 ? 31.864  -35.334 9.704   1.00 34.21 ? 846  THR C OG1 1 
ATOM   7950 C  CG2 . THR C 1 366 ? 30.086  -34.698 8.191   1.00 33.88 ? 846  THR C CG2 1 
ATOM   7951 N  N   . ALA C 1 367 ? 33.268  -33.045 11.002  1.00 34.07 ? 847  ALA C N   1 
ATOM   7952 C  CA  . ALA C 1 367 ? 34.073  -32.852 12.209  1.00 34.05 ? 847  ALA C CA  1 
ATOM   7953 C  C   . ALA C 1 367 ? 34.183  -31.375 12.589  1.00 34.02 ? 847  ALA C C   1 
ATOM   7954 O  O   . ALA C 1 367 ? 33.993  -31.017 13.755  1.00 33.91 ? 847  ALA C O   1 
ATOM   7955 C  CB  . ALA C 1 367 ? 35.463  -33.455 12.025  1.00 33.96 ? 847  ALA C CB  1 
ATOM   7956 N  N   . ILE C 1 368 ? 34.485  -30.527 11.605  1.00 33.96 ? 848  ILE C N   1 
ATOM   7957 C  CA  . ILE C 1 368 ? 34.669  -29.092 11.857  1.00 33.98 ? 848  ILE C CA  1 
ATOM   7958 C  C   . ILE C 1 368 ? 33.339  -28.367 12.083  1.00 33.99 ? 848  ILE C C   1 
ATOM   7959 O  O   . ILE C 1 368 ? 33.309  -27.295 12.693  1.00 33.97 ? 848  ILE C O   1 
ATOM   7960 C  CB  . ILE C 1 368 ? 35.485  -28.385 10.732  1.00 33.97 ? 848  ILE C CB  1 
ATOM   7961 C  CG1 . ILE C 1 368 ? 34.671  -28.257 9.436   1.00 33.96 ? 848  ILE C CG1 1 
ATOM   7962 C  CG2 . ILE C 1 368 ? 36.803  -29.122 10.486  1.00 33.95 ? 848  ILE C CG2 1 
ATOM   7963 C  CD1 . ILE C 1 368 ? 35.449  -27.657 8.281   1.00 33.69 ? 848  ILE C CD1 1 
ATOM   7964 N  N   . CYS C 1 369 ? 32.250  -28.951 11.582  1.00 33.93 ? 849  CYS C N   1 
ATOM   7965 C  CA  . CYS C 1 369 ? 30.906  -28.436 11.841  1.00 34.01 ? 849  CYS C CA  1 
ATOM   7966 C  C   . CYS C 1 369 ? 30.472  -28.715 13.280  1.00 33.92 ? 849  CYS C C   1 
ATOM   7967 O  O   . CYS C 1 369 ? 29.952  -27.828 13.957  1.00 33.92 ? 849  CYS C O   1 
ATOM   7968 C  CB  . CYS C 1 369 ? 29.894  -29.045 10.864  1.00 34.09 ? 849  CYS C CB  1 
ATOM   7969 S  SG  . CYS C 1 369 ? 29.853  -28.245 9.243   1.00 34.57 ? 849  CYS C SG  1 
ATOM   7970 N  N   . ASP C 1 370 ? 30.687  -29.948 13.735  1.00 33.86 ? 850  ASP C N   1 
ATOM   7971 C  CA  . ASP C 1 370 ? 30.374  -30.340 15.113  1.00 33.86 ? 850  ASP C CA  1 
ATOM   7972 C  C   . ASP C 1 370 ? 31.009  -29.390 16.122  1.00 33.84 ? 850  ASP C C   1 
ATOM   7973 O  O   . ASP C 1 370 ? 30.337  -28.891 17.029  1.00 33.86 ? 850  ASP C O   1 
ATOM   7974 C  CB  . ASP C 1 370 ? 30.875  -31.759 15.405  1.00 33.86 ? 850  ASP C CB  1 
ATOM   7975 C  CG  . ASP C 1 370 ? 30.081  -32.828 14.685  1.00 33.94 ? 850  ASP C CG  1 
ATOM   7976 O  OD1 . ASP C 1 370 ? 28.901  -32.597 14.349  1.00 33.70 ? 850  ASP C OD1 1 
ATOM   7977 O  OD2 . ASP C 1 370 ? 30.647  -33.917 14.464  1.00 34.27 ? 850  ASP C OD2 1 
ATOM   7978 N  N   . ALA C 1 371 ? 32.308  -29.156 15.957  1.00 33.82 ? 851  ALA C N   1 
ATOM   7979 C  CA  . ALA C 1 371 ? 33.065  -28.304 16.868  1.00 33.80 ? 851  ALA C CA  1 
ATOM   7980 C  C   . ALA C 1 371 ? 32.564  -26.864 16.828  1.00 33.79 ? 851  ALA C C   1 
ATOM   7981 O  O   . ALA C 1 371 ? 32.377  -26.245 17.873  1.00 33.88 ? 851  ALA C O   1 
ATOM   7982 C  CB  . ALA C 1 371 ? 34.545  -28.360 16.539  1.00 33.74 ? 851  ALA C CB  1 
ATOM   7983 N  N   . SER C 1 372 ? 32.339  -26.339 15.626  1.00 33.75 ? 852  SER C N   1 
ATOM   7984 C  CA  . SER C 1 372 ? 31.859  -24.968 15.467  1.00 33.73 ? 852  SER C CA  1 
ATOM   7985 C  C   . SER C 1 372 ? 30.518  -24.791 16.168  1.00 33.72 ? 852  SER C C   1 
ATOM   7986 O  O   . SER C 1 372 ? 30.337  -23.845 16.936  1.00 33.89 ? 852  SER C O   1 
ATOM   7987 C  CB  . SER C 1 372 ? 31.751  -24.595 13.987  1.00 33.80 ? 852  SER C CB  1 
ATOM   7988 O  OG  . SER C 1 372 ? 33.037  -24.531 13.386  1.00 33.97 ? 852  SER C OG  1 
ATOM   7989 N  N   . GLU C 1 373 ? 29.592  -25.714 15.913  1.00 33.61 ? 853  GLU C N   1 
ATOM   7990 C  CA  . GLU C 1 373 ? 28.312  -25.745 16.617  1.00 33.51 ? 853  GLU C CA  1 
ATOM   7991 C  C   . GLU C 1 373 ? 28.543  -25.801 18.124  1.00 33.47 ? 853  GLU C C   1 
ATOM   7992 O  O   . GLU C 1 373 ? 27.969  -25.012 18.875  1.00 33.59 ? 853  GLU C O   1 
ATOM   7993 C  CB  . GLU C 1 373 ? 27.483  -26.960 16.183  1.00 33.48 ? 853  GLU C CB  1 
ATOM   7994 C  CG  . GLU C 1 373 ? 26.075  -27.005 16.783  1.00 33.22 ? 853  GLU C CG  1 
ATOM   7995 C  CD  . GLU C 1 373 ? 25.392  -28.355 16.618  1.00 32.94 ? 853  GLU C CD  1 
ATOM   7996 O  OE1 . GLU C 1 373 ? 25.781  -29.131 15.718  1.00 32.89 ? 853  GLU C OE1 1 
ATOM   7997 O  OE2 . GLU C 1 373 ? 24.454  -28.641 17.392  1.00 32.36 ? 853  GLU C OE2 1 
ATOM   7998 N  N   . ALA C 1 374 ? 29.386  -26.738 18.552  1.00 33.33 ? 854  ALA C N   1 
ATOM   7999 C  CA  . ALA C 1 374 ? 29.689  -26.924 19.971  1.00 33.23 ? 854  ALA C CA  1 
ATOM   8000 C  C   . ALA C 1 374 ? 30.265  -25.651 20.591  1.00 33.22 ? 854  ALA C C   1 
ATOM   8001 O  O   . ALA C 1 374 ? 29.825  -25.228 21.663  1.00 33.30 ? 854  ALA C O   1 
ATOM   8002 C  CB  . ALA C 1 374 ? 30.652  -28.090 20.158  1.00 33.15 ? 854  ALA C CB  1 
ATOM   8003 N  N   . CYS C 1 375 ? 31.240  -25.047 19.911  1.00 33.08 ? 855  CYS C N   1 
ATOM   8004 C  CA  . CYS C 1 375 ? 31.849  -23.795 20.368  1.00 33.01 ? 855  CYS C CA  1 
ATOM   8005 C  C   . CYS C 1 375 ? 30.824  -22.663 20.412  1.00 32.87 ? 855  CYS C C   1 
ATOM   8006 O  O   . CYS C 1 375 ? 30.741  -21.941 21.403  1.00 32.84 ? 855  CYS C O   1 
ATOM   8007 C  CB  . CYS C 1 375 ? 33.020  -23.391 19.466  1.00 33.03 ? 855  CYS C CB  1 
ATOM   8008 S  SG  . CYS C 1 375 ? 34.446  -24.503 19.522  1.00 33.04 ? 855  CYS C SG  1 
ATOM   8009 N  N   . VAL C 1 376 ? 30.052  -22.516 19.339  1.00 32.67 ? 856  VAL C N   1 
ATOM   8010 C  CA  . VAL C 1 376 ? 29.024  -21.477 19.261  1.00 32.63 ? 856  VAL C CA  1 
ATOM   8011 C  C   . VAL C 1 376 ? 27.951  -21.661 20.335  1.00 32.62 ? 856  VAL C C   1 
ATOM   8012 O  O   . VAL C 1 376 ? 27.542  -20.694 20.977  1.00 32.54 ? 856  VAL C O   1 
ATOM   8013 C  CB  . VAL C 1 376 ? 28.357  -21.437 17.864  1.00 32.63 ? 856  VAL C CB  1 
ATOM   8014 C  CG1 . VAL C 1 376 ? 27.058  -20.632 17.902  1.00 32.45 ? 856  VAL C CG1 1 
ATOM   8015 C  CG2 . VAL C 1 376 ? 29.318  -20.857 16.841  1.00 32.42 ? 856  VAL C CG2 1 
ATOM   8016 N  N   . ALA C 1 377 ? 27.504  -22.901 20.526  1.00 32.64 ? 857  ALA C N   1 
ATOM   8017 C  CA  . ALA C 1 377 ? 26.523  -23.223 21.565  1.00 32.73 ? 857  ALA C CA  1 
ATOM   8018 C  C   . ALA C 1 377 ? 27.034  -22.806 22.942  1.00 32.82 ? 857  ALA C C   1 
ATOM   8019 O  O   . ALA C 1 377 ? 26.315  -22.164 23.708  1.00 32.90 ? 857  ALA C O   1 
ATOM   8020 C  CB  . ALA C 1 377 ? 26.196  -24.709 21.550  1.00 32.68 ? 857  ALA C CB  1 
ATOM   8021 N  N   . ALA C 1 378 ? 28.281  -23.166 23.243  1.00 32.82 ? 858  ALA C N   1 
ATOM   8022 C  CA  . ALA C 1 378 ? 28.930  -22.751 24.485  1.00 32.89 ? 858  ALA C CA  1 
ATOM   8023 C  C   . ALA C 1 378 ? 29.115  -21.233 24.536  1.00 33.02 ? 858  ALA C C   1 
ATOM   8024 O  O   . ALA C 1 378 ? 28.976  -20.622 25.597  1.00 32.95 ? 858  ALA C O   1 
ATOM   8025 C  CB  . ALA C 1 378 ? 30.270  -23.458 24.648  1.00 32.87 ? 858  ALA C CB  1 
ATOM   8026 N  N   . LEU C 1 379 ? 29.411  -20.634 23.383  1.00 33.24 ? 859  LEU C N   1 
ATOM   8027 C  CA  . LEU C 1 379 ? 29.563  -19.178 23.258  1.00 33.49 ? 859  LEU C CA  1 
ATOM   8028 C  C   . LEU C 1 379 ? 28.256  -18.442 23.571  1.00 33.73 ? 859  LEU C C   1 
ATOM   8029 O  O   . LEU C 1 379 ? 28.274  -17.297 24.028  1.00 33.68 ? 859  LEU C O   1 
ATOM   8030 C  CB  . LEU C 1 379 ? 30.041  -18.805 21.843  1.00 33.51 ? 859  LEU C CB  1 
ATOM   8031 C  CG  . LEU C 1 379 ? 31.310  -17.955 21.720  1.00 33.60 ? 859  LEU C CG  1 
ATOM   8032 C  CD1 . LEU C 1 379 ? 32.471  -18.555 22.492  1.00 32.90 ? 859  LEU C CD1 1 
ATOM   8033 C  CD2 . LEU C 1 379 ? 31.682  -17.782 20.254  1.00 33.68 ? 859  LEU C CD2 1 
ATOM   8034 N  N   . LEU C 1 380 ? 27.129  -19.109 23.321  1.00 34.01 ? 860  LEU C N   1 
ATOM   8035 C  CA  . LEU C 1 380 ? 25.802  -18.561 23.608  1.00 34.21 ? 860  LEU C CA  1 
ATOM   8036 C  C   . LEU C 1 380 ? 25.377  -18.765 25.068  1.00 34.42 ? 860  LEU C C   1 
ATOM   8037 O  O   . LEU C 1 380 ? 24.259  -18.407 25.446  1.00 34.43 ? 860  LEU C O   1 
ATOM   8038 C  CB  . LEU C 1 380 ? 24.761  -19.179 22.664  1.00 34.22 ? 860  LEU C CB  1 
ATOM   8039 C  CG  . LEU C 1 380 ? 24.901  -18.767 21.194  1.00 34.23 ? 860  LEU C CG  1 
ATOM   8040 C  CD1 . LEU C 1 380 ? 24.251  -19.785 20.270  1.00 34.33 ? 860  LEU C CD1 1 
ATOM   8041 C  CD2 . LEU C 1 380 ? 24.310  -17.386 20.970  1.00 34.24 ? 860  LEU C CD2 1 
ATOM   8042 N  N   . GLY C 1 381 ? 26.264  -19.337 25.882  1.00 34.63 ? 861  GLY C N   1 
ATOM   8043 C  CA  . GLY C 1 381 ? 26.023  -19.498 27.317  1.00 34.86 ? 861  GLY C CA  1 
ATOM   8044 C  C   . GLY C 1 381 ? 25.635  -20.903 27.742  1.00 35.07 ? 861  GLY C C   1 
ATOM   8045 O  O   . GLY C 1 381 ? 25.259  -21.121 28.896  1.00 35.02 ? 861  GLY C O   1 
ATOM   8046 N  N   . ASN C 1 382 ? 25.730  -21.859 26.820  1.00 35.40 ? 862  ASN C N   1 
ATOM   8047 C  CA  . ASN C 1 382 ? 25.420  -23.249 27.129  1.00 35.77 ? 862  ASN C CA  1 
ATOM   8048 C  C   . ASN C 1 382 ? 26.569  -23.896 27.901  1.00 36.04 ? 862  ASN C C   1 
ATOM   8049 O  O   . ASN C 1 382 ? 27.740  -23.557 27.700  1.00 36.02 ? 862  ASN C O   1 
ATOM   8050 C  CB  . ASN C 1 382 ? 25.121  -24.034 25.849  1.00 35.85 ? 862  ASN C CB  1 
ATOM   8051 C  CG  . ASN C 1 382 ? 24.206  -25.220 26.093  1.00 36.34 ? 862  ASN C CG  1 
ATOM   8052 O  OD1 . ASN C 1 382 ? 24.494  -26.080 26.928  1.00 37.38 ? 862  ASN C OD1 1 
ATOM   8053 N  ND2 . ASN C 1 382 ? 23.092  -25.270 25.366  1.00 36.40 ? 862  ASN C ND2 1 
ATOM   8054 N  N   . ARG C 1 383 ? 26.224  -24.817 28.795  1.00 36.36 ? 863  ARG C N   1 
ATOM   8055 C  CA  . ARG C 1 383 ? 27.210  -25.477 29.644  1.00 36.61 ? 863  ARG C CA  1 
ATOM   8056 C  C   . ARG C 1 383 ? 27.284  -26.961 29.316  1.00 36.61 ? 863  ARG C C   1 
ATOM   8057 O  O   . ARG C 1 383 ? 26.253  -27.633 29.221  1.00 36.69 ? 863  ARG C O   1 
ATOM   8058 C  CB  . ARG C 1 383 ? 26.845  -25.305 31.120  1.00 36.72 ? 863  ARG C CB  1 
ATOM   8059 C  CG  . ARG C 1 383 ? 26.745  -23.860 31.589  1.00 37.25 ? 863  ARG C CG  1 
ATOM   8060 C  CD  . ARG C 1 383 ? 26.476  -23.788 33.090  1.00 37.86 ? 863  ARG C CD  1 
ATOM   8061 N  NE  . ARG C 1 383 ? 27.624  -24.249 33.874  1.00 38.55 ? 863  ARG C NE  1 
ATOM   8062 C  CZ  . ARG C 1 383 ? 27.621  -24.445 35.194  1.00 39.05 ? 863  ARG C CZ  1 
ATOM   8063 N  NH1 . ARG C 1 383 ? 26.521  -24.228 35.917  1.00 39.34 ? 863  ARG C NH1 1 
ATOM   8064 N  NH2 . ARG C 1 383 ? 28.728  -24.865 35.799  1.00 38.91 ? 863  ARG C NH2 1 
ATOM   8065 N  N   . VAL C 1 384 ? 28.503  -27.465 29.142  1.00 36.51 ? 864  VAL C N   1 
ATOM   8066 C  CA  . VAL C 1 384 ? 28.730  -28.895 28.982  1.00 36.46 ? 864  VAL C CA  1 
ATOM   8067 C  C   . VAL C 1 384 ? 28.925  -29.491 30.375  1.00 36.37 ? 864  VAL C C   1 
ATOM   8068 O  O   . VAL C 1 384 ? 29.580  -28.882 31.226  1.00 36.49 ? 864  VAL C O   1 
ATOM   8069 C  CB  . VAL C 1 384 ? 29.977  -29.193 28.112  1.00 36.52 ? 864  VAL C CB  1 
ATOM   8070 C  CG1 . VAL C 1 384 ? 30.015  -30.667 27.725  1.00 36.54 ? 864  VAL C CG1 1 
ATOM   8071 C  CG2 . VAL C 1 384 ? 29.996  -28.313 26.862  1.00 36.46 ? 864  VAL C CG2 1 
ATOM   8072 N  N   . ASP C 1 385 ? 28.347  -30.666 30.612  1.00 36.16 ? 865  ASP C N   1 
ATOM   8073 C  CA  . ASP C 1 385 ? 28.498  -31.357 31.890  1.00 35.97 ? 865  ASP C CA  1 
ATOM   8074 C  C   . ASP C 1 385 ? 29.669  -32.345 31.801  1.00 35.89 ? 865  ASP C C   1 
ATOM   8075 O  O   . ASP C 1 385 ? 29.582  -33.333 31.070  1.00 35.93 ? 865  ASP C O   1 
ATOM   8076 C  CB  . ASP C 1 385 ? 27.207  -32.092 32.254  1.00 35.87 ? 865  ASP C CB  1 
ATOM   8077 C  CG  . ASP C 1 385 ? 27.204  -32.598 33.684  1.00 35.62 ? 865  ASP C CG  1 
ATOM   8078 O  OD1 . ASP C 1 385 ? 28.288  -32.686 34.305  1.00 34.80 ? 865  ASP C OD1 1 
ATOM   8079 O  OD2 . ASP C 1 385 ? 26.106  -32.909 34.189  1.00 35.34 ? 865  ASP C OD2 1 
ATOM   8080 N  N   . PRO C 1 386 ? 30.764  -32.090 32.548  1.00 35.75 ? 866  PRO C N   1 
ATOM   8081 C  CA  . PRO C 1 386 ? 31.950  -32.949 32.438  1.00 35.66 ? 866  PRO C CA  1 
ATOM   8082 C  C   . PRO C 1 386 ? 31.748  -34.367 32.982  1.00 35.56 ? 866  PRO C C   1 
ATOM   8083 O  O   . PRO C 1 386 ? 32.420  -35.300 32.534  1.00 35.47 ? 866  PRO C O   1 
ATOM   8084 C  CB  . PRO C 1 386 ? 33.011  -32.204 33.267  1.00 35.69 ? 866  PRO C CB  1 
ATOM   8085 C  CG  . PRO C 1 386 ? 32.428  -30.863 33.570  1.00 35.75 ? 866  PRO C CG  1 
ATOM   8086 C  CD  . PRO C 1 386 ? 30.958  -31.041 33.563  1.00 35.74 ? 866  PRO C CD  1 
ATOM   8087 N  N   . LEU C 1 387 ? 30.827  -34.522 33.932  1.00 35.51 ? 867  LEU C N   1 
ATOM   8088 C  CA  . LEU C 1 387 ? 30.477  -35.840 34.470  1.00 35.40 ? 867  LEU C CA  1 
ATOM   8089 C  C   . LEU C 1 387 ? 29.596  -36.660 33.519  1.00 35.29 ? 867  LEU C C   1 
ATOM   8090 O  O   . LEU C 1 387 ? 29.332  -37.833 33.785  1.00 35.35 ? 867  LEU C O   1 
ATOM   8091 C  CB  . LEU C 1 387 ? 29.769  -35.698 35.823  1.00 35.33 ? 867  LEU C CB  1 
ATOM   8092 C  CG  . LEU C 1 387 ? 30.499  -34.914 36.919  1.00 35.35 ? 867  LEU C CG  1 
ATOM   8093 C  CD1 . LEU C 1 387 ? 29.749  -35.037 38.243  1.00 34.90 ? 867  LEU C CD1 1 
ATOM   8094 C  CD2 . LEU C 1 387 ? 31.944  -35.377 37.073  1.00 34.86 ? 867  LEU C CD2 1 
ATOM   8095 N  N   . SER C 1 388 ? 29.146  -36.055 32.419  1.00 35.15 ? 868  SER C N   1 
ATOM   8096 C  CA  . SER C 1 388 ? 28.304  -36.747 31.440  1.00 35.08 ? 868  SER C CA  1 
ATOM   8097 C  C   . SER C 1 388 ? 29.120  -37.343 30.286  1.00 34.98 ? 868  SER C C   1 
ATOM   8098 O  O   . SER C 1 388 ? 28.619  -37.451 29.166  1.00 34.98 ? 868  SER C O   1 
ATOM   8099 C  CB  . SER C 1 388 ? 27.244  -35.790 30.885  1.00 35.05 ? 868  SER C CB  1 
ATOM   8100 O  OG  . SER C 1 388 ? 27.814  -34.861 29.977  1.00 35.03 ? 868  SER C OG  1 
ATOM   8101 N  N   . GLU C 1 389 ? 30.371  -37.714 30.556  1.00 34.81 ? 869  GLU C N   1 
ATOM   8102 C  CA  . GLU C 1 389 ? 31.221  -38.387 29.572  1.00 34.68 ? 869  GLU C CA  1 
ATOM   8103 C  C   . GLU C 1 389 ? 32.118  -39.397 30.282  1.00 34.53 ? 869  GLU C C   1 
ATOM   8104 O  O   . GLU C 1 389 ? 33.093  -39.021 30.932  1.00 34.51 ? 869  GLU C O   1 
ATOM   8105 C  CB  . GLU C 1 389 ? 32.084  -37.379 28.801  1.00 34.67 ? 869  GLU C CB  1 
ATOM   8106 C  CG  . GLU C 1 389 ? 31.309  -36.342 27.975  1.00 34.68 ? 869  GLU C CG  1 
ATOM   8107 C  CD  . GLU C 1 389 ? 30.461  -36.943 26.855  1.00 34.49 ? 869  GLU C CD  1 
ATOM   8108 O  OE1 . GLU C 1 389 ? 30.741  -38.080 26.414  1.00 34.02 ? 869  GLU C OE1 1 
ATOM   8109 O  OE2 . GLU C 1 389 ? 29.510  -36.263 26.410  1.00 34.16 ? 869  GLU C OE2 1 
ATOM   8110 N  N   . GLU C 1 390 ? 31.776  -40.678 30.159  1.00 34.46 ? 870  GLU C N   1 
ATOM   8111 C  CA  . GLU C 1 390 ? 32.528  -41.755 30.807  1.00 34.37 ? 870  GLU C CA  1 
ATOM   8112 C  C   . GLU C 1 390 ? 34.000  -41.762 30.381  1.00 34.27 ? 870  GLU C C   1 
ATOM   8113 O  O   . GLU C 1 390 ? 34.880  -42.073 31.185  1.00 34.32 ? 870  GLU C O   1 
ATOM   8114 C  CB  . GLU C 1 390 ? 31.886  -43.114 30.507  1.00 34.25 ? 870  GLU C CB  1 
ATOM   8115 N  N   . GLY C 1 391 ? 34.256  -41.411 29.122  1.00 34.14 ? 871  GLY C N   1 
ATOM   8116 C  CA  . GLY C 1 391 ? 35.618  -41.349 28.586  1.00 34.09 ? 871  GLY C CA  1 
ATOM   8117 C  C   . GLY C 1 391 ? 36.495  -40.265 29.197  1.00 33.99 ? 871  GLY C C   1 
ATOM   8118 O  O   . GLY C 1 391 ? 37.721  -40.392 29.217  1.00 33.93 ? 871  GLY C O   1 
ATOM   8119 N  N   . TRP C 1 392 ? 35.870  -39.200 29.695  1.00 33.85 ? 872  TRP C N   1 
ATOM   8120 C  CA  . TRP C 1 392 ? 36.590  -38.117 30.370  1.00 33.69 ? 872  TRP C CA  1 
ATOM   8121 C  C   . TRP C 1 392 ? 37.053  -38.525 31.778  1.00 33.71 ? 872  TRP C C   1 
ATOM   8122 O  O   . TRP C 1 392 ? 37.800  -37.791 32.422  1.00 33.65 ? 872  TRP C O   1 
ATOM   8123 C  CB  . TRP C 1 392 ? 35.724  -36.851 30.434  1.00 33.59 ? 872  TRP C CB  1 
ATOM   8124 C  CG  . TRP C 1 392 ? 35.481  -36.200 29.092  1.00 33.37 ? 872  TRP C CG  1 
ATOM   8125 C  CD1 . TRP C 1 392 ? 35.723  -36.737 27.858  1.00 33.09 ? 872  TRP C CD1 1 
ATOM   8126 C  CD2 . TRP C 1 392 ? 34.920  -34.901 28.856  1.00 33.25 ? 872  TRP C CD2 1 
ATOM   8127 N  NE1 . TRP C 1 392 ? 35.365  -35.850 26.874  1.00 32.88 ? 872  TRP C NE1 1 
ATOM   8128 C  CE2 . TRP C 1 392 ? 34.866  -34.716 27.457  1.00 32.95 ? 872  TRP C CE2 1 
ATOM   8129 C  CE3 . TRP C 1 392 ? 34.463  -33.873 29.691  1.00 33.28 ? 872  TRP C CE3 1 
ATOM   8130 C  CZ2 . TRP C 1 392 ? 34.372  -33.546 26.872  1.00 32.98 ? 872  TRP C CZ2 1 
ATOM   8131 C  CZ3 . TRP C 1 392 ? 33.971  -32.707 29.108  1.00 33.20 ? 872  TRP C CZ3 1 
ATOM   8132 C  CH2 . TRP C 1 392 ? 33.931  -32.556 27.710  1.00 33.17 ? 872  TRP C CH2 1 
ATOM   8133 N  N   . LYS C 1 393 ? 36.606  -39.687 32.254  1.00 33.73 ? 873  LYS C N   1 
ATOM   8134 C  CA  . LYS C 1 393 ? 37.131  -40.268 33.491  1.00 33.74 ? 873  LYS C CA  1 
ATOM   8135 C  C   . LYS C 1 393 ? 38.535  -40.852 33.294  1.00 33.72 ? 873  LYS C C   1 
ATOM   8136 O  O   . LYS C 1 393 ? 39.292  -40.989 34.254  1.00 33.72 ? 873  LYS C O   1 
ATOM   8137 C  CB  . LYS C 1 393 ? 36.194  -41.361 34.005  1.00 33.66 ? 873  LYS C CB  1 
ATOM   8138 N  N   . GLN C 1 394 ? 38.875  -41.195 32.051  1.00 33.67 ? 874  GLN C N   1 
ATOM   8139 C  CA  . GLN C 1 394 ? 40.143  -41.858 31.740  1.00 33.61 ? 874  GLN C CA  1 
ATOM   8140 C  C   . GLN C 1 394 ? 41.345  -40.918 31.879  1.00 33.48 ? 874  GLN C C   1 
ATOM   8141 O  O   . GLN C 1 394 ? 41.266  -39.733 31.544  1.00 33.32 ? 874  GLN C O   1 
ATOM   8142 C  CB  . GLN C 1 394 ? 40.097  -42.437 30.323  1.00 33.67 ? 874  GLN C CB  1 
ATOM   8143 C  CG  . GLN C 1 394 ? 41.281  -43.327 29.961  1.00 33.91 ? 874  GLN C CG  1 
ATOM   8144 C  CD  . GLN C 1 394 ? 41.312  -43.674 28.488  1.00 34.16 ? 874  GLN C CD  1 
ATOM   8145 O  OE1 . GLN C 1 394 ? 42.122  -43.137 27.730  1.00 34.16 ? 874  GLN C OE1 1 
ATOM   8146 N  NE2 . GLN C 1 394 ? 40.416  -44.563 28.070  1.00 34.28 ? 874  GLN C NE2 1 
ATOM   8147 N  N   . LYS C 1 395 ? 42.453  -41.466 32.377  1.00 33.36 ? 875  LYS C N   1 
ATOM   8148 C  CA  . LYS C 1 395 ? 43.697  -40.718 32.542  1.00 33.23 ? 875  LYS C CA  1 
ATOM   8149 C  C   . LYS C 1 395 ? 44.393  -40.533 31.193  1.00 33.09 ? 875  LYS C C   1 
ATOM   8150 O  O   . LYS C 1 395 ? 44.350  -41.427 30.343  1.00 33.06 ? 875  LYS C O   1 
ATOM   8151 C  CB  . LYS C 1 395 ? 44.636  -41.443 33.513  1.00 33.13 ? 875  LYS C CB  1 
ATOM   8152 N  N   . PRO C 1 396 ? 45.045  -39.374 30.994  1.00 32.98 ? 876  PRO C N   1 
ATOM   8153 C  CA  . PRO C 1 396 ? 45.751  -39.101 29.737  1.00 32.90 ? 876  PRO C CA  1 
ATOM   8154 C  C   . PRO C 1 396 ? 46.995  -39.978 29.563  1.00 32.79 ? 876  PRO C C   1 
ATOM   8155 O  O   . PRO C 1 396 ? 47.633  -40.342 30.550  1.00 32.74 ? 876  PRO C O   1 
ATOM   8156 C  CB  . PRO C 1 396 ? 46.142  -37.629 29.870  1.00 32.87 ? 876  PRO C CB  1 
ATOM   8157 C  CG  . PRO C 1 396 ? 46.225  -37.394 31.335  1.00 32.92 ? 876  PRO C CG  1 
ATOM   8158 C  CD  . PRO C 1 396 ? 45.198  -38.275 31.964  1.00 32.88 ? 876  PRO C CD  1 
ATOM   8159 N  N   . ASN C 1 397 ? 47.336  -40.304 28.317  1.00 32.66 ? 877  ASN C N   1 
ATOM   8160 C  CA  . ASN C 1 397 ? 48.436  -41.232 28.043  1.00 32.56 ? 877  ASN C CA  1 
ATOM   8161 C  C   . ASN C 1 397 ? 49.793  -40.706 28.506  1.00 32.54 ? 877  ASN C C   1 
ATOM   8162 O  O   . ASN C 1 397 ? 49.946  -39.519 28.803  1.00 32.60 ? 877  ASN C O   1 
ATOM   8163 C  CB  . ASN C 1 397 ? 48.483  -41.619 26.559  1.00 32.55 ? 877  ASN C CB  1 
ATOM   8164 C  CG  . ASN C 1 397 ? 48.787  -40.441 25.644  1.00 32.55 ? 877  ASN C CG  1 
ATOM   8165 O  OD1 . ASN C 1 397 ? 49.817  -39.780 25.778  1.00 32.27 ? 877  ASN C OD1 1 
ATOM   8166 N  ND2 . ASN C 1 397 ? 47.894  -40.189 24.692  1.00 32.28 ? 877  ASN C ND2 1 
ATOM   8167 N  N   . LEU C 1 398 ? 50.775  -41.602 28.557  1.00 32.44 ? 878  LEU C N   1 
ATOM   8168 C  CA  . LEU C 1 398 ? 52.077  -41.290 29.141  1.00 32.35 ? 878  LEU C CA  1 
ATOM   8169 C  C   . LEU C 1 398 ? 52.858  -40.278 28.309  1.00 32.19 ? 878  LEU C C   1 
ATOM   8170 O  O   . LEU C 1 398 ? 53.712  -39.562 28.837  1.00 32.21 ? 878  LEU C O   1 
ATOM   8171 C  CB  . LEU C 1 398 ? 52.892  -42.572 29.337  1.00 32.35 ? 878  LEU C CB  1 
ATOM   8172 C  CG  . LEU C 1 398 ? 54.295  -42.455 29.947  1.00 32.66 ? 878  LEU C CG  1 
ATOM   8173 C  CD1 . LEU C 1 398 ? 54.348  -41.473 31.116  1.00 32.70 ? 878  LEU C CD1 1 
ATOM   8174 C  CD2 . LEU C 1 398 ? 54.787  -43.834 30.382  1.00 32.84 ? 878  LEU C CD2 1 
ATOM   8175 N  N   . ASN C 1 399 ? 52.565  -40.215 27.012  1.00 32.01 ? 879  ASN C N   1 
ATOM   8176 C  CA  . ASN C 1 399 ? 53.172  -39.208 26.141  1.00 31.79 ? 879  ASN C CA  1 
ATOM   8177 C  C   . ASN C 1 399 ? 52.723  -37.804 26.527  1.00 31.58 ? 879  ASN C C   1 
ATOM   8178 O  O   . ASN C 1 399 ? 53.544  -36.893 26.647  1.00 31.63 ? 879  ASN C O   1 
ATOM   8179 C  CB  . ASN C 1 399 ? 52.833  -39.480 24.676  1.00 31.73 ? 879  ASN C CB  1 
ATOM   8180 C  CG  . ASN C 1 399 ? 53.435  -40.773 24.165  1.00 31.72 ? 879  ASN C CG  1 
ATOM   8181 O  OD1 . ASN C 1 399 ? 52.806  -41.493 23.395  1.00 32.14 ? 879  ASN C OD1 1 
ATOM   8182 N  ND2 . ASN C 1 399 ? 54.657  -41.072 24.586  1.00 31.46 ? 879  ASN C ND2 1 
ATOM   8183 N  N   . ALA C 1 400 ? 51.420  -37.639 26.730  1.00 31.34 ? 880  ALA C N   1 
ATOM   8184 C  CA  . ALA C 1 400 ? 50.862  -36.360 27.162  1.00 31.21 ? 880  ALA C CA  1 
ATOM   8185 C  C   . ALA C 1 400 ? 51.406  -35.944 28.529  1.00 31.04 ? 880  ALA C C   1 
ATOM   8186 O  O   . ALA C 1 400 ? 51.715  -34.776 28.744  1.00 30.93 ? 880  ALA C O   1 
ATOM   8187 C  CB  . ALA C 1 400 ? 49.343  -36.434 27.198  1.00 31.14 ? 880  ALA C CB  1 
ATOM   8188 N  N   . ILE C 1 401 ? 51.520  -36.904 29.443  1.00 30.97 ? 881  ILE C N   1 
ATOM   8189 C  CA  . ILE C 1 401 ? 52.055  -36.643 30.779  1.00 30.98 ? 881  ILE C CA  1 
ATOM   8190 C  C   . ILE C 1 401 ? 53.481  -36.100 30.680  1.00 30.96 ? 881  ILE C C   1 
ATOM   8191 O  O   . ILE C 1 401 ? 53.784  -35.030 31.216  1.00 30.92 ? 881  ILE C O   1 
ATOM   8192 C  CB  . ILE C 1 401 ? 52.049  -37.926 31.662  1.00 31.12 ? 881  ILE C CB  1 
ATOM   8193 C  CG1 . ILE C 1 401 ? 50.616  -38.356 31.997  1.00 30.95 ? 881  ILE C CG1 1 
ATOM   8194 C  CG2 . ILE C 1 401 ? 52.836  -37.707 32.952  1.00 31.13 ? 881  ILE C CG2 1 
ATOM   8195 C  CD1 . ILE C 1 401 ? 49.837  -37.334 32.801  1.00 31.20 ? 881  ILE C CD1 1 
ATOM   8196 N  N   . ARG C 1 402 ? 54.343  -36.838 29.982  1.00 30.85 ? 882  ARG C N   1 
ATOM   8197 C  CA  . ARG C 1 402 ? 55.739  -36.435 29.782  1.00 30.82 ? 882  ARG C CA  1 
ATOM   8198 C  C   . ARG C 1 402 ? 55.864  -35.065 29.114  1.00 30.73 ? 882  ARG C C   1 
ATOM   8199 O  O   . ARG C 1 402 ? 56.745  -34.283 29.468  1.00 30.72 ? 882  ARG C O   1 
ATOM   8200 C  CB  . ARG C 1 402 ? 56.494  -37.483 28.957  1.00 30.80 ? 882  ARG C CB  1 
ATOM   8201 C  CG  . ARG C 1 402 ? 56.745  -38.774 29.705  1.00 30.92 ? 882  ARG C CG  1 
ATOM   8202 C  CD  . ARG C 1 402 ? 57.252  -39.871 28.782  1.00 31.18 ? 882  ARG C CD  1 
ATOM   8203 N  NE  . ARG C 1 402 ? 58.591  -39.590 28.267  1.00 31.21 ? 882  ARG C NE  1 
ATOM   8204 C  CZ  . ARG C 1 402 ? 59.720  -39.707 28.969  1.00 30.78 ? 882  ARG C CZ  1 
ATOM   8205 N  NH1 . ARG C 1 402 ? 59.696  -40.090 30.243  1.00 30.87 ? 882  ARG C NH1 1 
ATOM   8206 N  NH2 . ARG C 1 402 ? 60.886  -39.431 28.395  1.00 30.25 ? 882  ARG C NH2 1 
ATOM   8207 N  N   . SER C 1 403 ? 54.983  -34.782 28.156  1.00 30.61 ? 883  SER C N   1 
ATOM   8208 C  CA  . SER C 1 403 ? 54.985  -33.496 27.457  1.00 30.58 ? 883  SER C CA  1 
ATOM   8209 C  C   . SER C 1 403 ? 54.649  -32.345 28.402  1.00 30.59 ? 883  SER C C   1 
ATOM   8210 O  O   . SER C 1 403 ? 55.345  -31.328 28.430  1.00 30.58 ? 883  SER C O   1 
ATOM   8211 C  CB  . SER C 1 403 ? 53.985  -33.515 26.301  1.00 30.58 ? 883  SER C CB  1 
ATOM   8212 O  OG  . SER C 1 403 ? 54.262  -34.576 25.408  1.00 30.39 ? 883  SER C OG  1 
ATOM   8213 N  N   . LEU C 1 404 ? 53.578  -32.516 29.170  1.00 30.63 ? 884  LEU C N   1 
ATOM   8214 C  CA  . LEU C 1 404 ? 53.166  -31.520 30.160  1.00 30.69 ? 884  LEU C CA  1 
ATOM   8215 C  C   . LEU C 1 404 ? 54.234  -31.331 31.240  1.00 30.62 ? 884  LEU C C   1 
ATOM   8216 O  O   . LEU C 1 404 ? 54.494  -30.207 31.676  1.00 30.57 ? 884  LEU C O   1 
ATOM   8217 C  CB  . LEU C 1 404 ? 51.825  -31.915 30.791  1.00 30.71 ? 884  LEU C CB  1 
ATOM   8218 C  CG  . LEU C 1 404 ? 50.620  -31.848 29.843  1.00 30.94 ? 884  LEU C CG  1 
ATOM   8219 C  CD1 . LEU C 1 404 ? 49.452  -32.676 30.369  1.00 31.01 ? 884  LEU C CD1 1 
ATOM   8220 C  CD2 . LEU C 1 404 ? 50.188  -30.405 29.601  1.00 30.80 ? 884  LEU C CD2 1 
ATOM   8221 N  N   . GLU C 1 405 ? 54.859  -32.429 31.661  1.00 30.52 ? 885  GLU C N   1 
ATOM   8222 C  CA  . GLU C 1 405 ? 55.972  -32.353 32.612  1.00 30.44 ? 885  GLU C CA  1 
ATOM   8223 C  C   . GLU C 1 405 ? 57.131  -31.508 32.066  1.00 30.09 ? 885  GLU C C   1 
ATOM   8224 O  O   . GLU C 1 405 ? 57.821  -30.838 32.832  1.00 30.00 ? 885  GLU C O   1 
ATOM   8225 C  CB  . GLU C 1 405 ? 56.452  -33.755 33.009  1.00 30.55 ? 885  GLU C CB  1 
ATOM   8226 C  CG  . GLU C 1 405 ? 55.540  -34.436 34.032  1.00 31.31 ? 885  GLU C CG  1 
ATOM   8227 C  CD  . GLU C 1 405 ? 55.975  -35.851 34.404  1.00 32.71 ? 885  GLU C CD  1 
ATOM   8228 O  OE1 . GLU C 1 405 ? 56.884  -36.405 33.745  1.00 33.13 ? 885  GLU C OE1 1 
ATOM   8229 O  OE2 . GLU C 1 405 ? 55.398  -36.415 35.366  1.00 33.85 ? 885  GLU C OE2 1 
ATOM   8230 N  N   . ALA C 1 406 ? 57.328  -31.534 30.748  1.00 29.77 ? 886  ALA C N   1 
ATOM   8231 C  CA  . ALA C 1 406 ? 58.304  -30.664 30.082  1.00 29.52 ? 886  ALA C CA  1 
ATOM   8232 C  C   . ALA C 1 406 ? 57.896  -29.186 30.161  1.00 29.53 ? 886  ALA C C   1 
ATOM   8233 O  O   . ALA C 1 406 ? 58.738  -28.320 30.416  1.00 29.47 ? 886  ALA C O   1 
ATOM   8234 C  CB  . ALA C 1 406 ? 58.484  -31.087 28.631  1.00 29.33 ? 886  ALA C CB  1 
ATOM   8235 N  N   . VAL C 1 407 ? 56.607  -28.910 29.946  1.00 29.44 ? 887  VAL C N   1 
ATOM   8236 C  CA  . VAL C 1 407 ? 56.076  -27.547 30.027  1.00 29.47 ? 887  VAL C CA  1 
ATOM   8237 C  C   . VAL C 1 407 ? 56.198  -26.995 31.448  1.00 29.60 ? 887  VAL C C   1 
ATOM   8238 O  O   . VAL C 1 407 ? 56.670  -25.880 31.644  1.00 29.63 ? 887  VAL C O   1 
ATOM   8239 C  CB  . VAL C 1 407 ? 54.590  -27.470 29.573  1.00 29.51 ? 887  VAL C CB  1 
ATOM   8240 C  CG1 . VAL C 1 407 ? 54.070  -26.044 29.682  1.00 29.37 ? 887  VAL C CG1 1 
ATOM   8241 C  CG2 . VAL C 1 407 ? 54.428  -27.971 28.151  1.00 29.23 ? 887  VAL C CG2 1 
ATOM   8242 N  N   . ILE C 1 408 ? 55.780  -27.787 32.432  1.00 29.82 ? 888  ILE C N   1 
ATOM   8243 C  CA  . ILE C 1 408 ? 55.871  -27.397 33.845  1.00 29.93 ? 888  ILE C CA  1 
ATOM   8244 C  C   . ILE C 1 408 ? 57.312  -27.103 34.250  1.00 30.09 ? 888  ILE C C   1 
ATOM   8245 O  O   . ILE C 1 408 ? 57.599  -26.086 34.888  1.00 29.74 ? 888  ILE C O   1 
ATOM   8246 C  CB  . ILE C 1 408 ? 55.308  -28.501 34.771  1.00 29.88 ? 888  ILE C CB  1 
ATOM   8247 C  CG1 . ILE C 1 408 ? 53.801  -28.650 34.564  1.00 29.94 ? 888  ILE C CG1 1 
ATOM   8248 C  CG2 . ILE C 1 408 ? 55.600  -28.178 36.230  1.00 29.50 ? 888  ILE C CG2 1 
ATOM   8249 C  CD1 . ILE C 1 408 ? 53.236  -29.923 35.142  1.00 30.40 ? 888  ILE C CD1 1 
ATOM   8250 N  N   . ARG C 1 409 ? 58.204  -28.009 33.866  1.00 30.45 ? 889  ARG C N   1 
ATOM   8251 C  CA  . ARG C 1 409 ? 59.628  -27.899 34.173  1.00 30.85 ? 889  ARG C CA  1 
ATOM   8252 C  C   . ARG C 1 409 ? 60.215  -26.604 33.614  1.00 30.71 ? 889  ARG C C   1 
ATOM   8253 O  O   . ARG C 1 409 ? 60.951  -25.899 34.304  1.00 30.90 ? 889  ARG C O   1 
ATOM   8254 C  CB  . ARG C 1 409 ? 60.365  -29.112 33.600  1.00 31.04 ? 889  ARG C CB  1 
ATOM   8255 C  CG  . ARG C 1 409 ? 61.776  -29.315 34.098  1.00 32.44 ? 889  ARG C CG  1 
ATOM   8256 C  CD  . ARG C 1 409 ? 62.335  -30.637 33.568  1.00 34.34 ? 889  ARG C CD  1 
ATOM   8257 N  NE  . ARG C 1 409 ? 62.263  -30.682 32.108  1.00 35.89 ? 889  ARG C NE  1 
ATOM   8258 C  CZ  . ARG C 1 409 ? 63.135  -30.105 31.279  1.00 37.16 ? 889  ARG C CZ  1 
ATOM   8259 N  NH1 . ARG C 1 409 ? 64.195  -29.444 31.744  1.00 37.51 ? 889  ARG C NH1 1 
ATOM   8260 N  NH2 . ARG C 1 409 ? 62.951  -30.198 29.964  1.00 37.78 ? 889  ARG C NH2 1 
ATOM   8261 N  N   . VAL C 1 410 ? 59.875  -26.287 32.368  1.00 30.54 ? 890  VAL C N   1 
ATOM   8262 C  CA  . VAL C 1 410 ? 60.364  -25.068 31.720  1.00 30.40 ? 890  VAL C CA  1 
ATOM   8263 C  C   . VAL C 1 410 ? 59.755  -23.801 32.330  1.00 30.33 ? 890  VAL C C   1 
ATOM   8264 O  O   . VAL C 1 410 ? 60.471  -22.856 32.661  1.00 30.26 ? 890  VAL C O   1 
ATOM   8265 C  CB  . VAL C 1 410 ? 60.071  -25.090 30.200  1.00 30.48 ? 890  VAL C CB  1 
ATOM   8266 C  CG1 . VAL C 1 410 ? 60.161  -23.689 29.604  1.00 30.00 ? 890  VAL C CG1 1 
ATOM   8267 C  CG2 . VAL C 1 410 ? 61.021  -26.051 29.495  1.00 30.19 ? 890  VAL C CG2 1 
ATOM   8268 N  N   . HIS C 1 411 ? 58.434  -23.793 32.483  1.00 30.28 ? 891  HIS C N   1 
ATOM   8269 C  CA  . HIS C 1 411 ? 57.714  -22.581 32.882  1.00 30.18 ? 891  HIS C CA  1 
ATOM   8270 C  C   . HIS C 1 411 ? 57.591  -22.375 34.395  1.00 30.30 ? 891  HIS C C   1 
ATOM   8271 O  O   . HIS C 1 411 ? 57.007  -21.387 34.841  1.00 30.22 ? 891  HIS C O   1 
ATOM   8272 C  CB  . HIS C 1 411 ? 56.345  -22.538 32.201  1.00 30.19 ? 891  HIS C CB  1 
ATOM   8273 C  CG  . HIS C 1 411 ? 56.410  -22.085 30.778  1.00 29.67 ? 891  HIS C CG  1 
ATOM   8274 N  ND1 . HIS C 1 411 ? 56.472  -20.755 30.429  1.00 29.86 ? 891  HIS C ND1 1 
ATOM   8275 C  CD2 . HIS C 1 411 ? 56.457  -22.782 29.619  1.00 29.21 ? 891  HIS C CD2 1 
ATOM   8276 C  CE1 . HIS C 1 411 ? 56.542  -20.650 29.115  1.00 29.83 ? 891  HIS C CE1 1 
ATOM   8277 N  NE2 . HIS C 1 411 ? 56.533  -21.866 28.599  1.00 29.39 ? 891  HIS C NE2 1 
ATOM   8278 N  N   . SER C 1 412 ? 58.162  -23.289 35.178  1.00 30.38 ? 892  SER C N   1 
ATOM   8279 C  CA  . SER C 1 412 ? 58.315  -23.084 36.618  1.00 30.42 ? 892  SER C CA  1 
ATOM   8280 C  C   . SER C 1 412 ? 59.177  -21.849 36.929  1.00 30.41 ? 892  SER C C   1 
ATOM   8281 O  O   . SER C 1 412 ? 59.106  -21.291 38.023  1.00 30.18 ? 892  SER C O   1 
ATOM   8282 C  CB  . SER C 1 412 ? 58.935  -24.323 37.265  1.00 30.48 ? 892  SER C CB  1 
ATOM   8283 O  OG  . SER C 1 412 ? 60.169  -24.650 36.649  1.00 30.68 ? 892  SER C OG  1 
ATOM   8284 N  N   . LYS C 1 413 ? 59.992  -21.435 35.963  1.00 30.50 ? 893  LYS C N   1 
ATOM   8285 C  CA  . LYS C 1 413 ? 60.822  -20.238 36.093  1.00 30.72 ? 893  LYS C CA  1 
ATOM   8286 C  C   . LYS C 1 413 ? 60.011  -18.930 36.065  1.00 30.61 ? 893  LYS C C   1 
ATOM   8287 O  O   . LYS C 1 413 ? 60.437  -17.929 36.639  1.00 30.46 ? 893  LYS C O   1 
ATOM   8288 C  CB  . LYS C 1 413 ? 61.868  -20.231 34.971  1.00 30.80 ? 893  LYS C CB  1 
ATOM   8289 C  CG  . LYS C 1 413 ? 62.906  -19.131 35.060  1.00 31.64 ? 893  LYS C CG  1 
ATOM   8290 C  CD  . LYS C 1 413 ? 64.002  -19.327 34.016  1.00 32.48 ? 893  LYS C CD  1 
ATOM   8291 C  CE  . LYS C 1 413 ? 64.981  -18.158 33.997  1.00 32.75 ? 893  LYS C CE  1 
ATOM   8292 N  NZ  . LYS C 1 413 ? 66.011  -18.303 32.929  1.00 32.84 ? 893  LYS C NZ  1 
ATOM   8293 N  N   . TYR C 1 414 ? 58.847  -18.944 35.411  1.00 30.59 ? 894  TYR C N   1 
ATOM   8294 C  CA  . TYR C 1 414 ? 58.087  -17.712 35.142  1.00 30.56 ? 894  TYR C CA  1 
ATOM   8295 C  C   . TYR C 1 414 ? 56.718  -17.610 35.829  1.00 30.66 ? 894  TYR C C   1 
ATOM   8296 O  O   . TYR C 1 414 ? 56.233  -16.500 36.064  1.00 30.70 ? 894  TYR C O   1 
ATOM   8297 C  CB  . TYR C 1 414 ? 57.890  -17.550 33.635  1.00 30.47 ? 894  TYR C CB  1 
ATOM   8298 C  CG  . TYR C 1 414 ? 59.162  -17.704 32.847  1.00 30.16 ? 894  TYR C CG  1 
ATOM   8299 C  CD1 . TYR C 1 414 ? 60.066  -16.654 32.734  1.00 29.82 ? 894  TYR C CD1 1 
ATOM   8300 C  CD2 . TYR C 1 414 ? 59.469  -18.906 32.220  1.00 30.43 ? 894  TYR C CD2 1 
ATOM   8301 C  CE1 . TYR C 1 414 ? 61.242  -16.798 32.013  1.00 30.10 ? 894  TYR C CE1 1 
ATOM   8302 C  CE2 . TYR C 1 414 ? 60.642  -19.062 31.495  1.00 30.45 ? 894  TYR C CE2 1 
ATOM   8303 C  CZ  . TYR C 1 414 ? 61.526  -18.006 31.394  1.00 30.35 ? 894  TYR C CZ  1 
ATOM   8304 O  OH  . TYR C 1 414 ? 62.695  -18.167 30.679  1.00 30.45 ? 894  TYR C OH  1 
ATOM   8305 N  N   . TRP C 1 415 ? 56.097  -18.747 36.138  1.00 30.66 ? 895  TRP C N   1 
ATOM   8306 C  CA  . TRP C 1 415 ? 54.728  -18.763 36.651  1.00 30.71 ? 895  TRP C CA  1 
ATOM   8307 C  C   . TRP C 1 415 ? 54.630  -19.506 37.977  1.00 30.96 ? 895  TRP C C   1 
ATOM   8308 O  O   . TRP C 1 415 ? 55.068  -20.649 38.089  1.00 30.84 ? 895  TRP C O   1 
ATOM   8309 C  CB  . TRP C 1 415 ? 53.793  -19.415 35.632  1.00 30.61 ? 895  TRP C CB  1 
ATOM   8310 C  CG  . TRP C 1 415 ? 53.847  -18.782 34.277  1.00 30.14 ? 895  TRP C CG  1 
ATOM   8311 C  CD1 . TRP C 1 415 ? 54.581  -19.200 33.208  1.00 29.68 ? 895  TRP C CD1 1 
ATOM   8312 C  CD2 . TRP C 1 415 ? 53.136  -17.618 33.844  1.00 29.80 ? 895  TRP C CD2 1 
ATOM   8313 N  NE1 . TRP C 1 415 ? 54.370  -18.373 32.134  1.00 29.44 ? 895  TRP C NE1 1 
ATOM   8314 C  CE2 . TRP C 1 415 ? 53.486  -17.392 32.496  1.00 29.36 ? 895  TRP C CE2 1 
ATOM   8315 C  CE3 . TRP C 1 415 ? 52.232  -16.744 34.465  1.00 30.23 ? 895  TRP C CE3 1 
ATOM   8316 C  CZ2 . TRP C 1 415 ? 52.972  -16.326 31.754  1.00 29.46 ? 895  TRP C CZ2 1 
ATOM   8317 C  CZ3 . TRP C 1 415 ? 51.716  -15.681 33.726  1.00 30.03 ? 895  TRP C CZ3 1 
ATOM   8318 C  CH2 . TRP C 1 415 ? 52.091  -15.483 32.384  1.00 29.74 ? 895  TRP C CH2 1 
ATOM   8319 N  N   . GLY C 1 416 ? 54.036  -18.852 38.971  1.00 31.41 ? 896  GLY C N   1 
ATOM   8320 C  CA  . GLY C 1 416 ? 53.850  -19.442 40.296  1.00 31.92 ? 896  GLY C CA  1 
ATOM   8321 C  C   . GLY C 1 416 ? 53.046  -20.730 40.290  1.00 32.33 ? 896  GLY C C   1 
ATOM   8322 O  O   . GLY C 1 416 ? 53.290  -21.624 41.103  1.00 32.23 ? 896  GLY C O   1 
ATOM   8323 N  N   . CYS C 1 417 ? 52.091  -20.829 39.366  1.00 32.91 ? 897  CYS C N   1 
ATOM   8324 C  CA  . CYS C 1 417 ? 51.267  -22.031 39.235  1.00 33.34 ? 897  CYS C CA  1 
ATOM   8325 C  C   . CYS C 1 417 ? 52.033  -23.211 38.623  1.00 33.54 ? 897  CYS C C   1 
ATOM   8326 O  O   . CYS C 1 417 ? 51.579  -24.352 38.716  1.00 33.59 ? 897  CYS C O   1 
ATOM   8327 C  CB  . CYS C 1 417 ? 50.015  -21.736 38.407  1.00 33.38 ? 897  CYS C CB  1 
ATOM   8328 S  SG  . CYS C 1 417 ? 50.344  -21.326 36.683  1.00 34.12 ? 897  CYS C SG  1 
ATOM   8329 N  N   . MET C 1 418 ? 53.178  -22.939 38.000  1.00 33.90 ? 898  MET C N   1 
ATOM   8330 C  CA  . MET C 1 418 ? 54.030  -23.995 37.442  1.00 34.25 ? 898  MET C CA  1 
ATOM   8331 C  C   . MET C 1 418 ? 55.171  -24.387 38.379  1.00 34.45 ? 898  MET C C   1 
ATOM   8332 O  O   . MET C 1 418 ? 55.852  -25.382 38.132  1.00 34.70 ? 898  MET C O   1 
ATOM   8333 C  CB  . MET C 1 418 ? 54.603  -23.561 36.092  1.00 34.22 ? 898  MET C CB  1 
ATOM   8334 C  CG  . MET C 1 418 ? 53.545  -23.204 35.060  1.00 34.90 ? 898  MET C CG  1 
ATOM   8335 S  SD  . MET C 1 418 ? 52.525  -24.607 34.554  1.00 35.70 ? 898  MET C SD  1 
ATOM   8336 C  CE  . MET C 1 418 ? 53.428  -25.162 33.113  1.00 34.91 ? 898  MET C CE  1 
ATOM   8337 N  N   . GLN C 1 419 ? 55.377  -23.618 39.448  1.00 34.65 ? 899  GLN C N   1 
ATOM   8338 C  CA  . GLN C 1 419 ? 56.448  -23.899 40.411  1.00 34.85 ? 899  GLN C CA  1 
ATOM   8339 C  C   . GLN C 1 419 ? 56.100  -25.075 41.325  1.00 34.82 ? 899  GLN C C   1 
ATOM   8340 O  O   . GLN C 1 419 ? 55.583  -24.890 42.428  1.00 34.84 ? 899  GLN C O   1 
ATOM   8341 C  CB  . GLN C 1 419 ? 56.758  -22.650 41.242  1.00 34.95 ? 899  GLN C CB  1 
ATOM   8342 C  CG  . GLN C 1 419 ? 57.510  -21.593 40.460  1.00 35.57 ? 899  GLN C CG  1 
ATOM   8343 C  CD  . GLN C 1 419 ? 57.481  -20.210 41.096  1.00 36.43 ? 899  GLN C CD  1 
ATOM   8344 O  OE1 . GLN C 1 419 ? 57.781  -19.209 40.434  1.00 36.60 ? 899  GLN C OE1 1 
ATOM   8345 N  NE2 . GLN C 1 419 ? 57.120  -20.144 42.376  1.00 36.62 ? 899  GLN C NE2 1 
HETATM 8346 ZN ZN  . ZN  D 2 .   ? -5.054  0.799   -9.695  1.00 32.35 ? 101  ZN  A ZN  1 
HETATM 8347 ZN ZN  . ZN  E 2 .   ? -3.636  1.917   -29.797 1.00 30.19 ? 102  ZN  A ZN  1 
HETATM 8348 K  K   . K   F 3 .   ? -6.211  -2.288  -3.436  1.00 61.65 ? 201  K   A K   1 
HETATM 8349 K  K   . K   G 3 .   ? -7.168  -16.231 1.923   1.00 65.03 ? 202  K   A K   1 
HETATM 8350 C  C1  . NU7 H 4 .   ? -8.636  6.416   -21.340 1.00 68.82 ? 1900 NU7 A C1  1 
HETATM 8351 N  N2  . NU7 H 4 .   ? -9.863  6.143   -20.564 1.00 68.69 ? 1900 NU7 A N2  1 
HETATM 8352 F  F01 . NU7 H 4 .   ? -2.606  -1.094  -12.654 1.00 64.54 ? 1900 NU7 A F01 1 
HETATM 8353 C  C02 . NU7 H 4 .   ? -3.790  -1.410  -12.141 1.00 65.44 ? 1900 NU7 A C02 1 
HETATM 8354 F  F03 . NU7 H 4 .   ? -4.088  -2.642  -12.528 1.00 65.36 ? 1900 NU7 A F03 1 
HETATM 8355 F  F04 . NU7 H 4 .   ? -3.788  -1.321  -10.815 1.00 65.93 ? 1900 NU7 A F04 1 
HETATM 8356 C  C05 . NU7 H 4 .   ? -4.830  -0.443  -12.623 1.00 65.35 ? 1900 NU7 A C05 1 
HETATM 8357 N  N06 . NU7 H 4 .   ? -5.925  -0.734  -13.301 1.00 65.69 ? 1900 NU7 A N06 1 
HETATM 8358 C  C07 . NU7 H 4 .   ? -6.618  0.456   -13.539 1.00 65.02 ? 1900 NU7 A C07 1 
HETATM 8359 N  N08 . NU7 H 4 .   ? -5.934  1.453   -13.012 1.00 65.27 ? 1900 NU7 A N08 1 
HETATM 8360 O  O09 . NU7 H 4 .   ? -4.788  0.926   -12.408 1.00 65.12 ? 1900 NU7 A O09 1 
HETATM 8361 C  C10 . NU7 H 4 .   ? -7.880  0.588   -14.286 1.00 64.49 ? 1900 NU7 A C10 1 
HETATM 8362 C  C11 . NU7 H 4 .   ? -8.590  -0.550  -14.685 1.00 64.26 ? 1900 NU7 A C11 1 
HETATM 8363 C  C12 . NU7 H 4 .   ? -9.781  -0.401  -15.411 1.00 64.45 ? 1900 NU7 A C12 1 
HETATM 8364 C  C13 . NU7 H 4 .   ? -10.254 0.877   -15.741 1.00 64.75 ? 1900 NU7 A C13 1 
HETATM 8365 C  C14 . NU7 H 4 .   ? -9.537  2.015   -15.341 1.00 65.14 ? 1900 NU7 A C14 1 
HETATM 8366 C  C15 . NU7 H 4 .   ? -8.344  1.866   -14.621 1.00 64.50 ? 1900 NU7 A C15 1 
HETATM 8367 C  C16 . NU7 H 4 .   ? -10.024 3.365   -15.710 1.00 66.08 ? 1900 NU7 A C16 1 
HETATM 8368 O  O17 . NU7 H 4 .   ? -11.233 3.615   -15.701 1.00 65.85 ? 1900 NU7 A O17 1 
HETATM 8369 N  N18 . NU7 H 4 .   ? -9.120  4.262   -16.115 1.00 66.85 ? 1900 NU7 A N18 1 
HETATM 8370 C  C19 . NU7 H 4 .   ? -9.485  5.572   -16.692 1.00 67.56 ? 1900 NU7 A C19 1 
HETATM 8371 C  C20 . NU7 H 4 .   ? -8.579  5.886   -17.896 1.00 67.92 ? 1900 NU7 A C20 1 
HETATM 8372 C  C21 . NU7 H 4 .   ? -8.970  7.259   -18.504 1.00 68.24 ? 1900 NU7 A C21 1 
HETATM 8373 C  C22 . NU7 H 4 .   ? -10.102 7.183   -19.549 1.00 68.59 ? 1900 NU7 A C22 1 
HETATM 8374 C  C24 . NU7 H 4 .   ? -9.792  4.822   -19.925 1.00 68.31 ? 1900 NU7 A C24 1 
HETATM 8375 C  C25 . NU7 H 4 .   ? -8.618  4.733   -18.931 1.00 68.06 ? 1900 NU7 A C25 1 
HETATM 8376 C  C26 . NU7 H 4 .   ? -7.165  5.968   -17.358 1.00 67.64 ? 1900 NU7 A C26 1 
HETATM 8377 N  N27 . NU7 H 4 .   ? -6.380  4.963   -16.998 1.00 67.23 ? 1900 NU7 A N27 1 
HETATM 8378 C  C28 . NU7 H 4 .   ? -5.093  5.270   -16.530 1.00 67.04 ? 1900 NU7 A C28 1 
HETATM 8379 C  C29 . NU7 H 4 .   ? -4.776  6.576   -16.499 1.00 67.55 ? 1900 NU7 A C29 1 
HETATM 8380 S  S30 . NU7 H 4 .   ? -6.207  7.429   -17.095 1.00 67.94 ? 1900 NU7 A S30 1 
HETATM 8381 C  C31 . NU7 H 4 .   ? -4.138  4.211   -16.093 1.00 66.37 ? 1900 NU7 A C31 1 
HETATM 8382 C  C32 . NU7 H 4 .   ? -2.750  4.446   -16.050 1.00 65.77 ? 1900 NU7 A C32 1 
HETATM 8383 C  C33 . NU7 H 4 .   ? -1.868  3.441   -15.635 1.00 65.78 ? 1900 NU7 A C33 1 
HETATM 8384 C  C34 . NU7 H 4 .   ? -2.360  2.188   -15.253 1.00 65.62 ? 1900 NU7 A C34 1 
HETATM 8385 C  C35 . NU7 H 4 .   ? -3.738  1.946   -15.290 1.00 65.97 ? 1900 NU7 A C35 1 
HETATM 8386 C  C36 . NU7 H 4 .   ? -4.625  2.952   -15.706 1.00 66.08 ? 1900 NU7 A C36 1 
HETATM 8387 ZN ZN  . ZN  I 2 .   ? 36.944  27.297  -14.947 1.00 34.57 ? 101  ZN  B ZN  1 
HETATM 8388 ZN ZN  . ZN  J 2 .   ? 39.315  26.781  -34.986 1.00 24.14 ? 102  ZN  B ZN  1 
HETATM 8389 K  K   . K   K 3 .   ? 33.956  25.899  -8.598  1.00 61.40 ? 201  K   B K   1 
HETATM 8390 K  K   . K   L 3 .   ? 23.831  16.327  -3.315  1.00 54.31 ? 202  K   B K   1 
HETATM 8391 C  C1  . NU7 M 4 .   ? 38.796  33.654  -27.420 1.00 74.17 ? 1900 NU7 B C1  1 
HETATM 8392 N  N2  . NU7 M 4 .   ? 37.562  34.217  -26.839 1.00 74.36 ? 1900 NU7 B N2  1 
HETATM 8393 F  F01 . NU7 M 4 .   ? 37.615  24.431  -17.636 1.00 64.87 ? 1900 NU7 B F01 1 
HETATM 8394 C  C02 . NU7 M 4 .   ? 36.422  24.984  -17.475 1.00 66.36 ? 1900 NU7 B C02 1 
HETATM 8395 F  F03 . NU7 M 4 .   ? 35.586  24.243  -18.188 1.00 65.53 ? 1900 NU7 B F03 1 
HETATM 8396 F  F04 . NU7 M 4 .   ? 36.068  25.042  -16.192 1.00 66.66 ? 1900 NU7 B F04 1 
HETATM 8397 C  C05 . NU7 M 4 .   ? 36.412  26.400  -17.982 1.00 67.01 ? 1900 NU7 B C05 1 
HETATM 8398 N  N06 . NU7 M 4 .   ? 35.423  26.979  -18.643 1.00 67.54 ? 1900 NU7 B N06 1 
HETATM 8399 C  C07 . NU7 M 4 .   ? 35.794  28.296  -18.932 1.00 67.51 ? 1900 NU7 B C07 1 
HETATM 8400 N  N08 . NU7 M 4 .   ? 37.006  28.502  -18.449 1.00 67.01 ? 1900 NU7 B N08 1 
HETATM 8401 O  O09 . NU7 M 4 .   ? 37.439  27.325  -17.822 1.00 67.38 ? 1900 NU7 B O09 1 
HETATM 8402 C  C10 . NU7 M 4 .   ? 34.982  29.279  -19.682 1.00 68.06 ? 1900 NU7 B C10 1 
HETATM 8403 C  C11 . NU7 M 4 .   ? 33.647  29.003  -20.001 1.00 67.99 ? 1900 NU7 B C11 1 
HETATM 8404 C  C12 . NU7 M 4 .   ? 32.901  29.942  -20.727 1.00 68.67 ? 1900 NU7 B C12 1 
HETATM 8405 C  C13 . NU7 M 4 .   ? 33.485  31.149  -21.142 1.00 69.23 ? 1900 NU7 B C13 1 
HETATM 8406 C  C14 . NU7 M 4 .   ? 34.821  31.418  -20.818 1.00 69.71 ? 1900 NU7 B C14 1 
HETATM 8407 C  C15 . NU7 M 4 .   ? 35.570  30.481  -20.102 1.00 68.51 ? 1900 NU7 B C15 1 
HETATM 8408 C  C16 . NU7 M 4 .   ? 35.480  32.665  -21.259 1.00 70.97 ? 1900 NU7 B C16 1 
HETATM 8409 O  O17 . NU7 M 4 .   ? 35.660  33.586  -20.471 1.00 71.58 ? 1900 NU7 B O17 1 
HETATM 8410 N  N18 . NU7 M 4 .   ? 35.903  32.709  -22.524 1.00 72.52 ? 1900 NU7 B N18 1 
HETATM 8411 C  C19 . NU7 M 4 .   ? 36.677  33.831  -23.096 1.00 73.29 ? 1900 NU7 B C19 1 
HETATM 8412 C  C20 . NU7 M 4 .   ? 37.839  33.349  -23.987 1.00 73.62 ? 1900 NU7 B C20 1 
HETATM 8413 C  C21 . NU7 M 4 .   ? 38.571  34.587  -24.564 1.00 73.76 ? 1900 NU7 B C21 1 
HETATM 8414 C  C22 . NU7 M 4 .   ? 37.876  35.210  -25.794 1.00 74.27 ? 1900 NU7 B C22 1 
HETATM 8415 C  C24 . NU7 M 4 .   ? 36.708  33.145  -26.308 1.00 74.11 ? 1900 NU7 B C24 1 
HETATM 8416 C  C25 . NU7 M 4 .   ? 37.382  32.409  -25.133 1.00 73.85 ? 1900 NU7 B C25 1 
HETATM 8417 C  C26 . NU7 M 4 .   ? 38.828  32.573  -23.131 1.00 73.47 ? 1900 NU7 B C26 1 
HETATM 8418 N  N27 . NU7 M 4 .   ? 38.780  31.301  -22.747 1.00 73.22 ? 1900 NU7 B N27 1 
HETATM 8419 C  C28 . NU7 M 4 .   ? 39.844  30.809  -21.964 1.00 72.96 ? 1900 NU7 B C28 1 
HETATM 8420 C  C29 . NU7 M 4 .   ? 40.829  31.676  -21.691 1.00 73.11 ? 1900 NU7 B C29 1 
HETATM 8421 S  S30 . NU7 M 4 .   ? 40.351  33.185  -22.469 1.00 73.21 ? 1900 NU7 B S30 1 
HETATM 8422 C  C31 . NU7 M 4 .   ? 39.911  29.401  -21.481 1.00 72.46 ? 1900 NU7 B C31 1 
HETATM 8423 C  C32 . NU7 M 4 .   ? 41.152  28.750  -21.360 1.00 72.23 ? 1900 NU7 B C32 1 
HETATM 8424 C  C33 . NU7 M 4 .   ? 41.236  27.423  -20.916 1.00 71.96 ? 1900 NU7 B C33 1 
HETATM 8425 C  C34 . NU7 M 4 .   ? 40.070  26.724  -20.593 1.00 71.83 ? 1900 NU7 B C34 1 
HETATM 8426 C  C35 . NU7 M 4 .   ? 38.829  27.362  -20.719 1.00 72.11 ? 1900 NU7 B C35 1 
HETATM 8427 C  C36 . NU7 M 4 .   ? 38.750  28.692  -21.163 1.00 72.29 ? 1900 NU7 B C36 1 
HETATM 8428 ZN ZN  . ZN  N 2 .   ? 46.346  -26.683 11.371  1.00 32.44 ? 101  ZN  C ZN  1 
HETATM 8429 ZN ZN  . ZN  O 2 .   ? 44.998  -25.991 -8.787  1.00 33.72 ? 102  ZN  C ZN  1 
HETATM 8430 K  K   . K   P 3 .   ? 48.464  -24.695 17.950  1.00 67.15 ? 201  K   C K   1 
HETATM 8431 K  K   . K   Q 3 .   ? 54.048  -13.711 23.724  1.00 86.48 ? 202  K   C K   1 
HETATM 8432 C  C1  . NU7 R 4 .   ? 47.914  -32.442 -1.015  1.00 86.52 ? 1900 NU7 C C1  1 
HETATM 8433 N  N2  . NU7 R 4 .   ? 48.988  -32.725 -0.046  1.00 86.69 ? 1900 NU7 C N2  1 
HETATM 8434 F  F01 . NU7 R 4 .   ? 44.862  -23.978 9.241   1.00 84.02 ? 1900 NU7 C F01 1 
HETATM 8435 C  C02 . NU7 R 4 .   ? 46.129  -23.949 8.846   1.00 84.06 ? 1900 NU7 C C02 1 
HETATM 8436 F  F03 . NU7 R 4 .   ? 46.230  -23.219 7.742   1.00 83.30 ? 1900 NU7 C F03 1 
HETATM 8437 F  F04 . NU7 R 4 .   ? 46.898  -23.443 9.802   1.00 84.06 ? 1900 NU7 C F04 1 
HETATM 8438 C  C05 . NU7 R 4 .   ? 46.607  -25.333 8.509   1.00 84.16 ? 1900 NU7 C C05 1 
HETATM 8439 N  N06 . NU7 R 4 .   ? 47.709  -25.579 7.835   1.00 84.18 ? 1900 NU7 C N06 1 
HETATM 8440 C  C07 . NU7 R 4 .   ? 47.853  -26.958 7.696   1.00 84.07 ? 1900 NU7 C C07 1 
HETATM 8441 N  N08 . NU7 R 4 .   ? 46.818  -27.544 8.276   1.00 84.31 ? 1900 NU7 C N08 1 
HETATM 8442 O  O09 . NU7 R 4 .   ? 45.995  -26.545 8.820   1.00 84.01 ? 1900 NU7 C O09 1 
HETATM 8443 C  C10 . NU7 R 4 .   ? 48.971  -27.601 6.975   1.00 83.95 ? 1900 NU7 C C10 1 
HETATM 8444 C  C11 . NU7 R 4 .   ? 50.150  -26.877 6.733   1.00 83.85 ? 1900 NU7 C C11 1 
HETATM 8445 C  C12 . NU7 R 4 .   ? 51.209  -27.470 6.033   1.00 83.71 ? 1900 NU7 C C12 1 
HETATM 8446 C  C13 . NU7 R 4 .   ? 51.092  -28.783 5.568   1.00 84.01 ? 1900 NU7 C C13 1 
HETATM 8447 C  C14 . NU7 R 4 .   ? 49.916  -29.503 5.815   1.00 84.43 ? 1900 NU7 C C14 1 
HETATM 8448 C  C15 . NU7 R 4 .   ? 48.848  -28.912 6.503   1.00 84.04 ? 1900 NU7 C C15 1 
HETATM 8449 C  C16 . NU7 R 4 .   ? 49.785  -30.879 5.305   1.00 85.06 ? 1900 NU7 C C16 1 
HETATM 8450 O  O17 . NU7 R 4 .   ? 50.584  -31.760 5.620   1.00 85.63 ? 1900 NU7 C O17 1 
HETATM 8451 N  N18 . NU7 R 4 .   ? 48.792  -31.087 4.451   1.00 85.57 ? 1900 NU7 C N18 1 
HETATM 8452 C  C19 . NU7 R 4 .   ? 48.619  -32.355 3.722   1.00 85.96 ? 1900 NU7 C C19 1 
HETATM 8453 C  C20 . NU7 R 4 .   ? 47.654  -32.135 2.551   1.00 86.28 ? 1900 NU7 C C20 1 
HETATM 8454 C  C21 . NU7 R 4 .   ? 47.421  -33.459 1.788   1.00 86.37 ? 1900 NU7 C C21 1 
HETATM 8455 C  C22 . NU7 R 4 .   ? 48.594  -33.827 0.852   1.00 86.57 ? 1900 NU7 C C22 1 
HETATM 8456 C  C24 . NU7 R 4 .   ? 49.332  -31.504 0.699   1.00 86.58 ? 1900 NU7 C C24 1 
HETATM 8457 C  C25 . NU7 R 4 .   ? 48.170  -31.029 1.595   1.00 86.50 ? 1900 NU7 C C25 1 
HETATM 8458 C  C26 . NU7 R 4 .   ? 46.373  -31.684 3.219   1.00 86.14 ? 1900 NU7 C C26 1 
HETATM 8459 N  N27 . NU7 R 4 .   ? 46.091  -30.466 3.652   1.00 86.11 ? 1900 NU7 C N27 1 
HETATM 8460 C  C28 . NU7 R 4 .   ? 44.840  -30.261 4.256   1.00 86.31 ? 1900 NU7 C C28 1 
HETATM 8461 C  C29 . NU7 R 4 .   ? 44.040  -31.339 4.337   1.00 86.30 ? 1900 NU7 C C29 1 
HETATM 8462 S  S30 . NU7 R 4 .   ? 44.953  -32.666 3.605   1.00 85.96 ? 1900 NU7 C S30 1 
HETATM 8463 C  C31 . NU7 R 4 .   ? 44.421  -28.926 4.765   1.00 86.24 ? 1900 NU7 C C31 1 
HETATM 8464 C  C32 . NU7 R 4 .   ? 45.390  -28.004 5.191   1.00 86.22 ? 1900 NU7 C C32 1 
HETATM 8465 C  C33 . NU7 R 4 .   ? 45.006  -26.741 5.668   1.00 86.07 ? 1900 NU7 C C33 1 
HETATM 8466 C  C34 . NU7 R 4 .   ? 43.652  -26.390 5.723   1.00 85.98 ? 1900 NU7 C C34 1 
HETATM 8467 C  C35 . NU7 R 4 .   ? 42.680  -27.304 5.298   1.00 86.09 ? 1900 NU7 C C35 1 
HETATM 8468 C  C36 . NU7 R 4 .   ? 43.061  -28.565 4.819   1.00 86.06 ? 1900 NU7 C C36 1 
HETATM 8469 O  O   . HOH S 5 .   ? 3.306   8.885   -27.229 1.00 32.28 ? 2001 HOH A O   1 
HETATM 8470 O  O   . HOH S 5 .   ? -3.983  9.191   -20.529 1.00 39.30 ? 2002 HOH A O   1 
HETATM 8471 O  O   . HOH S 5 .   ? -2.769  1.549   -21.717 1.00 23.90 ? 2003 HOH A O   1 
HETATM 8472 O  O   . HOH S 5 .   ? -5.305  1.517   -23.134 1.00 23.14 ? 2004 HOH A O   1 
HETATM 8473 O  O   . HOH S 5 .   ? -0.810  -0.135  -22.312 1.00 22.19 ? 2005 HOH A O   1 
HETATM 8474 O  O   . HOH S 5 .   ? 9.194   15.778  -6.069  1.00 44.68 ? 2006 HOH A O   1 
HETATM 8475 O  O   . HOH S 5 .   ? 20.211  14.467  -8.282  1.00 23.04 ? 2007 HOH A O   1 
HETATM 8476 O  O   . HOH S 5 .   ? 15.704  13.647  -10.254 1.00 39.29 ? 2008 HOH A O   1 
HETATM 8477 O  O   . HOH S 5 .   ? 20.087  4.938   2.529   1.00 18.98 ? 2009 HOH A O   1 
HETATM 8478 O  O   . HOH S 5 .   ? 19.553  -10.834 -13.016 1.00 32.02 ? 2010 HOH A O   1 
HETATM 8479 O  O   . HOH S 5 .   ? 13.343  -18.596 -8.163  1.00 43.80 ? 2011 HOH A O   1 
HETATM 8480 O  O   . HOH S 5 .   ? -4.796  -22.657 -11.404 1.00 38.80 ? 2012 HOH A O   1 
HETATM 8481 O  O   . HOH S 5 .   ? -8.363  -15.696 -20.434 1.00 25.72 ? 2013 HOH A O   1 
HETATM 8482 O  O   . HOH S 5 .   ? -0.885  -18.236 -28.500 1.00 42.91 ? 2014 HOH A O   1 
HETATM 8483 O  O   . HOH S 5 .   ? -8.876  -12.874 -21.344 1.00 21.91 ? 2015 HOH A O   1 
HETATM 8484 O  O   . HOH S 5 .   ? 5.712   -16.906 -27.181 1.00 40.99 ? 2016 HOH A O   1 
HETATM 8485 O  O   . HOH S 5 .   ? 0.983   -25.700 -33.633 1.00 30.12 ? 2017 HOH A O   1 
HETATM 8486 O  O   . HOH S 5 .   ? -3.346  1.014   -35.682 1.00 23.04 ? 2018 HOH A O   1 
HETATM 8487 O  O   . HOH S 5 .   ? -11.090 -11.091 -25.072 1.00 20.73 ? 2019 HOH A O   1 
HETATM 8488 O  O   . HOH S 5 .   ? -2.909  -1.999  -21.906 1.00 17.07 ? 2020 HOH A O   1 
HETATM 8489 O  O   . HOH S 5 .   ? 2.957   -11.153 -27.401 1.00 29.97 ? 2021 HOH A O   1 
HETATM 8490 O  O   . HOH S 5 .   ? 2.459   -10.375 -15.352 1.00 33.84 ? 2022 HOH A O   1 
HETATM 8491 O  O   . HOH S 5 .   ? 3.335   -7.562  -12.905 1.00 25.81 ? 2023 HOH A O   1 
HETATM 8492 O  O   . HOH S 5 .   ? 0.496   -8.810  -16.353 1.00 30.97 ? 2024 HOH A O   1 
HETATM 8493 O  O   . HOH S 5 .   ? 0.270   -8.927  -9.368  1.00 24.73 ? 2025 HOH A O   1 
HETATM 8494 O  O   . HOH S 5 .   ? -12.087 -11.592 -10.959 1.00 28.23 ? 2026 HOH A O   1 
HETATM 8495 O  O   . HOH S 5 .   ? 3.608   -17.696 13.152  1.00 39.20 ? 2027 HOH A O   1 
HETATM 8496 O  O   . HOH S 5 .   ? -3.005  -7.886  -5.251  1.00 27.00 ? 2028 HOH A O   1 
HETATM 8497 O  O   . HOH S 5 .   ? -5.571  2.149   -1.899  1.00 23.07 ? 2029 HOH A O   1 
HETATM 8498 O  O   . HOH S 5 .   ? -1.949  3.770   -4.310  1.00 27.55 ? 2030 HOH A O   1 
HETATM 8499 O  O   . HOH S 5 .   ? -8.570  -14.038 -0.870  1.00 18.07 ? 2031 HOH A O   1 
HETATM 8500 O  O   . HOH S 5 .   ? -8.489  -20.139 -2.798  1.00 27.31 ? 2032 HOH A O   1 
HETATM 8501 O  O   . HOH S 5 .   ? -11.718 -19.346 9.461   1.00 36.33 ? 2033 HOH A O   1 
HETATM 8502 O  O   . HOH S 5 .   ? -0.446  4.084   10.559  1.00 21.39 ? 2034 HOH A O   1 
HETATM 8503 O  O   . HOH S 5 .   ? 5.070   -11.719 11.297  1.00 37.28 ? 2035 HOH A O   1 
HETATM 8504 O  O   . HOH S 5 .   ? -13.564 -19.650 11.342  1.00 45.94 ? 2036 HOH A O   1 
HETATM 8505 O  O   . HOH S 5 .   ? -5.553  12.913  -6.682  1.00 24.08 ? 2037 HOH A O   1 
HETATM 8506 O  O   . HOH S 5 .   ? 3.301   10.799  -4.243  1.00 22.91 ? 2038 HOH A O   1 
HETATM 8507 O  O   . HOH S 5 .   ? 10.190  -1.291  10.418  1.00 33.44 ? 2039 HOH A O   1 
HETATM 8508 O  O   . HOH S 5 .   ? 9.144   -9.415  12.120  1.00 42.88 ? 2040 HOH A O   1 
HETATM 8509 O  O   . HOH S 5 .   ? 7.190   1.337   13.425  1.00 45.78 ? 2041 HOH A O   1 
HETATM 8510 O  O   . HOH S 5 .   ? 6.734   16.913  -6.161  1.00 34.55 ? 2042 HOH A O   1 
HETATM 8511 O  O   . HOH S 5 .   ? 12.793  1.955   7.164   1.00 22.29 ? 2043 HOH A O   1 
HETATM 8512 O  O   . HOH S 5 .   ? 1.229   20.780  12.611  1.00 37.61 ? 2044 HOH A O   1 
HETATM 8513 O  O   . HOH S 5 .   ? -9.763  16.694  13.197  1.00 33.09 ? 2045 HOH A O   1 
HETATM 8514 O  O   . HOH S 5 .   ? -19.855 1.567   17.276  1.00 22.28 ? 2046 HOH A O   1 
HETATM 8515 O  O   . HOH T 5 .   ? 37.426  21.610  -24.808 1.00 25.77 ? 2001 HOH B O   1 
HETATM 8516 O  O   . HOH T 5 .   ? 42.563  23.396  -29.740 1.00 31.59 ? 2002 HOH B O   1 
HETATM 8517 O  O   . HOH T 5 .   ? 38.882  24.740  -40.556 1.00 30.51 ? 2003 HOH B O   1 
HETATM 8518 O  O   . HOH T 5 .   ? 39.800  23.379  -27.386 1.00 26.45 ? 2004 HOH B O   1 
HETATM 8519 O  O   . HOH T 5 .   ? 41.166  20.005  -18.625 1.00 20.74 ? 2005 HOH B O   1 
HETATM 8520 O  O   . HOH T 5 .   ? 54.804  16.225  -22.389 1.00 33.97 ? 2006 HOH B O   1 
HETATM 8521 O  O   . HOH T 5 .   ? 61.473  19.942  -7.082  1.00 43.26 ? 2007 HOH B O   1 
HETATM 8522 O  O   . HOH T 5 .   ? 39.945  2.420   -23.882 1.00 30.85 ? 2008 HOH B O   1 
HETATM 8523 O  O   . HOH T 5 .   ? 42.564  3.346   -27.611 1.00 31.25 ? 2009 HOH B O   1 
HETATM 8524 O  O   . HOH T 5 .   ? 41.711  5.917   -29.013 1.00 44.17 ? 2010 HOH B O   1 
HETATM 8525 O  O   . HOH T 5 .   ? 30.909  0.892   -24.538 1.00 28.74 ? 2011 HOH B O   1 
HETATM 8526 O  O   . HOH T 5 .   ? 28.695  0.120   -22.852 1.00 33.61 ? 2012 HOH B O   1 
HETATM 8527 O  O   . HOH T 5 .   ? 21.479  9.480   -16.174 1.00 37.39 ? 2013 HOH B O   1 
HETATM 8528 O  O   . HOH T 5 .   ? 18.078  10.748  -24.696 1.00 28.05 ? 2014 HOH B O   1 
HETATM 8529 O  O   . HOH T 5 .   ? 25.165  19.540  -26.424 1.00 36.96 ? 2015 HOH B O   1 
HETATM 8530 O  O   . HOH T 5 .   ? 28.133  8.771   -34.498 1.00 47.89 ? 2016 HOH B O   1 
HETATM 8531 O  O   . HOH T 5 .   ? 33.952  6.189   -37.328 1.00 38.46 ? 2017 HOH B O   1 
HETATM 8532 O  O   . HOH T 5 .   ? 35.322  12.631  -32.646 1.00 17.22 ? 2018 HOH B O   1 
HETATM 8533 O  O   . HOH T 5 .   ? 28.392  2.360   -36.144 1.00 44.45 ? 2019 HOH B O   1 
HETATM 8534 O  O   . HOH T 5 .   ? 29.245  27.264  -23.990 1.00 34.56 ? 2020 HOH B O   1 
HETATM 8535 O  O   . HOH T 5 .   ? 36.990  23.336  -26.892 1.00 26.10 ? 2021 HOH B O   1 
HETATM 8536 O  O   . HOH T 5 .   ? 42.874  16.645  -36.889 1.00 15.84 ? 2022 HOH B O   1 
HETATM 8537 O  O   . HOH T 5 .   ? 37.083  17.975  -37.599 1.00 20.05 ? 2023 HOH B O   1 
HETATM 8538 O  O   . HOH T 5 .   ? 31.043  15.037  -39.697 1.00 33.79 ? 2024 HOH B O   1 
HETATM 8539 O  O   . HOH T 5 .   ? 35.083  13.869  -20.567 1.00 24.43 ? 2025 HOH B O   1 
HETATM 8540 O  O   . HOH T 5 .   ? 43.419  5.550   0.145   1.00 43.87 ? 2026 HOH B O   1 
HETATM 8541 O  O   . HOH T 5 .   ? 51.746  7.400   3.408   1.00 32.15 ? 2027 HOH B O   1 
HETATM 8542 O  O   . HOH T 5 .   ? 37.338  15.792  -17.814 1.00 28.24 ? 2028 HOH B O   1 
HETATM 8543 O  O   . HOH T 5 .   ? 34.617  16.530  -21.459 1.00 25.12 ? 2029 HOH B O   1 
HETATM 8544 O  O   . HOH T 5 .   ? 34.291  16.825  -14.428 1.00 22.66 ? 2030 HOH B O   1 
HETATM 8545 O  O   . HOH T 5 .   ? 20.211  18.882  -18.711 1.00 63.56 ? 2031 HOH B O   1 
HETATM 8546 O  O   . HOH T 5 .   ? 20.810  22.879  -19.656 1.00 56.79 ? 2032 HOH B O   1 
HETATM 8547 O  O   . HOH T 5 .   ? 23.314  22.866  -16.043 1.00 31.71 ? 2033 HOH B O   1 
HETATM 8548 O  O   . HOH T 5 .   ? 25.898  5.467   -2.255  1.00 23.53 ? 2034 HOH B O   1 
HETATM 8549 O  O   . HOH T 5 .   ? 32.638  19.689  -10.369 1.00 26.72 ? 2035 HOH B O   1 
HETATM 8550 O  O   . HOH T 5 .   ? 40.924  27.505  -9.560  1.00 31.07 ? 2036 HOH B O   1 
HETATM 8551 O  O   . HOH T 5 .   ? 30.856  30.864  -12.028 1.00 14.82 ? 2037 HOH B O   1 
HETATM 8552 O  O   . HOH T 5 .   ? 24.231  18.986  -6.123  1.00 24.69 ? 2038 HOH B O   1 
HETATM 8553 O  O   . HOH T 5 .   ? 20.318  22.737  -10.555 1.00 31.90 ? 2039 HOH B O   1 
HETATM 8554 O  O   . HOH T 5 .   ? 16.996  25.727  -5.598  1.00 36.80 ? 2040 HOH B O   1 
HETATM 8555 O  O   . HOH T 5 .   ? 18.788  25.057  -9.467  1.00 38.43 ? 2041 HOH B O   1 
HETATM 8556 O  O   . HOH T 5 .   ? 22.419  31.436  -9.995  1.00 28.44 ? 2042 HOH B O   1 
HETATM 8557 O  O   . HOH T 5 .   ? 31.944  39.292  -15.900 1.00 42.94 ? 2043 HOH B O   1 
HETATM 8558 O  O   . HOH T 5 .   ? 27.963  31.130  -11.968 1.00 24.42 ? 2044 HOH B O   1 
HETATM 8559 O  O   . HOH T 5 .   ? 25.255  30.030  -19.502 1.00 47.64 ? 2045 HOH B O   1 
HETATM 8560 O  O   . HOH T 5 .   ? 23.480  27.280  -16.525 1.00 35.73 ? 2046 HOH B O   1 
HETATM 8561 O  O   . HOH T 5 .   ? 24.910  34.000  -4.240  1.00 20.91 ? 2047 HOH B O   1 
HETATM 8562 O  O   . HOH T 5 .   ? 19.187  33.029  -5.869  1.00 30.21 ? 2048 HOH B O   1 
HETATM 8563 O  O   . HOH T 5 .   ? 16.973  29.095  -5.414  1.00 44.60 ? 2049 HOH B O   1 
HETATM 8564 O  O   . HOH T 5 .   ? 27.361  40.720  -6.046  1.00 36.22 ? 2050 HOH B O   1 
HETATM 8565 O  O   . HOH T 5 .   ? 40.279  39.843  -7.121  1.00 32.14 ? 2051 HOH B O   1 
HETATM 8566 O  O   . HOH T 5 .   ? 41.326  45.018  -9.521  1.00 13.49 ? 2052 HOH B O   1 
HETATM 8567 O  O   . HOH T 5 .   ? 43.626  38.641  -1.258  1.00 29.83 ? 2053 HOH B O   1 
HETATM 8568 O  O   . HOH T 5 .   ? 46.599  36.007  -2.696  1.00 17.00 ? 2054 HOH B O   1 
HETATM 8569 O  O   . HOH T 5 .   ? 51.060  33.602  -0.669  1.00 43.26 ? 2055 HOH B O   1 
HETATM 8570 O  O   . HOH T 5 .   ? 42.460  33.548  5.961   1.00 17.66 ? 2056 HOH B O   1 
HETATM 8571 O  O   . HOH T 5 .   ? 44.071  28.614  7.315   1.00 19.96 ? 2057 HOH B O   1 
HETATM 8572 O  O   . HOH T 5 .   ? 32.650  6.853   6.347   1.00 41.04 ? 2058 HOH B O   1 
HETATM 8573 O  O   . HOH T 5 .   ? 44.519  36.696  -12.103 1.00 22.81 ? 2059 HOH B O   1 
HETATM 8574 O  O   . HOH T 5 .   ? 41.585  24.844  7.463   1.00 32.13 ? 2060 HOH B O   1 
HETATM 8575 O  O   . HOH T 5 .   ? 37.868  16.886  -15.299 1.00 32.54 ? 2061 HOH B O   1 
HETATM 8576 O  O   . HOH T 5 .   ? 56.310  31.304  -10.892 1.00 35.77 ? 2062 HOH B O   1 
HETATM 8577 O  O   . HOH T 5 .   ? 48.475  36.130  -0.058  1.00 36.37 ? 2063 HOH B O   1 
HETATM 8578 O  O   . HOH T 5 .   ? 25.888  38.265  3.475   1.00 23.69 ? 2064 HOH B O   1 
HETATM 8579 O  O   . HOH T 5 .   ? 27.084  33.137  12.133  1.00 34.85 ? 2065 HOH B O   1 
HETATM 8580 O  O   . HOH T 5 .   ? 23.992  37.106  5.695   1.00 33.63 ? 2066 HOH B O   1 
HETATM 8581 O  O   . HOH T 5 .   ? 21.004  34.097  0.195   1.00 40.46 ? 2067 HOH B O   1 
HETATM 8582 O  O   . HOH T 5 .   ? 18.323  28.331  4.974   1.00 31.51 ? 2068 HOH B O   1 
HETATM 8583 O  O   . HOH T 5 .   ? 24.593  30.518  12.203  1.00 34.69 ? 2069 HOH B O   1 
HETATM 8584 O  O   . HOH U 5 .   ? 40.878  -34.549 -7.881  1.00 15.41 ? 2001 HOH C O   1 
HETATM 8585 O  O   . HOH U 5 .   ? 19.641  -20.217 13.001  1.00 15.17 ? 2002 HOH C O   1 
HETATM 8586 O  O   . HOH U 5 .   ? 35.105  -4.197  -1.341  1.00 31.38 ? 2003 HOH C O   1 
HETATM 8587 O  O   . HOH U 5 .   ? 58.398  -3.389  6.014   1.00 23.91 ? 2004 HOH C O   1 
HETATM 8588 O  O   . HOH U 5 .   ? 59.280  2.932   2.108   1.00 31.43 ? 2005 HOH C O   1 
HETATM 8589 O  O   . HOH U 5 .   ? 43.989  -11.624 -5.432  1.00 27.10 ? 2006 HOH C O   1 
HETATM 8590 O  O   . HOH U 5 .   ? 53.489  -24.096 2.815   1.00 31.97 ? 2007 HOH C O   1 
HETATM 8591 O  O   . HOH U 5 .   ? 37.220  -11.044 -4.792  1.00 13.38 ? 2008 HOH C O   1 
HETATM 8592 O  O   . HOH U 5 .   ? 49.018  2.216   22.170  1.00 27.85 ? 2009 HOH C O   1 
HETATM 8593 O  O   . HOH U 5 .   ? 51.494  -10.841 34.005  1.00 28.85 ? 2010 HOH C O   1 
HETATM 8594 O  O   . HOH U 5 .   ? 61.184  -6.592  25.202  1.00 20.33 ? 2011 HOH C O   1 
HETATM 8595 O  O   . HOH U 5 .   ? 57.049  -22.758 26.121  1.00 16.02 ? 2012 HOH C O   1 
HETATM 8596 O  O   . HOH U 5 .   ? 46.926  -44.132 17.861  1.00 19.35 ? 2013 HOH C O   1 
HETATM 8597 O  O   . HOH U 5 .   ? 46.825  -39.768 18.516  1.00 26.32 ? 2014 HOH C O   1 
HETATM 8598 O  O   . HOH U 5 .   ? 38.977  -38.121 22.717  1.00 12.95 ? 2015 HOH C O   1 
HETATM 8599 O  O   . HOH U 5 .   ? 23.423  -25.415 29.624  1.00 19.94 ? 2016 HOH C O   1 
HETATM 8600 O  O   . HOH U 5 .   ? 27.261  -32.755 28.319  1.00 33.33 ? 2017 HOH C O   1 
HETATM 8601 O  O   . HOH U 5 .   ? 54.631  -13.673 34.671  1.00 24.59 ? 2018 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   481 ?   ?   ?   A . n 
A 1 2   SER 2   482 ?   ?   ?   A . n 
A 1 3   ARG 3   483 ?   ?   ?   A . n 
A 1 4   ALA 4   484 ?   ?   ?   A . n 
A 1 5   GLN 5   485 ?   ?   ?   A . n 
A 1 6   SER 6   486 ?   ?   ?   A . n 
A 1 7   SER 7   487 ?   ?   ?   A . n 
A 1 8   PRO 8   488 ?   ?   ?   A . n 
A 1 9   ALA 9   489 ?   ?   ?   A . n 
A 1 10  ALA 10  490 ?   ?   ?   A . n 
A 1 11  PRO 11  491 ?   ?   ?   A . n 
A 1 12  ALA 12  492 ?   ?   ?   A . n 
A 1 13  SER 13  493 ?   ?   ?   A . n 
A 1 14  LEU 14  494 ?   ?   ?   A . n 
A 1 15  SER 15  495 ?   ?   ?   A . n 
A 1 16  ALA 16  496 ?   ?   ?   A . n 
A 1 17  PRO 17  497 ?   ?   ?   A . n 
A 1 18  GLU 18  498 ?   ?   ?   A . n 
A 1 19  PRO 19  499 ?   ?   ?   A . n 
A 1 20  ALA 20  500 ?   ?   ?   A . n 
A 1 21  SER 21  501 ?   ?   ?   A . n 
A 1 22  GLN 22  502 ?   ?   ?   A . n 
A 1 23  ALA 23  503 ?   ?   ?   A . n 
A 1 24  ARG 24  504 ?   ?   ?   A . n 
A 1 25  VAL 25  505 ?   ?   ?   A . n 
A 1 26  LEU 26  506 ?   ?   ?   A . n 
A 1 27  SER 27  507 ?   ?   ?   A . n 
A 1 28  SER 28  508 ?   ?   ?   A . n 
A 1 29  SER 29  509 ?   ?   ?   A . n 
A 1 30  GLU 30  510 ?   ?   ?   A . n 
A 1 31  THR 31  511 ?   ?   ?   A . n 
A 1 32  PRO 32  512 ?   ?   ?   A . n 
A 1 33  ALA 33  513 ?   ?   ?   A . n 
A 1 34  ARG 34  514 ?   ?   ?   A . n 
A 1 35  THR 35  515 ?   ?   ?   A . n 
A 1 36  LEU 36  516 516 LEU LEU A . n 
A 1 37  PRO 37  517 517 PRO PRO A . n 
A 1 38  PHE 38  518 518 PHE PHE A . n 
A 1 39  THR 39  519 519 THR THR A . n 
A 1 40  THR 40  520 520 THR THR A . n 
A 1 41  GLY 41  521 521 GLY GLY A . n 
A 1 42  LEU 42  522 522 LEU LEU A . n 
A 1 43  ILE 43  523 523 ILE ILE A . n 
A 1 44  TYR 44  524 524 TYR TYR A . n 
A 1 45  ASP 45  525 525 ASP ASP A . n 
A 1 46  SER 46  526 526 SER SER A . n 
A 1 47  VAL 47  527 527 VAL VAL A . n 
A 1 48  MET 48  528 528 MET MET A . n 
A 1 49  LEU 49  529 529 LEU LEU A . n 
A 1 50  LYS 50  530 530 LYS LYS A . n 
A 1 51  HIS 51  531 531 HIS HIS A . n 
A 1 52  GLN 52  532 532 GLN GLN A . n 
A 1 53  CYS 53  533 533 CYS CYS A . n 
A 1 54  SER 54  534 534 SER SER A . n 
A 1 55  CYS 55  535 535 CYS CYS A . n 
A 1 56  GLY 56  536 536 GLY GLY A . n 
A 1 57  ASP 57  537 537 ASP ASP A . n 
A 1 58  ASN 58  538 538 ASN ASN A . n 
A 1 59  SER 59  539 539 SER SER A . n 
A 1 60  ARG 60  540 540 ARG ARG A . n 
A 1 61  HIS 61  541 541 HIS HIS A . n 
A 1 62  PRO 62  542 542 PRO PRO A . n 
A 1 63  GLU 63  543 543 GLU GLU A . n 
A 1 64  HIS 64  544 544 HIS HIS A . n 
A 1 65  ALA 65  545 545 ALA ALA A . n 
A 1 66  GLY 66  546 546 GLY GLY A . n 
A 1 67  ARG 67  547 547 ARG ARG A . n 
A 1 68  ILE 68  548 548 ILE ILE A . n 
A 1 69  GLN 69  549 549 GLN GLN A . n 
A 1 70  SER 70  550 550 SER SER A . n 
A 1 71  ILE 71  551 551 ILE ILE A . n 
A 1 72  TRP 72  552 552 TRP TRP A . n 
A 1 73  SER 73  553 553 SER SER A . n 
A 1 74  ARG 74  554 554 ARG ARG A . n 
A 1 75  LEU 75  555 555 LEU LEU A . n 
A 1 76  GLN 76  556 556 GLN GLN A . n 
A 1 77  GLU 77  557 557 GLU GLU A . n 
A 1 78  ARG 78  558 558 ARG ARG A . n 
A 1 79  GLY 79  559 559 GLY GLY A . n 
A 1 80  LEU 80  560 560 LEU LEU A . n 
A 1 81  ARG 81  561 561 ARG ARG A . n 
A 1 82  SER 82  562 562 SER SER A . n 
A 1 83  GLN 83  563 563 GLN GLN A . n 
A 1 84  CYS 84  564 564 CYS CYS A . n 
A 1 85  GLU 85  565 565 GLU GLU A . n 
A 1 86  CYS 86  566 566 CYS CYS A . n 
A 1 87  LEU 87  567 567 LEU LEU A . n 
A 1 88  ARG 88  568 568 ARG ARG A . n 
A 1 89  GLY 89  569 569 GLY GLY A . n 
A 1 90  ARG 90  570 570 ARG ARG A . n 
A 1 91  LYS 91  571 571 LYS LYS A . n 
A 1 92  ALA 92  572 572 ALA ALA A . n 
A 1 93  SER 93  573 573 SER SER A . n 
A 1 94  LEU 94  574 574 LEU LEU A . n 
A 1 95  GLU 95  575 575 GLU GLU A . n 
A 1 96  GLU 96  576 576 GLU GLU A . n 
A 1 97  LEU 97  577 577 LEU LEU A . n 
A 1 98  GLN 98  578 578 GLN GLN A . n 
A 1 99  SER 99  579 579 SER SER A . n 
A 1 100 VAL 100 580 580 VAL VAL A . n 
A 1 101 HIS 101 581 581 HIS HIS A . n 
A 1 102 SER 102 582 582 SER SER A . n 
A 1 103 GLU 103 583 583 GLU GLU A . n 
A 1 104 ARG 104 584 584 ARG ARG A . n 
A 1 105 HIS 105 585 585 HIS HIS A . n 
A 1 106 VAL 106 586 586 VAL VAL A . n 
A 1 107 LEU 107 587 587 LEU LEU A . n 
A 1 108 LEU 108 588 588 LEU LEU A . n 
A 1 109 TYR 109 589 589 TYR TYR A . n 
A 1 110 GLY 110 590 590 GLY GLY A . n 
A 1 111 THR 111 591 591 THR THR A . n 
A 1 112 ASN 112 592 592 ASN ASN A . n 
A 1 113 PRO 113 593 593 PRO PRO A . n 
A 1 114 LEU 114 594 594 LEU LEU A . n 
A 1 115 SER 115 595 595 SER SER A . n 
A 1 116 ARG 116 596 ?   ?   ?   A . n 
A 1 117 LEU 117 597 ?   ?   ?   A . n 
A 1 118 LYS 118 598 ?   ?   ?   A . n 
A 1 119 LEU 119 599 ?   ?   ?   A . n 
A 1 120 ASP 120 600 ?   ?   ?   A . n 
A 1 121 ASN 121 601 ?   ?   ?   A . n 
A 1 122 GLY 122 602 ?   ?   ?   A . n 
A 1 123 LYS 123 603 ?   ?   ?   A . n 
A 1 124 LEU 124 604 ?   ?   ?   A . n 
A 1 125 ALA 125 605 ?   ?   ?   A . n 
A 1 126 GLY 126 606 ?   ?   ?   A . n 
A 1 127 LEU 127 607 ?   ?   ?   A . n 
A 1 128 LEU 128 608 ?   ?   ?   A . n 
A 1 129 ALA 129 609 ?   ?   ?   A . n 
A 1 130 GLN 130 610 ?   ?   ?   A . n 
A 1 131 ARG 131 611 ?   ?   ?   A . n 
A 1 132 MET 132 612 ?   ?   ?   A . n 
A 1 133 PHE 133 613 ?   ?   ?   A . n 
A 1 134 VAL 134 614 614 VAL VAL A . n 
A 1 135 MET 135 615 615 MET MET A . n 
A 1 136 LEU 136 616 616 LEU LEU A . n 
A 1 137 PRO 137 617 617 PRO PRO A . n 
A 1 138 CYS 138 618 618 CYS CYS A . n 
A 1 139 GLY 139 619 619 GLY GLY A . n 
A 1 140 GLY 140 620 620 GLY GLY A . n 
A 1 141 VAL 141 621 621 VAL VAL A . n 
A 1 142 GLY 142 622 622 GLY GLY A . n 
A 1 143 VAL 143 623 623 VAL VAL A . n 
A 1 144 ASP 144 624 624 ASP ASP A . n 
A 1 145 THR 145 625 625 THR THR A . n 
A 1 146 ASP 146 626 626 ASP ASP A . n 
A 1 147 THR 147 627 627 THR THR A . n 
A 1 148 ILE 148 628 628 ILE ILE A . n 
A 1 149 TRP 149 629 629 TRP TRP A . n 
A 1 150 ASN 150 630 630 ASN ASN A . n 
A 1 151 GLU 151 631 631 GLU GLU A . n 
A 1 152 LEU 152 632 632 LEU LEU A . n 
A 1 153 HIS 153 633 633 HIS HIS A . n 
A 1 154 SER 154 634 634 SER SER A . n 
A 1 155 SER 155 635 635 SER SER A . n 
A 1 156 ASN 156 636 636 ASN ASN A . n 
A 1 157 ALA 157 637 637 ALA ALA A . n 
A 1 158 ALA 158 638 638 ALA ALA A . n 
A 1 159 ARG 159 639 639 ARG ARG A . n 
A 1 160 TRP 160 640 640 TRP TRP A . n 
A 1 161 ALA 161 641 641 ALA ALA A . n 
A 1 162 ALA 162 642 642 ALA ALA A . n 
A 1 163 GLY 163 643 643 GLY GLY A . n 
A 1 164 SER 164 644 644 SER SER A . n 
A 1 165 VAL 165 645 645 VAL VAL A . n 
A 1 166 THR 166 646 646 THR THR A . n 
A 1 167 ASP 167 647 647 ASP ASP A . n 
A 1 168 LEU 168 648 648 LEU LEU A . n 
A 1 169 ALA 169 649 649 ALA ALA A . n 
A 1 170 PHE 170 650 650 PHE PHE A . n 
A 1 171 LYS 171 651 651 LYS LYS A . n 
A 1 172 VAL 172 652 652 VAL VAL A . n 
A 1 173 ALA 173 653 653 ALA ALA A . n 
A 1 174 SER 174 654 654 SER SER A . n 
A 1 175 ARG 175 655 655 ARG ARG A . n 
A 1 176 GLU 176 656 656 GLU GLU A . n 
A 1 177 LEU 177 657 657 LEU LEU A . n 
A 1 178 LYS 178 658 658 LYS LYS A . n 
A 1 179 ASN 179 659 659 ASN ASN A . n 
A 1 180 GLY 180 660 660 GLY GLY A . n 
A 1 181 PHE 181 661 661 PHE PHE A . n 
A 1 182 ALA 182 662 662 ALA ALA A . n 
A 1 183 VAL 183 663 663 VAL VAL A . n 
A 1 184 VAL 184 664 664 VAL VAL A . n 
A 1 185 ARG 185 665 665 ARG ARG A . n 
A 1 186 PRO 186 666 666 PRO PRO A . n 
A 1 187 PRO 187 667 667 PRO PRO A . n 
A 1 188 GLY 188 668 668 GLY GLY A . n 
A 1 189 HIS 189 669 669 HIS HIS A . n 
A 1 190 HIS 190 670 670 HIS HIS A . n 
A 1 191 ALA 191 671 671 ALA ALA A . n 
A 1 192 ASP 192 672 672 ASP ASP A . n 
A 1 193 HIS 193 673 673 HIS HIS A . n 
A 1 194 SER 194 674 674 SER SER A . n 
A 1 195 THR 195 675 675 THR THR A . n 
A 1 196 ALA 196 676 676 ALA ALA A . n 
A 1 197 MET 197 677 677 MET MET A . n 
A 1 198 GLY 198 678 678 GLY GLY A . n 
A 1 199 PHE 199 679 679 PHE PHE A . n 
A 1 200 CYS 200 680 680 CYS CYS A . n 
A 1 201 PHE 201 681 681 PHE PHE A . n 
A 1 202 PHE 202 682 682 PHE PHE A . n 
A 1 203 ASN 203 683 683 ASN ASN A . n 
A 1 204 SER 204 684 684 SER SER A . n 
A 1 205 VAL 205 685 685 VAL VAL A . n 
A 1 206 ALA 206 686 686 ALA ALA A . n 
A 1 207 ILE 207 687 687 ILE ILE A . n 
A 1 208 ALA 208 688 688 ALA ALA A . n 
A 1 209 CYS 209 689 689 CYS CYS A . n 
A 1 210 ARG 210 690 690 ARG ARG A . n 
A 1 211 GLN 211 691 691 GLN GLN A . n 
A 1 212 LEU 212 692 692 LEU LEU A . n 
A 1 213 GLN 213 693 693 GLN GLN A . n 
A 1 214 GLN 214 694 694 GLN GLN A . n 
A 1 215 GLN 215 695 695 GLN GLN A . n 
A 1 216 SER 216 696 696 SER SER A . n 
A 1 217 LYS 217 697 697 LYS LYS A . n 
A 1 218 ALA 218 698 698 ALA ALA A . n 
A 1 219 SER 219 699 699 SER SER A . n 
A 1 220 LYS 220 700 700 LYS LYS A . n 
A 1 221 ILE 221 701 701 ILE ILE A . n 
A 1 222 LEU 222 702 702 LEU LEU A . n 
A 1 223 ILE 223 703 703 ILE ILE A . n 
A 1 224 VAL 224 704 704 VAL VAL A . n 
A 1 225 ASP 225 705 705 ASP ASP A . n 
A 1 226 TRP 226 706 706 TRP TRP A . n 
A 1 227 ASP 227 707 707 ASP ASP A . n 
A 1 228 VAL 228 708 708 VAL VAL A . n 
A 1 229 HIS 229 709 709 HIS HIS A . n 
A 1 230 HIS 230 710 710 HIS HIS A . n 
A 1 231 GLY 231 711 711 GLY GLY A . n 
A 1 232 ASN 232 712 712 ASN ASN A . n 
A 1 233 GLY 233 713 713 GLY GLY A . n 
A 1 234 THR 234 714 714 THR THR A . n 
A 1 235 GLN 235 715 715 GLN GLN A . n 
A 1 236 GLN 236 716 716 GLN GLN A . n 
A 1 237 THR 237 717 717 THR THR A . n 
A 1 238 PHE 238 718 718 PHE PHE A . n 
A 1 239 TYR 239 719 719 TYR TYR A . n 
A 1 240 GLN 240 720 720 GLN GLN A . n 
A 1 241 ASP 241 721 721 ASP ASP A . n 
A 1 242 PRO 242 722 722 PRO PRO A . n 
A 1 243 SER 243 723 723 SER SER A . n 
A 1 244 VAL 244 724 724 VAL VAL A . n 
A 1 245 LEU 245 725 725 LEU LEU A . n 
A 1 246 TYR 246 726 726 TYR TYR A . n 
A 1 247 ILE 247 727 727 ILE ILE A . n 
A 1 248 SER 248 728 728 SER SER A . n 
A 1 249 LEU 249 729 729 LEU LEU A . n 
A 1 250 HIS 250 730 730 HIS HIS A . n 
A 1 251 ARG 251 731 731 ARG ARG A . n 
A 1 252 HIS 252 732 732 HIS HIS A . n 
A 1 253 ASP 253 733 733 ASP ASP A . n 
A 1 254 ASP 254 734 734 ASP ASP A . n 
A 1 255 GLY 255 735 735 GLY GLY A . n 
A 1 256 ASN 256 736 736 ASN ASN A . n 
A 1 257 PHE 257 737 737 PHE PHE A . n 
A 1 258 PHE 258 738 738 PHE PHE A . n 
A 1 259 PRO 259 739 739 PRO PRO A . n 
A 1 260 GLY 260 740 740 GLY GLY A . n 
A 1 261 SER 261 741 741 SER SER A . n 
A 1 262 GLY 262 742 742 GLY GLY A . n 
A 1 263 ALA 263 743 743 ALA ALA A . n 
A 1 264 VAL 264 744 744 VAL VAL A . n 
A 1 265 ASP 265 745 745 ASP ASP A . n 
A 1 266 GLU 266 746 746 GLU GLU A . n 
A 1 267 VAL 267 747 747 VAL VAL A . n 
A 1 268 GLY 268 748 748 GLY GLY A . n 
A 1 269 ALA 269 749 749 ALA ALA A . n 
A 1 270 GLY 270 750 750 GLY GLY A . n 
A 1 271 SER 271 751 751 SER SER A . n 
A 1 272 GLY 272 752 752 GLY GLY A . n 
A 1 273 GLU 273 753 753 GLU GLU A . n 
A 1 274 GLY 274 754 754 GLY GLY A . n 
A 1 275 PHE 275 755 755 PHE PHE A . n 
A 1 276 ASN 276 756 756 ASN ASN A . n 
A 1 277 VAL 277 757 757 VAL VAL A . n 
A 1 278 ASN 278 758 758 ASN ASN A . n 
A 1 279 VAL 279 759 759 VAL VAL A . n 
A 1 280 ALA 280 760 760 ALA ALA A . n 
A 1 281 TRP 281 761 761 TRP TRP A . n 
A 1 282 ALA 282 762 762 ALA ALA A . n 
A 1 283 GLY 283 763 763 GLY GLY A . n 
A 1 284 GLY 284 764 764 GLY GLY A . n 
A 1 285 LEU 285 765 765 LEU LEU A . n 
A 1 286 ASP 286 766 766 ASP ASP A . n 
A 1 287 PRO 287 767 767 PRO PRO A . n 
A 1 288 PRO 288 768 768 PRO PRO A . n 
A 1 289 MET 289 769 769 MET MET A . n 
A 1 290 GLY 290 770 770 GLY GLY A . n 
A 1 291 ASP 291 771 771 ASP ASP A . n 
A 1 292 PRO 292 772 772 PRO PRO A . n 
A 1 293 GLU 293 773 773 GLU GLU A . n 
A 1 294 TYR 294 774 774 TYR TYR A . n 
A 1 295 LEU 295 775 775 LEU LEU A . n 
A 1 296 ALA 296 776 776 ALA ALA A . n 
A 1 297 ALA 297 777 777 ALA ALA A . n 
A 1 298 PHE 298 778 778 PHE PHE A . n 
A 1 299 ARG 299 779 779 ARG ARG A . n 
A 1 300 ILE 300 780 780 ILE ILE A . n 
A 1 301 VAL 301 781 781 VAL VAL A . n 
A 1 302 VAL 302 782 782 VAL VAL A . n 
A 1 303 MET 303 783 783 MET MET A . n 
A 1 304 PRO 304 784 784 PRO PRO A . n 
A 1 305 ILE 305 785 785 ILE ILE A . n 
A 1 306 ALA 306 786 786 ALA ALA A . n 
A 1 307 ARG 307 787 787 ARG ARG A . n 
A 1 308 GLU 308 788 788 GLU GLU A . n 
A 1 309 PHE 309 789 789 PHE PHE A . n 
A 1 310 SER 310 790 790 SER SER A . n 
A 1 311 PRO 311 791 791 PRO PRO A . n 
A 1 312 ASP 312 792 792 ASP ASP A . n 
A 1 313 LEU 313 793 793 LEU LEU A . n 
A 1 314 VAL 314 794 794 VAL VAL A . n 
A 1 315 LEU 315 795 795 LEU LEU A . n 
A 1 316 VAL 316 796 796 VAL VAL A . n 
A 1 317 SER 317 797 797 SER SER A . n 
A 1 318 ALA 318 798 798 ALA ALA A . n 
A 1 319 GLY 319 799 799 GLY GLY A . n 
A 1 320 PHE 320 800 800 PHE PHE A . n 
A 1 321 ASP 321 801 801 ASP ASP A . n 
A 1 322 ALA 322 802 802 ALA ALA A . n 
A 1 323 ALA 323 803 803 ALA ALA A . n 
A 1 324 GLU 324 804 804 GLU GLU A . n 
A 1 325 GLY 325 805 805 GLY GLY A . n 
A 1 326 HIS 326 806 806 HIS HIS A . n 
A 1 327 PRO 327 807 807 PRO PRO A . n 
A 1 328 ALA 328 808 808 ALA ALA A . n 
A 1 329 PRO 329 809 809 PRO PRO A . n 
A 1 330 LEU 330 810 810 LEU LEU A . n 
A 1 331 GLY 331 811 811 GLY GLY A . n 
A 1 332 GLY 332 812 812 GLY GLY A . n 
A 1 333 TYR 333 813 813 TYR TYR A . n 
A 1 334 HIS 334 814 814 HIS HIS A . n 
A 1 335 VAL 335 815 815 VAL VAL A . n 
A 1 336 SER 336 816 816 SER SER A . n 
A 1 337 ALA 337 817 817 ALA ALA A . n 
A 1 338 LYS 338 818 818 LYS LYS A . n 
A 1 339 CYS 339 819 819 CYS CYS A . n 
A 1 340 PHE 340 820 820 PHE PHE A . n 
A 1 341 GLY 341 821 821 GLY GLY A . n 
A 1 342 TYR 342 822 822 TYR TYR A . n 
A 1 343 MET 343 823 823 MET MET A . n 
A 1 344 THR 344 824 824 THR THR A . n 
A 1 345 GLN 345 825 825 GLN GLN A . n 
A 1 346 GLN 346 826 826 GLN GLN A . n 
A 1 347 LEU 347 827 827 LEU LEU A . n 
A 1 348 MET 348 828 828 MET MET A . n 
A 1 349 ASN 349 829 829 ASN ASN A . n 
A 1 350 LEU 350 830 830 LEU LEU A . n 
A 1 351 ALA 351 831 831 ALA ALA A . n 
A 1 352 GLY 352 832 832 GLY GLY A . n 
A 1 353 GLY 353 833 833 GLY GLY A . n 
A 1 354 ALA 354 834 834 ALA ALA A . n 
A 1 355 VAL 355 835 835 VAL VAL A . n 
A 1 356 VAL 356 836 836 VAL VAL A . n 
A 1 357 LEU 357 837 837 LEU LEU A . n 
A 1 358 ALA 358 838 838 ALA ALA A . n 
A 1 359 LEU 359 839 839 LEU LEU A . n 
A 1 360 GLU 360 840 840 GLU GLU A . n 
A 1 361 GLY 361 841 841 GLY GLY A . n 
A 1 362 GLY 362 842 842 GLY GLY A . n 
A 1 363 HIS 363 843 843 HIS HIS A . n 
A 1 364 ASP 364 844 844 ASP ASP A . n 
A 1 365 LEU 365 845 845 LEU LEU A . n 
A 1 366 THR 366 846 846 THR THR A . n 
A 1 367 ALA 367 847 847 ALA ALA A . n 
A 1 368 ILE 368 848 848 ILE ILE A . n 
A 1 369 CYS 369 849 849 CYS CYS A . n 
A 1 370 ASP 370 850 850 ASP ASP A . n 
A 1 371 ALA 371 851 851 ALA ALA A . n 
A 1 372 SER 372 852 852 SER SER A . n 
A 1 373 GLU 373 853 853 GLU GLU A . n 
A 1 374 ALA 374 854 854 ALA ALA A . n 
A 1 375 CYS 375 855 855 CYS CYS A . n 
A 1 376 VAL 376 856 856 VAL VAL A . n 
A 1 377 ALA 377 857 857 ALA ALA A . n 
A 1 378 ALA 378 858 858 ALA ALA A . n 
A 1 379 LEU 379 859 859 LEU LEU A . n 
A 1 380 LEU 380 860 860 LEU LEU A . n 
A 1 381 GLY 381 861 861 GLY GLY A . n 
A 1 382 ASN 382 862 862 ASN ASN A . n 
A 1 383 ARG 383 863 863 ARG ARG A . n 
A 1 384 VAL 384 864 864 VAL VAL A . n 
A 1 385 ASP 385 865 865 ASP ASP A . n 
A 1 386 PRO 386 866 866 PRO PRO A . n 
A 1 387 LEU 387 867 867 LEU LEU A . n 
A 1 388 SER 388 868 868 SER SER A . n 
A 1 389 GLU 389 869 869 GLU GLU A . n 
A 1 390 GLU 390 870 870 GLU GLU A . n 
A 1 391 GLY 391 871 871 GLY GLY A . n 
A 1 392 TRP 392 872 872 TRP TRP A . n 
A 1 393 LYS 393 873 873 LYS LYS A . n 
A 1 394 GLN 394 874 874 GLN GLN A . n 
A 1 395 LYS 395 875 875 LYS LYS A . n 
A 1 396 PRO 396 876 876 PRO PRO A . n 
A 1 397 ASN 397 877 877 ASN ASN A . n 
A 1 398 LEU 398 878 878 LEU LEU A . n 
A 1 399 ASN 399 879 879 ASN ASN A . n 
A 1 400 ALA 400 880 880 ALA ALA A . n 
A 1 401 ILE 401 881 881 ILE ILE A . n 
A 1 402 ARG 402 882 882 ARG ARG A . n 
A 1 403 SER 403 883 883 SER SER A . n 
A 1 404 LEU 404 884 884 LEU LEU A . n 
A 1 405 GLU 405 885 885 GLU GLU A . n 
A 1 406 ALA 406 886 886 ALA ALA A . n 
A 1 407 VAL 407 887 887 VAL VAL A . n 
A 1 408 ILE 408 888 888 ILE ILE A . n 
A 1 409 ARG 409 889 889 ARG ARG A . n 
A 1 410 VAL 410 890 890 VAL VAL A . n 
A 1 411 HIS 411 891 891 HIS HIS A . n 
A 1 412 SER 412 892 892 SER SER A . n 
A 1 413 LYS 413 893 893 LYS LYS A . n 
A 1 414 TYR 414 894 894 TYR TYR A . n 
A 1 415 TRP 415 895 895 TRP TRP A . n 
A 1 416 GLY 416 896 896 GLY GLY A . n 
A 1 417 CYS 417 897 897 CYS CYS A . n 
A 1 418 MET 418 898 898 MET MET A . n 
A 1 419 GLN 419 899 899 GLN GLN A . n 
A 1 420 ARG 420 900 900 ARG ARG A . n 
A 1 421 LEU 421 901 901 LEU LEU A . n 
A 1 422 ALA 422 902 ?   ?   ?   A . n 
A 1 423 SER 423 903 ?   ?   ?   A . n 
B 1 1   GLY 1   481 ?   ?   ?   B . n 
B 1 2   SER 2   482 ?   ?   ?   B . n 
B 1 3   ARG 3   483 ?   ?   ?   B . n 
B 1 4   ALA 4   484 ?   ?   ?   B . n 
B 1 5   GLN 5   485 ?   ?   ?   B . n 
B 1 6   SER 6   486 ?   ?   ?   B . n 
B 1 7   SER 7   487 ?   ?   ?   B . n 
B 1 8   PRO 8   488 ?   ?   ?   B . n 
B 1 9   ALA 9   489 ?   ?   ?   B . n 
B 1 10  ALA 10  490 ?   ?   ?   B . n 
B 1 11  PRO 11  491 ?   ?   ?   B . n 
B 1 12  ALA 12  492 ?   ?   ?   B . n 
B 1 13  SER 13  493 ?   ?   ?   B . n 
B 1 14  LEU 14  494 ?   ?   ?   B . n 
B 1 15  SER 15  495 ?   ?   ?   B . n 
B 1 16  ALA 16  496 ?   ?   ?   B . n 
B 1 17  PRO 17  497 ?   ?   ?   B . n 
B 1 18  GLU 18  498 ?   ?   ?   B . n 
B 1 19  PRO 19  499 ?   ?   ?   B . n 
B 1 20  ALA 20  500 ?   ?   ?   B . n 
B 1 21  SER 21  501 ?   ?   ?   B . n 
B 1 22  GLN 22  502 ?   ?   ?   B . n 
B 1 23  ALA 23  503 ?   ?   ?   B . n 
B 1 24  ARG 24  504 ?   ?   ?   B . n 
B 1 25  VAL 25  505 ?   ?   ?   B . n 
B 1 26  LEU 26  506 ?   ?   ?   B . n 
B 1 27  SER 27  507 ?   ?   ?   B . n 
B 1 28  SER 28  508 ?   ?   ?   B . n 
B 1 29  SER 29  509 ?   ?   ?   B . n 
B 1 30  GLU 30  510 ?   ?   ?   B . n 
B 1 31  THR 31  511 ?   ?   ?   B . n 
B 1 32  PRO 32  512 ?   ?   ?   B . n 
B 1 33  ALA 33  513 ?   ?   ?   B . n 
B 1 34  ARG 34  514 ?   ?   ?   B . n 
B 1 35  THR 35  515 ?   ?   ?   B . n 
B 1 36  LEU 36  516 ?   ?   ?   B . n 
B 1 37  PRO 37  517 ?   ?   ?   B . n 
B 1 38  PHE 38  518 518 PHE PHE B . n 
B 1 39  THR 39  519 519 THR THR B . n 
B 1 40  THR 40  520 520 THR THR B . n 
B 1 41  GLY 41  521 521 GLY GLY B . n 
B 1 42  LEU 42  522 522 LEU LEU B . n 
B 1 43  ILE 43  523 523 ILE ILE B . n 
B 1 44  TYR 44  524 524 TYR TYR B . n 
B 1 45  ASP 45  525 525 ASP ASP B . n 
B 1 46  SER 46  526 526 SER SER B . n 
B 1 47  VAL 47  527 527 VAL VAL B . n 
B 1 48  MET 48  528 528 MET MET B . n 
B 1 49  LEU 49  529 529 LEU LEU B . n 
B 1 50  LYS 50  530 530 LYS LYS B . n 
B 1 51  HIS 51  531 531 HIS HIS B . n 
B 1 52  GLN 52  532 532 GLN GLN B . n 
B 1 53  CYS 53  533 533 CYS CYS B . n 
B 1 54  SER 54  534 534 SER SER B . n 
B 1 55  CYS 55  535 535 CYS CYS B . n 
B 1 56  GLY 56  536 536 GLY GLY B . n 
B 1 57  ASP 57  537 537 ASP ASP B . n 
B 1 58  ASN 58  538 538 ASN ASN B . n 
B 1 59  SER 59  539 539 SER SER B . n 
B 1 60  ARG 60  540 540 ARG ARG B . n 
B 1 61  HIS 61  541 541 HIS HIS B . n 
B 1 62  PRO 62  542 542 PRO PRO B . n 
B 1 63  GLU 63  543 543 GLU GLU B . n 
B 1 64  HIS 64  544 544 HIS HIS B . n 
B 1 65  ALA 65  545 545 ALA ALA B . n 
B 1 66  GLY 66  546 546 GLY GLY B . n 
B 1 67  ARG 67  547 547 ARG ARG B . n 
B 1 68  ILE 68  548 548 ILE ILE B . n 
B 1 69  GLN 69  549 549 GLN GLN B . n 
B 1 70  SER 70  550 550 SER SER B . n 
B 1 71  ILE 71  551 551 ILE ILE B . n 
B 1 72  TRP 72  552 552 TRP TRP B . n 
B 1 73  SER 73  553 553 SER SER B . n 
B 1 74  ARG 74  554 554 ARG ARG B . n 
B 1 75  LEU 75  555 555 LEU LEU B . n 
B 1 76  GLN 76  556 556 GLN GLN B . n 
B 1 77  GLU 77  557 557 GLU GLU B . n 
B 1 78  ARG 78  558 558 ARG ARG B . n 
B 1 79  GLY 79  559 559 GLY GLY B . n 
B 1 80  LEU 80  560 560 LEU LEU B . n 
B 1 81  ARG 81  561 561 ARG ARG B . n 
B 1 82  SER 82  562 562 SER SER B . n 
B 1 83  GLN 83  563 563 GLN GLN B . n 
B 1 84  CYS 84  564 564 CYS CYS B . n 
B 1 85  GLU 85  565 565 GLU GLU B . n 
B 1 86  CYS 86  566 566 CYS CYS B . n 
B 1 87  LEU 87  567 567 LEU LEU B . n 
B 1 88  ARG 88  568 568 ARG ARG B . n 
B 1 89  GLY 89  569 569 GLY GLY B . n 
B 1 90  ARG 90  570 570 ARG ARG B . n 
B 1 91  LYS 91  571 571 LYS LYS B . n 
B 1 92  ALA 92  572 572 ALA ALA B . n 
B 1 93  SER 93  573 573 SER SER B . n 
B 1 94  LEU 94  574 574 LEU LEU B . n 
B 1 95  GLU 95  575 575 GLU GLU B . n 
B 1 96  GLU 96  576 576 GLU GLU B . n 
B 1 97  LEU 97  577 577 LEU LEU B . n 
B 1 98  GLN 98  578 578 GLN GLN B . n 
B 1 99  SER 99  579 579 SER SER B . n 
B 1 100 VAL 100 580 580 VAL VAL B . n 
B 1 101 HIS 101 581 581 HIS HIS B . n 
B 1 102 SER 102 582 582 SER SER B . n 
B 1 103 GLU 103 583 583 GLU GLU B . n 
B 1 104 ARG 104 584 584 ARG ARG B . n 
B 1 105 HIS 105 585 585 HIS HIS B . n 
B 1 106 VAL 106 586 586 VAL VAL B . n 
B 1 107 LEU 107 587 587 LEU LEU B . n 
B 1 108 LEU 108 588 588 LEU LEU B . n 
B 1 109 TYR 109 589 589 TYR TYR B . n 
B 1 110 GLY 110 590 590 GLY GLY B . n 
B 1 111 THR 111 591 591 THR THR B . n 
B 1 112 ASN 112 592 592 ASN ASN B . n 
B 1 113 PRO 113 593 593 PRO PRO B . n 
B 1 114 LEU 114 594 594 LEU LEU B . n 
B 1 115 SER 115 595 595 SER SER B . n 
B 1 116 ARG 116 596 596 ARG ARG B . n 
B 1 117 LEU 117 597 597 LEU LEU B . n 
B 1 118 LYS 118 598 598 LYS LYS B . n 
B 1 119 LEU 119 599 599 LEU LEU B . n 
B 1 120 ASP 120 600 600 ASP ASP B . n 
B 1 121 ASN 121 601 601 ASN ASN B . n 
B 1 122 GLY 122 602 602 GLY GLY B . n 
B 1 123 LYS 123 603 603 LYS LYS B . n 
B 1 124 LEU 124 604 604 LEU LEU B . n 
B 1 125 ALA 125 605 605 ALA ALA B . n 
B 1 126 GLY 126 606 606 GLY GLY B . n 
B 1 127 LEU 127 607 607 LEU LEU B . n 
B 1 128 LEU 128 608 608 LEU LEU B . n 
B 1 129 ALA 129 609 609 ALA ALA B . n 
B 1 130 GLN 130 610 610 GLN GLN B . n 
B 1 131 ARG 131 611 ?   ?   ?   B . n 
B 1 132 MET 132 612 ?   ?   ?   B . n 
B 1 133 PHE 133 613 ?   ?   ?   B . n 
B 1 134 VAL 134 614 614 VAL VAL B . n 
B 1 135 MET 135 615 615 MET MET B . n 
B 1 136 LEU 136 616 616 LEU LEU B . n 
B 1 137 PRO 137 617 617 PRO PRO B . n 
B 1 138 CYS 138 618 618 CYS CYS B . n 
B 1 139 GLY 139 619 619 GLY GLY B . n 
B 1 140 GLY 140 620 620 GLY GLY B . n 
B 1 141 VAL 141 621 621 VAL VAL B . n 
B 1 142 GLY 142 622 622 GLY GLY B . n 
B 1 143 VAL 143 623 623 VAL VAL B . n 
B 1 144 ASP 144 624 624 ASP ASP B . n 
B 1 145 THR 145 625 625 THR THR B . n 
B 1 146 ASP 146 626 626 ASP ASP B . n 
B 1 147 THR 147 627 627 THR THR B . n 
B 1 148 ILE 148 628 628 ILE ILE B . n 
B 1 149 TRP 149 629 629 TRP TRP B . n 
B 1 150 ASN 150 630 630 ASN ASN B . n 
B 1 151 GLU 151 631 631 GLU GLU B . n 
B 1 152 LEU 152 632 632 LEU LEU B . n 
B 1 153 HIS 153 633 633 HIS HIS B . n 
B 1 154 SER 154 634 634 SER SER B . n 
B 1 155 SER 155 635 635 SER SER B . n 
B 1 156 ASN 156 636 636 ASN ASN B . n 
B 1 157 ALA 157 637 637 ALA ALA B . n 
B 1 158 ALA 158 638 638 ALA ALA B . n 
B 1 159 ARG 159 639 639 ARG ARG B . n 
B 1 160 TRP 160 640 640 TRP TRP B . n 
B 1 161 ALA 161 641 641 ALA ALA B . n 
B 1 162 ALA 162 642 642 ALA ALA B . n 
B 1 163 GLY 163 643 643 GLY GLY B . n 
B 1 164 SER 164 644 644 SER SER B . n 
B 1 165 VAL 165 645 645 VAL VAL B . n 
B 1 166 THR 166 646 646 THR THR B . n 
B 1 167 ASP 167 647 647 ASP ASP B . n 
B 1 168 LEU 168 648 648 LEU LEU B . n 
B 1 169 ALA 169 649 649 ALA ALA B . n 
B 1 170 PHE 170 650 650 PHE PHE B . n 
B 1 171 LYS 171 651 651 LYS LYS B . n 
B 1 172 VAL 172 652 652 VAL VAL B . n 
B 1 173 ALA 173 653 653 ALA ALA B . n 
B 1 174 SER 174 654 654 SER SER B . n 
B 1 175 ARG 175 655 655 ARG ARG B . n 
B 1 176 GLU 176 656 656 GLU GLU B . n 
B 1 177 LEU 177 657 657 LEU LEU B . n 
B 1 178 LYS 178 658 658 LYS LYS B . n 
B 1 179 ASN 179 659 659 ASN ASN B . n 
B 1 180 GLY 180 660 660 GLY GLY B . n 
B 1 181 PHE 181 661 661 PHE PHE B . n 
B 1 182 ALA 182 662 662 ALA ALA B . n 
B 1 183 VAL 183 663 663 VAL VAL B . n 
B 1 184 VAL 184 664 664 VAL VAL B . n 
B 1 185 ARG 185 665 665 ARG ARG B . n 
B 1 186 PRO 186 666 666 PRO PRO B . n 
B 1 187 PRO 187 667 667 PRO PRO B . n 
B 1 188 GLY 188 668 668 GLY GLY B . n 
B 1 189 HIS 189 669 669 HIS HIS B . n 
B 1 190 HIS 190 670 670 HIS HIS B . n 
B 1 191 ALA 191 671 671 ALA ALA B . n 
B 1 192 ASP 192 672 672 ASP ASP B . n 
B 1 193 HIS 193 673 673 HIS HIS B . n 
B 1 194 SER 194 674 674 SER SER B . n 
B 1 195 THR 195 675 675 THR THR B . n 
B 1 196 ALA 196 676 676 ALA ALA B . n 
B 1 197 MET 197 677 677 MET MET B . n 
B 1 198 GLY 198 678 678 GLY GLY B . n 
B 1 199 PHE 199 679 679 PHE PHE B . n 
B 1 200 CYS 200 680 680 CYS CYS B . n 
B 1 201 PHE 201 681 681 PHE PHE B . n 
B 1 202 PHE 202 682 682 PHE PHE B . n 
B 1 203 ASN 203 683 683 ASN ASN B . n 
B 1 204 SER 204 684 684 SER SER B . n 
B 1 205 VAL 205 685 685 VAL VAL B . n 
B 1 206 ALA 206 686 686 ALA ALA B . n 
B 1 207 ILE 207 687 687 ILE ILE B . n 
B 1 208 ALA 208 688 688 ALA ALA B . n 
B 1 209 CYS 209 689 689 CYS CYS B . n 
B 1 210 ARG 210 690 690 ARG ARG B . n 
B 1 211 GLN 211 691 691 GLN GLN B . n 
B 1 212 LEU 212 692 692 LEU LEU B . n 
B 1 213 GLN 213 693 693 GLN GLN B . n 
B 1 214 GLN 214 694 694 GLN GLN B . n 
B 1 215 GLN 215 695 695 GLN GLN B . n 
B 1 216 SER 216 696 696 SER SER B . n 
B 1 217 LYS 217 697 697 LYS LYS B . n 
B 1 218 ALA 218 698 698 ALA ALA B . n 
B 1 219 SER 219 699 699 SER SER B . n 
B 1 220 LYS 220 700 700 LYS LYS B . n 
B 1 221 ILE 221 701 701 ILE ILE B . n 
B 1 222 LEU 222 702 702 LEU LEU B . n 
B 1 223 ILE 223 703 703 ILE ILE B . n 
B 1 224 VAL 224 704 704 VAL VAL B . n 
B 1 225 ASP 225 705 705 ASP ASP B . n 
B 1 226 TRP 226 706 706 TRP TRP B . n 
B 1 227 ASP 227 707 707 ASP ASP B . n 
B 1 228 VAL 228 708 708 VAL VAL B . n 
B 1 229 HIS 229 709 709 HIS HIS B . n 
B 1 230 HIS 230 710 710 HIS HIS B . n 
B 1 231 GLY 231 711 711 GLY GLY B . n 
B 1 232 ASN 232 712 712 ASN ASN B . n 
B 1 233 GLY 233 713 713 GLY GLY B . n 
B 1 234 THR 234 714 714 THR THR B . n 
B 1 235 GLN 235 715 715 GLN GLN B . n 
B 1 236 GLN 236 716 716 GLN GLN B . n 
B 1 237 THR 237 717 717 THR THR B . n 
B 1 238 PHE 238 718 718 PHE PHE B . n 
B 1 239 TYR 239 719 719 TYR TYR B . n 
B 1 240 GLN 240 720 720 GLN GLN B . n 
B 1 241 ASP 241 721 721 ASP ASP B . n 
B 1 242 PRO 242 722 722 PRO PRO B . n 
B 1 243 SER 243 723 723 SER SER B . n 
B 1 244 VAL 244 724 724 VAL VAL B . n 
B 1 245 LEU 245 725 725 LEU LEU B . n 
B 1 246 TYR 246 726 726 TYR TYR B . n 
B 1 247 ILE 247 727 727 ILE ILE B . n 
B 1 248 SER 248 728 728 SER SER B . n 
B 1 249 LEU 249 729 729 LEU LEU B . n 
B 1 250 HIS 250 730 730 HIS HIS B . n 
B 1 251 ARG 251 731 731 ARG ARG B . n 
B 1 252 HIS 252 732 732 HIS HIS B . n 
B 1 253 ASP 253 733 733 ASP ASP B . n 
B 1 254 ASP 254 734 734 ASP ASP B . n 
B 1 255 GLY 255 735 735 GLY GLY B . n 
B 1 256 ASN 256 736 736 ASN ASN B . n 
B 1 257 PHE 257 737 737 PHE PHE B . n 
B 1 258 PHE 258 738 738 PHE PHE B . n 
B 1 259 PRO 259 739 739 PRO PRO B . n 
B 1 260 GLY 260 740 740 GLY GLY B . n 
B 1 261 SER 261 741 741 SER SER B . n 
B 1 262 GLY 262 742 742 GLY GLY B . n 
B 1 263 ALA 263 743 743 ALA ALA B . n 
B 1 264 VAL 264 744 744 VAL VAL B . n 
B 1 265 ASP 265 745 745 ASP ASP B . n 
B 1 266 GLU 266 746 746 GLU GLU B . n 
B 1 267 VAL 267 747 747 VAL VAL B . n 
B 1 268 GLY 268 748 748 GLY GLY B . n 
B 1 269 ALA 269 749 749 ALA ALA B . n 
B 1 270 GLY 270 750 750 GLY GLY B . n 
B 1 271 SER 271 751 751 SER SER B . n 
B 1 272 GLY 272 752 752 GLY GLY B . n 
B 1 273 GLU 273 753 753 GLU GLU B . n 
B 1 274 GLY 274 754 754 GLY GLY B . n 
B 1 275 PHE 275 755 755 PHE PHE B . n 
B 1 276 ASN 276 756 756 ASN ASN B . n 
B 1 277 VAL 277 757 757 VAL VAL B . n 
B 1 278 ASN 278 758 758 ASN ASN B . n 
B 1 279 VAL 279 759 759 VAL VAL B . n 
B 1 280 ALA 280 760 760 ALA ALA B . n 
B 1 281 TRP 281 761 761 TRP TRP B . n 
B 1 282 ALA 282 762 762 ALA ALA B . n 
B 1 283 GLY 283 763 763 GLY GLY B . n 
B 1 284 GLY 284 764 764 GLY GLY B . n 
B 1 285 LEU 285 765 765 LEU LEU B . n 
B 1 286 ASP 286 766 766 ASP ASP B . n 
B 1 287 PRO 287 767 767 PRO PRO B . n 
B 1 288 PRO 288 768 768 PRO PRO B . n 
B 1 289 MET 289 769 769 MET MET B . n 
B 1 290 GLY 290 770 770 GLY GLY B . n 
B 1 291 ASP 291 771 771 ASP ASP B . n 
B 1 292 PRO 292 772 772 PRO PRO B . n 
B 1 293 GLU 293 773 773 GLU GLU B . n 
B 1 294 TYR 294 774 774 TYR TYR B . n 
B 1 295 LEU 295 775 775 LEU LEU B . n 
B 1 296 ALA 296 776 776 ALA ALA B . n 
B 1 297 ALA 297 777 777 ALA ALA B . n 
B 1 298 PHE 298 778 778 PHE PHE B . n 
B 1 299 ARG 299 779 779 ARG ARG B . n 
B 1 300 ILE 300 780 780 ILE ILE B . n 
B 1 301 VAL 301 781 781 VAL VAL B . n 
B 1 302 VAL 302 782 782 VAL VAL B . n 
B 1 303 MET 303 783 783 MET MET B . n 
B 1 304 PRO 304 784 784 PRO PRO B . n 
B 1 305 ILE 305 785 785 ILE ILE B . n 
B 1 306 ALA 306 786 786 ALA ALA B . n 
B 1 307 ARG 307 787 787 ARG ARG B . n 
B 1 308 GLU 308 788 788 GLU GLU B . n 
B 1 309 PHE 309 789 789 PHE PHE B . n 
B 1 310 SER 310 790 790 SER SER B . n 
B 1 311 PRO 311 791 791 PRO PRO B . n 
B 1 312 ASP 312 792 792 ASP ASP B . n 
B 1 313 LEU 313 793 793 LEU LEU B . n 
B 1 314 VAL 314 794 794 VAL VAL B . n 
B 1 315 LEU 315 795 795 LEU LEU B . n 
B 1 316 VAL 316 796 796 VAL VAL B . n 
B 1 317 SER 317 797 797 SER SER B . n 
B 1 318 ALA 318 798 798 ALA ALA B . n 
B 1 319 GLY 319 799 799 GLY GLY B . n 
B 1 320 PHE 320 800 800 PHE PHE B . n 
B 1 321 ASP 321 801 801 ASP ASP B . n 
B 1 322 ALA 322 802 802 ALA ALA B . n 
B 1 323 ALA 323 803 803 ALA ALA B . n 
B 1 324 GLU 324 804 804 GLU GLU B . n 
B 1 325 GLY 325 805 805 GLY GLY B . n 
B 1 326 HIS 326 806 806 HIS HIS B . n 
B 1 327 PRO 327 807 807 PRO PRO B . n 
B 1 328 ALA 328 808 808 ALA ALA B . n 
B 1 329 PRO 329 809 809 PRO PRO B . n 
B 1 330 LEU 330 810 810 LEU LEU B . n 
B 1 331 GLY 331 811 811 GLY GLY B . n 
B 1 332 GLY 332 812 812 GLY GLY B . n 
B 1 333 TYR 333 813 813 TYR TYR B . n 
B 1 334 HIS 334 814 814 HIS HIS B . n 
B 1 335 VAL 335 815 815 VAL VAL B . n 
B 1 336 SER 336 816 816 SER SER B . n 
B 1 337 ALA 337 817 817 ALA ALA B . n 
B 1 338 LYS 338 818 818 LYS LYS B . n 
B 1 339 CYS 339 819 819 CYS CYS B . n 
B 1 340 PHE 340 820 820 PHE PHE B . n 
B 1 341 GLY 341 821 821 GLY GLY B . n 
B 1 342 TYR 342 822 822 TYR TYR B . n 
B 1 343 MET 343 823 823 MET MET B . n 
B 1 344 THR 344 824 824 THR THR B . n 
B 1 345 GLN 345 825 825 GLN GLN B . n 
B 1 346 GLN 346 826 826 GLN GLN B . n 
B 1 347 LEU 347 827 827 LEU LEU B . n 
B 1 348 MET 348 828 828 MET MET B . n 
B 1 349 ASN 349 829 829 ASN ASN B . n 
B 1 350 LEU 350 830 830 LEU LEU B . n 
B 1 351 ALA 351 831 831 ALA ALA B . n 
B 1 352 GLY 352 832 832 GLY GLY B . n 
B 1 353 GLY 353 833 833 GLY GLY B . n 
B 1 354 ALA 354 834 834 ALA ALA B . n 
B 1 355 VAL 355 835 835 VAL VAL B . n 
B 1 356 VAL 356 836 836 VAL VAL B . n 
B 1 357 LEU 357 837 837 LEU LEU B . n 
B 1 358 ALA 358 838 838 ALA ALA B . n 
B 1 359 LEU 359 839 839 LEU LEU B . n 
B 1 360 GLU 360 840 840 GLU GLU B . n 
B 1 361 GLY 361 841 841 GLY GLY B . n 
B 1 362 GLY 362 842 842 GLY GLY B . n 
B 1 363 HIS 363 843 843 HIS HIS B . n 
B 1 364 ASP 364 844 844 ASP ASP B . n 
B 1 365 LEU 365 845 845 LEU LEU B . n 
B 1 366 THR 366 846 846 THR THR B . n 
B 1 367 ALA 367 847 847 ALA ALA B . n 
B 1 368 ILE 368 848 848 ILE ILE B . n 
B 1 369 CYS 369 849 849 CYS CYS B . n 
B 1 370 ASP 370 850 850 ASP ASP B . n 
B 1 371 ALA 371 851 851 ALA ALA B . n 
B 1 372 SER 372 852 852 SER SER B . n 
B 1 373 GLU 373 853 853 GLU GLU B . n 
B 1 374 ALA 374 854 854 ALA ALA B . n 
B 1 375 CYS 375 855 855 CYS CYS B . n 
B 1 376 VAL 376 856 856 VAL VAL B . n 
B 1 377 ALA 377 857 857 ALA ALA B . n 
B 1 378 ALA 378 858 858 ALA ALA B . n 
B 1 379 LEU 379 859 859 LEU LEU B . n 
B 1 380 LEU 380 860 860 LEU LEU B . n 
B 1 381 GLY 381 861 861 GLY GLY B . n 
B 1 382 ASN 382 862 862 ASN ASN B . n 
B 1 383 ARG 383 863 863 ARG ARG B . n 
B 1 384 VAL 384 864 864 VAL VAL B . n 
B 1 385 ASP 385 865 865 ASP ASP B . n 
B 1 386 PRO 386 866 866 PRO PRO B . n 
B 1 387 LEU 387 867 867 LEU LEU B . n 
B 1 388 SER 388 868 868 SER SER B . n 
B 1 389 GLU 389 869 869 GLU GLU B . n 
B 1 390 GLU 390 870 870 GLU GLU B . n 
B 1 391 GLY 391 871 871 GLY GLY B . n 
B 1 392 TRP 392 872 872 TRP TRP B . n 
B 1 393 LYS 393 873 873 LYS LYS B . n 
B 1 394 GLN 394 874 874 GLN GLN B . n 
B 1 395 LYS 395 875 875 LYS LYS B . n 
B 1 396 PRO 396 876 876 PRO PRO B . n 
B 1 397 ASN 397 877 877 ASN ASN B . n 
B 1 398 LEU 398 878 878 LEU LEU B . n 
B 1 399 ASN 399 879 879 ASN ASN B . n 
B 1 400 ALA 400 880 880 ALA ALA B . n 
B 1 401 ILE 401 881 881 ILE ILE B . n 
B 1 402 ARG 402 882 882 ARG ARG B . n 
B 1 403 SER 403 883 883 SER SER B . n 
B 1 404 LEU 404 884 884 LEU LEU B . n 
B 1 405 GLU 405 885 885 GLU GLU B . n 
B 1 406 ALA 406 886 886 ALA ALA B . n 
B 1 407 VAL 407 887 887 VAL VAL B . n 
B 1 408 ILE 408 888 888 ILE ILE B . n 
B 1 409 ARG 409 889 889 ARG ARG B . n 
B 1 410 VAL 410 890 890 VAL VAL B . n 
B 1 411 HIS 411 891 891 HIS HIS B . n 
B 1 412 SER 412 892 892 SER SER B . n 
B 1 413 LYS 413 893 893 LYS LYS B . n 
B 1 414 TYR 414 894 894 TYR TYR B . n 
B 1 415 TRP 415 895 895 TRP TRP B . n 
B 1 416 GLY 416 896 896 GLY GLY B . n 
B 1 417 CYS 417 897 897 CYS CYS B . n 
B 1 418 MET 418 898 898 MET MET B . n 
B 1 419 GLN 419 899 899 GLN GLN B . n 
B 1 420 ARG 420 900 900 ARG ARG B . n 
B 1 421 LEU 421 901 ?   ?   ?   B . n 
B 1 422 ALA 422 902 ?   ?   ?   B . n 
B 1 423 SER 423 903 ?   ?   ?   B . n 
C 1 1   GLY 1   481 ?   ?   ?   C . n 
C 1 2   SER 2   482 ?   ?   ?   C . n 
C 1 3   ARG 3   483 ?   ?   ?   C . n 
C 1 4   ALA 4   484 ?   ?   ?   C . n 
C 1 5   GLN 5   485 ?   ?   ?   C . n 
C 1 6   SER 6   486 ?   ?   ?   C . n 
C 1 7   SER 7   487 ?   ?   ?   C . n 
C 1 8   PRO 8   488 ?   ?   ?   C . n 
C 1 9   ALA 9   489 ?   ?   ?   C . n 
C 1 10  ALA 10  490 ?   ?   ?   C . n 
C 1 11  PRO 11  491 ?   ?   ?   C . n 
C 1 12  ALA 12  492 ?   ?   ?   C . n 
C 1 13  SER 13  493 ?   ?   ?   C . n 
C 1 14  LEU 14  494 ?   ?   ?   C . n 
C 1 15  SER 15  495 ?   ?   ?   C . n 
C 1 16  ALA 16  496 ?   ?   ?   C . n 
C 1 17  PRO 17  497 ?   ?   ?   C . n 
C 1 18  GLU 18  498 ?   ?   ?   C . n 
C 1 19  PRO 19  499 ?   ?   ?   C . n 
C 1 20  ALA 20  500 ?   ?   ?   C . n 
C 1 21  SER 21  501 ?   ?   ?   C . n 
C 1 22  GLN 22  502 ?   ?   ?   C . n 
C 1 23  ALA 23  503 ?   ?   ?   C . n 
C 1 24  ARG 24  504 ?   ?   ?   C . n 
C 1 25  VAL 25  505 ?   ?   ?   C . n 
C 1 26  LEU 26  506 ?   ?   ?   C . n 
C 1 27  SER 27  507 ?   ?   ?   C . n 
C 1 28  SER 28  508 ?   ?   ?   C . n 
C 1 29  SER 29  509 ?   ?   ?   C . n 
C 1 30  GLU 30  510 ?   ?   ?   C . n 
C 1 31  THR 31  511 ?   ?   ?   C . n 
C 1 32  PRO 32  512 ?   ?   ?   C . n 
C 1 33  ALA 33  513 ?   ?   ?   C . n 
C 1 34  ARG 34  514 ?   ?   ?   C . n 
C 1 35  THR 35  515 ?   ?   ?   C . n 
C 1 36  LEU 36  516 ?   ?   ?   C . n 
C 1 37  PRO 37  517 ?   ?   ?   C . n 
C 1 38  PHE 38  518 ?   ?   ?   C . n 
C 1 39  THR 39  519 519 THR THR C . n 
C 1 40  THR 40  520 520 THR THR C . n 
C 1 41  GLY 41  521 521 GLY GLY C . n 
C 1 42  LEU 42  522 522 LEU LEU C . n 
C 1 43  ILE 43  523 523 ILE ILE C . n 
C 1 44  TYR 44  524 524 TYR TYR C . n 
C 1 45  ASP 45  525 525 ASP ASP C . n 
C 1 46  SER 46  526 526 SER SER C . n 
C 1 47  VAL 47  527 527 VAL VAL C . n 
C 1 48  MET 48  528 528 MET MET C . n 
C 1 49  LEU 49  529 529 LEU LEU C . n 
C 1 50  LYS 50  530 530 LYS LYS C . n 
C 1 51  HIS 51  531 531 HIS HIS C . n 
C 1 52  GLN 52  532 532 GLN GLN C . n 
C 1 53  CYS 53  533 533 CYS CYS C . n 
C 1 54  SER 54  534 534 SER SER C . n 
C 1 55  CYS 55  535 535 CYS CYS C . n 
C 1 56  GLY 56  536 536 GLY GLY C . n 
C 1 57  ASP 57  537 537 ASP ASP C . n 
C 1 58  ASN 58  538 538 ASN ASN C . n 
C 1 59  SER 59  539 539 SER SER C . n 
C 1 60  ARG 60  540 540 ARG ARG C . n 
C 1 61  HIS 61  541 541 HIS HIS C . n 
C 1 62  PRO 62  542 542 PRO PRO C . n 
C 1 63  GLU 63  543 543 GLU GLU C . n 
C 1 64  HIS 64  544 544 HIS HIS C . n 
C 1 65  ALA 65  545 545 ALA ALA C . n 
C 1 66  GLY 66  546 546 GLY GLY C . n 
C 1 67  ARG 67  547 547 ARG ARG C . n 
C 1 68  ILE 68  548 548 ILE ILE C . n 
C 1 69  GLN 69  549 549 GLN GLN C . n 
C 1 70  SER 70  550 550 SER SER C . n 
C 1 71  ILE 71  551 551 ILE ILE C . n 
C 1 72  TRP 72  552 552 TRP TRP C . n 
C 1 73  SER 73  553 553 SER SER C . n 
C 1 74  ARG 74  554 554 ARG ARG C . n 
C 1 75  LEU 75  555 555 LEU LEU C . n 
C 1 76  GLN 76  556 556 GLN GLN C . n 
C 1 77  GLU 77  557 557 GLU GLU C . n 
C 1 78  ARG 78  558 558 ARG ARG C . n 
C 1 79  GLY 79  559 559 GLY GLY C . n 
C 1 80  LEU 80  560 560 LEU LEU C . n 
C 1 81  ARG 81  561 561 ARG ARG C . n 
C 1 82  SER 82  562 562 SER SER C . n 
C 1 83  GLN 83  563 563 GLN GLN C . n 
C 1 84  CYS 84  564 564 CYS CYS C . n 
C 1 85  GLU 85  565 565 GLU GLU C . n 
C 1 86  CYS 86  566 566 CYS CYS C . n 
C 1 87  LEU 87  567 567 LEU LEU C . n 
C 1 88  ARG 88  568 568 ARG ARG C . n 
C 1 89  GLY 89  569 569 GLY GLY C . n 
C 1 90  ARG 90  570 570 ARG ARG C . n 
C 1 91  LYS 91  571 571 LYS LYS C . n 
C 1 92  ALA 92  572 572 ALA ALA C . n 
C 1 93  SER 93  573 573 SER SER C . n 
C 1 94  LEU 94  574 574 LEU LEU C . n 
C 1 95  GLU 95  575 575 GLU GLU C . n 
C 1 96  GLU 96  576 576 GLU GLU C . n 
C 1 97  LEU 97  577 577 LEU LEU C . n 
C 1 98  GLN 98  578 578 GLN GLN C . n 
C 1 99  SER 99  579 579 SER SER C . n 
C 1 100 VAL 100 580 580 VAL VAL C . n 
C 1 101 HIS 101 581 581 HIS HIS C . n 
C 1 102 SER 102 582 582 SER SER C . n 
C 1 103 GLU 103 583 583 GLU GLU C . n 
C 1 104 ARG 104 584 584 ARG ARG C . n 
C 1 105 HIS 105 585 585 HIS HIS C . n 
C 1 106 VAL 106 586 586 VAL VAL C . n 
C 1 107 LEU 107 587 587 LEU LEU C . n 
C 1 108 LEU 108 588 588 LEU LEU C . n 
C 1 109 TYR 109 589 589 TYR TYR C . n 
C 1 110 GLY 110 590 590 GLY GLY C . n 
C 1 111 THR 111 591 591 THR THR C . n 
C 1 112 ASN 112 592 592 ASN ASN C . n 
C 1 113 PRO 113 593 593 PRO PRO C . n 
C 1 114 LEU 114 594 ?   ?   ?   C . n 
C 1 115 SER 115 595 ?   ?   ?   C . n 
C 1 116 ARG 116 596 ?   ?   ?   C . n 
C 1 117 LEU 117 597 ?   ?   ?   C . n 
C 1 118 LYS 118 598 ?   ?   ?   C . n 
C 1 119 LEU 119 599 ?   ?   ?   C . n 
C 1 120 ASP 120 600 ?   ?   ?   C . n 
C 1 121 ASN 121 601 ?   ?   ?   C . n 
C 1 122 GLY 122 602 ?   ?   ?   C . n 
C 1 123 LYS 123 603 ?   ?   ?   C . n 
C 1 124 LEU 124 604 ?   ?   ?   C . n 
C 1 125 ALA 125 605 ?   ?   ?   C . n 
C 1 126 GLY 126 606 ?   ?   ?   C . n 
C 1 127 LEU 127 607 ?   ?   ?   C . n 
C 1 128 LEU 128 608 ?   ?   ?   C . n 
C 1 129 ALA 129 609 ?   ?   ?   C . n 
C 1 130 GLN 130 610 ?   ?   ?   C . n 
C 1 131 ARG 131 611 ?   ?   ?   C . n 
C 1 132 MET 132 612 ?   ?   ?   C . n 
C 1 133 PHE 133 613 ?   ?   ?   C . n 
C 1 134 VAL 134 614 ?   ?   ?   C . n 
C 1 135 MET 135 615 ?   ?   ?   C . n 
C 1 136 LEU 136 616 616 LEU LEU C . n 
C 1 137 PRO 137 617 617 PRO PRO C . n 
C 1 138 CYS 138 618 618 CYS CYS C . n 
C 1 139 GLY 139 619 619 GLY GLY C . n 
C 1 140 GLY 140 620 620 GLY GLY C . n 
C 1 141 VAL 141 621 621 VAL VAL C . n 
C 1 142 GLY 142 622 622 GLY GLY C . n 
C 1 143 VAL 143 623 623 VAL VAL C . n 
C 1 144 ASP 144 624 624 ASP ASP C . n 
C 1 145 THR 145 625 625 THR THR C . n 
C 1 146 ASP 146 626 626 ASP ASP C . n 
C 1 147 THR 147 627 627 THR THR C . n 
C 1 148 ILE 148 628 628 ILE ILE C . n 
C 1 149 TRP 149 629 629 TRP TRP C . n 
C 1 150 ASN 150 630 630 ASN ASN C . n 
C 1 151 GLU 151 631 631 GLU GLU C . n 
C 1 152 LEU 152 632 632 LEU LEU C . n 
C 1 153 HIS 153 633 633 HIS HIS C . n 
C 1 154 SER 154 634 634 SER SER C . n 
C 1 155 SER 155 635 635 SER SER C . n 
C 1 156 ASN 156 636 636 ASN ASN C . n 
C 1 157 ALA 157 637 637 ALA ALA C . n 
C 1 158 ALA 158 638 638 ALA ALA C . n 
C 1 159 ARG 159 639 639 ARG ARG C . n 
C 1 160 TRP 160 640 640 TRP TRP C . n 
C 1 161 ALA 161 641 641 ALA ALA C . n 
C 1 162 ALA 162 642 642 ALA ALA C . n 
C 1 163 GLY 163 643 643 GLY GLY C . n 
C 1 164 SER 164 644 644 SER SER C . n 
C 1 165 VAL 165 645 645 VAL VAL C . n 
C 1 166 THR 166 646 646 THR THR C . n 
C 1 167 ASP 167 647 647 ASP ASP C . n 
C 1 168 LEU 168 648 648 LEU LEU C . n 
C 1 169 ALA 169 649 649 ALA ALA C . n 
C 1 170 PHE 170 650 650 PHE PHE C . n 
C 1 171 LYS 171 651 651 LYS LYS C . n 
C 1 172 VAL 172 652 652 VAL VAL C . n 
C 1 173 ALA 173 653 653 ALA ALA C . n 
C 1 174 SER 174 654 654 SER SER C . n 
C 1 175 ARG 175 655 655 ARG ARG C . n 
C 1 176 GLU 176 656 656 GLU GLU C . n 
C 1 177 LEU 177 657 657 LEU LEU C . n 
C 1 178 LYS 178 658 658 LYS LYS C . n 
C 1 179 ASN 179 659 659 ASN ASN C . n 
C 1 180 GLY 180 660 660 GLY GLY C . n 
C 1 181 PHE 181 661 661 PHE PHE C . n 
C 1 182 ALA 182 662 662 ALA ALA C . n 
C 1 183 VAL 183 663 663 VAL VAL C . n 
C 1 184 VAL 184 664 664 VAL VAL C . n 
C 1 185 ARG 185 665 665 ARG ARG C . n 
C 1 186 PRO 186 666 666 PRO PRO C . n 
C 1 187 PRO 187 667 667 PRO PRO C . n 
C 1 188 GLY 188 668 668 GLY GLY C . n 
C 1 189 HIS 189 669 669 HIS HIS C . n 
C 1 190 HIS 190 670 670 HIS HIS C . n 
C 1 191 ALA 191 671 671 ALA ALA C . n 
C 1 192 ASP 192 672 672 ASP ASP C . n 
C 1 193 HIS 193 673 673 HIS HIS C . n 
C 1 194 SER 194 674 674 SER SER C . n 
C 1 195 THR 195 675 675 THR THR C . n 
C 1 196 ALA 196 676 676 ALA ALA C . n 
C 1 197 MET 197 677 677 MET MET C . n 
C 1 198 GLY 198 678 678 GLY GLY C . n 
C 1 199 PHE 199 679 679 PHE PHE C . n 
C 1 200 CYS 200 680 680 CYS CYS C . n 
C 1 201 PHE 201 681 681 PHE PHE C . n 
C 1 202 PHE 202 682 682 PHE PHE C . n 
C 1 203 ASN 203 683 683 ASN ASN C . n 
C 1 204 SER 204 684 684 SER SER C . n 
C 1 205 VAL 205 685 685 VAL VAL C . n 
C 1 206 ALA 206 686 686 ALA ALA C . n 
C 1 207 ILE 207 687 687 ILE ILE C . n 
C 1 208 ALA 208 688 688 ALA ALA C . n 
C 1 209 CYS 209 689 689 CYS CYS C . n 
C 1 210 ARG 210 690 690 ARG ARG C . n 
C 1 211 GLN 211 691 691 GLN GLN C . n 
C 1 212 LEU 212 692 692 LEU LEU C . n 
C 1 213 GLN 213 693 693 GLN GLN C . n 
C 1 214 GLN 214 694 694 GLN GLN C . n 
C 1 215 GLN 215 695 695 GLN GLN C . n 
C 1 216 SER 216 696 696 SER SER C . n 
C 1 217 LYS 217 697 697 LYS LYS C . n 
C 1 218 ALA 218 698 698 ALA ALA C . n 
C 1 219 SER 219 699 699 SER SER C . n 
C 1 220 LYS 220 700 700 LYS LYS C . n 
C 1 221 ILE 221 701 701 ILE ILE C . n 
C 1 222 LEU 222 702 702 LEU LEU C . n 
C 1 223 ILE 223 703 703 ILE ILE C . n 
C 1 224 VAL 224 704 704 VAL VAL C . n 
C 1 225 ASP 225 705 705 ASP ASP C . n 
C 1 226 TRP 226 706 706 TRP TRP C . n 
C 1 227 ASP 227 707 707 ASP ASP C . n 
C 1 228 VAL 228 708 708 VAL VAL C . n 
C 1 229 HIS 229 709 709 HIS HIS C . n 
C 1 230 HIS 230 710 710 HIS HIS C . n 
C 1 231 GLY 231 711 711 GLY GLY C . n 
C 1 232 ASN 232 712 712 ASN ASN C . n 
C 1 233 GLY 233 713 713 GLY GLY C . n 
C 1 234 THR 234 714 714 THR THR C . n 
C 1 235 GLN 235 715 715 GLN GLN C . n 
C 1 236 GLN 236 716 716 GLN GLN C . n 
C 1 237 THR 237 717 717 THR THR C . n 
C 1 238 PHE 238 718 718 PHE PHE C . n 
C 1 239 TYR 239 719 719 TYR TYR C . n 
C 1 240 GLN 240 720 720 GLN GLN C . n 
C 1 241 ASP 241 721 721 ASP ASP C . n 
C 1 242 PRO 242 722 722 PRO PRO C . n 
C 1 243 SER 243 723 723 SER SER C . n 
C 1 244 VAL 244 724 724 VAL VAL C . n 
C 1 245 LEU 245 725 725 LEU LEU C . n 
C 1 246 TYR 246 726 726 TYR TYR C . n 
C 1 247 ILE 247 727 727 ILE ILE C . n 
C 1 248 SER 248 728 728 SER SER C . n 
C 1 249 LEU 249 729 729 LEU LEU C . n 
C 1 250 HIS 250 730 730 HIS HIS C . n 
C 1 251 ARG 251 731 731 ARG ARG C . n 
C 1 252 HIS 252 732 732 HIS HIS C . n 
C 1 253 ASP 253 733 733 ASP ASP C . n 
C 1 254 ASP 254 734 734 ASP ASP C . n 
C 1 255 GLY 255 735 735 GLY GLY C . n 
C 1 256 ASN 256 736 736 ASN ASN C . n 
C 1 257 PHE 257 737 737 PHE PHE C . n 
C 1 258 PHE 258 738 738 PHE PHE C . n 
C 1 259 PRO 259 739 739 PRO PRO C . n 
C 1 260 GLY 260 740 740 GLY GLY C . n 
C 1 261 SER 261 741 741 SER SER C . n 
C 1 262 GLY 262 742 742 GLY GLY C . n 
C 1 263 ALA 263 743 743 ALA ALA C . n 
C 1 264 VAL 264 744 744 VAL VAL C . n 
C 1 265 ASP 265 745 745 ASP ASP C . n 
C 1 266 GLU 266 746 746 GLU GLU C . n 
C 1 267 VAL 267 747 747 VAL VAL C . n 
C 1 268 GLY 268 748 748 GLY GLY C . n 
C 1 269 ALA 269 749 749 ALA ALA C . n 
C 1 270 GLY 270 750 750 GLY GLY C . n 
C 1 271 SER 271 751 751 SER SER C . n 
C 1 272 GLY 272 752 752 GLY GLY C . n 
C 1 273 GLU 273 753 753 GLU GLU C . n 
C 1 274 GLY 274 754 754 GLY GLY C . n 
C 1 275 PHE 275 755 755 PHE PHE C . n 
C 1 276 ASN 276 756 756 ASN ASN C . n 
C 1 277 VAL 277 757 757 VAL VAL C . n 
C 1 278 ASN 278 758 758 ASN ASN C . n 
C 1 279 VAL 279 759 759 VAL VAL C . n 
C 1 280 ALA 280 760 760 ALA ALA C . n 
C 1 281 TRP 281 761 761 TRP TRP C . n 
C 1 282 ALA 282 762 762 ALA ALA C . n 
C 1 283 GLY 283 763 763 GLY GLY C . n 
C 1 284 GLY 284 764 764 GLY GLY C . n 
C 1 285 LEU 285 765 765 LEU LEU C . n 
C 1 286 ASP 286 766 766 ASP ASP C . n 
C 1 287 PRO 287 767 767 PRO PRO C . n 
C 1 288 PRO 288 768 768 PRO PRO C . n 
C 1 289 MET 289 769 769 MET MET C . n 
C 1 290 GLY 290 770 770 GLY GLY C . n 
C 1 291 ASP 291 771 771 ASP ASP C . n 
C 1 292 PRO 292 772 772 PRO PRO C . n 
C 1 293 GLU 293 773 773 GLU GLU C . n 
C 1 294 TYR 294 774 774 TYR TYR C . n 
C 1 295 LEU 295 775 775 LEU LEU C . n 
C 1 296 ALA 296 776 776 ALA ALA C . n 
C 1 297 ALA 297 777 777 ALA ALA C . n 
C 1 298 PHE 298 778 778 PHE PHE C . n 
C 1 299 ARG 299 779 779 ARG ARG C . n 
C 1 300 ILE 300 780 780 ILE ILE C . n 
C 1 301 VAL 301 781 781 VAL VAL C . n 
C 1 302 VAL 302 782 782 VAL VAL C . n 
C 1 303 MET 303 783 783 MET MET C . n 
C 1 304 PRO 304 784 784 PRO PRO C . n 
C 1 305 ILE 305 785 785 ILE ILE C . n 
C 1 306 ALA 306 786 786 ALA ALA C . n 
C 1 307 ARG 307 787 787 ARG ARG C . n 
C 1 308 GLU 308 788 788 GLU GLU C . n 
C 1 309 PHE 309 789 789 PHE PHE C . n 
C 1 310 SER 310 790 790 SER SER C . n 
C 1 311 PRO 311 791 791 PRO PRO C . n 
C 1 312 ASP 312 792 792 ASP ASP C . n 
C 1 313 LEU 313 793 793 LEU LEU C . n 
C 1 314 VAL 314 794 794 VAL VAL C . n 
C 1 315 LEU 315 795 795 LEU LEU C . n 
C 1 316 VAL 316 796 796 VAL VAL C . n 
C 1 317 SER 317 797 797 SER SER C . n 
C 1 318 ALA 318 798 798 ALA ALA C . n 
C 1 319 GLY 319 799 799 GLY GLY C . n 
C 1 320 PHE 320 800 800 PHE PHE C . n 
C 1 321 ASP 321 801 801 ASP ASP C . n 
C 1 322 ALA 322 802 802 ALA ALA C . n 
C 1 323 ALA 323 803 803 ALA ALA C . n 
C 1 324 GLU 324 804 804 GLU GLU C . n 
C 1 325 GLY 325 805 805 GLY GLY C . n 
C 1 326 HIS 326 806 806 HIS HIS C . n 
C 1 327 PRO 327 807 807 PRO PRO C . n 
C 1 328 ALA 328 808 808 ALA ALA C . n 
C 1 329 PRO 329 809 809 PRO PRO C . n 
C 1 330 LEU 330 810 810 LEU LEU C . n 
C 1 331 GLY 331 811 811 GLY GLY C . n 
C 1 332 GLY 332 812 812 GLY GLY C . n 
C 1 333 TYR 333 813 813 TYR TYR C . n 
C 1 334 HIS 334 814 814 HIS HIS C . n 
C 1 335 VAL 335 815 815 VAL VAL C . n 
C 1 336 SER 336 816 816 SER SER C . n 
C 1 337 ALA 337 817 817 ALA ALA C . n 
C 1 338 LYS 338 818 818 LYS LYS C . n 
C 1 339 CYS 339 819 819 CYS CYS C . n 
C 1 340 PHE 340 820 820 PHE PHE C . n 
C 1 341 GLY 341 821 821 GLY GLY C . n 
C 1 342 TYR 342 822 822 TYR TYR C . n 
C 1 343 MET 343 823 823 MET MET C . n 
C 1 344 THR 344 824 824 THR THR C . n 
C 1 345 GLN 345 825 825 GLN GLN C . n 
C 1 346 GLN 346 826 826 GLN GLN C . n 
C 1 347 LEU 347 827 827 LEU LEU C . n 
C 1 348 MET 348 828 828 MET MET C . n 
C 1 349 ASN 349 829 829 ASN ASN C . n 
C 1 350 LEU 350 830 830 LEU LEU C . n 
C 1 351 ALA 351 831 831 ALA ALA C . n 
C 1 352 GLY 352 832 832 GLY GLY C . n 
C 1 353 GLY 353 833 833 GLY GLY C . n 
C 1 354 ALA 354 834 834 ALA ALA C . n 
C 1 355 VAL 355 835 835 VAL VAL C . n 
C 1 356 VAL 356 836 836 VAL VAL C . n 
C 1 357 LEU 357 837 837 LEU LEU C . n 
C 1 358 ALA 358 838 838 ALA ALA C . n 
C 1 359 LEU 359 839 839 LEU LEU C . n 
C 1 360 GLU 360 840 840 GLU GLU C . n 
C 1 361 GLY 361 841 841 GLY GLY C . n 
C 1 362 GLY 362 842 842 GLY GLY C . n 
C 1 363 HIS 363 843 843 HIS HIS C . n 
C 1 364 ASP 364 844 844 ASP ASP C . n 
C 1 365 LEU 365 845 845 LEU LEU C . n 
C 1 366 THR 366 846 846 THR THR C . n 
C 1 367 ALA 367 847 847 ALA ALA C . n 
C 1 368 ILE 368 848 848 ILE ILE C . n 
C 1 369 CYS 369 849 849 CYS CYS C . n 
C 1 370 ASP 370 850 850 ASP ASP C . n 
C 1 371 ALA 371 851 851 ALA ALA C . n 
C 1 372 SER 372 852 852 SER SER C . n 
C 1 373 GLU 373 853 853 GLU GLU C . n 
C 1 374 ALA 374 854 854 ALA ALA C . n 
C 1 375 CYS 375 855 855 CYS CYS C . n 
C 1 376 VAL 376 856 856 VAL VAL C . n 
C 1 377 ALA 377 857 857 ALA ALA C . n 
C 1 378 ALA 378 858 858 ALA ALA C . n 
C 1 379 LEU 379 859 859 LEU LEU C . n 
C 1 380 LEU 380 860 860 LEU LEU C . n 
C 1 381 GLY 381 861 861 GLY GLY C . n 
C 1 382 ASN 382 862 862 ASN ASN C . n 
C 1 383 ARG 383 863 863 ARG ARG C . n 
C 1 384 VAL 384 864 864 VAL VAL C . n 
C 1 385 ASP 385 865 865 ASP ASP C . n 
C 1 386 PRO 386 866 866 PRO PRO C . n 
C 1 387 LEU 387 867 867 LEU LEU C . n 
C 1 388 SER 388 868 868 SER SER C . n 
C 1 389 GLU 389 869 869 GLU GLU C . n 
C 1 390 GLU 390 870 870 GLU GLU C . n 
C 1 391 GLY 391 871 871 GLY GLY C . n 
C 1 392 TRP 392 872 872 TRP TRP C . n 
C 1 393 LYS 393 873 873 LYS LYS C . n 
C 1 394 GLN 394 874 874 GLN GLN C . n 
C 1 395 LYS 395 875 875 LYS LYS C . n 
C 1 396 PRO 396 876 876 PRO PRO C . n 
C 1 397 ASN 397 877 877 ASN ASN C . n 
C 1 398 LEU 398 878 878 LEU LEU C . n 
C 1 399 ASN 399 879 879 ASN ASN C . n 
C 1 400 ALA 400 880 880 ALA ALA C . n 
C 1 401 ILE 401 881 881 ILE ILE C . n 
C 1 402 ARG 402 882 882 ARG ARG C . n 
C 1 403 SER 403 883 883 SER SER C . n 
C 1 404 LEU 404 884 884 LEU LEU C . n 
C 1 405 GLU 405 885 885 GLU GLU C . n 
C 1 406 ALA 406 886 886 ALA ALA C . n 
C 1 407 VAL 407 887 887 VAL VAL C . n 
C 1 408 ILE 408 888 888 ILE ILE C . n 
C 1 409 ARG 409 889 889 ARG ARG C . n 
C 1 410 VAL 410 890 890 VAL VAL C . n 
C 1 411 HIS 411 891 891 HIS HIS C . n 
C 1 412 SER 412 892 892 SER SER C . n 
C 1 413 LYS 413 893 893 LYS LYS C . n 
C 1 414 TYR 414 894 894 TYR TYR C . n 
C 1 415 TRP 415 895 895 TRP TRP C . n 
C 1 416 GLY 416 896 896 GLY GLY C . n 
C 1 417 CYS 417 897 897 CYS CYS C . n 
C 1 418 MET 418 898 898 MET MET C . n 
C 1 419 GLN 419 899 899 GLN GLN C . n 
C 1 420 ARG 420 900 ?   ?   ?   C . n 
C 1 421 LEU 421 901 ?   ?   ?   C . n 
C 1 422 ALA 422 902 ?   ?   ?   C . n 
C 1 423 SER 423 903 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 ZN  1  101  101  ZN  ZN  A . 
E 2 ZN  1  102  102  ZN  ZN  A . 
F 3 K   1  201  201  K   K   A . 
G 3 K   1  202  202  K   K   A . 
H 4 NU7 1  1900 1900 NU7 NU7 A . 
I 2 ZN  1  101  101  ZN  ZN  B . 
J 2 ZN  1  102  102  ZN  ZN  B . 
K 3 K   1  201  201  K   K   B . 
L 3 K   1  202  202  K   K   B . 
M 4 NU7 1  1900 1900 NU7 NU7 B . 
N 2 ZN  1  101  101  ZN  ZN  C . 
O 2 ZN  1  102  102  ZN  ZN  C . 
P 3 K   1  201  201  K   K   C . 
Q 3 K   1  202  202  K   K   C . 
R 4 NU7 1  1900 1900 NU7 NU7 C . 
S 5 HOH 1  2001 2001 HOH HOH A . 
S 5 HOH 2  2002 2002 HOH HOH A . 
S 5 HOH 3  2003 2003 HOH HOH A . 
S 5 HOH 4  2004 2004 HOH HOH A . 
S 5 HOH 5  2005 2005 HOH HOH A . 
S 5 HOH 6  2006 2006 HOH HOH A . 
S 5 HOH 7  2007 2007 HOH HOH A . 
S 5 HOH 8  2008 2008 HOH HOH A . 
S 5 HOH 9  2009 2009 HOH HOH A . 
S 5 HOH 10 2010 2010 HOH HOH A . 
S 5 HOH 11 2011 2011 HOH HOH A . 
S 5 HOH 12 2012 2012 HOH HOH A . 
S 5 HOH 13 2013 2013 HOH HOH A . 
S 5 HOH 14 2014 2014 HOH HOH A . 
S 5 HOH 15 2015 2015 HOH HOH A . 
S 5 HOH 16 2016 2016 HOH HOH A . 
S 5 HOH 17 2017 2017 HOH HOH A . 
S 5 HOH 18 2018 2018 HOH HOH A . 
S 5 HOH 19 2019 2019 HOH HOH A . 
S 5 HOH 20 2020 2020 HOH HOH A . 
S 5 HOH 21 2021 2021 HOH HOH A . 
S 5 HOH 22 2022 2022 HOH HOH A . 
S 5 HOH 23 2023 2023 HOH HOH A . 
S 5 HOH 24 2024 2024 HOH HOH A . 
S 5 HOH 25 2025 2025 HOH HOH A . 
S 5 HOH 26 2026 2026 HOH HOH A . 
S 5 HOH 27 2027 2027 HOH HOH A . 
S 5 HOH 28 2028 2028 HOH HOH A . 
S 5 HOH 29 2029 2029 HOH HOH A . 
S 5 HOH 30 2030 2030 HOH HOH A . 
S 5 HOH 31 2031 2031 HOH HOH A . 
S 5 HOH 32 2032 2032 HOH HOH A . 
S 5 HOH 33 2033 2033 HOH HOH A . 
S 5 HOH 34 2034 2034 HOH HOH A . 
S 5 HOH 35 2035 2035 HOH HOH A . 
S 5 HOH 36 2036 2036 HOH HOH A . 
S 5 HOH 37 2037 2037 HOH HOH A . 
S 5 HOH 38 2038 2038 HOH HOH A . 
S 5 HOH 39 2039 2039 HOH HOH A . 
S 5 HOH 40 2040 2040 HOH HOH A . 
S 5 HOH 41 2041 2041 HOH HOH A . 
S 5 HOH 42 2042 2042 HOH HOH A . 
S 5 HOH 43 2043 2043 HOH HOH A . 
S 5 HOH 44 2044 2044 HOH HOH A . 
S 5 HOH 45 2045 2045 HOH HOH A . 
S 5 HOH 46 2046 2046 HOH HOH A . 
T 5 HOH 1  2001 2001 HOH HOH B . 
T 5 HOH 2  2002 2002 HOH HOH B . 
T 5 HOH 3  2003 2003 HOH HOH B . 
T 5 HOH 4  2004 2004 HOH HOH B . 
T 5 HOH 5  2005 2005 HOH HOH B . 
T 5 HOH 6  2006 2006 HOH HOH B . 
T 5 HOH 7  2007 2007 HOH HOH B . 
T 5 HOH 8  2008 2008 HOH HOH B . 
T 5 HOH 9  2009 2009 HOH HOH B . 
T 5 HOH 10 2010 2010 HOH HOH B . 
T 5 HOH 11 2011 2011 HOH HOH B . 
T 5 HOH 12 2012 2012 HOH HOH B . 
T 5 HOH 13 2013 2013 HOH HOH B . 
T 5 HOH 14 2014 2014 HOH HOH B . 
T 5 HOH 15 2015 2015 HOH HOH B . 
T 5 HOH 16 2016 2016 HOH HOH B . 
T 5 HOH 17 2017 2017 HOH HOH B . 
T 5 HOH 18 2018 2018 HOH HOH B . 
T 5 HOH 19 2019 2019 HOH HOH B . 
T 5 HOH 20 2020 2020 HOH HOH B . 
T 5 HOH 21 2021 2021 HOH HOH B . 
T 5 HOH 22 2022 2022 HOH HOH B . 
T 5 HOH 23 2023 2023 HOH HOH B . 
T 5 HOH 24 2024 2024 HOH HOH B . 
T 5 HOH 25 2025 2025 HOH HOH B . 
T 5 HOH 26 2026 2026 HOH HOH B . 
T 5 HOH 27 2027 2027 HOH HOH B . 
T 5 HOH 28 2028 2028 HOH HOH B . 
T 5 HOH 29 2029 2029 HOH HOH B . 
T 5 HOH 30 2030 2030 HOH HOH B . 
T 5 HOH 31 2031 2031 HOH HOH B . 
T 5 HOH 32 2032 2032 HOH HOH B . 
T 5 HOH 33 2033 2033 HOH HOH B . 
T 5 HOH 34 2034 2034 HOH HOH B . 
T 5 HOH 35 2035 2035 HOH HOH B . 
T 5 HOH 36 2036 2036 HOH HOH B . 
T 5 HOH 37 2037 2037 HOH HOH B . 
T 5 HOH 38 2038 2038 HOH HOH B . 
T 5 HOH 39 2039 2039 HOH HOH B . 
T 5 HOH 40 2040 2040 HOH HOH B . 
T 5 HOH 41 2041 2041 HOH HOH B . 
T 5 HOH 42 2042 2042 HOH HOH B . 
T 5 HOH 43 2043 2043 HOH HOH B . 
T 5 HOH 44 2044 2044 HOH HOH B . 
T 5 HOH 45 2045 2045 HOH HOH B . 
T 5 HOH 46 2046 2046 HOH HOH B . 
T 5 HOH 47 2047 2047 HOH HOH B . 
T 5 HOH 48 2048 2048 HOH HOH B . 
T 5 HOH 49 2049 2049 HOH HOH B . 
T 5 HOH 50 2050 2050 HOH HOH B . 
T 5 HOH 51 2051 2051 HOH HOH B . 
T 5 HOH 52 2052 2052 HOH HOH B . 
T 5 HOH 53 2053 2053 HOH HOH B . 
T 5 HOH 54 2054 2054 HOH HOH B . 
T 5 HOH 55 2055 2055 HOH HOH B . 
T 5 HOH 56 2056 2056 HOH HOH B . 
T 5 HOH 57 2057 2057 HOH HOH B . 
T 5 HOH 58 2058 2058 HOH HOH B . 
T 5 HOH 59 2059 2059 HOH HOH B . 
T 5 HOH 60 2060 2060 HOH HOH B . 
T 5 HOH 61 2061 2061 HOH HOH B . 
T 5 HOH 62 2062 2062 HOH HOH B . 
T 5 HOH 63 2063 2063 HOH HOH B . 
T 5 HOH 64 2064 2064 HOH HOH B . 
T 5 HOH 65 2065 2065 HOH HOH B . 
T 5 HOH 66 2066 2066 HOH HOH B . 
T 5 HOH 67 2067 2067 HOH HOH B . 
T 5 HOH 68 2068 2068 HOH HOH B . 
T 5 HOH 69 2069 2069 HOH HOH B . 
U 5 HOH 1  2001 2001 HOH HOH C . 
U 5 HOH 2  2002 2002 HOH HOH C . 
U 5 HOH 3  2003 2003 HOH HOH C . 
U 5 HOH 4  2004 2004 HOH HOH C . 
U 5 HOH 5  2005 2005 HOH HOH C . 
U 5 HOH 6  2006 2006 HOH HOH C . 
U 5 HOH 7  2007 2007 HOH HOH C . 
U 5 HOH 8  2008 2008 HOH HOH C . 
U 5 HOH 9  2009 2009 HOH HOH C . 
U 5 HOH 10 2010 2010 HOH HOH C . 
U 5 HOH 11 2011 2011 HOH HOH C . 
U 5 HOH 12 2012 2012 HOH HOH C . 
U 5 HOH 13 2013 2013 HOH HOH C . 
U 5 HOH 14 2014 2014 HOH HOH C . 
U 5 HOH 15 2015 2015 HOH HOH C . 
U 5 HOH 16 2016 2016 HOH HOH C . 
U 5 HOH 17 2017 2017 HOH HOH C . 
U 5 HOH 18 2018 2018 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,E,F,G,H,S 
2 1 B,I,J,K,L,M,T 
3 1 C,N,O,P,Q,R,U 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? A HIS 229 ? A HIS 709  ? 1_555 ZN ? D ZN . ? A ZN 101 ? 1_555 OD2 ? A ASP 321 ? A ASP 801  ? 1_555 100.3 ? 
2  ND1 ? A HIS 229 ? A HIS 709  ? 1_555 ZN ? D ZN . ? A ZN 101 ? 1_555 OD1 ? A ASP 227 ? A ASP 707  ? 1_555 102.9 ? 
3  OD2 ? A ASP 321 ? A ASP 801  ? 1_555 ZN ? D ZN . ? A ZN 101 ? 1_555 OD1 ? A ASP 227 ? A ASP 707  ? 1_555 96.4  ? 
4  SG  ? A CYS 53  ? A CYS 533  ? 1_555 ZN ? E ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 61  ? A HIS 541  ? 1_555 102.9 ? 
5  SG  ? A CYS 53  ? A CYS 533  ? 1_555 ZN ? E ZN . ? A ZN 102 ? 1_555 SG  ? A CYS 138 ? A CYS 618  ? 1_555 112.4 ? 
6  NE2 ? A HIS 61  ? A HIS 541  ? 1_555 ZN ? E ZN . ? A ZN 102 ? 1_555 SG  ? A CYS 138 ? A CYS 618  ? 1_555 111.2 ? 
7  SG  ? A CYS 53  ? A CYS 533  ? 1_555 ZN ? E ZN . ? A ZN 102 ? 1_555 SG  ? A CYS 55  ? A CYS 535  ? 1_555 103.9 ? 
8  NE2 ? A HIS 61  ? A HIS 541  ? 1_555 ZN ? E ZN . ? A ZN 102 ? 1_555 SG  ? A CYS 55  ? A CYS 535  ? 1_555 107.5 ? 
9  SG  ? A CYS 138 ? A CYS 618  ? 1_555 ZN ? E ZN . ? A ZN 102 ? 1_555 SG  ? A CYS 55  ? A CYS 535  ? 1_555 117.7 ? 
10 OD1 ? A ASP 225 ? A ASP 705  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 OG  ? A SER 248 ? A SER 728  ? 1_555 113.5 ? 
11 OD1 ? A ASP 225 ? A ASP 705  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A ASP 227 ? A ASP 707  ? 1_555 92.8  ? 
12 OG  ? A SER 248 ? A SER 728  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A ASP 227 ? A ASP 707  ? 1_555 151.5 ? 
13 OD1 ? A ASP 225 ? A ASP 705  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A HIS 229 ? A HIS 709  ? 1_555 91.9  ? 
14 OG  ? A SER 248 ? A SER 728  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A HIS 229 ? A HIS 709  ? 1_555 111.4 ? 
15 O   ? A ASP 227 ? A ASP 707  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A HIS 229 ? A HIS 709  ? 1_555 76.8  ? 
16 OD1 ? A ASP 225 ? A ASP 705  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A ASP 225 ? A ASP 705  ? 1_555 68.4  ? 
17 OG  ? A SER 248 ? A SER 728  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A ASP 225 ? A ASP 705  ? 1_555 82.0  ? 
18 O   ? A ASP 227 ? A ASP 707  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A ASP 225 ? A ASP 705  ? 1_555 98.8  ? 
19 O   ? A HIS 229 ? A HIS 709  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A ASP 225 ? A ASP 705  ? 1_555 159.7 ? 
20 OD1 ? A ASP 225 ? A ASP 705  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A LEU 249 ? A LEU 729  ? 1_555 132.0 ? 
21 OG  ? A SER 248 ? A SER 728  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A LEU 249 ? A LEU 729  ? 1_555 89.2  ? 
22 O   ? A ASP 227 ? A ASP 707  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A LEU 249 ? A LEU 729  ? 1_555 64.1  ? 
23 O   ? A HIS 229 ? A HIS 709  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A LEU 249 ? A LEU 729  ? 1_555 119.6 ? 
24 O   ? A ASP 225 ? A ASP 705  ? 1_555 K  ? F K  . ? A K  201 ? 1_555 O   ? A LEU 249 ? A LEU 729  ? 1_555 74.2  ? 
25 O   ? A ASP 241 ? A ASP 721  ? 1_555 K  ? G K  . ? A K  202 ? 1_555 O   ? A VAL 244 ? A VAL 724  ? 1_555 72.1  ? 
26 O   ? A ASP 241 ? A ASP 721  ? 1_555 K  ? G K  . ? A K  202 ? 1_555 O   ? A PHE 275 ? A PHE 755  ? 1_555 128.6 ? 
27 O   ? A VAL 244 ? A VAL 724  ? 1_555 K  ? G K  . ? A K  202 ? 1_555 O   ? A PHE 275 ? A PHE 755  ? 1_555 71.9  ? 
28 O   ? A ASP 241 ? A ASP 721  ? 1_555 K  ? G K  . ? A K  202 ? 1_555 O   ? A PHE 238 ? A PHE 718  ? 1_555 90.9  ? 
29 O   ? A VAL 244 ? A VAL 724  ? 1_555 K  ? G K  . ? A K  202 ? 1_555 O   ? A PHE 238 ? A PHE 718  ? 1_555 132.8 ? 
30 O   ? A PHE 275 ? A PHE 755  ? 1_555 K  ? G K  . ? A K  202 ? 1_555 O   ? A PHE 238 ? A PHE 718  ? 1_555 140.4 ? 
31 ND1 ? B HIS 229 ? B HIS 709  ? 1_555 ZN ? I ZN . ? B ZN 101 ? 1_555 OD1 ? B ASP 227 ? B ASP 707  ? 1_555 106.6 ? 
32 ND1 ? B HIS 229 ? B HIS 709  ? 1_555 ZN ? I ZN . ? B ZN 101 ? 1_555 OD2 ? B ASP 321 ? B ASP 801  ? 1_555 95.4  ? 
33 OD1 ? B ASP 227 ? B ASP 707  ? 1_555 ZN ? I ZN . ? B ZN 101 ? 1_555 OD2 ? B ASP 321 ? B ASP 801  ? 1_555 97.5  ? 
34 SG  ? B CYS 55  ? B CYS 535  ? 1_555 ZN ? J ZN . ? B ZN 102 ? 1_555 SG  ? B CYS 138 ? B CYS 618  ? 1_555 119.6 ? 
35 SG  ? B CYS 55  ? B CYS 535  ? 1_555 ZN ? J ZN . ? B ZN 102 ? 1_555 NE2 ? B HIS 61  ? B HIS 541  ? 1_555 109.7 ? 
36 SG  ? B CYS 138 ? B CYS 618  ? 1_555 ZN ? J ZN . ? B ZN 102 ? 1_555 NE2 ? B HIS 61  ? B HIS 541  ? 1_555 114.9 ? 
37 SG  ? B CYS 55  ? B CYS 535  ? 1_555 ZN ? J ZN . ? B ZN 102 ? 1_555 SG  ? B CYS 53  ? B CYS 533  ? 1_555 105.0 ? 
38 SG  ? B CYS 138 ? B CYS 618  ? 1_555 ZN ? J ZN . ? B ZN 102 ? 1_555 SG  ? B CYS 53  ? B CYS 533  ? 1_555 106.4 ? 
39 NE2 ? B HIS 61  ? B HIS 541  ? 1_555 ZN ? J ZN . ? B ZN 102 ? 1_555 SG  ? B CYS 53  ? B CYS 533  ? 1_555 98.5  ? 
40 OG  ? B SER 248 ? B SER 728  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B ASP 225 ? B ASP 705  ? 1_555 84.2  ? 
41 OG  ? B SER 248 ? B SER 728  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B LEU 249 ? B LEU 729  ? 1_555 88.4  ? 
42 O   ? B ASP 225 ? B ASP 705  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B LEU 249 ? B LEU 729  ? 1_555 74.6  ? 
43 OG  ? B SER 248 ? B SER 728  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 OD1 ? B ASP 225 ? B ASP 705  ? 1_555 114.8 ? 
44 O   ? B ASP 225 ? B ASP 705  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 OD1 ? B ASP 225 ? B ASP 705  ? 1_555 68.1  ? 
45 O   ? B LEU 249 ? B LEU 729  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 OD1 ? B ASP 225 ? B ASP 705  ? 1_555 132.7 ? 
46 OG  ? B SER 248 ? B SER 728  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B ASP 227 ? B ASP 707  ? 1_555 153.3 ? 
47 O   ? B ASP 225 ? B ASP 705  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B ASP 227 ? B ASP 707  ? 1_555 100.5 ? 
48 O   ? B LEU 249 ? B LEU 729  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B ASP 227 ? B ASP 707  ? 1_555 68.0  ? 
49 OD1 ? B ASP 225 ? B ASP 705  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B ASP 227 ? B ASP 707  ? 1_555 91.0  ? 
50 OG  ? B SER 248 ? B SER 728  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B HIS 229 ? B HIS 709  ? 1_555 109.6 ? 
51 O   ? B ASP 225 ? B ASP 705  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B HIS 229 ? B HIS 709  ? 1_555 161.2 ? 
52 O   ? B LEU 249 ? B LEU 729  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B HIS 229 ? B HIS 709  ? 1_555 117.3 ? 
53 OD1 ? B ASP 225 ? B ASP 705  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B HIS 229 ? B HIS 709  ? 1_555 94.0  ? 
54 O   ? B ASP 227 ? B ASP 707  ? 1_555 K  ? K K  . ? B K  201 ? 1_555 O   ? B HIS 229 ? B HIS 709  ? 1_555 73.2  ? 
55 O   ? B ASP 241 ? B ASP 721  ? 1_555 K  ? L K  . ? B K  202 ? 1_555 O   ? B PHE 275 ? B PHE 755  ? 1_555 130.8 ? 
56 O   ? B ASP 241 ? B ASP 721  ? 1_555 K  ? L K  . ? B K  202 ? 1_555 O   ? B PHE 238 ? B PHE 718  ? 1_555 88.3  ? 
57 O   ? B PHE 275 ? B PHE 755  ? 1_555 K  ? L K  . ? B K  202 ? 1_555 O   ? B PHE 238 ? B PHE 718  ? 1_555 140.3 ? 
58 O   ? B ASP 241 ? B ASP 721  ? 1_555 K  ? L K  . ? B K  202 ? 1_555 O   ? B VAL 244 ? B VAL 724  ? 1_555 74.3  ? 
59 O   ? B PHE 275 ? B PHE 755  ? 1_555 K  ? L K  . ? B K  202 ? 1_555 O   ? B VAL 244 ? B VAL 724  ? 1_555 71.6  ? 
60 O   ? B PHE 238 ? B PHE 718  ? 1_555 K  ? L K  . ? B K  202 ? 1_555 O   ? B VAL 244 ? B VAL 724  ? 1_555 136.7 ? 
61 OD2 ? C ASP 321 ? C ASP 801  ? 1_555 ZN ? N ZN . ? C ZN 101 ? 1_555 O09 ? R NU7 .   ? C NU7 1900 ? 1_555 91.1  ? 
62 OD2 ? C ASP 321 ? C ASP 801  ? 1_555 ZN ? N ZN . ? C ZN 101 ? 1_555 ND1 ? C HIS 229 ? C HIS 709  ? 1_555 90.7  ? 
63 O09 ? R NU7 .   ? C NU7 1900 ? 1_555 ZN ? N ZN . ? C ZN 101 ? 1_555 ND1 ? C HIS 229 ? C HIS 709  ? 1_555 97.3  ? 
64 OD2 ? C ASP 321 ? C ASP 801  ? 1_555 ZN ? N ZN . ? C ZN 101 ? 1_555 OD1 ? C ASP 227 ? C ASP 707  ? 1_555 94.7  ? 
65 O09 ? R NU7 .   ? C NU7 1900 ? 1_555 ZN ? N ZN . ? C ZN 101 ? 1_555 OD1 ? C ASP 227 ? C ASP 707  ? 1_555 161.8 ? 
66 ND1 ? C HIS 229 ? C HIS 709  ? 1_555 ZN ? N ZN . ? C ZN 101 ? 1_555 OD1 ? C ASP 227 ? C ASP 707  ? 1_555 99.9  ? 
67 SG  ? C CYS 53  ? C CYS 533  ? 1_555 ZN ? O ZN . ? C ZN 102 ? 1_555 NE2 ? C HIS 61  ? C HIS 541  ? 1_555 99.1  ? 
68 SG  ? C CYS 53  ? C CYS 533  ? 1_555 ZN ? O ZN . ? C ZN 102 ? 1_555 SG  ? C CYS 138 ? C CYS 618  ? 1_555 103.9 ? 
69 NE2 ? C HIS 61  ? C HIS 541  ? 1_555 ZN ? O ZN . ? C ZN 102 ? 1_555 SG  ? C CYS 138 ? C CYS 618  ? 1_555 112.2 ? 
70 SG  ? C CYS 53  ? C CYS 533  ? 1_555 ZN ? O ZN . ? C ZN 102 ? 1_555 SG  ? C CYS 55  ? C CYS 535  ? 1_555 113.6 ? 
71 NE2 ? C HIS 61  ? C HIS 541  ? 1_555 ZN ? O ZN . ? C ZN 102 ? 1_555 SG  ? C CYS 55  ? C CYS 535  ? 1_555 114.4 ? 
72 SG  ? C CYS 138 ? C CYS 618  ? 1_555 ZN ? O ZN . ? C ZN 102 ? 1_555 SG  ? C CYS 55  ? C CYS 535  ? 1_555 112.5 ? 
73 OG  ? C SER 248 ? C SER 728  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C HIS 229 ? C HIS 709  ? 1_555 114.5 ? 
74 OG  ? C SER 248 ? C SER 728  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C ASP 227 ? C ASP 707  ? 1_555 156.5 ? 
75 O   ? C HIS 229 ? C HIS 709  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C ASP 227 ? C ASP 707  ? 1_555 72.1  ? 
76 OG  ? C SER 248 ? C SER 728  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 OD1 ? C ASP 225 ? C ASP 705  ? 1_555 112.2 ? 
77 O   ? C HIS 229 ? C HIS 709  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 OD1 ? C ASP 225 ? C ASP 705  ? 1_555 93.1  ? 
78 O   ? C ASP 227 ? C ASP 707  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 OD1 ? C ASP 225 ? C ASP 705  ? 1_555 89.2  ? 
79 OG  ? C SER 248 ? C SER 728  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C ASP 225 ? C ASP 705  ? 1_555 82.9  ? 
80 O   ? C HIS 229 ? C HIS 709  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C ASP 225 ? C ASP 705  ? 1_555 156.3 ? 
81 O   ? C ASP 227 ? C ASP 707  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C ASP 225 ? C ASP 705  ? 1_555 98.7  ? 
82 OD1 ? C ASP 225 ? C ASP 705  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C ASP 225 ? C ASP 705  ? 1_555 64.5  ? 
83 OG  ? C SER 248 ? C SER 728  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C LEU 249 ? C LEU 729  ? 1_555 95.2  ? 
84 O   ? C HIS 229 ? C HIS 709  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C LEU 249 ? C LEU 729  ? 1_555 116.4 ? 
85 O   ? C ASP 227 ? C ASP 707  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C LEU 249 ? C LEU 729  ? 1_555 62.9  ? 
86 OD1 ? C ASP 225 ? C ASP 705  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C LEU 249 ? C LEU 729  ? 1_555 126.8 ? 
87 O   ? C ASP 225 ? C ASP 705  ? 1_555 K  ? P K  . ? C K  201 ? 1_555 O   ? C LEU 249 ? C LEU 729  ? 1_555 75.6  ? 
88 O   ? C VAL 244 ? C VAL 724  ? 1_555 K  ? Q K  . ? C K  202 ? 1_555 O   ? C PHE 238 ? C PHE 718  ? 1_555 109.1 ? 
89 O   ? C VAL 244 ? C VAL 724  ? 1_555 K  ? Q K  . ? C K  202 ? 1_555 O   ? C PHE 275 ? C PHE 755  ? 1_555 75.6  ? 
90 O   ? C PHE 238 ? C PHE 718  ? 1_555 K  ? Q K  . ? C K  202 ? 1_555 O   ? C PHE 275 ? C PHE 755  ? 1_555 157.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-03-27 
2 'Structure model' 1 1 2013-04-03 
3 'Structure model' 1 2 2013-05-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.5.0053 ? 1 
HKL    'data reduction' .        ? 2 
HKL    'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 672 ? ? -105.90 -165.80 
2  1 SER A 674 ? ? -141.22 33.38   
3  1 VAL A 781 ? ? -108.52 -63.01  
4  1 SER A 790 ? ? 62.39   71.32   
5  1 PRO A 809 ? ? -105.37 58.63   
6  1 GLU A 840 ? ? -113.15 -103.12 
7  1 HIS B 531 ? ? -68.32  95.69   
8  1 LYS B 598 ? ? -100.68 55.51   
9  1 PHE B 681 ? ? -120.34 -50.19  
10 1 ALA B 698 ? ? 81.44   5.58    
11 1 VAL B 781 ? ? -120.23 -58.32  
12 1 SER B 790 ? ? 67.30   69.04   
13 1 GLU B 840 ? ? -114.98 -103.00 
14 1 HIS B 843 ? ? -122.02 -51.96  
15 1 ASN C 592 ? ? -84.99  -132.28 
16 1 SER C 674 ? ? -143.66 47.71   
17 1 SER C 699 ? ? -101.71 -62.68  
18 1 VAL C 781 ? ? -109.96 -63.63  
19 1 SER C 790 ? ? 65.51   70.92   
20 1 GLU C 840 ? ? -117.43 -103.80 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 583 ? CG  ? A GLU 103 CG  
2  1 Y 1 A GLU 583 ? CD  ? A GLU 103 CD  
3  1 Y 1 A GLU 583 ? OE1 ? A GLU 103 OE1 
4  1 Y 1 A GLU 583 ? OE2 ? A GLU 103 OE2 
5  1 Y 1 A ARG 584 ? CG  ? A ARG 104 CG  
6  1 Y 1 A ARG 584 ? CD  ? A ARG 104 CD  
7  1 Y 1 A ARG 584 ? NE  ? A ARG 104 NE  
8  1 Y 1 A ARG 584 ? CZ  ? A ARG 104 CZ  
9  1 Y 1 A ARG 584 ? NH1 ? A ARG 104 NH1 
10 1 Y 1 A ARG 584 ? NH2 ? A ARG 104 NH2 
11 1 Y 1 A LEU 867 ? CG  ? A LEU 387 CG  
12 1 Y 1 A LEU 867 ? CD1 ? A LEU 387 CD1 
13 1 Y 1 A LEU 867 ? CD2 ? A LEU 387 CD2 
14 1 Y 1 A GLU 870 ? CB  ? A GLU 390 CB  
15 1 Y 1 A GLU 870 ? CG  ? A GLU 390 CG  
16 1 Y 1 A GLU 870 ? CD  ? A GLU 390 CD  
17 1 Y 1 A GLU 870 ? OE1 ? A GLU 390 OE1 
18 1 Y 1 A GLU 870 ? OE2 ? A GLU 390 OE2 
19 1 Y 1 A LYS 875 ? CG  ? A LYS 395 CG  
20 1 Y 1 A LYS 875 ? CD  ? A LYS 395 CD  
21 1 Y 1 A LYS 875 ? CE  ? A LYS 395 CE  
22 1 Y 1 A LYS 875 ? NZ  ? A LYS 395 NZ  
23 1 Y 1 A ARG 889 ? CG  ? A ARG 409 CG  
24 1 Y 1 A ARG 889 ? CD  ? A ARG 409 CD  
25 1 Y 1 A ARG 889 ? NE  ? A ARG 409 NE  
26 1 Y 1 A ARG 889 ? CZ  ? A ARG 409 CZ  
27 1 Y 1 A ARG 889 ? NH1 ? A ARG 409 NH1 
28 1 Y 1 A ARG 889 ? NH2 ? A ARG 409 NH2 
29 1 Y 1 B ARG 596 ? CB  ? B ARG 116 CB  
30 1 Y 1 B ARG 596 ? CG  ? B ARG 116 CG  
31 1 Y 1 B ARG 596 ? CD  ? B ARG 116 CD  
32 1 Y 1 B ARG 596 ? NE  ? B ARG 116 NE  
33 1 Y 1 B ARG 596 ? CZ  ? B ARG 116 CZ  
34 1 Y 1 B ARG 596 ? NH1 ? B ARG 116 NH1 
35 1 Y 1 B ARG 596 ? NH2 ? B ARG 116 NH2 
36 1 Y 1 B LYS 598 ? CG  ? B LYS 118 CG  
37 1 Y 1 B LYS 598 ? CD  ? B LYS 118 CD  
38 1 Y 1 B LYS 598 ? CE  ? B LYS 118 CE  
39 1 Y 1 B LYS 598 ? NZ  ? B LYS 118 NZ  
40 1 Y 1 B ARG 655 ? CG  ? B ARG 175 CG  
41 1 Y 1 B ARG 655 ? CD  ? B ARG 175 CD  
42 1 Y 1 B ARG 655 ? NE  ? B ARG 175 NE  
43 1 Y 1 B ARG 655 ? CZ  ? B ARG 175 CZ  
44 1 Y 1 B ARG 655 ? NH1 ? B ARG 175 NH1 
45 1 Y 1 B ARG 655 ? NH2 ? B ARG 175 NH2 
46 1 Y 1 B LYS 818 ? CD  ? B LYS 338 CD  
47 1 Y 1 B LYS 818 ? CE  ? B LYS 338 CE  
48 1 Y 1 B LYS 818 ? NZ  ? B LYS 338 NZ  
49 1 Y 1 B ARG 900 ? NE  ? B ARG 420 NE  
50 1 Y 1 B ARG 900 ? CZ  ? B ARG 420 CZ  
51 1 Y 1 B ARG 900 ? NH1 ? B ARG 420 NH1 
52 1 Y 1 B ARG 900 ? NH2 ? B ARG 420 NH2 
53 1 Y 1 C GLU 575 ? CG  ? C GLU 95  CG  
54 1 Y 1 C GLU 575 ? CD  ? C GLU 95  CD  
55 1 Y 1 C GLU 575 ? OE1 ? C GLU 95  OE1 
56 1 Y 1 C GLU 575 ? OE2 ? C GLU 95  OE2 
57 1 Y 1 C LYS 697 ? CG  ? C LYS 217 CG  
58 1 Y 1 C LYS 697 ? CD  ? C LYS 217 CD  
59 1 Y 1 C LYS 697 ? CE  ? C LYS 217 CE  
60 1 Y 1 C LYS 697 ? NZ  ? C LYS 217 NZ  
61 1 Y 1 C GLN 716 ? CG  ? C GLN 236 CG  
62 1 Y 1 C GLN 716 ? CD  ? C GLN 236 CD  
63 1 Y 1 C GLN 716 ? OE1 ? C GLN 236 OE1 
64 1 Y 1 C GLN 716 ? NE2 ? C GLN 236 NE2 
65 1 Y 1 C GLU 870 ? CG  ? C GLU 390 CG  
66 1 Y 1 C GLU 870 ? CD  ? C GLU 390 CD  
67 1 Y 1 C GLU 870 ? OE1 ? C GLU 390 OE1 
68 1 Y 1 C GLU 870 ? OE2 ? C GLU 390 OE2 
69 1 Y 1 C LYS 873 ? CG  ? C LYS 393 CG  
70 1 Y 1 C LYS 873 ? CD  ? C LYS 393 CD  
71 1 Y 1 C LYS 873 ? CE  ? C LYS 393 CE  
72 1 Y 1 C LYS 873 ? NZ  ? C LYS 393 NZ  
73 1 Y 1 C LYS 875 ? CG  ? C LYS 395 CG  
74 1 Y 1 C LYS 875 ? CD  ? C LYS 395 CD  
75 1 Y 1 C LYS 875 ? CE  ? C LYS 395 CE  
76 1 Y 1 C LYS 875 ? NZ  ? C LYS 395 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 481 ? A GLY 1   
2   1 Y 1 A SER 482 ? A SER 2   
3   1 Y 1 A ARG 483 ? A ARG 3   
4   1 Y 1 A ALA 484 ? A ALA 4   
5   1 Y 1 A GLN 485 ? A GLN 5   
6   1 Y 1 A SER 486 ? A SER 6   
7   1 Y 1 A SER 487 ? A SER 7   
8   1 Y 1 A PRO 488 ? A PRO 8   
9   1 Y 1 A ALA 489 ? A ALA 9   
10  1 Y 1 A ALA 490 ? A ALA 10  
11  1 Y 1 A PRO 491 ? A PRO 11  
12  1 Y 1 A ALA 492 ? A ALA 12  
13  1 Y 1 A SER 493 ? A SER 13  
14  1 Y 1 A LEU 494 ? A LEU 14  
15  1 Y 1 A SER 495 ? A SER 15  
16  1 Y 1 A ALA 496 ? A ALA 16  
17  1 Y 1 A PRO 497 ? A PRO 17  
18  1 Y 1 A GLU 498 ? A GLU 18  
19  1 Y 1 A PRO 499 ? A PRO 19  
20  1 Y 1 A ALA 500 ? A ALA 20  
21  1 Y 1 A SER 501 ? A SER 21  
22  1 Y 1 A GLN 502 ? A GLN 22  
23  1 Y 1 A ALA 503 ? A ALA 23  
24  1 Y 1 A ARG 504 ? A ARG 24  
25  1 Y 1 A VAL 505 ? A VAL 25  
26  1 Y 1 A LEU 506 ? A LEU 26  
27  1 Y 1 A SER 507 ? A SER 27  
28  1 Y 1 A SER 508 ? A SER 28  
29  1 Y 1 A SER 509 ? A SER 29  
30  1 Y 1 A GLU 510 ? A GLU 30  
31  1 Y 1 A THR 511 ? A THR 31  
32  1 Y 1 A PRO 512 ? A PRO 32  
33  1 Y 1 A ALA 513 ? A ALA 33  
34  1 Y 1 A ARG 514 ? A ARG 34  
35  1 Y 1 A THR 515 ? A THR 35  
36  1 Y 1 A ARG 596 ? A ARG 116 
37  1 Y 1 A LEU 597 ? A LEU 117 
38  1 Y 1 A LYS 598 ? A LYS 118 
39  1 Y 1 A LEU 599 ? A LEU 119 
40  1 Y 1 A ASP 600 ? A ASP 120 
41  1 Y 1 A ASN 601 ? A ASN 121 
42  1 Y 1 A GLY 602 ? A GLY 122 
43  1 Y 1 A LYS 603 ? A LYS 123 
44  1 Y 1 A LEU 604 ? A LEU 124 
45  1 Y 1 A ALA 605 ? A ALA 125 
46  1 Y 1 A GLY 606 ? A GLY 126 
47  1 Y 1 A LEU 607 ? A LEU 127 
48  1 Y 1 A LEU 608 ? A LEU 128 
49  1 Y 1 A ALA 609 ? A ALA 129 
50  1 Y 1 A GLN 610 ? A GLN 130 
51  1 Y 1 A ARG 611 ? A ARG 131 
52  1 Y 1 A MET 612 ? A MET 132 
53  1 Y 1 A PHE 613 ? A PHE 133 
54  1 Y 1 A ALA 902 ? A ALA 422 
55  1 Y 1 A SER 903 ? A SER 423 
56  1 Y 1 B GLY 481 ? B GLY 1   
57  1 Y 1 B SER 482 ? B SER 2   
58  1 Y 1 B ARG 483 ? B ARG 3   
59  1 Y 1 B ALA 484 ? B ALA 4   
60  1 Y 1 B GLN 485 ? B GLN 5   
61  1 Y 1 B SER 486 ? B SER 6   
62  1 Y 1 B SER 487 ? B SER 7   
63  1 Y 1 B PRO 488 ? B PRO 8   
64  1 Y 1 B ALA 489 ? B ALA 9   
65  1 Y 1 B ALA 490 ? B ALA 10  
66  1 Y 1 B PRO 491 ? B PRO 11  
67  1 Y 1 B ALA 492 ? B ALA 12  
68  1 Y 1 B SER 493 ? B SER 13  
69  1 Y 1 B LEU 494 ? B LEU 14  
70  1 Y 1 B SER 495 ? B SER 15  
71  1 Y 1 B ALA 496 ? B ALA 16  
72  1 Y 1 B PRO 497 ? B PRO 17  
73  1 Y 1 B GLU 498 ? B GLU 18  
74  1 Y 1 B PRO 499 ? B PRO 19  
75  1 Y 1 B ALA 500 ? B ALA 20  
76  1 Y 1 B SER 501 ? B SER 21  
77  1 Y 1 B GLN 502 ? B GLN 22  
78  1 Y 1 B ALA 503 ? B ALA 23  
79  1 Y 1 B ARG 504 ? B ARG 24  
80  1 Y 1 B VAL 505 ? B VAL 25  
81  1 Y 1 B LEU 506 ? B LEU 26  
82  1 Y 1 B SER 507 ? B SER 27  
83  1 Y 1 B SER 508 ? B SER 28  
84  1 Y 1 B SER 509 ? B SER 29  
85  1 Y 1 B GLU 510 ? B GLU 30  
86  1 Y 1 B THR 511 ? B THR 31  
87  1 Y 1 B PRO 512 ? B PRO 32  
88  1 Y 1 B ALA 513 ? B ALA 33  
89  1 Y 1 B ARG 514 ? B ARG 34  
90  1 Y 1 B THR 515 ? B THR 35  
91  1 Y 1 B LEU 516 ? B LEU 36  
92  1 Y 1 B PRO 517 ? B PRO 37  
93  1 Y 1 B ARG 611 ? B ARG 131 
94  1 Y 1 B MET 612 ? B MET 132 
95  1 Y 1 B PHE 613 ? B PHE 133 
96  1 Y 1 B LEU 901 ? B LEU 421 
97  1 Y 1 B ALA 902 ? B ALA 422 
98  1 Y 1 B SER 903 ? B SER 423 
99  1 Y 1 C GLY 481 ? C GLY 1   
100 1 Y 1 C SER 482 ? C SER 2   
101 1 Y 1 C ARG 483 ? C ARG 3   
102 1 Y 1 C ALA 484 ? C ALA 4   
103 1 Y 1 C GLN 485 ? C GLN 5   
104 1 Y 1 C SER 486 ? C SER 6   
105 1 Y 1 C SER 487 ? C SER 7   
106 1 Y 1 C PRO 488 ? C PRO 8   
107 1 Y 1 C ALA 489 ? C ALA 9   
108 1 Y 1 C ALA 490 ? C ALA 10  
109 1 Y 1 C PRO 491 ? C PRO 11  
110 1 Y 1 C ALA 492 ? C ALA 12  
111 1 Y 1 C SER 493 ? C SER 13  
112 1 Y 1 C LEU 494 ? C LEU 14  
113 1 Y 1 C SER 495 ? C SER 15  
114 1 Y 1 C ALA 496 ? C ALA 16  
115 1 Y 1 C PRO 497 ? C PRO 17  
116 1 Y 1 C GLU 498 ? C GLU 18  
117 1 Y 1 C PRO 499 ? C PRO 19  
118 1 Y 1 C ALA 500 ? C ALA 20  
119 1 Y 1 C SER 501 ? C SER 21  
120 1 Y 1 C GLN 502 ? C GLN 22  
121 1 Y 1 C ALA 503 ? C ALA 23  
122 1 Y 1 C ARG 504 ? C ARG 24  
123 1 Y 1 C VAL 505 ? C VAL 25  
124 1 Y 1 C LEU 506 ? C LEU 26  
125 1 Y 1 C SER 507 ? C SER 27  
126 1 Y 1 C SER 508 ? C SER 28  
127 1 Y 1 C SER 509 ? C SER 29  
128 1 Y 1 C GLU 510 ? C GLU 30  
129 1 Y 1 C THR 511 ? C THR 31  
130 1 Y 1 C PRO 512 ? C PRO 32  
131 1 Y 1 C ALA 513 ? C ALA 33  
132 1 Y 1 C ARG 514 ? C ARG 34  
133 1 Y 1 C THR 515 ? C THR 35  
134 1 Y 1 C LEU 516 ? C LEU 36  
135 1 Y 1 C PRO 517 ? C PRO 37  
136 1 Y 1 C PHE 518 ? C PHE 38  
137 1 Y 1 C LEU 594 ? C LEU 114 
138 1 Y 1 C SER 595 ? C SER 115 
139 1 Y 1 C ARG 596 ? C ARG 116 
140 1 Y 1 C LEU 597 ? C LEU 117 
141 1 Y 1 C LYS 598 ? C LYS 118 
142 1 Y 1 C LEU 599 ? C LEU 119 
143 1 Y 1 C ASP 600 ? C ASP 120 
144 1 Y 1 C ASN 601 ? C ASN 121 
145 1 Y 1 C GLY 602 ? C GLY 122 
146 1 Y 1 C LYS 603 ? C LYS 123 
147 1 Y 1 C LEU 604 ? C LEU 124 
148 1 Y 1 C ALA 605 ? C ALA 125 
149 1 Y 1 C GLY 606 ? C GLY 126 
150 1 Y 1 C LEU 607 ? C LEU 127 
151 1 Y 1 C LEU 608 ? C LEU 128 
152 1 Y 1 C ALA 609 ? C ALA 129 
153 1 Y 1 C GLN 610 ? C GLN 130 
154 1 Y 1 C ARG 611 ? C ARG 131 
155 1 Y 1 C MET 612 ? C MET 132 
156 1 Y 1 C PHE 613 ? C PHE 133 
157 1 Y 1 C VAL 614 ? C VAL 134 
158 1 Y 1 C MET 615 ? C MET 135 
159 1 Y 1 C ARG 900 ? C ARG 420 
160 1 Y 1 C LEU 901 ? C LEU 421 
161 1 Y 1 C ALA 902 ? C ALA 422 
162 1 Y 1 C SER 903 ? C SER 423 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                                                                                                               ZN  
3 'POTASSIUM ION'                                                                                                          K   
4 'N-{[1-methyl-4-(4-phenyl-1,3-thiazol-2-yl)piperidin-4-yl]methyl}-3-[5-(trifluoromethyl)-1,2,4-oxadiazol-3-yl]benzamide' NU7 
5 water                                                                                                                    HOH 
#