data_3ZO7
# 
_entry.id   3ZO7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ZO7         
PDBE  EBI-55891    
WWPDB D_1290055891 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 3ZNJ unspecified 'CRYSTAL STRUCTURE OF UNLIGANDED CLCF FROM R.OPACUS 1CP IN CRYSTAL FORM 1.' 
PDB 3ZNU unspecified 'CRYSTAL STRUCTURE OF CLCF IN CRYSTAL FORM 2'                               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ZO7 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-02-20 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Roth, C.'         1 
'Groening, J.A.D.' 2 
'Kaschabek, S.R.'  3 
'Schloemann, M.'   4 
'Straeter, N.'     5 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure and Catalytic Mechanism of Chloromuconolactone Dehalogenase Clcf from Rhodococcus Opacus 1Cp.' 
_citation.journal_abbrev            Mol.Microbiol. 
_citation.journal_volume            88 
_citation.page_first                254 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           MOMIEE 
_citation.country                   UK 
_citation.journal_id_ISSN           0950-382X 
_citation.journal_id_CSD            2007 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23421784 
_citation.pdbx_database_id_DOI      10.1111/MMI.12182 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Roth, C.'        1 
primary 'Janosch, A.D.'   2 
primary 'Kaschabek, S.R.' 3 
primary 'Schloemann, M.'  4 
primary 'Straeter, N.'    5 
# 
_cell.entry_id           3ZO7 
_cell.length_a           77.836 
_cell.length_b           103.112 
_cell.length_c           137.767 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              40 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3ZO7 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '5-CHLOROMUCONOLACTONE DEHALOGENASE'                                   11152.681 10  ? YES ? ? 
2 non-polymer syn '(2S)-2-chloranyl-2-[(2R)-5-oxidanylidene-2H-furan-2-yl]ethanoic acid' 176.554   10  ? ?   ? ? 
3 non-polymer syn 'CHLORIDE ION'                                                         35.453    14  ? ?   ? ? 
4 water       nat water                                                                  18.015    494 ? ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CHLORMUCONOLACTONE DEHALOGENASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVNSHDELHEILWSLPFFPYLTID
VEPLSHHPARVGKD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKYGNISVFDVNSHDELHEILWSLPFFPYLTID
VEPLSHHPARVGKD
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LEU n 
1 3  TYR n 
1 4  LEU n 
1 5  VAL n 
1 6  ARG n 
1 7  MET n 
1 8  THR n 
1 9  VAL n 
1 10 ASN n 
1 11 LEU n 
1 12 PRO n 
1 13 ARG n 
1 14 ASN n 
1 15 LEU n 
1 16 ASP n 
1 17 PRO n 
1 18 ARG n 
1 19 GLU n 
1 20 GLU n 
1 21 GLU n 
1 22 ARG n 
1 23 LEU n 
1 24 LYS n 
1 25 ALA n 
1 26 SER n 
1 27 ALA n 
1 28 LYS n 
1 29 ALA n 
1 30 ARG n 
1 31 SER n 
1 32 ARG n 
1 33 THR n 
1 34 LEU n 
1 35 GLN n 
1 36 GLU n 
1 37 GLN n 
1 38 GLY n 
1 39 GLN n 
1 40 TRP n 
1 41 ARG n 
1 42 TYR n 
1 43 LEU n 
1 44 TRP n 
1 45 ARG n 
1 46 THR n 
1 47 THR n 
1 48 GLY n 
1 49 LYS n 
1 50 TYR n 
1 51 GLY n 
1 52 ASN n 
1 53 ILE n 
1 54 SER n 
1 55 VAL n 
1 56 PHE n 
1 57 ASP n 
1 58 VAL n 
1 59 ASN n 
1 60 SER n 
1 61 HIS n 
1 62 ASP n 
1 63 GLU n 
1 64 LEU n 
1 65 HIS n 
1 66 GLU n 
1 67 ILE n 
1 68 LEU n 
1 69 TRP n 
1 70 SER n 
1 71 LEU n 
1 72 PRO n 
1 73 PHE n 
1 74 PHE n 
1 75 PRO n 
1 76 TYR n 
1 77 LEU n 
1 78 THR n 
1 79 ILE n 
1 80 ASP n 
1 81 VAL n 
1 82 GLU n 
1 83 PRO n 
1 84 LEU n 
1 85 SER n 
1 86 HIS n 
1 87 HIS n 
1 88 PRO n 
1 89 ALA n 
1 90 ARG n 
1 91 VAL n 
1 92 GLY n 
1 93 LYS n 
1 94 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    1CP 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'RHODOCOCCUS OPACUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     37919 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8G9L0_RHOOP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q8G9L0 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3ZO7 A 1 ? 94 ? Q8G9L0 1 ? 94 ? 1 94 
2  1 3ZO7 B 1 ? 94 ? Q8G9L0 1 ? 94 ? 1 94 
3  1 3ZO7 C 1 ? 94 ? Q8G9L0 1 ? 94 ? 1 94 
4  1 3ZO7 D 1 ? 94 ? Q8G9L0 1 ? 94 ? 1 94 
5  1 3ZO7 E 1 ? 94 ? Q8G9L0 1 ? 94 ? 1 94 
6  1 3ZO7 F 1 ? 94 ? Q8G9L0 1 ? 94 ? 1 94 
7  1 3ZO7 G 1 ? 94 ? Q8G9L0 1 ? 94 ? 1 94 
8  1 3ZO7 H 1 ? 94 ? Q8G9L0 1 ? 94 ? 1 94 
9  1 3ZO7 I 1 ? 94 ? Q8G9L0 1 ? 94 ? 1 94 
10 1 3ZO7 J 1 ? 94 ? Q8G9L0 1 ? 94 ? 1 94 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  3ZO7 ALA A 27 ? UNP Q8G9L0 GLU 27 'engineered mutation' 27 1  
2  3ZO7 ALA B 27 ? UNP Q8G9L0 GLU 27 'engineered mutation' 27 2  
3  3ZO7 ALA C 27 ? UNP Q8G9L0 GLU 27 'engineered mutation' 27 3  
4  3ZO7 ALA D 27 ? UNP Q8G9L0 GLU 27 'engineered mutation' 27 4  
5  3ZO7 ALA E 27 ? UNP Q8G9L0 GLU 27 'engineered mutation' 27 5  
6  3ZO7 ALA F 27 ? UNP Q8G9L0 GLU 27 'engineered mutation' 27 6  
7  3ZO7 ALA G 27 ? UNP Q8G9L0 GLU 27 'engineered mutation' 27 7  
8  3ZO7 ALA H 27 ? UNP Q8G9L0 GLU 27 'engineered mutation' 27 8  
9  3ZO7 ALA I 27 ? UNP Q8G9L0 GLU 27 'engineered mutation' 27 9  
10 3ZO7 ALA J 27 ? UNP Q8G9L0 GLU 27 'engineered mutation' 27 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                ?                     
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                               ?                     
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                             ?                     
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                        ?                     
'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                         ?                     'Cl -1' 
35.453  
GLN 'L-peptide linking' y GLUTAMINE                                                              ?                     
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                        ?                     
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                ?                     
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                              ?                     
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                  ?                     'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                             ?                     
'C6 H13 N O2'    131.173 
K6H non-polymer         . '(2S)-2-chloranyl-2-[(2R)-5-oxidanylidene-2H-furan-2-yl]ethanoic acid' 5-CHLOROMUCONOLACTONE 
'C6 H5 Cl O4'    176.554 
LEU 'L-peptide linking' y LEUCINE                                                                ?                     
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                 ?                     
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                             ?                     
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                          ?                     
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                ?                     
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                 ?                     
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                              ?                     
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                             ?                     
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                               ?                     
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                 ?                     
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3ZO7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.density_percent_sol   46.6 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91841 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_wavelength             0.91841 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3ZO7 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            2.22 
_reflns.number_obs                   102684 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.6 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.60 
_reflns.B_iso_Wilson_estimate        34.74 
_reflns.pdbx_redundancy              4.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.22 
_reflns_shell.d_res_low              2.36 
_reflns_shell.percent_possible_all   91.2 
_reflns_shell.Rmerge_I_obs           0.47 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.04 
_reflns_shell.pdbx_redundancy        4.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3ZO7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     54447 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.99 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.935 
_refine.ls_d_res_high                            2.224 
_refine.ls_percent_reflns_obs                    98.86 
_refine.ls_R_factor_obs                          0.1872 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1862 
_refine.ls_R_factor_R_free                       0.2324 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1100 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               39.8 
_refine.aniso_B[1][1]                            1.0351 
_refine.aniso_B[2][2]                            0.6636 
_refine.aniso_B[3][3]                            -1.6987 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.341 
_refine.solvent_model_param_bsol                 34.560 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.98 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.62 
_refine.pdbx_overall_phase_error                 21.22 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7724 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         124 
_refine_hist.number_atoms_solvent             494 
_refine_hist.number_atoms_total               8342 
_refine_hist.d_res_high                       2.224 
_refine_hist.d_res_low                        19.935 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.002  ? ? 8114  'X-RAY DIFFRACTION' ? 
f_angle_d          0.947  ? ? 11042 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.172 ? ? 3095  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.043  ? ? 1176  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 1423  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.2243 2.3254  6111 0.2485 92.00  0.2969 . . 110 . . 
'X-RAY DIFFRACTION' . 2.3254 2.4478  6637 0.2368 100.00 0.2974 . . 165 . . 
'X-RAY DIFFRACTION' . 2.4478 2.6009  6716 0.2173 100.00 0.2904 . . 110 . . 
'X-RAY DIFFRACTION' . 2.6009 2.8012  6646 0.2191 100.00 0.2380 . . 165 . . 
'X-RAY DIFFRACTION' . 2.8012 3.0822  6732 0.2082 100.00 0.2783 . . 110 . . 
'X-RAY DIFFRACTION' . 3.0822 3.5260  6715 0.1950 100.00 0.2476 . . 165 . . 
'X-RAY DIFFRACTION' . 3.5260 4.4344  6809 0.1554 100.00 0.1908 . . 110 . . 
'X-RAY DIFFRACTION' . 4.4344 19.9354 6981 0.1592 100.00 0.1974 . . 165 . . 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.313400 -0.773400 0.551100  -0.742900 -0.161700 -0.649500 0.591400  -0.613000 -0.523900 105.20330 112.65280 22.99890  
2 given ? 0.339300  -0.833900 0.435300  0.731400  0.524900  0.435500  -0.591600 0.170600  0.788000  73.80970  -22.31160 28.14260  
3 given ? 0.793800  -0.387500 0.468800  -0.398000 -0.913800 -0.081400 0.459900  -0.121900 -0.879600 24.75980  124.54390 9.97550   
4 given ? -0.786300 -0.587700 0.190400  0.409500  -0.265000 0.873000  -0.462600 0.764400  0.449100  127.63880 30.17970  -6.34230  
5 given ? -0.788500 0.395100  -0.471300 -0.585400 -0.247400 0.772100  0.188500  0.884700  0.426400  85.84850  87.03380  -48.59430 
6 given ? -0.999900 -0.004300 0.015300  -0.015700 0.403200  -0.915000 -0.002200 -0.915100 -0.403200 111.34260 46.77810  70.60000  
7 given ? 0.788900  0.580900  -0.200300 0.585000  -0.809800 -0.044500 -0.188100 -0.082100 -0.978700 -16.14480 64.01210  45.13720  
8 given ? -0.317800 0.826000  -0.465500 0.822700  -0.003700 -0.568400 -0.471300 -0.563600 -0.678400 36.52180  15.97240  82.35710  
9 given ? 0.293400  0.742900  -0.601700 -0.825500 0.514300  0.232400  0.482100  0.428500  0.764100  8.87380   67.62110  -45.36340 
# 
_struct.entry_id                  3ZO7 
_struct.title                     'Crystal structure of ClcFE27A with substrate' 
_struct.pdbx_descriptor           '5-CHLOROMUCONOLACTONE DEHALOGENASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ZO7 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'LYASE, FERREDOXIN FOLD, CHLOROCATECHOL PATHWAY, DEHALOGENASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 3 ? 
CA N N 2 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 3 ? 
IA N N 4 ? 
JA N N 4 ? 
KA N N 4 ? 
LA N N 4 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 16 ? GLN A 37 ? ASP A 16 GLN A 37 1 ? 22 
HELX_P HELX_P2  2  SER A 60 ? LEU A 71 ? SER A 60 LEU A 71 1 ? 12 
HELX_P HELX_P3  3  PHE A 73 ? PRO A 75 ? PHE A 73 PRO A 75 5 ? 3  
HELX_P HELX_P4  4  ASP B 16 ? GLN B 37 ? ASP B 16 GLN B 37 1 ? 22 
HELX_P HELX_P5  5  SER B 60 ? LEU B 71 ? SER B 60 LEU B 71 1 ? 12 
HELX_P HELX_P6  6  PHE B 73 ? PRO B 75 ? PHE B 73 PRO B 75 5 ? 3  
HELX_P HELX_P7  7  ASP C 16 ? GLN C 37 ? ASP C 16 GLN C 37 1 ? 22 
HELX_P HELX_P8  8  SER C 60 ? LEU C 71 ? SER C 60 LEU C 71 1 ? 12 
HELX_P HELX_P9  9  PHE C 73 ? PRO C 75 ? PHE C 73 PRO C 75 5 ? 3  
HELX_P HELX_P10 10 ASP D 16 ? GLN D 37 ? ASP D 16 GLN D 37 1 ? 22 
HELX_P HELX_P11 11 SER D 60 ? LEU D 71 ? SER D 60 LEU D 71 1 ? 12 
HELX_P HELX_P12 12 PHE D 73 ? PRO D 75 ? PHE D 73 PRO D 75 5 ? 3  
HELX_P HELX_P13 13 GLU E 19 ? GLN E 37 ? GLU E 19 GLN E 37 1 ? 19 
HELX_P HELX_P14 14 SER E 60 ? LEU E 71 ? SER E 60 LEU E 71 1 ? 12 
HELX_P HELX_P15 15 PHE E 73 ? PRO E 75 ? PHE E 73 PRO E 75 5 ? 3  
HELX_P HELX_P16 16 ASP F 16 ? GLN F 37 ? ASP F 16 GLN F 37 1 ? 22 
HELX_P HELX_P17 17 SER F 60 ? LEU F 71 ? SER F 60 LEU F 71 1 ? 12 
HELX_P HELX_P18 18 PHE F 73 ? PRO F 75 ? PHE F 73 PRO F 75 5 ? 3  
HELX_P HELX_P19 19 ASP G 16 ? GLN G 37 ? ASP G 16 GLN G 37 1 ? 22 
HELX_P HELX_P20 20 SER G 60 ? LEU G 71 ? SER G 60 LEU G 71 1 ? 12 
HELX_P HELX_P21 21 PHE G 73 ? PRO G 75 ? PHE G 73 PRO G 75 5 ? 3  
HELX_P HELX_P22 22 ASP H 16 ? GLY H 38 ? ASP H 16 GLY H 38 1 ? 23 
HELX_P HELX_P23 23 SER H 60 ? LEU H 71 ? SER H 60 LEU H 71 1 ? 12 
HELX_P HELX_P24 24 PHE H 73 ? PRO H 75 ? PHE H 73 PRO H 75 5 ? 3  
HELX_P HELX_P25 25 ASP I 16 ? GLY I 38 ? ASP I 16 GLY I 38 1 ? 23 
HELX_P HELX_P26 26 SER I 60 ? LEU I 71 ? SER I 60 LEU I 71 1 ? 12 
HELX_P HELX_P27 27 PHE I 73 ? PRO I 75 ? PHE I 73 PRO I 75 5 ? 3  
HELX_P HELX_P28 28 ASP J 16 ? GLN J 37 ? ASP J 16 GLN J 37 1 ? 22 
HELX_P HELX_P29 29 SER J 60 ? SER J 70 ? SER J 60 SER J 70 1 ? 11 
HELX_P HELX_P30 30 PHE J 73 ? PRO J 75 ? PHE J 73 PRO J 75 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 9 ? 
BA ? 9 ? 
EA ? 9 ? 
FA ? 9 ? 
HA ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AA 7 8 ? anti-parallel 
AA 8 9 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BA 6 7 ? anti-parallel 
BA 7 8 ? anti-parallel 
BA 8 9 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
EA 3 4 ? anti-parallel 
EA 4 5 ? anti-parallel 
EA 5 6 ? anti-parallel 
EA 6 7 ? anti-parallel 
EA 7 8 ? anti-parallel 
EA 8 9 ? anti-parallel 
FA 1 2 ? anti-parallel 
FA 2 3 ? anti-parallel 
FA 3 4 ? anti-parallel 
FA 4 5 ? anti-parallel 
FA 5 6 ? anti-parallel 
FA 6 7 ? anti-parallel 
FA 7 8 ? anti-parallel 
FA 8 9 ? anti-parallel 
HA 1 2 ? anti-parallel 
HA 2 3 ? anti-parallel 
HA 3 4 ? anti-parallel 
HA 4 5 ? anti-parallel 
HA 5 6 ? anti-parallel 
HA 6 7 ? anti-parallel 
HA 7 8 ? anti-parallel 
HA 8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 2  ? VAL A 9  ? LEU A 2  VAL A 9  
AA 2 GLY A 51 ? ASP A 57 ? GLY A 51 ASP A 57 
AA 3 TRP A 40 ? THR A 46 ? TRP A 40 THR A 46 
AA 4 LEU D 77 ? HIS D 86 ? LEU D 77 HIS D 86 
AA 5 LEU D 2  ? VAL D 9  ? LEU D 2  VAL D 9  
AA 6 GLY D 51 ? ASP D 57 ? GLY D 51 ASP D 57 
AA 7 TRP D 40 ? THR D 46 ? TRP D 40 THR D 46 
AA 8 LEU A 77 ? HIS A 86 ? LEU A 77 HIS A 86 
AA 9 LEU A 2  ? VAL A 9  ? LEU A 2  VAL A 9  
BA 1 LEU B 2  ? VAL B 9  ? LEU B 2  VAL B 9  
BA 2 GLY B 51 ? ASP B 57 ? GLY B 51 ASP B 57 
BA 3 TRP B 40 ? THR B 46 ? TRP B 40 THR B 46 
BA 4 LEU C 77 ? SER C 85 ? LEU C 77 SER C 85 
BA 5 LEU C 2  ? VAL C 9  ? LEU C 2  VAL C 9  
BA 6 GLY C 51 ? ASP C 57 ? GLY C 51 ASP C 57 
BA 7 TRP C 40 ? THR C 46 ? TRP C 40 THR C 46 
BA 8 LEU B 77 ? HIS B 86 ? LEU B 77 HIS B 86 
BA 9 LEU B 2  ? VAL B 9  ? LEU B 2  VAL B 9  
EA 1 LEU E 2  ? VAL E 9  ? LEU E 2  VAL E 9  
EA 2 LEU E 77 ? HIS E 86 ? LEU E 77 HIS E 86 
EA 3 TRP G 40 ? THR G 46 ? TRP G 40 THR G 46 
EA 4 GLY G 51 ? ASP G 57 ? GLY G 51 ASP G 57 
EA 5 LEU G 2  ? VAL G 9  ? LEU G 2  VAL G 9  
EA 6 LEU G 77 ? SER G 85 ? LEU G 77 SER G 85 
EA 7 TRP E 40 ? THR E 46 ? TRP E 40 THR E 46 
EA 8 GLY E 51 ? ASP E 57 ? GLY E 51 ASP E 57 
EA 9 LEU E 2  ? VAL E 9  ? LEU E 2  VAL E 9  
FA 1 LEU F 2  ? VAL F 9  ? LEU F 2  VAL F 9  
FA 2 LEU F 77 ? SER F 85 ? LEU F 77 SER F 85 
FA 3 TRP I 40 ? THR I 46 ? TRP I 40 THR I 46 
FA 4 GLY I 51 ? ASP I 57 ? GLY I 51 ASP I 57 
FA 5 LEU I 2  ? VAL I 9  ? LEU I 2  VAL I 9  
FA 6 LEU I 77 ? HIS I 86 ? LEU I 77 HIS I 86 
FA 7 TRP F 40 ? THR F 46 ? TRP F 40 THR F 46 
FA 8 GLY F 51 ? ASP F 57 ? GLY F 51 ASP F 57 
FA 9 LEU F 2  ? VAL F 9  ? LEU F 2  VAL F 9  
HA 1 LEU H 2  ? VAL H 9  ? LEU H 2  VAL H 9  
HA 2 LEU H 77 ? HIS H 86 ? LEU H 77 HIS H 86 
HA 3 TRP J 40 ? THR J 46 ? TRP J 40 THR J 46 
HA 4 GLY J 51 ? ASP J 57 ? GLY J 51 ASP J 57 
HA 5 LEU J 2  ? VAL J 9  ? LEU J 2  VAL J 9  
HA 6 LEU J 77 ? HIS J 86 ? LEU J 77 HIS J 86 
HA 7 TRP H 40 ? THR H 46 ? TRP H 40 THR H 46 
HA 8 GLY H 51 ? ASP H 57 ? GLY H 51 ASP H 57 
HA 9 LEU H 2  ? VAL H 9  ? LEU H 2  VAL H 9  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N MET A 7  ? N MET A 7  O ASN A 52 ? O ASN A 52 
AA 2 3 O VAL A 55 ? O VAL A 55 N ARG A 41 ? N ARG A 41 
AA 3 4 N ARG A 45 ? N ARG A 45 O SER D 85 ? O SER D 85 
AA 4 5 N LEU D 84 ? N LEU D 84 O LEU D 2  ? O LEU D 2  
AA 5 6 N MET D 7  ? N MET D 7  O ASN D 52 ? O ASN D 52 
AA 6 7 O VAL D 55 ? O VAL D 55 N ARG D 41 ? N ARG D 41 
AA 7 8 N ARG D 45 ? N ARG D 45 O SER A 85 ? O SER A 85 
AA 8 9 N LEU A 84 ? N LEU A 84 O LEU A 2  ? O LEU A 2  
BA 1 2 N MET B 7  ? N MET B 7  O ASN B 52 ? O ASN B 52 
BA 2 3 O VAL B 55 ? O VAL B 55 N ARG B 41 ? N ARG B 41 
BA 3 4 N ARG B 45 ? N ARG B 45 O SER C 85 ? O SER C 85 
BA 4 5 N LEU C 84 ? N LEU C 84 O LEU C 2  ? O LEU C 2  
BA 5 6 N MET C 7  ? N MET C 7  O ASN C 52 ? O ASN C 52 
BA 6 7 O VAL C 55 ? O VAL C 55 N ARG C 41 ? N ARG C 41 
BA 7 8 N ARG C 45 ? N ARG C 45 O SER B 85 ? O SER B 85 
BA 8 9 N LEU B 84 ? N LEU B 84 O LEU B 2  ? O LEU B 2  
EA 1 2 N THR E 8  ? N THR E 8  O THR E 78 ? O THR E 78 
EA 2 3 N SER E 85 ? N SER E 85 O ARG G 45 ? O ARG G 45 
EA 3 4 N THR G 46 ? N THR G 46 O GLY G 51 ? O GLY G 51 
EA 4 5 N PHE G 56 ? N PHE G 56 O TYR G 3  ? O TYR G 3  
EA 5 6 N THR G 8  ? N THR G 8  O THR G 78 ? O THR G 78 
EA 6 7 N SER G 85 ? N SER G 85 O ARG E 45 ? O ARG E 45 
EA 7 8 N THR E 46 ? N THR E 46 O GLY E 51 ? O GLY E 51 
EA 8 9 N PHE E 56 ? N PHE E 56 O TYR E 3  ? O TYR E 3  
FA 1 2 N THR F 8  ? N THR F 8  O THR F 78 ? O THR F 78 
FA 2 3 N SER F 85 ? N SER F 85 O ARG I 45 ? O ARG I 45 
FA 3 4 N THR I 46 ? N THR I 46 O GLY I 51 ? O GLY I 51 
FA 4 5 N PHE I 56 ? N PHE I 56 O TYR I 3  ? O TYR I 3  
FA 5 6 N THR I 8  ? N THR I 8  O THR I 78 ? O THR I 78 
FA 6 7 N SER I 85 ? N SER I 85 O ARG F 45 ? O ARG F 45 
FA 7 8 N THR F 46 ? N THR F 46 O GLY F 51 ? O GLY F 51 
FA 8 9 N PHE F 56 ? N PHE F 56 O TYR F 3  ? O TYR F 3  
HA 1 2 N THR H 8  ? N THR H 8  O THR H 78 ? O THR H 78 
HA 2 3 N SER H 85 ? N SER H 85 O ARG J 45 ? O ARG J 45 
HA 3 4 N THR J 46 ? N THR J 46 O GLY J 51 ? O GLY J 51 
HA 4 5 N PHE J 56 ? N PHE J 56 O TYR J 3  ? O TYR J 3  
HA 5 6 N THR J 8  ? N THR J 8  O THR J 78 ? O THR J 78 
HA 6 7 N SER J 85 ? N SER J 85 O ARG H 45 ? O ARG H 45 
HA 7 8 N THR H 46 ? N THR H 46 O GLY H 51 ? O GLY H 51 
HA 8 9 N PHE H 56 ? N PHE H 56 O TYR H 3  ? O TYR H 3  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE K6H A 1093' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE K6H B 1095' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE K6H D 1092' 
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE K6H E 1092' 
AC5 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE K6H G 1095' 
AC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE K6H H 1093' 
AC7 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE K6H J 1093' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CL B 1096'  
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CL G 1096'  
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL H 1094'  
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CL A 1094'  
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL C 1095'  
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CL J 1094'  
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CL D 1093'  
BC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL E 1093'  
BC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL B 1097'  
BC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL F 1092'  
BC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL I 1093'  
CC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A 1095'  
CC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL B 1098'  
CC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL C 1096'  
CC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE K6H C 1097' 
CC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE K6H I 1094' 
CC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE K6H F 1093' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 12 VAL A  9  ? VAL A 9    . ? 1_555 ? 
2   AC1 12 ALA A  27 ? ALA A 27   . ? 1_555 ? 
3   AC1 12 LYS A  28 ? LYS A 28   . ? 1_555 ? 
4   AC1 12 ARG A  45 ? ARG A 45   . ? 1_555 ? 
5   AC1 12 ASN A  52 ? ASN A 52   . ? 1_555 ? 
6   AC1 12 PHE A  73 ? PHE A 73   . ? 1_555 ? 
7   AC1 12 LEU A  77 ? LEU A 77   . ? 1_555 ? 
8   AC1 12 CL  L  .  ? CL  A 1094 . ? 1_555 ? 
9   AC1 12 HOH IA .  ? HOH A 2027 . ? 1_555 ? 
10  AC1 12 HOH IA .  ? HOH A 2076 . ? 1_555 ? 
11  AC1 12 HIS D  87 ? HIS D 87   . ? 1_555 ? 
12  AC1 12 ALA D  89 ? ALA D 89   . ? 1_555 ? 
13  AC2 10 ALA B  27 ? ALA B 27   . ? 1_555 ? 
14  AC2 10 ARG B  45 ? ARG B 45   . ? 1_555 ? 
15  AC2 10 GLY B  51 ? GLY B 51   . ? 1_555 ? 
16  AC2 10 ASN B  52 ? ASN B 52   . ? 1_555 ? 
17  AC2 10 PHE B  73 ? PHE B 73   . ? 1_555 ? 
18  AC2 10 CL  O  .  ? CL  B 1096 . ? 1_555 ? 
19  AC2 10 HOH JA .  ? HOH B 2036 . ? 1_555 ? 
20  AC2 10 HOH JA .  ? HOH B 2080 . ? 1_555 ? 
21  AC2 10 HIS C  87 ? HIS C 87   . ? 1_555 ? 
22  AC2 10 ALA C  89 ? ALA C 89   . ? 1_555 ? 
23  AC3 10 HIS A  87 ? HIS A 87   . ? 1_555 ? 
24  AC3 10 ALA A  89 ? ALA A 89   . ? 1_555 ? 
25  AC3 10 VAL D  9  ? VAL D 9    . ? 1_555 ? 
26  AC3 10 ALA D  27 ? ALA D 27   . ? 1_555 ? 
27  AC3 10 LYS D  28 ? LYS D 28   . ? 1_555 ? 
28  AC3 10 SER D  31 ? SER D 31   . ? 1_555 ? 
29  AC3 10 ARG D  45 ? ARG D 45   . ? 1_555 ? 
30  AC3 10 ASN D  52 ? ASN D 52   . ? 1_555 ? 
31  AC3 10 PHE D  73 ? PHE D 73   . ? 1_555 ? 
32  AC3 10 CL  V  .  ? CL  D 1093 . ? 1_555 ? 
33  AC4 10 VAL E  9  ? VAL E 9    . ? 1_555 ? 
34  AC4 10 ALA E  27 ? ALA E 27   . ? 1_555 ? 
35  AC4 10 LYS E  28 ? LYS E 28   . ? 1_555 ? 
36  AC4 10 ARG E  45 ? ARG E 45   . ? 1_555 ? 
37  AC4 10 ASN E  52 ? ASN E 52   . ? 1_555 ? 
38  AC4 10 PHE E  73 ? PHE E 73   . ? 1_555 ? 
39  AC4 10 LEU E  77 ? LEU E 77   . ? 1_555 ? 
40  AC4 10 CL  X  .  ? CL  E 1093 . ? 1_555 ? 
41  AC4 10 HIS G  87 ? HIS G 87   . ? 1_555 ? 
42  AC4 10 ALA G  89 ? ALA G 89   . ? 1_555 ? 
43  AC5 12 HIS E  87 ? HIS E 87   . ? 1_555 ? 
44  AC5 12 ALA E  89 ? ALA E 89   . ? 1_555 ? 
45  AC5 12 VAL G  9  ? VAL G 9    . ? 1_555 ? 
46  AC5 12 ALA G  27 ? ALA G 27   . ? 1_555 ? 
47  AC5 12 LYS G  28 ? LYS G 28   . ? 1_555 ? 
48  AC5 12 ARG G  45 ? ARG G 45   . ? 1_555 ? 
49  AC5 12 TYR G  50 ? TYR G 50   . ? 1_555 ? 
50  AC5 12 ASN G  52 ? ASN G 52   . ? 1_555 ? 
51  AC5 12 PHE G  73 ? PHE G 73   . ? 1_555 ? 
52  AC5 12 CL  BA .  ? CL  G 1096 . ? 1_555 ? 
53  AC5 12 HOH OA .  ? HOH G 2015 . ? 1_555 ? 
54  AC5 12 HOH OA .  ? HOH G 2034 . ? 1_555 ? 
55  AC6 12 VAL H  9  ? VAL H 9    . ? 1_555 ? 
56  AC6 12 ALA H  27 ? ALA H 27   . ? 1_555 ? 
57  AC6 12 ARG H  45 ? ARG H 45   . ? 1_555 ? 
58  AC6 12 TYR H  50 ? TYR H 50   . ? 1_555 ? 
59  AC6 12 ASN H  52 ? ASN H 52   . ? 1_555 ? 
60  AC6 12 PHE H  73 ? PHE H 73   . ? 1_555 ? 
61  AC6 12 LEU H  77 ? LEU H 77   . ? 1_555 ? 
62  AC6 12 CL  DA .  ? CL  H 1094 . ? 1_555 ? 
63  AC6 12 HOH PA .  ? HOH H 2016 . ? 1_555 ? 
64  AC6 12 HOH PA .  ? HOH H 2051 . ? 1_555 ? 
65  AC6 12 HIS J  87 ? HIS J 87   . ? 1_555 ? 
66  AC6 12 ALA J  89 ? ALA J 89   . ? 1_555 ? 
67  AC7 13 HIS H  87 ? HIS H 87   . ? 1_555 ? 
68  AC7 13 ALA H  89 ? ALA H 89   . ? 1_555 ? 
69  AC7 13 VAL J  9  ? VAL J 9    . ? 1_555 ? 
70  AC7 13 ALA J  27 ? ALA J 27   . ? 1_555 ? 
71  AC7 13 LYS J  28 ? LYS J 28   . ? 1_555 ? 
72  AC7 13 SER J  31 ? SER J 31   . ? 1_555 ? 
73  AC7 13 ARG J  45 ? ARG J 45   . ? 1_555 ? 
74  AC7 13 TYR J  50 ? TYR J 50   . ? 1_555 ? 
75  AC7 13 ASN J  52 ? ASN J 52   . ? 1_555 ? 
76  AC7 13 LEU J  77 ? LEU J 77   . ? 1_555 ? 
77  AC7 13 CL  HA .  ? CL  J 1094 . ? 1_555 ? 
78  AC7 13 HOH RA .  ? HOH J 2022 . ? 1_555 ? 
79  AC7 13 HOH RA .  ? HOH J 2037 . ? 1_555 ? 
80  AC8 6  ALA B  27 ? ALA B 27   . ? 1_555 ? 
81  AC8 6  LEU B  71 ? LEU B 71   . ? 1_555 ? 
82  AC8 6  PRO B  72 ? PRO B 72   . ? 1_555 ? 
83  AC8 6  PHE B  73 ? PHE B 73   . ? 1_555 ? 
84  AC8 6  K6H N  .  ? K6H B 1095 . ? 1_555 ? 
85  AC8 6  HOH JA .  ? HOH B 2042 . ? 1_555 ? 
86  AC9 6  ALA G  27 ? ALA G 27   . ? 1_555 ? 
87  AC9 6  LEU G  71 ? LEU G 71   . ? 1_555 ? 
88  AC9 6  PRO G  72 ? PRO G 72   . ? 1_555 ? 
89  AC9 6  PHE G  73 ? PHE G 73   . ? 1_555 ? 
90  AC9 6  K6H AA .  ? K6H G 1095 . ? 1_555 ? 
91  AC9 6  HOH OA .  ? HOH G 2021 . ? 1_555 ? 
92  BC1 5  ALA H  27 ? ALA H 27   . ? 1_555 ? 
93  BC1 5  LEU H  71 ? LEU H 71   . ? 1_555 ? 
94  BC1 5  PRO H  72 ? PRO H 72   . ? 1_555 ? 
95  BC1 5  PHE H  73 ? PHE H 73   . ? 1_555 ? 
96  BC1 5  K6H CA .  ? K6H H 1093 . ? 1_555 ? 
97  BC2 6  ALA A  27 ? ALA A 27   . ? 1_555 ? 
98  BC2 6  LEU A  71 ? LEU A 71   . ? 1_555 ? 
99  BC2 6  PRO A  72 ? PRO A 72   . ? 1_555 ? 
100 BC2 6  PHE A  73 ? PHE A 73   . ? 1_555 ? 
101 BC2 6  K6H K  .  ? K6H A 1093 . ? 1_555 ? 
102 BC2 6  HOH IA .  ? HOH A 2034 . ? 1_555 ? 
103 BC3 5  ALA C  27 ? ALA C 27   . ? 1_555 ? 
104 BC3 5  LEU C  71 ? LEU C 71   . ? 1_555 ? 
105 BC3 5  PRO C  72 ? PRO C 72   . ? 1_555 ? 
106 BC3 5  PHE C  73 ? PHE C 73   . ? 1_555 ? 
107 BC3 5  HOH KA .  ? HOH C 2028 . ? 1_555 ? 
108 BC4 6  ALA J  27 ? ALA J 27   . ? 1_555 ? 
109 BC4 6  LEU J  71 ? LEU J 71   . ? 1_555 ? 
110 BC4 6  PRO J  72 ? PRO J 72   . ? 1_555 ? 
111 BC4 6  PHE J  73 ? PHE J 73   . ? 1_555 ? 
112 BC4 6  K6H GA .  ? K6H J 1093 . ? 1_555 ? 
113 BC4 6  HOH RA .  ? HOH J 2029 . ? 1_555 ? 
114 BC5 6  ALA D  27 ? ALA D 27   . ? 1_555 ? 
115 BC5 6  LEU D  71 ? LEU D 71   . ? 1_555 ? 
116 BC5 6  PRO D  72 ? PRO D 72   . ? 1_555 ? 
117 BC5 6  PHE D  73 ? PHE D 73   . ? 1_555 ? 
118 BC5 6  K6H U  .  ? K6H D 1092 . ? 1_555 ? 
119 BC5 6  HOH LA .  ? HOH D 2012 . ? 1_555 ? 
120 BC6 4  LEU E  71 ? LEU E 71   . ? 1_555 ? 
121 BC6 4  PRO E  72 ? PRO E 72   . ? 1_555 ? 
122 BC6 4  PHE E  73 ? PHE E 73   . ? 1_555 ? 
123 BC6 4  K6H W  .  ? K6H E 1092 . ? 1_555 ? 
124 BC7 4  HOH IA .  ? HOH A 2001 . ? 1_555 ? 
125 BC7 4  SER B  60 ? SER B 60   . ? 1_555 ? 
126 BC7 4  HIS B  61 ? HIS B 61   . ? 1_555 ? 
127 BC7 4  ASP B  62 ? ASP B 62   . ? 1_555 ? 
128 BC8 5  ALA F  27 ? ALA F 27   . ? 1_555 ? 
129 BC8 5  LEU F  71 ? LEU F 71   . ? 1_555 ? 
130 BC8 5  PRO F  72 ? PRO F 72   . ? 1_555 ? 
131 BC8 5  PHE F  73 ? PHE F 73   . ? 1_555 ? 
132 BC8 5  HOH NA .  ? HOH F 2016 . ? 1_555 ? 
133 BC9 4  ALA I  27 ? ALA I 27   . ? 1_555 ? 
134 BC9 4  LEU I  71 ? LEU I 71   . ? 1_555 ? 
135 BC9 4  PRO I  72 ? PRO I 72   . ? 1_555 ? 
136 BC9 4  PHE I  73 ? PHE I 73   . ? 1_555 ? 
137 CC1 2  HIS A  65 ? HIS A 65   . ? 1_555 ? 
138 CC1 2  ARG C  45 ? ARG C 45   . ? 1_555 ? 
139 CC2 2  ARG B  45 ? ARG B 45   . ? 1_555 ? 
140 CC2 2  HIS G  65 ? HIS G 65   . ? 1_555 ? 
141 CC3 4  SER C  60 ? SER C 60   . ? 1_555 ? 
142 CC3 4  HIS C  61 ? HIS C 61   . ? 1_555 ? 
143 CC3 4  ASP C  62 ? ASP C 62   . ? 1_555 ? 
144 CC3 4  HOH OA .  ? HOH G 2001 . ? 1_555 ? 
145 CC4 11 HIS B  87 ? HIS B 87   . ? 1_555 ? 
146 CC4 11 ALA B  89 ? ALA B 89   . ? 1_555 ? 
147 CC4 11 VAL C  9  ? VAL C 9    . ? 1_555 ? 
148 CC4 11 ALA C  27 ? ALA C 27   . ? 1_555 ? 
149 CC4 11 LYS C  28 ? LYS C 28   . ? 1_555 ? 
150 CC4 11 ARG C  45 ? ARG C 45   . ? 1_555 ? 
151 CC4 11 GLY C  51 ? GLY C 51   . ? 1_555 ? 
152 CC4 11 ASN C  52 ? ASN C 52   . ? 1_555 ? 
153 CC4 11 PHE C  73 ? PHE C 73   . ? 1_555 ? 
154 CC4 11 LEU C  77 ? LEU C 77   . ? 1_555 ? 
155 CC4 11 HOH KA .  ? HOH C 2025 . ? 1_555 ? 
156 CC5 9  HIS F  87 ? HIS F 87   . ? 1_555 ? 
157 CC5 9  ALA F  89 ? ALA F 89   . ? 1_555 ? 
158 CC5 9  ALA I  27 ? ALA I 27   . ? 1_555 ? 
159 CC5 9  LYS I  28 ? LYS I 28   . ? 1_555 ? 
160 CC5 9  SER I  31 ? SER I 31   . ? 1_555 ? 
161 CC5 9  ARG I  45 ? ARG I 45   . ? 1_555 ? 
162 CC5 9  TYR I  50 ? TYR I 50   . ? 1_555 ? 
163 CC5 9  ASN I  52 ? ASN I 52   . ? 1_555 ? 
164 CC5 9  PHE I  73 ? PHE I 73   . ? 1_555 ? 
165 CC6 7  VAL F  9  ? VAL F 9    . ? 1_555 ? 
166 CC6 7  ALA F  27 ? ALA F 27   . ? 1_555 ? 
167 CC6 7  ARG F  45 ? ARG F 45   . ? 1_555 ? 
168 CC6 7  ASN F  52 ? ASN F 52   . ? 1_555 ? 
169 CC6 7  PHE F  73 ? PHE F 73   . ? 1_555 ? 
170 CC6 7  HIS I  87 ? HIS I 87   . ? 1_555 ? 
171 CC6 7  ALA I  89 ? ALA I 89   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3ZO7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ZO7 
_atom_sites.fract_transf_matrix[1][1]   0.012848 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009698 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007259 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . MET A  1 1  ? 32.366 70.262 2.271   1.00 31.87  ?  1    MET A N    1 
ATOM   2     C  CA   . MET A  1 1  ? 33.051 68.968 1.998   1.00 31.72  ?  1    MET A CA   1 
ATOM   3     C  C    . MET A  1 1  ? 33.397 68.264 3.302   1.00 27.14  ?  1    MET A C    1 
ATOM   4     O  O    . MET A  1 1  ? 33.373 68.870 4.371   1.00 26.60  ?  1    MET A O    1 
ATOM   5     C  CB   . MET A  1 1  ? 34.307 69.193 1.162   1.00 34.99  ?  1    MET A CB   1 
ATOM   6     C  CG   . MET A  1 1  ? 35.256 70.233 1.726   1.00 35.96  ?  1    MET A CG   1 
ATOM   7     S  SD   . MET A  1 1  ? 36.421 70.804 0.478   1.00 49.34  ?  1    MET A SD   1 
ATOM   8     C  CE   . MET A  1 1  ? 35.299 71.576 -0.687  1.00 34.45  ?  1    MET A CE   1 
ATOM   9     H  H1   . MET A  1 1  ? 32.823 70.723 2.977   1.00 38.24  ?  1    MET A H1   1 
ATOM   10    H  H2   . MET A  1 1  ? 32.375 70.802 1.477   1.00 38.24  ?  1    MET A H2   1 
ATOM   11    H  H3   . MET A  1 1  ? 31.458 70.094 2.533   1.00 38.24  ?  1    MET A H3   1 
ATOM   12    H  HA   . MET A  1 1  ? 32.447 68.395 1.481   1.00 38.06  ?  1    MET A HA   1 
ATOM   13    H  HB2  . MET A  1 1  ? 34.792 68.355 1.099   1.00 41.99  ?  1    MET A HB2  1 
ATOM   14    H  HB3  . MET A  1 1  ? 34.042 69.485 0.276   1.00 41.99  ?  1    MET A HB3  1 
ATOM   15    H  HG2  . MET A  1 1  ? 34.746 70.997 2.038   1.00 43.15  ?  1    MET A HG2  1 
ATOM   16    H  HG3  . MET A  1 1  ? 35.760 69.844 2.457   1.00 43.15  ?  1    MET A HG3  1 
ATOM   17    H  HE1  . MET A  1 1  ? 34.826 72.284 -0.242  1.00 41.34  ?  1    MET A HE1  1 
ATOM   18    H  HE2  . MET A  1 1  ? 35.806 71.931 -1.421  1.00 41.34  ?  1    MET A HE2  1 
ATOM   19    H  HE3  . MET A  1 1  ? 34.678 70.917 -1.006  1.00 41.34  ?  1    MET A HE3  1 
ATOM   20    N  N    . LEU A  1 2  ? 33.735 66.984 3.200   1.00 26.87  ?  2    LEU A N    1 
ATOM   21    C  CA   . LEU A  1 2  ? 33.760 66.106 4.361   1.00 25.54  ?  2    LEU A CA   1 
ATOM   22    C  C    . LEU A  1 2  ? 35.158 65.880 4.934   1.00 25.86  ?  2    LEU A C    1 
ATOM   23    O  O    . LEU A  1 2  ? 36.129 65.718 4.196   1.00 28.00  ?  2    LEU A O    1 
ATOM   24    C  CB   . LEU A  1 2  ? 33.123 64.766 3.988   1.00 25.51  ?  2    LEU A CB   1 
ATOM   25    C  CG   . LEU A  1 2  ? 31.771 64.904 3.279   1.00 26.76  ?  2    LEU A CG   1 
ATOM   26    C  CD1  . LEU A  1 2  ? 31.230 63.547 2.856   1.00 27.23  ?  2    LEU A CD1  1 
ATOM   27    C  CD2  . LEU A  1 2  ? 30.771 65.629 4.164   1.00 26.82  ?  2    LEU A CD2  1 
ATOM   28    H  H    . LEU A  1 2  ? 33.955 66.598 2.464   1.00 32.24  ?  2    LEU A H    1 
ATOM   29    H  HA   . LEU A  1 2  ? 33.213 66.508 5.068   1.00 30.64  ?  2    LEU A HA   1 
ATOM   30    H  HB2  . LEU A  1 2  ? 33.723 64.289 3.394   1.00 30.61  ?  2    LEU A HB2  1 
ATOM   31    H  HB3  . LEU A  1 2  ? 32.982 64.250 4.798   1.00 30.61  ?  2    LEU A HB3  1 
ATOM   32    H  HG   . LEU A  1 2  ? 31.894 65.435 2.477   1.00 32.11  ?  2    LEU A HG   1 
ATOM   33    H  HD11 . LEU A  1 2  ? 31.116 63.000 3.636   1.00 32.68  ?  2    LEU A HD11 1 
ATOM   34    H  HD12 . LEU A  1 2  ? 30.386 63.671 2.416   1.00 32.68  ?  2    LEU A HD12 1 
ATOM   35    H  HD13 . LEU A  1 2  ? 31.855 63.135 2.255   1.00 32.68  ?  2    LEU A HD13 1 
ATOM   36    H  HD21 . LEU A  1 2  ? 31.110 66.504 4.367   1.00 32.19  ?  2    LEU A HD21 1 
ATOM   37    H  HD22 . LEU A  1 2  ? 29.935 65.702 3.697   1.00 32.19  ?  2    LEU A HD22 1 
ATOM   38    H  HD23 . LEU A  1 2  ? 30.651 65.128 4.975   1.00 32.19  ?  2    LEU A HD23 1 
ATOM   39    N  N    . TYR A  1 3  ? 35.240 65.875 6.262   1.00 23.95  ?  3    TYR A N    1 
ATOM   40    C  CA   . TYR A  1 3  ? 36.468 65.533 6.970   1.00 23.24  ?  3    TYR A CA   1 
ATOM   41    C  C    . TYR A  1 3  ? 36.157 64.503 8.044   1.00 23.66  ?  3    TYR A C    1 
ATOM   42    O  O    . TYR A  1 3  ? 35.197 64.662 8.800   1.00 24.48  ?  3    TYR A O    1 
ATOM   43    C  CB   . TYR A  1 3  ? 37.069 66.759 7.657   1.00 22.97  ?  3    TYR A CB   1 
ATOM   44    C  CG   . TYR A  1 3  ? 37.392 67.917 6.746   1.00 23.81  ?  3    TYR A CG   1 
ATOM   45    C  CD1  . TYR A  1 3  ? 36.385 68.727 6.235   1.00 24.45  ?  3    TYR A CD1  1 
ATOM   46    C  CD2  . TYR A  1 3  ? 38.707 68.221 6.420   1.00 25.18  ?  3    TYR A CD2  1 
ATOM   47    C  CE1  . TYR A  1 3  ? 36.680 69.796 5.412   1.00 25.38  ?  3    TYR A CE1  1 
ATOM   48    C  CE2  . TYR A  1 3  ? 39.012 69.287 5.598   1.00 25.78  ?  3    TYR A CE2  1 
ATOM   49    C  CZ   . TYR A  1 3  ? 37.994 70.073 5.099   1.00 26.15  ?  3    TYR A CZ   1 
ATOM   50    O  OH   . TYR A  1 3  ? 38.289 71.136 4.284   1.00 26.87  ?  3    TYR A OH   1 
ATOM   51    H  H    . TYR A  1 3  ? 34.585 66.071 6.784   1.00 28.74  ?  3    TYR A H    1 
ATOM   52    H  HA   . TYR A  1 3  ? 37.124 65.159 6.346   1.00 27.88  ?  3    TYR A HA   1 
ATOM   53    H  HB2  . TYR A  1 3  ? 36.439 67.078 8.322   1.00 27.56  ?  3    TYR A HB2  1 
ATOM   54    H  HB3  . TYR A  1 3  ? 37.893 66.493 8.093   1.00 27.56  ?  3    TYR A HB3  1 
ATOM   55    H  HD1  . TYR A  1 3  ? 35.498 68.543 6.446   1.00 29.34  ?  3    TYR A HD1  1 
ATOM   56    H  HD2  . TYR A  1 3  ? 39.395 67.693 6.757   1.00 30.21  ?  3    TYR A HD2  1 
ATOM   57    H  HE1  . TYR A  1 3  ? 35.996 70.328 5.074   1.00 30.45  ?  3    TYR A HE1  1 
ATOM   58    H  HE2  . TYR A  1 3  ? 39.897 69.477 5.385   1.00 30.94  ?  3    TYR A HE2  1 
ATOM   59    H  HH   . TYR A  1 3  ? 38.017 71.832 4.622   1.00 32.24  ?  3    TYR A HH   1 
ATOM   60    N  N    . LEU A  1 4  ? 36.968 63.454 8.120   1.00 24.23  ?  4    LEU A N    1 
ATOM   61    C  CA   . LEU A  1 4  ? 36.879 62.517 9.230   1.00 22.95  ?  4    LEU A CA   1 
ATOM   62    C  C    . LEU A  1 4  ? 37.767 63.018 10.361  1.00 21.69  ?  4    LEU A C    1 
ATOM   63    O  O    . LEU A  1 4  ? 38.979 63.173 10.189  1.00 23.40  ?  4    LEU A O    1 
ATOM   64    C  CB   . LEU A  1 4  ? 37.316 61.117 8.803   1.00 23.53  ?  4    LEU A CB   1 
ATOM   65    C  CG   . LEU A  1 4  ? 37.188 60.046 9.890   1.00 23.48  ?  4    LEU A CG   1 
ATOM   66    C  CD1  . LEU A  1 4  ? 35.725 59.699 10.133  1.00 23.15  ?  4    LEU A CD1  1 
ATOM   67    C  CD2  . LEU A  1 4  ? 37.988 58.808 9.523   1.00 24.23  ?  4    LEU A CD2  1 
ATOM   68    H  H    . LEU A  1 4  ? 37.576 63.263 7.543   1.00 29.07  ?  4    LEU A H    1 
ATOM   69    H  HA   . LEU A  1 4  ? 35.955 62.473 9.552   1.00 27.54  ?  4    LEU A HA   1 
ATOM   70    H  HB2  . LEU A  1 4  ? 36.769 60.838 8.051   1.00 28.23  ?  4    LEU A HB2  1 
ATOM   71    H  HB3  . LEU A  1 4  ? 38.247 61.151 8.534   1.00 28.23  ?  4    LEU A HB3  1 
ATOM   72    H  HG   . LEU A  1 4  ? 37.550 60.398 10.718  1.00 28.17  ?  4    LEU A HG   1 
ATOM   73    H  HD11 . LEU A  1 4  ? 35.344 59.366 9.317   1.00 27.79  ?  4    LEU A HD11 1 
ATOM   74    H  HD12 . LEU A  1 4  ? 35.673 59.027 10.817  1.00 27.79  ?  4    LEU A HD12 1 
ATOM   75    H  HD13 . LEU A  1 4  ? 35.259 60.489 10.414  1.00 27.79  ?  4    LEU A HD13 1 
ATOM   76    H  HD21 . LEU A  1 4  ? 38.912 59.050 9.428   1.00 29.08  ?  4    LEU A HD21 1 
ATOM   77    H  HD22 . LEU A  1 4  ? 37.890 58.155 10.220  1.00 29.08  ?  4    LEU A HD22 1 
ATOM   78    H  HD23 . LEU A  1 4  ? 37.655 58.455 8.695   1.00 29.08  ?  4    LEU A HD23 1 
ATOM   79    N  N    . VAL A  1 5  ? 37.160 63.272 11.515  1.00 19.34  ?  5    VAL A N    1 
ATOM   80    C  CA   . VAL A  1 5  ? 37.881 63.824 12.653  1.00 21.11  ?  5    VAL A CA   1 
ATOM   81    C  C    . VAL A  1 5  ? 37.767 62.909 13.869  1.00 23.00  ?  5    VAL A C    1 
ATOM   82    O  O    . VAL A  1 5  ? 36.667 62.593 14.321  1.00 23.39  ?  5    VAL A O    1 
ATOM   83    C  CB   . VAL A  1 5  ? 37.343 65.219 13.018  1.00 21.91  ?  5    VAL A CB   1 
ATOM   84    C  CG1  . VAL A  1 5  ? 38.122 65.806 14.185  1.00 21.95  ?  5    VAL A CG1  1 
ATOM   85    C  CG2  . VAL A  1 5  ? 37.409 66.143 11.809  1.00 24.40  ?  5    VAL A CG2  1 
ATOM   86    H  H    . VAL A  1 5  ? 36.325 63.131 11.664  1.00 23.21  ?  5    VAL A H    1 
ATOM   87    H  HA   . VAL A  1 5  ? 38.829 63.912 12.422  1.00 25.34  ?  5    VAL A HA   1 
ATOM   88    H  HB   . VAL A  1 5  ? 36.405 65.139 13.288  1.00 26.29  ?  5    VAL A HB   1 
ATOM   89    H  HG11 . VAL A  1 5  ? 39.046 65.881 13.938  1.00 26.34  ?  5    VAL A HG11 1 
ATOM   90    H  HG12 . VAL A  1 5  ? 37.767 66.674 14.392  1.00 26.34  ?  5    VAL A HG12 1 
ATOM   91    H  HG13 . VAL A  1 5  ? 38.031 65.226 14.944  1.00 26.34  ?  5    VAL A HG13 1 
ATOM   92    H  HG21 . VAL A  1 5  ? 36.875 65.771 11.103  1.00 29.29  ?  5    VAL A HG21 1 
ATOM   93    H  HG22 . VAL A  1 5  ? 37.071 67.006 12.058  1.00 29.29  ?  5    VAL A HG22 1 
ATOM   94    H  HG23 . VAL A  1 5  ? 38.323 66.219 11.524  1.00 29.29  ?  5    VAL A HG23 1 
ATOM   95    N  N    . ARG A  1 6  ? 38.912 62.478 14.390  1.00 25.73  ?  6    ARG A N    1 
ATOM   96    C  CA   . ARG A  1 6  ? 38.944 61.675 15.605  1.00 25.77  ?  6    ARG A CA   1 
ATOM   97    C  C    . ARG A  1 6  ? 39.392 62.546 16.768  1.00 26.56  ?  6    ARG A C    1 
ATOM   98    O  O    . ARG A  1 6  ? 40.354 63.301 16.648  1.00 26.88  ?  6    ARG A O    1 
ATOM   99    C  CB   . ARG A  1 6  ? 39.895 60.489 15.448  1.00 26.28  ?  6    ARG A CB   1 
ATOM   100   C  CG   . ARG A  1 6  ? 40.045 59.648 16.709  1.00 26.92  ?  6    ARG A CG   1 
ATOM   101   C  CD   . ARG A  1 6  ? 41.132 58.597 16.550  1.00 28.41  ?  6    ARG A CD   1 
ATOM   102   N  NE   . ARG A  1 6  ? 40.860 57.707 15.425  1.00 28.95  ?  6    ARG A NE   1 
ATOM   103   C  CZ   . ARG A  1 6  ? 40.117 56.607 15.493  1.00 29.03  ?  6    ARG A CZ   1 
ATOM   104   N  NH1  . ARG A  1 6  ? 39.554 56.238 16.638  1.00 29.48  ?  6    ARG A NH1  1 
ATOM   105   N  NH2  . ARG A  1 6  ? 39.929 55.873 14.407  1.00 28.45  ?  6    ARG A NH2  1 
ATOM   106   H  H    . ARG A  1 6  ? 39.688 62.638 14.055  1.00 30.88  ?  6    ARG A H    1 
ATOM   107   H  HA   . ARG A  1 6  ? 38.046 61.333 15.797  1.00 30.93  ?  6    ARG A HA   1 
ATOM   108   H  HB2  . ARG A  1 6  ? 39.561 59.912 14.744  1.00 31.53  ?  6    ARG A HB2  1 
ATOM   109   H  HB3  . ARG A  1 6  ? 40.774 60.824 15.209  1.00 31.53  ?  6    ARG A HB3  1 
ATOM   110   H  HG2  . ARG A  1 6  ? 40.285 60.224 17.452  1.00 32.30  ?  6    ARG A HG2  1 
ATOM   111   H  HG3  . ARG A  1 6  ? 39.207 59.194 16.893  1.00 32.30  ?  6    ARG A HG3  1 
ATOM   112   H  HD2  . ARG A  1 6  ? 41.981 59.037 16.391  1.00 34.09  ?  6    ARG A HD2  1 
ATOM   113   H  HD3  . ARG A  1 6  ? 41.178 58.060 17.357  1.00 34.09  ?  6    ARG A HD3  1 
ATOM   114   H  HE   . ARG A  1 6  ? 41.206 57.909 14.664  1.00 34.74  ?  6    ARG A HE   1 
ATOM   115   H  HH11 . ARG A  1 6  ? 39.670 56.711 17.347  1.00 35.37  ?  6    ARG A HH11 1 
ATOM   116   H  HH12 . ARG A  1 6  ? 39.075 55.524 16.672  1.00 35.37  ?  6    ARG A HH12 1 
ATOM   117   H  HH21 . ARG A  1 6  ? 40.291 56.106 13.663  1.00 34.13  ?  6    ARG A HH21 1 
ATOM   118   H  HH22 . ARG A  1 6  ? 39.450 55.160 14.448  1.00 34.13  ?  6    ARG A HH22 1 
ATOM   119   N  N    . MET A  1 7  ? 38.687 62.442 17.889  1.00 25.63  ?  7    MET A N    1 
ATOM   120   C  CA   . MET A  1 7  ? 39.009 63.232 19.070  1.00 27.06  ?  7    MET A CA   1 
ATOM   121   C  C    . MET A  1 7  ? 39.198 62.329 20.280  1.00 27.16  ?  7    MET A C    1 
ATOM   122   O  O    . MET A  1 7  ? 38.367 61.465 20.561  1.00 27.71  ?  7    MET A O    1 
ATOM   123   C  CB   . MET A  1 7  ? 37.897 64.237 19.366  1.00 26.66  ?  7    MET A CB   1 
ATOM   124   C  CG   . MET A  1 7  ? 37.459 65.063 18.174  1.00 26.59  ?  7    MET A CG   1 
ATOM   125   S  SD   . MET A  1 7  ? 36.399 66.433 18.670  1.00 27.09  ?  7    MET A SD   1 
ATOM   126   C  CE   . MET A  1 7  ? 35.664 66.870 17.098  1.00 26.62  ?  7    MET A CE   1 
ATOM   127   H  H    . MET A  1 7  ? 38.012 61.918 17.991  1.00 30.75  ?  7    MET A H    1 
ATOM   128   H  HA   . MET A  1 7  ? 39.837 63.730 18.908  1.00 32.47  ?  7    MET A HA   1 
ATOM   129   H  HB2  . MET A  1 7  ? 37.120 63.753 19.689  1.00 31.99  ?  7    MET A HB2  1 
ATOM   130   H  HB3  . MET A  1 7  ? 38.207 64.850 20.050  1.00 31.99  ?  7    MET A HB3  1 
ATOM   131   H  HG2  . MET A  1 7  ? 38.242 65.429 17.733  1.00 31.90  ?  7    MET A HG2  1 
ATOM   132   H  HG3  . MET A  1 7  ? 36.962 64.500 17.560  1.00 31.90  ?  7    MET A HG3  1 
ATOM   133   H  HE1  . MET A  1 7  ? 35.184 66.112 16.756  1.00 31.94  ?  7    MET A HE1  1 
ATOM   134   H  HE2  . MET A  1 7  ? 35.062 67.606 17.229  1.00 31.94  ?  7    MET A HE2  1 
ATOM   135   H  HE3  . MET A  1 7  ? 36.360 67.120 16.486  1.00 31.94  ?  7    MET A HE3  1 
ATOM   136   N  N    . THR A  1 8  ? 40.295 62.537 20.997  1.00 28.81  ?  8    THR A N    1 
ATOM   137   C  CA   . THR A  1 8  ? 40.556 61.795 22.220  1.00 28.52  ?  8    THR A CA   1 
ATOM   138   C  C    . THR A  1 8  ? 40.828 62.772 23.354  1.00 28.67  ?  8    THR A C    1 
ATOM   139   O  O    . THR A  1 8  ? 41.683 63.646 23.237  1.00 28.60  ?  8    THR A O    1 
ATOM   140   C  CB   . THR A  1 8  ? 41.757 60.853 22.065  1.00 30.14  ?  8    THR A CB   1 
ATOM   141   O  OG1  . THR A  1 8  ? 41.531 59.965 20.962  1.00 29.32  ?  8    THR A OG1  1 
ATOM   142   C  CG2  . THR A  1 8  ? 41.963 60.042 23.338  1.00 31.42  ?  8    THR A CG2  1 
ATOM   143   H  H    . THR A  1 8  ? 40.908 63.105 20.794  1.00 34.58  ?  8    THR A H    1 
ATOM   144   H  HA   . THR A  1 8  ? 39.769 61.260 22.453  1.00 34.22  ?  8    THR A HA   1 
ATOM   145   H  HB   . THR A  1 8  ? 42.558 61.374 21.900  1.00 36.16  ?  8    THR A HB   1 
ATOM   146   H  HG1  . THR A  1 8  ? 41.436 60.395 20.270  1.00 35.18  ?  8    THR A HG1  1 
ATOM   147   H  HG21 . THR A  1 8  ? 41.181 59.518 23.523  1.00 37.71  ?  8    THR A HG21 1 
ATOM   148   H  HG22 . THR A  1 8  ? 42.716 59.455 23.234  1.00 37.71  ?  8    THR A HG22 1 
ATOM   149   H  HG23 . THR A  1 8  ? 42.127 60.631 24.078  1.00 37.71  ?  8    THR A HG23 1 
ATOM   150   N  N    . VAL A  1 9  ? 40.091 62.615 24.448  1.00 28.63  ?  9    VAL A N    1 
ATOM   151   C  CA   . VAL A  1 9  ? 40.188 63.525 25.579  1.00 30.64  ?  9    VAL A CA   1 
ATOM   152   C  C    . VAL A  1 9  ? 41.203 63.030 26.602  1.00 32.96  ?  9    VAL A C    1 
ATOM   153   O  O    . VAL A  1 9  ? 41.217 61.854 26.959  1.00 32.15  ?  9    VAL A O    1 
ATOM   154   C  CB   . VAL A  1 9  ? 38.824 63.683 26.280  1.00 31.69  ?  9    VAL A CB   1 
ATOM   155   C  CG1  . VAL A  1 9  ? 38.943 64.616 27.478  1.00 33.31  ?  9    VAL A CG1  1 
ATOM   156   C  CG2  . VAL A  1 9  ? 37.780 64.195 25.302  1.00 30.99  ?  9    VAL A CG2  1 
ATOM   157   H  H    . VAL A  1 9  ? 39.521 61.981 24.559  1.00 34.36  ?  9    VAL A H    1 
ATOM   158   H  HA   . VAL A  1 9  ? 40.475 64.407 25.262  1.00 36.77  ?  9    VAL A HA   1 
ATOM   159   H  HB   . VAL A  1 9  ? 38.530 62.807 26.607  1.00 38.03  ?  9    VAL A HB   1 
ATOM   160   H  HG11 . VAL A  1 9  ? 39.243 65.476 27.175  1.00 39.97  ?  9    VAL A HG11 1 
ATOM   161   H  HG12 . VAL A  1 9  ? 38.083 64.697 27.896  1.00 39.97  ?  9    VAL A HG12 1 
ATOM   162   H  HG13 . VAL A  1 9  ? 39.576 64.248 28.098  1.00 39.97  ?  9    VAL A HG13 1 
ATOM   163   H  HG21 . VAL A  1 9  ? 37.694 63.567 24.580  1.00 37.19  ?  9    VAL A HG21 1 
ATOM   164   H  HG22 . VAL A  1 9  ? 36.941 64.285 25.760  1.00 37.19  ?  9    VAL A HG22 1 
ATOM   165   H  HG23 . VAL A  1 9  ? 38.061 65.047 24.962  1.00 37.19  ?  9    VAL A HG23 1 
ATOM   166   N  N    . ASN A  1 10 ? 42.053 63.938 27.067  1.00 35.07  ?  10   ASN A N    1 
ATOM   167   C  CA   . ASN A  1 10 ? 42.982 63.639 28.150  1.00 38.90  ?  10   ASN A CA   1 
ATOM   168   C  C    . ASN A  1 10 ? 42.945 64.744 29.192  1.00 39.71  ?  10   ASN A C    1 
ATOM   169   O  O    . ASN A  1 10 ? 43.724 65.694 29.131  1.00 41.24  ?  10   ASN A O    1 
ATOM   170   C  CB   . ASN A  1 10 ? 44.405 63.471 27.617  1.00 43.30  ?  10   ASN A CB   1 
ATOM   171   C  CG   . ASN A  1 10 ? 44.546 62.268 26.708  1.00 45.90  ?  10   ASN A CG   1 
ATOM   172   O  OD1  . ASN A  1 10 ? 44.499 62.390 25.483  1.00 46.67  ?  10   ASN A OD1  1 
ATOM   173   N  ND2  . ASN A  1 10 ? 44.710 61.093 27.305  1.00 47.27  ?  10   ASN A ND2  1 
ATOM   174   H  H    . ASN A  1 10 ? 42.112 64.742 26.769  1.00 42.09  ?  10   ASN A H    1 
ATOM   175   H  HA   . ASN A  1 10 ? 42.716 62.801 28.582  1.00 46.68  ?  10   ASN A HA   1 
ATOM   176   H  HB2  . ASN A  1 10 ? 44.649 64.261 27.109  1.00 51.95  ?  10   ASN A HB2  1 
ATOM   177   H  HB3  . ASN A  1 10 ? 45.012 63.355 28.364  1.00 51.95  ?  10   ASN A HB3  1 
ATOM   178   H  HD21 . ASN A  1 10 ? 44.732 61.046 28.163  1.00 56.73  ?  10   ASN A HD21 1 
ATOM   179   H  HD22 . ASN A  1 10 ? 44.795 60.379 26.833  1.00 56.73  ?  10   ASN A HD22 1 
ATOM   180   N  N    . LEU A  1 11 ? 42.028 64.618 30.145  1.00 36.33  ?  11   LEU A N    1 
ATOM   181   C  CA   . LEU A  1 11 ? 41.862 65.626 31.183  1.00 37.44  ?  11   LEU A CA   1 
ATOM   182   C  C    . LEU A  1 11 ? 43.035 65.615 32.150  1.00 39.23  ?  11   LEU A C    1 
ATOM   183   O  O    . LEU A  1 11 ? 43.414 64.557 32.652  1.00 40.98  ?  11   LEU A O    1 
ATOM   184   C  CB   . LEU A  1 11 ? 40.571 65.378 31.963  1.00 37.87  ?  11   LEU A CB   1 
ATOM   185   C  CG   . LEU A  1 11 ? 39.272 65.457 31.166  1.00 37.29  ?  11   LEU A CG   1 
ATOM   186   C  CD1  . LEU A  1 11 ? 38.080 65.283 32.094  1.00 38.92  ?  11   LEU A CD1  1 
ATOM   187   C  CD2  . LEU A  1 11 ? 39.189 66.775 30.414  1.00 36.71  ?  11   LEU A CD2  1 
ATOM   188   H  H    . LEU A  1 11 ? 41.487 63.953 30.212  1.00 43.59  ?  11   LEU A H    1 
ATOM   189   H  HA   . LEU A  1 11 ? 41.809 66.513 30.770  1.00 44.93  ?  11   LEU A HA   1 
ATOM   190   H  HB2  . LEU A  1 11 ? 40.617 64.491 32.352  1.00 45.44  ?  11   LEU A HB2  1 
ATOM   191   H  HB3  . LEU A  1 11 ? 40.514 66.037 32.673  1.00 45.44  ?  11   LEU A HB3  1 
ATOM   192   H  HG   . LEU A  1 11 ? 39.255 64.738 30.515  1.00 44.75  ?  11   LEU A HG   1 
ATOM   193   H  HD11 . LEU A  1 11 ? 38.094 65.980 32.753  1.00 46.70  ?  11   LEU A HD11 1 
ATOM   194   H  HD12 . LEU A  1 11 ? 37.272 65.335 31.578  1.00 46.70  ?  11   LEU A HD12 1 
ATOM   195   H  HD13 . LEU A  1 11 ? 38.141 64.426 32.522  1.00 46.70  ?  11   LEU A HD13 1 
ATOM   196   H  HD21 . LEU A  1 11 ? 39.934 66.838 29.811  1.00 44.05  ?  11   LEU A HD21 1 
ATOM   197   H  HD22 . LEU A  1 11 ? 38.366 66.802 29.921  1.00 44.05  ?  11   LEU A HD22 1 
ATOM   198   H  HD23 . LEU A  1 11 ? 39.216 67.498 31.046  1.00 44.05  ?  11   LEU A HD23 1 
ATOM   199   N  N    . PRO A  1 12 ? 43.614 66.794 32.419  1.00 37.69  ?  12   PRO A N    1 
ATOM   200   C  CA   . PRO A  1 12 ? 44.631 66.869 33.471  1.00 41.36  ?  12   PRO A CA   1 
ATOM   201   C  C    . PRO A  1 12 ? 44.007 66.473 34.802  1.00 46.45  ?  12   PRO A C    1 
ATOM   202   O  O    . PRO A  1 12 ? 42.811 66.688 34.997  1.00 44.37  ?  12   PRO A O    1 
ATOM   203   C  CB   . PRO A  1 12 ? 45.039 68.345 33.466  1.00 43.39  ?  12   PRO A CB   1 
ATOM   204   C  CG   . PRO A  1 12 ? 43.885 69.063 32.857  1.00 41.89  ?  12   PRO A CG   1 
ATOM   205   C  CD   . PRO A  1 12 ? 43.296 68.118 31.858  1.00 38.07  ?  12   PRO A CD   1 
ATOM   206   H  HA   . PRO A  1 12 ? 45.402 66.299 33.267  1.00 49.63  ?  12   PRO A HA   1 
ATOM   207   H  HB2  . PRO A  1 12 ? 45.189 68.646 34.376  1.00 52.07  ?  12   PRO A HB2  1 
ATOM   208   H  HB3  . PRO A  1 12 ? 45.839 68.462 32.929  1.00 52.07  ?  12   PRO A HB3  1 
ATOM   209   H  HG2  . PRO A  1 12 ? 43.237 69.279 33.545  1.00 50.27  ?  12   PRO A HG2  1 
ATOM   210   H  HG3  . PRO A  1 12 ? 44.200 69.870 32.419  1.00 50.27  ?  12   PRO A HG3  1 
ATOM   211   H  HD2  . PRO A  1 12 ? 42.336 68.240 31.802  1.00 45.68  ?  12   PRO A HD2  1 
ATOM   212   H  HD3  . PRO A  1 12 ? 43.721 68.231 30.994  1.00 45.68  ?  12   PRO A HD3  1 
ATOM   213   N  N    . ARG A  1 13 ? 44.794 65.901 35.703  1.00 55.38  ?  13   ARG A N    1 
ATOM   214   C  CA   . ARG A  1 13 ? 44.229 65.304 36.906  1.00 61.65  ?  13   ARG A CA   1 
ATOM   215   C  C    . ARG A  1 13 ? 43.682 66.329 37.896  1.00 63.12  ?  13   ARG A C    1 
ATOM   216   O  O    . ARG A  1 13 ? 42.755 66.030 38.649  1.00 64.34  ?  13   ARG A O    1 
ATOM   217   C  CB   . ARG A  1 13 ? 45.256 64.418 37.603  1.00 67.30  ?  13   ARG A CB   1 
ATOM   218   C  CG   . ARG A  1 13 ? 44.630 63.519 38.644  1.00 69.99  ?  13   ARG A CG   1 
ATOM   219   C  CD   . ARG A  1 13 ? 45.625 62.542 39.217  1.00 72.07  ?  13   ARG A CD   1 
ATOM   220   N  NE   . ARG A  1 13 ? 46.068 62.927 40.553  1.00 74.40  ?  13   ARG A NE   1 
ATOM   221   C  CZ   . ARG A  1 13 ? 45.365 62.721 41.662  1.00 75.22  ?  13   ARG A CZ   1 
ATOM   222   N  NH1  . ARG A  1 13 ? 44.173 62.139 41.604  1.00 71.85  ?  13   ARG A NH1  1 
ATOM   223   N  NH2  . ARG A  1 13 ? 45.851 63.102 42.835  1.00 79.92  ?  13   ARG A NH2  1 
ATOM   224   H  H    . ARG A  1 13 ? 45.651 65.845 35.645  1.00 66.46  ?  13   ARG A H    1 
ATOM   225   H  HA   . ARG A  1 13 ? 43.481 64.729 36.640  1.00 73.98  ?  13   ARG A HA   1 
ATOM   226   H  HB2  . ARG A  1 13 ? 45.691 63.857 36.942  1.00 80.76  ?  13   ARG A HB2  1 
ATOM   227   H  HB3  . ARG A  1 13 ? 45.911 64.980 38.045  1.00 80.76  ?  13   ARG A HB3  1 
ATOM   228   H  HG2  . ARG A  1 13 ? 44.287 64.062 39.371  1.00 83.99  ?  13   ARG A HG2  1 
ATOM   229   H  HG3  . ARG A  1 13 ? 43.910 63.012 38.237  1.00 83.99  ?  13   ARG A HG3  1 
ATOM   230   H  HD2  . ARG A  1 13 ? 45.212 61.666 39.277  1.00 86.48  ?  13   ARG A HD2  1 
ATOM   231   H  HD3  . ARG A  1 13 ? 46.403 62.506 38.639  1.00 86.48  ?  13   ARG A HD3  1 
ATOM   232   H  HE   . ARG A  1 13 ? 46.833 63.313 40.627  1.00 89.28  ?  13   ARG A HE   1 
ATOM   233   H  HH11 . ARG A  1 13 ? 43.853 61.889 40.845  1.00 86.22  ?  13   ARG A HH11 1 
ATOM   234   H  HH12 . ARG A  1 13 ? 43.722 62.009 42.324  1.00 86.22  ?  13   ARG A HH12 1 
ATOM   235   H  HH21 . ARG A  1 13 ? 46.621 63.481 42.879  1.00 95.90  ?  13   ARG A HH21 1 
ATOM   236   H  HH22 . ARG A  1 13 ? 45.395 62.971 43.553  1.00 95.90  ?  13   ARG A HH22 1 
ATOM   237   N  N    . ASN A  1 14 ? 44.247 67.532 37.900  1.00 65.38  ?  14   ASN A N    1 
ATOM   238   C  CA   . ASN A  1 14 ? 43.817 68.556 38.849  1.00 68.11  ?  14   ASN A CA   1 
ATOM   239   C  C    . ASN A  1 14 ? 42.643 69.391 38.338  1.00 65.63  ?  14   ASN A C    1 
ATOM   240   O  O    . ASN A  1 14 ? 42.404 70.501 38.814  1.00 68.36  ?  14   ASN A O    1 
ATOM   241   C  CB   . ASN A  1 14 ? 44.987 69.464 39.242  1.00 73.94  ?  14   ASN A CB   1 
ATOM   242   C  CG   . ASN A  1 14 ? 45.648 70.120 38.049  1.00 77.55  ?  14   ASN A CG   1 
ATOM   243   O  OD1  . ASN A  1 14 ? 45.113 70.110 36.941  1.00 76.03  ?  14   ASN A OD1  1 
ATOM   244   N  ND2  . ASN A  1 14 ? 46.822 70.700 38.273  1.00 82.49  ?  14   ASN A ND2  1 
ATOM   245   H  H    . ASN A  1 14 ? 44.876 67.780 37.369  1.00 78.46  ?  14   ASN A H    1 
ATOM   246   H  HA   . ASN A  1 14 ? 43.516 68.106 39.665  1.00 81.73  ?  14   ASN A HA   1 
ATOM   247   H  HB2  . ASN A  1 14 ? 44.659 70.166 39.826  1.00 88.72  ?  14   ASN A HB2  1 
ATOM   248   H  HB3  . ASN A  1 14 ? 45.656 68.935 39.702  1.00 88.72  ?  14   ASN A HB3  1 
ATOM   249   H  HD21 . ASN A  1 14 ? 47.163 70.688 39.063  1.00 98.99  ?  14   ASN A HD21 1 
ATOM   250   H  HD22 . ASN A  1 14 ? 47.240 71.087 37.629  1.00 98.99  ?  14   ASN A HD22 1 
ATOM   251   N  N    . LEU A  1 15 ? 41.913 68.850 37.368  1.00 58.20  ?  15   LEU A N    1 
ATOM   252   C  CA   . LEU A  1 15 ? 40.674 69.460 36.909  1.00 55.11  ?  15   LEU A CA   1 
ATOM   253   C  C    . LEU A  1 15 ? 39.536 68.938 37.783  1.00 50.05  ?  15   LEU A C    1 
ATOM   254   O  O    . LEU A  1 15 ? 39.164 67.768 37.694  1.00 51.83  ?  15   LEU A O    1 
ATOM   255   C  CB   . LEU A  1 15 ? 40.438 69.119 35.436  1.00 54.45  ?  15   LEU A CB   1 
ATOM   256   C  CG   . LEU A  1 15 ? 39.257 69.789 34.733  1.00 55.50  ?  15   LEU A CG   1 
ATOM   257   C  CD1  . LEU A  1 15 ? 39.521 69.891 33.240  1.00 55.17  ?  15   LEU A CD1  1 
ATOM   258   C  CD2  . LEU A  1 15 ? 37.977 69.018 34.983  1.00 54.77  ?  15   LEU A CD2  1 
ATOM   259   H  H    . LEU A  1 15 ? 42.118 68.123 36.957  1.00 69.84  ?  15   LEU A H    1 
ATOM   260   H  HA   . LEU A  1 15 ? 40.726 70.434 37.004  1.00 66.13  ?  15   LEU A HA   1 
ATOM   261   H  HB2  . LEU A  1 15 ? 41.237 69.360 34.941  1.00 65.34  ?  15   LEU A HB2  1 
ATOM   262   H  HB3  . LEU A  1 15 ? 40.301 68.161 35.369  1.00 65.34  ?  15   LEU A HB3  1 
ATOM   263   H  HG   . LEU A  1 15 ? 39.145 70.686 35.084  1.00 66.60  ?  15   LEU A HG   1 
ATOM   264   H  HD11 . LEU A  1 15 ? 39.643 69.008 32.884  1.00 66.20  ?  15   LEU A HD11 1 
ATOM   265   H  HD12 . LEU A  1 15 ? 38.769 70.314 32.819  1.00 66.20  ?  15   LEU A HD12 1 
ATOM   266   H  HD13 . LEU A  1 15 ? 40.313 70.415 33.098  1.00 66.20  ?  15   LEU A HD13 1 
ATOM   267   H  HD21 . LEU A  1 15 ? 37.807 68.993 35.928  1.00 65.73  ?  15   LEU A HD21 1 
ATOM   268   H  HD22 . LEU A  1 15 ? 37.254 69.460 34.532  1.00 65.73  ?  15   LEU A HD22 1 
ATOM   269   H  HD23 . LEU A  1 15 ? 38.079 68.126 34.644  1.00 65.73  ?  15   LEU A HD23 1 
ATOM   270   N  N    . ASP A  1 16 ? 38.990 69.803 38.633  1.00 43.63  ?  16   ASP A N    1 
ATOM   271   C  CA   . ASP A  1 16 ? 38.022 69.373 39.640  1.00 39.88  ?  16   ASP A CA   1 
ATOM   272   C  C    . ASP A  1 16 ? 36.658 69.048 39.027  1.00 39.54  ?  16   ASP A C    1 
ATOM   273   O  O    . ASP A  1 16 ? 36.356 69.470 37.914  1.00 32.41  ?  16   ASP A O    1 
ATOM   274   C  CB   . ASP A  1 16 ? 37.891 70.430 40.745  1.00 42.62  ?  16   ASP A CB   1 
ATOM   275   C  CG   . ASP A  1 16 ? 37.312 71.741 40.246  1.00 43.70  ?  16   ASP A CG   1 
ATOM   276   O  OD1  . ASP A  1 16 ? 36.239 71.723 39.608  1.00 42.10  ?  16   ASP A OD1  1 
ATOM   277   O  OD2  . ASP A  1 16 ? 37.932 72.796 40.499  1.00 46.86  ?  16   ASP A OD2  1 
ATOM   278   H  H    . ASP A  1 16 ? 39.164 70.645 38.648  1.00 52.35  ?  16   ASP A H    1 
ATOM   279   H  HA   . ASP A  1 16 ? 38.356 68.553 40.058  1.00 47.86  ?  16   ASP A HA   1 
ATOM   280   H  HB2  . ASP A  1 16 ? 37.305 70.089 41.439  1.00 51.14  ?  16   ASP A HB2  1 
ATOM   281   H  HB3  . ASP A  1 16 ? 38.769 70.612 41.114  1.00 51.14  ?  16   ASP A HB3  1 
ATOM   282   N  N    . PRO A  1 17 ? 35.833 68.284 39.759  1.00 35.55  ?  17   PRO A N    1 
ATOM   283   C  CA   . PRO A  1 17 ? 34.531 67.808 39.275  1.00 40.00  ?  17   PRO A CA   1 
ATOM   284   C  C    . PRO A  1 17 ? 33.653 68.889 38.643  1.00 38.35  ?  17   PRO A C    1 
ATOM   285   O  O    . PRO A  1 17 ? 33.068 68.638 37.591  1.00 39.96  ?  17   PRO A O    1 
ATOM   286   C  CB   . PRO A  1 17 ? 33.877 67.255 40.541  1.00 42.04  ?  17   PRO A CB   1 
ATOM   287   C  CG   . PRO A  1 17 ? 35.024 66.786 41.361  1.00 40.80  ?  17   PRO A CG   1 
ATOM   288   C  CD   . PRO A  1 17 ? 36.136 67.764 41.105  1.00 39.64  ?  17   PRO A CD   1 
ATOM   289   H  HA   . PRO A  1 17 ? 34.656 67.078 38.633  1.00 48.00  ?  17   PRO A HA   1 
ATOM   290   H  HB2  . PRO A  1 17 ? 33.391 67.960 40.997  1.00 50.45  ?  17   PRO A HB2  1 
ATOM   291   H  HB3  . PRO A  1 17 ? 33.289 66.518 40.314  1.00 50.45  ?  17   PRO A HB3  1 
ATOM   292   H  HG2  . PRO A  1 17 ? 34.777 66.789 42.299  1.00 48.95  ?  17   PRO A HG2  1 
ATOM   293   H  HG3  . PRO A  1 17 ? 35.283 65.895 41.078  1.00 48.95  ?  17   PRO A HG3  1 
ATOM   294   H  HD2  . PRO A  1 17 ? 36.113 68.481 41.758  1.00 47.57  ?  17   PRO A HD2  1 
ATOM   295   H  HD3  . PRO A  1 17 ? 36.993 67.310 41.106  1.00 47.57  ?  17   PRO A HD3  1 
ATOM   296   N  N    . ARG A  1 18 ? 33.554 70.060 39.264  1.00 29.43  ?  18   ARG A N    1 
ATOM   297   C  CA   . ARG A  1 18 ? 32.725 71.128 38.708  1.00 29.54  ?  18   ARG A CA   1 
ATOM   298   C  C    . ARG A  1 18 ? 33.292 71.635 37.388  1.00 26.69  ?  18   ARG A C    1 
ATOM   299   O  O    . ARG A  1 18 ? 32.544 71.907 36.451  1.00 26.27  ?  18   ARG A O    1 
ATOM   300   C  CB   . ARG A  1 18 ? 32.573 72.291 39.694  1.00 34.14  ?  18   ARG A CB   1 
ATOM   301   C  CG   . ARG A  1 18 ? 31.280 72.257 40.503  1.00 39.22  ?  18   ARG A CG   1 
ATOM   302   C  CD   . ARG A  1 18 ? 30.040 72.332 39.612  1.00 41.53  ?  18   ARG A CD   1 
ATOM   303   N  NE   . ARG A  1 18 ? 29.884 73.633 38.966  1.00 42.93  ?  18   ARG A NE   1 
ATOM   304   C  CZ   . ARG A  1 18 ? 29.034 73.879 37.972  1.00 45.61  ?  18   ARG A CZ   1 
ATOM   305   N  NH1  . ARG A  1 18 ? 28.266 72.911 37.492  1.00 46.18  ?  18   ARG A NH1  1 
ATOM   306   N  NH2  . ARG A  1 18 ? 28.955 75.093 37.448  1.00 48.14  ?  18   ARG A NH2  1 
ATOM   307   H  H    . ARG A  1 18 ? 33.951 70.262 40.000  1.00 35.31  ?  18   ARG A H    1 
ATOM   308   H  HA   . ARG A  1 18 ? 31.830 70.770 38.530  1.00 35.45  ?  18   ARG A HA   1 
ATOM   309   H  HB2  . ARG A  1 18 ? 33.314 72.268 40.319  1.00 40.97  ?  18   ARG A HB2  1 
ATOM   310   H  HB3  . ARG A  1 18 ? 32.588 73.124 39.197  1.00 40.97  ?  18   ARG A HB3  1 
ATOM   311   H  HG2  . ARG A  1 18 ? 31.241 71.429 41.006  1.00 47.06  ?  18   ARG A HG2  1 
ATOM   312   H  HG3  . ARG A  1 18 ? 31.264 73.016 41.108  1.00 47.06  ?  18   ARG A HG3  1 
ATOM   313   H  HD2  . ARG A  1 18 ? 30.110 71.659 38.917  1.00 49.84  ?  18   ARG A HD2  1 
ATOM   314   H  HD3  . ARG A  1 18 ? 29.252 72.169 40.153  1.00 49.84  ?  18   ARG A HD3  1 
ATOM   315   H  HE   . ARG A  1 18 ? 30.372 74.283 39.247  1.00 51.51  ?  18   ARG A HE   1 
ATOM   316   H  HH11 . ARG A  1 18 ? 28.310 72.120 37.827  1.00 55.42  ?  18   ARG A HH11 1 
ATOM   317   H  HH12 . ARG A  1 18 ? 27.720 73.075 36.848  1.00 55.42  ?  18   ARG A HH12 1 
ATOM   318   H  HH21 . ARG A  1 18 ? 29.452 75.726 37.752  1.00 57.77  ?  18   ARG A HH21 1 
ATOM   319   H  HH22 . ARG A  1 18 ? 28.408 75.248 36.803  1.00 57.77  ?  18   ARG A HH22 1 
ATOM   320   N  N    . GLU A  1 19 ? 34.612 71.763 37.316  1.00 29.70  ?  19   GLU A N    1 
ATOM   321   C  CA   . GLU A  1 19 ? 35.263 72.172 36.080  1.00 32.93  ?  19   GLU A CA   1 
ATOM   322   C  C    . GLU A  1 19 ? 34.932 71.197 34.952  1.00 33.46  ?  19   GLU A C    1 
ATOM   323   O  O    . GLU A  1 19 ? 34.686 71.614 33.821  1.00 34.48  ?  19   GLU A O    1 
ATOM   324   C  CB   . GLU A  1 19 ? 36.779 72.279 36.271  1.00 33.31  ?  19   GLU A CB   1 
ATOM   325   C  CG   . GLU A  1 19 ? 37.225 73.591 36.903  1.00 37.06  ?  19   GLU A CG   1 
ATOM   326   C  CD   . GLU A  1 19 ? 38.688 73.587 37.320  1.00 36.46  ?  19   GLU A CD   1 
ATOM   327   O  OE1  . GLU A  1 19 ? 39.227 72.499 37.623  1.00 35.28  ?  19   GLU A OE1  1 
ATOM   328   O  OE2  . GLU A  1 19 ? 39.301 74.677 37.345  1.00 37.31  ?  19   GLU A OE2  1 
ATOM   329   H  H    . GLU A  1 19 ? 35.152 71.620 37.970  1.00 35.64  ?  19   GLU A H    1 
ATOM   330   H  HA   . GLU A  1 19 ? 34.928 73.056 35.822  1.00 39.52  ?  19   GLU A HA   1 
ATOM   331   H  HB2  . GLU A  1 19 ? 37.073 71.557 36.848  1.00 39.97  ?  19   GLU A HB2  1 
ATOM   332   H  HB3  . GLU A  1 19 ? 37.210 72.205 35.405  1.00 39.97  ?  19   GLU A HB3  1 
ATOM   333   H  HG2  . GLU A  1 19 ? 37.099 74.308 36.262  1.00 44.47  ?  19   GLU A HG2  1 
ATOM   334   H  HG3  . GLU A  1 19 ? 36.689 73.757 37.695  1.00 44.47  ?  19   GLU A HG3  1 
ATOM   335   N  N    . GLU A  1 20 ? 34.914 69.902 35.258  1.00 36.76  ?  20   GLU A N    1 
ATOM   336   C  CA   . GLU A  1 20 ? 34.596 68.899 34.246  1.00 36.60  ?  20   GLU A CA   1 
ATOM   337   C  C    . GLU A  1 20 ? 33.111 68.917 33.894  1.00 34.29  ?  20   GLU A C    1 
ATOM   338   O  O    . GLU A  1 20 ? 32.743 68.795 32.725  1.00 38.04  ?  20   GLU A O    1 
ATOM   339   C  CB   . GLU A  1 20 ? 34.999 67.495 34.701  1.00 35.78  ?  20   GLU A CB   1 
ATOM   340   C  CG   . GLU A  1 20 ? 34.697 66.427 33.658  1.00 37.10  ?  20   GLU A CG   1 
ATOM   341   C  CD   . GLU A  1 20 ? 35.287 65.073 33.999  1.00 38.08  ?  20   GLU A CD   1 
ATOM   342   O  OE1  . GLU A  1 20 ? 35.758 64.893 35.142  1.00 38.71  ?  20   GLU A OE1  1 
ATOM   343   O  OE2  . GLU A  1 20 ? 35.277 64.187 33.119  1.00 37.74  ?  20   GLU A OE2  1 
ATOM   344   H  H    . GLU A  1 20 ? 35.081 69.580 36.038  1.00 44.11  ?  20   GLU A H    1 
ATOM   345   H  HA   . GLU A  1 20 ? 35.099 69.105 33.430  1.00 43.91  ?  20   GLU A HA   1 
ATOM   346   H  HB2  . GLU A  1 20 ? 35.953 67.482 34.876  1.00 42.94  ?  20   GLU A HB2  1 
ATOM   347   H  HB3  . GLU A  1 20 ? 34.511 67.272 35.509  1.00 42.94  ?  20   GLU A HB3  1 
ATOM   348   H  HG2  . GLU A  1 20 ? 33.735 66.324 33.583  1.00 44.52  ?  20   GLU A HG2  1 
ATOM   349   H  HG3  . GLU A  1 20 ? 35.066 66.707 32.805  1.00 44.52  ?  20   GLU A HG3  1 
ATOM   350   N  N    . GLU A  1 21 ? 32.260 69.063 34.904  1.00 26.39  ?  21   GLU A N    1 
ATOM   351   C  CA   . GLU A  1 21 ? 30.821 69.101 34.677  1.00 26.04  ?  21   GLU A CA   1 
ATOM   352   C  C    . GLU A  1 21 ? 30.464 70.262 33.758  1.00 30.28  ?  21   GLU A C    1 
ATOM   353   O  O    . GLU A  1 21 ? 29.648 70.119 32.847  1.00 29.49  ?  21   GLU A O    1 
ATOM   354   C  CB   . GLU A  1 21 ? 30.061 69.237 35.998  1.00 29.39  ?  21   GLU A CB   1 
ATOM   355   C  CG   . GLU A  1 21 ? 28.550 69.195 35.834  1.00 34.96  ?  21   GLU A CG   1 
ATOM   356   C  CD   . GLU A  1 21 ? 27.807 69.329 37.151  1.00 41.90  ?  21   GLU A CD   1 
ATOM   357   O  OE1  . GLU A  1 21 ? 28.392 69.855 38.122  1.00 39.66  ?  21   GLU A OE1  1 
ATOM   358   O  OE2  . GLU A  1 21 ? 26.632 68.909 37.216  1.00 49.35  ?  21   GLU A OE2  1 
ATOM   359   H  H    . GLU A  1 21 ? 32.491 69.143 35.729  1.00 31.67  ?  21   GLU A H    1 
ATOM   360   H  HA   . GLU A  1 21 ? 30.539 68.268 34.244  1.00 31.25  ?  21   GLU A HA   1 
ATOM   361   H  HB2  . GLU A  1 21 ? 30.317 68.507 36.584  1.00 35.26  ?  21   GLU A HB2  1 
ATOM   362   H  HB3  . GLU A  1 21 ? 30.293 70.085 36.408  1.00 35.26  ?  21   GLU A HB3  1 
ATOM   363   H  HG2  . GLU A  1 21 ? 28.275 69.926 35.259  1.00 41.95  ?  21   GLU A HG2  1 
ATOM   364   H  HG3  . GLU A  1 21 ? 28.300 68.347 35.434  1.00 41.95  ?  21   GLU A HG3  1 
ATOM   365   N  N    . ARG A  1 22 ? 31.089 71.409 34.002  1.00 32.47  ?  22   ARG A N    1 
ATOM   366   C  CA   . ARG A  1 22 ? 30.822 72.616 33.229  1.00 36.99  ?  22   ARG A CA   1 
ATOM   367   C  C    . ARG A  1 22 ? 31.380 72.493 31.812  1.00 34.64  ?  22   ARG A C    1 
ATOM   368   O  O    . ARG A  1 22 ? 30.781 72.975 30.852  1.00 34.94  ?  22   ARG A O    1 
ATOM   369   C  CB   . ARG A  1 22 ? 31.424 73.828 33.941  1.00 41.56  ?  22   ARG A CB   1 
ATOM   370   C  CG   . ARG A  1 22 ? 31.433 75.104 33.121  1.00 46.63  ?  22   ARG A CG   1 
ATOM   371   C  CD   . ARG A  1 22 ? 31.488 76.332 34.020  1.00 51.71  ?  22   ARG A CD   1 
ATOM   372   N  NE   . ARG A  1 22 ? 32.263 76.089 35.235  1.00 51.53  ?  22   ARG A NE   1 
ATOM   373   C  CZ   . ARG A  1 22 ? 33.586 76.196 35.323  1.00 49.15  ?  22   ARG A CZ   1 
ATOM   374   N  NH1  . ARG A  1 22 ? 34.310 76.543 34.265  1.00 47.04  ?  22   ARG A NH1  1 
ATOM   375   N  NH2  . ARG A  1 22 ? 34.193 75.951 36.477  1.00 48.87  ?  22   ARG A NH2  1 
ATOM   376   H  H    . ARG A  1 22 ? 31.679 71.515 34.619  1.00 38.96  ?  22   ARG A H    1 
ATOM   377   H  HA   . ARG A  1 22 ? 29.853 72.749 33.165  1.00 44.39  ?  22   ARG A HA   1 
ATOM   378   H  HB2  . ARG A  1 22 ? 30.911 74.001 34.746  1.00 49.88  ?  22   ARG A HB2  1 
ATOM   379   H  HB3  . ARG A  1 22 ? 32.342 73.625 34.177  1.00 49.88  ?  22   ARG A HB3  1 
ATOM   380   H  HG2  . ARG A  1 22 ? 32.214 75.111 32.546  1.00 55.96  ?  22   ARG A HG2  1 
ATOM   381   H  HG3  . ARG A  1 22 ? 30.623 75.150 32.590  1.00 55.96  ?  22   ARG A HG3  1 
ATOM   382   H  HD2  . ARG A  1 22 ? 31.905 77.062 33.536  1.00 62.05  ?  22   ARG A HD2  1 
ATOM   383   H  HD3  . ARG A  1 22 ? 30.586 76.576 34.280  1.00 62.05  ?  22   ARG A HD3  1 
ATOM   384   H  HE   . ARG A  1 22 ? 31.833 75.861 35.943  1.00 61.84  ?  22   ARG A HE   1 
ATOM   385   H  HH11 . ARG A  1 22 ? 33.923 76.703 33.514  1.00 56.45  ?  22   ARG A HH11 1 
ATOM   386   H  HH12 . ARG A  1 22 ? 35.164 76.609 34.332  1.00 56.45  ?  22   ARG A HH12 1 
ATOM   387   H  HH21 . ARG A  1 22 ? 33.730 75.726 37.166  1.00 58.64  ?  22   ARG A HH21 1 
ATOM   388   H  HH22 . ARG A  1 22 ? 35.048 76.019 36.537  1.00 58.64  ?  22   ARG A HH22 1 
ATOM   389   N  N    . LEU A  1 23 ? 32.529 71.839 31.695  1.00 35.41  ?  23   LEU A N    1 
ATOM   390   C  CA   . LEU A  1 23 ? 33.164 71.615 30.404  1.00 34.25  ?  23   LEU A CA   1 
ATOM   391   C  C    . LEU A  1 23 ? 32.289 70.708 29.547  1.00 33.45  ?  23   LEU A C    1 
ATOM   392   O  O    . LEU A  1 23 ? 32.084 70.956 28.358  1.00 32.06  ?  23   LEU A O    1 
ATOM   393   C  CB   . LEU A  1 23 ? 34.531 70.967 30.619  1.00 33.48  ?  23   LEU A CB   1 
ATOM   394   C  CG   . LEU A  1 23 ? 35.597 71.140 29.539  1.00 35.00  ?  23   LEU A CG   1 
ATOM   395   C  CD1  . LEU A  1 23 ? 35.886 72.611 29.285  1.00 36.39  ?  23   LEU A CD1  1 
ATOM   396   C  CD2  . LEU A  1 23 ? 36.860 70.411 29.969  1.00 34.82  ?  23   LEU A CD2  1 
ATOM   397   H  H    . LEU A  1 23 ? 32.966 71.510 32.358  1.00 42.49  ?  23   LEU A H    1 
ATOM   398   H  HA   . LEU A  1 23 ? 33.287 72.470 29.940  1.00 41.10  ?  23   LEU A HA   1 
ATOM   399   H  HB2  . LEU A  1 23 ? 34.903 71.325 31.440  1.00 40.17  ?  23   LEU A HB2  1 
ATOM   400   H  HB3  . LEU A  1 23 ? 34.393 70.013 30.725  1.00 40.17  ?  23   LEU A HB3  1 
ATOM   401   H  HG   . LEU A  1 23 ? 35.283 70.744 28.712  1.00 42.00  ?  23   LEU A HG   1 
ATOM   402   H  HD11 . LEU A  1 23 ? 36.200 73.013 30.099  1.00 43.67  ?  23   LEU A HD11 1 
ATOM   403   H  HD12 . LEU A  1 23 ? 36.558 72.684 28.604  1.00 43.67  ?  23   LEU A HD12 1 
ATOM   404   H  HD13 . LEU A  1 23 ? 35.079 73.043 28.997  1.00 43.67  ?  23   LEU A HD13 1 
ATOM   405   H  HD21 . LEU A  1 23 ? 36.659 69.479 30.084  1.00 41.78  ?  23   LEU A HD21 1 
ATOM   406   H  HD22 . LEU A  1 23 ? 37.530 70.520 29.290  1.00 41.78  ?  23   LEU A HD22 1 
ATOM   407   H  HD23 . LEU A  1 23 ? 37.169 70.784 30.798  1.00 41.78  ?  23   LEU A HD23 1 
ATOM   408   N  N    . LYS A  1 24 ? 31.772 69.655 30.171  1.00 35.09  ?  24   LYS A N    1 
ATOM   409   C  CA   . LYS A  1 24 ? 30.930 68.679 29.495  1.00 38.13  ?  24   LYS A CA   1 
ATOM   410   C  C    . LYS A  1 24 ? 29.651 69.323 28.969  1.00 35.15  ?  24   LYS A C    1 
ATOM   411   O  O    . LYS A  1 24 ? 29.212 69.031 27.857  1.00 37.22  ?  24   LYS A O    1 
ATOM   412   C  CB   . LYS A  1 24 ? 30.591 67.544 30.462  1.00 44.45  ?  24   LYS A CB   1 
ATOM   413   C  CG   . LYS A  1 24 ? 29.986 66.310 29.812  1.00 50.44  ?  24   LYS A CG   1 
ATOM   414   C  CD   . LYS A  1 24 ? 29.909 65.145 30.795  1.00 55.02  ?  24   LYS A CD   1 
ATOM   415   C  CE   . LYS A  1 24 ? 31.294 64.734 31.286  1.00 55.63  ?  24   LYS A CE   1 
ATOM   416   N  NZ   . LYS A  1 24 ? 31.270 63.475 32.086  1.00 57.20  ?  24   LYS A NZ   1 
ATOM   417   H  H    . LYS A  1 24 ? 31.897 69.483 31.005  1.00 42.11  ?  24   LYS A H    1 
ATOM   418   H  HA   . LYS A  1 24 ? 31.420 68.300 28.735  1.00 45.76  ?  24   LYS A HA   1 
ATOM   419   H  HB2  . LYS A  1 24 ? 31.404 67.268 30.913  1.00 53.34  ?  24   LYS A HB2  1 
ATOM   420   H  HB3  . LYS A  1 24 ? 29.953 67.874 31.114  1.00 53.34  ?  24   LYS A HB3  1 
ATOM   421   H  HG2  . LYS A  1 24 ? 29.086 66.514 29.511  1.00 60.53  ?  24   LYS A HG2  1 
ATOM   422   H  HG3  . LYS A  1 24 ? 30.538 66.039 29.062  1.00 60.53  ?  24   LYS A HG3  1 
ATOM   423   H  HD2  . LYS A  1 24 ? 29.380 65.409 31.564  1.00 66.03  ?  24   LYS A HD2  1 
ATOM   424   H  HD3  . LYS A  1 24 ? 29.503 64.381 30.356  1.00 66.03  ?  24   LYS A HD3  1 
ATOM   425   H  HE2  . LYS A  1 24 ? 31.872 64.592 30.520  1.00 66.75  ?  24   LYS A HE2  1 
ATOM   426   H  HE3  . LYS A  1 24 ? 31.653 65.439 31.847  1.00 66.75  ?  24   LYS A HE3  1 
ATOM   427   H  HZ1  . LYS A  1 24 ? 30.951 62.807 31.592  1.00 68.64  ?  24   LYS A HZ1  1 
ATOM   428   H  HZ2  . LYS A  1 24 ? 32.094 63.269 32.353  1.00 68.64  ?  24   LYS A HZ2  1 
ATOM   429   H  HZ3  . LYS A  1 24 ? 30.752 63.579 32.802  1.00 68.64  ?  24   LYS A HZ3  1 
ATOM   430   N  N    . ALA A  1 25 ? 29.060 70.202 29.772  1.00 28.24  ?  25   ALA A N    1 
ATOM   431   C  CA   . ALA A  1 25 ? 27.825 70.878 29.392  1.00 28.57  ?  25   ALA A CA   1 
ATOM   432   C  C    . ALA A  1 25 ? 28.076 71.901 28.288  1.00 28.94  ?  25   ALA A C    1 
ATOM   433   O  O    . ALA A  1 25 ? 27.236 72.095 27.409  1.00 29.86  ?  25   ALA A O    1 
ATOM   434   C  CB   . ALA A  1 25 ? 27.192 71.548 30.606  1.00 30.78  ?  25   ALA A CB   1 
ATOM   435   H  H    . ALA A  1 25 ? 29.357 70.426 30.547  1.00 33.88  ?  25   ALA A H    1 
ATOM   436   H  HA   . ALA A  1 25 ? 27.192 70.213 29.049  1.00 34.29  ?  25   ALA A HA   1 
ATOM   437   H  HB1  . ALA A  1 25 ? 27.808 72.191 30.964  1.00 36.93  ?  25   ALA A HB1  1 
ATOM   438   H  HB2  . ALA A  1 25 ? 26.382 71.985 30.333  1.00 36.93  ?  25   ALA A HB2  1 
ATOM   439   H  HB3  . ALA A  1 25 ? 26.997 70.878 31.265  1.00 36.93  ?  25   ALA A HB3  1 
ATOM   440   N  N    . SER A  1 26 ? 29.233 72.553 28.336  1.00 29.94  ?  26   SER A N    1 
ATOM   441   C  CA   . SER A  1 26 ? 29.613 73.511 27.303  1.00 32.10  ?  26   SER A CA   1 
ATOM   442   C  C    . SER A  1 26 ? 29.790 72.808 25.962  1.00 28.88  ?  26   SER A C    1 
ATOM   443   O  O    . SER A  1 26 ? 29.276 73.265 24.940  1.00 29.86  ?  26   SER A O    1 
ATOM   444   C  CB   . SER A  1 26 ? 30.909 74.230 27.683  1.00 34.78  ?  26   SER A CB   1 
ATOM   445   O  OG   . SER A  1 26 ? 30.704 75.117 28.768  1.00 39.74  ?  26   SER A OG   1 
ATOM   446   H  H    . SER A  1 26 ? 29.819 72.459 28.959  1.00 35.93  ?  26   SER A H    1 
ATOM   447   H  HA   . SER A  1 26 ? 28.905 74.182 27.208  1.00 38.52  ?  26   SER A HA   1 
ATOM   448   H  HB2  . SER A  1 26 ? 31.572 73.569 27.938  1.00 41.73  ?  26   SER A HB2  1 
ATOM   449   H  HB3  . SER A  1 26 ? 31.225 74.735 26.918  1.00 41.73  ?  26   SER A HB3  1 
ATOM   450   H  HG   . SER A  1 26 ? 29.920 75.092 29.006  1.00 47.68  ?  26   SER A HG   1 
ATOM   451   N  N    . ALA A  1 27 ? 30.521 71.697 25.973  1.00 26.83  ?  27   ALA A N    1 
ATOM   452   C  CA   . ALA A  1 27 ? 30.773 70.929 24.757  1.00 25.08  ?  27   ALA A CA   1 
ATOM   453   C  C    . ALA A  1 27 ? 29.466 70.435 24.150  1.00 28.75  ?  27   ALA A C    1 
ATOM   454   O  O    . ALA A  1 27 ? 29.244 70.558 22.948  1.00 27.66  ?  27   ALA A O    1 
ATOM   455   C  CB   . ALA A  1 27 ? 31.692 69.756 25.054  1.00 22.43  ?  27   ALA A CB   1 
ATOM   456   H  H    . ALA A  1 27 ? 30.886 71.364 26.677  1.00 32.20  ?  27   ALA A H    1 
ATOM   457   H  HA   . ALA A  1 27 ? 31.216 71.505 24.099  1.00 30.09  ?  27   ALA A HA   1 
ATOM   458   H  HB1  . ALA A  1 27 ? 31.274 69.189 25.706  1.00 26.92  ?  27   ALA A HB1  1 
ATOM   459   H  HB2  . ALA A  1 27 ? 31.845 69.266 24.243  1.00 26.92  ?  27   ALA A HB2  1 
ATOM   460   H  HB3  . ALA A  1 27 ? 32.525 70.091 25.396  1.00 26.92  ?  27   ALA A HB3  1 
ATOM   461   N  N    . LYS A  1 28 ? 28.601 69.876 24.988  1.00 29.29  ?  28   LYS A N    1 
ATOM   462   C  CA   . LYS A  1 28 ? 27.321 69.358 24.523  1.00 32.77  ?  28   LYS A CA   1 
ATOM   463   C  C    . LYS A  1 28 ? 26.514 70.459 23.838  1.00 32.62  ?  28   LYS A C    1 
ATOM   464   O  O    . LYS A  1 28 ? 25.922 70.240 22.782  1.00 32.93  ?  28   LYS A O    1 
ATOM   465   C  CB   . LYS A  1 28 ? 26.534 68.762 25.692  1.00 35.94  ?  28   LYS A CB   1 
ATOM   466   C  CG   . LYS A  1 28 ? 25.185 68.177 25.307  1.00 39.63  ?  28   LYS A CG   1 
ATOM   467   C  CD   . LYS A  1 28 ? 24.617 67.319 26.427  1.00 43.24  ?  28   LYS A CD   1 
ATOM   468   C  CE   . LYS A  1 28 ? 23.235 66.792 26.082  1.00 49.64  ?  28   LYS A CE   1 
ATOM   469   N  NZ   . LYS A  1 28 ? 22.748 65.804 27.085  1.00 54.08  ?  28   LYS A NZ   1 
ATOM   470   H  H    . LYS A  1 28 ? 28.733 69.784 25.833  1.00 35.14  ?  28   LYS A H    1 
ATOM   471   H  HA   . LYS A  1 28 ? 27.481 68.646 23.869  1.00 39.32  ?  28   LYS A HA   1 
ATOM   472   H  HB2  . LYS A  1 28 ? 27.060 68.051 26.090  1.00 43.13  ?  28   LYS A HB2  1 
ATOM   473   H  HB3  . LYS A  1 28 ? 26.376 69.459 26.348  1.00 43.13  ?  28   LYS A HB3  1 
ATOM   474   H  HG2  . LYS A  1 28 ? 24.561 68.899 25.129  1.00 47.55  ?  28   LYS A HG2  1 
ATOM   475   H  HG3  . LYS A  1 28 ? 25.289 67.621 24.519  1.00 47.55  ?  28   LYS A HG3  1 
ATOM   476   H  HD2  . LYS A  1 28 ? 25.203 66.561 26.577  1.00 51.89  ?  28   LYS A HD2  1 
ATOM   477   H  HD3  . LYS A  1 28 ? 24.546 67.853 27.234  1.00 51.89  ?  28   LYS A HD3  1 
ATOM   478   H  HE2  . LYS A  1 28 ? 22.609 67.532 26.058  1.00 59.57  ?  28   LYS A HE2  1 
ATOM   479   H  HE3  . LYS A  1 28 ? 23.268 66.354 25.218  1.00 59.57  ?  28   LYS A HE3  1 
ATOM   480   H  HZ1  . LYS A  1 28 ? 22.703 66.184 27.889  1.00 64.90  ?  28   LYS A HZ1  1 
ATOM   481   H  HZ2  . LYS A  1 28 ? 21.938 65.514 26.857  1.00 64.90  ?  28   LYS A HZ2  1 
ATOM   482   H  HZ3  . LYS A  1 28 ? 23.304 65.110 27.123  1.00 64.90  ?  28   LYS A HZ3  1 
ATOM   483   N  N    . ALA A  1 29 ? 26.502 71.644 24.439  1.00 30.08  ?  29   ALA A N    1 
ATOM   484   C  CA   . ALA A  1 29 ? 25.783 72.781 23.876  1.00 31.42  ?  29   ALA A CA   1 
ATOM   485   C  C    . ALA A  1 29 ? 26.407 73.220 22.555  1.00 29.95  ?  29   ALA A C    1 
ATOM   486   O  O    . ALA A  1 29 ? 25.702 73.485 21.582  1.00 31.28  ?  29   ALA A O    1 
ATOM   487   C  CB   . ALA A  1 29 ? 25.772 73.940 24.863  1.00 32.34  ?  29   ALA A CB   1 
ATOM   488   H  H    . ALA A  1 29 ? 26.906 71.816 25.178  1.00 36.10  ?  29   ALA A H    1 
ATOM   489   H  HA   . ALA A  1 29 ? 24.854 72.519 23.702  1.00 37.70  ?  29   ALA A HA   1 
ATOM   490   H  HB1  . ALA A  1 29 ? 26.677 74.199 25.051  1.00 38.80  ?  29   ALA A HB1  1 
ATOM   491   H  HB2  . ALA A  1 29 ? 25.294 74.677 24.475  1.00 38.80  ?  29   ALA A HB2  1 
ATOM   492   H  HB3  . ALA A  1 29 ? 25.337 73.658 25.671  1.00 38.80  ?  29   ALA A HB3  1 
ATOM   493   N  N    . ARG A  1 30 ? 27.733 73.298 22.529  1.00 30.58  ?  30   ARG A N    1 
ATOM   494   C  CA   . ARG A  1 30 ? 28.448 73.741 21.339  1.00 30.08  ?  30   ARG A CA   1 
ATOM   495   C  C    . ARG A  1 30 ? 28.218 72.781 20.175  1.00 29.02  ?  30   ARG A C    1 
ATOM   496   O  O    . ARG A  1 30 ? 27.983 73.208 19.043  1.00 28.61  ?  30   ARG A O    1 
ATOM   497   C  CB   . ARG A  1 30 ? 29.944 73.865 21.636  1.00 29.18  ?  30   ARG A CB   1 
ATOM   498   C  CG   . ARG A  1 30 ? 30.793 74.263 20.440  1.00 29.84  ?  30   ARG A CG   1 
ATOM   499   C  CD   . ARG A  1 30 ? 30.287 75.538 19.782  1.00 33.40  ?  30   ARG A CD   1 
ATOM   500   N  NE   . ARG A  1 30 ? 31.260 76.080 18.837  1.00 33.35  ?  30   ARG A NE   1 
ATOM   501   C  CZ   . ARG A  1 30 ? 30.957 76.834 17.784  1.00 34.37  ?  30   ARG A CZ   1 
ATOM   502   N  NH1  . ARG A  1 30 ? 29.697 77.148 17.513  1.00 36.98  ?  30   ARG A NH1  1 
ATOM   503   N  NH2  . ARG A  1 30 ? 31.923 77.274 16.991  1.00 32.93  ?  30   ARG A NH2  1 
ATOM   504   H  H    . ARG A  1 30 ? 28.244 73.099 23.192  1.00 36.70  ?  30   ARG A H    1 
ATOM   505   H  HA   . ARG A  1 30 ? 28.115 74.624 21.075  1.00 36.10  ?  30   ARG A HA   1 
ATOM   506   H  HB2  . ARG A  1 30 ? 30.069 74.539 22.322  1.00 35.02  ?  30   ARG A HB2  1 
ATOM   507   H  HB3  . ARG A  1 30 ? 30.269 73.009 21.956  1.00 35.02  ?  30   ARG A HB3  1 
ATOM   508   H  HG2  . ARG A  1 30 ? 31.705 74.415 20.733  1.00 35.81  ?  30   ARG A HG2  1 
ATOM   509   H  HG3  . ARG A  1 30 ? 30.768 73.552 19.780  1.00 35.81  ?  30   ARG A HG3  1 
ATOM   510   H  HD2  . ARG A  1 30 ? 29.469 75.344 19.298  1.00 40.08  ?  30   ARG A HD2  1 
ATOM   511   H  HD3  . ARG A  1 30 ? 30.122 76.206 20.465  1.00 40.08  ?  30   ARG A HD3  1 
ATOM   512   H  HE   . ARG A  1 30 ? 32.090 75.898 18.972  1.00 40.02  ?  30   ARG A HE   1 
ATOM   513   H  HH11 . ARG A  1 30 ? 29.064 76.866 18.022  1.00 44.38  ?  30   ARG A HH11 1 
ATOM   514   H  HH12 . ARG A  1 30 ? 29.512 77.635 16.828  1.00 44.38  ?  30   ARG A HH12 1 
ATOM   515   H  HH21 . ARG A  1 30 ? 32.743 77.074 17.160  1.00 39.52  ?  30   ARG A HH21 1 
ATOM   516   H  HH22 . ARG A  1 30 ? 31.731 77.760 16.308  1.00 39.52  ?  30   ARG A HH22 1 
ATOM   517   N  N    . SER A  1 31 ? 28.282 71.483 20.457  1.00 29.35  ?  31   SER A N    1 
ATOM   518   C  CA   . SER A  1 31 ? 28.098 70.478 19.419  1.00 30.31  ?  31   SER A CA   1 
ATOM   519   C  C    . SER A  1 31 ? 26.656 70.454 18.914  1.00 32.09  ?  31   SER A C    1 
ATOM   520   O  O    . SER A  1 31 ? 26.420 70.240 17.725  1.00 30.60  ?  31   SER A O    1 
ATOM   521   C  CB   . SER A  1 31 ? 28.520 69.091 19.915  1.00 31.78  ?  31   SER A CB   1 
ATOM   522   O  OG   . SER A  1 31 ? 27.781 68.689 21.056  1.00 36.13  ?  31   SER A OG   1 
ATOM   523   H  H    . SER A  1 31 ? 28.431 71.161 21.241  1.00 35.22  ?  31   SER A H    1 
ATOM   524   H  HA   . SER A  1 31 ? 28.673 70.707 18.660  1.00 36.38  ?  31   SER A HA   1 
ATOM   525   H  HB2  . SER A  1 31 ? 28.372 68.447 19.205  1.00 38.14  ?  31   SER A HB2  1 
ATOM   526   H  HB3  . SER A  1 31 ? 29.462 69.115 20.146  1.00 38.14  ?  31   SER A HB3  1 
ATOM   527   H  HG   . SER A  1 31 ? 27.244 69.274 21.263  1.00 43.35  ?  31   SER A HG   1 
ATOM   528   N  N    . ARG A  1 32 ? 25.693 70.679 19.804  1.00 30.86  ?  32   ARG A N    1 
ATOM   529   C  CA   . ARG A  1 32 ? 24.296 70.719 19.389  1.00 35.71  ?  32   ARG A CA   1 
ATOM   530   C  C    . ARG A  1 32 ? 24.126 71.783 18.316  1.00 35.37  ?  32   ARG A C    1 
ATOM   531   O  O    . ARG A  1 32 ? 23.506 71.543 17.281  1.00 37.75  ?  32   ARG A O    1 
ATOM   532   C  CB   . ARG A  1 32 ? 23.369 71.017 20.568  1.00 41.60  ?  32   ARG A CB   1 
ATOM   533   C  CG   . ARG A  1 32 ? 21.975 71.462 20.140  1.00 48.61  ?  32   ARG A CG   1 
ATOM   534   C  CD   . ARG A  1 32 ? 21.000 71.521 21.310  1.00 54.29  ?  32   ARG A CD   1 
ATOM   535   N  NE   . ARG A  1 32 ? 20.470 70.202 21.648  1.00 57.01  ?  32   ARG A NE   1 
ATOM   536   C  CZ   . ARG A  1 32 ? 19.438 69.625 21.037  1.00 61.19  ?  32   ARG A CZ   1 
ATOM   537   N  NH1  . ARG A  1 32 ? 18.810 70.242 20.043  1.00 64.41  ?  32   ARG A NH1  1 
ATOM   538   N  NH2  . ARG A  1 32 ? 19.032 68.422 21.417  1.00 61.29  ?  32   ARG A NH2  1 
ATOM   539   H  H    . ARG A  1 32 ? 25.821 70.810 20.645  1.00 37.04  ?  32   ARG A H    1 
ATOM   540   H  HA   . ARG A  1 32 ? 24.044 69.852 19.008  1.00 42.85  ?  32   ARG A HA   1 
ATOM   541   H  HB2  . ARG A  1 32 ? 23.274 70.214 21.104  1.00 49.92  ?  32   ARG A HB2  1 
ATOM   542   H  HB3  . ARG A  1 32 ? 23.758 71.727 21.102  1.00 49.92  ?  32   ARG A HB3  1 
ATOM   543   H  HG2  . ARG A  1 32 ? 22.031 72.349 19.750  1.00 58.33  ?  32   ARG A HG2  1 
ATOM   544   H  HG3  . ARG A  1 32 ? 21.627 70.833 19.489  1.00 58.33  ?  32   ARG A HG3  1 
ATOM   545   H  HD2  . ARG A  1 32 ? 21.459 71.871 22.089  1.00 65.15  ?  32   ARG A HD2  1 
ATOM   546   H  HD3  . ARG A  1 32 ? 20.255 72.095 21.075  1.00 65.15  ?  32   ARG A HD3  1 
ATOM   547   H  HE   . ARG A  1 32 ? 20.850 69.769 22.286  1.00 68.42  ?  32   ARG A HE   1 
ATOM   548   H  HH11 . ARG A  1 32 ? 19.067 71.022 19.790  1.00 77.29  ?  32   ARG A HH11 1 
ATOM   549   H  HH12 . ARG A  1 32 ? 18.144 69.861 19.653  1.00 77.29  ?  32   ARG A HH12 1 
ATOM   550   H  HH21 . ARG A  1 32 ? 19.434 68.016 22.060  1.00 73.55  ?  32   ARG A HH21 1 
ATOM   551   H  HH22 . ARG A  1 32 ? 18.365 68.048 21.022  1.00 73.55  ?  32   ARG A HH22 1 
ATOM   552   N  N    . THR A  1 33 ? 24.694 72.956 18.570  1.00 32.99  ?  33   THR A N    1 
ATOM   553   C  CA   . THR A  1 33 ? 24.614 74.066 17.630  1.00 33.48  ?  33   THR A CA   1 
ATOM   554   C  C    . THR A  1 33 ? 25.205 73.662 16.284  1.00 31.18  ?  33   THR A C    1 
ATOM   555   O  O    . THR A  1 33 ? 24.573 73.827 15.242  1.00 32.50  ?  33   THR A O    1 
ATOM   556   C  CB   . THR A  1 33 ? 25.372 75.305 18.150  1.00 33.94  ?  33   THR A CB   1 
ATOM   557   O  OG1  . THR A  1 33 ? 24.850 75.698 19.425  1.00 35.41  ?  33   THR A OG1  1 
ATOM   558   C  CG2  . THR A  1 33 ? 25.232 76.465 17.175  1.00 35.44  ?  33   THR A CG2  1 
ATOM   559   H  H    . THR A  1 33 ? 25.135 73.136 19.286  1.00 39.59  ?  33   THR A H    1 
ATOM   560   H  HA   . THR A  1 33 ? 23.675 74.312 17.495  1.00 40.18  ?  33   THR A HA   1 
ATOM   561   H  HB   . THR A  1 33 ? 26.314 75.092 18.239  1.00 40.73  ?  33   THR A HB   1 
ATOM   562   H  HG1  . THR A  1 33 ? 24.937 75.086 19.965  1.00 42.50  ?  33   THR A HG1  1 
ATOM   563   H  HG21 . THR A  1 33 ? 24.306 76.694 17.069  1.00 42.53  ?  33   THR A HG21 1 
ATOM   564   H  HG22 . THR A  1 33 ? 25.707 77.230 17.507  1.00 42.53  ?  33   THR A HG22 1 
ATOM   565   H  HG23 . THR A  1 33 ? 25.593 76.220 16.320  1.00 42.53  ?  33   THR A HG23 1 
ATOM   566   N  N    . LEU A  1 34 ? 26.419 73.121 16.318  1.00 32.70  ?  34   LEU A N    1 
ATOM   567   C  CA   . LEU A  1 34 ? 27.146 72.772 15.102  1.00 29.03  ?  34   LEU A CA   1 
ATOM   568   C  C    . LEU A  1 34 ? 26.452 71.671 14.297  1.00 28.79  ?  34   LEU A C    1 
ATOM   569   O  O    . LEU A  1 34 ? 26.512 71.669 13.066  1.00 27.23  ?  34   LEU A O    1 
ATOM   570   C  CB   . LEU A  1 34 ? 28.578 72.358 15.450  1.00 25.79  ?  34   LEU A CB   1 
ATOM   571   C  CG   . LEU A  1 34 ? 29.471 73.508 15.925  1.00 25.42  ?  34   LEU A CG   1 
ATOM   572   C  CD1  . LEU A  1 34 ? 30.694 72.985 16.658  1.00 24.08  ?  34   LEU A CD1  1 
ATOM   573   C  CD2  . LEU A  1 34 ? 29.891 74.378 14.747  1.00 26.94  ?  34   LEU A CD2  1 
ATOM   574   H  H    . LEU A  1 34 ? 26.848 72.944 17.042  1.00 39.23  ?  34   LEU A H    1 
ATOM   575   H  HA   . LEU A  1 34 ? 27.197 73.567 14.531  1.00 34.84  ?  34   LEU A HA   1 
ATOM   576   H  HB2  . LEU A  1 34 ? 28.547 71.698 16.159  1.00 30.94  ?  34   LEU A HB2  1 
ATOM   577   H  HB3  . LEU A  1 34 ? 28.990 71.972 14.661  1.00 30.94  ?  34   LEU A HB3  1 
ATOM   578   H  HG   . LEU A  1 34 ? 28.968 74.063 16.541  1.00 30.51  ?  34   LEU A HG   1 
ATOM   579   H  HD11 . LEU A  1 34 ? 31.198 72.425 16.063  1.00 28.89  ?  34   LEU A HD11 1 
ATOM   580   H  HD12 . LEU A  1 34 ? 31.231 73.729 16.941  1.00 28.89  ?  34   LEU A HD12 1 
ATOM   581   H  HD13 . LEU A  1 34 ? 30.407 72.478 17.421  1.00 28.89  ?  34   LEU A HD13 1 
ATOM   582   H  HD21 . LEU A  1 34 ? 29.106 74.740 14.330  1.00 32.33  ?  34   LEU A HD21 1 
ATOM   583   H  HD22 . LEU A  1 34 ? 30.449 75.091 15.069  1.00 32.33  ?  34   LEU A HD22 1 
ATOM   584   H  HD23 . LEU A  1 34 ? 30.378 73.839 14.119  1.00 32.33  ?  34   LEU A HD23 1 
ATOM   585   N  N    . GLN A  1 35 ? 25.798 70.742 14.987  1.00 29.57  ?  35   GLN A N    1 
ATOM   586   C  CA   . GLN A  1 35 ? 25.061 69.675 14.317  1.00 31.01  ?  35   GLN A CA   1 
ATOM   587   C  C    . GLN A  1 35 ? 23.791 70.217 13.671  1.00 34.57  ?  35   GLN A C    1 
ATOM   588   O  O    . GLN A  1 35 ? 23.433 69.824 12.562  1.00 34.11  ?  35   GLN A O    1 
ATOM   589   C  CB   . GLN A  1 35 ? 24.696 68.565 15.305  1.00 30.93  ?  35   GLN A CB   1 
ATOM   590   C  CG   . GLN A  1 35 ? 25.884 67.791 15.844  1.00 27.14  ?  35   GLN A CG   1 
ATOM   591   C  CD   . GLN A  1 35 ? 25.489 66.814 16.930  1.00 26.94  ?  35   GLN A CD   1 
ATOM   592   O  OE1  . GLN A  1 35 ? 24.899 65.772 16.655  1.00 28.35  ?  35   GLN A OE1  1 
ATOM   593   N  NE2  . GLN A  1 35 ? 25.804 67.152 18.176  1.00 25.67  ?  35   GLN A NE2  1 
ATOM   594   H  H    . GLN A  1 35 ? 25.766 70.706 15.846  1.00 35.48  ?  35   GLN A H    1 
ATOM   595   H  HA   . GLN A  1 35 ? 25.622 69.287 13.614  1.00 37.21  ?  35   GLN A HA   1 
ATOM   596   H  HB2  . GLN A  1 35 ? 24.235 68.962 16.061  1.00 37.11  ?  35   GLN A HB2  1 
ATOM   597   H  HB3  . GLN A  1 35 ? 24.110 67.933 14.860  1.00 37.11  ?  35   GLN A HB3  1 
ATOM   598   H  HG2  . GLN A  1 35 ? 26.290 67.289 15.120  1.00 32.56  ?  35   GLN A HG2  1 
ATOM   599   H  HG3  . GLN A  1 35 ? 26.526 68.414 16.218  1.00 32.56  ?  35   GLN A HG3  1 
ATOM   600   H  HE21 . GLN A  1 35 ? 26.212 67.893 18.330  1.00 30.81  ?  35   GLN A HE21 1 
ATOM   601   H  HE22 . GLN A  1 35 ? 25.600 66.629 18.827  1.00 30.81  ?  35   GLN A HE22 1 
ATOM   602   N  N    . GLU A  1 36 ? 23.112 71.118 14.373  1.00 31.31  ?  36   GLU A N    1 
ATOM   603   C  CA   . GLU A  1 36 ? 21.885 71.722 13.863  1.00 35.96  ?  36   GLU A CA   1 
ATOM   604   C  C    . GLU A  1 36 ? 22.162 72.607 12.651  1.00 37.56  ?  36   GLU A C    1 
ATOM   605   O  O    . GLU A  1 36 ? 21.287 72.812 11.813  1.00 39.18  ?  36   GLU A O    1 
ATOM   606   C  CB   . GLU A  1 36 ? 21.199 72.532 14.963  1.00 39.78  ?  36   GLU A CB   1 
ATOM   607   C  CG   . GLU A  1 36 ? 20.563 71.672 16.043  1.00 42.80  ?  36   GLU A CG   1 
ATOM   608   C  CD   . GLU A  1 36 ? 20.021 72.487 17.201  1.00 47.34  ?  36   GLU A CD   1 
ATOM   609   O  OE1  . GLU A  1 36 ? 20.336 73.694 17.284  1.00 49.47  ?  36   GLU A OE1  1 
ATOM   610   O  OE2  . GLU A  1 36 ? 19.278 71.918 18.028  1.00 48.53  ?  36   GLU A OE2  1 
ATOM   611   H  H    . GLU A  1 36 ? 23.342 71.398 15.152  1.00 37.57  ?  36   GLU A H    1 
ATOM   612   H  HA   . GLU A  1 36 ? 21.271 71.010 13.584  1.00 43.15  ?  36   GLU A HA   1 
ATOM   613   H  HB2  . GLU A  1 36 ? 21.857 73.105 15.387  1.00 47.73  ?  36   GLU A HB2  1 
ATOM   614   H  HB3  . GLU A  1 36 ? 20.500 73.073 14.564  1.00 47.73  ?  36   GLU A HB3  1 
ATOM   615   H  HG2  . GLU A  1 36 ? 19.826 71.174 15.657  1.00 51.36  ?  36   GLU A HG2  1 
ATOM   616   H  HG3  . GLU A  1 36 ? 21.230 71.061 16.393  1.00 51.36  ?  36   GLU A HG3  1 
ATOM   617   N  N    . GLN A  1 37 ? 23.382 73.127 12.562  1.00 39.84  ?  37   GLN A N    1 
ATOM   618   C  CA   . GLN A  1 37 ? 23.775 73.949 11.423  1.00 41.69  ?  37   GLN A CA   1 
ATOM   619   C  C    . GLN A  1 37 ? 24.280 73.082 10.276  1.00 41.84  ?  37   GLN A C    1 
ATOM   620   O  O    . GLN A  1 37 ? 24.425 73.553 9.148   1.00 42.32  ?  37   GLN A O    1 
ATOM   621   C  CB   . GLN A  1 37 ? 24.844 74.962 11.835  1.00 42.26  ?  37   GLN A CB   1 
ATOM   622   C  CG   . GLN A  1 37 ? 24.318 76.063 12.739  1.00 45.53  ?  37   GLN A CG   1 
ATOM   623   C  CD   . GLN A  1 37 ? 25.399 77.031 13.170  1.00 46.80  ?  37   GLN A CD   1 
ATOM   624   O  OE1  . GLN A  1 37 ? 26.582 76.686 13.204  1.00 46.39  ?  37   GLN A OE1  1 
ATOM   625   N  NE2  . GLN A  1 37 ? 24.999 78.255 13.498  1.00 49.08  ?  37   GLN A NE2  1 
ATOM   626   H  H    . GLN A  1 37 ? 24.001 73.018 13.148  1.00 47.81  ?  37   GLN A H    1 
ATOM   627   H  HA   . GLN A  1 37 ? 22.994 74.447 11.104  1.00 50.03  ?  37   GLN A HA   1 
ATOM   628   H  HB2  . GLN A  1 37 ? 25.549 74.497 12.311  1.00 50.72  ?  37   GLN A HB2  1 
ATOM   629   H  HB3  . GLN A  1 37 ? 25.205 75.379 11.037  1.00 50.72  ?  37   GLN A HB3  1 
ATOM   630   H  HG2  . GLN A  1 37 ? 23.638 76.565 12.264  1.00 54.64  ?  37   GLN A HG2  1 
ATOM   631   H  HG3  . GLN A  1 37 ? 23.939 75.663 13.537  1.00 54.64  ?  37   GLN A HG3  1 
ATOM   632   H  HE21 . GLN A  1 37 ? 24.165 78.460 13.459  1.00 58.90  ?  37   GLN A HE21 1 
ATOM   633   H  HE22 . GLN A  1 37 ? 25.574 78.843 13.749  1.00 58.90  ?  37   GLN A HE22 1 
ATOM   634   N  N    . GLY A  1 38 ? 24.547 71.812 10.569  1.00 32.21  ?  38   GLY A N    1 
ATOM   635   C  CA   . GLY A  1 38 ? 24.929 70.855 9.546   1.00 32.26  ?  38   GLY A CA   1 
ATOM   636   C  C    . GLY A  1 38 ? 26.427 70.739 9.337   1.00 30.56  ?  38   GLY A C    1 
ATOM   637   O  O    . GLY A  1 38 ? 26.880 69.957 8.500   1.00 30.30  ?  38   GLY A O    1 
ATOM   638   H  H    . GLY A  1 38 ? 24.512 71.481 11.362  1.00 38.66  ?  38   GLY A H    1 
ATOM   639   H  HA2  . GLY A  1 38 ? 24.589 69.980 9.788   1.00 38.71  ?  38   GLY A HA2  1 
ATOM   640   H  HA3  . GLY A  1 38 ? 24.526 71.114 8.703   1.00 38.71  ?  38   GLY A HA3  1 
ATOM   641   N  N    . GLN A  1 39 ? 27.200 71.510 10.095  1.00 30.49  ?  39   GLN A N    1 
ATOM   642   C  CA   . GLN A  1 39 ? 28.653 71.495 9.965   1.00 30.93  ?  39   GLN A CA   1 
ATOM   643   C  C    . GLN A  1 39 ? 29.264 70.294 10.679  1.00 30.94  ?  39   GLN A C    1 
ATOM   644   O  O    . GLN A  1 39 ? 30.273 69.747 10.236  1.00 32.75  ?  39   GLN A O    1 
ATOM   645   C  CB   . GLN A  1 39 ? 29.248 72.796 10.502  1.00 31.58  ?  39   GLN A CB   1 
ATOM   646   C  CG   . GLN A  1 39 ? 28.957 74.003 9.628   1.00 33.68  ?  39   GLN A CG   1 
ATOM   647   C  CD   . GLN A  1 39 ? 29.476 75.292 10.228  1.00 36.85  ?  39   GLN A CD   1 
ATOM   648   O  OE1  . GLN A  1 39 ? 29.186 75.613 11.382  1.00 39.04  ?  39   GLN A OE1  1 
ATOM   649   N  NE2  . GLN A  1 39 ? 30.256 76.037 9.450   1.00 38.31  ?  39   GLN A NE2  1 
ATOM   650   H  H    . GLN A  1 39 ? 26.906 72.052 10.695  1.00 36.59  ?  39   GLN A H    1 
ATOM   651   H  HA   . GLN A  1 39 ? 28.884 71.429 9.015   1.00 37.12  ?  39   GLN A HA   1 
ATOM   652   H  HB2  . GLN A  1 39 ? 28.879 72.970 11.382  1.00 37.90  ?  39   GLN A HB2  1 
ATOM   653   H  HB3  . GLN A  1 39 ? 30.211 72.698 10.563  1.00 37.90  ?  39   GLN A HB3  1 
ATOM   654   H  HG2  . GLN A  1 39 ? 29.383 73.880 8.765   1.00 40.42  ?  39   GLN A HG2  1 
ATOM   655   H  HG3  . GLN A  1 39 ? 27.997 74.089 9.516   1.00 40.42  ?  39   GLN A HG3  1 
ATOM   656   H  HE21 . GLN A  1 39 ? 30.440 75.777 8.651   1.00 45.97  ?  39   GLN A HE21 1 
ATOM   657   H  HE22 . GLN A  1 39 ? 30.576 76.779 9.745   1.00 45.97  ?  39   GLN A HE22 1 
ATOM   658   N  N    . TRP A  1 40 ? 28.654 69.896 11.791  1.00 26.93  ?  40   TRP A N    1 
ATOM   659   C  CA   . TRP A  1 40 ? 29.029 68.669 12.481  1.00 27.19  ?  40   TRP A CA   1 
ATOM   660   C  C    . TRP A  1 40 ? 28.015 67.603 12.082  1.00 27.93  ?  40   TRP A C    1 
ATOM   661   O  O    . TRP A  1 40 ? 26.994 67.424 12.747  1.00 27.78  ?  40   TRP A O    1 
ATOM   662   C  CB   . TRP A  1 40 ? 29.022 68.897 13.994  1.00 26.58  ?  40   TRP A CB   1 
ATOM   663   C  CG   . TRP A  1 40 ? 29.803 67.890 14.791  1.00 25.35  ?  40   TRP A CG   1 
ATOM   664   C  CD1  . TRP A  1 40 ? 30.012 66.578 14.484  1.00 23.34  ?  40   TRP A CD1  1 
ATOM   665   C  CD2  . TRP A  1 40 ? 30.483 68.125 16.031  1.00 24.43  ?  40   TRP A CD2  1 
ATOM   666   N  NE1  . TRP A  1 40 ? 30.777 65.980 15.459  1.00 22.87  ?  40   TRP A NE1  1 
ATOM   667   C  CE2  . TRP A  1 40 ? 31.080 66.910 16.418  1.00 24.07  ?  40   TRP A CE2  1 
ATOM   668   C  CE3  . TRP A  1 40 ? 30.643 69.247 16.852  1.00 24.25  ?  40   TRP A CE3  1 
ATOM   669   C  CZ2  . TRP A  1 40 ? 31.825 66.785 17.591  1.00 24.36  ?  40   TRP A CZ2  1 
ATOM   670   C  CZ3  . TRP A  1 40 ? 31.384 69.121 18.012  1.00 23.85  ?  40   TRP A CZ3  1 
ATOM   671   C  CH2  . TRP A  1 40 ? 31.964 67.899 18.372  1.00 24.30  ?  40   TRP A CH2  1 
ATOM   672   H  H    . TRP A  1 40 ? 28.012 70.326 12.169  1.00 32.32  ?  40   TRP A H    1 
ATOM   673   H  HA   . TRP A  1 40 ? 29.924 68.384 12.202  1.00 32.62  ?  40   TRP A HA   1 
ATOM   674   H  HB2  . TRP A  1 40 ? 29.401 69.771 14.176  1.00 31.89  ?  40   TRP A HB2  1 
ATOM   675   H  HB3  . TRP A  1 40 ? 28.104 68.869 14.306  1.00 31.89  ?  40   TRP A HB3  1 
ATOM   676   H  HD1  . TRP A  1 40 ? 29.683 66.148 13.728  1.00 28.01  ?  40   TRP A HD1  1 
ATOM   677   H  HE1  . TRP A  1 40 ? 31.027 65.157 15.464  1.00 27.44  ?  40   TRP A HE1  1 
ATOM   678   H  HE3  . TRP A  1 40 ? 30.260 70.062 16.620  1.00 29.10  ?  40   TRP A HE3  1 
ATOM   679   H  HZ2  . TRP A  1 40 ? 32.213 65.975 17.832  1.00 29.23  ?  40   TRP A HZ2  1 
ATOM   680   H  HZ3  . TRP A  1 40 ? 31.495 69.860 18.565  1.00 28.62  ?  40   TRP A HZ3  1 
ATOM   681   H  HH2  . TRP A  1 40 ? 32.456 67.844 19.159  1.00 29.16  ?  40   TRP A HH2  1 
ATOM   682   N  N    . ARG A  1 41 ? 28.297 66.902 10.987  1.00 31.76  ?  41   ARG A N    1 
ATOM   683   C  CA   . ARG A  1 41 ? 27.305 66.038 10.353  1.00 33.17  ?  41   ARG A CA   1 
ATOM   684   C  C    . ARG A  1 41 ? 27.052 64.755 11.138  1.00 32.41  ?  41   ARG A C    1 
ATOM   685   O  O    . ARG A  1 41 ? 25.904 64.402 11.406  1.00 35.91  ?  41   ARG A O    1 
ATOM   686   C  CB   . ARG A  1 41 ? 27.734 65.692 8.924   1.00 34.47  ?  41   ARG A CB   1 
ATOM   687   C  CG   . ARG A  1 41 ? 26.586 65.237 8.033   1.00 37.27  ?  41   ARG A CG   1 
ATOM   688   C  CD   . ARG A  1 41 ? 27.080 64.420 6.852   1.00 41.70  ?  41   ARG A CD   1 
ATOM   689   N  NE   . ARG A  1 41 ? 26.631 64.951 5.569   1.00 46.47  ?  41   ARG A NE   1 
ATOM   690   C  CZ   . ARG A  1 41 ? 26.881 64.377 4.395   1.00 50.84  ?  41   ARG A CZ   1 
ATOM   691   N  NH1  . ARG A  1 41 ? 27.577 63.248 4.335   1.00 53.20  ?  41   ARG A NH1  1 
ATOM   692   N  NH2  . ARG A  1 41 ? 26.435 64.932 3.276   1.00 52.03  ?  41   ARG A NH2  1 
ATOM   693   H  H    . ARG A  1 41 ? 29.060 66.910 10.590  1.00 38.11  ?  41   ARG A H    1 
ATOM   694   H  HA   . ARG A  1 41 ? 26.456 66.525 10.299  1.00 39.80  ?  41   ARG A HA   1 
ATOM   695   H  HB2  . ARG A  1 41 ? 28.131 66.478 8.517   1.00 41.37  ?  41   ARG A HB2  1 
ATOM   696   H  HB3  . ARG A  1 41 ? 28.385 64.975 8.958   1.00 41.37  ?  41   ARG A HB3  1 
ATOM   697   H  HG2  . ARG A  1 41 ? 25.980 64.685 8.551   1.00 44.72  ?  41   ARG A HG2  1 
ATOM   698   H  HG3  . ARG A  1 41 ? 26.120 66.015 7.690   1.00 44.72  ?  41   ARG A HG3  1 
ATOM   699   H  HD2  . ARG A  1 41 ? 28.050 64.419 6.853   1.00 50.03  ?  41   ARG A HD2  1 
ATOM   700   H  HD3  . ARG A  1 41 ? 26.748 63.513 6.934   1.00 50.03  ?  41   ARG A HD3  1 
ATOM   701   H  HE   . ARG A  1 41 ? 26.211 65.702 5.569   1.00 55.76  ?  41   ARG A HE   1 
ATOM   702   H  HH11 . ARG A  1 41 ? 27.870 62.884 5.057   1.00 62.44  ?  41   ARG A HH11 1 
ATOM   703   H  HH12 . ARG A  1 41 ? 27.736 62.880 3.574   1.00 62.44  ?  41   ARG A HH12 1 
ATOM   704   H  HH21 . ARG A  1 41 ? 25.983 65.663 3.309   1.00 63.84  ?  41   ARG A HH21 1 
ATOM   705   H  HH22 . ARG A  1 41 ? 26.596 64.560 2.517   1.00 63.84  ?  41   ARG A HH22 1 
ATOM   706   N  N    . TYR A  1 42 ? 28.123 64.052 11.496  1.00 26.10  ?  42   TYR A N    1 
ATOM   707   C  CA   . TYR A  1 42 ? 27.999 62.815 12.258  1.00 23.38  ?  42   TYR A CA   1 
ATOM   708   C  C    . TYR A  1 42 ? 28.861 62.855 13.508  1.00 23.69  ?  42   TYR A C    1 
ATOM   709   O  O    . TYR A  1 42 ? 29.925 63.475 13.525  1.00 22.15  ?  42   TYR A O    1 
ATOM   710   C  CB   . TYR A  1 42 ? 28.391 61.611 11.401  1.00 23.85  ?  42   TYR A CB   1 
ATOM   711   C  CG   . TYR A  1 42 ? 27.542 61.449 10.163  1.00 25.60  ?  42   TYR A CG   1 
ATOM   712   C  CD1  . TYR A  1 42 ? 26.155 61.469 10.241  1.00 26.75  ?  42   TYR A CD1  1 
ATOM   713   C  CD2  . TYR A  1 42 ? 28.126 61.291 8.915   1.00 27.30  ?  42   TYR A CD2  1 
ATOM   714   C  CE1  . TYR A  1 42 ? 25.375 61.327 9.111   1.00 27.92  ?  42   TYR A CE1  1 
ATOM   715   C  CE2  . TYR A  1 42 ? 27.355 61.149 7.777   1.00 28.76  ?  42   TYR A CE2  1 
ATOM   716   C  CZ   . TYR A  1 42 ? 25.981 61.167 7.881   1.00 29.09  ?  42   TYR A CZ   1 
ATOM   717   O  OH   . TYR A  1 42 ? 25.212 61.028 6.751   1.00 30.06  ?  42   TYR A OH   1 
ATOM   718   H  H    . TYR A  1 42 ? 28.933 64.271 11.309  1.00 31.32  ?  42   TYR A H    1 
ATOM   719   H  HA   . TYR A  1 42 ? 27.066 62.701 12.535  1.00 28.06  ?  42   TYR A HA   1 
ATOM   720   H  HB2  . TYR A  1 42 ? 29.312 61.714 11.117  1.00 28.62  ?  42   TYR A HB2  1 
ATOM   721   H  HB3  . TYR A  1 42 ? 28.298 60.805 11.932  1.00 28.62  ?  42   TYR A HB3  1 
ATOM   722   H  HD1  . TYR A  1 42 ? 25.745 61.576 11.069  1.00 32.10  ?  42   TYR A HD1  1 
ATOM   723   H  HD2  . TYR A  1 42 ? 29.053 61.278 8.843   1.00 32.75  ?  42   TYR A HD2  1 
ATOM   724   H  HE1  . TYR A  1 42 ? 24.448 61.340 9.177   1.00 33.50  ?  42   TYR A HE1  1 
ATOM   725   H  HE2  . TYR A  1 42 ? 27.760 61.041 6.947   1.00 34.51  ?  42   TYR A HE2  1 
ATOM   726   H  HH   . TYR A  1 42 ? 25.370 60.309 6.390   1.00 36.07  ?  42   TYR A HH   1 
ATOM   727   N  N    . LEU A  1 43 ? 28.391 62.181 14.552  1.00 25.41  ?  43   LEU A N    1 
ATOM   728   C  CA   . LEU A  1 43 ? 29.105 62.116 15.817  1.00 27.54  ?  43   LEU A CA   1 
ATOM   729   C  C    . LEU A  1 43 ? 28.847 60.779 16.493  1.00 28.40  ?  43   LEU A C    1 
ATOM   730   O  O    . LEU A  1 43 ? 27.707 60.452 16.823  1.00 30.06  ?  43   LEU A O    1 
ATOM   731   C  CB   . LEU A  1 43 ? 28.658 63.251 16.735  1.00 27.36  ?  43   LEU A CB   1 
ATOM   732   C  CG   . LEU A  1 43 ? 29.131 63.153 18.186  1.00 28.97  ?  43   LEU A CG   1 
ATOM   733   C  CD1  . LEU A  1 43 ? 30.645 63.287 18.274  1.00 30.29  ?  43   LEU A CD1  1 
ATOM   734   C  CD2  . LEU A  1 43 ? 28.440 64.209 19.035  1.00 29.23  ?  43   LEU A CD2  1 
ATOM   735   H  H    . LEU A  1 43 ? 27.648 61.748 14.550  1.00 30.49  ?  43   LEU A H    1 
ATOM   736   H  HA   . LEU A  1 43 ? 30.068 62.205 15.656  1.00 33.05  ?  43   LEU A HA   1 
ATOM   737   H  HB2  . LEU A  1 43 ? 28.996 64.087 16.376  1.00 32.83  ?  43   LEU A HB2  1 
ATOM   738   H  HB3  . LEU A  1 43 ? 27.689 63.272 16.746  1.00 32.83  ?  43   LEU A HB3  1 
ATOM   739   H  HG   . LEU A  1 43 ? 28.888 62.282 18.537  1.00 34.76  ?  43   LEU A HG   1 
ATOM   740   H  HD11 . LEU A  1 43 ? 30.904 64.140 17.918  1.00 36.35  ?  43   LEU A HD11 1 
ATOM   741   H  HD12 . LEU A  1 43 ? 30.911 63.221 19.194  1.00 36.35  ?  43   LEU A HD12 1 
ATOM   742   H  HD13 . LEU A  1 43 ? 31.051 62.582 17.764  1.00 36.35  ?  43   LEU A HD13 1 
ATOM   743   H  HD21 . LEU A  1 43 ? 27.491 64.068 18.999  1.00 35.07  ?  43   LEU A HD21 1 
ATOM   744   H  HD22 . LEU A  1 43 ? 28.748 64.133 19.941  1.00 35.07  ?  43   LEU A HD22 1 
ATOM   745   H  HD23 . LEU A  1 43 ? 28.655 65.078 18.688  1.00 35.07  ?  43   LEU A HD23 1 
ATOM   746   N  N    . TRP A  1 44 ? 29.910 60.007 16.692  1.00 26.44  ?  44   TRP A N    1 
ATOM   747   C  CA   . TRP A  1 44 ? 29.804 58.719 17.363  1.00 26.00  ?  44   TRP A CA   1 
ATOM   748   C  C    . TRP A  1 44 ? 30.803 58.627 18.505  1.00 28.87  ?  44   TRP A C    1 
ATOM   749   O  O    . TRP A  1 44 ? 31.904 59.172 18.427  1.00 29.77  ?  44   TRP A O    1 
ATOM   750   C  CB   . TRP A  1 44 ? 30.065 57.575 16.384  1.00 25.74  ?  44   TRP A CB   1 
ATOM   751   C  CG   . TRP A  1 44 ? 29.131 57.538 15.223  1.00 27.90  ?  44   TRP A CG   1 
ATOM   752   C  CD1  . TRP A  1 44 ? 27.805 57.222 15.247  1.00 30.74  ?  44   TRP A CD1  1 
ATOM   753   C  CD2  . TRP A  1 44 ? 29.454 57.813 13.855  1.00 28.52  ?  44   TRP A CD2  1 
ATOM   754   N  NE1  . TRP A  1 44 ? 27.280 57.289 13.979  1.00 31.51  ?  44   TRP A NE1  1 
ATOM   755   C  CE2  . TRP A  1 44 ? 28.272 57.649 13.106  1.00 29.46  ?  44   TRP A CE2  1 
ATOM   756   C  CE3  . TRP A  1 44 ? 30.627 58.183 13.192  1.00 28.43  ?  44   TRP A CE3  1 
ATOM   757   C  CZ2  . TRP A  1 44 ? 28.230 57.844 11.728  1.00 27.84  ?  44   TRP A CZ2  1 
ATOM   758   C  CZ3  . TRP A  1 44 ? 30.583 58.374 11.823  1.00 28.01  ?  44   TRP A CZ3  1 
ATOM   759   C  CH2  . TRP A  1 44 ? 29.393 58.205 11.106  1.00 27.40  ?  44   TRP A CH2  1 
ATOM   760   H  H    . TRP A  1 44 ? 30.709 60.209 16.446  1.00 31.72  ?  44   TRP A H    1 
ATOM   761   H  HA   . TRP A  1 44 ? 28.901 58.615 17.730  1.00 31.20  ?  44   TRP A HA   1 
ATOM   762   H  HB2  . TRP A  1 44 ? 30.966 57.664 16.036  1.00 30.88  ?  44   TRP A HB2  1 
ATOM   763   H  HB3  . TRP A  1 44 ? 29.979 56.734 16.859  1.00 30.88  ?  44   TRP A HB3  1 
ATOM   764   H  HD1  . TRP A  1 44 ? 27.324 56.997 16.011  1.00 36.88  ?  44   TRP A HD1  1 
ATOM   765   H  HE1  . TRP A  1 44 ? 26.461 57.131 13.767  1.00 37.81  ?  44   TRP A HE1  1 
ATOM   766   H  HE3  . TRP A  1 44 ? 31.422 58.297 13.661  1.00 34.12  ?  44   TRP A HE3  1 
ATOM   767   H  HZ2  . TRP A  1 44 ? 27.441 57.732 11.249  1.00 33.41  ?  44   TRP A HZ2  1 
ATOM   768   H  HZ3  . TRP A  1 44 ? 31.357 58.622 11.371  1.00 33.61  ?  44   TRP A HZ3  1 
ATOM   769   H  HH2  . TRP A  1 44 ? 29.393 58.342 10.187  1.00 32.87  ?  44   TRP A HH2  1 
ATOM   770   N  N    . ARG A  1 45 ? 30.414 57.931 19.565  1.00 28.24  ?  45   ARG A N    1 
ATOM   771   C  CA   . ARG A  1 45 ? 31.320 57.649 20.666  1.00 28.40  ?  45   ARG A CA   1 
ATOM   772   C  C    . ARG A  1 45 ? 32.302 56.550 20.275  1.00 26.61  ?  45   ARG A C    1 
ATOM   773   O  O    . ARG A  1 45 ? 31.907 55.517 19.737  1.00 28.04  ?  45   ARG A O    1 
ATOM   774   C  CB   . ARG A  1 45 ? 30.534 57.213 21.903  1.00 27.94  ?  45   ARG A CB   1 
ATOM   775   C  CG   . ARG A  1 45 ? 31.412 56.730 23.049  1.00 28.19  ?  45   ARG A CG   1 
ATOM   776   C  CD   . ARG A  1 45 ? 32.162 57.885 23.678  1.00 27.94  ?  45   ARG A CD   1 
ATOM   777   N  NE   . ARG A  1 45 ? 31.315 58.641 24.595  1.00 29.87  ?  45   ARG A NE   1 
ATOM   778   C  CZ   . ARG A  1 45 ? 31.521 59.908 24.945  1.00 31.32  ?  45   ARG A CZ   1 
ATOM   779   N  NH1  . ARG A  1 45 ? 32.548 60.590 24.450  1.00 30.23  ?  45   ARG A NH1  1 
ATOM   780   N  NH2  . ARG A  1 45 ? 30.688 60.499 25.791  1.00 34.15  ?  45   ARG A NH2  1 
ATOM   781   H  H    . ARG A  1 45 ? 29.624 57.608 19.671  1.00 33.89  ?  45   ARG A H    1 
ATOM   782   H  HA   . ARG A  1 45 ? 31.828 58.458 20.887  1.00 34.08  ?  45   ARG A HA   1 
ATOM   783   H  HB2  . ARG A  1 45 ? 30.014 57.966 22.225  1.00 33.53  ?  45   ARG A HB2  1 
ATOM   784   H  HB3  . ARG A  1 45 ? 29.941 56.486 21.657  1.00 33.53  ?  45   ARG A HB3  1 
ATOM   785   H  HG2  . ARG A  1 45 ? 30.856 56.320 23.730  1.00 33.83  ?  45   ARG A HG2  1 
ATOM   786   H  HG3  . ARG A  1 45 ? 32.059 56.092 22.712  1.00 33.83  ?  45   ARG A HG3  1 
ATOM   787   H  HD2  . ARG A  1 45 ? 32.918 57.540 24.178  1.00 33.53  ?  45   ARG A HD2  1 
ATOM   788   H  HD3  . ARG A  1 45 ? 32.467 58.486 22.981  1.00 33.53  ?  45   ARG A HD3  1 
ATOM   789   H  HE   . ARG A  1 45 ? 30.634 58.240 24.932  1.00 35.84  ?  45   ARG A HE   1 
ATOM   790   H  HH11 . ARG A  1 45 ? 33.091 60.212 23.901  1.00 36.28  ?  45   ARG A HH11 1 
ATOM   791   H  HH12 . ARG A  1 45 ? 32.671 61.409 24.681  1.00 36.28  ?  45   ARG A HH12 1 
ATOM   792   H  HH21 . ARG A  1 45 ? 30.020 60.063 26.113  1.00 40.98  ?  45   ARG A HH21 1 
ATOM   793   H  HH22 . ARG A  1 45 ? 30.815 61.319 26.018  1.00 40.98  ?  45   ARG A HH22 1 
ATOM   794   N  N    . THR A  1 46 ? 33.583 56.781 20.541  1.00 24.06  ?  46   THR A N    1 
ATOM   795   C  CA   . THR A  1 46 ? 34.587 55.734 20.405  1.00 23.83  ?  46   THR A CA   1 
ATOM   796   C  C    . THR A  1 46 ? 34.456 54.789 21.593  1.00 27.63  ?  46   THR A C    1 
ATOM   797   O  O    . THR A  1 46 ? 34.807 55.142 22.716  1.00 28.26  ?  46   THR A O    1 
ATOM   798   C  CB   . THR A  1 46 ? 36.014 56.314 20.373  1.00 24.75  ?  46   THR A CB   1 
ATOM   799   O  OG1  . THR A  1 46 ? 36.184 57.230 21.462  1.00 25.69  ?  46   THR A OG1  1 
ATOM   800   C  CG2  . THR A  1 46 ? 36.271 57.047 19.060  1.00 22.00  ?  46   THR A CG2  1 
ATOM   801   H  H    . THR A  1 46 ? 33.896 57.538 20.802  1.00 28.87  ?  46   THR A H    1 
ATOM   802   H  HA   . THR A  1 46 ? 34.432 55.229 19.580  1.00 28.60  ?  46   THR A HA   1 
ATOM   803   H  HB   . THR A  1 46 ? 36.657 55.593 20.454  1.00 29.70  ?  46   THR A HB   1 
ATOM   804   H  HG1  . THR A  1 46 ? 36.067 56.842 22.175  1.00 30.83  ?  46   THR A HG1  1 
ATOM   805   H  HG21 . THR A  1 46 ? 35.645 57.768 18.959  1.00 26.40  ?  46   THR A HG21 1 
ATOM   806   H  HG22 . THR A  1 46 ? 37.162 57.403 19.053  1.00 26.40  ?  46   THR A HG22 1 
ATOM   807   H  HG23 . THR A  1 46 ? 36.171 56.441 18.322  1.00 26.40  ?  46   THR A HG23 1 
ATOM   808   N  N    . THR A  1 47 ? 33.948 53.588 21.339  1.00 28.17  ?  47   THR A N    1 
ATOM   809   C  CA   . THR A  1 47 ? 33.611 52.649 22.409  1.00 30.42  ?  47   THR A CA   1 
ATOM   810   C  C    . THR A  1 47 ? 34.780 52.387 23.357  1.00 32.05  ?  47   THR A C    1 
ATOM   811   O  O    . THR A  1 47 ? 35.903 52.141 22.925  1.00 30.56  ?  47   THR A O    1 
ATOM   812   C  CB   . THR A  1 47 ? 33.118 51.310 21.834  1.00 31.20  ?  47   THR A CB   1 
ATOM   813   O  OG1  . THR A  1 47 ? 32.038 51.549 20.922  1.00 28.66  ?  47   THR A OG1  1 
ATOM   814   C  CG2  . THR A  1 47 ? 32.645 50.384 22.949  1.00 33.52  ?  47   THR A CG2  1 
ATOM   815   H  H    . THR A  1 47 ? 33.787 53.288 20.549  1.00 33.81  ?  47   THR A H    1 
ATOM   816   H  HA   . THR A  1 47 ? 32.880 53.031 22.939  1.00 36.50  ?  47   THR A HA   1 
ATOM   817   H  HB   . THR A  1 47 ? 33.846 50.874 21.363  1.00 37.44  ?  47   THR A HB   1 
ATOM   818   H  HG1  . THR A  1 47 ? 31.418 51.919 21.312  1.00 34.39  ?  47   THR A HG1  1 
ATOM   819   H  HG21 . THR A  1 47 ? 31.923 50.793 23.431  1.00 40.22  ?  47   THR A HG21 1 
ATOM   820   H  HG22 . THR A  1 47 ? 32.340 49.552 22.578  1.00 40.22  ?  47   THR A HG22 1 
ATOM   821   H  HG23 . THR A  1 47 ? 33.366 50.208 23.558  1.00 40.22  ?  47   THR A HG23 1 
ATOM   822   N  N    . GLY A  1 48 ? 34.494 52.425 24.655  1.00 34.03  ?  48   GLY A N    1 
ATOM   823   C  CA   . GLY A  1 48 ? 35.503 52.251 25.686  1.00 36.73  ?  48   GLY A CA   1 
ATOM   824   C  C    . GLY A  1 48 ? 36.426 53.437 25.921  1.00 36.59  ?  48   GLY A C    1 
ATOM   825   O  O    . GLY A  1 48 ? 37.319 53.364 26.764  1.00 36.71  ?  48   GLY A O    1 
ATOM   826   H  H    . GLY A  1 48 ? 33.703 52.554 24.967  1.00 40.84  ?  48   GLY A H    1 
ATOM   827   H  HA2  . GLY A  1 48 ? 35.059 52.052 26.525  1.00 44.07  ?  48   GLY A HA2  1 
ATOM   828   H  HA3  . GLY A  1 48 ? 36.056 51.489 25.454  1.00 44.07  ?  48   GLY A HA3  1 
ATOM   829   N  N    . LYS A  1 49 ? 36.219 54.532 25.197  1.00 34.70  ?  49   LYS A N    1 
ATOM   830   C  CA   . LYS A  1 49 ? 37.138 55.664 25.276  1.00 37.43  ?  49   LYS A CA   1 
ATOM   831   C  C    . LYS A  1 49 ? 36.444 57.010 25.471  1.00 35.02  ?  49   LYS A C    1 
ATOM   832   O  O    . LYS A  1 49 ? 35.280 57.187 25.108  1.00 35.20  ?  49   LYS A O    1 
ATOM   833   C  CB   . LYS A  1 49 ? 38.010 55.714 24.020  1.00 38.98  ?  49   LYS A CB   1 
ATOM   834   C  CG   . LYS A  1 49 ? 39.067 54.626 23.964  1.00 42.73  ?  49   LYS A CG   1 
ATOM   835   C  CD   . LYS A  1 49 ? 39.800 54.639 22.632  1.00 43.18  ?  49   LYS A CD   1 
ATOM   836   C  CE   . LYS A  1 49 ? 40.905 53.597 22.591  1.00 46.57  ?  49   LYS A CE   1 
ATOM   837   N  NZ   . LYS A  1 49 ? 42.004 53.906 23.551  1.00 49.29  ?  49   LYS A NZ   1 
ATOM   838   H  H    . LYS A  1 49 ? 35.560 54.645 24.657  1.00 41.64  ?  49   LYS A H    1 
ATOM   839   H  HA   . LYS A  1 49 ? 37.733 55.527 26.043  1.00 44.92  ?  49   LYS A HA   1 
ATOM   840   H  HB2  . LYS A  1 49 ? 37.441 55.615 23.241  1.00 46.78  ?  49   LYS A HB2  1 
ATOM   841   H  HB3  . LYS A  1 49 ? 38.465 56.570 23.989  1.00 46.78  ?  49   LYS A HB3  1 
ATOM   842   H  HG2  . LYS A  1 49 ? 39.715 54.771 24.670  1.00 51.27  ?  49   LYS A HG2  1 
ATOM   843   H  HG3  . LYS A  1 49 ? 38.642 53.760 24.069  1.00 51.27  ?  49   LYS A HG3  1 
ATOM   844   H  HD2  . LYS A  1 49 ? 39.172 54.444 21.919  1.00 51.82  ?  49   LYS A HD2  1 
ATOM   845   H  HD3  . LYS A  1 49 ? 40.201 55.512 22.497  1.00 51.82  ?  49   LYS A HD3  1 
ATOM   846   H  HE2  . LYS A  1 49 ? 40.535 52.732 22.824  1.00 55.89  ?  49   LYS A HE2  1 
ATOM   847   H  HE3  . LYS A  1 49 ? 41.283 53.570 21.698  1.00 55.89  ?  49   LYS A HE3  1 
ATOM   848   H  HZ1  . LYS A  1 49 ? 41.684 53.932 24.381  1.00 59.14  ?  49   LYS A HZ1  1 
ATOM   849   H  HZ2  . LYS A  1 49 ? 42.634 53.279 23.504  1.00 59.14  ?  49   LYS A HZ2  1 
ATOM   850   H  HZ3  . LYS A  1 49 ? 42.365 54.695 23.356  1.00 59.14  ?  49   LYS A HZ3  1 
ATOM   851   N  N    . TYR A  1 50 ? 37.181 57.952 26.050  1.00 34.94  ?  50   TYR A N    1 
ATOM   852   C  CA   . TYR A  1 50 ? 36.709 59.317 26.232  1.00 34.24  ?  50   TYR A CA   1 
ATOM   853   C  C    . TYR A  1 50 ? 37.016 60.117 24.973  1.00 33.26  ?  50   TYR A C    1 
ATOM   854   O  O    . TYR A  1 50 ? 38.090 60.705 24.845  1.00 36.77  ?  50   TYR A O    1 
ATOM   855   C  CB   . TYR A  1 50 ? 37.407 59.953 27.436  1.00 36.25  ?  50   TYR A CB   1 
ATOM   856   C  CG   . TYR A  1 50 ? 36.673 61.126 28.050  1.00 38.22  ?  50   TYR A CG   1 
ATOM   857   C  CD1  . TYR A  1 50 ? 35.810 61.914 27.296  1.00 36.32  ?  50   TYR A CD1  1 
ATOM   858   C  CD2  . TYR A  1 50 ? 36.846 61.445 29.391  1.00 42.46  ?  50   TYR A CD2  1 
ATOM   859   C  CE1  . TYR A  1 50 ? 35.142 62.984 27.863  1.00 37.56  ?  50   TYR A CE1  1 
ATOM   860   C  CE2  . TYR A  1 50 ? 36.184 62.511 29.965  1.00 43.76  ?  50   TYR A CE2  1 
ATOM   861   C  CZ   . TYR A  1 50 ? 35.333 63.278 29.198  1.00 42.40  ?  50   TYR A CZ   1 
ATOM   862   O  OH   . TYR A  1 50 ? 34.672 64.340 29.770  1.00 45.66  ?  50   TYR A OH   1 
ATOM   863   H  H    . TYR A  1 50 ? 37.976 57.821 26.352  1.00 41.93  ?  50   TYR A H    1 
ATOM   864   H  HA   . TYR A  1 50 ? 35.741 59.321 26.385  1.00 41.09  ?  50   TYR A HA   1 
ATOM   865   H  HB2  . TYR A  1 50 ? 37.510 59.278 28.125  1.00 43.50  ?  50   TYR A HB2  1 
ATOM   866   H  HB3  . TYR A  1 50 ? 38.281 60.267 27.156  1.00 43.50  ?  50   TYR A HB3  1 
ATOM   867   H  HD1  . TYR A  1 50 ? 35.680 61.718 26.396  1.00 43.59  ?  50   TYR A HD1  1 
ATOM   868   H  HD2  . TYR A  1 50 ? 37.419 60.930 29.912  1.00 50.96  ?  50   TYR A HD2  1 
ATOM   869   H  HE1  . TYR A  1 50 ? 34.567 63.503 27.348  1.00 45.07  ?  50   TYR A HE1  1 
ATOM   870   H  HE2  . TYR A  1 50 ? 36.310 62.711 30.864  1.00 52.51  ?  50   TYR A HE2  1 
ATOM   871   H  HH   . TYR A  1 50 ? 35.213 64.881 30.064  1.00 54.79  ?  50   TYR A HH   1 
ATOM   872   N  N    . GLY A  1 51 ? 36.074 60.128 24.038  1.00 28.26  ?  51   GLY A N    1 
ATOM   873   C  CA   . GLY A  1 51 ? 36.269 60.817 22.777  1.00 26.32  ?  51   GLY A CA   1 
ATOM   874   C  C    . GLY A  1 51 ? 35.218 60.445 21.752  1.00 26.52  ?  51   GLY A C    1 
ATOM   875   O  O    . GLY A  1 51 ? 34.175 59.885 22.091  1.00 28.99  ?  51   GLY A O    1 
ATOM   876   H  H    . GLY A  1 51 ? 35.310 59.741 24.113  1.00 33.92  ?  51   GLY A H    1 
ATOM   877   H  HA2  . GLY A  1 51 ? 36.232 61.775 22.923  1.00 31.59  ?  51   GLY A HA2  1 
ATOM   878   H  HA3  . GLY A  1 51 ? 37.142 60.594 22.418  1.00 31.59  ?  51   GLY A HA3  1 
ATOM   879   N  N    . ASN A  1 52 ? 35.492 60.753 20.489  1.00 25.47  ?  52   ASN A N    1 
ATOM   880   C  CA   . ASN A  1 52 ? 34.520 60.510 19.434  1.00 25.43  ?  52   ASN A CA   1 
ATOM   881   C  C    . ASN A  1 52 ? 35.155 60.341 18.060  1.00 27.58  ?  52   ASN A C    1 
ATOM   882   O  O    . ASN A  1 52 ? 36.336 60.628 17.862  1.00 28.29  ?  52   ASN A O    1 
ATOM   883   C  CB   . ASN A  1 52 ? 33.516 61.663 19.375  1.00 24.28  ?  52   ASN A CB   1 
ATOM   884   C  CG   . ASN A  1 52 ? 34.147 62.963 18.903  1.00 22.76  ?  52   ASN A CG   1 
ATOM   885   O  OD1  . ASN A  1 52 ? 34.411 63.143 17.712  1.00 22.66  ?  52   ASN A OD1  1 
ATOM   886   N  ND2  . ASN A  1 52 ? 34.387 63.878 19.834  1.00 22.40  ?  52   ASN A ND2  1 
ATOM   887   H  H    . ASN A  1 52 ? 36.230 61.102 20.220  1.00 30.57  ?  52   ASN A H    1 
ATOM   888   H  HA   . ASN A  1 52 ? 34.026 59.689 19.640  1.00 30.52  ?  52   ASN A HA   1 
ATOM   889   H  HB2  . ASN A  1 52 ? 32.805 61.432 18.757  1.00 29.13  ?  52   ASN A HB2  1 
ATOM   890   H  HB3  . ASN A  1 52 ? 33.151 61.811 20.262  1.00 29.13  ?  52   ASN A HB3  1 
ATOM   891   H  HD21 . ASN A  1 52 ? 34.186 63.719 20.655  1.00 26.88  ?  52   ASN A HD21 1 
ATOM   892   H  HD22 . ASN A  1 52 ? 34.743 64.630 19.616  1.00 26.88  ?  52   ASN A HD22 1 
ATOM   893   N  N    . ILE A  1 53 ? 34.349 59.852 17.124  1.00 28.97  ?  53   ILE A N    1 
ATOM   894   C  CA   . ILE A  1 53 ? 34.672 59.887 15.706  1.00 29.27  ?  53   ILE A CA   1 
ATOM   895   C  C    . ILE A  1 53 ? 33.611 60.753 15.055  1.00 27.63  ?  53   ILE A C    1 
ATOM   896   O  O    . ILE A  1 53 ? 32.419 60.565 15.298  1.00 29.64  ?  53   ILE A O    1 
ATOM   897   C  CB   . ILE A  1 53 ? 34.632 58.492 15.067  1.00 31.66  ?  53   ILE A CB   1 
ATOM   898   C  CG1  . ILE A  1 53 ? 35.862 57.683 15.474  1.00 35.58  ?  53   ILE A CG1  1 
ATOM   899   C  CG2  . ILE A  1 53 ? 34.561 58.603 13.549  1.00 30.10  ?  53   ILE A CG2  1 
ATOM   900   C  CD1  . ILE A  1 53 ? 37.160 58.210 14.902  1.00 37.53  ?  53   ILE A CD1  1 
ATOM   901   H  H    . ILE A  1 53 ? 33.590 59.485 17.292  1.00 34.76  ?  53   ILE A H    1 
ATOM   902   H  HA   . ILE A  1 53 ? 35.554 60.288 15.564  1.00 35.12  ?  53   ILE A HA   1 
ATOM   903   H  HB   . ILE A  1 53 ? 33.839 58.029 15.382  1.00 37.99  ?  53   ILE A HB   1 
ATOM   904   H  HG12 . ILE A  1 53 ? 35.938 57.695 16.441  1.00 42.70  ?  53   ILE A HG12 1 
ATOM   905   H  HG13 . ILE A  1 53 ? 35.751 56.770 15.165  1.00 42.70  ?  53   ILE A HG13 1 
ATOM   906   H  HG21 . ILE A  1 53 ? 35.337 59.073 13.235  1.00 36.12  ?  53   ILE A HG21 1 
ATOM   907   H  HG22 . ILE A  1 53 ? 34.537 57.720 13.173  1.00 36.12  ?  53   ILE A HG22 1 
ATOM   908   H  HG23 . ILE A  1 53 ? 33.766 59.084 13.308  1.00 36.12  ?  53   ILE A HG23 1 
ATOM   909   H  HD11 . ILE A  1 53 ? 37.293 59.110 15.208  1.00 45.03  ?  53   ILE A HD11 1 
ATOM   910   H  HD12 . ILE A  1 53 ? 37.882 57.652 15.201  1.00 45.03  ?  53   ILE A HD12 1 
ATOM   911   H  HD13 . ILE A  1 53 ? 37.109 58.193 13.944  1.00 45.03  ?  53   ILE A HD13 1 
ATOM   912   N  N    . SER A  1 54 ? 34.037 61.702 14.233  1.00 25.92  ?  54   SER A N    1 
ATOM   913   C  CA   . SER A  1 54 ? 33.114 62.676 13.680  1.00 25.06  ?  54   SER A CA   1 
ATOM   914   C  C    . SER A  1 54 ? 33.333 62.910 12.194  1.00 23.32  ?  54   SER A C    1 
ATOM   915   O  O    . SER A  1 54 ? 34.432 62.720 11.671  1.00 22.72  ?  54   SER A O    1 
ATOM   916   C  CB   . SER A  1 54 ? 33.247 64.003 14.428  1.00 25.83  ?  54   SER A CB   1 
ATOM   917   O  OG   . SER A  1 54 ? 32.850 63.866 15.782  1.00 26.95  ?  54   SER A OG   1 
ATOM   918   H  H    . SER A  1 54 ? 34.854 61.803 13.982  1.00 31.10  ?  54   SER A H    1 
ATOM   919   H  HA   . SER A  1 54 ? 32.197 62.350 13.802  1.00 30.07  ?  54   SER A HA   1 
ATOM   920   H  HB2  . SER A  1 54 ? 34.173 64.289 14.399  1.00 31.00  ?  54   SER A HB2  1 
ATOM   921   H  HB3  . SER A  1 54 ? 32.682 64.664 14.000  1.00 31.00  ?  54   SER A HB3  1 
ATOM   922   H  HG   . SER A  1 54 ? 32.926 64.583 16.170  1.00 32.34  ?  54   SER A HG   1 
ATOM   923   N  N    . VAL A  1 55 ? 32.266 63.320 11.520  1.00 24.02  ?  55   VAL A N    1 
ATOM   924   C  CA   . VAL A  1 55 ? 32.363 63.788 10.150  1.00 22.82  ?  55   VAL A CA   1 
ATOM   925   C  C    . VAL A  1 55 ? 31.860 65.221 10.102  1.00 22.03  ?  55   VAL A C    1 
ATOM   926   O  O    . VAL A  1 55 ? 30.719 65.502 10.480  1.00 22.61  ?  55   VAL A O    1 
ATOM   927   C  CB   . VAL A  1 55 ? 31.540 62.923 9.185   1.00 22.52  ?  55   VAL A CB   1 
ATOM   928   C  CG1  . VAL A  1 55 ? 31.639 63.474 7.771   1.00 21.80  ?  55   VAL A CG1  1 
ATOM   929   C  CG2  . VAL A  1 55 ? 32.016 61.478 9.233   1.00 23.30  ?  55   VAL A CG2  1 
ATOM   930   H  H    . VAL A  1 55 ? 31.467 63.334 11.839  1.00 28.83  ?  55   VAL A H    1 
ATOM   931   H  HA   . VAL A  1 55 ? 33.300 63.775 9.863   1.00 27.38  ?  55   VAL A HA   1 
ATOM   932   H  HB   . VAL A  1 55 ? 30.598 62.945 9.457   1.00 27.03  ?  55   VAL A HB   1 
ATOM   933   H  HG11 . VAL A  1 55 ? 32.559 63.468 7.498   1.00 26.16  ?  55   VAL A HG11 1 
ATOM   934   H  HG12 . VAL A  1 55 ? 31.118 62.921 7.184   1.00 26.16  ?  55   VAL A HG12 1 
ATOM   935   H  HG13 . VAL A  1 55 ? 31.300 64.372 7.762   1.00 26.16  ?  55   VAL A HG13 1 
ATOM   936   H  HG21 . VAL A  1 55 ? 31.910 61.144 10.127  1.00 27.96  ?  55   VAL A HG21 1 
ATOM   937   H  HG22 . VAL A  1 55 ? 31.489 60.956 8.624   1.00 27.96  ?  55   VAL A HG22 1 
ATOM   938   H  HG23 . VAL A  1 55 ? 32.940 61.445 8.978   1.00 27.96  ?  55   VAL A HG23 1 
ATOM   939   N  N    . PHE A  1 56 ? 32.722 66.128 9.656   1.00 21.74  ?  56   PHE A N    1 
ATOM   940   C  CA   . PHE A  1 56 ? 32.357 67.529 9.521   1.00 23.03  ?  56   PHE A CA   1 
ATOM   941   C  C    . PHE A  1 56 ? 32.122 67.862 8.057   1.00 26.13  ?  56   PHE A C    1 
ATOM   942   O  O    . PHE A  1 56 ? 32.736 67.271 7.170   1.00 26.26  ?  56   PHE A O    1 
ATOM   943   C  CB   . PHE A  1 56 ? 33.448 68.432 10.101  1.00 22.52  ?  56   PHE A CB   1 
ATOM   944   C  CG   . PHE A  1 56 ? 33.474 68.462 11.603  1.00 23.16  ?  56   PHE A CG   1 
ATOM   945   C  CD1  . PHE A  1 56 ? 34.139 67.478 12.319  1.00 21.85  ?  56   PHE A CD1  1 
ATOM   946   C  CD2  . PHE A  1 56 ? 32.835 69.475 12.299  1.00 25.39  ?  56   PHE A CD2  1 
ATOM   947   C  CE1  . PHE A  1 56 ? 34.164 67.503 13.700  1.00 22.48  ?  56   PHE A CE1  1 
ATOM   948   C  CE2  . PHE A  1 56 ? 32.857 69.506 13.683  1.00 25.99  ?  56   PHE A CE2  1 
ATOM   949   C  CZ   . PHE A  1 56 ? 33.521 68.518 14.384  1.00 24.56  ?  56   PHE A CZ   1 
ATOM   950   H  H    . PHE A  1 56 ? 33.532 65.953 9.423   1.00 26.09  ?  56   PHE A H    1 
ATOM   951   H  HA   . PHE A  1 56 ? 31.526 67.696 10.013  1.00 27.63  ?  56   PHE A HA   1 
ATOM   952   H  HB2  . PHE A  1 56 ? 34.312 68.114 9.796   1.00 27.03  ?  56   PHE A HB2  1 
ATOM   953   H  HB3  . PHE A  1 56 ? 33.302 69.338 9.789   1.00 27.03  ?  56   PHE A HB3  1 
ATOM   954   H  HD1  . PHE A  1 56 ? 34.572 66.792 11.864  1.00 26.22  ?  56   PHE A HD1  1 
ATOM   955   H  HD2  . PHE A  1 56 ? 32.386 70.142 11.831  1.00 30.47  ?  56   PHE A HD2  1 
ATOM   956   H  HE1  . PHE A  1 56 ? 34.612 66.837 14.170  1.00 26.97  ?  56   PHE A HE1  1 
ATOM   957   H  HE2  . PHE A  1 56 ? 32.424 70.191 14.141  1.00 31.19  ?  56   PHE A HE2  1 
ATOM   958   H  HZ   . PHE A  1 56 ? 33.538 68.537 15.314  1.00 29.47  ?  56   PHE A HZ   1 
ATOM   959   N  N    . ASP A  1 57 ? 31.221 68.806 7.813   1.00 31.28  ?  57   ASP A N    1 
ATOM   960   C  CA   . ASP A  1 57 ? 30.878 69.216 6.460   1.00 34.29  ?  57   ASP A CA   1 
ATOM   961   C  C    . ASP A  1 57 ? 30.950 70.734 6.375   1.00 31.61  ?  57   ASP A C    1 
ATOM   962   O  O    . ASP A  1 57 ? 30.002 71.430 6.739   1.00 34.14  ?  57   ASP A O    1 
ATOM   963   C  CB   . ASP A  1 57 ? 29.471 68.734 6.103   1.00 37.76  ?  57   ASP A CB   1 
ATOM   964   C  CG   . ASP A  1 57 ? 29.140 68.934 4.640   1.00 42.16  ?  57   ASP A CG   1 
ATOM   965   O  OD1  . ASP A  1 57 ? 29.910 69.629 3.946   1.00 42.61  ?  57   ASP A OD1  1 
ATOM   966   O  OD2  . ASP A  1 57 ? 28.108 68.398 4.182   1.00 44.61  ?  57   ASP A OD2  1 
ATOM   967   H  H    . ASP A  1 57 ? 30.789 69.230 8.424   1.00 37.53  ?  57   ASP A H    1 
ATOM   968   H  HA   . ASP A  1 57 ? 31.516 68.832 5.823   1.00 41.14  ?  57   ASP A HA   1 
ATOM   969   H  HB2  . ASP A  1 57 ? 29.402 67.786 6.300   1.00 45.31  ?  57   ASP A HB2  1 
ATOM   970   H  HB3  . ASP A  1 57 ? 28.824 69.230 6.628   1.00 45.31  ?  57   ASP A HB3  1 
ATOM   971   N  N    . VAL A  1 58 ? 32.084 71.244 5.905   1.00 26.05  ?  58   VAL A N    1 
ATOM   972   C  CA   . VAL A  1 58 ? 32.310 72.681 5.859   1.00 25.52  ?  58   VAL A CA   1 
ATOM   973   C  C    . VAL A  1 58 ? 32.943 73.074 4.529   1.00 26.28  ?  58   VAL A C    1 
ATOM   974   O  O    . VAL A  1 58 ? 33.227 72.216 3.697   1.00 26.13  ?  58   VAL A O    1 
ATOM   975   C  CB   . VAL A  1 58 ? 33.195 73.142 7.035   1.00 25.83  ?  58   VAL A CB   1 
ATOM   976   C  CG1  . VAL A  1 58 ? 32.504 72.842 8.360   1.00 27.61  ?  58   VAL A CG1  1 
ATOM   977   C  CG2  . VAL A  1 58 ? 34.557 72.474 6.980   1.00 25.00  ?  58   VAL A CG2  1 
ATOM   978   H  H    . VAL A  1 58 ? 32.740 70.776 5.606   1.00 31.26  ?  58   VAL A H    1 
ATOM   979   H  HA   . VAL A  1 58 ? 31.448 73.141 5.931   1.00 30.63  ?  58   VAL A HA   1 
ATOM   980   H  HB   . VAL A  1 58 ? 33.329 74.111 6.974   1.00 31.00  ?  58   VAL A HB   1 
ATOM   981   H  HG11 . VAL A  1 58 ? 32.353 71.896 8.426   1.00 33.13  ?  58   VAL A HG11 1 
ATOM   982   H  HG12 . VAL A  1 58 ? 33.068 73.135 9.079   1.00 33.13  ?  58   VAL A HG12 1 
ATOM   983   H  HG13 . VAL A  1 58 ? 31.667 73.310 8.389   1.00 33.13  ?  58   VAL A HG13 1 
ATOM   984   H  HG21 . VAL A  1 58 ? 34.986 72.708 6.154   1.00 30.00  ?  58   VAL A HG21 1 
ATOM   985   H  HG22 . VAL A  1 58 ? 35.084 72.779 7.721   1.00 30.00  ?  58   VAL A HG22 1 
ATOM   986   H  HG23 . VAL A  1 58 ? 34.439 71.522 7.030   1.00 30.00  ?  58   VAL A HG23 1 
ATOM   987   N  N    . ASN A  1 59 ? 33.162 74.368 4.328   1.00 29.61  ?  59   ASN A N    1 
ATOM   988   C  CA   . ASN A  1 59 ? 33.581 74.873 3.022   1.00 32.09  ?  59   ASN A CA   1 
ATOM   989   C  C    . ASN A  1 59 ? 35.090 75.023 2.833   1.00 34.33  ?  59   ASN A C    1 
ATOM   990   O  O    . ASN A  1 59 ? 35.545 75.298 1.724   1.00 37.91  ?  59   ASN A O    1 
ATOM   991   C  CB   . ASN A  1 59 ? 32.901 76.214 2.741   1.00 33.80  ?  59   ASN A CB   1 
ATOM   992   C  CG   . ASN A  1 59 ? 31.399 76.085 2.603   1.00 35.06  ?  59   ASN A CG   1 
ATOM   993   O  OD1  . ASN A  1 59 ? 30.901 75.142 1.985   1.00 34.58  ?  59   ASN A OD1  1 
ATOM   994   N  ND2  . ASN A  1 59 ? 30.666 77.027 3.186   1.00 37.03  ?  59   ASN A ND2  1 
ATOM   995   H  H    . ASN A  1 59 ? 33.077 74.976 4.930   1.00 35.53  ?  59   ASN A H    1 
ATOM   996   H  HA   . ASN A  1 59 ? 33.269 74.242 2.340   1.00 38.51  ?  59   ASN A HA   1 
ATOM   997   H  HB2  . ASN A  1 59 ? 33.084 76.823 3.474   1.00 40.56  ?  59   ASN A HB2  1 
ATOM   998   H  HB3  . ASN A  1 59 ? 33.249 76.578 1.912   1.00 40.56  ?  59   ASN A HB3  1 
ATOM   999   H  HD21 . ASN A  1 59 ? 31.050 77.666 3.614   1.00 44.43  ?  59   ASN A HD21 1 
ATOM   1000  H  HD22 . ASN A  1 59 ? 29.808 76.997 3.135   1.00 44.43  ?  59   ASN A HD22 1 
ATOM   1001  N  N    . SER A  1 60 ? 35.868 74.849 3.897   1.00 31.49  ?  60   SER A N    1 
ATOM   1002  C  CA   . SER A  1 60 ? 37.319 75.004 3.786   1.00 31.35  ?  60   SER A CA   1 
ATOM   1003  C  C    . SER A  1 60 ? 38.059 74.473 5.007   1.00 27.85  ?  60   SER A C    1 
ATOM   1004  O  O    . SER A  1 60 ? 37.456 74.212 6.050   1.00 26.53  ?  60   SER A O    1 
ATOM   1005  C  CB   . SER A  1 60 ? 37.675 76.478 3.590   1.00 34.59  ?  60   SER A CB   1 
ATOM   1006  O  OG   . SER A  1 60 ? 37.421 77.220 4.771   1.00 36.41  ?  60   SER A OG   1 
ATOM   1007  H  H    . SER A  1 60 ? 35.588 74.643 4.683   1.00 37.79  ?  60   SER A H    1 
ATOM   1008  H  HA   . SER A  1 60 ? 37.634 74.508 3.002   1.00 37.62  ?  60   SER A HA   1 
ATOM   1009  H  HB2  . SER A  1 60 ? 38.617 76.548 3.370   1.00 41.51  ?  60   SER A HB2  1 
ATOM   1010  H  HB3  . SER A  1 60 ? 37.138 76.839 2.868   1.00 41.51  ?  60   SER A HB3  1 
ATOM   1011  H  HG   . SER A  1 60 ? 37.615 78.008 4.654   1.00 43.70  ?  60   SER A HG   1 
ATOM   1012  N  N    . HIS A  1 61 ? 39.373 74.317 4.865   1.00 28.64  ?  61   HIS A N    1 
ATOM   1013  C  CA   . HIS A  1 61 ? 40.223 73.902 5.972   1.00 26.18  ?  61   HIS A CA   1 
ATOM   1014  C  C    . HIS A  1 61 ? 40.131 74.927 7.090   1.00 25.42  ?  61   HIS A C    1 
ATOM   1015  O  O    . HIS A  1 61 ? 40.089 74.578 8.269   1.00 26.49  ?  61   HIS A O    1 
ATOM   1016  C  CB   . HIS A  1 61 ? 41.678 73.786 5.517   1.00 27.94  ?  61   HIS A CB   1 
ATOM   1017  C  CG   . HIS A  1 61 ? 41.893 72.809 4.402   1.00 27.86  ?  61   HIS A CG   1 
ATOM   1018  N  ND1  . HIS A  1 61 ? 41.027 71.768 4.141   1.00 26.34  ?  61   HIS A ND1  1 
ATOM   1019  C  CD2  . HIS A  1 61 ? 42.881 72.716 3.481   1.00 28.00  ?  61   HIS A CD2  1 
ATOM   1020  C  CE1  . HIS A  1 61 ? 41.474 71.075 3.109   1.00 25.27  ?  61   HIS A CE1  1 
ATOM   1021  N  NE2  . HIS A  1 61 ? 42.597 71.630 2.689   1.00 26.20  ?  61   HIS A NE2  1 
ATOM   1022  H  H    . HIS A  1 61 ? 39.798 74.448 4.129   1.00 34.36  ?  61   HIS A H    1 
ATOM   1023  H  HA   . HIS A  1 61 ? 39.927 73.033 6.312   1.00 31.41  ?  61   HIS A HA   1 
ATOM   1024  H  HB2  . HIS A  1 61 ? 41.979 74.656 5.209   1.00 33.53  ?  61   HIS A HB2  1 
ATOM   1025  H  HB3  . HIS A  1 61 ? 42.218 73.500 6.270   1.00 33.53  ?  61   HIS A HB3  1 
ATOM   1026  H  HD1  . HIS A  1 61 ? 40.310 71.595 4.584   1.00 31.60  ?  61   HIS A HD1  1 
ATOM   1027  H  HD2  . HIS A  1 61 ? 43.615 73.281 3.400   1.00 33.60  ?  61   HIS A HD2  1 
ATOM   1028  H  HE1  . HIS A  1 61 ? 41.066 70.326 2.739   1.00 30.33  ?  61   HIS A HE1  1 
ATOM   1029  H  HE2  . HIS A  1 61 ? 43.072 71.357 2.027   1.00 31.44  ?  61   HIS A HE2  1 
ATOM   1030  N  N    . ASP A  1 62 ? 40.101 76.197 6.706   1.00 18.81  ?  62   ASP A N    1 
ATOM   1031  C  CA   . ASP A  1 62 ? 40.051 77.290 7.667   1.00 22.24  ?  62   ASP A CA   1 
ATOM   1032  C  C    . ASP A  1 62 ? 38.764 77.263 8.492   1.00 22.64  ?  62   ASP A C    1 
ATOM   1033  O  O    . ASP A  1 62 ? 38.788 77.539 9.690   1.00 22.67  ?  62   ASP A O    1 
ATOM   1034  C  CB   . ASP A  1 62 ? 40.205 78.631 6.945   1.00 27.91  ?  62   ASP A CB   1 
ATOM   1035  C  CG   . ASP A  1 62 ? 41.609 78.836 6.395   1.00 34.35  ?  62   ASP A CG   1 
ATOM   1036  O  OD1  . ASP A  1 62 ? 42.567 78.317 7.009   1.00 36.39  ?  62   ASP A OD1  1 
ATOM   1037  O  OD2  . ASP A  1 62 ? 41.759 79.510 5.354   1.00 38.10  ?  62   ASP A OD2  1 
ATOM   1038  H  H    . ASP A  1 62 ? 40.108 76.454 5.886   1.00 22.57  ?  62   ASP A H    1 
ATOM   1039  H  HA   . ASP A  1 62 ? 40.804 77.197 8.287   1.00 26.69  ?  62   ASP A HA   1 
ATOM   1040  H  HB2  . ASP A  1 62 ? 39.583 78.664 6.201   1.00 33.49  ?  62   ASP A HB2  1 
ATOM   1041  H  HB3  . ASP A  1 62 ? 40.018 79.350 7.568   1.00 33.49  ?  62   ASP A HB3  1 
ATOM   1042  N  N    . GLU A  1 63 ? 37.644 76.928 7.859   1.00 24.92  ?  63   GLU A N    1 
ATOM   1043  C  CA   . GLU A  1 63 ? 36.385 76.815 8.589   1.00 27.32  ?  63   GLU A CA   1 
ATOM   1044  C  C    . GLU A  1 63 ? 36.450 75.679 9.604   1.00 26.34  ?  63   GLU A C    1 
ATOM   1045  O  O    . GLU A  1 63 ? 36.039 75.844 10.751  1.00 27.77  ?  63   GLU A O    1 
ATOM   1046  C  CB   . GLU A  1 63 ? 35.203 76.618 7.637   1.00 29.62  ?  63   GLU A CB   1 
ATOM   1047  C  CG   . GLU A  1 63 ? 34.771 77.894 6.933   1.00 34.54  ?  63   GLU A CG   1 
ATOM   1048  C  CD   . GLU A  1 63 ? 33.448 77.748 6.201   1.00 37.58  ?  63   GLU A CD   1 
ATOM   1049  O  OE1  . GLU A  1 63 ? 32.877 76.634 6.204   1.00 35.00  ?  63   GLU A OE1  1 
ATOM   1050  O  OE2  . GLU A  1 63 ? 32.979 78.754 5.625   1.00 42.63  ?  63   GLU A OE2  1 
ATOM   1051  H  H    . GLU A  1 63 ? 37.586 76.762 7.017   1.00 29.90  ?  63   GLU A H    1 
ATOM   1052  H  HA   . GLU A  1 63 ? 36.234 77.648 9.083   1.00 32.79  ?  63   GLU A HA   1 
ATOM   1053  H  HB2  . GLU A  1 63 ? 35.452 75.973 6.957   1.00 35.54  ?  63   GLU A HB2  1 
ATOM   1054  H  HB3  . GLU A  1 63 ? 34.445 76.286 8.143   1.00 35.54  ?  63   GLU A HB3  1 
ATOM   1055  H  HG2  . GLU A  1 63 ? 34.672 78.600 7.591   1.00 41.45  ?  63   GLU A HG2  1 
ATOM   1056  H  HG3  . GLU A  1 63 ? 35.447 78.140 6.283   1.00 41.45  ?  63   GLU A HG3  1 
ATOM   1057  N  N    . LEU A  1 64 ? 36.973 74.528 9.192   1.00 24.57  ?  64   LEU A N    1 
ATOM   1058  C  CA   . LEU A  1 64 ? 37.114 73.410 10.116  1.00 23.31  ?  64   LEU A CA   1 
ATOM   1059  C  C    . LEU A  1 64 ? 38.016 73.783 11.289  1.00 22.35  ?  64   LEU A C    1 
ATOM   1060  O  O    . LEU A  1 64 ? 37.679 73.505 12.436  1.00 22.73  ?  64   LEU A O    1 
ATOM   1061  C  CB   . LEU A  1 64 ? 37.665 72.165 9.417   1.00 23.28  ?  64   LEU A CB   1 
ATOM   1062  C  CG   . LEU A  1 64 ? 37.852 70.967 10.358  1.00 23.75  ?  64   LEU A CG   1 
ATOM   1063  C  CD1  . LEU A  1 64 ? 36.514 70.511 10.931  1.00 23.35  ?  64   LEU A CD1  1 
ATOM   1064  C  CD2  . LEU A  1 64 ? 38.551 69.811 9.662   1.00 23.20  ?  64   LEU A CD2  1 
ATOM   1065  H  H    . LEU A  1 64 ? 37.251 74.371 8.393   1.00 29.49  ?  64   LEU A H    1 
ATOM   1066  H  HA   . LEU A  1 64 ? 36.230 73.185 10.476  1.00 27.97  ?  64   LEU A HA   1 
ATOM   1067  H  HB2  . LEU A  1 64 ? 37.048 71.899 8.717   1.00 27.94  ?  64   LEU A HB2  1 
ATOM   1068  H  HB3  . LEU A  1 64 ? 38.529 72.378 9.031   1.00 27.94  ?  64   LEU A HB3  1 
ATOM   1069  H  HG   . LEU A  1 64 ? 38.411 71.242 11.102  1.00 28.50  ?  64   LEU A HG   1 
ATOM   1070  H  HD11 . LEU A  1 64 ? 35.937 70.254 10.208  1.00 28.01  ?  64   LEU A HD11 1 
ATOM   1071  H  HD12 . LEU A  1 64 ? 36.663 69.763 11.514  1.00 28.01  ?  64   LEU A HD12 1 
ATOM   1072  H  HD13 . LEU A  1 64 ? 36.122 71.237 11.422  1.00 28.01  ?  64   LEU A HD13 1 
ATOM   1073  H  HD21 . LEU A  1 64 ? 39.414 70.104 9.362   1.00 27.83  ?  64   LEU A HD21 1 
ATOM   1074  H  HD22 . LEU A  1 64 ? 38.648 69.086 10.283  1.00 27.83  ?  64   LEU A HD22 1 
ATOM   1075  H  HD23 . LEU A  1 64 ? 38.020 69.532 8.912   1.00 27.83  ?  64   LEU A HD23 1 
ATOM   1076  N  N    . HIS A  1 65 ? 39.156 74.411 11.010  1.00 20.43  ?  65   HIS A N    1 
ATOM   1077  C  CA   . HIS A  1 65 ? 40.104 74.739 12.076  1.00 22.58  ?  65   HIS A CA   1 
ATOM   1078  C  C    . HIS A  1 65 ? 39.481 75.671 13.113  1.00 27.92  ?  65   HIS A C    1 
ATOM   1079  O  O    . HIS A  1 65 ? 39.606 75.439 14.314  1.00 27.96  ?  65   HIS A O    1 
ATOM   1080  C  CB   . HIS A  1 65 ? 41.390 75.368 11.528  1.00 22.45  ?  65   HIS A CB   1 
ATOM   1081  C  CG   . HIS A  1 65 ? 42.322 75.844 12.600  1.00 23.55  ?  65   HIS A CG   1 
ATOM   1082  N  ND1  . HIS A  1 65 ? 43.328 75.058 13.121  1.00 24.21  ?  65   HIS A ND1  1 
ATOM   1083  C  CD2  . HIS A  1 65 ? 42.385 77.021 13.268  1.00 25.65  ?  65   HIS A CD2  1 
ATOM   1084  C  CE1  . HIS A  1 65 ? 43.976 75.733 14.054  1.00 26.11  ?  65   HIS A CE1  1 
ATOM   1085  N  NE2  . HIS A  1 65 ? 43.423 76.926 14.163  1.00 26.95  ?  65   HIS A NE2  1 
ATOM   1086  H  H    . HIS A  1 65 ? 39.403 74.656 10.223  1.00 24.52  ?  65   HIS A H    1 
ATOM   1087  H  HA   . HIS A  1 65 ? 40.354 73.910 12.536  1.00 27.10  ?  65   HIS A HA   1 
ATOM   1088  H  HB2  . HIS A  1 65 ? 41.860 74.708 10.996  1.00 26.94  ?  65   HIS A HB2  1 
ATOM   1089  H  HB3  . HIS A  1 65 ? 41.156 76.131 10.977  1.00 26.94  ?  65   HIS A HB3  1 
ATOM   1090  H  HD1  . HIS A  1 65 ? 43.508 74.254 12.874  1.00 29.05  ?  65   HIS A HD1  1 
ATOM   1091  H  HD2  . HIS A  1 65 ? 41.831 77.758 13.141  1.00 30.78  ?  65   HIS A HD2  1 
ATOM   1092  H  HE1  . HIS A  1 65 ? 44.698 75.420 14.549  1.00 31.33  ?  65   HIS A HE1  1 
ATOM   1093  H  HE2  . HIS A  1 65 ? 43.674 77.545 14.705  1.00 32.33  ?  65   HIS A HE2  1 
ATOM   1094  N  N    . GLU A  1 66 ? 38.816 76.725 12.652  1.00 28.73  ?  66   GLU A N    1 
ATOM   1095  C  CA   . GLU A  1 66 ? 38.183 77.671 13.564  1.00 32.66  ?  66   GLU A CA   1 
ATOM   1096  C  C    . GLU A  1 66 ? 37.200 76.952 14.483  1.00 28.12  ?  66   GLU A C    1 
ATOM   1097  O  O    . GLU A  1 66 ? 37.127 77.245 15.672  1.00 27.88  ?  66   GLU A O    1 
ATOM   1098  C  CB   . GLU A  1 66 ? 37.466 78.780 12.792  1.00 41.03  ?  66   GLU A CB   1 
ATOM   1099  C  CG   . GLU A  1 66 ? 38.394 79.733 12.050  1.00 50.19  ?  66   GLU A CG   1 
ATOM   1100  C  CD   . GLU A  1 66 ? 39.198 80.625 12.983  1.00 59.83  ?  66   GLU A CD   1 
ATOM   1101  O  OE1  . GLU A  1 66 ? 39.160 80.401 14.212  1.00 62.83  ?  66   GLU A OE1  1 
ATOM   1102  O  OE2  . GLU A  1 66 ? 39.865 81.559 12.486  1.00 64.13  ?  66   GLU A OE2  1 
ATOM   1103  H  H    . GLU A  1 66 ? 38.716 76.915 11.819  1.00 34.47  ?  66   GLU A H    1 
ATOM   1104  H  HA   . GLU A  1 66 ? 38.873 78.087 14.123  1.00 39.19  ?  66   GLU A HA   1 
ATOM   1105  H  HB2  . GLU A  1 66 ? 36.878 78.372 12.137  1.00 49.23  ?  66   GLU A HB2  1 
ATOM   1106  H  HB3  . GLU A  1 66 ? 36.943 79.306 13.417  1.00 49.23  ?  66   GLU A HB3  1 
ATOM   1107  H  HG2  . GLU A  1 66 ? 39.019 79.215 11.519  1.00 60.23  ?  66   GLU A HG2  1 
ATOM   1108  H  HG3  . GLU A  1 66 ? 37.864 80.304 11.472  1.00 60.23  ?  66   GLU A HG3  1 
ATOM   1109  N  N    . ILE A  1 67 ? 36.450 76.007 13.925  1.00 28.00  ?  67   ILE A N    1 
ATOM   1110  C  CA   . ILE A  1 67 ? 35.492 75.233 14.703  1.00 29.19  ?  67   ILE A CA   1 
ATOM   1111  C  C    . ILE A  1 67 ? 36.201 74.376 15.748  1.00 29.27  ?  67   ILE A C    1 
ATOM   1112  O  O    . ILE A  1 67 ? 35.903 74.460 16.941  1.00 29.92  ?  67   ILE A O    1 
ATOM   1113  C  CB   . ILE A  1 67 ? 34.627 74.335 13.794  1.00 28.60  ?  67   ILE A CB   1 
ATOM   1114  C  CG1  . ILE A  1 67 ? 33.631 75.193 13.010  1.00 31.55  ?  67   ILE A CG1  1 
ATOM   1115  C  CG2  . ILE A  1 67 ? 33.883 73.291 14.617  1.00 27.41  ?  67   ILE A CG2  1 
ATOM   1116  C  CD1  . ILE A  1 67 ? 32.890 74.443 11.926  1.00 31.40  ?  67   ILE A CD1  1 
ATOM   1117  H  H    . ILE A  1 67 ? 36.478 75.795 13.092  1.00 33.60  ?  67   ILE A H    1 
ATOM   1118  H  HA   . ILE A  1 67 ? 34.894 75.850 15.175  1.00 35.03  ?  67   ILE A HA   1 
ATOM   1119  H  HB   . ILE A  1 67 ? 35.208 73.879 13.164  1.00 34.32  ?  67   ILE A HB   1 
ATOM   1120  H  HG12 . ILE A  1 67 ? 32.971 75.547 13.628  1.00 37.86  ?  67   ILE A HG12 1 
ATOM   1121  H  HG13 . ILE A  1 67 ? 34.111 75.923 12.589  1.00 37.86  ?  67   ILE A HG13 1 
ATOM   1122  H  HG21 . ILE A  1 67 ? 33.315 73.739 15.248  1.00 32.89  ?  67   ILE A HG21 1 
ATOM   1123  H  HG22 . ILE A  1 67 ? 33.355 72.748 14.028  1.00 32.89  ?  67   ILE A HG22 1 
ATOM   1124  H  HG23 . ILE A  1 67 ? 34.523 72.746 15.081  1.00 32.89  ?  67   ILE A HG23 1 
ATOM   1125  H  HD11 . ILE A  1 67 ? 32.397 73.722 12.325  1.00 37.68  ?  67   ILE A HD11 1 
ATOM   1126  H  HD12 . ILE A  1 67 ? 32.288 75.046 11.484  1.00 37.68  ?  67   ILE A HD12 1 
ATOM   1127  H  HD13 . ILE A  1 67 ? 33.526 74.095 11.297  1.00 37.68  ?  67   ILE A HD13 1 
ATOM   1128  N  N    . LEU A  1 68 ? 37.143 73.555 15.297  1.00 29.63  ?  68   LEU A N    1 
ATOM   1129  C  CA   . LEU A  1 68 ? 37.892 72.688 16.201  1.00 26.78  ?  68   LEU A CA   1 
ATOM   1130  C  C    . LEU A  1 68 ? 38.595 73.501 17.288  1.00 27.17  ?  68   LEU A C    1 
ATOM   1131  O  O    . LEU A  1 68 ? 38.593 73.126 18.458  1.00 27.33  ?  68   LEU A O    1 
ATOM   1132  C  CB   . LEU A  1 68 ? 38.913 71.859 15.418  1.00 24.40  ?  68   LEU A CB   1 
ATOM   1133  C  CG   . LEU A  1 68 ? 38.312 70.873 14.413  1.00 23.53  ?  68   LEU A CG   1 
ATOM   1134  C  CD1  . LEU A  1 68 ? 39.406 70.128 13.658  1.00 22.93  ?  68   LEU A CD1  1 
ATOM   1135  C  CD2  . LEU A  1 68 ? 37.383 69.894 15.116  1.00 24.58  ?  68   LEU A CD2  1 
ATOM   1136  H  H    . LEU A  1 68 ? 37.370 73.482 14.471  1.00 35.56  ?  68   LEU A H    1 
ATOM   1137  H  HA   . LEU A  1 68 ? 37.270 72.070 16.639  1.00 32.13  ?  68   LEU A HA   1 
ATOM   1138  H  HB2  . LEU A  1 68 ? 39.488 72.465 14.925  1.00 29.28  ?  68   LEU A HB2  1 
ATOM   1139  H  HB3  . LEU A  1 68 ? 39.443 71.347 16.048  1.00 29.28  ?  68   LEU A HB3  1 
ATOM   1140  H  HG   . LEU A  1 68 ? 37.787 71.368 13.764  1.00 28.24  ?  68   LEU A HG   1 
ATOM   1141  H  HD11 . LEU A  1 68 ? 39.944 69.643 14.288  1.00 27.52  ?  68   LEU A HD11 1 
ATOM   1142  H  HD12 . LEU A  1 68 ? 38.998 69.520 13.038  1.00 27.52  ?  68   LEU A HD12 1 
ATOM   1143  H  HD13 . LEU A  1 68 ? 39.947 70.765 13.186  1.00 27.52  ?  68   LEU A HD13 1 
ATOM   1144  H  HD21 . LEU A  1 68 ? 36.674 70.385 15.538  1.00 29.49  ?  68   LEU A HD21 1 
ATOM   1145  H  HD22 . LEU A  1 68 ? 37.020 69.288 14.466  1.00 29.49  ?  68   LEU A HD22 1 
ATOM   1146  H  HD23 . LEU A  1 68 ? 37.883 69.407 15.774  1.00 29.49  ?  68   LEU A HD23 1 
ATOM   1147  N  N    . TRP A  1 69 ? 39.184 74.620 16.886  1.00 23.15  ?  69   TRP A N    1 
ATOM   1148  C  CA   . TRP A  1 69 ? 39.940 75.474 17.795  1.00 25.48  ?  69   TRP A CA   1 
ATOM   1149  C  C    . TRP A  1 69 ? 39.073 75.969 18.948  1.00 26.79  ?  69   TRP A C    1 
ATOM   1150  O  O    . TRP A  1 69 ? 39.559 76.159 20.065  1.00 27.31  ?  69   TRP A O    1 
ATOM   1151  C  CB   . TRP A  1 69 ? 40.502 76.669 17.022  1.00 27.51  ?  69   TRP A CB   1 
ATOM   1152  C  CG   . TRP A  1 69 ? 41.529 77.474 17.763  1.00 30.63  ?  69   TRP A CG   1 
ATOM   1153  C  CD1  . TRP A  1 69 ? 41.325 78.645 18.434  1.00 35.03  ?  69   TRP A CD1  1 
ATOM   1154  C  CD2  . TRP A  1 69 ? 42.924 77.174 17.894  1.00 30.41  ?  69   TRP A CD2  1 
ATOM   1155  N  NE1  . TRP A  1 69 ? 42.507 79.092 18.974  1.00 36.74  ?  69   TRP A NE1  1 
ATOM   1156  C  CE2  . TRP A  1 69 ? 43.503 78.206 18.658  1.00 33.88  ?  69   TRP A CE2  1 
ATOM   1157  C  CE3  . TRP A  1 69 ? 43.739 76.134 17.440  1.00 27.66  ?  69   TRP A CE3  1 
ATOM   1158  C  CZ2  . TRP A  1 69 ? 44.859 78.228 18.979  1.00 35.09  ?  69   TRP A CZ2  1 
ATOM   1159  C  CZ3  . TRP A  1 69 ? 45.085 76.156 17.759  1.00 29.75  ?  69   TRP A CZ3  1 
ATOM   1160  C  CH2  . TRP A  1 69 ? 45.631 77.196 18.521  1.00 33.08  ?  69   TRP A CH2  1 
ATOM   1161  H  H    . TRP A  1 69 ? 39.161 74.912 16.077  1.00 27.78  ?  69   TRP A H    1 
ATOM   1162  H  HA   . TRP A  1 69 ? 40.691 74.967 18.169  1.00 30.58  ?  69   TRP A HA   1 
ATOM   1163  H  HB2  . TRP A  1 69 ? 40.916 76.343 16.208  1.00 33.01  ?  69   TRP A HB2  1 
ATOM   1164  H  HB3  . TRP A  1 69 ? 39.769 77.264 16.798  1.00 33.01  ?  69   TRP A HB3  1 
ATOM   1165  H  HD1  . TRP A  1 69 ? 40.507 79.079 18.511  1.00 42.03  ?  69   TRP A HD1  1 
ATOM   1166  H  HE1  . TRP A  1 69 ? 42.604 79.809 19.438  1.00 44.09  ?  69   TRP A HE1  1 
ATOM   1167  H  HE3  . TRP A  1 69 ? 43.384 75.441 16.931  1.00 33.19  ?  69   TRP A HE3  1 
ATOM   1168  H  HZ2  . TRP A  1 69 ? 45.224 78.916 19.487  1.00 42.11  ?  69   TRP A HZ2  1 
ATOM   1169  H  HZ3  . TRP A  1 69 ? 45.636 75.469 17.462  1.00 35.70  ?  69   TRP A HZ3  1 
ATOM   1170  H  HH2  . TRP A  1 69 ? 46.539 77.183 18.722  1.00 39.69  ?  69   TRP A HH2  1 
ATOM   1171  N  N    . SER A  1 70 ? 37.785 76.162 18.675  1.00 26.39  ?  70   SER A N    1 
ATOM   1172  C  CA   . SER A  1 70 ? 36.883 76.782 19.636  1.00 30.16  ?  70   SER A CA   1 
ATOM   1173  C  C    . SER A  1 70 ? 36.134 75.773 20.508  1.00 30.77  ?  70   SER A C    1 
ATOM   1174  O  O    . SER A  1 70 ? 35.439 76.160 21.446  1.00 33.72  ?  70   SER A O    1 
ATOM   1175  C  CB   . SER A  1 70 ? 35.878 77.678 18.906  1.00 32.13  ?  70   SER A CB   1 
ATOM   1176  O  OG   . SER A  1 70 ? 35.019 76.918 18.072  1.00 32.83  ?  70   SER A OG   1 
ATOM   1177  H  H    . SER A  1 70 ? 37.409 75.940 17.934  1.00 31.67  ?  70   SER A H    1 
ATOM   1178  H  HA   . SER A  1 70 ? 37.410 77.354 20.233  1.00 36.19  ?  70   SER A HA   1 
ATOM   1179  H  HB2  . SER A  1 70 ? 35.342 78.149 19.563  1.00 38.55  ?  70   SER A HB2  1 
ATOM   1180  H  HB3  . SER A  1 70 ? 36.365 78.314 18.359  1.00 38.55  ?  70   SER A HB3  1 
ATOM   1181  H  HG   . SER A  1 70 ? 35.209 76.122 18.124  1.00 39.39  ?  70   SER A HG   1 
ATOM   1182  N  N    . LEU A  1 71 ? 36.269 74.485 20.207  1.00 30.77  ?  71   LEU A N    1 
ATOM   1183  C  CA   . LEU A  1 71 ? 35.609 73.460 21.010  1.00 28.39  ?  71   LEU A CA   1 
ATOM   1184  C  C    . LEU A  1 71 ? 36.079 73.542 22.458  1.00 28.99  ?  71   LEU A C    1 
ATOM   1185  O  O    . LEU A  1 71 ? 37.276 73.653 22.718  1.00 29.55  ?  71   LEU A O    1 
ATOM   1186  C  CB   . LEU A  1 71 ? 35.897 72.067 20.454  1.00 26.01  ?  71   LEU A CB   1 
ATOM   1187  C  CG   . LEU A  1 71 ? 35.338 71.749 19.067  1.00 25.57  ?  71   LEU A CG   1 
ATOM   1188  C  CD1  . LEU A  1 71 ? 35.649 70.306 18.702  1.00 24.13  ?  71   LEU A CD1  1 
ATOM   1189  C  CD2  . LEU A  1 71 ? 33.838 72.009 19.003  1.00 27.53  ?  71   LEU A CD2  1 
ATOM   1190  H  H    . LEU A  1 71 ? 36.732 74.181 19.549  1.00 36.93  ?  71   LEU A H    1 
ATOM   1191  H  HA   . LEU A  1 71 ? 34.640 73.606 20.991  1.00 34.06  ?  71   LEU A HA   1 
ATOM   1192  H  HB2  . LEU A  1 71 ? 36.859 71.952 20.408  1.00 31.21  ?  71   LEU A HB2  1 
ATOM   1193  H  HB3  . LEU A  1 71 ? 35.526 71.414 21.068  1.00 31.21  ?  71   LEU A HB3  1 
ATOM   1194  H  HG   . LEU A  1 71 ? 35.769 72.322 18.414  1.00 30.69  ?  71   LEU A HG   1 
ATOM   1195  H  HD11 . LEU A  1 71 ? 35.245 69.726 19.352  1.00 28.95  ?  71   LEU A HD11 1 
ATOM   1196  H  HD12 . LEU A  1 71 ? 35.293 70.120 17.831  1.00 28.95  ?  71   LEU A HD12 1 
ATOM   1197  H  HD13 . LEU A  1 71 ? 36.601 70.183 18.701  1.00 28.95  ?  71   LEU A HD13 1 
ATOM   1198  H  HD21 . LEU A  1 71 ? 33.674 72.934 19.199  1.00 33.03  ?  71   LEU A HD21 1 
ATOM   1199  H  HD22 . LEU A  1 71 ? 33.523 71.800 18.121  1.00 33.03  ?  71   LEU A HD22 1 
ATOM   1200  H  HD23 . LEU A  1 71 ? 33.397 71.453 19.650  1.00 33.03  ?  71   LEU A HD23 1 
ATOM   1201  N  N    . PRO A  1 72 ? 35.137 73.495 23.410  1.00 27.02  ?  72   PRO A N    1 
ATOM   1202  C  CA   . PRO A  1 72 ? 35.488 73.560 24.833  1.00 27.25  ?  72   PRO A CA   1 
ATOM   1203  C  C    . PRO A  1 72 ? 36.600 72.595 25.239  1.00 26.23  ?  72   PRO A C    1 
ATOM   1204  O  O    . PRO A  1 72 ? 37.473 72.980 26.015  1.00 27.97  ?  72   PRO A O    1 
ATOM   1205  C  CB   . PRO A  1 72 ? 34.176 73.193 25.525  1.00 27.44  ?  72   PRO A CB   1 
ATOM   1206  C  CG   . PRO A  1 72 ? 33.132 73.707 24.602  1.00 27.89  ?  72   PRO A CG   1 
ATOM   1207  C  CD   . PRO A  1 72 ? 33.676 73.495 23.210  1.00 26.87  ?  72   PRO A CD   1 
ATOM   1208  H  HA   . PRO A  1 72 ? 35.743 74.474 25.081  1.00 32.69  ?  72   PRO A HA   1 
ATOM   1209  H  HB2  . PRO A  1 72 ? 34.111 72.230 25.621  1.00 32.93  ?  72   PRO A HB2  1 
ATOM   1210  H  HB3  . PRO A  1 72 ? 34.123 73.633 26.388  1.00 32.93  ?  72   PRO A HB3  1 
ATOM   1211  H  HG2  . PRO A  1 72 ? 32.311 73.205 24.728  1.00 33.47  ?  72   PRO A HG2  1 
ATOM   1212  H  HG3  . PRO A  1 72 ? 32.984 74.650 24.771  1.00 33.47  ?  72   PRO A HG3  1 
ATOM   1213  H  HD2  . PRO A  1 72 ? 33.383 72.640 22.859  1.00 32.25  ?  72   PRO A HD2  1 
ATOM   1214  H  HD3  . PRO A  1 72 ? 33.414 74.227 22.630  1.00 32.25  ?  72   PRO A HD3  1 
ATOM   1215  N  N    . PHE A  1 73 ? 36.577 71.371 24.717  1.00 25.57  ?  73   PHE A N    1 
ATOM   1216  C  CA   . PHE A  1 73 ? 37.564 70.361 25.098  1.00 26.94  ?  73   PHE A CA   1 
ATOM   1217  C  C    . PHE A  1 73 ? 38.913 70.516 24.397  1.00 25.63  ?  73   PHE A C    1 
ATOM   1218  O  O    . PHE A  1 73 ? 39.852 69.787 24.708  1.00 25.95  ?  73   PHE A O    1 
ATOM   1219  C  CB   . PHE A  1 73 ? 37.028 68.955 24.810  1.00 27.12  ?  73   PHE A CB   1 
ATOM   1220  C  CG   . PHE A  1 73 ? 36.229 68.367 25.934  1.00 30.24  ?  73   PHE A CG   1 
ATOM   1221  C  CD1  . PHE A  1 73 ? 36.862 67.826 27.038  1.00 33.38  ?  73   PHE A CD1  1 
ATOM   1222  C  CD2  . PHE A  1 73 ? 34.845 68.345 25.884  1.00 30.94  ?  73   PHE A CD2  1 
ATOM   1223  C  CE1  . PHE A  1 73 ? 36.128 67.282 28.077  1.00 35.74  ?  73   PHE A CE1  1 
ATOM   1224  C  CE2  . PHE A  1 73 ? 34.109 67.800 26.919  1.00 33.54  ?  73   PHE A CE2  1 
ATOM   1225  C  CZ   . PHE A  1 73 ? 34.751 67.269 28.016  1.00 35.84  ?  73   PHE A CZ   1 
ATOM   1226  H  H    . PHE A  1 73 ? 36.000 71.099 24.140  1.00 30.68  ?  73   PHE A H    1 
ATOM   1227  H  HA   . PHE A  1 73 ? 37.722 70.427 26.063  1.00 32.33  ?  73   PHE A HA   1 
ATOM   1228  H  HB2  . PHE A  1 73 ? 36.456 68.994 24.028  1.00 32.54  ?  73   PHE A HB2  1 
ATOM   1229  H  HB3  . PHE A  1 73 ? 37.778 68.364 24.638  1.00 32.54  ?  73   PHE A HB3  1 
ATOM   1230  H  HD1  . PHE A  1 73 ? 37.791 67.833 27.085  1.00 40.06  ?  73   PHE A HD1  1 
ATOM   1231  H  HD2  . PHE A  1 73 ? 34.406 68.703 25.147  1.00 37.12  ?  73   PHE A HD2  1 
ATOM   1232  H  HE1  . PHE A  1 73 ? 36.564 66.923 28.815  1.00 42.88  ?  73   PHE A HE1  1 
ATOM   1233  H  HE2  . PHE A  1 73 ? 33.180 67.793 26.876  1.00 40.25  ?  73   PHE A HE2  1 
ATOM   1234  H  HZ   . PHE A  1 73 ? 34.257 66.902 28.713  1.00 43.01  ?  73   PHE A HZ   1 
ATOM   1235  N  N    . PHE A  1 74 ? 39.015 71.459 23.464  1.00 23.81  ?  74   PHE A N    1 
ATOM   1236  C  CA   . PHE A  1 74 ? 40.173 71.518 22.573  1.00 23.51  ?  74   PHE A CA   1 
ATOM   1237  C  C    . PHE A  1 74 ? 41.529 71.407 23.277  1.00 25.47  ?  74   PHE A C    1 
ATOM   1238  O  O    . PHE A  1 74 ? 42.372 70.614 22.865  1.00 24.64  ?  74   PHE A O    1 
ATOM   1239  C  CB   . PHE A  1 74 ? 40.154 72.785 21.714  1.00 24.42  ?  74   PHE A CB   1 
ATOM   1240  C  CG   . PHE A  1 74 ? 41.278 72.842 20.722  1.00 24.87  ?  74   PHE A CG   1 
ATOM   1241  C  CD1  . PHE A  1 74 ? 41.189 72.162 19.519  1.00 23.06  ?  74   PHE A CD1  1 
ATOM   1242  C  CD2  . PHE A  1 74 ? 42.435 73.551 21.004  1.00 27.94  ?  74   PHE A CD2  1 
ATOM   1243  C  CE1  . PHE A  1 74 ? 42.225 72.200 18.605  1.00 23.47  ?  74   PHE A CE1  1 
ATOM   1244  C  CE2  . PHE A  1 74 ? 43.477 73.592 20.094  1.00 28.32  ?  74   PHE A CE2  1 
ATOM   1245  C  CZ   . PHE A  1 74 ? 43.370 72.914 18.892  1.00 26.04  ?  74   PHE A CZ   1 
ATOM   1246  H  H    . PHE A  1 74 ? 38.431 72.075 23.326  1.00 28.57  ?  74   PHE A H    1 
ATOM   1247  H  HA   . PHE A  1 74 ? 40.112 70.758 21.957  1.00 28.21  ?  74   PHE A HA   1 
ATOM   1248  H  HB2  . PHE A  1 74 ? 39.319 72.818 21.221  1.00 29.31  ?  74   PHE A HB2  1 
ATOM   1249  H  HB3  . PHE A  1 74 ? 40.227 73.559 22.293  1.00 29.31  ?  74   PHE A HB3  1 
ATOM   1250  H  HD1  . PHE A  1 74 ? 40.419 71.680 19.320  1.00 27.68  ?  74   PHE A HD1  1 
ATOM   1251  H  HD2  . PHE A  1 74 ? 42.510 74.007 21.811  1.00 33.52  ?  74   PHE A HD2  1 
ATOM   1252  H  HE1  . PHE A  1 74 ? 42.150 71.744 17.798  1.00 28.17  ?  74   PHE A HE1  1 
ATOM   1253  H  HE2  . PHE A  1 74 ? 44.247 74.074 20.290  1.00 33.98  ?  74   PHE A HE2  1 
ATOM   1254  H  HZ   . PHE A  1 74 ? 44.068 72.942 18.278  1.00 31.25  ?  74   PHE A HZ   1 
ATOM   1255  N  N    . PRO A  1 75 ? 41.756 72.209 24.328  1.00 29.85  ?  75   PRO A N    1 
ATOM   1256  C  CA   . PRO A  1 75 ? 43.075 72.147 24.972  1.00 31.09  ?  75   PRO A CA   1 
ATOM   1257  C  C    . PRO A  1 75 ? 43.429 70.769 25.538  1.00 28.71  ?  75   PRO A C    1 
ATOM   1258  O  O    . PRO A  1 75 ? 44.593 70.531 25.857  1.00 29.90  ?  75   PRO A O    1 
ATOM   1259  C  CB   . PRO A  1 75 ? 42.975 73.188 26.098  1.00 34.19  ?  75   PRO A CB   1 
ATOM   1260  C  CG   . PRO A  1 75 ? 41.520 73.492 26.246  1.00 36.02  ?  75   PRO A CG   1 
ATOM   1261  C  CD   . PRO A  1 75 ? 40.907 73.264 24.904  1.00 33.94  ?  75   PRO A CD   1 
ATOM   1262  H  HA   . PRO A  1 75 ? 43.772 72.423 24.341  1.00 37.30  ?  75   PRO A HA   1 
ATOM   1263  H  HB2  . PRO A  1 75 ? 43.330 72.814 26.919  1.00 41.02  ?  75   PRO A HB2  1 
ATOM   1264  H  HB3  . PRO A  1 75 ? 43.466 73.986 25.846  1.00 41.02  ?  75   PRO A HB3  1 
ATOM   1265  H  HG2  . PRO A  1 75 ? 41.130 72.894 26.904  1.00 43.22  ?  75   PRO A HG2  1 
ATOM   1266  H  HG3  . PRO A  1 75 ? 41.408 74.416 26.518  1.00 43.22  ?  75   PRO A HG3  1 
ATOM   1267  H  HD2  . PRO A  1 75 ? 39.994 72.952 24.996  1.00 40.73  ?  75   PRO A HD2  1 
ATOM   1268  H  HD3  . PRO A  1 75 ? 40.957 74.070 24.367  1.00 40.73  ?  75   PRO A HD3  1 
ATOM   1269  N  N    . TYR A  1 76 ? 42.449 69.878 25.652  1.00 26.07  ?  76   TYR A N    1 
ATOM   1270  C  CA   . TYR A  1 76 ? 42.695 68.541 26.185  1.00 26.55  ?  76   TYR A CA   1 
ATOM   1271  C  C    . TYR A  1 76 ? 42.525 67.459 25.123  1.00 25.04  ?  76   TYR A C    1 
ATOM   1272  O  O    . TYR A  1 76 ? 42.542 66.268 25.439  1.00 25.61  ?  76   TYR A O    1 
ATOM   1273  C  CB   . TYR A  1 76 ? 41.749 68.263 27.354  1.00 28.89  ?  76   TYR A CB   1 
ATOM   1274  C  CG   . TYR A  1 76 ? 41.618 69.429 28.303  1.00 31.74  ?  76   TYR A CG   1 
ATOM   1275  C  CD1  . TYR A  1 76 ? 42.689 69.830 29.090  1.00 32.28  ?  76   TYR A CD1  1 
ATOM   1276  C  CD2  . TYR A  1 76 ? 40.426 70.134 28.408  1.00 35.32  ?  76   TYR A CD2  1 
ATOM   1277  C  CE1  . TYR A  1 76 ? 42.578 70.899 29.956  1.00 35.84  ?  76   TYR A CE1  1 
ATOM   1278  C  CE2  . TYR A  1 76 ? 40.305 71.206 29.272  1.00 38.71  ?  76   TYR A CE2  1 
ATOM   1279  C  CZ   . TYR A  1 76 ? 41.384 71.584 30.043  1.00 40.41  ?  76   TYR A CZ   1 
ATOM   1280  O  OH   . TYR A  1 76 ? 41.268 72.650 30.904  1.00 45.08  ?  76   TYR A OH   1 
ATOM   1281  H  H    . TYR A  1 76 ? 41.631 70.022 25.428  1.00 31.28  ?  76   TYR A H    1 
ATOM   1282  H  HA   . TYR A  1 76 ? 43.615 68.495 26.520  1.00 31.86  ?  76   TYR A HA   1 
ATOM   1283  H  HB2  . TYR A  1 76 ? 40.867 68.061 27.005  1.00 34.67  ?  76   TYR A HB2  1 
ATOM   1284  H  HB3  . TYR A  1 76 ? 42.086 67.505 27.858  1.00 34.67  ?  76   TYR A HB3  1 
ATOM   1285  H  HD1  . TYR A  1 76 ? 43.496 69.370 29.032  1.00 38.74  ?  76   TYR A HD1  1 
ATOM   1286  H  HD2  . TYR A  1 76 ? 39.698 69.881 27.887  1.00 42.39  ?  76   TYR A HD2  1 
ATOM   1287  H  HE1  . TYR A  1 76 ? 43.304 71.156 30.478  1.00 43.01  ?  76   TYR A HE1  1 
ATOM   1288  H  HE2  . TYR A  1 76 ? 39.501 71.670 29.332  1.00 46.45  ?  76   TYR A HE2  1 
ATOM   1289  H  HH   . TYR A  1 76 ? 40.677 72.504 31.453  1.00 54.09  ?  76   TYR A HH   1 
ATOM   1290  N  N    . LEU A  1 77 ? 42.368 67.870 23.867  1.00 25.39  ?  77   LEU A N    1 
ATOM   1291  C  CA   . LEU A  1 77 ? 42.110 66.924 22.784  1.00 25.49  ?  77   LEU A CA   1 
ATOM   1292  C  C    . LEU A  1 77 ? 43.359 66.541 21.994  1.00 26.43  ?  77   LEU A C    1 
ATOM   1293  O  O    . LEU A  1 77 ? 44.217 67.378 21.708  1.00 25.69  ?  77   LEU A O    1 
ATOM   1294  C  CB   . LEU A  1 77 ? 41.082 67.495 21.803  1.00 24.96  ?  77   LEU A CB   1 
ATOM   1295  C  CG   . LEU A  1 77 ? 39.625 67.601 22.253  1.00 23.47  ?  77   LEU A CG   1 
ATOM   1296  C  CD1  . LEU A  1 77 ? 38.766 68.044 21.080  1.00 22.16  ?  77   LEU A CD1  1 
ATOM   1297  C  CD2  . LEU A  1 77 ? 39.118 66.287 22.829  1.00 23.37  ?  77   LEU A CD2  1 
ATOM   1298  H  H    . LEU A  1 77 ? 42.406 68.691 23.615  1.00 30.47  ?  77   LEU A H    1 
ATOM   1299  H  HA   . LEU A  1 77 ? 41.734 66.103 23.167  1.00 30.59  ?  77   LEU A HA   1 
ATOM   1300  H  HB2  . LEU A  1 77 ? 41.368 68.391 21.564  1.00 29.95  ?  77   LEU A HB2  1 
ATOM   1301  H  HB3  . LEU A  1 77 ? 41.091 66.939 21.008  1.00 29.95  ?  77   LEU A HB3  1 
ATOM   1302  H  HG   . LEU A  1 77 ? 39.557 68.277 22.946  1.00 28.16  ?  77   LEU A HG   1 
ATOM   1303  H  HD11 . LEU A  1 77 ? 38.842 67.396 20.376  1.00 26.60  ?  77   LEU A HD11 1 
ATOM   1304  H  HD12 . LEU A  1 77 ? 37.853 68.108 21.369  1.00 26.60  ?  77   LEU A HD12 1 
ATOM   1305  H  HD13 . LEU A  1 77 ? 39.074 68.899 20.773  1.00 26.60  ?  77   LEU A HD13 1 
ATOM   1306  H  HD21 . LEU A  1 77 ? 39.657 66.050 23.587  1.00 28.04  ?  77   LEU A HD21 1 
ATOM   1307  H  HD22 . LEU A  1 77 ? 38.203 66.396 23.098  1.00 28.04  ?  77   LEU A HD22 1 
ATOM   1308  H  HD23 . LEU A  1 77 ? 39.183 65.606 22.155  1.00 28.04  ?  77   LEU A HD23 1 
ATOM   1309  N  N    . THR A  1 78 ? 43.444 65.260 21.653  1.00 28.16  ?  78   THR A N    1 
ATOM   1310  C  CA   . THR A  1 78 ? 44.342 64.798 20.608  1.00 28.27  ?  78   THR A CA   1 
ATOM   1311  C  C    . THR A  1 78 ? 43.476 64.599 19.374  1.00 26.68  ?  78   THR A C    1 
ATOM   1312  O  O    . THR A  1 78 ? 42.529 63.813 19.398  1.00 26.59  ?  78   THR A O    1 
ATOM   1313  C  CB   . THR A  1 78 ? 45.030 63.473 20.979  1.00 29.69  ?  78   THR A CB   1 
ATOM   1314  O  OG1  . THR A  1 78 ? 45.948 63.694 22.057  1.00 31.08  ?  78   THR A OG1  1 
ATOM   1315  C  CG2  . THR A  1 78 ? 45.788 62.907 19.784  1.00 29.03  ?  78   THR A CG2  1 
ATOM   1316  H  H    . THR A  1 78 ? 42.985 64.632 22.019  1.00 33.79  ?  78   THR A H    1 
ATOM   1317  H  HA   . THR A  1 78 ? 45.024 65.476 20.420  1.00 33.92  ?  78   THR A HA   1 
ATOM   1318  H  HB   . THR A  1 78 ? 44.361 62.827 21.253  1.00 35.63  ?  78   THR A HB   1 
ATOM   1319  H  HG1  . THR A  1 78 ? 45.548 63.982 22.712  1.00 37.29  ?  78   THR A HG1  1 
ATOM   1320  H  HG21 . THR A  1 78 ? 46.458 63.530 19.496  1.00 34.83  ?  78   THR A HG21 1 
ATOM   1321  H  HG22 . THR A  1 78 ? 46.213 62.081 20.027  1.00 34.83  ?  78   THR A HG22 1 
ATOM   1322  H  HG23 . THR A  1 78 ? 45.180 62.744 19.058  1.00 34.83  ?  78   THR A HG23 1 
ATOM   1323  N  N    . ILE A  1 79 ? 43.796 65.317 18.303  1.00 25.18  ?  79   ILE A N    1 
ATOM   1324  C  CA   . ILE A  1 79 ? 42.920 65.378 17.140  1.00 25.92  ?  79   ILE A CA   1 
ATOM   1325  C  C    . ILE A  1 79 ? 43.581 64.875 15.863  1.00 27.22  ?  79   ILE A C    1 
ATOM   1326  O  O    . ILE A  1 79 ? 44.696 65.279 15.523  1.00 27.43  ?  79   ILE A O    1 
ATOM   1327  C  CB   . ILE A  1 79 ? 42.441 66.821 16.890  1.00 26.79  ?  79   ILE A CB   1 
ATOM   1328  C  CG1  . ILE A  1 79 ? 41.534 67.283 18.034  1.00 27.21  ?  79   ILE A CG1  1 
ATOM   1329  C  CG2  . ILE A  1 79 ? 41.710 66.917 15.558  1.00 27.40  ?  79   ILE A CG2  1 
ATOM   1330  C  CD1  . ILE A  1 79 ? 41.024 68.702 17.880  1.00 27.71  ?  79   ILE A CD1  1 
ATOM   1331  H  H    . ILE A  1 79 ? 44.517 65.779 18.224  1.00 30.22  ?  79   ILE A H    1 
ATOM   1332  H  HA   . ILE A  1 79 ? 42.130 64.823 17.309  1.00 31.11  ?  79   ILE A HA   1 
ATOM   1333  H  HB   . ILE A  1 79 ? 43.217 67.402 16.858  1.00 32.15  ?  79   ILE A HB   1 
ATOM   1334  H  HG12 . ILE A  1 79 ? 40.764 66.695 18.078  1.00 32.65  ?  79   ILE A HG12 1 
ATOM   1335  H  HG13 . ILE A  1 79 ? 42.031 67.236 18.865  1.00 32.65  ?  79   ILE A HG13 1 
ATOM   1336  H  HG21 . ILE A  1 79 ? 40.950 66.330 15.576  1.00 32.88  ?  79   ILE A HG21 1 
ATOM   1337  H  HG22 . ILE A  1 79 ? 41.422 67.823 15.425  1.00 32.88  ?  79   ILE A HG22 1 
ATOM   1338  H  HG23 . ILE A  1 79 ? 42.309 66.656 14.854  1.00 32.88  ?  79   ILE A HG23 1 
ATOM   1339  H  HD11 . ILE A  1 79 ? 40.518 68.765 17.067  1.00 33.25  ?  79   ILE A HD11 1 
ATOM   1340  H  HD12 . ILE A  1 79 ? 40.467 68.916 18.631  1.00 33.25  ?  79   ILE A HD12 1 
ATOM   1341  H  HD13 . ILE A  1 79 ? 41.774 69.301 17.847  1.00 33.25  ?  79   ILE A HD13 1 
ATOM   1342  N  N    . ASP A  1 80 ? 42.879 63.990 15.162  1.00 30.58  ?  80   ASP A N    1 
ATOM   1343  C  CA   A ASP A  1 80 ? 43.316 63.518 13.855  0.65 32.43  ?  80   ASP A CA   1 
ATOM   1344  C  CA   B ASP A  1 80 ? 43.318 63.524 13.854  0.35 32.18  ?  80   ASP A CA   1 
ATOM   1345  C  C    . ASP A  1 80 ? 42.314 63.964 12.795  1.00 28.73  ?  80   ASP A C    1 
ATOM   1346  O  O    . ASP A  1 80 ? 41.112 63.727 12.929  1.00 32.31  ?  80   ASP A O    1 
ATOM   1347  C  CB   A ASP A  1 80 ? 43.443 61.993 13.846  0.65 32.51  ?  80   ASP A CB   1 
ATOM   1348  C  CB   B ASP A  1 80 ? 43.463 62.002 13.840  0.35 32.38  ?  80   ASP A CB   1 
ATOM   1349  C  CG   A ASP A  1 80 ? 44.587 61.496 14.712  0.65 34.56  ?  80   ASP A CG   1 
ATOM   1350  C  CG   B ASP A  1 80 ? 44.059 61.487 12.543  0.35 34.50  ?  80   ASP A CG   1 
ATOM   1351  O  OD1  A ASP A  1 80 ? 45.699 62.056 14.610  0.65 33.97  ?  80   ASP A OD1  1 
ATOM   1352  O  OD1  B ASP A  1 80 ? 45.303 61.428 12.440  0.35 36.03  ?  80   ASP A OD1  1 
ATOM   1353  O  OD2  A ASP A  1 80 ? 44.374 60.548 15.498  0.65 36.92  ?  80   ASP A OD2  1 
ATOM   1354  O  OD2  B ASP A  1 80 ? 43.285 61.143 11.626  0.35 35.09  ?  80   ASP A OD2  1 
ATOM   1355  H  H    A ASP A  1 80 ? 42.138 63.644 15.426  0.65 36.69  ?  80   ASP A H    1 
ATOM   1356  H  H    B ASP A  1 80 ? 42.138 63.642 15.426  0.35 36.69  ?  80   ASP A H    1 
ATOM   1357  H  HA   A ASP A  1 80 ? 44.190 63.906 13.641  0.65 38.92  ?  80   ASP A HA   1 
ATOM   1358  H  HA   B ASP A  1 80 ? 44.189 63.921 13.641  0.35 38.61  ?  80   ASP A HA   1 
ATOM   1359  H  HB2  A ASP A  1 80 ? 42.621 61.605 14.184  0.65 39.01  ?  80   ASP A HB2  1 
ATOM   1360  H  HB2  B ASP A  1 80 ? 44.045 61.732 14.567  0.35 38.85  ?  80   ASP A HB2  1 
ATOM   1361  H  HB3  A ASP A  1 80 ? 43.602 61.694 12.938  0.65 39.01  ?  80   ASP A HB3  1 
ATOM   1362  H  HB3  B ASP A  1 80 ? 42.587 61.600 13.948  0.35 38.85  ?  80   ASP A HB3  1 
ATOM   1363  N  N    . VAL A  1 81 ? 42.813 64.612 11.748  1.00 23.83  ?  81   VAL A N    1 
ATOM   1364  C  CA   . VAL A  1 81 ? 41.966 65.097 10.669  1.00 21.71  ?  81   VAL A CA   1 
ATOM   1365  C  C    . VAL A  1 81 ? 42.389 64.478 9.345   1.00 22.60  ?  81   VAL A C    1 
ATOM   1366  O  O    . VAL A  1 81 ? 43.574 64.445 9.015   1.00 23.68  ?  81   VAL A O    1 
ATOM   1367  C  CB   . VAL A  1 81 ? 42.058 66.629 10.528  1.00 21.56  ?  81   VAL A CB   1 
ATOM   1368  C  CG1  . VAL A  1 81 ? 41.246 67.105 9.325   1.00 22.20  ?  81   VAL A CG1  1 
ATOM   1369  C  CG2  . VAL A  1 81 ? 41.586 67.315 11.799  1.00 22.33  ?  81   VAL A CG2  1 
ATOM   1370  H  H    . VAL A  1 81 ? 43.649 64.784 11.639  1.00 28.60  ?  81   VAL A H    1 
ATOM   1371  H  HA   . VAL A  1 81 ? 41.034 64.854 10.847  1.00 26.05  ?  81   VAL A HA   1 
ATOM   1372  H  HB   . VAL A  1 81 ? 42.993 66.880 10.380  1.00 25.87  ?  81   VAL A HB   1 
ATOM   1373  H  HG11 . VAL A  1 81 ? 40.328 66.853 9.448   1.00 26.64  ?  81   VAL A HG11 1 
ATOM   1374  H  HG12 . VAL A  1 81 ? 41.318 68.060 9.258   1.00 26.64  ?  81   VAL A HG12 1 
ATOM   1375  H  HG13 . VAL A  1 81 ? 41.595 66.693 8.531   1.00 26.64  ?  81   VAL A HG13 1 
ATOM   1376  H  HG21 . VAL A  1 81 ? 42.142 67.033 12.530  1.00 26.80  ?  81   VAL A HG21 1 
ATOM   1377  H  HG22 . VAL A  1 81 ? 41.654 68.266 11.684  1.00 26.80  ?  81   VAL A HG22 1 
ATOM   1378  H  HG23 . VAL A  1 81 ? 40.674 67.069 11.967  1.00 26.80  ?  81   VAL A HG23 1 
ATOM   1379  N  N    . GLU A  1 82 ? 41.420 63.984 8.586   1.00 25.17  ?  82   GLU A N    1 
ATOM   1380  C  CA   . GLU A  1 82 ? 41.702 63.533 7.233   1.00 28.02  ?  82   GLU A CA   1 
ATOM   1381  C  C    . GLU A  1 82 ? 40.522 63.826 6.316   1.00 28.46  ?  82   GLU A C    1 
ATOM   1382  O  O    . GLU A  1 82 ? 39.369 63.590 6.678   1.00 31.16  ?  82   GLU A O    1 
ATOM   1383  C  CB   . GLU A  1 82 ? 42.054 62.044 7.207   1.00 29.58  ?  82   GLU A CB   1 
ATOM   1384  C  CG   . GLU A  1 82 ? 40.869 61.108 7.247   1.00 32.51  ?  82   GLU A CG   1 
ATOM   1385  C  CD   . GLU A  1 82 ? 41.291 59.661 7.399   1.00 37.03  ?  82   GLU A CD   1 
ATOM   1386  O  OE1  . GLU A  1 82 ? 41.587 59.251 8.541   1.00 39.65  ?  82   GLU A OE1  1 
ATOM   1387  O  OE2  . GLU A  1 82 ? 41.334 58.938 6.381   1.00 38.38  ?  82   GLU A OE2  1 
ATOM   1388  H  H    . GLU A  1 82 ? 40.600 63.899 8.828   1.00 30.21  ?  82   GLU A H    1 
ATOM   1389  H  HA   . GLU A  1 82 ? 42.476 64.028 6.891   1.00 33.62  ?  82   GLU A HA   1 
ATOM   1390  H  HB2  . GLU A  1 82 ? 42.548 61.858 6.393   1.00 35.50  ?  82   GLU A HB2  1 
ATOM   1391  H  HB3  . GLU A  1 82 ? 42.610 61.845 7.977   1.00 35.50  ?  82   GLU A HB3  1 
ATOM   1392  H  HG2  . GLU A  1 82 ? 40.306 61.339 8.001   1.00 39.01  ?  82   GLU A HG2  1 
ATOM   1393  H  HG3  . GLU A  1 82 ? 40.370 61.191 6.419   1.00 39.01  ?  82   GLU A HG3  1 
ATOM   1394  N  N    . PRO A  1 83 ? 40.811 64.366 5.126   1.00 26.08  ?  83   PRO A N    1 
ATOM   1395  C  CA   . PRO A  1 83 ? 39.760 64.675 4.154   1.00 25.10  ?  83   PRO A CA   1 
ATOM   1396  C  C    . PRO A  1 83 ? 39.122 63.421 3.568   1.00 25.01  ?  83   PRO A C    1 
ATOM   1397  O  O    . PRO A  1 83 ? 39.791 62.402 3.402   1.00 24.11  ?  83   PRO A O    1 
ATOM   1398  C  CB   . PRO A  1 83 ? 40.503 65.466 3.071   1.00 25.41  ?  83   PRO A CB   1 
ATOM   1399  C  CG   . PRO A  1 83 ? 41.938 65.099 3.227   1.00 25.20  ?  83   PRO A CG   1 
ATOM   1400  C  CD   . PRO A  1 83 ? 42.140 64.814 4.678   1.00 24.48  ?  83   PRO A CD   1 
ATOM   1401  H  HA   . PRO A  1 83 ? 39.070 65.240 4.559   1.00 30.12  ?  83   PRO A HA   1 
ATOM   1402  H  HB2  . PRO A  1 83 ? 40.176 65.205 2.196   1.00 30.49  ?  83   PRO A HB2  1 
ATOM   1403  H  HB3  . PRO A  1 83 ? 40.375 66.416 3.216   1.00 30.49  ?  83   PRO A HB3  1 
ATOM   1404  H  HG2  . PRO A  1 83 ? 42.130 64.310 2.696   1.00 30.24  ?  83   PRO A HG2  1 
ATOM   1405  H  HG3  . PRO A  1 83 ? 42.495 65.842 2.946   1.00 30.24  ?  83   PRO A HG3  1 
ATOM   1406  H  HD2  . PRO A  1 83 ? 42.793 64.106 4.796   1.00 29.38  ?  83   PRO A HD2  1 
ATOM   1407  H  HD3  . PRO A  1 83 ? 42.401 65.621 5.148   1.00 29.38  ?  83   PRO A HD3  1 
ATOM   1408  N  N    . LEU A  1 84 ? 37.828 63.505 3.277   1.00 24.87  ?  84   LEU A N    1 
ATOM   1409  C  CA   . LEU A  1 84 ? 37.099 62.415 2.645   1.00 24.14  ?  84   LEU A CA   1 
ATOM   1410  C  C    . LEU A  1 84 ? 36.637 62.857 1.263   1.00 23.37  ?  84   LEU A C    1 
ATOM   1411  O  O    . LEU A  1 84 ? 36.294 64.021 1.060   1.00 24.83  ?  84   LEU A O    1 
ATOM   1412  C  CB   . LEU A  1 84 ? 35.888 62.020 3.490   1.00 23.77  ?  84   LEU A CB   1 
ATOM   1413  C  CG   . LEU A  1 84 ? 36.173 61.456 4.883   1.00 25.18  ?  84   LEU A CG   1 
ATOM   1414  C  CD1  . LEU A  1 84 ? 34.873 61.277 5.654   1.00 27.86  ?  84   LEU A CD1  1 
ATOM   1415  C  CD2  . LEU A  1 84 ? 36.926 60.139 4.789   1.00 25.17  ?  84   LEU A CD2  1 
ATOM   1416  H  H    . LEU A  1 84 ? 37.342 64.197 3.439   1.00 29.84  ?  84   LEU A H    1 
ATOM   1417  H  HA   . LEU A  1 84 ? 37.686 61.636 2.549   1.00 28.96  ?  84   LEU A HA   1 
ATOM   1418  H  HB2  . LEU A  1 84 ? 35.332 62.806 3.608   1.00 28.53  ?  84   LEU A HB2  1 
ATOM   1419  H  HB3  . LEU A  1 84 ? 35.388 61.345 3.005   1.00 28.53  ?  84   LEU A HB3  1 
ATOM   1420  H  HG   . LEU A  1 84 ? 36.728 62.084 5.371   1.00 30.22  ?  84   LEU A HG   1 
ATOM   1421  H  HD11 . LEU A  1 84 ? 34.306 60.668 5.174   1.00 33.43  ?  84   LEU A HD11 1 
ATOM   1422  H  HD12 . LEU A  1 84 ? 35.072 60.923 6.524   1.00 33.43  ?  84   LEU A HD12 1 
ATOM   1423  H  HD13 . LEU A  1 84 ? 34.440 62.130 5.739   1.00 33.43  ?  84   LEU A HD13 1 
ATOM   1424  H  HD21 . LEU A  1 84 ? 37.758 60.287 4.334   1.00 30.21  ?  84   LEU A HD21 1 
ATOM   1425  H  HD22 . LEU A  1 84 ? 37.091 59.810 5.675   1.00 30.21  ?  84   LEU A HD22 1 
ATOM   1426  H  HD23 . LEU A  1 84 ? 36.393 59.509 4.299   1.00 30.21  ?  84   LEU A HD23 1 
ATOM   1427  N  N    . SER A  1 85 ? 36.631 61.923 0.319   1.00 27.42  ?  85   SER A N    1 
ATOM   1428  C  CA   . SER A  1 85 ? 36.194 62.202 -1.044  1.00 28.20  ?  85   SER A CA   1 
ATOM   1429  C  C    . SER A  1 85 ? 34.993 61.336 -1.384  1.00 29.45  ?  85   SER A C    1 
ATOM   1430  O  O    . SER A  1 85 ? 34.761 60.309 -0.748  1.00 28.44  ?  85   SER A O    1 
ATOM   1431  C  CB   . SER A  1 85 ? 37.325 61.922 -2.038  1.00 28.94  ?  85   SER A CB   1 
ATOM   1432  O  OG   . SER A  1 85 ? 38.428 62.781 -1.817  1.00 30.38  ?  85   SER A OG   1 
ATOM   1433  H  H    . SER A  1 85 ? 36.878 61.108 0.444   1.00 32.91  ?  85   SER A H    1 
ATOM   1434  H  HA   . SER A  1 85 ? 35.934 63.144 -1.121  1.00 33.84  ?  85   SER A HA   1 
ATOM   1435  H  HB2  . SER A  1 85 ? 37.617 61.003 -1.932  1.00 34.73  ?  85   SER A HB2  1 
ATOM   1436  H  HB3  . SER A  1 85 ? 36.994 62.062 -2.939  1.00 34.73  ?  85   SER A HB3  1 
ATOM   1437  H  HG   . SER A  1 85 ? 38.270 63.284 -1.189  1.00 36.46  ?  85   SER A HG   1 
ATOM   1438  N  N    . HIS A  1 86 ? 34.231 61.748 -2.388  1.00 32.46  ?  86   HIS A N    1 
ATOM   1439  C  CA   . HIS A  1 86 ? 33.107 60.951 -2.853  1.00 36.55  ?  86   HIS A CA   1 
ATOM   1440  C  C    . HIS A  1 86 ? 33.620 59.665 -3.489  1.00 35.32  ?  86   HIS A C    1 
ATOM   1441  O  O    . HIS A  1 86 ? 34.542 59.685 -4.303  1.00 34.33  ?  86   HIS A O    1 
ATOM   1442  C  CB   . HIS A  1 86 ? 32.265 61.732 -3.863  1.00 46.23  ?  86   HIS A CB   1 
ATOM   1443  C  CG   . HIS A  1 86 ? 31.061 60.985 -4.347  1.00 50.74  ?  86   HIS A CG   1 
ATOM   1444  N  ND1  . HIS A  1 86 ? 29.917 60.846 -3.590  1.00 52.50  ?  86   HIS A ND1  1 
ATOM   1445  C  CD2  . HIS A  1 86 ? 30.826 60.329 -5.508  1.00 53.20  ?  86   HIS A CD2  1 
ATOM   1446  C  CE1  . HIS A  1 86 ? 29.028 60.140 -4.265  1.00 54.06  ?  86   HIS A CE1  1 
ATOM   1447  N  NE2  . HIS A  1 86 ? 29.554 59.814 -5.432  1.00 54.53  ?  86   HIS A NE2  1 
ATOM   1448  H  H    . HIS A  1 86 ? 34.343 62.486 -2.816  1.00 38.95  ?  86   HIS A H    1 
ATOM   1449  H  HA   . HIS A  1 86 ? 32.538 60.714 -2.092  1.00 43.86  ?  86   HIS A HA   1 
ATOM   1450  H  HB2  . HIS A  1 86 ? 31.958 62.552 -3.445  1.00 55.48  ?  86   HIS A HB2  1 
ATOM   1451  H  HB3  . HIS A  1 86 ? 32.815 61.941 -4.634  1.00 55.48  ?  86   HIS A HB3  1 
ATOM   1452  H  HD1  . HIS A  1 86 ? 29.800 61.170 -2.802  1.00 63.00  ?  86   HIS A HD1  1 
ATOM   1453  H  HD2  . HIS A  1 86 ? 31.414 60.244 -6.223  1.00 63.84  ?  86   HIS A HD2  1 
ATOM   1454  H  HE1  . HIS A  1 86 ? 28.176 59.912 -3.970  1.00 64.88  ?  86   HIS A HE1  1 
ATOM   1455  H  HE2  . HIS A  1 86 ? 29.164 59.354 -6.045  1.00 65.43  ?  86   HIS A HE2  1 
ATOM   1456  N  N    . HIS A  1 87 ? 33.016 58.548 -3.107  1.00 34.21  ?  87   HIS A N    1 
ATOM   1457  C  CA   . HIS A  1 87 ? 33.407 57.249 -3.630  1.00 33.11  ?  87   HIS A CA   1 
ATOM   1458  C  C    . HIS A  1 87 ? 32.557 56.929 -4.859  1.00 36.54  ?  87   HIS A C    1 
ATOM   1459  O  O    . HIS A  1 87 ? 31.341 57.117 -4.836  1.00 37.45  ?  87   HIS A O    1 
ATOM   1460  C  CB   . HIS A  1 87 ? 33.211 56.184 -2.551  1.00 29.49  ?  87   HIS A CB   1 
ATOM   1461  C  CG   . HIS A  1 87 ? 33.971 54.919 -2.801  1.00 29.04  ?  87   HIS A CG   1 
ATOM   1462  N  ND1  . HIS A  1 87 ? 33.471 53.893 -3.571  1.00 29.97  ?  87   HIS A ND1  1 
ATOM   1463  C  CD2  . HIS A  1 87 ? 35.188 54.510 -2.372  1.00 27.63  ?  87   HIS A CD2  1 
ATOM   1464  C  CE1  . HIS A  1 87 ? 34.350 52.907 -3.613  1.00 29.10  ?  87   HIS A CE1  1 
ATOM   1465  N  NE2  . HIS A  1 87 ? 35.400 53.257 -2.893  1.00 27.74  ?  87   HIS A NE2  1 
ATOM   1466  H  H    . HIS A  1 87 ? 32.370 58.516 -2.540  1.00 41.05  ?  87   HIS A H    1 
ATOM   1467  H  HA   . HIS A  1 87 ? 34.351 57.265 -3.892  1.00 39.73  ?  87   HIS A HA   1 
ATOM   1468  H  HB2  . HIS A  1 87 ? 33.507 56.544 -1.700  1.00 35.38  ?  87   HIS A HB2  1 
ATOM   1469  H  HB3  . HIS A  1 87 ? 32.269 55.959 -2.502  1.00 35.38  ?  87   HIS A HB3  1 
ATOM   1470  H  HD1  . HIS A  1 87 ? 32.707 53.895 -3.966  1.00 35.97  ?  87   HIS A HD1  1 
ATOM   1471  H  HD2  . HIS A  1 87 ? 35.772 54.989 -1.829  1.00 33.16  ?  87   HIS A HD2  1 
ATOM   1472  H  HE1  . HIS A  1 87 ? 34.246 52.105 -4.071  1.00 34.92  ?  87   HIS A HE1  1 
ATOM   1473  H  HE2  . HIS A  1 87 ? 36.104 52.777 -2.770  1.00 33.28  ?  87   HIS A HE2  1 
ATOM   1474  N  N    . PRO A  1 88 ? 33.195 56.461 -5.944  1.00 39.35  ?  88   PRO A N    1 
ATOM   1475  C  CA   . PRO A  1 88 ? 32.474 56.107 -7.175  1.00 42.88  ?  88   PRO A CA   1 
ATOM   1476  C  C    . PRO A  1 88 ? 31.344 55.108 -6.933  1.00 42.55  ?  88   PRO A C    1 
ATOM   1477  O  O    . PRO A  1 88 ? 30.232 55.289 -7.428  1.00 45.33  ?  88   PRO A O    1 
ATOM   1478  C  CB   . PRO A  1 88 ? 33.561 55.466 -8.043  1.00 44.68  ?  88   PRO A CB   1 
ATOM   1479  C  CG   . PRO A  1 88 ? 34.832 56.065 -7.561  1.00 43.28  ?  88   PRO A CG   1 
ATOM   1480  C  CD   . PRO A  1 88 ? 34.652 56.297 -6.090  1.00 39.66  ?  88   PRO A CD   1 
ATOM   1481  H  HA   . PRO A  1 88 ? 32.124 56.908 -7.618  1.00 51.46  ?  88   PRO A HA   1 
ATOM   1482  H  HB2  . PRO A  1 88 ? 33.562 54.505 -7.911  1.00 53.61  ?  88   PRO A HB2  1 
ATOM   1483  H  HB3  . PRO A  1 88 ? 33.409 55.686 -8.975  1.00 53.61  ?  88   PRO A HB3  1 
ATOM   1484  H  HG2  . PRO A  1 88 ? 35.563 55.447 -7.720  1.00 51.93  ?  88   PRO A HG2  1 
ATOM   1485  H  HG3  . PRO A  1 88 ? 34.990 56.905 -8.020  1.00 51.93  ?  88   PRO A HG3  1 
ATOM   1486  H  HD2  . PRO A  1 88 ? 34.957 55.526 -5.586  1.00 47.59  ?  88   PRO A HD2  1 
ATOM   1487  H  HD3  . PRO A  1 88 ? 35.112 57.106 -5.816  1.00 47.59  ?  88   PRO A HD3  1 
ATOM   1488  N  N    . ALA A  1 89 ? 31.645 54.058 -6.180  1.00 36.85  ?  89   ALA A N    1 
ATOM   1489  C  CA   . ALA A  1 89 ? 30.671 53.018 -5.856  1.00 35.95  ?  89   ALA A CA   1 
ATOM   1490  C  C    . ALA A  1 89 ? 29.627 53.426 -4.811  1.00 35.28  ?  89   ALA A C    1 
ATOM   1491  O  O    . ALA A  1 89 ? 28.862 52.582 -4.347  1.00 36.81  ?  89   ALA A O    1 
ATOM   1492  C  CB   . ALA A  1 89 ? 31.399 51.760 -5.392  1.00 33.58  ?  89   ALA A CB   1 
ATOM   1493  H  H    . ALA A  1 89 ? 32.422 53.921 -5.837  1.00 44.22  ?  89   ALA A H    1 
ATOM   1494  H  HA   . ALA A  1 89 ? 30.185 52.788 -6.676  1.00 43.14  ?  89   ALA A HA   1 
ATOM   1495  H  HB1  . ALA A  1 89 ? 31.918 51.970 -4.613  1.00 40.29  ?  89   ALA A HB1  1 
ATOM   1496  H  HB2  . ALA A  1 89 ? 30.750 51.084 -5.182  1.00 40.29  ?  89   ALA A HB2  1 
ATOM   1497  H  HB3  . ALA A  1 89 ? 31.974 51.455 -6.097  1.00 40.29  ?  89   ALA A HB3  1 
ATOM   1498  N  N    . ARG A  1 90 ? 29.583 54.704 -4.440  1.00 33.54  ?  90   ARG A N    1 
ATOM   1499  C  CA   . ARG A  1 90 ? 28.619 55.168 -3.442  1.00 33.31  ?  90   ARG A CA   1 
ATOM   1500  C  C    . ARG A  1 90 ? 27.200 55.220 -4.002  1.00 39.66  ?  90   ARG A C    1 
ATOM   1501  O  O    . ARG A  1 90 ? 26.971 55.733 -5.098  1.00 40.01  ?  90   ARG A O    1 
ATOM   1502  C  CB   . ARG A  1 90 ? 29.008 56.553 -2.916  1.00 31.57  ?  90   ARG A CB   1 
ATOM   1503  C  CG   . ARG A  1 90 ? 27.984 57.175 -1.967  1.00 32.95  ?  90   ARG A CG   1 
ATOM   1504  C  CD   . ARG A  1 90 ? 27.746 56.307 -0.735  1.00 32.78  ?  90   ARG A CD   1 
ATOM   1505  N  NE   . ARG A  1 90 ? 26.714 56.861 0.142   1.00 36.16  ?  90   ARG A NE   1 
ATOM   1506  C  CZ   . ARG A  1 90 ? 26.105 56.185 1.113   1.00 36.41  ?  90   ARG A CZ   1 
ATOM   1507  N  NH1  . ARG A  1 90 ? 26.409 54.914 1.343   1.00 35.10  ?  90   ARG A NH1  1 
ATOM   1508  N  NH2  . ARG A  1 90 ? 25.180 56.778 1.855   1.00 38.03  ?  90   ARG A NH2  1 
ATOM   1509  H  H    . ARG A  1 90 ? 30.098 55.320 -4.749  1.00 40.25  ?  90   ARG A H    1 
ATOM   1510  H  HA   . ARG A  1 90 ? 28.622 54.546 -2.685  1.00 39.97  ?  90   ARG A HA   1 
ATOM   1511  H  HB2  . ARG A  1 90 ? 29.847 56.478 -2.436  1.00 37.88  ?  90   ARG A HB2  1 
ATOM   1512  H  HB3  . ARG A  1 90 ? 29.114 57.153 -3.670  1.00 37.88  ?  90   ARG A HB3  1 
ATOM   1513  H  HG2  . ARG A  1 90 ? 28.309 58.039 -1.670  1.00 39.54  ?  90   ARG A HG2  1 
ATOM   1514  H  HG3  . ARG A  1 90 ? 27.139 57.278 -2.432  1.00 39.54  ?  90   ARG A HG3  1 
ATOM   1515  H  HD2  . ARG A  1 90 ? 27.459 55.425 -1.018  1.00 39.34  ?  90   ARG A HD2  1 
ATOM   1516  H  HD3  . ARG A  1 90 ? 28.570 56.243 -0.228  1.00 39.34  ?  90   ARG A HD3  1 
ATOM   1517  H  HE   . ARG A  1 90 ? 26.486 57.682 0.021   1.00 43.39  ?  90   ARG A HE   1 
ATOM   1518  H  HH11 . ARG A  1 90 ? 27.007 54.522 0.866   1.00 42.12  ?  90   ARG A HH11 1 
ATOM   1519  H  HH12 . ARG A  1 90 ? 26.010 54.483 1.971   1.00 42.12  ?  90   ARG A HH12 1 
ATOM   1520  H  HH21 . ARG A  1 90 ? 24.976 57.601 1.711   1.00 45.63  ?  90   ARG A HH21 1 
ATOM   1521  H  HH22 . ARG A  1 90 ? 24.785 56.340 2.481   1.00 45.63  ?  90   ARG A HH22 1 
ATOM   1522  N  N    . VAL A  1 91 ? 26.253 54.685 -3.238  1.00 46.21  ?  91   VAL A N    1 
ATOM   1523  C  CA   . VAL A  1 91 ? 24.838 54.778 -3.579  1.00 55.04  ?  91   VAL A CA   1 
ATOM   1524  C  C    . VAL A  1 91 ? 24.148 55.766 -2.645  1.00 60.57  ?  91   VAL A C    1 
ATOM   1525  O  O    . VAL A  1 91 ? 23.825 55.434 -1.503  1.00 58.50  ?  91   VAL A O    1 
ATOM   1526  C  CB   . VAL A  1 91 ? 24.144 53.407 -3.474  1.00 55.97  ?  91   VAL A CB   1 
ATOM   1527  C  CG1  . VAL A  1 91 ? 22.636 53.553 -3.636  1.00 59.14  ?  91   VAL A CG1  1 
ATOM   1528  C  CG2  . VAL A  1 91 ? 24.705 52.450 -4.513  1.00 56.19  ?  91   VAL A CG2  1 
ATOM   1529  H  H    . VAL A  1 91 ? 26.407 54.257 -2.507  1.00 55.45  ?  91   VAL A H    1 
ATOM   1530  H  HA   . VAL A  1 91 ? 24.745 55.103 -4.499  1.00 66.05  ?  91   VAL A HA   1 
ATOM   1531  H  HB   . VAL A  1 91 ? 24.318 53.028 -2.587  1.00 67.17  ?  91   VAL A HB   1 
ATOM   1532  H  HG11 . VAL A  1 91 ? 22.450 53.934 -4.497  1.00 70.97  ?  91   VAL A HG11 1 
ATOM   1533  H  HG12 . VAL A  1 91 ? 22.229 52.686 -3.566  1.00 70.97  ?  91   VAL A HG12 1 
ATOM   1534  H  HG13 . VAL A  1 91 ? 22.302 54.128 -2.944  1.00 70.97  ?  91   VAL A HG13 1 
ATOM   1535  H  HG21 . VAL A  1 91 ? 25.647 52.341 -4.360  1.00 67.43  ?  91   VAL A HG21 1 
ATOM   1536  H  HG22 . VAL A  1 91 ? 24.260 51.603 -4.430  1.00 67.43  ?  91   VAL A HG22 1 
ATOM   1537  H  HG23 . VAL A  1 91 ? 24.555 52.815 -5.387  1.00 67.43  ?  91   VAL A HG23 1 
ATOM   1538  N  N    . GLY A  1 92 ? 23.932 56.983 -3.135  1.00 64.58  ?  92   GLY A N    1 
ATOM   1539  C  CA   . GLY A  1 92 ? 23.306 58.028 -2.345  1.00 70.46  ?  92   GLY A CA   1 
ATOM   1540  C  C    . GLY A  1 92 ? 24.105 59.316 -2.375  1.00 73.78  ?  92   GLY A C    1 
ATOM   1541  O  O    . GLY A  1 92 ? 23.999 60.146 -1.471  1.00 75.82  ?  92   GLY A O    1 
ATOM   1542  H  H    . GLY A  1 92 ? 24.142 57.228 -3.932  1.00 77.49  ?  92   GLY A H    1 
ATOM   1543  H  HA2  . GLY A  1 92 ? 22.417 58.208 -2.690  1.00 84.55  ?  92   GLY A HA2  1 
ATOM   1544  H  HA3  . GLY A  1 92 ? 23.226 57.735 -1.424  1.00 84.55  ?  92   GLY A HA3  1 
ATOM   1545  N  N    . MET B  1 1  ? 42.161 75.779 -1.766  1.00 35.74  ?  1    MET B N    1 
ATOM   1546  C  CA   . MET B  1 1  ? 42.703 75.615 -0.388  1.00 33.02  ?  1    MET B CA   1 
ATOM   1547  C  C    . MET B  1 1  ? 43.940 74.720 -0.413  1.00 26.91  ?  1    MET B C    1 
ATOM   1548  O  O    . MET B  1 1  ? 44.167 73.981 -1.374  1.00 27.08  ?  1    MET B O    1 
ATOM   1549  C  CB   . MET B  1 1  ? 41.635 75.045 0.548   1.00 33.88  ?  1    MET B CB   1 
ATOM   1550  C  CG   . MET B  1 1  ? 40.905 73.831 0.004   1.00 36.35  ?  1    MET B CG   1 
ATOM   1551  S  SD   . MET B  1 1  ? 39.640 73.211 1.138   1.00 46.70  ?  1    MET B SD   1 
ATOM   1552  C  CE   . MET B  1 1  ? 38.145 73.722 0.295   1.00 45.94  ?  1    MET B CE   1 
ATOM   1553  H  H1   . MET B  1 1  ? 42.171 74.932 -2.216  1.00 42.88  ?  1    MET B H1   1 
ATOM   1554  H  H2   . MET B  1 1  ? 41.260 76.106 -1.718  1.00 42.88  ?  1    MET B H2   1 
ATOM   1555  H  H3   . MET B  1 1  ? 42.704 76.405 -2.251  1.00 42.88  ?  1    MET B H3   1 
ATOM   1556  H  HA   . MET B  1 1  ? 42.960 76.496 -0.045  1.00 39.62  ?  1    MET B HA   1 
ATOM   1557  H  HB2  . MET B  1 1  ? 42.059 74.785 1.381   1.00 40.66  ?  1    MET B HB2  1 
ATOM   1558  H  HB3  . MET B  1 1  ? 40.974 75.734 0.720   1.00 40.66  ?  1    MET B HB3  1 
ATOM   1559  H  HG2  . MET B  1 1  ? 40.469 74.071 -0.829  1.00 43.62  ?  1    MET B HG2  1 
ATOM   1560  H  HG3  . MET B  1 1  ? 41.545 73.119 -0.149  1.00 43.62  ?  1    MET B HG3  1 
ATOM   1561  H  HE1  . MET B  1 1  ? 38.120 73.311 -0.573  1.00 55.12  ?  1    MET B HE1  1 
ATOM   1562  H  HE2  . MET B  1 1  ? 37.385 73.443 0.811   1.00 55.12  ?  1    MET B HE2  1 
ATOM   1563  H  HE3  . MET B  1 1  ? 38.148 74.678 0.205   1.00 55.12  ?  1    MET B HE3  1 
ATOM   1564  N  N    . LEU B  1 2  ? 44.731 74.784 0.653   1.00 24.58  ?  2    LEU B N    1 
ATOM   1565  C  CA   . LEU B  1 2  ? 46.073 74.214 0.640   1.00 22.21  ?  2    LEU B CA   1 
ATOM   1566  C  C    . LEU B  1 2  ? 46.146 72.826 1.268   1.00 21.52  ?  2    LEU B C    1 
ATOM   1567  O  O    . LEU B  1 2  ? 45.569 72.575 2.330   1.00 22.90  ?  2    LEU B O    1 
ATOM   1568  C  CB   . LEU B  1 2  ? 47.041 75.164 1.348   1.00 21.78  ?  2    LEU B CB   1 
ATOM   1569  C  CG   . LEU B  1 2  ? 47.049 76.587 0.779   1.00 23.78  ?  2    LEU B CG   1 
ATOM   1570  C  CD1  . LEU B  1 2  ? 47.912 77.513 1.623   1.00 25.02  ?  2    LEU B CD1  1 
ATOM   1571  C  CD2  . LEU B  1 2  ? 47.520 76.585 -0.670  1.00 24.14  ?  2    LEU B CD2  1 
ATOM   1572  H  H    . LEU B  1 2  ? 44.513 75.153 1.399   1.00 29.50  ?  2    LEU B H    1 
ATOM   1573  H  HA   . LEU B  1 2  ? 46.366 74.132 -0.292  1.00 26.65  ?  2    LEU B HA   1 
ATOM   1574  H  HB2  . LEU B  1 2  ? 46.794 75.221 2.284   1.00 26.14  ?  2    LEU B HB2  1 
ATOM   1575  H  HB3  . LEU B  1 2  ? 47.941 74.809 1.268   1.00 26.14  ?  2    LEU B HB3  1 
ATOM   1576  H  HG   . LEU B  1 2  ? 46.143 76.933 0.795   1.00 28.54  ?  2    LEU B HG   1 
ATOM   1577  H  HD11 . LEU B  1 2  ? 48.812 77.179 1.633   1.00 30.02  ?  2    LEU B HD11 1 
ATOM   1578  H  HD12 . LEU B  1 2  ? 47.894 78.393 1.239   1.00 30.02  ?  2    LEU B HD12 1 
ATOM   1579  H  HD13 . LEU B  1 2  ? 47.562 77.538 2.516   1.00 30.02  ?  2    LEU B HD13 1 
ATOM   1580  H  HD21 . LEU B  1 2  ? 46.925 76.042 -1.191  1.00 28.97  ?  2    LEU B HD21 1 
ATOM   1581  H  HD22 . LEU B  1 2  ? 47.515 77.486 -1.000  1.00 28.97  ?  2    LEU B HD22 1 
ATOM   1582  H  HD23 . LEU B  1 2  ? 48.410 76.226 -0.708  1.00 28.97  ?  2    LEU B HD23 1 
ATOM   1583  N  N    . TYR B  1 3  ? 46.861 71.929 0.593   1.00 18.80  ?  3    TYR B N    1 
ATOM   1584  C  CA   . TYR B  1 3  ? 47.140 70.599 1.119   1.00 18.48  ?  3    TYR B CA   1 
ATOM   1585  C  C    . TYR B  1 3  ? 48.641 70.335 1.055   1.00 19.13  ?  3    TYR B C    1 
ATOM   1586  O  O    . TYR B  1 3  ? 49.269 70.533 0.014   1.00 19.20  ?  3    TYR B O    1 
ATOM   1587  C  CB   . TYR B  1 3  ? 46.438 69.519 0.297   1.00 19.35  ?  3    TYR B CB   1 
ATOM   1588  C  CG   . TYR B  1 3  ? 44.936 69.646 0.161   1.00 21.10  ?  3    TYR B CG   1 
ATOM   1589  C  CD1  . TYR B  1 3  ? 44.372 70.594 -0.680  1.00 20.57  ?  3    TYR B CD1  1 
ATOM   1590  C  CD2  . TYR B  1 3  ? 44.083 68.779 0.837   1.00 22.35  ?  3    TYR B CD2  1 
ATOM   1591  C  CE1  . TYR B  1 3  ? 42.999 70.695 -0.826  1.00 21.62  ?  3    TYR B CE1  1 
ATOM   1592  C  CE2  . TYR B  1 3  ? 42.708 68.872 0.696   1.00 22.84  ?  3    TYR B CE2  1 
ATOM   1593  C  CZ   . TYR B  1 3  ? 42.173 69.832 -0.138  1.00 22.33  ?  3    TYR B CZ   1 
ATOM   1594  O  OH   . TYR B  1 3  ? 40.809 69.931 -0.287  1.00 23.31  ?  3    TYR B OH   1 
ATOM   1595  H  H    . TYR B  1 3  ? 47.200 72.071 -0.185  1.00 22.56  ?  3    TYR B H    1 
ATOM   1596  H  HA   . TYR B  1 3  ? 46.844 70.536 2.051   1.00 22.18  ?  3    TYR B HA   1 
ATOM   1597  H  HB2  . TYR B  1 3  ? 46.810 69.529 -0.599  1.00 23.22  ?  3    TYR B HB2  1 
ATOM   1598  H  HB3  . TYR B  1 3  ? 46.618 68.659 0.709   1.00 23.22  ?  3    TYR B HB3  1 
ATOM   1599  H  HD1  . TYR B  1 3  ? 44.925 71.177 -1.147  1.00 24.68  ?  3    TYR B HD1  1 
ATOM   1600  H  HD2  . TYR B  1 3  ? 44.441 68.130 1.398   1.00 26.82  ?  3    TYR B HD2  1 
ATOM   1601  H  HE1  . TYR B  1 3  ? 42.636 71.341 -1.388  1.00 25.95  ?  3    TYR B HE1  1 
ATOM   1602  H  HE2  . TYR B  1 3  ? 42.150 68.291 1.160   1.00 27.41  ?  3    TYR B HE2  1 
ATOM   1603  H  HH   . TYR B  1 3  ? 40.459 70.087 0.438   1.00 27.97  ?  3    TYR B HH   1 
ATOM   1604  N  N    . LEU B  1 4  ? 49.220 69.889 2.162   1.00 21.29  ?  4    LEU B N    1 
ATOM   1605  C  CA   . LEU B  1 4  ? 50.593 69.411 2.145   1.00 20.68  ?  4    LEU B CA   1 
ATOM   1606  C  C    . LEU B  1 4  ? 50.580 67.955 1.701   1.00 21.00  ?  4    LEU B C    1 
ATOM   1607  O  O    . LEU B  1 4  ? 49.944 67.118 2.335   1.00 22.89  ?  4    LEU B O    1 
ATOM   1608  C  CB   . LEU B  1 4  ? 51.226 69.526 3.530   1.00 19.89  ?  4    LEU B CB   1 
ATOM   1609  C  CG   . LEU B  1 4  ? 52.703 69.135 3.605   1.00 20.74  ?  4    LEU B CG   1 
ATOM   1610  C  CD1  . LEU B  1 4  ? 53.567 70.184 2.929   1.00 19.28  ?  4    LEU B CD1  1 
ATOM   1611  C  CD2  . LEU B  1 4  ? 53.132 68.931 5.051   1.00 23.57  ?  4    LEU B CD2  1 
ATOM   1612  H  H    . LEU B  1 4  ? 48.839 69.852 2.932   1.00 25.55  ?  4    LEU B H    1 
ATOM   1613  H  HA   . LEU B  1 4  ? 51.123 69.934 1.508   1.00 24.82  ?  4    LEU B HA   1 
ATOM   1614  H  HB2  . LEU B  1 4  ? 51.152 70.446 3.827   1.00 23.86  ?  4    LEU B HB2  1 
ATOM   1615  H  HB3  . LEU B  1 4  ? 50.740 68.948 4.139   1.00 23.86  ?  4    LEU B HB3  1 
ATOM   1616  H  HG   . LEU B  1 4  ? 52.830 68.296 3.136   1.00 24.89  ?  4    LEU B HG   1 
ATOM   1617  H  HD11 . LEU B  1 4  ? 53.441 71.026 3.372   1.00 23.13  ?  4    LEU B HD11 1 
ATOM   1618  H  HD12 . LEU B  1 4  ? 54.487 69.916 2.990   1.00 23.13  ?  4    LEU B HD12 1 
ATOM   1619  H  HD13 . LEU B  1 4  ? 53.307 70.255 2.008   1.00 23.13  ?  4    LEU B HD13 1 
ATOM   1620  H  HD21 . LEU B  1 4  ? 52.602 68.231 5.438   1.00 28.29  ?  4    LEU B HD21 1 
ATOM   1621  H  HD22 . LEU B  1 4  ? 54.061 68.688 5.069   1.00 28.29  ?  4    LEU B HD22 1 
ATOM   1622  H  HD23 . LEU B  1 4  ? 52.998 69.749 5.535   1.00 28.29  ?  4    LEU B HD23 1 
ATOM   1623  N  N    . VAL B  1 5  ? 51.279 67.656 0.612   1.00 17.11  ?  5    VAL B N    1 
ATOM   1624  C  CA   . VAL B  1 5  ? 51.269 66.310 0.052   1.00 17.60  ?  5    VAL B CA   1 
ATOM   1625  C  C    . VAL B  1 5  ? 52.685 65.763 -0.092  1.00 19.79  ?  5    VAL B C    1 
ATOM   1626  O  O    . VAL B  1 5  ? 53.515 66.333 -0.801  1.00 19.78  ?  5    VAL B O    1 
ATOM   1627  C  CB   . VAL B  1 5  ? 50.575 66.283 -1.322  1.00 17.87  ?  5    VAL B CB   1 
ATOM   1628  C  CG1  . VAL B  1 5  ? 50.472 64.858 -1.841  1.00 19.33  ?  5    VAL B CG1  1 
ATOM   1629  C  CG2  . VAL B  1 5  ? 49.194 66.919 -1.227  1.00 18.34  ?  5    VAL B CG2  1 
ATOM   1630  H  H    . VAL B  1 5  ? 51.767 68.215 0.177   1.00 20.54  ?  5    VAL B H    1 
ATOM   1631  H  HA   . VAL B  1 5  ? 50.774 65.716 0.654   1.00 21.12  ?  5    VAL B HA   1 
ATOM   1632  H  HB   . VAL B  1 5  ? 51.107 66.802 -1.961  1.00 21.44  ?  5    VAL B HB   1 
ATOM   1633  H  HG11 . VAL B  1 5  ? 49.960 64.336 -1.219  1.00 23.20  ?  5    VAL B HG11 1 
ATOM   1634  H  HG12 . VAL B  1 5  ? 50.037 64.869 -2.696  1.00 23.20  ?  5    VAL B HG12 1 
ATOM   1635  H  HG13 . VAL B  1 5  ? 51.356 64.493 -1.927  1.00 23.20  ?  5    VAL B HG13 1 
ATOM   1636  H  HG21 . VAL B  1 5  ? 49.289 67.829 -0.937  1.00 22.01  ?  5    VAL B HG21 1 
ATOM   1637  H  HG22 . VAL B  1 5  ? 48.779 66.892 -2.092  1.00 22.01  ?  5    VAL B HG22 1 
ATOM   1638  H  HG23 . VAL B  1 5  ? 48.667 66.426 -0.595  1.00 22.01  ?  5    VAL B HG23 1 
ATOM   1639  N  N    . ARG B  1 6  ? 52.953 64.659 0.597   1.00 22.92  ?  6    ARG B N    1 
ATOM   1640  C  CA   . ARG B  1 6  ? 54.233 63.976 0.493   1.00 23.69  ?  6    ARG B CA   1 
ATOM   1641  C  C    . ARG B  1 6  ? 54.086 62.784 -0.438  1.00 25.89  ?  6    ARG B C    1 
ATOM   1642  O  O    . ARG B  1 6  ? 53.155 61.994 -0.301  1.00 27.45  ?  6    ARG B O    1 
ATOM   1643  C  CB   . ARG B  1 6  ? 54.707 63.503 1.872   1.00 23.37  ?  6    ARG B CB   1 
ATOM   1644  C  CG   . ARG B  1 6  ? 56.093 62.866 1.864   1.00 24.54  ?  6    ARG B CG   1 
ATOM   1645  C  CD   . ARG B  1 6  ? 56.529 62.439 3.260   1.00 27.02  ?  6    ARG B CD   1 
ATOM   1646  N  NE   . ARG B  1 6  ? 56.611 63.572 4.180   1.00 28.30  ?  6    ARG B NE   1 
ATOM   1647  C  CZ   . ARG B  1 6  ? 57.657 64.388 4.283   1.00 29.43  ?  6    ARG B CZ   1 
ATOM   1648  N  NH1  . ARG B  1 6  ? 58.732 64.210 3.523   1.00 29.14  ?  6    ARG B NH1  1 
ATOM   1649  N  NH2  . ARG B  1 6  ? 57.628 65.388 5.151   1.00 30.13  ?  6    ARG B NH2  1 
ATOM   1650  H  H    . ARG B  1 6  ? 52.401 64.282 1.139   1.00 27.50  ?  6    ARG B H    1 
ATOM   1651  H  HA   . ARG B  1 6  ? 54.904 64.586 0.122   1.00 28.43  ?  6    ARG B HA   1 
ATOM   1652  H  HB2  . ARG B  1 6  ? 54.734 64.265 2.471   1.00 28.04  ?  6    ARG B HB2  1 
ATOM   1653  H  HB3  . ARG B  1 6  ? 54.080 62.843 2.208   1.00 28.04  ?  6    ARG B HB3  1 
ATOM   1654  H  HG2  . ARG B  1 6  ? 56.079 62.079 1.297   1.00 29.45  ?  6    ARG B HG2  1 
ATOM   1655  H  HG3  . ARG B  1 6  ? 56.737 63.509 1.529   1.00 29.45  ?  6    ARG B HG3  1 
ATOM   1656  H  HD2  . ARG B  1 6  ? 55.885 61.807 3.616   1.00 32.43  ?  6    ARG B HD2  1 
ATOM   1657  H  HD3  . ARG B  1 6  ? 57.406 62.028 3.208   1.00 32.43  ?  6    ARG B HD3  1 
ATOM   1658  H  HE   . ARG B  1 6  ? 55.936 63.722 4.691   1.00 33.96  ?  6    ARG B HE   1 
ATOM   1659  H  HH11 . ARG B  1 6  ? 58.756 63.563 2.957   1.00 34.97  ?  6    ARG B HH11 1 
ATOM   1660  H  HH12 . ARG B  1 6  ? 59.403 64.743 3.596   1.00 34.97  ?  6    ARG B HH12 1 
ATOM   1661  H  HH21 . ARG B  1 6  ? 56.935 65.508 5.646   1.00 36.16  ?  6    ARG B HH21 1 
ATOM   1662  H  HH22 . ARG B  1 6  ? 58.302 65.918 5.221   1.00 36.16  ?  6    ARG B HH22 1 
ATOM   1663  N  N    . MET B  1 7  ? 55.002 62.661 -1.392  1.00 23.62  ?  7    MET B N    1 
ATOM   1664  C  CA   . MET B  1 7  ? 54.993 61.538 -2.317  1.00 23.72  ?  7    MET B CA   1 
ATOM   1665  C  C    . MET B  1 7  ? 56.330 60.814 -2.257  1.00 22.53  ?  7    MET B C    1 
ATOM   1666  O  O    . MET B  1 7  ? 57.388 61.439 -2.324  1.00 21.89  ?  7    MET B O    1 
ATOM   1667  C  CB   . MET B  1 7  ? 54.736 62.014 -3.748  1.00 24.44  ?  7    MET B CB   1 
ATOM   1668  C  CG   . MET B  1 7  ? 53.594 63.004 -3.894  1.00 25.10  ?  7    MET B CG   1 
ATOM   1669  S  SD   . MET B  1 7  ? 53.187 63.330 -5.625  1.00 24.14  ?  7    MET B SD   1 
ATOM   1670  C  CE   . MET B  1 7  ? 52.356 64.907 -5.483  1.00 27.63  ?  7    MET B CE   1 
ATOM   1671  H  H    . MET B  1 7  ? 55.643 63.219 -1.524  1.00 28.34  ?  7    MET B H    1 
ATOM   1672  H  HA   . MET B  1 7  ? 54.277 60.917 -2.066  1.00 28.46  ?  7    MET B HA   1 
ATOM   1673  H  HB2  . MET B  1 7  ? 55.540 62.443 -4.080  1.00 29.32  ?  7    MET B HB2  1 
ATOM   1674  H  HB3  . MET B  1 7  ? 54.528 61.243 -4.298  1.00 29.32  ?  7    MET B HB3  1 
ATOM   1675  H  HG2  . MET B  1 7  ? 52.804 62.644 -3.461  1.00 30.13  ?  7    MET B HG2  1 
ATOM   1676  H  HG3  . MET B  1 7  ? 53.847 63.845 -3.480  1.00 30.13  ?  7    MET B HG3  1 
ATOM   1677  H  HE1  . MET B  1 7  ? 52.961 65.546 -5.101  1.00 33.16  ?  7    MET B HE1  1 
ATOM   1678  H  HE2  . MET B  1 7  ? 52.083 65.196 -6.357  1.00 33.16  ?  7    MET B HE2  1 
ATOM   1679  H  HE3  . MET B  1 7  ? 51.587 64.804 -4.918  1.00 33.16  ?  7    MET B HE3  1 
ATOM   1680  N  N    . THR B  1 8  ? 56.276 59.494 -2.124  1.00 23.03  ?  8    THR B N    1 
ATOM   1681  C  CA   . THR B  1 8  ? 57.480 58.677 -2.137  1.00 24.04  ?  8    THR B CA   1 
ATOM   1682  C  C    . THR B  1 8  ? 57.338 57.599 -3.202  1.00 24.38  ?  8    THR B C    1 
ATOM   1683  O  O    . THR B  1 8  ? 56.327 56.899 -3.256  1.00 24.96  ?  8    THR B O    1 
ATOM   1684  C  CB   . THR B  1 8  ? 57.732 58.022 -0.769  1.00 26.55  ?  8    THR B CB   1 
ATOM   1685  O  OG1  . THR B  1 8  ? 57.751 59.032 0.249   1.00 27.91  ?  8    THR B OG1  1 
ATOM   1686  C  CG2  . THR B  1 8  ? 59.060 57.284 -0.768  1.00 27.37  ?  8    THR B CG2  1 
ATOM   1687  H  H    . THR B  1 8  ? 55.549 59.046 -2.025  1.00 27.63  ?  8    THR B H    1 
ATOM   1688  H  HA   . THR B  1 8  ? 58.252 59.236 -2.362  1.00 28.85  ?  8    THR B HA   1 
ATOM   1689  H  HB   . THR B  1 8  ? 57.026 57.385 -0.579  1.00 31.86  ?  8    THR B HB   1 
ATOM   1690  H  HG1  . THR B  1 8  ? 57.032 59.425 0.267   1.00 33.49  ?  8    THR B HG1  1 
ATOM   1691  H  HG21 . THR B  1 8  ? 59.776 57.896 -0.953  1.00 32.84  ?  8    THR B HG21 1 
ATOM   1692  H  HG22 . THR B  1 8  ? 59.209 56.879 0.090   1.00 32.84  ?  8    THR B HG22 1 
ATOM   1693  H  HG23 . THR B  1 8  ? 59.054 56.598 -1.440  1.00 32.84  ?  8    THR B HG23 1 
ATOM   1694  N  N    . VAL B  1 9  ? 58.355 57.477 -4.049  1.00 23.39  ?  9    VAL B N    1 
ATOM   1695  C  CA   . VAL B  1 9  ? 58.318 56.552 -5.174  1.00 26.37  ?  9    VAL B CA   1 
ATOM   1696  C  C    . VAL B  1 9  ? 58.973 55.216 -4.840  1.00 28.27  ?  9    VAL B C    1 
ATOM   1697  O  O    . VAL B  1 9  ? 60.085 55.171 -4.312  1.00 28.69  ?  9    VAL B O    1 
ATOM   1698  C  CB   . VAL B  1 9  ? 59.049 57.143 -6.396  1.00 26.96  ?  9    VAL B CB   1 
ATOM   1699  C  CG1  . VAL B  1 9  ? 59.079 56.133 -7.544  1.00 28.15  ?  9    VAL B CG1  1 
ATOM   1700  C  CG2  . VAL B  1 9  ? 58.391 58.441 -6.832  1.00 27.99  ?  9    VAL B CG2  1 
ATOM   1701  H  H    . VAL B  1 9  ? 59.087 57.925 -3.992  1.00 28.06  ?  9    VAL B H    1 
ATOM   1702  H  HA   . VAL B  1 9  ? 57.386 56.384 -5.424  1.00 31.65  ?  9    VAL B HA   1 
ATOM   1703  H  HB   . VAL B  1 9  ? 59.975 57.343 -6.147  1.00 32.36  ?  9    VAL B HB   1 
ATOM   1704  H  HG11 . VAL B  1 9  ? 58.177 55.914 -7.791  1.00 33.78  ?  9    VAL B HG11 1 
ATOM   1705  H  HG12 . VAL B  1 9  ? 59.538 56.523 -8.291  1.00 33.78  ?  9    VAL B HG12 1 
ATOM   1706  H  HG13 . VAL B  1 9  ? 59.540 55.343 -7.252  1.00 33.78  ?  9    VAL B HG13 1 
ATOM   1707  H  HG21 . VAL B  1 9  ? 58.429 59.069 -6.107  1.00 33.59  ?  9    VAL B HG21 1 
ATOM   1708  H  HG22 . VAL B  1 9  ? 58.862 58.789 -7.593  1.00 33.59  ?  9    VAL B HG22 1 
ATOM   1709  H  HG23 . VAL B  1 9  ? 57.477 58.264 -7.065  1.00 33.59  ?  9    VAL B HG23 1 
ATOM   1710  N  N    . ASN B  1 10 ? 58.275 54.130 -5.160  1.00 29.29  ?  10   ASN B N    1 
ATOM   1711  C  CA   . ASN B  1 10 ? 58.840 52.791 -5.064  1.00 33.18  ?  10   ASN B CA   1 
ATOM   1712  C  C    . ASN B  1 10 ? 58.622 52.027 -6.368  1.00 35.71  ?  10   ASN B C    1 
ATOM   1713  O  O    . ASN B  1 10 ? 57.576 51.411 -6.574  1.00 38.74  ?  10   ASN B O    1 
ATOM   1714  C  CB   . ASN B  1 10 ? 58.228 52.027 -3.890  1.00 35.80  ?  10   ASN B CB   1 
ATOM   1715  C  CG   . ASN B  1 10 ? 58.680 52.568 -2.546  1.00 39.10  ?  10   ASN B CG   1 
ATOM   1716  O  OD1  . ASN B  1 10 ? 57.978 53.355 -1.909  1.00 39.41  ?  10   ASN B OD1  1 
ATOM   1717  N  ND2  . ASN B  1 10 ? 59.864 52.151 -2.110  1.00 42.09  ?  10   ASN B ND2  1 
ATOM   1718  H  H    . ASN B  1 10 ? 57.462 54.145 -5.439  1.00 35.15  ?  10   ASN B H    1 
ATOM   1719  H  HA   . ASN B  1 10 ? 59.805 52.861 -4.911  1.00 39.82  ?  10   ASN B HA   1 
ATOM   1720  H  HB2  . ASN B  1 10 ? 57.261 52.101 -3.934  1.00 42.96  ?  10   ASN B HB2  1 
ATOM   1721  H  HB3  . ASN B  1 10 ? 58.493 51.096 -3.944  1.00 42.96  ?  10   ASN B HB3  1 
ATOM   1722  H  HD21 . ASN B  1 10 ? 60.329 51.605 -2.584  1.00 50.50  ?  10   ASN B HD21 1 
ATOM   1723  H  HD22 . ASN B  1 10 ? 60.166 52.428 -1.353  1.00 50.50  ?  10   ASN B HD22 1 
ATOM   1724  N  N    . LEU B  1 11 ? 59.616 52.079 -7.248  1.00 34.55  ?  11   LEU B N    1 
ATOM   1725  C  CA   . LEU B  1 11 ? 59.508 51.460 -8.562  1.00 37.83  ?  11   LEU B CA   1 
ATOM   1726  C  C    . LEU B  1 11 ? 59.584 49.942 -8.467  1.00 39.88  ?  11   LEU B C    1 
ATOM   1727  O  O    . LEU B  1 11 ? 60.389 49.406 -7.708  1.00 41.23  ?  11   LEU B O    1 
ATOM   1728  C  CB   . LEU B  1 11 ? 60.630 51.956 -9.476  1.00 38.80  ?  11   LEU B CB   1 
ATOM   1729  C  CG   . LEU B  1 11 ? 60.665 53.449 -9.800  1.00 37.87  ?  11   LEU B CG   1 
ATOM   1730  C  CD1  . LEU B  1 11 ? 61.837 53.750 -10.723 1.00 39.49  ?  11   LEU B CD1  1 
ATOM   1731  C  CD2  . LEU B  1 11 ? 59.358 53.901 -10.428 1.00 36.48  ?  11   LEU B CD2  1 
ATOM   1732  H  H    . LEU B  1 11 ? 60.369 52.470 -7.106  1.00 41.46  ?  11   LEU B H    1 
ATOM   1733  H  HA   . LEU B  1 11 ? 58.649 51.703 -8.967  1.00 45.40  ?  11   LEU B HA   1 
ATOM   1734  H  HB2  . LEU B  1 11 ? 61.477 51.736 -9.057  1.00 46.56  ?  11   LEU B HB2  1 
ATOM   1735  H  HB3  . LEU B  1 11 ? 60.560 51.484 -10.320 1.00 46.56  ?  11   LEU B HB3  1 
ATOM   1736  H  HG   . LEU B  1 11 ? 60.793 53.949 -8.979  1.00 45.45  ?  11   LEU B HG   1 
ATOM   1737  H  HD11 . LEU B  1 11 ? 61.731 53.248 -11.535 1.00 47.39  ?  11   LEU B HD11 1 
ATOM   1738  H  HD12 . LEU B  1 11 ? 61.847 54.690 -10.919 1.00 47.39  ?  11   LEU B HD12 1 
ATOM   1739  H  HD13 . LEU B  1 11 ? 62.652 53.497 -10.285 1.00 47.39  ?  11   LEU B HD13 1 
ATOM   1740  H  HD21 . LEU B  1 11 ? 58.641 53.732 -9.812  1.00 43.78  ?  11   LEU B HD21 1 
ATOM   1741  H  HD22 . LEU B  1 11 ? 59.411 54.840 -10.620 1.00 43.78  ?  11   LEU B HD22 1 
ATOM   1742  H  HD23 . LEU B  1 11 ? 59.215 53.408 -11.240 1.00 43.78  ?  11   LEU B HD23 1 
ATOM   1743  N  N    . PRO B  1 12 ? 58.741 49.240 -9.239  1.00 39.51  ?  12   PRO B N    1 
ATOM   1744  C  CA   . PRO B  1 12 ? 58.867 47.781 -9.320  1.00 43.33  ?  12   PRO B CA   1 
ATOM   1745  C  C    . PRO B  1 12 ? 60.185 47.376 -9.977  1.00 48.60  ?  12   PRO B C    1 
ATOM   1746  O  O    . PRO B  1 12 ? 60.766 48.167 -10.720 1.00 44.15  ?  12   PRO B O    1 
ATOM   1747  C  CB   . PRO B  1 12 ? 57.668 47.365 -10.182 1.00 45.23  ?  12   PRO B CB   1 
ATOM   1748  C  CG   . PRO B  1 12 ? 57.247 48.601 -10.902 1.00 43.31  ?  12   PRO B CG   1 
ATOM   1749  C  CD   . PRO B  1 12 ? 57.591 49.745 -10.008 1.00 39.30  ?  12   PRO B CD   1 
ATOM   1750  H  HA   . PRO B  1 12 ? 58.796 47.374 -8.432  1.00 52.00  ?  12   PRO B HA   1 
ATOM   1751  H  HB2  . PRO B  1 12 ? 57.942 46.679 -10.812 1.00 54.27  ?  12   PRO B HB2  1 
ATOM   1752  H  HB3  . PRO B  1 12 ? 56.954 47.041 -9.612  1.00 54.27  ?  12   PRO B HB3  1 
ATOM   1753  H  HG2  . PRO B  1 12 ? 57.730 48.668 -11.740 1.00 51.97  ?  12   PRO B HG2  1 
ATOM   1754  H  HG3  . PRO B  1 12 ? 56.291 48.572 -11.063 1.00 51.97  ?  12   PRO B HG3  1 
ATOM   1755  H  HD2  . PRO B  1 12 ? 57.848 50.520 -10.533 1.00 47.16  ?  12   PRO B HD2  1 
ATOM   1756  H  HD3  . PRO B  1 12 ? 56.850 49.947 -9.415  1.00 47.16  ?  12   PRO B HD3  1 
ATOM   1757  N  N    . ARG B  1 13 ? 60.650 46.162 -9.703  1.00 60.90  ?  13   ARG B N    1 
ATOM   1758  C  CA   . ARG B  1 13 ? 61.952 45.715 -10.189 1.00 67.92  ?  13   ARG B CA   1 
ATOM   1759  C  C    . ARG B  1 13 ? 62.002 45.570 -11.708 1.00 68.83  ?  13   ARG B C    1 
ATOM   1760  O  O    . ARG B  1 13 ? 63.074 45.653 -12.306 1.00 67.41  ?  13   ARG B O    1 
ATOM   1761  C  CB   . ARG B  1 13 ? 62.336 44.385 -9.538  1.00 74.64  ?  13   ARG B CB   1 
ATOM   1762  C  CG   . ARG B  1 13 ? 62.744 44.504 -8.077  1.00 76.61  ?  13   ARG B CG   1 
ATOM   1763  C  CD   . ARG B  1 13 ? 63.665 43.366 -7.657  1.00 80.38  ?  13   ARG B CD   1 
ATOM   1764  N  NE   . ARG B  1 13 ? 64.890 43.332 -8.457  1.00 80.40  ?  13   ARG B NE   1 
ATOM   1765  C  CZ   . ARG B  1 13 ? 65.257 42.334 -9.260  1.00 81.24  ?  13   ARG B CZ   1 
ATOM   1766  N  NH1  . ARG B  1 13 ? 64.512 41.243 -9.389  1.00 83.65  ?  13   ARG B NH1  1 
ATOM   1767  N  NH2  . ARG B  1 13 ? 66.393 42.424 -9.937  1.00 80.14  ?  13   ARG B NH2  1 
ATOM   1768  H  H    . ARG B  1 13 ? 60.230 45.575 -9.235  1.00 73.08  ?  13   ARG B H    1 
ATOM   1769  H  HA   . ARG B  1 13 ? 62.626 46.378 -9.931  1.00 81.50  ?  13   ARG B HA   1 
ATOM   1770  H  HB2  . ARG B  1 13 ? 61.576 43.784 -9.584  1.00 89.57  ?  13   ARG B HB2  1 
ATOM   1771  H  HB3  . ARG B  1 13 ? 63.084 44.005 -10.024 1.00 89.57  ?  13   ARG B HB3  1 
ATOM   1772  H  HG2  . ARG B  1 13 ? 63.216 45.342 -7.945  1.00 91.93  ?  13   ARG B HG2  1 
ATOM   1773  H  HG3  . ARG B  1 13 ? 61.951 44.475 -7.520  1.00 91.93  ?  13   ARG B HG3  1 
ATOM   1774  H  HD2  . ARG B  1 13 ? 63.913 43.484 -6.727  1.00 96.46  ?  13   ARG B HD2  1 
ATOM   1775  H  HD3  . ARG B  1 13 ? 63.202 42.522 -7.776  1.00 96.46  ?  13   ARG B HD3  1 
ATOM   1776  H  HE   . ARG B  1 13 ? 65.416 44.011 -8.405  1.00 96.49  ?  13   ARG B HE   1 
ATOM   1777  H  HH11 . ARG B  1 13 ? 63.773 41.173 -8.955  1.00 100.38 ?  13   ARG B HH11 1 
ATOM   1778  H  HH12 . ARG B  1 13 ? 64.766 40.608 -9.911  1.00 100.38 ?  13   ARG B HH12 1 
ATOM   1779  H  HH21 . ARG B  1 13 ? 66.886 43.124 -9.860  1.00 96.17  ?  13   ARG B HH21 1 
ATOM   1780  H  HH22 . ARG B  1 13 ? 66.638 41.781 -10.454 1.00 96.17  ?  13   ARG B HH22 1 
ATOM   1781  N  N    . ASN B  1 14 ? 60.846 45.360 -12.329 1.00 59.56  ?  14   ASN B N    1 
ATOM   1782  C  CA   . ASN B  1 14 ? 60.791 45.074 -13.761 1.00 62.11  ?  14   ASN B CA   1 
ATOM   1783  C  C    . ASN B  1 14 ? 60.555 46.310 -14.631 1.00 56.56  ?  14   ASN B C    1 
ATOM   1784  O  O    . ASN B  1 14 ? 60.292 46.190 -15.827 1.00 58.37  ?  14   ASN B O    1 
ATOM   1785  C  CB   . ASN B  1 14 ? 59.713 44.026 -14.051 1.00 68.11  ?  14   ASN B CB   1 
ATOM   1786  C  CG   . ASN B  1 14 ? 58.344 44.448 -13.561 1.00 68.78  ?  14   ASN B CG   1 
ATOM   1787  O  OD1  . ASN B  1 14 ? 57.595 45.118 -14.273 1.00 68.62  ?  14   ASN B OD1  1 
ATOM   1788  N  ND2  . ASN B  1 14 ? 58.008 44.057 -12.336 1.00 69.51  ?  14   ASN B ND2  1 
ATOM   1789  H  H    . ASN B  1 14 ? 60.077 45.378 -11.944 1.00 71.47  ?  14   ASN B H    1 
ATOM   1790  H  HA   . ASN B  1 14 ? 61.651 44.690 -14.030 1.00 74.53  ?  14   ASN B HA   1 
ATOM   1791  H  HB2  . ASN B  1 14 ? 59.659 43.885 -15.009 1.00 81.73  ?  14   ASN B HB2  1 
ATOM   1792  H  HB3  . ASN B  1 14 ? 59.950 43.198 -13.605 1.00 81.73  ?  14   ASN B HB3  1 
ATOM   1793  H  HD21 . ASN B  1 14 ? 58.557 43.589 -11.868 1.00 83.41  ?  14   ASN B HD21 1 
ATOM   1794  H  HD22 . ASN B  1 14 ? 57.240 44.271 -12.012 1.00 83.41  ?  14   ASN B HD22 1 
ATOM   1795  N  N    . LEU B  1 15 ? 60.649 47.492 -14.032 1.00 55.91  ?  15   LEU B N    1 
ATOM   1796  C  CA   . LEU B  1 15 ? 60.532 48.735 -14.786 1.00 51.33  ?  15   LEU B CA   1 
ATOM   1797  C  C    . LEU B  1 15 ? 61.931 49.216 -15.157 1.00 48.63  ?  15   LEU B C    1 
ATOM   1798  O  O    . LEU B  1 15 ? 62.642 49.777 -14.324 1.00 48.21  ?  15   LEU B O    1 
ATOM   1799  C  CB   . LEU B  1 15 ? 59.792 49.789 -13.960 1.00 49.46  ?  15   LEU B CB   1 
ATOM   1800  C  CG   . LEU B  1 15 ? 59.202 50.980 -14.722 1.00 50.82  ?  15   LEU B CG   1 
ATOM   1801  C  CD1  . LEU B  1 15 ? 58.097 51.634 -13.905 1.00 52.40  ?  15   LEU B CD1  1 
ATOM   1802  C  CD2  . LEU B  1 15 ? 60.274 52.000 -15.069 1.00 48.87  ?  15   LEU B CD2  1 
ATOM   1803  H  H    . LEU B  1 15 ? 60.782 47.603 -13.189 1.00 67.09  ?  15   LEU B H    1 
ATOM   1804  H  HA   . LEU B  1 15 ? 60.027 48.573 -15.611 1.00 61.59  ?  15   LEU B HA   1 
ATOM   1805  H  HB2  . LEU B  1 15 ? 59.058 49.352 -13.501 1.00 59.35  ?  15   LEU B HB2  1 
ATOM   1806  H  HB3  . LEU B  1 15 ? 60.410 50.148 -13.304 1.00 59.35  ?  15   LEU B HB3  1 
ATOM   1807  H  HG   . LEU B  1 15 ? 58.813 50.662 -15.551 1.00 60.98  ?  15   LEU B HG   1 
ATOM   1808  H  HD11 . LEU B  1 15 ? 58.464 51.940 -13.072 1.00 62.88  ?  15   LEU B HD11 1 
ATOM   1809  H  HD12 . LEU B  1 15 ? 57.741 52.376 -14.399 1.00 62.88  ?  15   LEU B HD12 1 
ATOM   1810  H  HD13 . LEU B  1 15 ? 57.406 50.988 -13.741 1.00 62.88  ?  15   LEU B HD13 1 
ATOM   1811  H  HD21 . LEU B  1 15 ? 60.939 51.579 -15.620 1.00 58.64  ?  15   LEU B HD21 1 
ATOM   1812  H  HD22 . LEU B  1 15 ? 59.869 52.729 -15.545 1.00 58.64  ?  15   LEU B HD22 1 
ATOM   1813  H  HD23 . LEU B  1 15 ? 60.675 52.320 -14.258 1.00 58.64  ?  15   LEU B HD23 1 
ATOM   1814  N  N    . ASP B  1 16 ? 62.324 48.989 -16.408 1.00 47.22  ?  16   ASP B N    1 
ATOM   1815  C  CA   . ASP B  1 16 ? 63.696 49.243 -16.841 1.00 47.49  ?  16   ASP B CA   1 
ATOM   1816  C  C    . ASP B  1 16 ? 63.951 50.723 -17.147 1.00 44.98  ?  16   ASP B C    1 
ATOM   1817  O  O    . ASP B  1 16 ? 63.010 51.505 -17.288 1.00 42.37  ?  16   ASP B O    1 
ATOM   1818  C  CB   . ASP B  1 16 ? 64.045 48.363 -18.052 1.00 53.63  ?  16   ASP B CB   1 
ATOM   1819  C  CG   . ASP B  1 16 ? 63.221 48.697 -19.287 1.00 58.24  ?  16   ASP B CG   1 
ATOM   1820  O  OD1  . ASP B  1 16 ? 62.729 49.840 -19.399 1.00 57.42  ?  16   ASP B OD1  1 
ATOM   1821  O  OD2  . ASP B  1 16 ? 63.076 47.810 -20.156 1.00 63.11  ?  16   ASP B OD2  1 
ATOM   1822  H  H    . ASP B  1 16 ? 61.812 48.686 -17.029 1.00 56.66  ?  16   ASP B H    1 
ATOM   1823  H  HA   . ASP B  1 16 ? 64.300 48.989 -16.112 1.00 56.98  ?  16   ASP B HA   1 
ATOM   1824  H  HB2  . ASP B  1 16 ? 64.981 48.489 -18.273 1.00 64.36  ?  16   ASP B HB2  1 
ATOM   1825  H  HB3  . ASP B  1 16 ? 63.881 47.435 -17.824 1.00 64.36  ?  16   ASP B HB3  1 
ATOM   1826  N  N    . PRO B  1 17 ? 65.236 51.109 -17.235 1.00 49.11  ?  17   PRO B N    1 
ATOM   1827  C  CA   . PRO B  1 17 ? 65.675 52.494 -17.455 1.00 47.32  ?  17   PRO B CA   1 
ATOM   1828  C  C    . PRO B  1 17 ? 64.976 53.227 -18.602 1.00 43.08  ?  17   PRO B C    1 
ATOM   1829  O  O    . PRO B  1 17 ? 64.620 54.393 -18.436 1.00 40.03  ?  17   PRO B O    1 
ATOM   1830  C  CB   . PRO B  1 17 ? 67.165 52.331 -17.759 1.00 50.68  ?  17   PRO B CB   1 
ATOM   1831  C  CG   . PRO B  1 17 ? 67.561 51.143 -16.962 1.00 51.41  ?  17   PRO B CG   1 
ATOM   1832  C  CD   . PRO B  1 17 ? 66.381 50.211 -17.000 1.00 51.61  ?  17   PRO B CD   1 
ATOM   1833  H  HA   . PRO B  1 17 ? 65.572 53.015 -16.632 1.00 56.78  ?  17   PRO B HA   1 
ATOM   1834  H  HB2  . PRO B  1 17 ? 67.294 52.171 -18.707 1.00 60.82  ?  17   PRO B HB2  1 
ATOM   1835  H  HB3  . PRO B  1 17 ? 67.650 53.120 -17.470 1.00 60.82  ?  17   PRO B HB3  1 
ATOM   1836  H  HG2  . PRO B  1 17 ? 68.339 50.726 -17.366 1.00 61.69  ?  17   PRO B HG2  1 
ATOM   1837  H  HG3  . PRO B  1 17 ? 67.754 51.413 -16.050 1.00 61.69  ?  17   PRO B HG3  1 
ATOM   1838  H  HD2  . PRO B  1 17 ? 66.472 49.581 -17.732 1.00 61.93  ?  17   PRO B HD2  1 
ATOM   1839  H  HD3  . PRO B  1 17 ? 66.284 49.755 -16.149 1.00 61.93  ?  17   PRO B HD3  1 
ATOM   1840  N  N    . ARG B  1 18 ? 64.795 52.572 -19.745 1.00 39.15  ?  18   ARG B N    1 
ATOM   1841  C  CA   . ARG B  1 18 ? 64.137 53.216 -20.877 1.00 38.29  ?  18   ARG B CA   1 
ATOM   1842  C  C    . ARG B  1 18 ? 62.700 53.591 -20.521 1.00 36.99  ?  18   ARG B C    1 
ATOM   1843  O  O    . ARG B  1 18 ? 62.229 54.672 -20.873 1.00 36.77  ?  18   ARG B O    1 
ATOM   1844  C  CB   . ARG B  1 18 ? 64.153 52.309 -22.112 1.00 41.52  ?  18   ARG B CB   1 
ATOM   1845  C  CG   . ARG B  1 18 ? 65.530 52.126 -22.743 1.00 44.45  ?  18   ARG B CG   1 
ATOM   1846  C  CD   . ARG B  1 18 ? 66.056 53.419 -23.365 1.00 45.45  ?  18   ARG B CD   1 
ATOM   1847  N  NE   . ARG B  1 18 ? 65.211 53.906 -24.455 1.00 47.49  ?  18   ARG B NE   1 
ATOM   1848  C  CZ   . ARG B  1 18 ? 65.280 53.479 -25.715 1.00 51.61  ?  18   ARG B CZ   1 
ATOM   1849  N  NH1  . ARG B  1 18 ? 66.153 52.544 -26.065 1.00 53.53  ?  18   ARG B NH1  1 
ATOM   1850  N  NH2  . ARG B  1 18 ? 64.468 53.988 -26.631 1.00 54.12  ?  18   ARG B NH2  1 
ATOM   1851  H  H    . ARG B  1 18 ? 65.042 51.761 -19.890 1.00 46.97  ?  18   ARG B H    1 
ATOM   1852  H  HA   . ARG B  1 18 ? 64.619 54.040 -21.100 1.00 45.95  ?  18   ARG B HA   1 
ATOM   1853  H  HB2  . ARG B  1 18 ? 63.827 51.432 -21.857 1.00 49.83  ?  18   ARG B HB2  1 
ATOM   1854  H  HB3  . ARG B  1 18 ? 63.568 52.692 -22.785 1.00 49.83  ?  18   ARG B HB3  1 
ATOM   1855  H  HG2  . ARG B  1 18 ? 66.158 51.843 -22.060 1.00 53.34  ?  18   ARG B HG2  1 
ATOM   1856  H  HG3  . ARG B  1 18 ? 65.473 51.457 -23.443 1.00 53.34  ?  18   ARG B HG3  1 
ATOM   1857  H  HD2  . ARG B  1 18 ? 66.091 54.107 -22.683 1.00 54.54  ?  18   ARG B HD2  1 
ATOM   1858  H  HD3  . ARG B  1 18 ? 66.944 53.260 -23.722 1.00 54.54  ?  18   ARG B HD3  1 
ATOM   1859  H  HE   . ARG B  1 18 ? 64.629 54.511 -24.270 1.00 56.98  ?  18   ARG B HE   1 
ATOM   1860  H  HH11 . ARG B  1 18 ? 66.683 52.208 -25.477 1.00 64.24  ?  18   ARG B HH11 1 
ATOM   1861  H  HH12 . ARG B  1 18 ? 66.189 52.273 -26.881 1.00 64.24  ?  18   ARG B HH12 1 
ATOM   1862  H  HH21 . ARG B  1 18 ? 63.899 54.594 -26.412 1.00 64.94  ?  18   ARG B HH21 1 
ATOM   1863  H  HH22 . ARG B  1 18 ? 64.511 53.712 -27.444 1.00 64.94  ?  18   ARG B HH22 1 
ATOM   1864  N  N    . GLU B  1 19 ? 62.010 52.700 -19.817 1.00 39.14  ?  19   GLU B N    1 
ATOM   1865  C  CA   . GLU B  1 19 ? 60.628 52.951 -19.424 1.00 39.21  ?  19   GLU B CA   1 
ATOM   1866  C  C    . GLU B  1 19 ? 60.552 54.002 -18.323 1.00 35.82  ?  19   GLU B C    1 
ATOM   1867  O  O    . GLU B  1 19 ? 59.640 54.830 -18.309 1.00 34.77  ?  19   GLU B O    1 
ATOM   1868  C  CB   . GLU B  1 19 ? 59.952 51.659 -18.960 1.00 42.52  ?  19   GLU B CB   1 
ATOM   1869  C  CG   . GLU B  1 19 ? 58.481 51.832 -18.606 1.00 44.36  ?  19   GLU B CG   1 
ATOM   1870  C  CD   . GLU B  1 19 ? 57.788 50.514 -18.312 1.00 47.84  ?  19   GLU B CD   1 
ATOM   1871  O  OE1  . GLU B  1 19 ? 58.335 49.453 -18.683 1.00 51.84  ?  19   GLU B OE1  1 
ATOM   1872  O  OE2  . GLU B  1 19 ? 56.693 50.540 -17.711 1.00 46.52  ?  19   GLU B OE2  1 
ATOM   1873  H  H    . GLU B  1 19 ? 62.319 51.941 -19.554 1.00 46.97  ?  19   GLU B H    1 
ATOM   1874  H  HA   . GLU B  1 19 ? 60.134 53.289 -20.199 1.00 47.05  ?  19   GLU B HA   1 
ATOM   1875  H  HB2  . GLU B  1 19 ? 60.011 51.003 -19.672 1.00 51.02  ?  19   GLU B HB2  1 
ATOM   1876  H  HB3  . GLU B  1 19 ? 60.411 51.332 -18.171 1.00 51.02  ?  19   GLU B HB3  1 
ATOM   1877  H  HG2  . GLU B  1 19 ? 58.411 52.390 -17.816 1.00 53.24  ?  19   GLU B HG2  1 
ATOM   1878  H  HG3  . GLU B  1 19 ? 58.024 52.252 -19.351 1.00 53.24  ?  19   GLU B HG3  1 
ATOM   1879  N  N    . GLU B  1 20 ? 61.509 53.969 -17.400 1.00 37.73  ?  20   GLU B N    1 
ATOM   1880  C  CA   . GLU B  1 20 ? 61.545 54.944 -16.317 1.00 35.27  ?  20   GLU B CA   1 
ATOM   1881  C  C    . GLU B  1 20 ? 61.775 56.337 -16.886 1.00 34.65  ?  20   GLU B C    1 
ATOM   1882  O  O    . GLU B  1 20 ? 61.173 57.309 -16.434 1.00 33.00  ?  20   GLU B O    1 
ATOM   1883  C  CB   . GLU B  1 20 ? 62.643 54.604 -15.308 1.00 35.49  ?  20   GLU B CB   1 
ATOM   1884  C  CG   . GLU B  1 20 ? 62.706 55.572 -14.134 1.00 33.66  ?  20   GLU B CG   1 
ATOM   1885  C  CD   . GLU B  1 20 ? 63.769 55.203 -13.119 1.00 34.58  ?  20   GLU B CD   1 
ATOM   1886  O  OE1  . GLU B  1 20 ? 64.433 54.160 -13.296 1.00 36.28  ?  20   GLU B OE1  1 
ATOM   1887  O  OE2  . GLU B  1 20 ? 63.944 55.962 -12.144 1.00 32.45  ?  20   GLU B OE2  1 
ATOM   1888  H  H    . GLU B  1 20 ? 62.147 53.392 -17.379 1.00 45.28  ?  20   GLU B H    1 
ATOM   1889  H  HA   . GLU B  1 20 ? 60.684 54.940 -15.849 1.00 42.32  ?  20   GLU B HA   1 
ATOM   1890  H  HB2  . GLU B  1 20 ? 62.480 53.716 -14.953 1.00 42.58  ?  20   GLU B HB2  1 
ATOM   1891  H  HB3  . GLU B  1 20 ? 63.502 54.627 -15.759 1.00 42.58  ?  20   GLU B HB3  1 
ATOM   1892  H  HG2  . GLU B  1 20 ? 62.906 56.460 -14.468 1.00 40.39  ?  20   GLU B HG2  1 
ATOM   1893  H  HG3  . GLU B  1 20 ? 61.848 55.574 -13.681 1.00 40.39  ?  20   GLU B HG3  1 
ATOM   1894  N  N    . GLU B  1 21 ? 62.649 56.424 -17.883 1.00 35.44  ?  21   GLU B N    1 
ATOM   1895  C  CA   . GLU B  1 21 ? 62.933 57.687 -18.550 1.00 37.83  ?  21   GLU B CA   1 
ATOM   1896  C  C    . GLU B  1 21 ? 61.654 58.296 -19.125 1.00 35.69  ?  21   GLU B C    1 
ATOM   1897  O  O    . GLU B  1 21 ? 61.407 59.492 -18.973 1.00 34.05  ?  21   GLU B O    1 
ATOM   1898  C  CB   . GLU B  1 21 ? 63.964 57.477 -19.662 1.00 44.72  ?  21   GLU B CB   1 
ATOM   1899  C  CG   . GLU B  1 21 ? 64.439 58.761 -20.324 1.00 48.88  ?  21   GLU B CG   1 
ATOM   1900  C  CD   . GLU B  1 21 ? 65.419 58.508 -21.459 1.00 54.65  ?  21   GLU B CD   1 
ATOM   1901  O  OE1  . GLU B  1 21 ? 65.415 57.388 -22.016 1.00 58.16  ?  21   GLU B OE1  1 
ATOM   1902  O  OE2  . GLU B  1 21 ? 66.194 59.429 -21.794 1.00 55.44  ?  21   GLU B OE2  1 
ATOM   1903  H  H    . GLU B  1 21 ? 63.094 55.757 -18.194 1.00 42.52  ?  21   GLU B H    1 
ATOM   1904  H  HA   . GLU B  1 21 ? 63.307 58.318 -17.900 1.00 45.39  ?  21   GLU B HA   1 
ATOM   1905  H  HB2  . GLU B  1 21 ? 64.741 57.034 -19.286 1.00 53.67  ?  21   GLU B HB2  1 
ATOM   1906  H  HB3  . GLU B  1 21 ? 63.570 56.918 -20.350 1.00 53.67  ?  21   GLU B HB3  1 
ATOM   1907  H  HG2  . GLU B  1 21 ? 63.673 59.231 -20.688 1.00 58.66  ?  21   GLU B HG2  1 
ATOM   1908  H  HG3  . GLU B  1 21 ? 64.883 59.313 -19.662 1.00 58.66  ?  21   GLU B HG3  1 
ATOM   1909  N  N    . ARG B  1 22 ? 60.843 57.471 -19.783 1.00 34.30  ?  22   ARG B N    1 
ATOM   1910  C  CA   . ARG B  1 22 ? 59.592 57.944 -20.371 1.00 33.74  ?  22   ARG B CA   1 
ATOM   1911  C  C    . ARG B  1 22 ? 58.592 58.330 -19.291 1.00 31.19  ?  22   ARG B C    1 
ATOM   1912  O  O    . ARG B  1 22 ? 57.809 59.262 -19.464 1.00 30.20  ?  22   ARG B O    1 
ATOM   1913  C  CB   . ARG B  1 22 ? 58.983 56.878 -21.283 1.00 36.25  ?  22   ARG B CB   1 
ATOM   1914  C  CG   . ARG B  1 22 ? 59.872 56.510 -22.451 1.00 37.84  ?  22   ARG B CG   1 
ATOM   1915  C  CD   . ARG B  1 22 ? 59.191 55.573 -23.429 1.00 41.90  ?  22   ARG B CD   1 
ATOM   1916  N  NE   . ARG B  1 22 ? 60.180 54.966 -24.311 1.00 46.90  ?  22   ARG B NE   1 
ATOM   1917  C  CZ   . ARG B  1 22 ? 60.770 53.793 -24.096 1.00 51.22  ?  22   ARG B CZ   1 
ATOM   1918  N  NH1  . ARG B  1 22 ? 60.462 53.059 -23.033 1.00 50.02  ?  22   ARG B NH1  1 
ATOM   1919  N  NH2  . ARG B  1 22 ? 61.668 53.344 -24.958 1.00 55.08  ?  22   ARG B NH2  1 
ATOM   1920  H  H    . ARG B  1 22 ? 60.994 56.633 -19.902 1.00 41.15  ?  22   ARG B H    1 
ATOM   1921  H  HA   . ARG B  1 22 ? 59.775 58.739 -20.914 1.00 40.48  ?  22   ARG B HA   1 
ATOM   1922  H  HB2  . ARG B  1 22 ? 58.825 56.074 -20.764 1.00 43.50  ?  22   ARG B HB2  1 
ATOM   1923  H  HB3  . ARG B  1 22 ? 58.145 57.211 -21.640 1.00 43.50  ?  22   ARG B HB3  1 
ATOM   1924  H  HG2  . ARG B  1 22 ? 60.116 57.318 -22.930 1.00 45.40  ?  22   ARG B HG2  1 
ATOM   1925  H  HG3  . ARG B  1 22 ? 60.668 56.069 -22.116 1.00 45.40  ?  22   ARG B HG3  1 
ATOM   1926  H  HD2  . ARG B  1 22 ? 58.739 54.867 -22.940 1.00 50.28  ?  22   ARG B HD2  1 
ATOM   1927  H  HD3  . ARG B  1 22 ? 58.559 56.071 -23.970 1.00 50.28  ?  22   ARG B HD3  1 
ATOM   1928  H  HE   . ARG B  1 22 ? 60.398 55.397 -25.023 1.00 56.27  ?  22   ARG B HE   1 
ATOM   1929  H  HH11 . ARG B  1 22 ? 59.882 53.345 -22.466 1.00 60.02  ?  22   ARG B HH11 1 
ATOM   1930  H  HH12 . ARG B  1 22 ? 60.848 52.301 -22.907 1.00 60.02  ?  22   ARG B HH12 1 
ATOM   1931  H  HH21 . ARG B  1 22 ? 61.868 53.811 -25.652 1.00 66.09  ?  22   ARG B HH21 1 
ATOM   1932  H  HH22 . ARG B  1 22 ? 62.045 52.582 -24.828 1.00 66.09  ?  22   ARG B HH22 1 
ATOM   1933  N  N    . LEU B  1 23 ? 58.620 57.607 -18.176 1.00 32.94  ?  23   LEU B N    1 
ATOM   1934  C  CA   . LEU B  1 23 ? 57.736 57.906 -17.058 1.00 31.62  ?  23   LEU B CA   1 
ATOM   1935  C  C    . LEU B  1 23 ? 58.057 59.283 -16.479 1.00 29.25  ?  23   LEU B C    1 
ATOM   1936  O  O    . LEU B  1 23 ? 57.155 60.064 -16.181 1.00 27.54  ?  23   LEU B O    1 
ATOM   1937  C  CB   . LEU B  1 23 ? 57.863 56.833 -15.975 1.00 33.02  ?  23   LEU B CB   1 
ATOM   1938  C  CG   . LEU B  1 23 ? 56.937 56.998 -14.769 1.00 32.93  ?  23   LEU B CG   1 
ATOM   1939  C  CD1  . LEU B  1 23 ? 55.477 56.988 -15.202 1.00 34.73  ?  23   LEU B CD1  1 
ATOM   1940  C  CD2  . LEU B  1 23 ? 57.204 55.907 -13.742 1.00 33.69  ?  23   LEU B CD2  1 
ATOM   1941  H  H    . LEU B  1 23 ? 59.142 56.937 -18.044 1.00 39.53  ?  23   LEU B H    1 
ATOM   1942  H  HA   . LEU B  1 23 ? 56.808 57.914 -17.373 1.00 37.95  ?  23   LEU B HA   1 
ATOM   1943  H  HB2  . LEU B  1 23 ? 57.669 55.970 -16.374 1.00 39.63  ?  23   LEU B HB2  1 
ATOM   1944  H  HB3  . LEU B  1 23 ? 58.775 56.838 -15.644 1.00 39.63  ?  23   LEU B HB3  1 
ATOM   1945  H  HG   . LEU B  1 23 ? 57.118 57.853 -14.349 1.00 39.51  ?  23   LEU B HG   1 
ATOM   1946  H  HD11 . LEU B  1 23 ? 55.284 56.152 -15.632 1.00 41.67  ?  23   LEU B HD11 1 
ATOM   1947  H  HD12 . LEU B  1 23 ? 54.921 57.093 -14.426 1.00 41.67  ?  23   LEU B HD12 1 
ATOM   1948  H  HD13 . LEU B  1 23 ? 55.327 57.713 -15.812 1.00 41.67  ?  23   LEU B HD13 1 
ATOM   1949  H  HD21 . LEU B  1 23 ? 58.116 55.969 -13.451 1.00 40.43  ?  23   LEU B HD21 1 
ATOM   1950  H  HD22 . LEU B  1 23 ? 56.613 56.030 -12.996 1.00 40.43  ?  23   LEU B HD22 1 
ATOM   1951  H  HD23 . LEU B  1 23 ? 57.046 55.051 -14.148 1.00 40.43  ?  23   LEU B HD23 1 
ATOM   1952  N  N    . LYS B  1 24 ? 59.344 59.578 -16.325 1.00 29.44  ?  24   LYS B N    1 
ATOM   1953  C  CA   . LYS B  1 24 ? 59.770 60.882 -15.830 1.00 28.81  ?  24   LYS B CA   1 
ATOM   1954  C  C    . LYS B  1 24 ? 59.308 61.991 -16.764 1.00 27.61  ?  24   LYS B C    1 
ATOM   1955  O  O    . LYS B  1 24 ? 58.839 63.035 -16.316 1.00 25.33  ?  24   LYS B O    1 
ATOM   1956  C  CB   . LYS B  1 24 ? 61.291 60.940 -15.693 1.00 31.64  ?  24   LYS B CB   1 
ATOM   1957  C  CG   . LYS B  1 24 ? 61.856 60.113 -14.554 1.00 34.14  ?  24   LYS B CG   1 
ATOM   1958  C  CD   . LYS B  1 24 ? 63.371 60.229 -14.515 1.00 37.47  ?  24   LYS B CD   1 
ATOM   1959  C  CE   . LYS B  1 24 ? 63.968 59.481 -13.337 1.00 38.84  ?  24   LYS B CE   1 
ATOM   1960  N  NZ   . LYS B  1 24 ? 65.449 59.632 -13.294 1.00 40.72  ?  24   LYS B NZ   1 
ATOM   1961  H  H    . LYS B  1 24 ? 59.991 59.039 -16.501 1.00 35.33  ?  24   LYS B H    1 
ATOM   1962  H  HA   . LYS B  1 24 ? 59.375 61.038 -14.947 1.00 34.57  ?  24   LYS B HA   1 
ATOM   1963  H  HB2  . LYS B  1 24 ? 61.688 60.615 -16.516 1.00 37.97  ?  24   LYS B HB2  1 
ATOM   1964  H  HB3  . LYS B  1 24 ? 61.554 61.861 -15.545 1.00 37.97  ?  24   LYS B HB3  1 
ATOM   1965  H  HG2  . LYS B  1 24 ? 61.501 60.437 -13.712 1.00 40.97  ?  24   LYS B HG2  1 
ATOM   1966  H  HG3  . LYS B  1 24 ? 61.622 59.180 -14.685 1.00 40.97  ?  24   LYS B HG3  1 
ATOM   1967  H  HD2  . LYS B  1 24 ? 63.741 59.853 -15.330 1.00 44.96  ?  24   LYS B HD2  1 
ATOM   1968  H  HD3  . LYS B  1 24 ? 63.617 61.164 -14.436 1.00 44.96  ?  24   LYS B HD3  1 
ATOM   1969  H  HE2  . LYS B  1 24 ? 63.602 59.837 -12.512 1.00 46.60  ?  24   LYS B HE2  1 
ATOM   1970  H  HE3  . LYS B  1 24 ? 63.760 58.537 -13.417 1.00 46.60  ?  24   LYS B HE3  1 
ATOM   1971  H  HZ1  . LYS B  1 24 ? 65.665 60.492 -13.218 1.00 48.86  ?  24   LYS B HZ1  1 
ATOM   1972  H  HZ2  . LYS B  1 24 ? 65.780 59.188 -12.598 1.00 48.86  ?  24   LYS B HZ2  1 
ATOM   1973  H  HZ3  . LYS B  1 24 ? 65.809 59.309 -14.041 1.00 48.86  ?  24   LYS B HZ3  1 
ATOM   1974  N  N    . ALA B  1 25 ? 59.448 61.763 -18.067 1.00 27.27  ?  25   ALA B N    1 
ATOM   1975  C  CA   . ALA B  1 25 ? 59.048 62.754 -19.059 1.00 27.64  ?  25   ALA B CA   1 
ATOM   1976  C  C    . ALA B  1 25 ? 57.552 63.019 -18.955 1.00 27.16  ?  25   ALA B C    1 
ATOM   1977  O  O    . ALA B  1 25 ? 57.110 64.168 -18.967 1.00 26.95  ?  25   ALA B O    1 
ATOM   1978  C  CB   . ALA B  1 25 ? 59.407 62.279 -20.459 1.00 29.34  ?  25   ALA B CB   1 
ATOM   1979  H  H    . ALA B  1 25 ? 59.772 61.041 -18.402 1.00 32.73  ?  25   ALA B H    1 
ATOM   1980  H  HA   . ALA B  1 25 ? 59.522 63.594 -18.888 1.00 33.17  ?  25   ALA B HA   1 
ATOM   1981  H  HB1  . ALA B  1 25 ? 58.951 61.453 -20.635 1.00 35.21  ?  25   ALA B HB1  1 
ATOM   1982  H  HB2  . ALA B  1 25 ? 59.135 62.946 -21.094 1.00 35.21  ?  25   ALA B HB2  1 
ATOM   1983  H  HB3  . ALA B  1 25 ? 60.357 62.146 -20.510 1.00 35.21  ?  25   ALA B HB3  1 
ATOM   1984  N  N    . SER B  1 26 ? 56.777 61.945 -18.850 1.00 28.79  ?  26   SER B N    1 
ATOM   1985  C  CA   . SER B  1 26 ? 55.331 62.056 -18.704 1.00 30.00  ?  26   SER B CA   1 
ATOM   1986  C  C    . SER B  1 26 ? 54.976 62.805 -17.418 1.00 26.96  ?  26   SER B C    1 
ATOM   1987  O  O    . SER B  1 26 ? 54.167 63.732 -17.431 1.00 26.23  ?  26   SER B O    1 
ATOM   1988  C  CB   . SER B  1 26 ? 54.695 60.666 -18.694 1.00 34.42  ?  26   SER B CB   1 
ATOM   1989  O  OG   . SER B  1 26 ? 53.283 60.752 -18.756 1.00 37.98  ?  26   SER B OG   1 
ATOM   1990  H  H    . SER B  1 26 ? 57.066 61.135 -18.860 1.00 34.55  ?  26   SER B H    1 
ATOM   1991  H  HA   . SER B  1 26 ? 54.966 62.557 -19.463 1.00 36.00  ?  26   SER B HA   1 
ATOM   1992  H  HB2  . SER B  1 26 ? 55.014 60.168 -19.463 1.00 41.30  ?  26   SER B HB2  1 
ATOM   1993  H  HB3  . SER B  1 26 ? 54.947 60.209 -17.876 1.00 41.30  ?  26   SER B HB3  1 
ATOM   1994  H  HG   . SER B  1 26 ? 53.052 61.538 -18.787 1.00 45.58  ?  26   SER B HG   1 
ATOM   1995  N  N    . ALA B  1 27 ? 55.588 62.398 -16.311 1.00 26.90  ?  27   ALA B N    1 
ATOM   1996  C  CA   . ALA B  1 27 ? 55.340 63.033 -15.020 1.00 25.04  ?  27   ALA B CA   1 
ATOM   1997  C  C    . ALA B  1 27 ? 55.680 64.521 -15.065 1.00 24.91  ?  27   ALA B C    1 
ATOM   1998  O  O    . ALA B  1 27 ? 54.928 65.353 -14.559 1.00 25.12  ?  27   ALA B O    1 
ATOM   1999  C  CB   . ALA B  1 27 ? 56.144 62.342 -13.929 1.00 23.17  ?  27   ALA B CB   1 
ATOM   2000  H  H    . ALA B  1 27 ? 56.155 61.752 -16.280 1.00 32.28  ?  27   ALA B H    1 
ATOM   2001  H  HA   . ALA B  1 27 ? 54.390 62.945 -14.798 1.00 30.05  ?  27   ALA B HA   1 
ATOM   2002  H  HB1  . ALA B  1 27 ? 57.078 62.407 -14.141 1.00 27.81  ?  27   ALA B HB1  1 
ATOM   2003  H  HB2  . ALA B  1 27 ? 55.968 62.773 -13.090 1.00 27.81  ?  27   ALA B HB2  1 
ATOM   2004  H  HB3  . ALA B  1 27 ? 55.882 61.419 -13.885 1.00 27.81  ?  27   ALA B HB3  1 
ATOM   2005  N  N    . LYS B  1 28 ? 56.810 64.851 -15.680 1.00 27.75  ?  28   LYS B N    1 
ATOM   2006  C  CA   . LYS B  1 28 ? 57.270 66.233 -15.739 1.00 30.27  ?  28   LYS B CA   1 
ATOM   2007  C  C    . LYS B  1 28 ? 56.298 67.126 -16.506 1.00 28.61  ?  28   LYS B C    1 
ATOM   2008  O  O    . LYS B  1 28 ? 56.074 68.274 -16.125 1.00 30.73  ?  28   LYS B O    1 
ATOM   2009  C  CB   . LYS B  1 28 ? 58.658 66.308 -16.378 1.00 34.38  ?  28   LYS B CB   1 
ATOM   2010  C  CG   . LYS B  1 28 ? 59.213 67.719 -16.466 1.00 36.88  ?  28   LYS B CG   1 
ATOM   2011  C  CD   . LYS B  1 28 ? 60.642 67.727 -16.980 1.00 40.65  ?  28   LYS B CD   1 
ATOM   2012  C  CE   . LYS B  1 28 ? 61.165 69.145 -17.134 1.00 44.83  ?  28   LYS B CE   1 
ATOM   2013  N  NZ   . LYS B  1 28 ? 62.592 69.167 -17.556 1.00 49.35  ?  28   LYS B NZ   1 
ATOM   2014  H  H    . LYS B  1 28 ? 57.331 64.291 -16.073 1.00 33.30  ?  28   LYS B H    1 
ATOM   2015  H  HA   . LYS B  1 28 ? 57.340 66.581 -14.826 1.00 36.33  ?  28   LYS B HA   1 
ATOM   2016  H  HB2  . LYS B  1 28 ? 59.275 65.779 -15.849 1.00 41.25  ?  28   LYS B HB2  1 
ATOM   2017  H  HB3  . LYS B  1 28 ? 58.607 65.952 -17.279 1.00 41.25  ?  28   LYS B HB3  1 
ATOM   2018  H  HG2  . LYS B  1 28 ? 58.668 68.240 -17.076 1.00 44.26  ?  28   LYS B HG2  1 
ATOM   2019  H  HG3  . LYS B  1 28 ? 59.206 68.121 -15.583 1.00 44.26  ?  28   LYS B HG3  1 
ATOM   2020  H  HD2  . LYS B  1 28 ? 61.213 67.258 -16.351 1.00 48.77  ?  28   LYS B HD2  1 
ATOM   2021  H  HD3  . LYS B  1 28 ? 60.673 67.295 -17.848 1.00 48.77  ?  28   LYS B HD3  1 
ATOM   2022  H  HE2  . LYS B  1 28 ? 60.642 69.606 -17.809 1.00 53.79  ?  28   LYS B HE2  1 
ATOM   2023  H  HE3  . LYS B  1 28 ? 61.093 69.605 -16.283 1.00 53.79  ?  28   LYS B HE3  1 
ATOM   2024  H  HZ1  . LYS B  1 28 ? 62.684 68.753 -18.339 1.00 59.22  ?  28   LYS B HZ1  1 
ATOM   2025  H  HZ2  . LYS B  1 28 ? 62.871 70.008 -17.638 1.00 59.22  ?  28   LYS B HZ2  1 
ATOM   2026  H  HZ3  . LYS B  1 28 ? 63.094 68.753 -16.949 1.00 59.22  ?  28   LYS B HZ3  1 
ATOM   2027  N  N    . ALA B  1 29 ? 55.724 66.598 -17.583 1.00 23.03  ?  29   ALA B N    1 
ATOM   2028  C  CA   . ALA B  1 29 ? 54.785 67.364 -18.396 1.00 22.04  ?  29   ALA B CA   1 
ATOM   2029  C  C    . ALA B  1 29 ? 53.464 67.569 -17.660 1.00 21.90  ?  29   ALA B C    1 
ATOM   2030  O  O    . ALA B  1 29 ? 52.863 68.641 -17.726 1.00 19.79  ?  29   ALA B O    1 
ATOM   2031  C  CB   . ALA B  1 29 ? 54.543 66.663 -19.727 1.00 24.13  ?  29   ALA B CB   1 
ATOM   2032  H  H    . ALA B  1 29 ? 55.861 65.798 -17.865 1.00 27.63  ?  29   ALA B H    1 
ATOM   2033  H  HA   . ALA B  1 29 ? 55.169 68.246 -18.583 1.00 26.45  ?  29   ALA B HA   1 
ATOM   2034  H  HB1  . ALA B  1 29 ? 54.179 65.790 -19.559 1.00 28.96  ?  29   ALA B HB1  1 
ATOM   2035  H  HB2  . ALA B  1 29 ? 53.924 67.182 -20.245 1.00 28.96  ?  29   ALA B HB2  1 
ATOM   2036  H  HB3  . ALA B  1 29 ? 55.378 66.584 -20.195 1.00 28.96  ?  29   ALA B HB3  1 
ATOM   2037  N  N    . ARG B  1 30 ? 53.013 66.533 -16.962 1.00 25.88  ?  30   ARG B N    1 
ATOM   2038  C  CA   . ARG B  1 30 ? 51.756 66.603 -16.227 1.00 26.60  ?  30   ARG B CA   1 
ATOM   2039  C  C    . ARG B  1 30 ? 51.853 67.599 -15.072 1.00 24.35  ?  30   ARG B C    1 
ATOM   2040  O  O    . ARG B  1 30 ? 50.906 68.341 -14.804 1.00 23.69  ?  30   ARG B O    1 
ATOM   2041  C  CB   . ARG B  1 30 ? 51.367 65.216 -15.706 1.00 26.67  ?  30   ARG B CB   1 
ATOM   2042  C  CG   . ARG B  1 30 ? 50.102 65.188 -14.860 1.00 27.92  ?  30   ARG B CG   1 
ATOM   2043  C  CD   . ARG B  1 30 ? 48.900 65.750 -15.606 1.00 31.31  ?  30   ARG B CD   1 
ATOM   2044  N  NE   . ARG B  1 30 ? 47.686 65.674 -14.795 1.00 31.96  ?  30   ARG B NE   1 
ATOM   2045  C  CZ   . ARG B  1 30 ? 46.641 66.490 -14.913 1.00 31.97  ?  30   ARG B CZ   1 
ATOM   2046  N  NH1  . ARG B  1 30 ? 46.640 67.467 -15.815 1.00 33.20  ?  30   ARG B NH1  1 
ATOM   2047  N  NH2  . ARG B  1 30 ? 45.589 66.331 -14.119 1.00 31.83  ?  30   ARG B NH2  1 
ATOM   2048  H  H    . ARG B  1 30 ? 53.416 65.776 -16.899 1.00 31.05  ?  30   ARG B H    1 
ATOM   2049  H  HA   . ARG B  1 30 ? 51.049 66.909 -16.832 1.00 31.92  ?  30   ARG B HA   1 
ATOM   2050  H  HB2  . ARG B  1 30 ? 51.225 64.629 -16.465 1.00 32.00  ?  30   ARG B HB2  1 
ATOM   2051  H  HB3  . ARG B  1 30 ? 52.093 64.875 -15.161 1.00 32.00  ?  30   ARG B HB3  1 
ATOM   2052  H  HG2  . ARG B  1 30 ? 49.904 64.271 -14.614 1.00 33.51  ?  30   ARG B HG2  1 
ATOM   2053  H  HG3  . ARG B  1 30 ? 50.240 65.725 -14.063 1.00 33.51  ?  30   ARG B HG3  1 
ATOM   2054  H  HD2  . ARG B  1 30 ? 49.063 66.681 -15.823 1.00 37.57  ?  30   ARG B HD2  1 
ATOM   2055  H  HD3  . ARG B  1 30 ? 48.757 65.236 -16.416 1.00 37.57  ?  30   ARG B HD3  1 
ATOM   2056  H  HE   . ARG B  1 30 ? 47.644 65.057 -14.198 1.00 38.35  ?  30   ARG B HE   1 
ATOM   2057  H  HH11 . ARG B  1 30 ? 47.319 67.576 -16.331 1.00 39.84  ?  30   ARG B HH11 1 
ATOM   2058  H  HH12 . ARG B  1 30 ? 45.960 67.989 -15.882 1.00 39.84  ?  30   ARG B HH12 1 
ATOM   2059  H  HH21 . ARG B  1 30 ? 45.584 65.701 -13.534 1.00 38.19  ?  30   ARG B HH21 1 
ATOM   2060  H  HH22 . ARG B  1 30 ? 44.912 66.856 -14.192 1.00 38.19  ?  30   ARG B HH22 1 
ATOM   2061  N  N    . SER B  1 31 ? 52.995 67.622 -14.388 1.00 27.30  ?  31   SER B N    1 
ATOM   2062  C  CA   . SER B  1 31 ? 53.165 68.537 -13.264 1.00 28.02  ?  31   SER B CA   1 
ATOM   2063  C  C    . SER B  1 31 ? 53.378 69.970 -13.751 1.00 27.98  ?  31   SER B C    1 
ATOM   2064  O  O    . SER B  1 31 ? 53.015 70.923 -13.060 1.00 25.86  ?  31   SER B O    1 
ATOM   2065  C  CB   . SER B  1 31 ? 54.307 68.093 -12.341 1.00 30.06  ?  31   SER B CB   1 
ATOM   2066  O  OG   . SER B  1 31 ? 55.575 68.215 -12.958 1.00 33.42  ?  31   SER B OG   1 
ATOM   2067  H  H    . SER B  1 31 ? 53.678 67.126 -14.552 1.00 32.76  ?  31   SER B H    1 
ATOM   2068  H  HA   . SER B  1 31 ? 52.341 68.529 -12.733 1.00 33.62  ?  31   SER B HA   1 
ATOM   2069  H  HB2  . SER B  1 31 ? 54.295 68.645 -11.543 1.00 36.07  ?  31   SER B HB2  1 
ATOM   2070  H  HB3  . SER B  1 31 ? 54.167 67.164 -12.098 1.00 36.07  ?  31   SER B HB3  1 
ATOM   2071  H  HG   . SER B  1 31 ? 55.489 68.507 -13.720 1.00 40.11  ?  31   SER B HG   1 
ATOM   2072  N  N    . ARG B  1 32 ? 53.952 70.123 -14.942 1.00 27.70  ?  32   ARG B N    1 
ATOM   2073  C  CA   . ARG B  1 32 ? 54.100 71.447 -15.536 1.00 28.59  ?  32   ARG B CA   1 
ATOM   2074  C  C    . ARG B  1 32 ? 52.727 72.088 -15.706 1.00 28.13  ?  32   ARG B C    1 
ATOM   2075  O  O    . ARG B  1 32 ? 52.507 73.229 -15.304 1.00 28.18  ?  32   ARG B O    1 
ATOM   2076  C  CB   . ARG B  1 32 ? 54.804 71.375 -16.893 1.00 31.46  ?  32   ARG B CB   1 
ATOM   2077  C  CG   . ARG B  1 32 ? 54.575 72.616 -17.755 1.00 34.68  ?  32   ARG B CG   1 
ATOM   2078  C  CD   . ARG B  1 32 ? 55.459 72.631 -18.993 1.00 39.93  ?  32   ARG B CD   1 
ATOM   2079  N  NE   . ARG B  1 32 ? 56.861 72.873 -18.663 1.00 43.36  ?  32   ARG B NE   1 
ATOM   2080  C  CZ   . ARG B  1 32 ? 57.386 74.075 -18.433 1.00 46.89  ?  32   ARG B CZ   1 
ATOM   2081  N  NH1  . ARG B  1 32 ? 56.630 75.165 -18.490 1.00 48.70  ?  32   ARG B NH1  1 
ATOM   2082  N  NH2  . ARG B  1 32 ? 58.675 74.188 -18.141 1.00 47.30  ?  32   ARG B NH2  1 
ATOM   2083  H  H    . ARG B  1 32 ? 54.263 69.480 -15.422 1.00 33.24  ?  32   ARG B H    1 
ATOM   2084  H  HA   . ARG B  1 32 ? 54.634 72.013 -14.940 1.00 34.31  ?  32   ARG B HA   1 
ATOM   2085  H  HB2  . ARG B  1 32 ? 55.759 71.284 -16.748 1.00 37.75  ?  32   ARG B HB2  1 
ATOM   2086  H  HB3  . ARG B  1 32 ? 54.469 70.607 -17.381 1.00 37.75  ?  32   ARG B HB3  1 
ATOM   2087  H  HG2  . ARG B  1 32 ? 53.650 72.635 -18.045 1.00 41.61  ?  32   ARG B HG2  1 
ATOM   2088  H  HG3  . ARG B  1 32 ? 54.777 73.408 -17.232 1.00 41.61  ?  32   ARG B HG3  1 
ATOM   2089  H  HD2  . ARG B  1 32 ? 55.397 71.772 -19.438 1.00 47.92  ?  32   ARG B HD2  1 
ATOM   2090  H  HD3  . ARG B  1 32 ? 55.162 73.338 -19.587 1.00 47.92  ?  32   ARG B HD3  1 
ATOM   2091  H  HE   . ARG B  1 32 ? 57.383 72.192 -18.613 1.00 52.03  ?  32   ARG B HE   1 
ATOM   2092  H  HH11 . ARG B  1 32 ? 55.793 75.099 -18.679 1.00 58.44  ?  32   ARG B HH11 1 
ATOM   2093  H  HH12 . ARG B  1 32 ? 56.977 75.937 -18.340 1.00 58.44  ?  32   ARG B HH12 1 
ATOM   2094  H  HH21 . ARG B  1 32 ? 59.171 73.486 -18.101 1.00 56.76  ?  32   ARG B HH21 1 
ATOM   2095  H  HH22 . ARG B  1 32 ? 59.015 74.963 -17.991 1.00 56.76  ?  32   ARG B HH22 1 
ATOM   2096  N  N    . THR B  1 33 ? 51.806 71.337 -16.300 1.00 28.06  ?  33   THR B N    1 
ATOM   2097  C  CA   . THR B  1 33 ? 50.453 71.823 -16.533 1.00 28.82  ?  33   THR B CA   1 
ATOM   2098  C  C    . THR B  1 33 ? 49.794 72.246 -15.223 1.00 26.33  ?  33   THR B C    1 
ATOM   2099  O  O    . THR B  1 33 ? 49.183 73.310 -15.144 1.00 25.41  ?  33   THR B O    1 
ATOM   2100  C  CB   . THR B  1 33 ? 49.581 70.745 -17.206 1.00 31.81  ?  33   THR B CB   1 
ATOM   2101  O  OG1  . THR B  1 33 ? 50.132 70.408 -18.485 1.00 37.07  ?  33   THR B OG1  1 
ATOM   2102  C  CG2  . THR B  1 33 ? 48.155 71.243 -17.395 1.00 31.43  ?  33   THR B CG2  1 
ATOM   2103  H  H    . THR B  1 33 ? 51.942 70.536 -16.581 1.00 33.67  ?  33   THR B H    1 
ATOM   2104  H  HA   . THR B  1 33 ? 50.488 72.604 -17.124 1.00 34.59  ?  33   THR B HA   1 
ATOM   2105  H  HB   . THR B  1 33 ? 49.557 69.954 -16.647 1.00 38.17  ?  33   THR B HB   1 
ATOM   2106  H  HG1  . THR B  1 33 ? 50.894 70.119 -18.395 1.00 44.48  ?  33   THR B HG1  1 
ATOM   2107  H  HG21 . THR B  1 33 ? 48.153 72.028 -17.949 1.00 37.72  ?  33   THR B HG21 1 
ATOM   2108  H  HG22 . THR B  1 33 ? 47.623 70.564 -17.815 1.00 37.72  ?  33   THR B HG22 1 
ATOM   2109  H  HG23 . THR B  1 33 ? 47.768 71.461 -16.544 1.00 37.72  ?  33   THR B HG23 1 
ATOM   2110  N  N    . LEU B  1 34 ? 49.927 71.413 -14.196 1.00 28.98  ?  34   LEU B N    1 
ATOM   2111  C  CA   . LEU B  1 34 ? 49.270 71.661 -12.915 1.00 28.12  ?  34   LEU B CA   1 
ATOM   2112  C  C    . LEU B  1 34 ? 49.911 72.819 -12.146 1.00 25.99  ?  34   LEU B C    1 
ATOM   2113  O  O    . LEU B  1 34 ? 49.230 73.533 -11.411 1.00 27.91  ?  34   LEU B O    1 
ATOM   2114  C  CB   . LEU B  1 34 ? 49.270 70.387 -12.069 1.00 26.68  ?  34   LEU B CB   1 
ATOM   2115  C  CG   . LEU B  1 34 ? 48.457 69.238 -12.672 1.00 28.32  ?  34   LEU B CG   1 
ATOM   2116  C  CD1  . LEU B  1 34 ? 48.835 67.904 -12.051 1.00 26.23  ?  34   LEU B CD1  1 
ATOM   2117  C  CD2  . LEU B  1 34 ? 46.965 69.496 -12.508 1.00 31.37  ?  34   LEU B CD2  1 
ATOM   2118  H  H    . LEU B  1 34 ? 50.396 70.692 -14.214 1.00 34.78  ?  34   LEU B H    1 
ATOM   2119  H  HA   . LEU B  1 34 ? 48.335 71.902 -13.087 1.00 33.74  ?  34   LEU B HA   1 
ATOM   2120  H  HB2  . LEU B  1 34 ? 50.184 70.080 -11.967 1.00 32.02  ?  34   LEU B HB2  1 
ATOM   2121  H  HB3  . LEU B  1 34 ? 48.893 70.590 -11.198 1.00 32.02  ?  34   LEU B HB3  1 
ATOM   2122  H  HG   . LEU B  1 34 ? 48.646 69.187 -13.622 1.00 33.99  ?  34   LEU B HG   1 
ATOM   2123  H  HD11 . LEU B  1 34 ? 48.665 67.940 -11.107 1.00 31.47  ?  34   LEU B HD11 1 
ATOM   2124  H  HD12 . LEU B  1 34 ? 48.307 67.211 -12.453 1.00 31.47  ?  34   LEU B HD12 1 
ATOM   2125  H  HD13 . LEU B  1 34 ? 49.768 67.739 -12.210 1.00 31.47  ?  34   LEU B HD13 1 
ATOM   2126  H  HD21 . LEU B  1 34 ? 46.739 70.314 -12.957 1.00 37.65  ?  34   LEU B HD21 1 
ATOM   2127  H  HD22 . LEU B  1 34 ? 46.477 68.764 -12.893 1.00 37.65  ?  34   LEU B HD22 1 
ATOM   2128  H  HD23 . LEU B  1 34 ? 46.762 69.569 -11.572 1.00 37.65  ?  34   LEU B HD23 1 
ATOM   2129  N  N    . GLN B  1 35 ? 51.216 73.006 -12.313 1.00 24.02  ?  35   GLN B N    1 
ATOM   2130  C  CA   . GLN B  1 35 ? 51.904 74.140 -11.702 1.00 22.81  ?  35   GLN B CA   1 
ATOM   2131  C  C    . GLN B  1 35 ? 51.526 75.436 -12.410 1.00 25.98  ?  35   GLN B C    1 
ATOM   2132  O  O    . GLN B  1 35 ? 51.256 76.452 -11.768 1.00 25.89  ?  35   GLN B O    1 
ATOM   2133  C  CB   . GLN B  1 35 ? 53.420 73.952 -11.763 1.00 22.26  ?  35   GLN B CB   1 
ATOM   2134  C  CG   . GLN B  1 35 ? 53.954 72.871 -10.846 1.00 21.60  ?  35   GLN B CG   1 
ATOM   2135  C  CD   . GLN B  1 35 ? 55.445 72.673 -11.003 1.00 22.30  ?  35   GLN B CD   1 
ATOM   2136  O  OE1  . GLN B  1 35 ? 56.241 73.435 -10.456 1.00 23.11  ?  35   GLN B OE1  1 
ATOM   2137  N  NE2  . GLN B  1 35 ? 55.833 71.653 -11.762 1.00 21.90  ?  35   GLN B NE2  1 
ATOM   2138  H  H    . GLN B  1 35 ? 51.727 72.491 -12.776 1.00 28.82  ?  35   GLN B H    1 
ATOM   2139  H  HA   . GLN B  1 35 ? 51.638 74.213 -10.762 1.00 27.38  ?  35   GLN B HA   1 
ATOM   2140  H  HB2  . GLN B  1 35 ? 53.668 73.717 -12.671 1.00 26.72  ?  35   GLN B HB2  1 
ATOM   2141  H  HB3  . GLN B  1 35 ? 53.847 74.787 -11.513 1.00 26.72  ?  35   GLN B HB3  1 
ATOM   2142  H  HG2  . GLN B  1 35 ? 53.778 73.120 -9.925  1.00 25.92  ?  35   GLN B HG2  1 
ATOM   2143  H  HG3  . GLN B  1 35 ? 53.514 72.032 -11.055 1.00 25.92  ?  35   GLN B HG3  1 
ATOM   2144  H  HE21 . GLN B  1 35 ? 55.247 71.146 -12.133 1.00 26.28  ?  35   GLN B HE21 1 
ATOM   2145  H  HE22 . GLN B  1 35 ? 56.671 71.500 -11.881 1.00 26.28  ?  35   GLN B HE22 1 
ATOM   2146  N  N    . GLU B  1 36 ? 51.517 75.392 -13.739 1.00 25.39  ?  36   GLU B N    1 
ATOM   2147  C  CA   . GLU B  1 36 ? 51.147 76.548 -14.543 1.00 27.61  ?  36   GLU B CA   1 
ATOM   2148  C  C    . GLU B  1 36 ? 49.722 76.990 -14.232 1.00 27.61  ?  36   GLU B C    1 
ATOM   2149  O  O    . GLU B  1 36 ? 49.432 78.183 -14.196 1.00 27.62  ?  36   GLU B O    1 
ATOM   2150  C  CB   . GLU B  1 36 ? 51.281 76.223 -16.034 1.00 32.55  ?  36   GLU B CB   1 
ATOM   2151  C  CG   . GLU B  1 36 ? 52.719 76.113 -16.516 1.00 36.15  ?  36   GLU B CG   1 
ATOM   2152  C  CD   . GLU B  1 36 ? 52.820 75.711 -17.978 1.00 40.87  ?  36   GLU B CD   1 
ATOM   2153  O  OE1  . GLU B  1 36 ? 51.802 75.260 -18.548 1.00 42.98  ?  36   GLU B OE1  1 
ATOM   2154  O  OE2  . GLU B  1 36 ? 53.918 75.846 -18.557 1.00 41.95  ?  36   GLU B OE2  1 
ATOM   2155  H  H    . GLU B  1 36 ? 51.723 74.697 -14.201 1.00 30.47  ?  36   GLU B H    1 
ATOM   2156  H  HA   . GLU B  1 36 ? 51.751 77.291 -14.336 1.00 33.13  ?  36   GLU B HA   1 
ATOM   2157  H  HB2  . GLU B  1 36 ? 50.845 75.374 -16.208 1.00 39.05  ?  36   GLU B HB2  1 
ATOM   2158  H  HB3  . GLU B  1 36 ? 50.850 76.925 -16.546 1.00 39.05  ?  36   GLU B HB3  1 
ATOM   2159  H  HG2  . GLU B  1 36 ? 53.154 76.974 -16.411 1.00 43.38  ?  36   GLU B HG2  1 
ATOM   2160  H  HG3  . GLU B  1 36 ? 53.179 75.442 -15.988 1.00 43.38  ?  36   GLU B HG3  1 
ATOM   2161  N  N    . GLN B  1 37 ? 48.837 76.026 -14.004 1.00 30.14  ?  37   GLN B N    1 
ATOM   2162  C  CA   . GLN B  1 37 ? 47.435 76.324 -13.723 1.00 35.24  ?  37   GLN B CA   1 
ATOM   2163  C  C    . GLN B  1 37 ? 47.214 76.712 -12.261 1.00 31.25  ?  37   GLN B C    1 
ATOM   2164  O  O    . GLN B  1 37 ? 46.143 77.194 -11.899 1.00 33.75  ?  37   GLN B O    1 
ATOM   2165  C  CB   . GLN B  1 37 ? 46.552 75.132 -14.097 1.00 40.88  ?  37   GLN B CB   1 
ATOM   2166  C  CG   . GLN B  1 37 ? 46.340 74.979 -15.597 1.00 48.89  ?  37   GLN B CG   1 
ATOM   2167  C  CD   . GLN B  1 37 ? 45.727 73.641 -15.973 1.00 55.51  ?  37   GLN B CD   1 
ATOM   2168  O  OE1  . GLN B  1 37 ? 45.552 72.763 -15.126 1.00 56.08  ?  37   GLN B OE1  1 
ATOM   2169  N  NE2  . GLN B  1 37 ? 45.399 73.480 -17.250 1.00 60.37  ?  37   GLN B NE2  1 
ATOM   2170  H  H    . GLN B  1 37 ? 49.023 75.186 -14.006 1.00 36.17  ?  37   GLN B H    1 
ATOM   2171  H  HA   . GLN B  1 37 ? 47.159 77.084 -14.277 1.00 42.29  ?  37   GLN B HA   1 
ATOM   2172  H  HB2  . GLN B  1 37 ? 46.969 74.319 -13.772 1.00 49.06  ?  37   GLN B HB2  1 
ATOM   2173  H  HB3  . GLN B  1 37 ? 45.682 75.245 -13.684 1.00 49.06  ?  37   GLN B HB3  1 
ATOM   2174  H  HG2  . GLN B  1 37 ? 45.743 75.679 -15.905 1.00 58.67  ?  37   GLN B HG2  1 
ATOM   2175  H  HG3  . GLN B  1 37 ? 47.196 75.053 -16.046 1.00 58.67  ?  37   GLN B HG3  1 
ATOM   2176  H  HE21 . GLN B  1 37 ? 45.536 74.116 -17.813 1.00 72.45  ?  37   GLN B HE21 1 
ATOM   2177  H  HE22 . GLN B  1 37 ? 45.048 72.741 -17.514 1.00 72.45  ?  37   GLN B HE22 1 
ATOM   2178  N  N    . GLY B  1 38 ? 48.224 76.494 -11.424 1.00 31.66  ?  38   GLY B N    1 
ATOM   2179  C  CA   . GLY B  1 38 ? 48.187 76.961 -10.049 1.00 29.34  ?  38   GLY B CA   1 
ATOM   2180  C  C    . GLY B  1 38 ? 47.749 75.920 -9.031  1.00 28.24  ?  38   GLY B C    1 
ATOM   2181  O  O    . GLY B  1 38 ? 47.786 76.174 -7.827  1.00 28.55  ?  38   GLY B O    1 
ATOM   2182  H  H    . GLY B  1 38 ? 48.946 76.076 -11.633 1.00 37.99  ?  38   GLY B H    1 
ATOM   2183  H  HA2  . GLY B  1 38 ? 49.071 77.271 -9.798  1.00 35.21  ?  38   GLY B HA2  1 
ATOM   2184  H  HA3  . GLY B  1 38 ? 47.576 77.713 -9.988  1.00 35.21  ?  38   GLY B HA3  1 
ATOM   2185  N  N    . GLN B  1 39 ? 47.338 74.748 -9.503  1.00 27.06  ?  39   GLN B N    1 
ATOM   2186  C  CA   . GLN B  1 39 ? 46.868 73.697 -8.608  1.00 27.94  ?  39   GLN B CA   1 
ATOM   2187  C  C    . GLN B  1 39 ? 48.029 73.045 -7.860  1.00 26.19  ?  39   GLN B C    1 
ATOM   2188  O  O    . GLN B  1 39 ? 47.891 72.662 -6.699  1.00 26.46  ?  39   GLN B O    1 
ATOM   2189  C  CB   . GLN B  1 39 ? 46.071 72.654 -9.387  1.00 29.91  ?  39   GLN B CB   1 
ATOM   2190  C  CG   . GLN B  1 39 ? 44.722 73.166 -9.870  1.00 35.09  ?  39   GLN B CG   1 
ATOM   2191  C  CD   . GLN B  1 39 ? 44.158 72.346 -11.011 1.00 41.92  ?  39   GLN B CD   1 
ATOM   2192  O  OE1  . GLN B  1 39 ? 43.055 71.807 -10.917 1.00 45.17  ?  39   GLN B OE1  1 
ATOM   2193  N  NE2  . GLN B  1 39 ? 44.910 72.255 -12.103 1.00 44.76  ?  39   GLN B NE2  1 
ATOM   2194  H  H    . GLN B  1 39 ? 47.321 74.536 -10.337 1.00 32.48  ?  39   GLN B H    1 
ATOM   2195  H  HA   . GLN B  1 39 ? 46.269 74.095 -7.942  1.00 33.53  ?  39   GLN B HA   1 
ATOM   2196  H  HB2  . GLN B  1 39 ? 46.583 72.383 -10.165 1.00 35.89  ?  39   GLN B HB2  1 
ATOM   2197  H  HB3  . GLN B  1 39 ? 45.911 71.887 -8.814  1.00 35.89  ?  39   GLN B HB3  1 
ATOM   2198  H  HG2  . GLN B  1 39 ? 44.089 73.132 -9.135  1.00 42.10  ?  39   GLN B HG2  1 
ATOM   2199  H  HG3  . GLN B  1 39 ? 44.823 74.080 -10.179 1.00 42.10  ?  39   GLN B HG3  1 
ATOM   2200  H  HE21 . GLN B  1 39 ? 45.673 72.651 -12.134 1.00 53.71  ?  39   GLN B HE21 1 
ATOM   2201  H  HE22 . GLN B  1 39 ? 44.634 71.800 -12.779 1.00 53.71  ?  39   GLN B HE22 1 
ATOM   2202  N  N    . TRP B  1 40 ? 49.168 72.925 -8.534  1.00 24.44  ?  40   TRP B N    1 
ATOM   2203  C  CA   . TRP B  1 40 ? 50.395 72.460 -7.901  1.00 24.16  ?  40   TRP B CA   1 
ATOM   2204  C  C    . TRP B  1 40 ? 51.228 73.688 -7.550  1.00 25.08  ?  40   TRP B C    1 
ATOM   2205  O  O    . TRP B  1 40 ? 52.052 74.135 -8.347  1.00 26.35  ?  40   TRP B O    1 
ATOM   2206  C  CB   . TRP B  1 40 ? 51.158 71.538 -8.855  1.00 23.30  ?  40   TRP B CB   1 
ATOM   2207  C  CG   . TRP B  1 40 ? 52.088 70.575 -8.178  1.00 23.82  ?  40   TRP B CG   1 
ATOM   2208  C  CD1  . TRP B  1 40 ? 52.815 70.791 -7.042  1.00 24.34  ?  40   TRP B CD1  1 
ATOM   2209  C  CD2  . TRP B  1 40 ? 52.383 69.236 -8.594  1.00 23.86  ?  40   TRP B CD2  1 
ATOM   2210  N  NE1  . TRP B  1 40 ? 53.548 69.672 -6.730  1.00 25.15  ?  40   TRP B NE1  1 
ATOM   2211  C  CE2  . TRP B  1 40 ? 53.299 68.702 -7.665  1.00 24.82  ?  40   TRP B CE2  1 
ATOM   2212  C  CE3  . TRP B  1 40 ? 51.963 68.437 -9.662  1.00 22.89  ?  40   TRP B CE3  1 
ATOM   2213  C  CZ2  . TRP B  1 40 ? 53.805 67.405 -7.774  1.00 25.69  ?  40   TRP B CZ2  1 
ATOM   2214  C  CZ3  . TRP B  1 40 ? 52.465 67.151 -9.769  1.00 23.33  ?  40   TRP B CZ3  1 
ATOM   2215  C  CH2  . TRP B  1 40 ? 53.375 66.647 -8.829  1.00 24.59  ?  40   TRP B CH2  1 
ATOM   2216  H  H    . TRP B  1 40 ? 49.256 73.110 -9.369  1.00 29.32  ?  40   TRP B H    1 
ATOM   2217  H  HA   . TRP B  1 40 ? 50.185 71.970 -7.079  1.00 29.00  ?  40   TRP B HA   1 
ATOM   2218  H  HB2  . TRP B  1 40 ? 50.517 71.018 -9.364  1.00 27.96  ?  40   TRP B HB2  1 
ATOM   2219  H  HB3  . TRP B  1 40 ? 51.688 72.084 -9.457  1.00 27.96  ?  40   TRP B HB3  1 
ATOM   2220  H  HD1  . TRP B  1 40 ? 52.816 71.582 -6.554  1.00 29.21  ?  40   TRP B HD1  1 
ATOM   2221  H  HE1  . TRP B  1 40 ? 54.075 69.592 -6.054  1.00 30.18  ?  40   TRP B HE1  1 
ATOM   2222  H  HE3  . TRP B  1 40 ? 51.360 68.764 -10.290 1.00 27.47  ?  40   TRP B HE3  1 
ATOM   2223  H  HZ2  . TRP B  1 40 ? 54.409 67.069 -7.152  1.00 30.83  ?  40   TRP B HZ2  1 
ATOM   2224  H  HZ3  . TRP B  1 40 ? 52.192 66.611 -10.475 1.00 28.00  ?  40   TRP B HZ3  1 
ATOM   2225  H  HH2  . TRP B  1 40 ? 53.695 65.779 -8.926  1.00 29.51  ?  40   TRP B HH2  1 
ATOM   2226  N  N    . ARG B  1 41 ? 51.005 74.236 -6.358  1.00 23.68  ?  41   ARG B N    1 
ATOM   2227  C  CA   . ARG B  1 41 ? 51.569 75.535 -5.999  1.00 23.26  ?  41   ARG B CA   1 
ATOM   2228  C  C    . ARG B  1 41 ? 53.068 75.468 -5.714  1.00 21.67  ?  41   ARG B C    1 
ATOM   2229  O  O    . ARG B  1 41 ? 53.839 76.262 -6.250  1.00 20.74  ?  41   ARG B O    1 
ATOM   2230  C  CB   . ARG B  1 41 ? 50.840 76.130 -4.791  1.00 24.79  ?  41   ARG B CB   1 
ATOM   2231  C  CG   . ARG B  1 41 ? 51.211 77.581 -4.518  1.00 28.42  ?  41   ARG B CG   1 
ATOM   2232  C  CD   . ARG B  1 41 ? 50.775 78.031 -3.134  1.00 34.58  ?  41   ARG B CD   1 
ATOM   2233  N  NE   . ARG B  1 41 ? 49.614 78.913 -3.175  1.00 42.90  ?  41   ARG B NE   1 
ATOM   2234  C  CZ   . ARG B  1 41 ? 49.670 80.219 -3.420  1.00 52.00  ?  41   ARG B CZ   1 
ATOM   2235  N  NH1  . ARG B  1 41 ? 50.833 80.812 -3.658  1.00 53.82  ?  41   ARG B NH1  1 
ATOM   2236  N  NH2  . ARG B  1 41 ? 48.556 80.937 -3.433  1.00 57.38  ?  41   ARG B NH2  1 
ATOM   2237  H  H    . ARG B  1 41 ? 50.529 73.875 -5.739  1.00 28.41  ?  41   ARG B H    1 
ATOM   2238  H  HA   . ARG B  1 41 ? 51.440 76.148 -6.752  1.00 27.92  ?  41   ARG B HA   1 
ATOM   2239  H  HB2  . ARG B  1 41 ? 49.884 76.092 -4.950  1.00 29.75  ?  41   ARG B HB2  1 
ATOM   2240  H  HB3  . ARG B  1 41 ? 51.065 75.612 -4.002  1.00 29.75  ?  41   ARG B HB3  1 
ATOM   2241  H  HG2  . ARG B  1 41 ? 52.174 77.680 -4.579  1.00 34.10  ?  41   ARG B HG2  1 
ATOM   2242  H  HG3  . ARG B  1 41 ? 50.775 78.149 -5.172  1.00 34.10  ?  41   ARG B HG3  1 
ATOM   2243  H  HD2  . ARG B  1 41 ? 50.543 77.251 -2.606  1.00 41.49  ?  41   ARG B HD2  1 
ATOM   2244  H  HD3  . ARG B  1 41 ? 51.504 78.513 -2.713  1.00 41.49  ?  41   ARG B HD3  1 
ATOM   2245  H  HE   . ARG B  1 41 ? 48.841 78.565 -3.031  1.00 51.48  ?  41   ARG B HE   1 
ATOM   2246  H  HH11 . ARG B  1 41 ? 51.560 80.353 -3.651  1.00 64.58  ?  41   ARG B HH11 1 
ATOM   2247  H  HH12 . ARG B  1 41 ? 50.860 81.657 -3.817  1.00 64.58  ?  41   ARG B HH12 1 
ATOM   2248  H  HH21 . ARG B  1 41 ? 47.799 80.559 -3.282  1.00 68.86  ?  41   ARG B HH21 1 
ATOM   2249  H  HH22 . ARG B  1 41 ? 48.590 81.781 -3.594  1.00 68.86  ?  41   ARG B HH22 1 
ATOM   2250  N  N    . TYR B  1 42 ? 53.478 74.536 -4.859  1.00 20.73  ?  42   TYR B N    1 
ATOM   2251  C  CA   . TYR B  1 42 ? 54.898 74.358 -4.568  1.00 21.27  ?  42   TYR B CA   1 
ATOM   2252  C  C    . TYR B  1 42 ? 55.321 72.909 -4.763  1.00 20.94  ?  42   TYR B C    1 
ATOM   2253  O  O    . TYR B  1 42 ? 54.573 71.979 -4.458  1.00 21.03  ?  42   TYR B O    1 
ATOM   2254  C  CB   . TYR B  1 42 ? 55.235 74.816 -3.145  1.00 22.68  ?  42   TYR B CB   1 
ATOM   2255  C  CG   . TYR B  1 42 ? 54.903 76.263 -2.882  1.00 25.48  ?  42   TYR B CG   1 
ATOM   2256  C  CD1  . TYR B  1 42 ? 55.453 77.271 -3.662  1.00 26.31  ?  42   TYR B CD1  1 
ATOM   2257  C  CD2  . TYR B  1 42 ? 54.042 76.625 -1.855  1.00 27.21  ?  42   TYR B CD2  1 
ATOM   2258  C  CE1  . TYR B  1 42 ? 55.149 78.600 -3.433  1.00 28.70  ?  42   TYR B CE1  1 
ATOM   2259  C  CE2  . TYR B  1 42 ? 53.734 77.952 -1.613  1.00 29.54  ?  42   TYR B CE2  1 
ATOM   2260  C  CZ   . TYR B  1 42 ? 54.291 78.935 -2.407  1.00 30.72  ?  42   TYR B CZ   1 
ATOM   2261  O  OH   . TYR B  1 42 ? 53.988 80.257 -2.177  1.00 34.18  ?  42   TYR B OH   1 
ATOM   2262  H  H    . TYR B  1 42 ? 52.959 73.997 -4.436  1.00 24.88  ?  42   TYR B H    1 
ATOM   2263  H  HA   . TYR B  1 42 ? 55.418 74.908 -5.190  1.00 25.53  ?  42   TYR B HA   1 
ATOM   2264  H  HB2  . TYR B  1 42 ? 54.732 74.277 -2.514  1.00 27.22  ?  42   TYR B HB2  1 
ATOM   2265  H  HB3  . TYR B  1 42 ? 56.186 74.697 -2.994  1.00 27.22  ?  42   TYR B HB3  1 
ATOM   2266  H  HD1  . TYR B  1 42 ? 56.030 77.048 -4.356  1.00 31.57  ?  42   TYR B HD1  1 
ATOM   2267  H  HD2  . TYR B  1 42 ? 53.664 75.964 -1.321  1.00 32.65  ?  42   TYR B HD2  1 
ATOM   2268  H  HE1  . TYR B  1 42 ? 55.524 79.265 -3.965  1.00 34.44  ?  42   TYR B HE1  1 
ATOM   2269  H  HE2  . TYR B  1 42 ? 53.154 78.180 -0.923  1.00 35.45  ?  42   TYR B HE2  1 
ATOM   2270  H  HH   . TYR B  1 42 ? 54.217 80.469 -1.418  1.00 41.01  ?  42   TYR B HH   1 
ATOM   2271  N  N    . LEU B  1 43 ? 56.532 72.735 -5.277  1.00 21.01  ?  43   LEU B N    1 
ATOM   2272  C  CA   . LEU B  1 43 ? 57.096 71.416 -5.505  1.00 22.32  ?  43   LEU B CA   1 
ATOM   2273  C  C    . LEU B  1 43 ? 58.566 71.417 -5.105  1.00 25.98  ?  43   LEU B C    1 
ATOM   2274  O  O    . LEU B  1 43 ? 59.352 72.223 -5.600  1.00 27.24  ?  43   LEU B O    1 
ATOM   2275  C  CB   . LEU B  1 43 ? 56.959 71.027 -6.977  1.00 22.30  ?  43   LEU B CB   1 
ATOM   2276  C  CG   . LEU B  1 43 ? 57.703 69.755 -7.388  1.00 24.48  ?  43   LEU B CG   1 
ATOM   2277  C  CD1  . LEU B  1 43 ? 57.164 68.555 -6.629  1.00 26.58  ?  43   LEU B CD1  1 
ATOM   2278  C  CD2  . LEU B  1 43 ? 57.602 69.538 -8.889  1.00 24.87  ?  43   LEU B CD2  1 
ATOM   2279  H  H    . LEU B  1 43 ? 57.055 73.378 -5.506  1.00 25.21  ?  43   LEU B H    1 
ATOM   2280  H  HA   . LEU B  1 43 ? 56.622 70.754 -4.959  1.00 26.78  ?  43   LEU B HA   1 
ATOM   2281  H  HB2  . LEU B  1 43 ? 56.019 70.891 -7.172  1.00 26.75  ?  43   LEU B HB2  1 
ATOM   2282  H  HB3  . LEU B  1 43 ? 57.301 71.754 -7.520  1.00 26.75  ?  43   LEU B HB3  1 
ATOM   2283  H  HG   . LEU B  1 43 ? 58.641 69.854 -7.164  1.00 29.38  ?  43   LEU B HG   1 
ATOM   2284  H  HD11 . LEU B  1 43 ? 56.231 68.453 -6.827  1.00 31.90  ?  43   LEU B HD11 1 
ATOM   2285  H  HD12 . LEU B  1 43 ? 57.645 67.770 -6.903  1.00 31.90  ?  43   LEU B HD12 1 
ATOM   2286  H  HD13 . LEU B  1 43 ? 57.285 68.701 -5.688  1.00 31.90  ?  43   LEU B HD13 1 
ATOM   2287  H  HD21 . LEU B  1 43 ? 57.991 70.290 -9.340  1.00 29.84  ?  43   LEU B HD21 1 
ATOM   2288  H  HD22 . LEU B  1 43 ? 58.076 68.735 -9.120  1.00 29.84  ?  43   LEU B HD22 1 
ATOM   2289  H  HD23 . LEU B  1 43 ? 56.677 69.453 -9.130  1.00 29.84  ?  43   LEU B HD23 1 
ATOM   2290  N  N    . TRP B  1 44 ? 58.930 70.517 -4.200  1.00 25.72  ?  44   TRP B N    1 
ATOM   2291  C  CA   . TRP B  1 44 ? 60.309 70.401 -3.756  1.00 26.21  ?  44   TRP B CA   1 
ATOM   2292  C  C    . TRP B  1 44 ? 60.749 68.949 -3.782  1.00 24.28  ?  44   TRP B C    1 
ATOM   2293  O  O    . TRP B  1 44 ? 59.936 68.040 -3.615  1.00 25.48  ?  44   TRP B O    1 
ATOM   2294  C  CB   . TRP B  1 44 ? 60.474 70.948 -2.338  1.00 26.23  ?  44   TRP B CB   1 
ATOM   2295  C  CG   . TRP B  1 44 ? 60.176 72.408 -2.203  1.00 26.13  ?  44   TRP B CG   1 
ATOM   2296  C  CD1  . TRP B  1 44 ? 60.848 73.440 -2.790  1.00 27.59  ?  44   TRP B CD1  1 
ATOM   2297  C  CD2  . TRP B  1 44 ? 59.136 73.002 -1.415  1.00 26.02  ?  44   TRP B CD2  1 
ATOM   2298  N  NE1  . TRP B  1 44 ? 60.287 74.640 -2.422  1.00 28.12  ?  44   TRP B NE1  1 
ATOM   2299  C  CE2  . TRP B  1 44 ? 59.233 74.398 -1.579  1.00 27.03  ?  44   TRP B CE2  1 
ATOM   2300  C  CE3  . TRP B  1 44 ? 58.131 72.488 -0.591  1.00 25.56  ?  44   TRP B CE3  1 
ATOM   2301  C  CZ2  . TRP B  1 44 ? 58.364 75.286 -0.949  1.00 27.77  ?  44   TRP B CZ2  1 
ATOM   2302  C  CZ3  . TRP B  1 44 ? 57.268 73.369 0.033   1.00 27.03  ?  44   TRP B CZ3  1 
ATOM   2303  C  CH2  . TRP B  1 44 ? 57.390 74.753 -0.149  1.00 28.03  ?  44   TRP B CH2  1 
ATOM   2304  H  H    . TRP B  1 44 ? 58.393 69.960 -3.826  1.00 30.86  ?  44   TRP B H    1 
ATOM   2305  H  HA   . TRP B  1 44 ? 60.890 70.913 -4.357  1.00 31.45  ?  44   TRP B HA   1 
ATOM   2306  H  HB2  . TRP B  1 44 ? 59.872 70.469 -1.748  1.00 31.47  ?  44   TRP B HB2  1 
ATOM   2307  H  HB3  . TRP B  1 44 ? 61.391 70.807 -2.054  1.00 31.47  ?  44   TRP B HB3  1 
ATOM   2308  H  HD1  . TRP B  1 44 ? 61.578 73.346 -3.358  1.00 33.10  ?  44   TRP B HD1  1 
ATOM   2309  H  HE1  . TRP B  1 44 ? 60.552 75.417 -2.679  1.00 33.75  ?  44   TRP B HE1  1 
ATOM   2310  H  HE3  . TRP B  1 44 ? 58.043 71.570 -0.466  1.00 30.67  ?  44   TRP B HE3  1 
ATOM   2311  H  HZ2  . TRP B  1 44 ? 58.443 76.205 -1.068  1.00 33.32  ?  44   TRP B HZ2  1 
ATOM   2312  H  HZ3  . TRP B  1 44 ? 56.595 73.038 0.583   1.00 32.44  ?  44   TRP B HZ3  1 
ATOM   2313  H  HH2  . TRP B  1 44 ? 56.796 75.323 0.283   1.00 33.63  ?  44   TRP B HH2  1 
ATOM   2314  N  N    . ARG B  1 45 ? 62.043 68.741 -3.992  1.00 21.70  ?  45   ARG B N    1 
ATOM   2315  C  CA   . ARG B  1 45 ? 62.624 67.414 -3.902  1.00 22.10  ?  45   ARG B CA   1 
ATOM   2316  C  C    . ARG B  1 45 ? 62.897 67.078 -2.445  1.00 24.18  ?  45   ARG B C    1 
ATOM   2317  O  O    . ARG B  1 45 ? 63.415 67.905 -1.697  1.00 25.25  ?  45   ARG B O    1 
ATOM   2318  C  CB   . ARG B  1 45 ? 63.931 67.348 -4.694  1.00 22.74  ?  45   ARG B CB   1 
ATOM   2319  C  CG   . ARG B  1 45 ? 64.679 66.034 -4.538  1.00 24.69  ?  45   ARG B CG   1 
ATOM   2320  C  CD   . ARG B  1 45 ? 63.931 64.895 -5.209  1.00 25.95  ?  45   ARG B CD   1 
ATOM   2321  N  NE   . ARG B  1 45 ? 64.130 64.885 -6.655  1.00 26.68  ?  45   ARG B NE   1 
ATOM   2322  C  CZ   . ARG B  1 45 ? 63.327 64.274 -7.520  1.00 26.70  ?  45   ARG B CZ   1 
ATOM   2323  N  NH1  . ARG B  1 45 ? 62.251 63.622 -7.096  1.00 27.31  ?  45   ARG B NH1  1 
ATOM   2324  N  NH2  . ARG B  1 45 ? 63.594 64.322 -8.818  1.00 26.45  ?  45   ARG B NH2  1 
ATOM   2325  H  H    . ARG B  1 45 ? 62.608 69.359 -4.190  1.00 26.03  ?  45   ARG B H    1 
ATOM   2326  H  HA   . ARG B  1 45 ? 61.999 66.753 -4.267  1.00 26.52  ?  45   ARG B HA   1 
ATOM   2327  H  HB2  . ARG B  1 45 ? 63.732 67.465 -5.636  1.00 27.28  ?  45   ARG B HB2  1 
ATOM   2328  H  HB3  . ARG B  1 45 ? 64.516 68.059 -4.391  1.00 27.28  ?  45   ARG B HB3  1 
ATOM   2329  H  HG2  . ARG B  1 45 ? 65.553 66.110 -4.952  1.00 29.63  ?  45   ARG B HG2  1 
ATOM   2330  H  HG3  . ARG B  1 45 ? 64.769 65.826 -3.595  1.00 29.63  ?  45   ARG B HG3  1 
ATOM   2331  H  HD2  . ARG B  1 45 ? 64.252 64.051 -4.854  1.00 31.14  ?  45   ARG B HD2  1 
ATOM   2332  H  HD3  . ARG B  1 45 ? 62.982 64.991 -5.035  1.00 31.14  ?  45   ARG B HD3  1 
ATOM   2333  H  HE   . ARG B  1 45 ? 64.813 65.304 -6.968  1.00 32.02  ?  45   ARG B HE   1 
ATOM   2334  H  HH11 . ARG B  1 45 ? 62.073 63.588 -6.255  1.00 32.77  ?  45   ARG B HH11 1 
ATOM   2335  H  HH12 . ARG B  1 45 ? 61.735 63.230 -7.661  1.00 32.77  ?  45   ARG B HH12 1 
ATOM   2336  H  HH21 . ARG B  1 45 ? 64.289 64.744 -9.099  1.00 31.74  ?  45   ARG B HH21 1 
ATOM   2337  H  HH22 . ARG B  1 45 ? 63.074 63.929 -9.379  1.00 31.74  ?  45   ARG B HH22 1 
ATOM   2338  N  N    . THR B  1 46 ? 62.541 65.865 -2.041  1.00 23.01  ?  46   THR B N    1 
ATOM   2339  C  CA   . THR B  1 46 ? 62.901 65.378 -0.719  1.00 26.03  ?  46   THR B CA   1 
ATOM   2340  C  C    . THR B  1 46 ? 64.359 64.936 -0.756  1.00 26.55  ?  46   THR B C    1 
ATOM   2341  O  O    . THR B  1 46 ? 64.691 63.905 -1.338  1.00 27.33  ?  46   THR B O    1 
ATOM   2342  C  CB   . THR B  1 46 ? 62.006 64.208 -0.280  1.00 29.01  ?  46   THR B CB   1 
ATOM   2343  O  OG1  . THR B  1 46 ? 61.840 63.294 -1.372  1.00 31.09  ?  46   THR B OG1  1 
ATOM   2344  C  CG2  . THR B  1 46 ? 60.640 64.717 0.157   1.00 27.46  ?  46   THR B CG2  1 
ATOM   2345  H  H    . THR B  1 46 ? 62.090 65.305 -2.514  1.00 27.61  ?  46   THR B H    1 
ATOM   2346  H  HA   . THR B  1 46 ? 62.810 66.103 -0.066  1.00 31.23  ?  46   THR B HA   1 
ATOM   2347  H  HB   . THR B  1 46 ? 62.417 63.748 0.468   1.00 34.81  ?  46   THR B HB   1 
ATOM   2348  H  HG1  . THR B  1 46 ? 62.570 63.001 -1.605  1.00 37.31  ?  46   THR B HG1  1 
ATOM   2349  H  HG21 . THR B  1 46 ? 60.213 65.176 -0.571  1.00 32.96  ?  46   THR B HG21 1 
ATOM   2350  H  HG22 . THR B  1 46 ? 60.087 63.981 0.429   1.00 32.96  ?  46   THR B HG22 1 
ATOM   2351  H  HG23 . THR B  1 46 ? 60.736 65.324 0.894   1.00 32.96  ?  46   THR B HG23 1 
ATOM   2352  N  N    . THR B  1 47 ? 65.227 65.730 -0.137  1.00 23.99  ?  47   THR B N    1 
ATOM   2353  C  CA   . THR B  1 47 ? 66.669 65.529 -0.247  1.00 25.77  ?  47   THR B CA   1 
ATOM   2354  C  C    . THR B  1 47 ? 67.056 64.089 0.080   1.00 25.25  ?  47   THR B C    1 
ATOM   2355  O  O    . THR B  1 47 ? 66.651 63.546 1.106   1.00 27.98  ?  47   THR B O    1 
ATOM   2356  C  CB   . THR B  1 47 ? 67.446 66.497 0.671   1.00 27.67  ?  47   THR B CB   1 
ATOM   2357  O  OG1  . THR B  1 47 ? 67.151 67.853 0.309   1.00 27.60  ?  47   THR B OG1  1 
ATOM   2358  C  CG2  . THR B  1 47 ? 68.946 66.271 0.549   1.00 30.97  ?  47   THR B CG2  1 
ATOM   2359  H  H    . THR B  1 47 ? 65.005 66.398 0.357   1.00 28.79  ?  47   THR B H    1 
ATOM   2360  H  HA   . THR B  1 47 ? 66.942 65.709 -1.171  1.00 30.93  ?  47   THR B HA   1 
ATOM   2361  H  HB   . THR B  1 47 ? 67.187 66.345 1.593   1.00 33.21  ?  47   THR B HB   1 
ATOM   2362  H  HG1  . THR B  1 47 ? 66.347 67.995 0.389   1.00 33.12  ?  47   THR B HG1  1 
ATOM   2363  H  HG21 . THR B  1 47 ? 69.227 66.418 -0.357  1.00 37.16  ?  47   THR B HG21 1 
ATOM   2364  H  HG22 . THR B  1 47 ? 69.417 66.878 1.125   1.00 37.16  ?  47   THR B HG22 1 
ATOM   2365  H  HG23 . THR B  1 47 ? 69.164 65.370 0.801   1.00 37.16  ?  47   THR B HG23 1 
ATOM   2366  N  N    . GLY B  1 48 ? 67.851 63.483 -0.798  1.00 23.79  ?  48   GLY B N    1 
ATOM   2367  C  CA   . GLY B  1 48 ? 68.257 62.095 -0.656  1.00 25.47  ?  48   GLY B CA   1 
ATOM   2368  C  C    . GLY B  1 48 ? 67.204 61.040 -0.956  1.00 25.90  ?  48   GLY B C    1 
ATOM   2369  O  O    . GLY B  1 48 ? 67.444 59.856 -0.722  1.00 27.00  ?  48   GLY B O    1 
ATOM   2370  H  H    . GLY B  1 48 ? 68.173 63.866 -1.498  1.00 28.55  ?  48   GLY B H    1 
ATOM   2371  H  HA2  . GLY B  1 48 ? 69.010 61.932 -1.246  1.00 30.56  ?  48   GLY B HA2  1 
ATOM   2372  H  HA3  . GLY B  1 48 ? 68.560 61.954 0.254   1.00 30.56  ?  48   GLY B HA3  1 
ATOM   2373  N  N    . LYS B  1 49 ? 66.050 61.445 -1.478  1.00 24.92  ?  49   LYS B N    1 
ATOM   2374  C  CA   . LYS B  1 49 ? 64.958 60.500 -1.701  1.00 29.06  ?  49   LYS B CA   1 
ATOM   2375  C  C    . LYS B  1 49 ? 64.271 60.653 -3.057  1.00 26.13  ?  49   LYS B C    1 
ATOM   2376  O  O    . LYS B  1 49 ? 64.178 61.753 -3.608  1.00 26.96  ?  49   LYS B O    1 
ATOM   2377  C  CB   . LYS B  1 49 ? 63.919 60.625 -0.584  1.00 32.59  ?  49   LYS B CB   1 
ATOM   2378  C  CG   . LYS B  1 49 ? 64.356 60.002 0.727   1.00 38.07  ?  49   LYS B CG   1 
ATOM   2379  C  CD   . LYS B  1 49 ? 63.375 60.311 1.842   1.00 39.88  ?  49   LYS B CD   1 
ATOM   2380  C  CE   . LYS B  1 49 ? 63.828 59.713 3.165   1.00 42.63  ?  49   LYS B CE   1 
ATOM   2381  N  NZ   . LYS B  1 49 ? 63.784 58.224 3.155   1.00 44.13  ?  49   LYS B NZ   1 
ATOM   2382  H  H    . LYS B  1 49 ? 65.873 62.255 -1.710  1.00 29.90  ?  49   LYS B H    1 
ATOM   2383  H  HA   . LYS B  1 49 ? 65.324 59.592 -1.660  1.00 34.87  ?  49   LYS B HA   1 
ATOM   2384  H  HB2  . LYS B  1 49 ? 63.746 61.566 -0.423  1.00 39.11  ?  49   LYS B HB2  1 
ATOM   2385  H  HB3  . LYS B  1 49 ? 63.103 60.183 -0.865  1.00 39.11  ?  49   LYS B HB3  1 
ATOM   2386  H  HG2  . LYS B  1 49 ? 64.406 59.039 0.624   1.00 45.68  ?  49   LYS B HG2  1 
ATOM   2387  H  HG3  . LYS B  1 49 ? 65.223 60.358 0.978   1.00 45.68  ?  49   LYS B HG3  1 
ATOM   2388  H  HD2  . LYS B  1 49 ? 63.307 61.273 1.951   1.00 47.85  ?  49   LYS B HD2  1 
ATOM   2389  H  HD3  . LYS B  1 49 ? 62.509 59.936 1.619   1.00 47.85  ?  49   LYS B HD3  1 
ATOM   2390  H  HE2  . LYS B  1 49 ? 64.743 59.986 3.340   1.00 51.16  ?  49   LYS B HE2  1 
ATOM   2391  H  HE3  . LYS B  1 49 ? 63.245 60.028 3.873   1.00 51.16  ?  49   LYS B HE3  1 
ATOM   2392  H  HZ1  . LYS B  1 49 ? 64.317 57.908 2.517   1.00 52.96  ?  49   LYS B HZ1  1 
ATOM   2393  H  HZ2  . LYS B  1 49 ? 64.054 57.907 3.942   1.00 52.96  ?  49   LYS B HZ2  1 
ATOM   2394  H  HZ3  . LYS B  1 49 ? 62.952 57.946 3.002   1.00 52.96  ?  49   LYS B HZ3  1 
ATOM   2395  N  N    . TYR B  1 50 ? 63.792 59.528 -3.582  1.00 28.11  ?  50   TYR B N    1 
ATOM   2396  C  CA   . TYR B  1 50 ? 63.040 59.507 -4.828  1.00 27.18  ?  50   TYR B CA   1 
ATOM   2397  C  C    . TYR B  1 50 ? 61.592 59.878 -4.534  1.00 27.78  ?  50   TYR B C    1 
ATOM   2398  O  O    . TYR B  1 50 ? 60.772 59.022 -4.202  1.00 25.84  ?  50   TYR B O    1 
ATOM   2399  C  CB   . TYR B  1 50 ? 63.109 58.116 -5.459  1.00 29.26  ?  50   TYR B CB   1 
ATOM   2400  C  CG   . TYR B  1 50 ? 62.765 58.071 -6.933  1.00 29.42  ?  50   TYR B CG   1 
ATOM   2401  C  CD1  . TYR B  1 50 ? 62.022 59.080 -7.534  1.00 26.85  ?  50   TYR B CD1  1 
ATOM   2402  C  CD2  . TYR B  1 50 ? 63.190 57.012 -7.726  1.00 31.54  ?  50   TYR B CD2  1 
ATOM   2403  C  CE1  . TYR B  1 50 ? 61.711 59.033 -8.882  1.00 26.11  ?  50   TYR B CE1  1 
ATOM   2404  C  CE2  . TYR B  1 50 ? 62.884 56.956 -9.071  1.00 31.29  ?  50   TYR B CE2  1 
ATOM   2405  C  CZ   . TYR B  1 50 ? 62.144 57.969 -9.645  1.00 28.64  ?  50   TYR B CZ   1 
ATOM   2406  O  OH   . TYR B  1 50 ? 61.838 57.916 -10.986 1.00 29.26  ?  50   TYR B OH   1 
ATOM   2407  H  H    . TYR B  1 50 ? 63.893 58.752 -3.227  1.00 33.74  ?  50   TYR B H    1 
ATOM   2408  H  HA   . TYR B  1 50 ? 63.414 60.160 -5.455  1.00 32.62  ?  50   TYR B HA   1 
ATOM   2409  H  HB2  . TYR B  1 50 ? 64.011 57.775 -5.358  1.00 35.11  ?  50   TYR B HB2  1 
ATOM   2410  H  HB3  . TYR B  1 50 ? 62.487 57.534 -4.995  1.00 35.11  ?  50   TYR B HB3  1 
ATOM   2411  H  HD1  . TYR B  1 50 ? 61.728 59.798 -7.022  1.00 32.22  ?  50   TYR B HD1  1 
ATOM   2412  H  HD2  . TYR B  1 50 ? 63.689 56.326 -7.343  1.00 37.84  ?  50   TYR B HD2  1 
ATOM   2413  H  HE1  . TYR B  1 50 ? 61.212 59.715 -9.271  1.00 31.33  ?  50   TYR B HE1  1 
ATOM   2414  H  HE2  . TYR B  1 50 ? 63.176 56.240 -9.587  1.00 37.55  ?  50   TYR B HE2  1 
ATOM   2415  H  HH   . TYR B  1 50 ? 61.402 57.241 -11.148 1.00 35.12  ?  50   TYR B HH   1 
ATOM   2416  N  N    . GLY B  1 51 ? 61.287 61.163 -4.647  1.00 29.00  ?  51   GLY B N    1 
ATOM   2417  C  CA   . GLY B  1 51 ? 59.955 61.653 -4.355  1.00 31.23  ?  51   GLY B CA   1 
ATOM   2418  C  C    . GLY B  1 51 ? 59.950 63.151 -4.136  1.00 29.81  ?  51   GLY B C    1 
ATOM   2419  O  O    . GLY B  1 51 ? 60.922 63.840 -4.449  1.00 31.41  ?  51   GLY B O    1 
ATOM   2420  H  H    . GLY B  1 51 ? 61.840 61.774 -4.892  1.00 34.80  ?  51   GLY B H    1 
ATOM   2421  H  HA2  . GLY B  1 51 ? 59.362 61.446 -5.095  1.00 37.47  ?  51   GLY B HA2  1 
ATOM   2422  H  HA3  . GLY B  1 51 ? 59.616 61.221 -3.556  1.00 37.47  ?  51   GLY B HA3  1 
ATOM   2423  N  N    . ASN B  1 52 ? 58.853 63.659 -3.588  1.00 27.33  ?  52   ASN B N    1 
ATOM   2424  C  CA   . ASN B  1 52 ? 58.710 65.091 -3.398  1.00 23.78  ?  52   ASN B CA   1 
ATOM   2425  C  C    . ASN B  1 52 ? 57.829 65.446 -2.209  1.00 21.57  ?  52   ASN B C    1 
ATOM   2426  O  O    . ASN B  1 52 ? 57.098 64.609 -1.675  1.00 21.52  ?  52   ASN B O    1 
ATOM   2427  C  CB   . ASN B  1 52 ? 58.123 65.728 -4.660  1.00 22.00  ?  52   ASN B CB   1 
ATOM   2428  C  CG   . ASN B  1 52 ? 56.669 65.353 -4.878  1.00 20.61  ?  52   ASN B CG   1 
ATOM   2429  O  OD1  . ASN B  1 52 ? 55.772 65.905 -4.237  1.00 19.36  ?  52   ASN B OD1  1 
ATOM   2430  N  ND2  . ASN B  1 52 ? 56.427 64.413 -5.786  1.00 21.22  ?  52   ASN B ND2  1 
ATOM   2431  H  H    . ASN B  1 52 ? 58.180 63.196 -3.319  1.00 32.80  ?  52   ASN B H    1 
ATOM   2432  H  HA   . ASN B  1 52 ? 59.595 65.482 -3.246  1.00 28.54  ?  52   ASN B HA   1 
ATOM   2433  H  HB2  . ASN B  1 52 ? 58.176 66.693 -4.582  1.00 26.40  ?  52   ASN B HB2  1 
ATOM   2434  H  HB3  . ASN B  1 52 ? 58.629 65.428 -5.431  1.00 26.40  ?  52   ASN B HB3  1 
ATOM   2435  H  HD21 . ASN B  1 52 ? 57.079 64.051 -6.215  1.00 25.47  ?  52   ASN B HD21 1 
ATOM   2436  H  HD22 . ASN B  1 52 ? 55.619 64.166 -5.945  1.00 25.47  ?  52   ASN B HD22 1 
ATOM   2437  N  N    . ILE B  1 53 ? 57.918 66.707 -1.803  1.00 20.95  ?  53   ILE B N    1 
ATOM   2438  C  CA   . ILE B  1 53 ? 57.003 67.280 -0.838  1.00 21.13  ?  53   ILE B CA   1 
ATOM   2439  C  C    . ILE B  1 53 ? 56.403 68.515 -1.499  1.00 20.07  ?  53   ILE B C    1 
ATOM   2440  O  O    . ILE B  1 53 ? 57.127 69.382 -1.994  1.00 20.22  ?  53   ILE B O    1 
ATOM   2441  C  CB   . ILE B  1 53 ? 57.715 67.634 0.483   1.00 25.40  ?  53   ILE B CB   1 
ATOM   2442  C  CG1  . ILE B  1 53 ? 56.742 68.296 1.458   1.00 25.34  ?  53   ILE B CG1  1 
ATOM   2443  C  CG2  . ILE B  1 53 ? 58.912 68.533 0.232   1.00 30.49  ?  53   ILE B CG2  1 
ATOM   2444  C  CD1  . ILE B  1 53 ? 55.800 67.318 2.125   1.00 26.15  ?  53   ILE B CD1  1 
ATOM   2445  H  H    . ILE B  1 53 ? 58.515 67.259 -2.082  1.00 25.14  ?  53   ILE B H    1 
ATOM   2446  H  HA   . ILE B  1 53 ? 56.283 66.644 -0.646  1.00 25.35  ?  53   ILE B HA   1 
ATOM   2447  H  HB   . ILE B  1 53 ? 58.033 66.811 0.886   1.00 30.48  ?  53   ILE B HB   1 
ATOM   2448  H  HG12 . ILE B  1 53 ? 57.250 68.742 2.154   1.00 30.40  ?  53   ILE B HG12 1 
ATOM   2449  H  HG13 . ILE B  1 53 ? 56.206 68.944 0.975   1.00 30.40  ?  53   ILE B HG13 1 
ATOM   2450  H  HG21 . ILE B  1 53 ? 58.612 69.342 -0.187  1.00 36.58  ?  53   ILE B HG21 1 
ATOM   2451  H  HG22 . ILE B  1 53 ? 59.332 68.734 1.071   1.00 36.58  ?  53   ILE B HG22 1 
ATOM   2452  H  HG23 . ILE B  1 53 ? 59.530 68.075 -0.342  1.00 36.58  ?  53   ILE B HG23 1 
ATOM   2453  H  HD11 . ILE B  1 53 ? 56.316 66.675 2.618   1.00 31.38  ?  53   ILE B HD11 1 
ATOM   2454  H  HD12 . ILE B  1 53 ? 55.221 67.799 2.721   1.00 31.38  ?  53   ILE B HD12 1 
ATOM   2455  H  HD13 . ILE B  1 53 ? 55.281 66.875 1.450   1.00 31.38  ?  53   ILE B HD13 1 
ATOM   2456  N  N    . SER B  1 54 ? 55.076 68.577 -1.526  1.00 22.12  ?  54   SER B N    1 
ATOM   2457  C  CA   . SER B  1 54 ? 54.373 69.557 -2.342  1.00 22.83  ?  54   SER B CA   1 
ATOM   2458  C  C    . SER B  1 54 ? 53.263 70.249 -1.572  1.00 21.36  ?  54   SER B C    1 
ATOM   2459  O  O    . SER B  1 54 ? 52.748 69.723 -0.583  1.00 22.80  ?  54   SER B O    1 
ATOM   2460  C  CB   . SER B  1 54 ? 53.752 68.869 -3.560  1.00 23.09  ?  54   SER B CB   1 
ATOM   2461  O  OG   . SER B  1 54 ? 54.739 68.334 -4.421  1.00 24.68  ?  54   SER B OG   1 
ATOM   2462  H  H    . SER B  1 54 ? 54.557 68.059 -1.077  1.00 26.54  ?  54   SER B H    1 
ATOM   2463  H  HA   . SER B  1 54 ? 55.006 70.236 -2.655  1.00 27.39  ?  54   SER B HA   1 
ATOM   2464  H  HB2  . SER B  1 54 ? 53.180 68.148 -3.254  1.00 27.71  ?  54   SER B HB2  1 
ATOM   2465  H  HB3  . SER B  1 54 ? 53.227 69.519 -4.052  1.00 27.71  ?  54   SER B HB3  1 
ATOM   2466  H  HG   . SER B  1 54 ? 55.487 68.484 -4.119  1.00 29.62  ?  54   SER B HG   1 
ATOM   2467  N  N    . VAL B  1 55 ? 52.899 71.438 -2.037  1.00 19.04  ?  55   VAL B N    1 
ATOM   2468  C  CA   . VAL B  1 55 ? 51.681 72.088 -1.587  1.00 18.80  ?  55   VAL B CA   1 
ATOM   2469  C  C    . VAL B  1 55 ? 50.745 72.239 -2.778  1.00 20.71  ?  55   VAL B C    1 
ATOM   2470  O  O    . VAL B  1 55 ? 51.098 72.857 -3.784  1.00 22.37  ?  55   VAL B O    1 
ATOM   2471  C  CB   . VAL B  1 55 ? 51.953 73.469 -0.972  1.00 18.61  ?  55   VAL B CB   1 
ATOM   2472  C  CG1  . VAL B  1 55 ? 50.639 74.191 -0.691  1.00 19.07  ?  55   VAL B CG1  1 
ATOM   2473  C  CG2  . VAL B  1 55 ? 52.770 73.327 0.304   1.00 18.18  ?  55   VAL B CG2  1 
ATOM   2474  H  H    . VAL B  1 55 ? 53.345 71.890 -2.617  1.00 22.85  ?  55   VAL B H    1 
ATOM   2475  H  HA   . VAL B  1 55 ? 51.241 71.529 -0.913  1.00 22.56  ?  55   VAL B HA   1 
ATOM   2476  H  HB   . VAL B  1 55 ? 52.469 74.008 -1.607  1.00 22.33  ?  55   VAL B HB   1 
ATOM   2477  H  HG11 . VAL B  1 55 ? 50.120 73.667 -0.077  1.00 22.88  ?  55   VAL B HG11 1 
ATOM   2478  H  HG12 . VAL B  1 55 ? 50.831 75.051 -0.309  1.00 22.88  ?  55   VAL B HG12 1 
ATOM   2479  H  HG13 . VAL B  1 55 ? 50.160 74.300 -1.516  1.00 22.88  ?  55   VAL B HG13 1 
ATOM   2480  H  HG21 . VAL B  1 55 ? 53.606 72.903 0.094   1.00 21.82  ?  55   VAL B HG21 1 
ATOM   2481  H  HG22 . VAL B  1 55 ? 52.929 74.200 0.671   1.00 21.82  ?  55   VAL B HG22 1 
ATOM   2482  H  HG23 . VAL B  1 55 ? 52.279 72.791 0.931   1.00 21.82  ?  55   VAL B HG23 1 
ATOM   2483  N  N    . PHE B  1 56 ? 49.560 71.653 -2.670  1.00 20.65  ?  56   PHE B N    1 
ATOM   2484  C  CA   . PHE B  1 56 ? 48.548 71.802 -3.704  1.00 20.93  ?  56   PHE B CA   1 
ATOM   2485  C  C    . PHE B  1 56 ? 47.524 72.838 -3.274  1.00 22.08  ?  56   PHE B C    1 
ATOM   2486  O  O    . PHE B  1 56 ? 47.226 72.982 -2.088  1.00 21.13  ?  56   PHE B O    1 
ATOM   2487  C  CB   . PHE B  1 56 ? 47.851 70.471 -3.988  1.00 18.75  ?  56   PHE B CB   1 
ATOM   2488  C  CG   . PHE B  1 56 ? 48.655 69.537 -4.839  1.00 18.70  ?  56   PHE B CG   1 
ATOM   2489  C  CD1  . PHE B  1 56 ? 49.700 68.810 -4.296  1.00 18.30  ?  56   PHE B CD1  1 
ATOM   2490  C  CD2  . PHE B  1 56 ? 48.365 69.384 -6.185  1.00 18.53  ?  56   PHE B CD2  1 
ATOM   2491  C  CE1  . PHE B  1 56 ? 50.444 67.948 -5.080  1.00 18.67  ?  56   PHE B CE1  1 
ATOM   2492  C  CE2  . PHE B  1 56 ? 49.104 68.524 -6.974  1.00 19.14  ?  56   PHE B CE2  1 
ATOM   2493  C  CZ   . PHE B  1 56 ? 50.144 67.806 -6.421  1.00 19.07  ?  56   PHE B CZ   1 
ATOM   2494  H  H    . PHE B  1 56 ? 49.317 71.162 -2.006  1.00 24.78  ?  56   PHE B H    1 
ATOM   2495  H  HA   . PHE B  1 56 ? 48.972 72.111 -4.532  1.00 25.11  ?  56   PHE B HA   1 
ATOM   2496  H  HB2  . PHE B  1 56 ? 47.674 70.025 -3.145  1.00 22.50  ?  56   PHE B HB2  1 
ATOM   2497  H  HB3  . PHE B  1 56 ? 47.016 70.647 -4.448  1.00 22.50  ?  56   PHE B HB3  1 
ATOM   2498  H  HD1  . PHE B  1 56 ? 49.905 68.904 -3.394  1.00 21.96  ?  56   PHE B HD1  1 
ATOM   2499  H  HD2  . PHE B  1 56 ? 47.665 69.866 -6.563  1.00 22.23  ?  56   PHE B HD2  1 
ATOM   2500  H  HE1  . PHE B  1 56 ? 51.144 67.465 -4.706  1.00 22.40  ?  56   PHE B HE1  1 
ATOM   2501  H  HE2  . PHE B  1 56 ? 48.901 68.429 -7.876  1.00 22.97  ?  56   PHE B HE2  1 
ATOM   2502  H  HZ   . PHE B  1 56 ? 50.643 67.226 -6.950  1.00 22.88  ?  56   PHE B HZ   1 
ATOM   2503  N  N    . ASP B  1 57 ? 46.995 73.559 -4.253  1.00 22.04  ?  57   ASP B N    1 
ATOM   2504  C  CA   . ASP B  1 57 ? 45.983 74.567 -4.010  1.00 24.33  ?  57   ASP B CA   1 
ATOM   2505  C  C    . ASP B  1 57 ? 44.788 74.253 -4.900  1.00 23.59  ?  57   ASP B C    1 
ATOM   2506  O  O    . ASP B  1 57 ? 44.746 74.657 -6.062  1.00 25.82  ?  57   ASP B O    1 
ATOM   2507  C  CB   . ASP B  1 57 ? 46.545 75.955 -4.319  1.00 27.14  ?  57   ASP B CB   1 
ATOM   2508  C  CG   . ASP B  1 57 ? 45.574 77.066 -3.985  1.00 32.59  ?  57   ASP B CG   1 
ATOM   2509  O  OD1  . ASP B  1 57 ? 44.619 76.814 -3.224  1.00 35.83  ?  57   ASP B OD1  1 
ATOM   2510  O  OD2  . ASP B  1 57 ? 45.772 78.195 -4.475  1.00 32.65  ?  57   ASP B OD2  1 
ATOM   2511  H  H    . ASP B  1 57 ? 47.212 73.479 -5.081  1.00 26.45  ?  57   ASP B H    1 
ATOM   2512  H  HA   . ASP B  1 57 ? 45.699 74.538 -3.072  1.00 29.19  ?  57   ASP B HA   1 
ATOM   2513  H  HB2  . ASP B  1 57 ? 47.350 76.093 -3.796  1.00 32.57  ?  57   ASP B HB2  1 
ATOM   2514  H  HB3  . ASP B  1 57 ? 46.750 76.010 -5.265  1.00 32.57  ?  57   ASP B HB3  1 
ATOM   2515  N  N    . VAL B  1 58 ? 43.829 73.510 -4.356  1.00 24.11  ?  58   VAL B N    1 
ATOM   2516  C  CA   . VAL B  1 58 ? 42.673 73.068 -5.126  1.00 26.62  ?  58   VAL B CA   1 
ATOM   2517  C  C    . VAL B  1 58 ? 41.388 73.329 -4.350  1.00 28.37  ?  58   VAL B C    1 
ATOM   2518  O  O    . VAL B  1 58 ? 41.417 73.582 -3.145  1.00 29.20  ?  58   VAL B O    1 
ATOM   2519  C  CB   . VAL B  1 58 ? 42.769 71.571 -5.484  1.00 28.29  ?  58   VAL B CB   1 
ATOM   2520  C  CG1  . VAL B  1 58 ? 44.047 71.294 -6.265  1.00 27.51  ?  58   VAL B CG1  1 
ATOM   2521  C  CG2  . VAL B  1 58 ? 42.714 70.715 -4.234  1.00 30.35  ?  58   VAL B CG2  1 
ATOM   2522  H  H    . VAL B  1 58 ? 43.826 73.247 -3.537  1.00 28.94  ?  58   VAL B H    1 
ATOM   2523  H  HA   . VAL B  1 58 ? 42.632 73.578 -5.961  1.00 31.95  ?  58   VAL B HA   1 
ATOM   2524  H  HB   . VAL B  1 58 ? 42.008 71.329 -6.052  1.00 33.94  ?  58   VAL B HB   1 
ATOM   2525  H  HG11 . VAL B  1 58 ? 44.802 71.539 -5.726  1.00 33.01  ?  58   VAL B HG11 1 
ATOM   2526  H  HG12 . VAL B  1 58 ? 44.086 70.358 -6.478  1.00 33.01  ?  58   VAL B HG12 1 
ATOM   2527  H  HG13 . VAL B  1 58 ? 44.038 71.813 -7.073  1.00 33.01  ?  58   VAL B HG13 1 
ATOM   2528  H  HG21 . VAL B  1 58 ? 41.883 70.877 -3.781  1.00 36.42  ?  58   VAL B HG21 1 
ATOM   2529  H  HG22 . VAL B  1 58 ? 42.775 69.791 -4.486  1.00 36.42  ?  58   VAL B HG22 1 
ATOM   2530  H  HG23 . VAL B  1 58 ? 43.449 70.949 -3.663  1.00 36.42  ?  58   VAL B HG23 1 
ATOM   2531  N  N    . ASN B  1 59 ? 40.258 73.254 -5.043  1.00 27.74  ?  59   ASN B N    1 
ATOM   2532  C  CA   . ASN B  1 59 ? 38.998 73.730 -4.488  1.00 29.79  ?  59   ASN B CA   1 
ATOM   2533  C  C    . ASN B  1 59 ? 38.201 72.695 -3.692  1.00 26.76  ?  59   ASN B C    1 
ATOM   2534  O  O    . ASN B  1 59 ? 37.232 73.051 -3.026  1.00 28.21  ?  59   ASN B O    1 
ATOM   2535  C  CB   . ASN B  1 59 ? 38.129 74.310 -5.605  1.00 34.09  ?  59   ASN B CB   1 
ATOM   2536  C  CG   . ASN B  1 59 ? 38.723 75.572 -6.208  1.00 37.16  ?  59   ASN B CG   1 
ATOM   2537  O  OD1  . ASN B  1 59 ? 38.961 75.647 -7.412  1.00 37.57  ?  59   ASN B OD1  1 
ATOM   2538  N  ND2  . ASN B  1 59 ? 38.967 76.570 -5.366  1.00 39.28  ?  59   ASN B ND2  1 
ATOM   2539  H  H    . ASN B  1 59 ? 40.194 72.932 -5.837  1.00 33.29  ?  59   ASN B H    1 
ATOM   2540  H  HA   . ASN B  1 59 ? 39.200 74.465 -3.872  1.00 35.75  ?  59   ASN B HA   1 
ATOM   2541  H  HB2  . ASN B  1 59 ? 38.041 73.651 -6.312  1.00 40.91  ?  59   ASN B HB2  1 
ATOM   2542  H  HB3  . ASN B  1 59 ? 37.255 74.530 -5.246  1.00 40.91  ?  59   ASN B HB3  1 
ATOM   2543  H  HD21 . ASN B  1 59 ? 38.788 76.480 -4.530  1.00 47.14  ?  59   ASN B HD21 1 
ATOM   2544  H  HD22 . ASN B  1 59 ? 39.303 77.305 -5.658  1.00 47.14  ?  59   ASN B HD22 1 
ATOM   2545  N  N    . SER B  1 60 ? 38.599 71.426 -3.751  1.00 26.03  ?  60   SER B N    1 
ATOM   2546  C  CA   . SER B  1 60 ? 37.885 70.384 -3.013  1.00 24.69  ?  60   SER B CA   1 
ATOM   2547  C  C    . SER B  1 60 ? 38.715 69.114 -2.857  1.00 23.52  ?  60   SER B C    1 
ATOM   2548  O  O    . SER B  1 60 ? 39.704 68.916 -3.567  1.00 23.03  ?  60   SER B O    1 
ATOM   2549  C  CB   . SER B  1 60 ? 36.571 70.043 -3.718  1.00 25.46  ?  60   SER B CB   1 
ATOM   2550  O  OG   . SER B  1 60 ? 36.813 69.464 -4.990  1.00 26.04  ?  60   SER B OG   1 
ATOM   2551  H  H    . SER B  1 60 ? 39.273 71.143 -4.205  1.00 31.24  ?  60   SER B H    1 
ATOM   2552  H  HA   . SER B  1 60 ? 37.671 70.718 -2.117  1.00 29.63  ?  60   SER B HA   1 
ATOM   2553  H  HB2  . SER B  1 60 ? 36.075 69.412 -3.173  1.00 30.55  ?  60   SER B HB2  1 
ATOM   2554  H  HB3  . SER B  1 60 ? 36.055 70.856 -3.835  1.00 30.55  ?  60   SER B HB3  1 
ATOM   2555  H  HG   . SER B  1 60 ? 36.101 69.286 -5.357  1.00 31.25  ?  60   SER B HG   1 
ATOM   2556  N  N    . HIS B  1 61 ? 38.303 68.260 -1.921  1.00 24.83  ?  61   HIS B N    1 
ATOM   2557  C  CA   . HIS B  1 61 ? 38.948 66.967 -1.724  1.00 23.58  ?  61   HIS B CA   1 
ATOM   2558  C  C    . HIS B  1 61 ? 38.818 66.133 -2.991  1.00 22.54  ?  61   HIS B C    1 
ATOM   2559  O  O    . HIS B  1 61 ? 39.777 65.497 -3.429  1.00 21.69  ?  61   HIS B O    1 
ATOM   2560  C  CB   . HIS B  1 61 ? 38.308 66.201 -0.563  1.00 23.70  ?  61   HIS B CB   1 
ATOM   2561  C  CG   . HIS B  1 61 ? 38.273 66.960 0.726   1.00 22.61  ?  61   HIS B CG   1 
ATOM   2562  N  ND1  . HIS B  1 61 ? 39.198 67.929 1.050   1.00 21.85  ?  61   HIS B ND1  1 
ATOM   2563  C  CD2  . HIS B  1 61 ? 37.420 66.888 1.776   1.00 22.49  ?  61   HIS B CD2  1 
ATOM   2564  C  CE1  . HIS B  1 61 ? 38.916 68.422 2.243   1.00 21.92  ?  61   HIS B CE1  1 
ATOM   2565  N  NE2  . HIS B  1 61 ? 37.841 67.808 2.704   1.00 22.23  ?  61   HIS B NE2  1 
ATOM   2566  H  H    . HIS B  1 61 ? 37.648 68.409 -1.384  1.00 29.80  ?  61   HIS B H    1 
ATOM   2567  H  HA   . HIS B  1 61 ? 39.900 67.097 -1.529  1.00 28.29  ?  61   HIS B HA   1 
ATOM   2568  H  HB2  . HIS B  1 61 ? 37.393 65.982 -0.802  1.00 28.44  ?  61   HIS B HB2  1 
ATOM   2569  H  HB3  . HIS B  1 61 ? 38.811 65.385 -0.412  1.00 28.44  ?  61   HIS B HB3  1 
ATOM   2570  H  HD1  . HIS B  1 61 ? 39.856 68.174 0.554   1.00 26.22  ?  61   HIS B HD1  1 
ATOM   2571  H  HD2  . HIS B  1 61 ? 36.685 66.323 1.852   1.00 26.98  ?  61   HIS B HD2  1 
ATOM   2572  H  HE1  . HIS B  1 61 ? 39.392 69.088 2.682   1.00 26.30  ?  61   HIS B HE1  1 
ATOM   2573  H  HE2  . HIS B  1 61 ? 37.466 67.960 3.464   1.00 26.68  ?  61   HIS B HE2  1 
ATOM   2574  N  N    . ASP B  1 62 ? 37.619 66.136 -3.566  1.00 21.53  ?  62   ASP B N    1 
ATOM   2575  C  CA   . ASP B  1 62 ? 37.339 65.367 -4.770  1.00 23.39  ?  62   ASP B CA   1 
ATOM   2576  C  C    . ASP B  1 62 ? 38.292 65.776 -5.875  1.00 25.11  ?  62   ASP B C    1 
ATOM   2577  O  O    . ASP B  1 62 ? 38.808 64.936 -6.611  1.00 25.65  ?  62   ASP B O    1 
ATOM   2578  C  CB   . ASP B  1 62 ? 35.897 65.591 -5.229  1.00 27.79  ?  62   ASP B CB   1 
ATOM   2579  C  CG   . ASP B  1 62 ? 34.885 64.911 -4.328  1.00 33.63  ?  62   ASP B CG   1 
ATOM   2580  O  OD1  . ASP B  1 62 ? 35.272 63.972 -3.603  1.00 33.69  ?  62   ASP B OD1  1 
ATOM   2581  O  OD2  . ASP B  1 62 ? 33.702 65.309 -4.352  1.00 38.86  ?  62   ASP B OD2  1 
ATOM   2582  H  H    . ASP B  1 62 ? 36.944 66.582 -3.273  1.00 25.83  ?  62   ASP B H    1 
ATOM   2583  H  HA   . ASP B  1 62 ? 37.464 64.412 -4.587  1.00 28.07  ?  62   ASP B HA   1 
ATOM   2584  H  HB2  . ASP B  1 62 ? 35.709 66.543 -5.227  1.00 33.35  ?  62   ASP B HB2  1 
ATOM   2585  H  HB3  . ASP B  1 62 ? 35.790 65.234 -6.124  1.00 33.35  ?  62   ASP B HB3  1 
ATOM   2586  N  N    . GLU B  1 63 ? 38.522 67.079 -5.977  1.00 25.95  ?  63   GLU B N    1 
ATOM   2587  C  CA   . GLU B  1 63 ? 39.397 67.635 -6.996  1.00 29.76  ?  63   GLU B CA   1 
ATOM   2588  C  C    . GLU B  1 63 ? 40.839 67.169 -6.795  1.00 25.40  ?  63   GLU B C    1 
ATOM   2589  O  O    . GLU B  1 63 ? 41.514 66.792 -7.751  1.00 23.51  ?  63   GLU B O    1 
ATOM   2590  C  CB   . GLU B  1 63 ? 39.317 69.160 -6.960  1.00 37.12  ?  63   GLU B CB   1 
ATOM   2591  C  CG   . GLU B  1 63 ? 39.987 69.855 -8.129  1.00 43.76  ?  63   GLU B CG   1 
ATOM   2592  C  CD   . GLU B  1 63 ? 39.527 71.294 -8.279  1.00 49.04  ?  63   GLU B CD   1 
ATOM   2593  O  OE1  . GLU B  1 63 ? 38.334 71.505 -8.591  1.00 52.29  ?  63   GLU B OE1  1 
ATOM   2594  O  OE2  . GLU B  1 63 ? 40.354 72.210 -8.078  1.00 49.11  ?  63   GLU B OE2  1 
ATOM   2595  H  H    . GLU B  1 63 ? 38.177 67.671 -5.457  1.00 31.13  ?  63   GLU B H    1 
ATOM   2596  H  HA   . GLU B  1 63 ? 39.097 67.332 -7.879  1.00 35.71  ?  63   GLU B HA   1 
ATOM   2597  H  HB2  . GLU B  1 63 ? 38.383 69.422 -6.959  1.00 44.54  ?  63   GLU B HB2  1 
ATOM   2598  H  HB3  . GLU B  1 63 ? 39.745 69.474 -6.148  1.00 44.54  ?  63   GLU B HB3  1 
ATOM   2599  H  HG2  . GLU B  1 63 ? 40.947 69.858 -7.990  1.00 52.51  ?  63   GLU B HG2  1 
ATOM   2600  H  HG3  . GLU B  1 63 ? 39.769 69.382 -8.947  1.00 52.51  ?  63   GLU B HG3  1 
ATOM   2601  N  N    . LEU B  1 64 ? 41.306 67.191 -5.549  1.00 24.64  ?  64   LEU B N    1 
ATOM   2602  C  CA   . LEU B  1 64 ? 42.660 66.741 -5.243  1.00 22.74  ?  64   LEU B CA   1 
ATOM   2603  C  C    . LEU B  1 64 ? 42.810 65.255 -5.551  1.00 22.18  ?  64   LEU B C    1 
ATOM   2604  O  O    . LEU B  1 64 ? 43.816 64.833 -6.124  1.00 22.60  ?  64   LEU B O    1 
ATOM   2605  C  CB   . LEU B  1 64 ? 43.006 66.998 -3.777  1.00 21.19  ?  64   LEU B CB   1 
ATOM   2606  C  CG   . LEU B  1 64 ? 44.413 66.561 -3.346  1.00 20.05  ?  64   LEU B CG   1 
ATOM   2607  C  CD1  . LEU B  1 64 ? 45.490 67.323 -4.107  1.00 19.36  ?  64   LEU B CD1  1 
ATOM   2608  C  CD2  . LEU B  1 64 ? 44.592 66.741 -1.847  1.00 20.46  ?  64   LEU B CD2  1 
ATOM   2609  H  H    . LEU B  1 64 ? 40.860 67.461 -4.866  1.00 29.56  ?  64   LEU B H    1 
ATOM   2610  H  HA   . LEU B  1 64 ? 43.297 67.235 -5.800  1.00 27.29  ?  64   LEU B HA   1 
ATOM   2611  H  HB2  . LEU B  1 64 ? 42.933 67.950 -3.606  1.00 25.42  ?  64   LEU B HB2  1 
ATOM   2612  H  HB3  . LEU B  1 64 ? 42.371 66.519 -3.222  1.00 25.42  ?  64   LEU B HB3  1 
ATOM   2613  H  HG   . LEU B  1 64 ? 44.521 65.618 -3.546  1.00 24.06  ?  64   LEU B HG   1 
ATOM   2614  H  HD11 . LEU B  1 64 ? 45.391 68.262 -3.931  1.00 23.23  ?  64   LEU B HD11 1 
ATOM   2615  H  HD12 . LEU B  1 64 ? 46.352 67.023 -3.812  1.00 23.23  ?  64   LEU B HD12 1 
ATOM   2616  H  HD13 . LEU B  1 64 ? 45.388 67.153 -5.047  1.00 23.23  ?  64   LEU B HD13 1 
ATOM   2617  H  HD21 . LEU B  1 64 ? 43.941 66.206 -1.388  1.00 24.55  ?  64   LEU B HD21 1 
ATOM   2618  H  HD22 . LEU B  1 64 ? 45.478 66.462 -1.603  1.00 24.55  ?  64   LEU B HD22 1 
ATOM   2619  H  HD23 . LEU B  1 64 ? 44.469 67.668 -1.628  1.00 24.55  ?  64   LEU B HD23 1 
ATOM   2620  N  N    . HIS B  1 65 ? 41.808 64.465 -5.175  1.00 22.75  ?  65   HIS B N    1 
ATOM   2621  C  CA   . HIS B  1 65 ? 41.867 63.021 -5.383  1.00 23.29  ?  65   HIS B CA   1 
ATOM   2622  C  C    . HIS B  1 65 ? 42.072 62.690 -6.858  1.00 25.46  ?  65   HIS B C    1 
ATOM   2623  O  O    . HIS B  1 65 ? 42.969 61.927 -7.206  1.00 26.26  ?  65   HIS B O    1 
ATOM   2624  C  CB   . HIS B  1 65 ? 40.601 62.334 -4.859  1.00 23.20  ?  65   HIS B CB   1 
ATOM   2625  C  CG   . HIS B  1 65 ? 40.559 60.861 -5.129  1.00 24.50  ?  65   HIS B CG   1 
ATOM   2626  N  ND1  . HIS B  1 65 ? 41.051 59.923 -4.246  1.00 25.82  ?  65   HIS B ND1  1 
ATOM   2627  C  CD2  . HIS B  1 65 ? 40.091 60.163 -6.193  1.00 24.15  ?  65   HIS B CD2  1 
ATOM   2628  C  CE1  . HIS B  1 65 ? 40.882 58.714 -4.749  1.00 25.67  ?  65   HIS B CE1  1 
ATOM   2629  N  NE2  . HIS B  1 65 ? 40.304 58.831 -5.930  1.00 24.71  ?  65   HIS B NE2  1 
ATOM   2630  H  H    . HIS B  1 65 ? 41.085 64.739 -4.799  1.00 27.30  ?  65   HIS B H    1 
ATOM   2631  H  HA   . HIS B  1 65 ? 42.632 62.661 -4.886  1.00 27.94  ?  65   HIS B HA   1 
ATOM   2632  H  HB2  . HIS B  1 65 ? 40.551 62.461 -3.898  1.00 27.83  ?  65   HIS B HB2  1 
ATOM   2633  H  HB3  . HIS B  1 65 ? 39.828 62.736 -5.284  1.00 27.83  ?  65   HIS B HB3  1 
ATOM   2634  H  HD1  . HIS B  1 65 ? 41.408 60.098 -3.484  1.00 30.99  ?  65   HIS B HD1  1 
ATOM   2635  H  HD2  . HIS B  1 65 ? 39.698 60.519 -6.956  1.00 28.98  ?  65   HIS B HD2  1 
ATOM   2636  H  HE1  . HIS B  1 65 ? 41.131 57.915 -4.342  1.00 30.80  ?  65   HIS B HE1  1 
ATOM   2637  H  HE2  . HIS B  1 65 ? 40.093 58.179 -6.450  1.00 29.66  ?  65   HIS B HE2  1 
ATOM   2638  N  N    . GLU B  1 66 ? 41.243 63.268 -7.723  1.00 25.01  ?  66   GLU B N    1 
ATOM   2639  C  CA   . GLU B  1 66 ? 41.318 62.981 -9.153  1.00 27.48  ?  66   GLU B CA   1 
ATOM   2640  C  C    . GLU B  1 66 ? 42.662 63.410 -9.743  1.00 25.73  ?  66   GLU B C    1 
ATOM   2641  O  O    . GLU B  1 66 ? 43.206 62.741 -10.620 1.00 23.92  ?  66   GLU B O    1 
ATOM   2642  C  CB   . GLU B  1 66 ? 40.171 63.664 -9.903  1.00 32.55  ?  66   GLU B CB   1 
ATOM   2643  C  CG   . GLU B  1 66 ? 38.791 63.128 -9.545  1.00 38.23  ?  66   GLU B CG   1 
ATOM   2644  C  CD   . GLU B  1 66 ? 38.657 61.632 -9.786  1.00 44.40  ?  66   GLU B CD   1 
ATOM   2645  O  OE1  . GLU B  1 66 ? 39.382 61.093 -10.651 1.00 46.57  ?  66   GLU B OE1  1 
ATOM   2646  O  OE2  . GLU B  1 66 ? 37.828 60.993 -9.104  1.00 46.53  ?  66   GLU B OE2  1 
ATOM   2647  H  H    . GLU B  1 66 ? 40.629 63.830 -7.508  1.00 30.01  ?  66   GLU B H    1 
ATOM   2648  H  HA   . GLU B  1 66 ? 41.228 62.014 -9.285  1.00 32.97  ?  66   GLU B HA   1 
ATOM   2649  H  HB2  . GLU B  1 66 ? 40.183 64.611 -9.696  1.00 39.06  ?  66   GLU B HB2  1 
ATOM   2650  H  HB3  . GLU B  1 66 ? 40.301 63.534 -10.855 1.00 39.06  ?  66   GLU B HB3  1 
ATOM   2651  H  HG2  . GLU B  1 66 ? 38.621 63.297 -8.605  1.00 45.88  ?  66   GLU B HG2  1 
ATOM   2652  H  HG3  . GLU B  1 66 ? 38.127 63.580 -10.089 1.00 45.88  ?  66   GLU B HG3  1 
ATOM   2653  N  N    . ILE B  1 67 ? 43.195 64.526 -9.262  1.00 26.19  ?  67   ILE B N    1 
ATOM   2654  C  CA   . ILE B  1 67 ? 44.496 64.998 -9.722  1.00 26.94  ?  67   ILE B CA   1 
ATOM   2655  C  C    . ILE B  1 67 ? 45.587 63.994 -9.350  1.00 26.20  ?  67   ILE B C    1 
ATOM   2656  O  O    . ILE B  1 67 ? 46.364 63.566 -10.204 1.00 28.58  ?  67   ILE B O    1 
ATOM   2657  C  CB   . ILE B  1 67 ? 44.833 66.387 -9.144  1.00 26.74  ?  67   ILE B CB   1 
ATOM   2658  C  CG1  . ILE B  1 67 ? 44.003 67.460 -9.854  1.00 29.07  ?  67   ILE B CG1  1 
ATOM   2659  C  CG2  . ILE B  1 67 ? 46.317 66.687 -9.300  1.00 25.93  ?  67   ILE B CG2  1 
ATOM   2660  C  CD1  . ILE B  1 67 ? 44.159 68.852 -9.274  1.00 29.94  ?  67   ILE B CD1  1 
ATOM   2661  H  H    . ILE B  1 67 ? 42.825 65.029 -8.669  1.00 31.42  ?  67   ILE B H    1 
ATOM   2662  H  HA   . ILE B  1 67 ? 44.478 65.075 -10.699 1.00 32.33  ?  67   ILE B HA   1 
ATOM   2663  H  HB   . ILE B  1 67 ? 44.611 66.394 -8.200  1.00 32.09  ?  67   ILE B HB   1 
ATOM   2664  H  HG12 . ILE B  1 67 ? 44.273 67.497 -10.785 1.00 34.89  ?  67   ILE B HG12 1 
ATOM   2665  H  HG13 . ILE B  1 67 ? 43.066 67.219 -9.794  1.00 34.89  ?  67   ILE B HG13 1 
ATOM   2666  H  HG21 . ILE B  1 67 ? 46.542 66.671 -10.233 1.00 31.11  ?  67   ILE B HG21 1 
ATOM   2667  H  HG22 . ILE B  1 67 ? 46.500 67.555 -8.933  1.00 31.11  ?  67   ILE B HG22 1 
ATOM   2668  H  HG23 . ILE B  1 67 ? 46.821 66.019 -8.829  1.00 31.11  ?  67   ILE B HG23 1 
ATOM   2669  H  HD11 . ILE B  1 67 ? 45.081 69.115 -9.337  1.00 35.93  ?  67   ILE B HD11 1 
ATOM   2670  H  HD12 . ILE B  1 67 ? 43.610 69.462 -9.773  1.00 35.93  ?  67   ILE B HD12 1 
ATOM   2671  H  HD13 . ILE B  1 67 ? 43.884 68.840 -8.354  1.00 35.93  ?  67   ILE B HD13 1 
ATOM   2672  N  N    . LEU B  1 68 ? 45.636 63.613 -8.078  1.00 24.19  ?  68   LEU B N    1 
ATOM   2673  C  CA   . LEU B  1 68 ? 46.628 62.650 -7.613  1.00 23.46  ?  68   LEU B CA   1 
ATOM   2674  C  C    . LEU B  1 68 ? 46.467 61.311 -8.328  1.00 25.47  ?  68   LEU B C    1 
ATOM   2675  O  O    . LEU B  1 68 ? 47.448 60.683 -8.727  1.00 25.51  ?  68   LEU B O    1 
ATOM   2676  C  CB   . LEU B  1 68 ? 46.509 62.452 -6.103  1.00 21.88  ?  68   LEU B CB   1 
ATOM   2677  C  CG   . LEU B  1 68 ? 46.818 63.687 -5.252  1.00 19.90  ?  68   LEU B CG   1 
ATOM   2678  C  CD1  . LEU B  1 68 ? 46.646 63.374 -3.772  1.00 18.81  ?  68   LEU B CD1  1 
ATOM   2679  C  CD2  . LEU B  1 68 ? 48.223 64.197 -5.535  1.00 19.29  ?  68   LEU B CD2  1 
ATOM   2680  H  H    . LEU B  1 68 ? 45.105 63.896 -7.464  1.00 29.02  ?  68   LEU B H    1 
ATOM   2681  H  HA   . LEU B  1 68 ? 47.525 62.994 -7.807  1.00 28.15  ?  68   LEU B HA   1 
ATOM   2682  H  HB2  . LEU B  1 68 ? 45.601 62.178 -5.899  1.00 26.25  ?  68   LEU B HB2  1 
ATOM   2683  H  HB3  . LEU B  1 68 ? 47.126 61.753 -5.835  1.00 26.25  ?  68   LEU B HB3  1 
ATOM   2684  H  HG   . LEU B  1 68 ? 46.193 64.392 -5.483  1.00 23.88  ?  68   LEU B HG   1 
ATOM   2685  H  HD11 . LEU B  1 68 ? 47.247 62.666 -3.531  1.00 22.57  ?  68   LEU B HD11 1 
ATOM   2686  H  HD12 . LEU B  1 68 ? 46.844 64.162 -3.261  1.00 22.57  ?  68   LEU B HD12 1 
ATOM   2687  H  HD13 . LEU B  1 68 ? 45.739 63.101 -3.615  1.00 22.57  ?  68   LEU B HD13 1 
ATOM   2688  H  HD21 . LEU B  1 68 ? 48.290 64.430 -6.464  1.00 23.15  ?  68   LEU B HD21 1 
ATOM   2689  H  HD22 . LEU B  1 68 ? 48.391 64.969 -4.991  1.00 23.15  ?  68   LEU B HD22 1 
ATOM   2690  H  HD23 . LEU B  1 68 ? 48.855 63.504 -5.325  1.00 23.15  ?  68   LEU B HD23 1 
ATOM   2691  N  N    . TRP B  1 69 ? 45.221 60.885 -8.495  1.00 27.31  ?  69   TRP B N    1 
ATOM   2692  C  CA   . TRP B  1 69 ? 44.921 59.614 -9.139  1.00 31.27  ?  69   TRP B CA   1 
ATOM   2693  C  C    . TRP B  1 69 ? 45.458 59.576 -10.570 1.00 32.52  ?  69   TRP B C    1 
ATOM   2694  O  O    . TRP B  1 69 ? 45.794 58.508 -11.083 1.00 34.44  ?  69   TRP B O    1 
ATOM   2695  C  CB   . TRP B  1 69 ? 43.408 59.383 -9.142  1.00 34.29  ?  69   TRP B CB   1 
ATOM   2696  C  CG   . TRP B  1 69 ? 43.002 57.983 -9.482  1.00 37.59  ?  69   TRP B CG   1 
ATOM   2697  C  CD1  . TRP B  1 69 ? 42.739 57.484 -10.726 1.00 41.74  ?  69   TRP B CD1  1 
ATOM   2698  C  CD2  . TRP B  1 69 ? 42.804 56.900 -8.565  1.00 37.62  ?  69   TRP B CD2  1 
ATOM   2699  N  NE1  . TRP B  1 69 ? 42.390 56.157 -10.639 1.00 42.79  ?  69   TRP B NE1  1 
ATOM   2700  C  CE2  . TRP B  1 69 ? 42.423 55.774 -9.323  1.00 40.81  ?  69   TRP B CE2  1 
ATOM   2701  C  CE3  . TRP B  1 69 ? 42.912 56.772 -7.177  1.00 36.41  ?  69   TRP B CE3  1 
ATOM   2702  C  CZ2  . TRP B  1 69 ? 42.152 54.537 -8.740  1.00 42.21  ?  69   TRP B CZ2  1 
ATOM   2703  C  CZ3  . TRP B  1 69 ? 42.642 55.543 -6.600  1.00 38.89  ?  69   TRP B CZ3  1 
ATOM   2704  C  CH2  . TRP B  1 69 ? 42.266 54.442 -7.381  1.00 41.67  ?  69   TRP B CH2  1 
ATOM   2705  H  H    . TRP B  1 69 ? 44.524 61.319 -8.240  1.00 32.78  ?  69   TRP B H    1 
ATOM   2706  H  HA   . TRP B  1 69 ? 45.342 58.888 -8.633  1.00 37.52  ?  69   TRP B HA   1 
ATOM   2707  H  HB2  . TRP B  1 69 ? 43.061 59.584 -8.258  1.00 41.15  ?  69   TRP B HB2  1 
ATOM   2708  H  HB3  . TRP B  1 69 ? 43.004 59.975 -9.795  1.00 41.15  ?  69   TRP B HB3  1 
ATOM   2709  H  HD1  . TRP B  1 69 ? 42.787 57.971 -11.517 1.00 50.09  ?  69   TRP B HD1  1 
ATOM   2710  H  HE1  . TRP B  1 69 ? 42.187 55.649 -11.302 1.00 51.35  ?  69   TRP B HE1  1 
ATOM   2711  H  HE3  . TRP B  1 69 ? 43.161 57.498 -6.652  1.00 43.69  ?  69   TRP B HE3  1 
ATOM   2712  H  HZ2  . TRP B  1 69 ? 41.903 53.804 -9.256  1.00 50.65  ?  69   TRP B HZ2  1 
ATOM   2713  H  HZ3  . TRP B  1 69 ? 42.711 55.446 -5.677  1.00 46.67  ?  69   TRP B HZ3  1 
ATOM   2714  H  HH2  . TRP B  1 69 ? 42.091 53.628 -6.965  1.00 50.00  ?  69   TRP B HH2  1 
ATOM   2715  N  N    . SER B  1 70 ? 45.546 60.743 -11.204 1.00 30.79  ?  70   SER B N    1 
ATOM   2716  C  CA   . SER B  1 70 ? 45.932 60.829 -12.611 1.00 32.02  ?  70   SER B CA   1 
ATOM   2717  C  C    . SER B  1 70 ? 47.438 61.006 -12.812 1.00 30.00  ?  70   SER B C    1 
ATOM   2718  O  O    . SER B  1 70 ? 47.923 60.988 -13.943 1.00 32.47  ?  70   SER B O    1 
ATOM   2719  C  CB   . SER B  1 70 ? 45.188 61.981 -13.292 1.00 33.06  ?  70   SER B CB   1 
ATOM   2720  O  OG   . SER B  1 70 ? 45.692 63.243 -12.881 1.00 32.67  ?  70   SER B OG   1 
ATOM   2721  H  H    . SER B  1 70 ? 45.387 61.505 -10.839 1.00 36.95  ?  70   SER B H    1 
ATOM   2722  H  HA   . SER B  1 70 ? 45.668 59.998 -13.058 1.00 38.43  ?  70   SER B HA   1 
ATOM   2723  H  HB2  . SER B  1 70 ? 45.296 61.898 -14.253 1.00 39.67  ?  70   SER B HB2  1 
ATOM   2724  H  HB3  . SER B  1 70 ? 44.248 61.928 -13.060 1.00 39.67  ?  70   SER B HB3  1 
ATOM   2725  H  HG   . SER B  1 70 ? 46.302 63.140 -12.343 1.00 39.21  ?  70   SER B HG   1 
ATOM   2726  N  N    . LEU B  1 71 ? 48.178 61.184 -11.723 1.00 25.67  ?  71   LEU B N    1 
ATOM   2727  C  CA   . LEU B  1 71 ? 49.625 61.334 -11.819 1.00 22.74  ?  71   LEU B CA   1 
ATOM   2728  C  C    . LEU B  1 71 ? 50.247 60.050 -12.363 1.00 23.48  ?  71   LEU B C    1 
ATOM   2729  O  O    . LEU B  1 71 ? 49.927 58.958 -11.896 1.00 22.52  ?  71   LEU B O    1 
ATOM   2730  C  CB   . LEU B  1 71 ? 50.222 61.666 -10.454 1.00 20.80  ?  71   LEU B CB   1 
ATOM   2731  C  CG   . LEU B  1 71 ? 49.749 62.971 -9.811  1.00 20.32  ?  71   LEU B CG   1 
ATOM   2732  C  CD1  . LEU B  1 71 ? 50.490 63.201 -8.507  1.00 20.07  ?  71   LEU B CD1  1 
ATOM   2733  C  CD2  . LEU B  1 71 ? 49.939 64.152 -10.752 1.00 20.43  ?  71   LEU B CD2  1 
ATOM   2734  H  H    . LEU B  1 71 ? 47.869 61.222 -10.921 1.00 30.80  ?  71   LEU B H    1 
ATOM   2735  H  HA   . LEU B  1 71 ? 49.837 62.066 -12.436 1.00 27.29  ?  71   LEU B HA   1 
ATOM   2736  H  HB2  . LEU B  1 71 ? 50.002 60.947 -9.842  1.00 24.96  ?  71   LEU B HB2  1 
ATOM   2737  H  HB3  . LEU B  1 71 ? 51.186 61.724 -10.549 1.00 24.96  ?  71   LEU B HB3  1 
ATOM   2738  H  HG   . LEU B  1 71 ? 48.803 62.898 -9.609  1.00 24.38  ?  71   LEU B HG   1 
ATOM   2739  H  HD11 . LEU B  1 71 ? 51.431 63.255 -8.688  1.00 24.08  ?  71   LEU B HD11 1 
ATOM   2740  H  HD12 . LEU B  1 71 ? 50.184 64.022 -8.115  1.00 24.08  ?  71   LEU B HD12 1 
ATOM   2741  H  HD13 . LEU B  1 71 ? 50.312 62.467 -7.913  1.00 24.08  ?  71   LEU B HD13 1 
ATOM   2742  H  HD21 . LEU B  1 71 ? 49.430 63.999 -11.551 1.00 24.52  ?  71   LEU B HD21 1 
ATOM   2743  H  HD22 . LEU B  1 71 ? 49.632 64.950 -10.316 1.00 24.52  ?  71   LEU B HD22 1 
ATOM   2744  H  HD23 . LEU B  1 71 ? 50.871 64.233 -10.967 1.00 24.52  ?  71   LEU B HD23 1 
ATOM   2745  N  N    . PRO B  1 72 ? 51.134 60.175 -13.362 1.00 24.53  ?  72   PRO B N    1 
ATOM   2746  C  CA   . PRO B  1 72 ? 51.777 58.997 -13.958 1.00 25.26  ?  72   PRO B CA   1 
ATOM   2747  C  C    . PRO B  1 72 ? 52.486 58.094 -12.944 1.00 24.55  ?  72   PRO B C    1 
ATOM   2748  O  O    . PRO B  1 72 ? 52.516 56.880 -13.133 1.00 26.25  ?  72   PRO B O    1 
ATOM   2749  C  CB   . PRO B  1 72 ? 52.785 59.612 -14.932 1.00 27.11  ?  72   PRO B CB   1 
ATOM   2750  C  CG   . PRO B  1 72 ? 52.173 60.911 -15.318 1.00 27.66  ?  72   PRO B CG   1 
ATOM   2751  C  CD   . PRO B  1 72 ? 51.484 61.413 -14.081 1.00 26.17  ?  72   PRO B CD   1 
ATOM   2752  H  HA   . PRO B  1 72 ? 51.122 58.469 -14.461 1.00 30.32  ?  72   PRO B HA   1 
ATOM   2753  H  HB2  . PRO B  1 72 ? 53.634 59.749 -14.483 1.00 32.53  ?  72   PRO B HB2  1 
ATOM   2754  H  HB3  . PRO B  1 72 ? 52.890 59.036 -15.705 1.00 32.53  ?  72   PRO B HB3  1 
ATOM   2755  H  HG2  . PRO B  1 72 ? 52.867 61.528 -15.597 1.00 33.19  ?  72   PRO B HG2  1 
ATOM   2756  H  HG3  . PRO B  1 72 ? 51.532 60.770 -16.033 1.00 33.19  ?  72   PRO B HG3  1 
ATOM   2757  H  HD2  . PRO B  1 72 ? 52.091 61.952 -13.550 1.00 31.40  ?  72   PRO B HD2  1 
ATOM   2758  H  HD3  . PRO B  1 72 ? 50.682 61.906 -14.316 1.00 31.40  ?  72   PRO B HD3  1 
ATOM   2759  N  N    . PHE B  1 73 ? 53.044 58.672 -11.886 1.00 22.56  ?  73   PHE B N    1 
ATOM   2760  C  CA   . PHE B  1 73 ? 53.738 57.879 -10.873 1.00 24.11  ?  73   PHE B CA   1 
ATOM   2761  C  C    . PHE B  1 73 ? 52.784 57.251 -9.857  1.00 23.89  ?  73   PHE B C    1 
ATOM   2762  O  O    . PHE B  1 73 ? 53.200 56.414 -9.056  1.00 25.67  ?  73   PHE B O    1 
ATOM   2763  C  CB   . PHE B  1 73 ? 54.765 58.733 -10.124 1.00 23.92  ?  73   PHE B CB   1 
ATOM   2764  C  CG   . PHE B  1 73 ? 56.137 58.727 -10.742 1.00 26.64  ?  73   PHE B CG   1 
ATOM   2765  C  CD1  . PHE B  1 73 ? 57.015 57.684 -10.498 1.00 28.81  ?  73   PHE B CD1  1 
ATOM   2766  C  CD2  . PHE B  1 73 ? 56.554 59.769 -11.551 1.00 27.53  ?  73   PHE B CD2  1 
ATOM   2767  C  CE1  . PHE B  1 73 ? 58.280 57.678 -11.058 1.00 30.91  ?  73   PHE B CE1  1 
ATOM   2768  C  CE2  . PHE B  1 73 ? 57.818 59.767 -12.113 1.00 29.84  ?  73   PHE B CE2  1 
ATOM   2769  C  CZ   . PHE B  1 73 ? 58.681 58.719 -11.866 1.00 31.20  ?  73   PHE B CZ   1 
ATOM   2770  H  H    . PHE B  1 73 ? 53.036 59.518 -11.730 1.00 27.07  ?  73   PHE B H    1 
ATOM   2771  H  HA   . PHE B  1 73 ? 54.221 57.152 -11.319 1.00 28.93  ?  73   PHE B HA   1 
ATOM   2772  H  HB2  . PHE B  1 73 ? 54.453 59.651 -10.106 1.00 28.70  ?  73   PHE B HB2  1 
ATOM   2773  H  HB3  . PHE B  1 73 ? 54.848 58.398 -9.218  1.00 28.70  ?  73   PHE B HB3  1 
ATOM   2774  H  HD1  . PHE B  1 73 ? 56.750 56.978 -9.954  1.00 34.57  ?  73   PHE B HD1  1 
ATOM   2775  H  HD2  . PHE B  1 73 ? 55.977 60.478 -11.722 1.00 33.03  ?  73   PHE B HD2  1 
ATOM   2776  H  HE1  . PHE B  1 73 ? 58.859 56.970 -10.890 1.00 37.10  ?  73   PHE B HE1  1 
ATOM   2777  H  HE2  . PHE B  1 73 ? 58.086 60.471 -12.658 1.00 35.81  ?  73   PHE B HE2  1 
ATOM   2778  H  HZ   . PHE B  1 73 ? 59.531 58.716 -12.244 1.00 37.44  ?  73   PHE B HZ   1 
ATOM   2779  N  N    . PHE B  1 74 ? 51.513 57.641 -9.893  1.00 23.98  ?  74   PHE B N    1 
ATOM   2780  C  CA   . PHE B  1 74 ? 50.571 57.264 -8.838  1.00 23.18  ?  74   PHE B CA   1 
ATOM   2781  C  C    . PHE B  1 74 ? 50.656 55.795 -8.410  1.00 25.62  ?  74   PHE B C    1 
ATOM   2782  O  O    . PHE B  1 74 ? 50.680 55.505 -7.216  1.00 25.99  ?  74   PHE B O    1 
ATOM   2783  C  CB   . PHE B  1 74 ? 49.128 57.598 -9.230  1.00 22.59  ?  74   PHE B CB   1 
ATOM   2784  C  CG   . PHE B  1 74 ? 48.131 57.290 -8.149  1.00 22.39  ?  74   PHE B CG   1 
ATOM   2785  C  CD1  . PHE B  1 74 ? 47.930 58.177 -7.106  1.00 20.70  ?  74   PHE B CD1  1 
ATOM   2786  C  CD2  . PHE B  1 74 ? 47.415 56.104 -8.163  1.00 24.42  ?  74   PHE B CD2  1 
ATOM   2787  C  CE1  . PHE B  1 74 ? 47.025 57.894 -6.101  1.00 21.51  ?  74   PHE B CE1  1 
ATOM   2788  C  CE2  . PHE B  1 74 ? 46.506 55.817 -7.161  1.00 25.35  ?  74   PHE B CE2  1 
ATOM   2789  C  CZ   . PHE B  1 74 ? 46.312 56.714 -6.128  1.00 23.83  ?  74   PHE B CZ   1 
ATOM   2790  H  H    . PHE B  1 74 ? 51.169 58.125 -10.515 1.00 28.77  ?  74   PHE B H    1 
ATOM   2791  H  HA   . PHE B  1 74 ? 50.780 57.801 -8.046  1.00 27.82  ?  74   PHE B HA   1 
ATOM   2792  H  HB2  . PHE B  1 74 ? 49.068 58.545 -9.430  1.00 27.10  ?  74   PHE B HB2  1 
ATOM   2793  H  HB3  . PHE B  1 74 ? 48.888 57.079 -10.014 1.00 27.10  ?  74   PHE B HB3  1 
ATOM   2794  H  HD1  . PHE B  1 74 ? 48.408 58.974 -7.083  1.00 24.84  ?  74   PHE B HD1  1 
ATOM   2795  H  HD2  . PHE B  1 74 ? 47.542 55.497 -8.856  1.00 29.31  ?  74   PHE B HD2  1 
ATOM   2796  H  HE1  . PHE B  1 74 ? 46.895 58.501 -5.408  1.00 25.81  ?  74   PHE B HE1  1 
ATOM   2797  H  HE2  . PHE B  1 74 ? 46.027 55.020 -7.182  1.00 30.42  ?  74   PHE B HE2  1 
ATOM   2798  H  HZ   . PHE B  1 74 ? 45.700 56.523 -5.454  1.00 28.60  ?  74   PHE B HZ   1 
ATOM   2799  N  N    . PRO B  1 75 ? 50.700 54.865 -9.376  1.00 27.21  ?  75   PRO B N    1 
ATOM   2800  C  CA   . PRO B  1 75 ? 50.726 53.438 -9.022  1.00 28.31  ?  75   PRO B CA   1 
ATOM   2801  C  C    . PRO B  1 75 ? 51.926 53.044 -8.157  1.00 26.99  ?  75   PRO B C    1 
ATOM   2802  O  O    . PRO B  1 75 ? 51.899 51.999 -7.508  1.00 27.88  ?  75   PRO B O    1 
ATOM   2803  C  CB   . PRO B  1 75 ? 50.813 52.737 -10.383 1.00 30.47  ?  75   PRO B CB   1 
ATOM   2804  C  CG   . PRO B  1 75 ? 50.319 53.733 -11.373 1.00 30.95  ?  75   PRO B CG   1 
ATOM   2805  C  CD   . PRO B  1 75 ? 50.712 55.072 -10.835 1.00 29.39  ?  75   PRO B CD   1 
ATOM   2806  H  HA   . PRO B  1 75 ? 49.895 53.179 -8.571  1.00 33.97  ?  75   PRO B HA   1 
ATOM   2807  H  HB2  . PRO B  1 75 ? 51.735 52.499 -10.569 1.00 36.56  ?  75   PRO B HB2  1 
ATOM   2808  H  HB3  . PRO B  1 75 ? 50.249 51.948 -10.381 1.00 36.56  ?  75   PRO B HB3  1 
ATOM   2809  H  HG2  . PRO B  1 75 ? 50.740 53.574 -12.232 1.00 37.14  ?  75   PRO B HG2  1 
ATOM   2810  H  HG3  . PRO B  1 75 ? 49.355 53.665 -11.448 1.00 37.14  ?  75   PRO B HG3  1 
ATOM   2811  H  HD2  . PRO B  1 75 ? 51.603 55.309 -11.136 1.00 35.26  ?  75   PRO B HD2  1 
ATOM   2812  H  HD3  . PRO B  1 75 ? 50.059 55.743 -11.088 1.00 35.26  ?  75   PRO B HD3  1 
ATOM   2813  N  N    . TYR B  1 76 ? 52.963 53.873 -8.157  1.00 23.97  ?  76   TYR B N    1 
ATOM   2814  C  CA   . TYR B  1 76 ? 54.197 53.566 -7.441  1.00 24.20  ?  76   TYR B CA   1 
ATOM   2815  C  C    . TYR B  1 76 ? 54.406 54.506 -6.259  1.00 23.82  ?  76   TYR B C    1 
ATOM   2816  O  O    . TYR B  1 76 ? 55.494 54.558 -5.681  1.00 24.32  ?  76   TYR B O    1 
ATOM   2817  C  CB   . TYR B  1 76 ? 55.378 53.688 -8.399  1.00 24.72  ?  76   TYR B CB   1 
ATOM   2818  C  CG   . TYR B  1 76 ? 55.102 53.082 -9.752  1.00 28.19  ?  76   TYR B CG   1 
ATOM   2819  C  CD1  . TYR B  1 76 ? 54.658 51.772 -9.867  1.00 31.42  ?  76   TYR B CD1  1 
ATOM   2820  C  CD2  . TYR B  1 76 ? 55.258 53.827 -10.914 1.00 29.23  ?  76   TYR B CD2  1 
ATOM   2821  C  CE1  . TYR B  1 76 ? 54.397 51.212 -11.103 1.00 33.71  ?  76   TYR B CE1  1 
ATOM   2822  C  CE2  . TYR B  1 76 ? 54.998 53.276 -12.156 1.00 31.56  ?  76   TYR B CE2  1 
ATOM   2823  C  CZ   . TYR B  1 76 ? 54.567 51.969 -12.244 1.00 34.22  ?  76   TYR B CZ   1 
ATOM   2824  O  OH   . TYR B  1 76 ? 54.304 51.417 -13.476 1.00 36.58  ?  76   TYR B OH   1 
ATOM   2825  H  H    . TYR B  1 76 ? 52.978 54.629 -8.568  1.00 28.76  ?  76   TYR B H    1 
ATOM   2826  H  HA   . TYR B  1 76 ? 54.161 52.646 -7.106  1.00 29.04  ?  76   TYR B HA   1 
ATOM   2827  H  HB2  . TYR B  1 76 ? 55.584 54.627 -8.528  1.00 29.66  ?  76   TYR B HB2  1 
ATOM   2828  H  HB3  . TYR B  1 76 ? 56.143 53.231 -8.017  1.00 29.66  ?  76   TYR B HB3  1 
ATOM   2829  H  HD1  . TYR B  1 76 ? 54.545 51.259 -9.099  1.00 37.71  ?  76   TYR B HD1  1 
ATOM   2830  H  HD2  . TYR B  1 76 ? 55.550 54.708 -10.857 1.00 35.08  ?  76   TYR B HD2  1 
ATOM   2831  H  HE1  . TYR B  1 76 ? 54.105 50.331 -11.165 1.00 40.45  ?  76   TYR B HE1  1 
ATOM   2832  H  HE2  . TYR B  1 76 ? 55.111 53.784 -12.927 1.00 37.87  ?  76   TYR B HE2  1 
ATOM   2833  H  HH   . TYR B  1 76 ? 54.981 51.430 -13.939 1.00 43.89  ?  76   TYR B HH   1 
ATOM   2834  N  N    . LEU B  1 77 ? 53.365 55.248 -5.900  1.00 27.06  ?  77   LEU B N    1 
ATOM   2835  C  CA   . LEU B  1 77 ? 53.496 56.281 -4.882  1.00 26.40  ?  77   LEU B CA   1 
ATOM   2836  C  C    . LEU B  1 77 ? 52.918 55.878 -3.535  1.00 26.16  ?  77   LEU B C    1 
ATOM   2837  O  O    . LEU B  1 77 ? 51.849 55.273 -3.457  1.00 25.89  ?  77   LEU B O    1 
ATOM   2838  C  CB   . LEU B  1 77 ? 52.807 57.570 -5.337  1.00 25.06  ?  77   LEU B CB   1 
ATOM   2839  C  CG   . LEU B  1 77 ? 53.484 58.394 -6.430  1.00 22.45  ?  77   LEU B CG   1 
ATOM   2840  C  CD1  . LEU B  1 77 ? 52.734 59.700 -6.622  1.00 19.22  ?  77   LEU B CD1  1 
ATOM   2841  C  CD2  . LEU B  1 77 ? 54.945 58.656 -6.092  1.00 22.97  ?  77   LEU B CD2  1 
ATOM   2842  H  H    . LEU B  1 77 ? 52.574 55.174 -6.230  1.00 32.47  ?  77   LEU B H    1 
ATOM   2843  H  HA   . LEU B  1 77 ? 54.447 56.478 -4.753  1.00 31.67  ?  77   LEU B HA   1 
ATOM   2844  H  HB2  . LEU B  1 77 ? 51.924 57.336 -5.665  1.00 30.07  ?  77   LEU B HB2  1 
ATOM   2845  H  HB3  . LEU B  1 77 ? 52.714 58.148 -4.563  1.00 30.07  ?  77   LEU B HB3  1 
ATOM   2846  H  HG   . LEU B  1 77 ? 53.451 57.902 -7.265  1.00 26.93  ?  77   LEU B HG   1 
ATOM   2847  H  HD11 . LEU B  1 77 ? 52.742 60.190 -5.797  1.00 23.06  ?  77   LEU B HD11 1 
ATOM   2848  H  HD12 . LEU B  1 77 ? 53.167 60.211 -7.311  1.00 23.06  ?  77   LEU B HD12 1 
ATOM   2849  H  HD13 . LEU B  1 77 ? 51.829 59.506 -6.879  1.00 23.06  ?  77   LEU B HD13 1 
ATOM   2850  H  HD21 . LEU B  1 77 ? 55.401 57.815 -6.009  1.00 27.56  ?  77   LEU B HD21 1 
ATOM   2851  H  HD22 . LEU B  1 77 ? 55.340 59.174 -6.797  1.00 27.56  ?  77   LEU B HD22 1 
ATOM   2852  H  HD23 . LEU B  1 77 ? 54.992 59.138 -5.264  1.00 27.56  ?  77   LEU B HD23 1 
ATOM   2853  N  N    . THR B  1 78 ? 53.646 56.220 -2.478  1.00 25.60  ?  78   THR B N    1 
ATOM   2854  C  CA   . THR B  1 78 ? 53.073 56.287 -1.146  1.00 25.93  ?  78   THR B CA   1 
ATOM   2855  C  C    . THR B  1 78 ? 52.754 57.756 -0.902  1.00 24.00  ?  78   THR B C    1 
ATOM   2856  O  O    . THR B  1 78 ? 53.624 58.620 -1.032  1.00 22.12  ?  78   THR B O    1 
ATOM   2857  C  CB   . THR B  1 78 ? 54.041 55.782 -0.065  1.00 27.75  ?  78   THR B CB   1 
ATOM   2858  O  OG1  . THR B  1 78 ? 54.360 54.405 -0.303  1.00 29.86  ?  78   THR B OG1  1 
ATOM   2859  C  CG2  . THR B  1 78 ? 53.411 55.921 1.315   1.00 27.82  ?  78   THR B CG2  1 
ATOM   2860  H  H    . THR B  1 78 ? 54.482 56.420 -2.509  1.00 30.72  ?  78   THR B H    1 
ATOM   2861  H  HA   . THR B  1 78 ? 52.244 55.765 -1.107  1.00 31.11  ?  78   THR B HA   1 
ATOM   2862  H  HB   . THR B  1 78 ? 54.854 56.310 -0.086  1.00 33.30  ?  78   THR B HB   1 
ATOM   2863  H  HG1  . THR B  1 78 ? 54.713 54.322 -1.038  1.00 35.83  ?  78   THR B HG1  1 
ATOM   2864  H  HG21 . THR B  1 78 ? 52.602 55.407 1.360   1.00 33.39  ?  78   THR B HG21 1 
ATOM   2865  H  HG22 . THR B  1 78 ? 54.019 55.605 1.987   1.00 33.39  ?  78   THR B HG22 1 
ATOM   2866  H  HG23 . THR B  1 78 ? 53.205 56.843 1.490   1.00 33.39  ?  78   THR B HG23 1 
ATOM   2867  N  N    . ILE B  1 79 ? 51.505 58.040 -0.558  1.00 26.51  ?  79   ILE B N    1 
ATOM   2868  C  CA   . ILE B  1 79 ? 51.043 59.416 -0.482  1.00 27.39  ?  79   ILE B CA   1 
ATOM   2869  C  C    . ILE B  1 79 ? 50.467 59.776 0.883   1.00 27.94  ?  79   ILE B C    1 
ATOM   2870  O  O    . ILE B  1 79 ? 49.669 59.032 1.452   1.00 27.19  ?  79   ILE B O    1 
ATOM   2871  C  CB   . ILE B  1 79 ? 49.974 59.689 -1.555  1.00 27.47  ?  79   ILE B CB   1 
ATOM   2872  C  CG1  . ILE B  1 79 ? 50.596 59.576 -2.950  1.00 28.46  ?  79   ILE B CG1  1 
ATOM   2873  C  CG2  . ILE B  1 79 ? 49.353 61.064 -1.354  1.00 26.62  ?  79   ILE B CG2  1 
ATOM   2874  C  CD1  . ILE B  1 79 ? 49.600 59.689 -4.081  1.00 28.90  ?  79   ILE B CD1  1 
ATOM   2875  H  H    . ILE B  1 79 ? 50.906 57.454 -0.364  1.00 31.81  ?  79   ILE B H    1 
ATOM   2876  H  HA   . ILE B  1 79 ? 51.801 60.014 -0.654  1.00 32.87  ?  79   ILE B HA   1 
ATOM   2877  H  HB   . ILE B  1 79 ? 49.276 59.020 -1.473  1.00 32.96  ?  79   ILE B HB   1 
ATOM   2878  H  HG12 . ILE B  1 79 ? 51.249 60.285 -3.058  1.00 34.15  ?  79   ILE B HG12 1 
ATOM   2879  H  HG13 . ILE B  1 79 ? 51.034 58.713 -3.026  1.00 34.15  ?  79   ILE B HG13 1 
ATOM   2880  H  HG21 . ILE B  1 79 ? 50.041 61.730 -1.418  1.00 31.95  ?  79   ILE B HG21 1 
ATOM   2881  H  HG22 . ILE B  1 79 ? 48.691 61.210 -2.034  1.00 31.95  ?  79   ILE B HG22 1 
ATOM   2882  H  HG23 . ILE B  1 79 ? 48.944 61.098 -0.486  1.00 31.95  ?  79   ILE B HG23 1 
ATOM   2883  H  HD11 . ILE B  1 79 ? 49.165 60.543 -4.030  1.00 34.68  ?  79   ILE B HD11 1 
ATOM   2884  H  HD12 . ILE B  1 79 ? 50.067 59.608 -4.916  1.00 34.68  ?  79   ILE B HD12 1 
ATOM   2885  H  HD13 . ILE B  1 79 ? 48.952 58.985 -3.998  1.00 34.68  ?  79   ILE B HD13 1 
ATOM   2886  N  N    . ASP B  1 80 ? 50.894 60.922 1.401   1.00 29.53  ?  80   ASP B N    1 
ATOM   2887  C  CA   A ASP B  1 80 ? 50.334 61.472 2.627   0.56 30.16  ?  80   ASP B CA   1 
ATOM   2888  C  CA   B ASP B  1 80 ? 50.331 61.468 2.625   0.44 30.10  ?  80   ASP B CA   1 
ATOM   2889  C  C    . ASP B  1 80 ? 49.688 62.815 2.318   1.00 28.53  ?  80   ASP B C    1 
ATOM   2890  O  O    . ASP B  1 80 ? 50.324 63.696 1.743   1.00 29.11  ?  80   ASP B O    1 
ATOM   2891  C  CB   A ASP B  1 80 ? 51.420 61.656 3.689   0.56 31.78  ?  80   ASP B CB   1 
ATOM   2892  C  CB   B ASP B  1 80 ? 51.415 61.639 3.689   0.44 31.70  ?  80   ASP B CB   1 
ATOM   2893  C  CG   A ASP B  1 80 ? 52.016 60.340 4.152   0.56 34.17  ?  80   ASP B CG   1 
ATOM   2894  C  CG   B ASP B  1 80 ? 50.841 61.828 5.078   0.44 32.26  ?  80   ASP B CG   1 
ATOM   2895  O  OD1  A ASP B  1 80 ? 51.290 59.323 4.156   0.56 36.87  ?  80   ASP B OD1  1 
ATOM   2896  O  OD1  B ASP B  1 80 ? 49.959 61.035 5.468   0.44 32.45  ?  80   ASP B OD1  1 
ATOM   2897  O  OD2  A ASP B  1 80 ? 53.212 60.324 4.516   0.56 36.53  ?  80   ASP B OD2  1 
ATOM   2898  O  OD2  B ASP B  1 80 ? 51.266 62.772 5.776   0.44 33.69  ?  80   ASP B OD2  1 
ATOM   2899  H  H    A ASP B  1 80 ? 51.516 61.405 1.055   0.56 35.44  ?  80   ASP B H    1 
ATOM   2900  H  H    B ASP B  1 80 ? 51.516 61.406 1.057   0.44 35.44  ?  80   ASP B H    1 
ATOM   2901  H  HA   A ASP B  1 80 ? 49.649 60.866 2.979   0.56 36.19  ?  80   ASP B HA   1 
ATOM   2902  H  HA   B ASP B  1 80 ? 49.643 60.862 2.972   0.44 36.12  ?  80   ASP B HA   1 
ATOM   2903  H  HB2  A ASP B  1 80 ? 52.136 62.195 3.319   0.56 38.14  ?  80   ASP B HB2  1 
ATOM   2904  H  HB2  B ASP B  1 80 ? 51.975 60.847 3.700   0.44 38.05  ?  80   ASP B HB2  1 
ATOM   2905  H  HB3  A ASP B  1 80 ? 51.036 62.100 4.461   0.56 38.14  ?  80   ASP B HB3  1 
ATOM   2906  H  HB3  B ASP B  1 80 ? 51.949 62.420 3.475   0.44 38.05  ?  80   ASP B HB3  1 
ATOM   2907  N  N    . VAL B  1 81 ? 48.425 62.966 2.696   1.00 28.21  ?  81   VAL B N    1 
ATOM   2908  C  CA   . VAL B  1 81 ? 47.705 64.208 2.455   1.00 28.08  ?  81   VAL B CA   1 
ATOM   2909  C  C    . VAL B  1 81 ? 47.348 64.864 3.780   1.00 26.82  ?  81   VAL B C    1 
ATOM   2910  O  O    . VAL B  1 81 ? 46.908 64.199 4.718   1.00 26.30  ?  81   VAL B O    1 
ATOM   2911  C  CB   . VAL B  1 81 ? 46.424 63.973 1.637   1.00 30.29  ?  81   VAL B CB   1 
ATOM   2912  C  CG1  . VAL B  1 81 ? 45.620 65.258 1.528   1.00 31.33  ?  81   VAL B CG1  1 
ATOM   2913  C  CG2  . VAL B  1 81 ? 46.773 63.440 0.256   1.00 30.34  ?  81   VAL B CG2  1 
ATOM   2914  H  H    . VAL B  1 81 ? 47.961 62.362 3.095   1.00 33.85  ?  81   VAL B H    1 
ATOM   2915  H  HA   . VAL B  1 81 ? 48.280 64.823 1.954   1.00 33.69  ?  81   VAL B HA   1 
ATOM   2916  H  HB   . VAL B  1 81 ? 45.870 63.304 2.091   1.00 36.35  ?  81   VAL B HB   1 
ATOM   2917  H  HG11 . VAL B  1 81 ? 46.156 65.925 1.093   1.00 37.59  ?  81   VAL B HG11 1 
ATOM   2918  H  HG12 . VAL B  1 81 ? 44.827 65.088 1.015   1.00 37.59  ?  81   VAL B HG12 1 
ATOM   2919  H  HG13 . VAL B  1 81 ? 45.382 65.553 2.410   1.00 37.59  ?  81   VAL B HG13 1 
ATOM   2920  H  HG21 . VAL B  1 81 ? 47.246 62.610 0.352   1.00 36.41  ?  81   VAL B HG21 1 
ATOM   2921  H  HG22 . VAL B  1 81 ? 45.962 63.299 -0.239  1.00 36.41  ?  81   VAL B HG22 1 
ATOM   2922  H  HG23 . VAL B  1 81 ? 47.325 64.082 -0.196  1.00 36.41  ?  81   VAL B HG23 1 
ATOM   2923  N  N    . GLU B  1 82 ? 47.530 66.176 3.843   1.00 25.35  ?  82   GLU B N    1 
ATOM   2924  C  CA   . GLU B  1 82 ? 47.389 66.906 5.089   1.00 26.05  ?  82   GLU B CA   1 
ATOM   2925  C  C    . GLU B  1 82 ? 46.894 68.321 4.816   1.00 26.90  ?  82   GLU B C    1 
ATOM   2926  O  O    . GLU B  1 82 ? 47.578 69.101 4.157   1.00 28.61  ?  82   GLU B O    1 
ATOM   2927  C  CB   . GLU B  1 82 ? 48.742 66.950 5.795   1.00 27.57  ?  82   GLU B CB   1 
ATOM   2928  C  CG   . GLU B  1 82 ? 48.728 67.591 7.163   1.00 29.77  ?  82   GLU B CG   1 
ATOM   2929  C  CD   . GLU B  1 82 ? 50.100 67.580 7.810   1.00 31.05  ?  82   GLU B CD   1 
ATOM   2930  O  OE1  . GLU B  1 82 ? 50.993 66.867 7.305   1.00 30.95  ?  82   GLU B OE1  1 
ATOM   2931  O  OE2  . GLU B  1 82 ? 50.286 68.288 8.819   1.00 31.51  ?  82   GLU B OE2  1 
ATOM   2932  H  H    . GLU B  1 82 ? 47.738 66.669 3.170   1.00 30.42  ?  82   GLU B H    1 
ATOM   2933  H  HA   . GLU B  1 82 ? 46.743 66.452 5.669   1.00 31.26  ?  82   GLU B HA   1 
ATOM   2934  H  HB2  . GLU B  1 82 ? 49.064 66.041 5.902   1.00 33.08  ?  82   GLU B HB2  1 
ATOM   2935  H  HB3  . GLU B  1 82 ? 49.362 67.452 5.244   1.00 33.08  ?  82   GLU B HB3  1 
ATOM   2936  H  HG2  . GLU B  1 82 ? 48.440 68.513 7.079   1.00 35.73  ?  82   GLU B HG2  1 
ATOM   2937  H  HG3  . GLU B  1 82 ? 48.119 67.101 7.737   1.00 35.73  ?  82   GLU B HG3  1 
ATOM   2938  N  N    . PRO B  1 83 ? 45.698 68.658 5.315   1.00 26.87  ?  83   PRO B N    1 
ATOM   2939  C  CA   . PRO B  1 83 ? 45.163 70.008 5.104   1.00 26.37  ?  83   PRO B CA   1 
ATOM   2940  C  C    . PRO B  1 83 ? 45.970 71.086 5.819   1.00 24.50  ?  83   PRO B C    1 
ATOM   2941  O  O    . PRO B  1 83 ? 46.463 70.861 6.923   1.00 24.04  ?  83   PRO B O    1 
ATOM   2942  C  CB   . PRO B  1 83 ? 43.750 69.923 5.694   1.00 29.11  ?  83   PRO B CB   1 
ATOM   2943  C  CG   . PRO B  1 83 ? 43.801 68.788 6.653   1.00 29.36  ?  83   PRO B CG   1 
ATOM   2944  C  CD   . PRO B  1 83 ? 44.760 67.803 6.061   1.00 27.80  ?  83   PRO B CD   1 
ATOM   2945  H  HA   . PRO B  1 83 ? 45.109 70.214 4.147   1.00 31.64  ?  83   PRO B HA   1 
ATOM   2946  H  HB2  . PRO B  1 83 ? 43.537 70.751 6.152   1.00 34.93  ?  83   PRO B HB2  1 
ATOM   2947  H  HB3  . PRO B  1 83 ? 43.110 69.747 4.986   1.00 34.93  ?  83   PRO B HB3  1 
ATOM   2948  H  HG2  . PRO B  1 83 ? 44.122 69.103 7.513   1.00 35.23  ?  83   PRO B HG2  1 
ATOM   2949  H  HG3  . PRO B  1 83 ? 42.919 68.395 6.740   1.00 35.23  ?  83   PRO B HG3  1 
ATOM   2950  H  HD2  . PRO B  1 83 ? 45.225 67.320 6.762   1.00 33.36  ?  83   PRO B HD2  1 
ATOM   2951  H  HD3  . PRO B  1 83 ? 44.298 67.200 5.458   1.00 33.36  ?  83   PRO B HD3  1 
ATOM   2952  N  N    . LEU B  1 84 ? 46.102 72.243 5.180   1.00 23.07  ?  84   LEU B N    1 
ATOM   2953  C  CA   . LEU B  1 84 ? 46.774 73.387 5.778   1.00 24.37  ?  84   LEU B CA   1 
ATOM   2954  C  C    . LEU B  1 84 ? 45.788 74.538 5.899   1.00 24.70  ?  84   LEU B C    1 
ATOM   2955  O  O    . LEU B  1 84 ? 44.886 74.679 5.075   1.00 26.27  ?  84   LEU B O    1 
ATOM   2956  C  CB   . LEU B  1 84 ? 47.968 73.821 4.925   1.00 25.67  ?  84   LEU B CB   1 
ATOM   2957  C  CG   . LEU B  1 84 ? 49.112 72.817 4.777   1.00 27.57  ?  84   LEU B CG   1 
ATOM   2958  C  CD1  . LEU B  1 84 ? 50.182 73.375 3.847   1.00 30.48  ?  84   LEU B CD1  1 
ATOM   2959  C  CD2  . LEU B  1 84 ? 49.705 72.471 6.130   1.00 25.86  ?  84   LEU B CD2  1 
ATOM   2960  H  H    . LEU B  1 84 ? 45.805 72.391 4.387   1.00 27.69  ?  84   LEU B H    1 
ATOM   2961  H  HA   . LEU B  1 84 ? 47.095 73.152 6.674   1.00 29.24  ?  84   LEU B HA   1 
ATOM   2962  H  HB2  . LEU B  1 84 ? 47.645 74.021 4.032   1.00 30.81  ?  84   LEU B HB2  1 
ATOM   2963  H  HB3  . LEU B  1 84 ? 48.343 74.626 5.317   1.00 30.81  ?  84   LEU B HB3  1 
ATOM   2964  H  HG   . LEU B  1 84 ? 48.767 72.001 4.383   1.00 33.09  ?  84   LEU B HG   1 
ATOM   2965  H  HD11 . LEU B  1 84 ? 50.522 74.193 4.218   1.00 36.58  ?  84   LEU B HD11 1 
ATOM   2966  H  HD12 . LEU B  1 84 ? 50.891 72.732 3.766   1.00 36.58  ?  84   LEU B HD12 1 
ATOM   2967  H  HD13 . LEU B  1 84 ? 49.791 73.542 2.987   1.00 36.58  ?  84   LEU B HD13 1 
ATOM   2968  H  HD21 . LEU B  1 84 ? 49.020 72.087 6.682   1.00 31.03  ?  84   LEU B HD21 1 
ATOM   2969  H  HD22 . LEU B  1 84 ? 50.418 71.841 6.006   1.00 31.03  ?  84   LEU B HD22 1 
ATOM   2970  H  HD23 . LEU B  1 84 ? 50.043 73.272 6.537   1.00 31.03  ?  84   LEU B HD23 1 
ATOM   2971  N  N    . SER B  1 85 ? 45.967 75.360 6.927   1.00 27.28  ?  85   SER B N    1 
ATOM   2972  C  CA   . SER B  1 85 ? 45.097 76.502 7.159   1.00 29.75  ?  85   SER B CA   1 
ATOM   2973  C  C    . SER B  1 85 ? 45.910 77.782 7.248   1.00 26.85  ?  85   SER B C    1 
ATOM   2974  O  O    . SER B  1 85 ? 47.130 77.744 7.428   1.00 26.07  ?  85   SER B O    1 
ATOM   2975  C  CB   . SER B  1 85 ? 44.307 76.313 8.453   1.00 30.73  ?  85   SER B CB   1 
ATOM   2976  O  OG   . SER B  1 85 ? 43.274 75.362 8.283   1.00 35.83  ?  85   SER B OG   1 
ATOM   2977  H  H    . SER B  1 85 ? 46.593 75.274 7.511   1.00 32.73  ?  85   SER B H    1 
ATOM   2978  H  HA   . SER B  1 85 ? 44.464 76.587 6.416   1.00 35.70  ?  85   SER B HA   1 
ATOM   2979  H  HB2  . SER B  1 85 ? 44.909 76.003 9.148   1.00 36.88  ?  85   SER B HB2  1 
ATOM   2980  H  HB3  . SER B  1 85 ? 43.914 77.162 8.709   1.00 36.88  ?  85   SER B HB3  1 
ATOM   2981  H  HG   . SER B  1 85 ? 42.859 75.271 8.985   1.00 43.00  ?  85   SER B HG   1 
ATOM   2982  N  N    . HIS B  1 86 ? 45.230 78.915 7.120   1.00 24.06  ?  86   HIS B N    1 
ATOM   2983  C  CA   . HIS B  1 86 ? 45.874 80.201 7.321   1.00 25.22  ?  86   HIS B CA   1 
ATOM   2984  C  C    . HIS B  1 86 ? 46.275 80.353 8.781   1.00 23.40  ?  86   HIS B C    1 
ATOM   2985  O  O    . HIS B  1 86 ? 45.494 80.077 9.689   1.00 21.27  ?  86   HIS B O    1 
ATOM   2986  C  CB   . HIS B  1 86 ? 44.951 81.350 6.922   1.00 32.38  ?  86   HIS B CB   1 
ATOM   2987  C  CG   . HIS B  1 86 ? 45.544 82.701 7.169   1.00 35.12  ?  86   HIS B CG   1 
ATOM   2988  N  ND1  . HIS B  1 86 ? 46.493 83.261 6.340   1.00 36.45  ?  86   HIS B ND1  1 
ATOM   2989  C  CD2  . HIS B  1 86 ? 45.338 83.597 8.163   1.00 37.25  ?  86   HIS B CD2  1 
ATOM   2990  C  CE1  . HIS B  1 86 ? 46.838 84.447 6.808   1.00 37.10  ?  86   HIS B CE1  1 
ATOM   2991  N  NE2  . HIS B  1 86 ? 46.151 84.675 7.913   1.00 37.55  ?  86   HIS B NE2  1 
ATOM   2992  H  H    . HIS B  1 86 ? 44.396 78.964 6.917   1.00 28.87  ?  86   HIS B H    1 
ATOM   2993  H  HA   . HIS B  1 86 ? 46.683 80.249 6.771   1.00 30.27  ?  86   HIS B HA   1 
ATOM   2994  H  HB2  . HIS B  1 86 ? 44.754 81.280 5.974   1.00 38.85  ?  86   HIS B HB2  1 
ATOM   2995  H  HB3  . HIS B  1 86 ? 44.130 81.286 7.435   1.00 38.85  ?  86   HIS B HB3  1 
ATOM   2996  H  HD1  . HIS B  1 86 ? 46.808 82.896 5.628   1.00 43.73  ?  86   HIS B HD1  1 
ATOM   2997  H  HD2  . HIS B  1 86 ? 44.751 83.503 8.879   1.00 44.70  ?  86   HIS B HD2  1 
ATOM   2998  H  HE1  . HIS B  1 86 ? 47.459 85.023 6.425   1.00 44.52  ?  86   HIS B HE1  1 
ATOM   2999  H  HE2  . HIS B  1 86 ? 46.205 85.383 8.397   1.00 45.06  ?  86   HIS B HE2  1 
ATOM   3000  N  N    . HIS B  1 87 ? 47.504 80.798 8.994   1.00 28.02  ?  87   HIS B N    1 
ATOM   3001  C  CA   . HIS B  1 87 ? 48.039 80.969 10.331  1.00 26.27  ?  87   HIS B CA   1 
ATOM   3002  C  C    . HIS B  1 87 ? 47.847 82.426 10.760  1.00 28.07  ?  87   HIS B C    1 
ATOM   3003  O  O    . HIS B  1 87 ? 48.152 83.341 9.998   1.00 29.40  ?  87   HIS B O    1 
ATOM   3004  C  CB   . HIS B  1 87 ? 49.519 80.593 10.321  1.00 22.64  ?  87   HIS B CB   1 
ATOM   3005  C  CG   . HIS B  1 87 ? 50.097 80.371 11.680  1.00 21.55  ?  87   HIS B CG   1 
ATOM   3006  N  ND1  . HIS B  1 87 ? 50.497 81.408 12.492  1.00 23.99  ?  87   HIS B ND1  1 
ATOM   3007  C  CD2  . HIS B  1 87 ? 50.357 79.233 12.365  1.00 20.09  ?  87   HIS B CD2  1 
ATOM   3008  C  CE1  . HIS B  1 87 ? 50.974 80.920 13.624  1.00 23.82  ?  87   HIS B CE1  1 
ATOM   3009  N  NE2  . HIS B  1 87 ? 50.897 79.602 13.573  1.00 21.36  ?  87   HIS B NE2  1 
ATOM   3010  H  H    . HIS B  1 87 ? 48.056 81.010 8.369   1.00 33.62  ?  87   HIS B H    1 
ATOM   3011  H  HA   . HIS B  1 87 ? 47.565 80.386 10.959  1.00 31.53  ?  87   HIS B HA   1 
ATOM   3012  H  HB2  . HIS B  1 87 ? 49.629 79.773 9.815   1.00 27.16  ?  87   HIS B HB2  1 
ATOM   3013  H  HB3  . HIS B  1 87 ? 50.020 81.309 9.899   1.00 27.16  ?  87   HIS B HB3  1 
ATOM   3014  H  HD1  . HIS B  1 87 ? 50.444 82.244 12.295  1.00 28.78  ?  87   HIS B HD1  1 
ATOM   3015  H  HD2  . HIS B  1 87 ? 50.195 78.365 12.075  1.00 24.11  ?  87   HIS B HD2  1 
ATOM   3016  H  HE1  . HIS B  1 87 ? 51.303 81.419 14.336  1.00 28.58  ?  87   HIS B HE1  1 
ATOM   3017  H  HE2  . HIS B  1 87 ? 51.148 79.063 14.194  1.00 25.64  ?  87   HIS B HE2  1 
ATOM   3018  N  N    . PRO B  1 88 ? 47.327 82.649 11.979  1.00 26.19  ?  88   PRO B N    1 
ATOM   3019  C  CA   . PRO B  1 88 ? 47.053 84.016 12.452  1.00 29.30  ?  88   PRO B CA   1 
ATOM   3020  C  C    . PRO B  1 88 ? 48.292 84.911 12.506  1.00 29.30  ?  88   PRO B C    1 
ATOM   3021  O  O    . PRO B  1 88 ? 48.206 86.099 12.201  1.00 34.34  ?  88   PRO B O    1 
ATOM   3022  C  CB   . PRO B  1 88 ? 46.483 83.800 13.862  1.00 29.62  ?  88   PRO B CB   1 
ATOM   3023  C  CG   . PRO B  1 88 ? 46.884 82.412 14.248  1.00 26.28  ?  88   PRO B CG   1 
ATOM   3024  C  CD   . PRO B  1 88 ? 46.941 81.634 12.973  1.00 24.88  ?  88   PRO B CD   1 
ATOM   3025  H  HA   . PRO B  1 88 ? 46.372 84.440 11.889  1.00 35.16  ?  88   PRO B HA   1 
ATOM   3026  H  HB2  . PRO B  1 88 ? 46.868 84.449 14.472  1.00 35.54  ?  88   PRO B HB2  1 
ATOM   3027  H  HB3  . PRO B  1 88 ? 45.517 83.883 13.839  1.00 35.54  ?  88   PRO B HB3  1 
ATOM   3028  H  HG2  . PRO B  1 88 ? 47.755 82.432 14.674  1.00 31.53  ?  88   PRO B HG2  1 
ATOM   3029  H  HG3  . PRO B  1 88 ? 46.220 82.036 14.846  1.00 31.53  ?  88   PRO B HG3  1 
ATOM   3030  H  HD2  . PRO B  1 88 ? 47.616 80.940 13.029  1.00 29.85  ?  88   PRO B HD2  1 
ATOM   3031  H  HD3  . PRO B  1 88 ? 46.069 81.267 12.761  1.00 29.85  ?  88   PRO B HD3  1 
ATOM   3032  N  N    . ALA B  1 89 ? 49.424 84.348 12.909  1.00 28.32  ?  89   ALA B N    1 
ATOM   3033  C  CA   . ALA B  1 89 ? 50.692 85.076 12.918  1.00 28.25  ?  89   ALA B CA   1 
ATOM   3034  C  C    . ALA B  1 89 ? 51.322 85.244 11.529  1.00 29.65  ?  89   ALA B C    1 
ATOM   3035  O  O    . ALA B  1 89 ? 52.420 85.789 11.408  1.00 28.91  ?  89   ALA B O    1 
ATOM   3036  C  CB   . ALA B  1 89 ? 51.680 84.387 13.851  1.00 25.17  ?  89   ALA B CB   1 
ATOM   3037  H  H    . ALA B  1 89 ? 49.487 83.536 13.186  1.00 33.98  ?  89   ALA B H    1 
ATOM   3038  H  HA   . ALA B  1 89 ? 50.529 85.974 13.275  1.00 33.90  ?  89   ALA B HA   1 
ATOM   3039  H  HB1  . ALA B  1 89 ? 51.828 83.490 13.542  1.00 30.21  ?  89   ALA B HB1  1 
ATOM   3040  H  HB2  . ALA B  1 89 ? 52.506 84.876 13.846  1.00 30.21  ?  89   ALA B HB2  1 
ATOM   3041  H  HB3  . ALA B  1 89 ? 51.313 84.373 14.738  1.00 30.21  ?  89   ALA B HB3  1 
ATOM   3042  N  N    . ARG B  1 90 ? 50.643 84.783 10.484  1.00 31.23  ?  90   ARG B N    1 
ATOM   3043  C  CA   . ARG B  1 90 ? 51.191 84.890 9.134   1.00 32.15  ?  90   ARG B CA   1 
ATOM   3044  C  C    . ARG B  1 90 ? 51.264 86.340 8.664   1.00 35.08  ?  90   ARG B C    1 
ATOM   3045  O  O    . ARG B  1 90 ? 50.278 87.073 8.717   1.00 38.46  ?  90   ARG B O    1 
ATOM   3046  C  CB   . ARG B  1 90 ? 50.360 84.074 8.140   1.00 32.90  ?  90   ARG B CB   1 
ATOM   3047  C  CG   . ARG B  1 90 ? 50.839 84.182 6.696   1.00 33.23  ?  90   ARG B CG   1 
ATOM   3048  C  CD   . ARG B  1 90 ? 52.320 83.852 6.573   1.00 30.17  ?  90   ARG B CD   1 
ATOM   3049  N  NE   . ARG B  1 90 ? 52.806 83.977 5.201   1.00 32.58  ?  90   ARG B NE   1 
ATOM   3050  C  CZ   . ARG B  1 90 ? 54.091 84.013 4.858   1.00 32.15  ?  90   ARG B CZ   1 
ATOM   3051  N  NH1  . ARG B  1 90 ? 55.038 83.941 5.785   1.00 32.02  ?  90   ARG B NH1  1 
ATOM   3052  N  NH2  . ARG B  1 90 ? 54.435 84.128 3.582   1.00 31.59  ?  90   ARG B NH2  1 
ATOM   3053  H  H    . ARG B  1 90 ? 49.870 84.408 10.527  1.00 37.48  ?  90   ARG B H    1 
ATOM   3054  H  HA   . ARG B  1 90 ? 52.102 84.528 9.133   1.00 38.57  ?  90   ARG B HA   1 
ATOM   3055  H  HB2  . ARG B  1 90 ? 50.398 83.139 8.396   1.00 39.48  ?  90   ARG B HB2  1 
ATOM   3056  H  HB3  . ARG B  1 90 ? 49.442 84.385 8.172   1.00 39.48  ?  90   ARG B HB3  1 
ATOM   3057  H  HG2  . ARG B  1 90 ? 50.342 83.557 6.146   1.00 39.88  ?  90   ARG B HG2  1 
ATOM   3058  H  HG3  . ARG B  1 90 ? 50.703 85.089 6.381   1.00 39.88  ?  90   ARG B HG3  1 
ATOM   3059  H  HD2  . ARG B  1 90 ? 52.828 84.463 7.130   1.00 36.20  ?  90   ARG B HD2  1 
ATOM   3060  H  HD3  . ARG B  1 90 ? 52.466 82.938 6.862   1.00 36.20  ?  90   ARG B HD3  1 
ATOM   3061  H  HE   . ARG B  1 90 ? 52.222 84.031 4.572   1.00 39.09  ?  90   ARG B HE   1 
ATOM   3062  H  HH11 . ARG B  1 90 ? 54.823 83.866 6.615   1.00 38.42  ?  90   ARG B HH11 1 
ATOM   3063  H  HH12 . ARG B  1 90 ? 55.866 83.966 5.557   1.00 38.42  ?  90   ARG B HH12 1 
ATOM   3064  H  HH21 . ARG B  1 90 ? 53.827 84.176 2.976   1.00 37.90  ?  90   ARG B HH21 1 
ATOM   3065  H  HH22 . ARG B  1 90 ? 55.265 84.153 3.361   1.00 37.90  ?  90   ARG B HH22 1 
ATOM   3066  N  N    . VAL B  1 91 ? 52.445 86.745 8.210   1.00 33.96  ?  91   VAL B N    1 
ATOM   3067  C  CA   . VAL B  1 91 ? 52.625 88.041 7.570   1.00 37.36  ?  91   VAL B CA   1 
ATOM   3068  C  C    . VAL B  1 91 ? 53.021 87.809 6.117   1.00 39.54  ?  91   VAL B C    1 
ATOM   3069  O  O    . VAL B  1 91 ? 54.048 87.191 5.835   1.00 35.45  ?  91   VAL B O    1 
ATOM   3070  C  CB   . VAL B  1 91 ? 53.711 88.876 8.273   1.00 37.29  ?  91   VAL B CB   1 
ATOM   3071  C  CG1  . VAL B  1 91 ? 53.877 90.223 7.584   1.00 39.25  ?  91   VAL B CG1  1 
ATOM   3072  C  CG2  . VAL B  1 91 ? 53.366 89.066 9.742   1.00 38.81  ?  91   VAL B CG2  1 
ATOM   3073  H  H    . VAL B  1 91 ? 53.167 86.280 8.263   1.00 40.76  ?  91   VAL B H    1 
ATOM   3074  H  HA   . VAL B  1 91 ? 51.782 88.540 7.591   1.00 44.83  ?  91   VAL B HA   1 
ATOM   3075  H  HB   . VAL B  1 91 ? 54.566 88.399 8.220   1.00 44.75  ?  91   VAL B HB   1 
ATOM   3076  H  HG11 . VAL B  1 91 ? 53.043 90.696 7.619   1.00 47.10  ?  91   VAL B HG11 1 
ATOM   3077  H  HG12 . VAL B  1 91 ? 54.558 90.724 8.039   1.00 47.10  ?  91   VAL B HG12 1 
ATOM   3078  H  HG13 . VAL B  1 91 ? 54.133 90.076 6.670   1.00 47.10  ?  91   VAL B HG13 1 
ATOM   3079  H  HG21 . VAL B  1 91 ? 53.306 88.205 10.162  1.00 46.57  ?  91   VAL B HG21 1 
ATOM   3080  H  HG22 . VAL B  1 91 ? 54.055 89.588 10.159  1.00 46.57  ?  91   VAL B HG22 1 
ATOM   3081  H  HG23 . VAL B  1 91 ? 52.524 89.522 9.808   1.00 46.57  ?  91   VAL B HG23 1 
ATOM   3082  N  N    . GLY B  1 92 ? 52.198 88.299 5.197   1.00 41.51  ?  92   GLY B N    1 
ATOM   3083  C  CA   . GLY B  1 92 ? 52.411 88.061 3.781   1.00 43.95  ?  92   GLY B CA   1 
ATOM   3084  C  C    . GLY B  1 92 ? 51.387 87.095 3.214   1.00 44.95  ?  92   GLY B C    1 
ATOM   3085  O  O    . GLY B  1 92 ? 50.293 86.946 3.758   1.00 44.32  ?  92   GLY B O    1 
ATOM   3086  H  H    . GLY B  1 92 ? 51.504 88.776 5.371   1.00 49.81  ?  92   GLY B H    1 
ATOM   3087  H  HA2  . GLY B  1 92 ? 52.347 88.899 3.297   1.00 52.74  ?  92   GLY B HA2  1 
ATOM   3088  H  HA3  . GLY B  1 92 ? 53.297 87.690 3.643   1.00 52.74  ?  92   GLY B HA3  1 
ATOM   3089  N  N    . LYS B  1 93 ? 51.749 86.430 2.120   1.00 48.57  ?  93   LYS B N    1 
ATOM   3090  C  CA   . LYS B  1 93 ? 50.827 85.550 1.411   1.00 54.50  ?  93   LYS B CA   1 
ATOM   3091  C  C    . LYS B  1 93 ? 51.072 84.084 1.763   1.00 54.79  ?  93   LYS B C    1 
ATOM   3092  O  O    . LYS B  1 93 ? 52.116 83.735 2.312   1.00 48.52  ?  93   LYS B O    1 
ATOM   3093  C  CB   . LYS B  1 93 ? 50.972 85.759 -0.097  1.00 60.11  ?  93   LYS B CB   1 
ATOM   3094  C  CG   . LYS B  1 93 ? 50.972 87.224 -0.508  1.00 65.86  ?  93   LYS B CG   1 
ATOM   3095  C  CD   . LYS B  1 93 ? 51.263 87.401 -1.989  1.00 71.95  ?  93   LYS B CD   1 
ATOM   3096  C  CE   . LYS B  1 93 ? 51.396 88.873 -2.350  1.00 77.90  ?  93   LYS B CE   1 
ATOM   3097  N  NZ   . LYS B  1 93 ? 51.734 89.075 -3.786  1.00 83.04  ?  93   LYS B NZ   1 
ATOM   3098  H  H    . LYS B  1 93 ? 52.531 86.473 1.766   1.00 58.28  ?  93   LYS B H    1 
ATOM   3099  H  HA   . LYS B  1 93 ? 49.907 85.775 1.665   1.00 65.40  ?  93   LYS B HA   1 
ATOM   3100  H  HB2  . LYS B  1 93 ? 51.810 85.368 -0.389  1.00 72.13  ?  93   LYS B HB2  1 
ATOM   3101  H  HB3  . LYS B  1 93 ? 50.231 85.323 -0.547  1.00 72.13  ?  93   LYS B HB3  1 
ATOM   3102  H  HG2  . LYS B  1 93 ? 50.099 87.607 -0.324  1.00 79.03  ?  93   LYS B HG2  1 
ATOM   3103  H  HG3  . LYS B  1 93 ? 51.656 87.696 -0.008  1.00 79.03  ?  93   LYS B HG3  1 
ATOM   3104  H  HD2  . LYS B  1 93 ? 52.097 86.956 -2.208  1.00 86.33  ?  93   LYS B HD2  1 
ATOM   3105  H  HD3  . LYS B  1 93 ? 50.534 87.024 -2.507  1.00 86.33  ?  93   LYS B HD3  1 
ATOM   3106  H  HE2  . LYS B  1 93 ? 50.553 89.321 -2.173  1.00 93.48  ?  93   LYS B HE2  1 
ATOM   3107  H  HE3  . LYS B  1 93 ? 52.102 89.269 -1.816  1.00 93.48  ?  93   LYS B HE3  1 
ATOM   3108  H  HZ1  . LYS B  1 93 ? 51.097 88.725 -4.301  1.00 99.65  ?  93   LYS B HZ1  1 
ATOM   3109  H  HZ2  . LYS B  1 93 ? 51.804 89.944 -3.963  1.00 99.65  ?  93   LYS B HZ2  1 
ATOM   3110  H  HZ3  . LYS B  1 93 ? 52.508 88.678 -3.975  1.00 99.65  ?  93   LYS B HZ3  1 
ATOM   3111  N  N    . ASP B  1 94 ? 50.104 83.230 1.444   1.00 66.36  ?  94   ASP B N    1 
ATOM   3112  C  CA   . ASP B  1 94 ? 50.222 81.800 1.713   1.00 69.34  ?  94   ASP B CA   1 
ATOM   3113  C  C    . ASP B  1 94 ? 50.833 81.066 0.522   1.00 71.63  ?  94   ASP B C    1 
ATOM   3114  O  O    . ASP B  1 94 ? 51.477 81.667 -0.339  1.00 72.88  ?  94   ASP B O    1 
ATOM   3115  C  CB   . ASP B  1 94 ? 48.852 81.202 2.050   1.00 72.89  ?  94   ASP B CB   1 
ATOM   3116  C  CG   . ASP B  1 94 ? 48.308 81.695 3.379   1.00 73.36  ?  94   ASP B CG   1 
ATOM   3117  O  OD1  . ASP B  1 94 ? 49.097 82.230 4.186   1.00 70.52  ?  94   ASP B OD1  1 
ATOM   3118  O  OD2  . ASP B  1 94 ? 47.093 81.540 3.622   1.00 76.54  ?  94   ASP B OD2  1 
ATOM   3119  O  OXT  . ASP B  1 94 ? 50.703 79.848 0.394   1.00 72.11  ?  94   ASP B OXT  1 
ATOM   3120  H  H    . ASP B  1 94 ? 49.364 83.455 1.068   1.00 79.63  ?  94   ASP B H    1 
ATOM   3121  H  HA   . ASP B  1 94 ? 50.809 81.667 2.486   1.00 83.21  ?  94   ASP B HA   1 
ATOM   3122  H  HB2  . ASP B  1 94 ? 48.220 81.450 1.356   1.00 87.46  ?  94   ASP B HB2  1 
ATOM   3123  H  HB3  . ASP B  1 94 ? 48.932 80.237 2.097   1.00 87.46  ?  94   ASP B HB3  1 
ATOM   3124  N  N    . MET C  1 1  ? 68.996 78.469 1.536   1.00 28.76  ?  1    MET C N    1 
ATOM   3125  C  CA   . MET C  1 1  ? 68.550 77.047 1.521   1.00 30.61  ?  1    MET C CA   1 
ATOM   3126  C  C    . MET C  1 1  ? 67.223 76.893 2.249   1.00 26.41  ?  1    MET C C    1 
ATOM   3127  O  O    . MET C  1 1  ? 66.960 77.576 3.240   1.00 25.21  ?  1    MET C O    1 
ATOM   3128  C  CB   . MET C  1 1  ? 69.597 76.155 2.178   1.00 34.38  ?  1    MET C CB   1 
ATOM   3129  C  CG   . MET C  1 1  ? 70.887 76.039 1.393   1.00 37.52  ?  1    MET C CG   1 
ATOM   3130  S  SD   . MET C  1 1  ? 72.012 74.861 2.149   1.00 51.59  ?  1    MET C SD   1 
ATOM   3131  C  CE   . MET C  1 1  ? 72.091 75.501 3.817   1.00 48.20  ?  1    MET C CE   1 
ATOM   3132  H  H1   . MET C  1 1  ? 69.121 78.755 2.444   1.00 34.52  ?  1    MET C H1   1 
ATOM   3133  H  H2   . MET C  1 1  ? 69.824 78.550 1.058   1.00 34.52  ?  1    MET C H2   1 
ATOM   3134  H  H3   . MET C  1 1  ? 68.329 79.018 1.117   1.00 34.52  ?  1    MET C H3   1 
ATOM   3135  H  HA   . MET C  1 1  ? 68.442 76.756 0.591   1.00 36.74  ?  1    MET C HA   1 
ATOM   3136  H  HB2  . MET C  1 1  ? 69.813 76.518 3.051   1.00 41.25  ?  1    MET C HB2  1 
ATOM   3137  H  HB3  . MET C  1 1  ? 69.229 75.263 2.276   1.00 41.25  ?  1    MET C HB3  1 
ATOM   3138  H  HG2  . MET C  1 1  ? 70.689 75.735 0.494   1.00 45.02  ?  1    MET C HG2  1 
ATOM   3139  H  HG3  . MET C  1 1  ? 71.325 76.904 1.367   1.00 45.02  ?  1    MET C HG3  1 
ATOM   3140  H  HE1  . MET C  1 1  ? 71.209 75.493 4.196   1.00 57.84  ?  1    MET C HE1  1 
ATOM   3141  H  HE2  . MET C  1 1  ? 72.676 74.946 4.337   1.00 57.84  ?  1    MET C HE2  1 
ATOM   3142  H  HE3  . MET C  1 1  ? 72.429 76.399 3.791   1.00 57.84  ?  1    MET C HE3  1 
ATOM   3143  N  N    . LEU C  1 2  ? 66.394 75.981 1.757   1.00 24.91  ?  2    LEU C N    1 
ATOM   3144  C  CA   . LEU C  1 2  ? 65.055 75.801 2.299   1.00 21.76  ?  2    LEU C CA   1 
ATOM   3145  C  C    . LEU C  1 2  ? 64.981 74.598 3.235   1.00 22.79  ?  2    LEU C C    1 
ATOM   3146  O  O    . LEU C  1 2  ? 65.597 73.561 2.984   1.00 23.80  ?  2    LEU C O    1 
ATOM   3147  C  CB   . LEU C  1 2  ? 64.048 75.646 1.159   1.00 20.59  ?  2    LEU C CB   1 
ATOM   3148  C  CG   . LEU C  1 2  ? 64.056 76.796 0.147   1.00 19.40  ?  2    LEU C CG   1 
ATOM   3149  C  CD1  . LEU C  1 2  ? 63.159 76.478 -1.039  1.00 21.40  ?  2    LEU C CD1  1 
ATOM   3150  C  CD2  . LEU C  1 2  ? 63.633 78.101 0.806   1.00 17.48  ?  2    LEU C CD2  1 
ATOM   3151  H  H    . LEU C  1 2  ? 66.584 75.452 1.106   1.00 29.89  ?  2    LEU C H    1 
ATOM   3152  H  HA   . LEU C  1 2  ? 64.810 76.598 2.813   1.00 26.12  ?  2    LEU C HA   1 
ATOM   3153  H  HB2  . LEU C  1 2  ? 64.247 74.828 0.677   1.00 24.71  ?  2    LEU C HB2  1 
ATOM   3154  H  HB3  . LEU C  1 2  ? 63.156 75.593 1.537   1.00 24.71  ?  2    LEU C HB3  1 
ATOM   3155  H  HG   . LEU C  1 2  ? 64.959 76.912 -0.187  1.00 23.28  ?  2    LEU C HG   1 
ATOM   3156  H  HD11 . LEU C  1 2  ? 62.262 76.344 -0.725  1.00 25.68  ?  2    LEU C HD11 1 
ATOM   3157  H  HD12 . LEU C  1 2  ? 63.184 77.214 -1.655  1.00 25.68  ?  2    LEU C HD12 1 
ATOM   3158  H  HD13 . LEU C  1 2  ? 63.479 75.681 -1.468  1.00 25.68  ?  2    LEU C HD13 1 
ATOM   3159  H  HD21 . LEU C  1 2  ? 64.246 78.305 1.516   1.00 20.98  ?  2    LEU C HD21 1 
ATOM   3160  H  HD22 . LEU C  1 2  ? 63.648 78.802 0.149   1.00 20.98  ?  2    LEU C HD22 1 
ATOM   3161  H  HD23 . LEU C  1 2  ? 62.746 78.000 1.158   1.00 20.98  ?  2    LEU C HD23 1 
ATOM   3162  N  N    . TYR C  1 3  ? 64.225 74.755 4.318   1.00 22.21  ?  3    TYR C N    1 
ATOM   3163  C  CA   . TYR C  1 3  ? 63.974 73.673 5.259   1.00 22.45  ?  3    TYR C CA   1 
ATOM   3164  C  C    . TYR C  1 3  ? 62.484 73.611 5.557   1.00 22.27  ?  3    TYR C C    1 
ATOM   3165  O  O    . TYR C  1 3  ? 61.864 74.636 5.843   1.00 21.76  ?  3    TYR C O    1 
ATOM   3166  C  CB   . TYR C  1 3  ? 64.704 73.909 6.582   1.00 21.21  ?  3    TYR C CB   1 
ATOM   3167  C  CG   . TYR C  1 3  ? 66.203 74.081 6.493   1.00 21.45  ?  3    TYR C CG   1 
ATOM   3168  C  CD1  . TYR C  1 3  ? 66.761 75.255 6.004   1.00 21.31  ?  3    TYR C CD1  1 
ATOM   3169  C  CD2  . TYR C  1 3  ? 67.062 73.085 6.942   1.00 23.55  ?  3    TYR C CD2  1 
ATOM   3170  C  CE1  . TYR C  1 3  ? 68.130 75.421 5.941   1.00 22.39  ?  3    TYR C CE1  1 
ATOM   3171  C  CE2  . TYR C  1 3  ? 68.431 73.242 6.885   1.00 24.70  ?  3    TYR C CE2  1 
ATOM   3172  C  CZ   . TYR C  1 3  ? 68.961 74.413 6.384   1.00 23.46  ?  3    TYR C CZ   1 
ATOM   3173  O  OH   . TYR C  1 3  ? 70.326 74.578 6.324   1.00 23.46  ?  3    TYR C OH   1 
ATOM   3174  H  H    . TYR C  1 3  ? 63.841 75.494 4.532   1.00 26.65  ?  3    TYR C H    1 
ATOM   3175  H  HA   . TYR C  1 3  ? 64.263 72.817 4.878   1.00 26.94  ?  3    TYR C HA   1 
ATOM   3176  H  HB2  . TYR C  1 3  ? 64.345 74.714 6.988   1.00 25.45  ?  3    TYR C HB2  1 
ATOM   3177  H  HB3  . TYR C  1 3  ? 64.534 73.152 7.164   1.00 25.45  ?  3    TYR C HB3  1 
ATOM   3178  H  HD1  . TYR C  1 3  ? 66.203 75.937 5.706   1.00 25.58  ?  3    TYR C HD1  1 
ATOM   3179  H  HD2  . TYR C  1 3  ? 66.707 72.294 7.280   1.00 28.26  ?  3    TYR C HD2  1 
ATOM   3180  H  HE1  . TYR C  1 3  ? 68.491 76.209 5.605   1.00 26.87  ?  3    TYR C HE1  1 
ATOM   3181  H  HE2  . TYR C  1 3  ? 68.994 72.564 7.181   1.00 29.64  ?  3    TYR C HE2  1 
ATOM   3182  H  HH   . TYR C  1 3  ? 70.550 75.227 6.772   1.00 28.16  ?  3    TYR C HH   1 
ATOM   3183  N  N    . LEU C  1 4  ? 61.910 72.416 5.503   1.00 19.51  ?  4    LEU C N    1 
ATOM   3184  C  CA   . LEU C  1 4  ? 60.542 72.219 5.960   1.00 18.39  ?  4    LEU C CA   1 
ATOM   3185  C  C    . LEU C  1 4  ? 60.568 71.909 7.449   1.00 18.32  ?  4    LEU C C    1 
ATOM   3186  O  O    . LEU C  1 4  ? 61.094 70.879 7.865   1.00 18.58  ?  4    LEU C O    1 
ATOM   3187  C  CB   . LEU C  1 4  ? 59.876 71.070 5.208   1.00 22.35  ?  4    LEU C CB   1 
ATOM   3188  C  CG   . LEU C  1 4  ? 58.391 70.874 5.524   1.00 25.02  ?  4    LEU C CG   1 
ATOM   3189  C  CD1  . LEU C  1 4  ? 57.545 71.936 4.835   1.00 24.76  ?  4    LEU C CD1  1 
ATOM   3190  C  CD2  . LEU C  1 4  ? 57.942 69.481 5.122   1.00 28.08  ?  4    LEU C CD2  1 
ATOM   3191  H  H    . LEU C  1 4  ? 62.291 71.704 5.207   1.00 23.41  ?  4    LEU C H    1 
ATOM   3192  H  HA   . LEU C  1 4  ? 60.022 73.036 5.815   1.00 22.07  ?  4    LEU C HA   1 
ATOM   3193  H  HB2  . LEU C  1 4  ? 59.954 71.238 4.256   1.00 26.82  ?  4    LEU C HB2  1 
ATOM   3194  H  HB3  . LEU C  1 4  ? 60.336 70.246 5.433   1.00 26.82  ?  4    LEU C HB3  1 
ATOM   3195  H  HG   . LEU C  1 4  ? 58.259 70.964 6.481   1.00 30.03  ?  4    LEU C HG   1 
ATOM   3196  H  HD11 . LEU C  1 4  ? 57.674 71.871 3.886   1.00 29.71  ?  4    LEU C HD11 1 
ATOM   3197  H  HD12 . LEU C  1 4  ? 56.621 71.788 5.050   1.00 29.71  ?  4    LEU C HD12 1 
ATOM   3198  H  HD13 . LEU C  1 4  ? 57.819 72.803 5.144   1.00 29.71  ?  4    LEU C HD13 1 
ATOM   3199  H  HD21 . LEU C  1 4  ? 58.457 68.834 5.610   1.00 33.70  ?  4    LEU C HD21 1 
ATOM   3200  H  HD22 . LEU C  1 4  ? 57.010 69.381 5.329   1.00 33.70  ?  4    LEU C HD22 1 
ATOM   3201  H  HD23 . LEU C  1 4  ? 58.082 69.368 4.179   1.00 33.70  ?  4    LEU C HD23 1 
ATOM   3202  N  N    . VAL C  1 5  ? 60.002 72.799 8.253   1.00 20.03  ?  5    VAL C N    1 
ATOM   3203  C  CA   . VAL C  1 5  ? 60.004 72.615 9.697   1.00 23.18  ?  5    VAL C CA   1 
ATOM   3204  C  C    . VAL C  1 5  ? 58.586 72.456 10.227  1.00 22.72  ?  5    VAL C C    1 
ATOM   3205  O  O    . VAL C  1 5  ? 57.736 73.326 10.028  1.00 22.43  ?  5    VAL C O    1 
ATOM   3206  C  CB   . VAL C  1 5  ? 60.689 73.797 10.404  1.00 21.83  ?  5    VAL C CB   1 
ATOM   3207  C  CG1  . VAL C  1 5  ? 60.653 73.614 11.913  1.00 24.20  ?  5    VAL C CG1  1 
ATOM   3208  C  CG2  . VAL C  1 5  ? 62.125 73.943 9.914   1.00 22.21  ?  5    VAL C CG2  1 
ATOM   3209  H  H    . VAL C  1 5  ? 59.611 73.518 7.988   1.00 24.03  ?  5    VAL C H    1 
ATOM   3210  H  HA   . VAL C  1 5  ? 60.503 71.800 9.914   1.00 27.82  ?  5    VAL C HA   1 
ATOM   3211  H  HB   . VAL C  1 5  ? 60.208 74.623 10.187  1.00 26.20  ?  5    VAL C HB   1 
ATOM   3212  H  HG11 . VAL C  1 5  ? 61.114 72.803 12.140  1.00 29.04  ?  5    VAL C HG11 1 
ATOM   3213  H  HG12 . VAL C  1 5  ? 61.086 74.364 12.329  1.00 29.04  ?  5    VAL C HG12 1 
ATOM   3214  H  HG13 . VAL C  1 5  ? 59.739 73.563 12.200  1.00 29.04  ?  5    VAL C HG13 1 
ATOM   3215  H  HG21 . VAL C  1 5  ? 62.117 74.100 8.967   1.00 26.65  ?  5    VAL C HG21 1 
ATOM   3216  H  HG22 . VAL C  1 5  ? 62.535 74.684 10.365  1.00 26.65  ?  5    VAL C HG22 1 
ATOM   3217  H  HG23 . VAL C  1 5  ? 62.604 73.134 10.108  1.00 26.65  ?  5    VAL C HG23 1 
ATOM   3218  N  N    . ARG C  1 6  ? 58.332 71.333 10.892  1.00 21.32  ?  6    ARG C N    1 
ATOM   3219  C  CA   . ARG C  1 6  ? 57.051 71.110 11.549  1.00 20.94  ?  6    ARG C CA   1 
ATOM   3220  C  C    . ARG C  1 6  ? 57.201 71.392 13.032  1.00 21.56  ?  6    ARG C C    1 
ATOM   3221  O  O    . ARG C  1 6  ? 58.139 70.914 13.667  1.00 22.44  ?  6    ARG C O    1 
ATOM   3222  C  CB   . ARG C  1 6  ? 56.569 69.672 11.346  1.00 22.48  ?  6    ARG C CB   1 
ATOM   3223  C  CG   . ARG C  1 6  ? 55.237 69.373 12.029  1.00 22.48  ?  6    ARG C CG   1 
ATOM   3224  C  CD   . ARG C  1 6  ? 54.867 67.902 11.928  1.00 26.41  ?  6    ARG C CD   1 
ATOM   3225  N  NE   . ARG C  1 6  ? 54.738 67.462 10.541  1.00 30.44  ?  6    ARG C NE   1 
ATOM   3226  C  CZ   . ARG C  1 6  ? 53.592 67.393 9.868   1.00 33.66  ?  6    ARG C CZ   1 
ATOM   3227  N  NH1  . ARG C  1 6  ? 52.442 67.733 10.441  1.00 34.68  ?  6    ARG C NH1  1 
ATOM   3228  N  NH2  . ARG C  1 6  ? 53.595 66.979 8.608   1.00 35.08  ?  6    ARG C NH2  1 
ATOM   3229  H  H    . ARG C  1 6  ? 58.888 70.682 10.977  1.00 25.59  ?  6    ARG C H    1 
ATOM   3230  H  HA   . ARG C  1 6  ? 56.380 71.721 11.179  1.00 25.13  ?  6    ARG C HA   1 
ATOM   3231  H  HB2  . ARG C  1 6  ? 56.459 69.509 10.396  1.00 26.97  ?  6    ARG C HB2  1 
ATOM   3232  H  HB3  . ARG C  1 6  ? 57.233 69.065 11.710  1.00 26.97  ?  6    ARG C HB3  1 
ATOM   3233  H  HG2  . ARG C  1 6  ? 55.301 69.606 12.968  1.00 26.98  ?  6    ARG C HG2  1 
ATOM   3234  H  HG3  . ARG C  1 6  ? 54.537 69.891 11.602  1.00 26.98  ?  6    ARG C HG3  1 
ATOM   3235  H  HD2  . ARG C  1 6  ? 55.560 67.370 12.351  1.00 31.70  ?  6    ARG C HD2  1 
ATOM   3236  H  HD3  . ARG C  1 6  ? 54.017 67.756 12.372  1.00 31.70  ?  6    ARG C HD3  1 
ATOM   3237  H  HE   . ARG C  1 6  ? 55.457 67.230 10.129  1.00 36.53  ?  6    ARG C HE   1 
ATOM   3238  H  HH11 . ARG C  1 6  ? 52.432 68.002 11.257  1.00 41.61  ?  6    ARG C HH11 1 
ATOM   3239  H  HH12 . ARG C  1 6  ? 51.709 67.683 9.995   1.00 41.61  ?  6    ARG C HH12 1 
ATOM   3240  H  HH21 . ARG C  1 6  ? 54.335 66.757 8.230   1.00 42.09  ?  6    ARG C HH21 1 
ATOM   3241  H  HH22 . ARG C  1 6  ? 52.857 66.932 8.168   1.00 42.09  ?  6    ARG C HH22 1 
ATOM   3242  N  N    . MET C  1 7  ? 56.277 72.171 13.580  1.00 26.91  ?  7    MET C N    1 
ATOM   3243  C  CA   . MET C  1 7  ? 56.293 72.490 15.001  1.00 28.09  ?  7    MET C CA   1 
ATOM   3244  C  C    . MET C  1 7  ? 54.973 72.087 15.642  1.00 28.09  ?  7    MET C C    1 
ATOM   3245  O  O    . MET C  1 7  ? 53.899 72.396 15.125  1.00 28.70  ?  7    MET C O    1 
ATOM   3246  C  CB   . MET C  1 7  ? 56.522 73.984 15.210  1.00 26.22  ?  7    MET C CB   1 
ATOM   3247  C  CG   . MET C  1 7  ? 57.708 74.543 14.452  1.00 24.68  ?  7    MET C CG   1 
ATOM   3248  S  SD   . MET C  1 7  ? 57.981 76.280 14.831  1.00 26.13  ?  7    MET C SD   1 
ATOM   3249  C  CE   . MET C  1 7  ? 59.043 76.761 13.473  1.00 25.57  ?  7    MET C CE   1 
ATOM   3250  H  H    . MET C  1 7  ? 55.626 72.531 13.147  1.00 32.29  ?  7    MET C H    1 
ATOM   3251  H  HA   . MET C  1 7  ? 57.025 72.003 15.433  1.00 33.70  ?  7    MET C HA   1 
ATOM   3252  H  HB2  . MET C  1 7  ? 55.732 74.464 14.918  1.00 31.46  ?  7    MET C HB2  1 
ATOM   3253  H  HB3  . MET C  1 7  ? 56.674 74.146 16.155  1.00 31.46  ?  7    MET C HB3  1 
ATOM   3254  H  HG2  . MET C  1 7  ? 58.506 74.049 14.698  1.00 29.61  ?  7    MET C HG2  1 
ATOM   3255  H  HG3  . MET C  1 7  ? 57.544 74.462 13.499  1.00 29.61  ?  7    MET C HG3  1 
ATOM   3256  H  HE1  . MET C  1 7  ? 58.578 76.614 12.646  1.00 30.68  ?  7    MET C HE1  1 
ATOM   3257  H  HE2  . MET C  1 7  ? 59.264 77.691 13.564  1.00 30.68  ?  7    MET C HE2  1 
ATOM   3258  H  HE3  . MET C  1 7  ? 59.842 76.230 13.499  1.00 30.68  ?  7    MET C HE3  1 
ATOM   3259  N  N    . THR C  1 8  ? 55.061 71.387 16.766  1.00 24.56  ?  8    THR C N    1 
ATOM   3260  C  CA   . THR C  1 8  ? 53.876 70.986 17.510  1.00 26.51  ?  8    THR C CA   1 
ATOM   3261  C  C    . THR C  1 8  ? 53.994 71.490 18.939  1.00 25.25  ?  8    THR C C    1 
ATOM   3262  O  O    . THR C  1 8  ? 54.991 71.235 19.615  1.00 26.40  ?  8    THR C O    1 
ATOM   3263  C  CB   . THR C  1 8  ? 53.706 69.459 17.525  1.00 32.63  ?  8    THR C CB   1 
ATOM   3264  O  OG1  . THR C  1 8  ? 53.671 68.965 16.181  1.00 34.30  ?  8    THR C OG1  1 
ATOM   3265  C  CG2  . THR C  1 8  ? 52.421 69.073 18.238  1.00 35.01  ?  8    THR C CG2  1 
ATOM   3266  H  H    . THR C  1 8  ? 55.801 71.130 17.121  1.00 29.47  ?  8    THR C H    1 
ATOM   3267  H  HA   . THR C  1 8  ? 53.080 71.386 17.101  1.00 31.81  ?  8    THR C HA   1 
ATOM   3268  H  HB   . THR C  1 8  ? 54.452 69.056 17.997  1.00 39.16  ?  8    THR C HB   1 
ATOM   3269  H  HG1  . THR C  1 8  ? 54.369 69.154 15.794  1.00 41.16  ?  8    THR C HG1  1 
ATOM   3270  H  HG21 . THR C  1 8  ? 51.667 69.462 17.788  1.00 42.01  ?  8    THR C HG21 1 
ATOM   3271  H  HG22 . THR C  1 8  ? 52.322 68.118 18.243  1.00 42.01  ?  8    THR C HG22 1 
ATOM   3272  H  HG23 . THR C  1 8  ? 52.440 69.390 19.144  1.00 42.01  ?  8    THR C HG23 1 
ATOM   3273  N  N    . VAL C  1 9  ? 52.975 72.213 19.391  1.00 27.11  ?  9    VAL C N    1 
ATOM   3274  C  CA   . VAL C  1 9  ? 52.986 72.796 20.725  1.00 28.03  ?  9    VAL C CA   1 
ATOM   3275  C  C    . VAL C  1 9  ? 52.409 71.823 21.744  1.00 31.41  ?  9    VAL C C    1 
ATOM   3276  O  O    . VAL C  1 9  ? 51.342 71.251 21.531  1.00 32.90  ?  9    VAL C O    1 
ATOM   3277  C  CB   . VAL C  1 9  ? 52.176 74.105 20.770  1.00 28.24  ?  9    VAL C CB   1 
ATOM   3278  C  CG1  . VAL C  1 9  ? 52.148 74.668 22.183  1.00 29.39  ?  9    VAL C CG1  1 
ATOM   3279  C  CG2  . VAL C  1 9  ? 52.761 75.123 19.798  1.00 27.53  ?  9    VAL C CG2  1 
ATOM   3280  H  H    . VAL C  1 9  ? 52.262 72.382 18.941  1.00 32.54  ?  9    VAL C H    1 
ATOM   3281  H  HA   . VAL C  1 9  ? 53.910 72.997 20.982  1.00 33.63  ?  9    VAL C HA   1 
ATOM   3282  H  HB   . VAL C  1 9  ? 51.253 73.921 20.498  1.00 33.89  ?  9    VAL C HB   1 
ATOM   3283  H  HG11 . VAL C  1 9  ? 53.049 74.843 22.467  1.00 35.27  ?  9    VAL C HG11 1 
ATOM   3284  H  HG12 . VAL C  1 9  ? 51.639 75.481 22.185  1.00 35.27  ?  9    VAL C HG12 1 
ATOM   3285  H  HG13 . VAL C  1 9  ? 51.740 74.024 22.767  1.00 35.27  ?  9    VAL C HG13 1 
ATOM   3286  H  HG21 . VAL C  1 9  ? 52.729 74.760 18.910  1.00 33.04  ?  9    VAL C HG21 1 
ATOM   3287  H  HG22 . VAL C  1 9  ? 52.243 75.929 19.842  1.00 33.04  ?  9    VAL C HG22 1 
ATOM   3288  H  HG23 . VAL C  1 9  ? 53.671 75.304 20.046  1.00 33.04  ?  9    VAL C HG23 1 
ATOM   3289  N  N    . ASN C  1 10 ? 53.127 71.641 22.848  1.00 36.22  ?  10   ASN C N    1 
ATOM   3290  C  CA   . ASN C  1 10 ? 52.669 70.795 23.945  1.00 40.87  ?  10   ASN C CA   1 
ATOM   3291  C  C    . ASN C  1 10 ? 52.731 71.563 25.263  1.00 41.18  ?  10   ASN C C    1 
ATOM   3292  O  O    . ASN C  1 10 ? 53.720 71.482 25.991  1.00 41.11  ?  10   ASN C O    1 
ATOM   3293  C  CB   . ASN C  1 10 ? 53.527 69.533 24.041  1.00 45.97  ?  10   ASN C CB   1 
ATOM   3294  C  CG   . ASN C  1 10 ? 53.713 68.847 22.698  1.00 49.66  ?  10   ASN C CG   1 
ATOM   3295  O  OD1  . ASN C  1 10 ? 54.812 68.837 22.138  1.00 52.09  ?  10   ASN C OD1  1 
ATOM   3296  N  ND2  . ASN C  1 10 ? 52.638 68.268 22.174  1.00 51.54  ?  10   ASN C ND2  1 
ATOM   3297  H  H    . ASN C  1 10 ? 53.895 72.002 22.988  1.00 43.47  ?  10   ASN C H    1 
ATOM   3298  H  HA   . ASN C  1 10 ? 51.740 70.528 23.785  1.00 49.04  ?  10   ASN C HA   1 
ATOM   3299  H  HB2  . ASN C  1 10 ? 54.404 69.772 24.379  1.00 55.17  ?  10   ASN C HB2  1 
ATOM   3300  H  HB3  . ASN C  1 10 ? 53.099 68.904 24.642  1.00 55.17  ?  10   ASN C HB3  1 
ATOM   3301  H  HD21 . ASN C  1 10 ? 51.888 68.293 22.594  1.00 61.85  ?  10   ASN C HD21 1 
ATOM   3302  H  HD22 . ASN C  1 10 ? 52.692 67.866 21.415  1.00 61.85  ?  10   ASN C HD22 1 
ATOM   3303  N  N    . LEU C  1 11 ? 51.674 72.310 25.565  1.00 43.12  ?  11   LEU C N    1 
ATOM   3304  C  CA   . LEU C  1 11 ? 51.648 73.147 26.761  1.00 44.80  ?  11   LEU C CA   1 
ATOM   3305  C  C    . LEU C  1 11 ? 51.600 72.322 28.043  1.00 47.26  ?  11   LEU C C    1 
ATOM   3306  O  O    . LEU C  1 11 ? 50.893 71.318 28.112  1.00 48.95  ?  11   LEU C O    1 
ATOM   3307  C  CB   . LEU C  1 11 ? 50.444 74.090 26.729  1.00 46.12  ?  11   LEU C CB   1 
ATOM   3308  C  CG   . LEU C  1 11 ? 50.417 75.127 25.605  1.00 44.97  ?  11   LEU C CG   1 
ATOM   3309  C  CD1  . LEU C  1 11 ? 49.160 75.978 25.700  1.00 46.25  ?  11   LEU C CD1  1 
ATOM   3310  C  CD2  . LEU C  1 11 ? 51.659 76.003 25.645  1.00 44.15  ?  11   LEU C CD2  1 
ATOM   3311  H  H    . LEU C  1 11 ? 50.957 72.350 25.093  1.00 51.75  ?  11   LEU C H    1 
ATOM   3312  H  HA   . LEU C  1 11 ? 52.461 73.695 26.784  1.00 53.76  ?  11   LEU C HA   1 
ATOM   3313  H  HB2  . LEU C  1 11 ? 49.641 73.553 26.643  1.00 55.34  ?  11   LEU C HB2  1 
ATOM   3314  H  HB3  . LEU C  1 11 ? 50.416 74.576 27.568  1.00 55.34  ?  11   LEU C HB3  1 
ATOM   3315  H  HG   . LEU C  1 11 ? 50.403 74.667 24.751  1.00 53.97  ?  11   LEU C HG   1 
ATOM   3316  H  HD11 . LEU C  1 11 ? 49.152 76.429 26.548  1.00 55.50  ?  11   LEU C HD11 1 
ATOM   3317  H  HD12 . LEU C  1 11 ? 49.164 76.621 24.987  1.00 55.50  ?  11   LEU C HD12 1 
ATOM   3318  H  HD13 . LEU C  1 11 ? 48.391 75.409 25.625  1.00 55.50  ?  11   LEU C HD13 1 
ATOM   3319  H  HD21 . LEU C  1 11 ? 52.435 75.449 25.541  1.00 52.98  ?  11   LEU C HD21 1 
ATOM   3320  H  HD22 . LEU C  1 11 ? 51.613 76.642 24.930  1.00 52.98  ?  11   LEU C HD22 1 
ATOM   3321  H  HD23 . LEU C  1 11 ? 51.692 76.458 26.490  1.00 52.98  ?  11   LEU C HD23 1 
ATOM   3322  N  N    . PRO C  1 12 ? 52.364 72.744 29.063  1.00 44.36  ?  12   PRO C N    1 
ATOM   3323  C  CA   . PRO C  1 12 ? 52.263 72.173 30.412  1.00 47.82  ?  12   PRO C CA   1 
ATOM   3324  C  C    . PRO C  1 12 ? 50.866 72.385 30.980  1.00 51.78  ?  12   PRO C C    1 
ATOM   3325  O  O    . PRO C  1 12 ? 50.257 73.423 30.714  1.00 47.34  ?  12   PRO C O    1 
ATOM   3326  C  CB   . PRO C  1 12 ? 53.286 72.982 31.216  1.00 49.15  ?  12   PRO C CB   1 
ATOM   3327  C  CG   . PRO C  1 12 ? 54.253 73.490 30.210  1.00 47.00  ?  12   PRO C CG   1 
ATOM   3328  C  CD   . PRO C  1 12 ? 53.459 73.724 28.960  1.00 43.53  ?  12   PRO C CD   1 
ATOM   3329  H  HA   . PRO C  1 12 ? 52.497 71.222 30.418  1.00 57.39  ?  12   PRO C HA   1 
ATOM   3330  H  HB2  . PRO C  1 12 ? 52.841 73.718 31.666  1.00 58.98  ?  12   PRO C HB2  1 
ATOM   3331  H  HB3  . PRO C  1 12 ? 53.729 72.405 31.857  1.00 58.98  ?  12   PRO C HB3  1 
ATOM   3332  H  HG2  . PRO C  1 12 ? 54.644 74.319 30.525  1.00 56.40  ?  12   PRO C HG2  1 
ATOM   3333  H  HG3  . PRO C  1 12 ? 54.941 72.824 30.057  1.00 56.40  ?  12   PRO C HG3  1 
ATOM   3334  H  HD2  . PRO C  1 12 ? 53.105 74.627 28.949  1.00 52.24  ?  12   PRO C HD2  1 
ATOM   3335  H  HD3  . PRO C  1 12 ? 54.001 73.544 28.177  1.00 52.24  ?  12   PRO C HD3  1 
ATOM   3336  N  N    . ARG C  1 13 ? 50.366 71.429 31.754  1.00 57.46  ?  13   ARG C N    1 
ATOM   3337  C  CA   . ARG C  1 13 ? 49.000 71.516 32.258  1.00 65.75  ?  13   ARG C CA   1 
ATOM   3338  C  C    . ARG C  1 13 ? 48.825 72.675 33.240  1.00 66.05  ?  13   ARG C C    1 
ATOM   3339  O  O    . ARG C  1 13 ? 47.713 73.166 33.434  1.00 69.28  ?  13   ARG C O    1 
ATOM   3340  C  CB   . ARG C  1 13 ? 48.571 70.194 32.907  1.00 74.16  ?  13   ARG C CB   1 
ATOM   3341  C  CG   . ARG C  1 13 ? 49.150 69.923 34.291  1.00 81.69  ?  13   ARG C CG   1 
ATOM   3342  C  CD   . ARG C  1 13 ? 48.073 69.373 35.218  1.00 88.26  ?  13   ARG C CD   1 
ATOM   3343  N  NE   . ARG C  1 13 ? 48.571 68.347 36.131  1.00 94.14  ?  13   ARG C NE   1 
ATOM   3344  C  CZ   . ARG C  1 13 ? 48.594 67.043 35.862  1.00 96.40  ?  13   ARG C CZ   1 
ATOM   3345  N  NH1  . ARG C  1 13 ? 48.155 66.584 34.696  1.00 92.57  ?  13   ARG C NH1  1 
ATOM   3346  N  NH2  . ARG C  1 13 ? 49.063 66.191 36.763  1.00 101.90 ?  13   ARG C NH2  1 
ATOM   3347  H  H    . ARG C  1 13 ? 50.792 70.724 32.001  1.00 68.95  ?  13   ARG C H    1 
ATOM   3348  H  HA   . ARG C  1 13 ? 48.401 71.679 31.501  1.00 78.90  ?  13   ARG C HA   1 
ATOM   3349  H  HB2  . ARG C  1 13 ? 47.604 70.194 32.991  1.00 88.99  ?  13   ARG C HB2  1 
ATOM   3350  H  HB3  . ARG C  1 13 ? 48.845 69.466 32.329  1.00 88.99  ?  13   ARG C HB3  1 
ATOM   3351  H  HG2  . ARG C  1 13 ? 49.860 69.266 34.221  1.00 98.02  ?  13   ARG C HG2  1 
ATOM   3352  H  HG3  . ARG C  1 13 ? 49.488 70.750 34.668  1.00 98.02  ?  13   ARG C HG3  1 
ATOM   3353  H  HD2  . ARG C  1 13 ? 47.716 70.100 35.751  1.00 105.91 ?  13   ARG C HD2  1 
ATOM   3354  H  HD3  . ARG C  1 13 ? 47.367 68.979 34.681  1.00 105.91 ?  13   ARG C HD3  1 
ATOM   3355  H  HE   . ARG C  1 13 ? 48.869 68.603 36.896  1.00 112.97 ?  13   ARG C HE   1 
ATOM   3356  H  HH11 . ARG C  1 13 ? 47.849 67.129 34.106  1.00 111.08 ?  13   ARG C HH11 1 
ATOM   3357  H  HH12 . ARG C  1 13 ? 48.176 65.740 34.531  1.00 111.08 ?  13   ARG C HH12 1 
ATOM   3358  H  HH21 . ARG C  1 13 ? 49.350 66.481 37.520  1.00 122.28 ?  13   ARG C HH21 1 
ATOM   3359  H  HH22 . ARG C  1 13 ? 49.081 65.349 36.589  1.00 122.28 ?  13   ARG C HH22 1 
ATOM   3360  N  N    . ASN C  1 14 ? 49.922 73.116 33.847  1.00 70.00  ?  14   ASN C N    1 
ATOM   3361  C  CA   . ASN C  1 14 ? 49.864 74.189 34.835  1.00 72.09  ?  14   ASN C CA   1 
ATOM   3362  C  C    . ASN C  1 14 ? 50.110 75.573 34.235  1.00 69.76  ?  14   ASN C C    1 
ATOM   3363  O  O    . ASN C  1 14 ? 50.261 76.552 34.965  1.00 71.37  ?  14   ASN C O    1 
ATOM   3364  C  CB   . ASN C  1 14 ? 50.866 73.932 35.963  1.00 77.96  ?  14   ASN C CB   1 
ATOM   3365  C  CG   . ASN C  1 14 ? 52.302 73.900 35.476  1.00 80.57  ?  14   ASN C CG   1 
ATOM   3366  O  OD1  . ASN C  1 14 ? 52.589 74.238 34.327  1.00 78.70  ?  14   ASN C OD1  1 
ATOM   3367  N  ND2  . ASN C  1 14 ? 53.214 73.498 36.353  1.00 84.86  ?  14   ASN C ND2  1 
ATOM   3368  H  H    . ASN C  1 14 ? 50.714 72.811 33.705  1.00 83.99  ?  14   ASN C H    1 
ATOM   3369  H  HA   . ASN C  1 14 ? 48.968 74.196 35.232  1.00 86.50  ?  14   ASN C HA   1 
ATOM   3370  H  HB2  . ASN C  1 14 ? 50.788 74.639 36.622  1.00 93.55  ?  14   ASN C HB2  1 
ATOM   3371  H  HB3  . ASN C  1 14 ? 50.669 73.074 36.371  1.00 93.55  ?  14   ASN C HB3  1 
ATOM   3372  H  HD21 . ASN C  1 14 ? 52.976 73.274 37.149  1.00 101.84 ?  14   ASN C HD21 1 
ATOM   3373  H  HD22 . ASN C  1 14 ? 54.043 73.463 36.126  1.00 101.84 ?  14   ASN C HD22 1 
ATOM   3374  N  N    . LEU C  1 15 ? 50.151 75.653 32.909  1.00 65.21  ?  15   LEU C N    1 
ATOM   3375  C  CA   . LEU C  1 15 ? 50.345 76.929 32.232  1.00 61.31  ?  15   LEU C CA   1 
ATOM   3376  C  C    . LEU C  1 15 ? 48.993 77.592 31.981  1.00 59.81  ?  15   LEU C C    1 
ATOM   3377  O  O    . LEU C  1 15 ? 48.284 77.242 31.038  1.00 59.04  ?  15   LEU C O    1 
ATOM   3378  C  CB   . LEU C  1 15 ? 51.098 76.725 30.916  1.00 58.88  ?  15   LEU C CB   1 
ATOM   3379  C  CG   . LEU C  1 15 ? 51.758 77.972 30.323  1.00 57.94  ?  15   LEU C CG   1 
ATOM   3380  C  CD1  . LEU C  1 15 ? 53.203 77.681 29.950  1.00 58.68  ?  15   LEU C CD1  1 
ATOM   3381  C  CD2  . LEU C  1 15 ? 50.985 78.472 29.113  1.00 55.97  ?  15   LEU C CD2  1 
ATOM   3382  H  H    . LEU C  1 15 ? 50.068 74.981 32.378  1.00 78.25  ?  15   LEU C H    1 
ATOM   3383  H  HA   . LEU C  1 15 ? 50.878 77.522 32.803  1.00 73.57  ?  15   LEU C HA   1 
ATOM   3384  H  HB2  . LEU C  1 15 ? 51.798 76.070 31.063  1.00 70.65  ?  15   LEU C HB2  1 
ATOM   3385  H  HB3  . LEU C  1 15 ? 50.473 76.387 30.256  1.00 70.65  ?  15   LEU C HB3  1 
ATOM   3386  H  HG   . LEU C  1 15 ? 51.757 78.676 30.990  1.00 69.52  ?  15   LEU C HG   1 
ATOM   3387  H  HD11 . LEU C  1 15 ? 53.221 76.974 29.301  1.00 70.41  ?  15   LEU C HD11 1 
ATOM   3388  H  HD12 . LEU C  1 15 ? 53.596 78.475 29.580  1.00 70.41  ?  15   LEU C HD12 1 
ATOM   3389  H  HD13 . LEU C  1 15 ? 53.681 77.414 30.738  1.00 70.41  ?  15   LEU C HD13 1 
ATOM   3390  H  HD21 . LEU C  1 15 ? 50.090 78.690 29.383  1.00 67.17  ?  15   LEU C HD21 1 
ATOM   3391  H  HD22 . LEU C  1 15 ? 51.422 79.252 28.764  1.00 67.17  ?  15   LEU C HD22 1 
ATOM   3392  H  HD23 . LEU C  1 15 ? 50.967 77.781 28.447  1.00 67.17  ?  15   LEU C HD23 1 
ATOM   3393  N  N    . ASP C  1 16 ? 48.639 78.547 32.837  1.00 60.23  ?  16   ASP C N    1 
ATOM   3394  C  CA   . ASP C  1 16 ? 47.336 79.200 32.762  1.00 58.23  ?  16   ASP C CA   1 
ATOM   3395  C  C    . ASP C  1 16 ? 47.168 79.977 31.457  1.00 49.82  ?  16   ASP C C    1 
ATOM   3396  O  O    . ASP C  1 16 ? 48.150 80.409 30.859  1.00 48.08  ?  16   ASP C O    1 
ATOM   3397  C  CB   . ASP C  1 16 ? 47.136 80.135 33.957  1.00 64.79  ?  16   ASP C CB   1 
ATOM   3398  C  CG   . ASP C  1 16 ? 48.196 81.214 34.038  1.00 68.53  ?  16   ASP C CG   1 
ATOM   3399  O  OD1  . ASP C  1 16 ? 48.104 82.197 33.272  1.00 67.25  ?  16   ASP C OD1  1 
ATOM   3400  O  OD2  . ASP C  1 16 ? 49.119 81.083 34.870  1.00 73.04  ?  16   ASP C OD2  1 
ATOM   3401  H  H    . ASP C  1 16 ? 49.139 78.835 33.475  1.00 72.27  ?  16   ASP C H    1 
ATOM   3402  H  HA   . ASP C  1 16 ? 46.636 78.515 32.797  1.00 69.87  ?  16   ASP C HA   1 
ATOM   3403  H  HB2  . ASP C  1 16 ? 46.272 80.569 33.879  1.00 77.74  ?  16   ASP C HB2  1 
ATOM   3404  H  HB3  . ASP C  1 16 ? 47.175 79.615 34.775  1.00 77.74  ?  16   ASP C HB3  1 
ATOM   3405  N  N    . PRO C  1 17 ? 45.911 80.150 31.014  1.00 49.56  ?  17   PRO C N    1 
ATOM   3406  C  CA   . PRO C  1 17 ? 45.567 80.832 29.759  1.00 47.01  ?  17   PRO C CA   1 
ATOM   3407  C  C    . PRO C  1 17 ? 46.207 82.210 29.605  1.00 46.49  ?  17   PRO C C    1 
ATOM   3408  O  O    . PRO C  1 17 ? 46.562 82.594 28.490  1.00 45.15  ?  17   PRO C O    1 
ATOM   3409  C  CB   . PRO C  1 17 ? 44.045 80.966 29.847  1.00 50.00  ?  17   PRO C CB   1 
ATOM   3410  C  CG   . PRO C  1 17 ? 43.622 79.821 30.683  1.00 50.31  ?  17   PRO C CG   1 
ATOM   3411  C  CD   . PRO C  1 17 ? 44.714 79.627 31.696  1.00 49.92  ?  17   PRO C CD   1 
ATOM   3412  H  HA   . PRO C  1 17 ? 45.803 80.273 28.989  1.00 56.41  ?  17   PRO C HA   1 
ATOM   3413  H  HB2  . PRO C  1 17 ? 43.813 81.807 30.271  1.00 60.00  ?  17   PRO C HB2  1 
ATOM   3414  H  HB3  . PRO C  1 17 ? 43.658 80.907 28.960  1.00 60.00  ?  17   PRO C HB3  1 
ATOM   3415  H  HG2  . PRO C  1 17 ? 42.784 80.032 31.123  1.00 60.38  ?  17   PRO C HG2  1 
ATOM   3416  H  HG3  . PRO C  1 17 ? 43.528 79.031 30.129  1.00 60.38  ?  17   PRO C HG3  1 
ATOM   3417  H  HD2  . PRO C  1 17 ? 44.528 80.143 32.496  1.00 59.91  ?  17   PRO C HD2  1 
ATOM   3418  H  HD3  . PRO C  1 17 ? 44.825 78.685 31.897  1.00 59.91  ?  17   PRO C HD3  1 
ATOM   3419  N  N    . ARG C  1 18 ? 46.339 82.946 30.705  1.00 43.35  ?  18   ARG C N    1 
ATOM   3420  C  CA   . ARG C  1 18 ? 46.931 84.278 30.660  1.00 44.88  ?  18   ARG C CA   1 
ATOM   3421  C  C    . ARG C  1 18 ? 48.394 84.206 30.232  1.00 42.57  ?  18   ARG C C    1 
ATOM   3422  O  O    . ARG C  1 18 ? 48.854 85.007 29.417  1.00 39.21  ?  18   ARG C O    1 
ATOM   3423  C  CB   . ARG C  1 18 ? 46.805 84.969 32.020  1.00 51.18  ?  18   ARG C CB   1 
ATOM   3424  C  CG   . ARG C  1 18 ? 45.519 85.768 32.193  1.00 57.23  ?  18   ARG C CG   1 
ATOM   3425  C  CD   . ARG C  1 18 ? 44.275 84.942 31.888  1.00 58.58  ?  18   ARG C CD   1 
ATOM   3426  N  NE   . ARG C  1 18 ? 44.033 83.901 32.885  1.00 59.53  ?  18   ARG C NE   1 
ATOM   3427  C  CZ   . ARG C  1 18 ? 43.021 83.039 32.838  1.00 58.61  ?  18   ARG C CZ   1 
ATOM   3428  N  NH1  . ARG C  1 18 ? 42.146 83.084 31.841  1.00 58.68  ?  18   ARG C NH1  1 
ATOM   3429  N  NH2  . ARG C  1 18 ? 42.882 82.126 33.789  1.00 57.92  ?  18   ARG C NH2  1 
ATOM   3430  H  H    . ARG C  1 18 ? 46.094 82.696 31.490  1.00 52.02  ?  18   ARG C H    1 
ATOM   3431  H  HA   . ARG C  1 18 ? 46.449 84.819 30.000  1.00 53.85  ?  18   ARG C HA   1 
ATOM   3432  H  HB2  . ARG C  1 18 ? 46.829 84.293 32.716  1.00 61.41  ?  18   ARG C HB2  1 
ATOM   3433  H  HB3  . ARG C  1 18 ? 47.550 85.580 32.130  1.00 61.41  ?  18   ARG C HB3  1 
ATOM   3434  H  HG2  . ARG C  1 18 ? 45.458 86.076 33.110  1.00 68.68  ?  18   ARG C HG2  1 
ATOM   3435  H  HG3  . ARG C  1 18 ? 45.533 86.526 31.587  1.00 68.68  ?  18   ARG C HG3  1 
ATOM   3436  H  HD2  . ARG C  1 18 ? 43.502 85.528 31.873  1.00 70.30  ?  18   ARG C HD2  1 
ATOM   3437  H  HD3  . ARG C  1 18 ? 44.383 84.512 31.025  1.00 70.30  ?  18   ARG C HD3  1 
ATOM   3438  H  HE   . ARG C  1 18 ? 44.581 83.842 33.545  1.00 71.43  ?  18   ARG C HE   1 
ATOM   3439  H  HH11 . ARG C  1 18 ? 42.231 83.674 31.221  1.00 70.41  ?  18   ARG C HH11 1 
ATOM   3440  H  HH12 . ARG C  1 18 ? 41.494 82.525 31.816  1.00 70.41  ?  18   ARG C HH12 1 
ATOM   3441  H  HH21 . ARG C  1 18 ? 43.445 82.091 34.438  1.00 69.51  ?  18   ARG C HH21 1 
ATOM   3442  H  HH22 . ARG C  1 18 ? 42.227 81.569 33.758  1.00 69.51  ?  18   ARG C HH22 1 
ATOM   3443  N  N    . GLU C  1 19 ? 49.119 83.240 30.784  1.00 49.74  ?  19   GLU C N    1 
ATOM   3444  C  CA   . GLU C  1 19 ? 50.518 83.041 30.434  1.00 52.35  ?  19   GLU C CA   1 
ATOM   3445  C  C    . GLU C  1 19 ? 50.623 82.566 28.989  1.00 48.24  ?  19   GLU C C    1 
ATOM   3446  O  O    . GLU C  1 19 ? 51.550 82.939 28.272  1.00 44.15  ?  19   GLU C O    1 
ATOM   3447  C  CB   . GLU C  1 19 ? 51.165 82.023 31.376  1.00 57.90  ?  19   GLU C CB   1 
ATOM   3448  C  CG   . GLU C  1 19 ? 52.505 82.465 31.952  1.00 64.93  ?  19   GLU C CG   1 
ATOM   3449  C  CD   . GLU C  1 19 ? 53.658 82.272 30.984  1.00 66.56  ?  19   GLU C CD   1 
ATOM   3450  O  OE1  . GLU C  1 19 ? 53.754 83.041 30.005  1.00 67.07  ?  19   GLU C OE1  1 
ATOM   3451  O  OE2  . GLU C  1 19 ? 54.474 81.352 31.209  1.00 66.73  ?  19   GLU C OE2  1 
ATOM   3452  H  H    . GLU C  1 19 ? 48.821 82.682 31.368  1.00 59.69  ?  19   GLU C H    1 
ATOM   3453  H  HA   . GLU C  1 19 ? 50.999 83.891 30.517  1.00 62.82  ?  19   GLU C HA   1 
ATOM   3454  H  HB2  . GLU C  1 19 ? 50.564 81.862 32.120  1.00 69.48  ?  19   GLU C HB2  1 
ATOM   3455  H  HB3  . GLU C  1 19 ? 51.312 81.198 30.888  1.00 69.48  ?  19   GLU C HB3  1 
ATOM   3456  H  HG2  . GLU C  1 19 ? 52.456 83.407 32.175  1.00 77.91  ?  19   GLU C HG2  1 
ATOM   3457  H  HG3  . GLU C  1 19 ? 52.692 81.944 32.749  1.00 77.91  ?  19   GLU C HG3  1 
ATOM   3458  N  N    . GLU C  1 20 ? 49.664 81.748 28.566  1.00 51.92  ?  20   GLU C N    1 
ATOM   3459  C  CA   . GLU C  1 20 ? 49.639 81.240 27.198  1.00 49.82  ?  20   GLU C CA   1 
ATOM   3460  C  C    . GLU C  1 20 ? 49.452 82.375 26.196  1.00 48.75  ?  20   GLU C C    1 
ATOM   3461  O  O    . GLU C  1 20 ? 50.107 82.407 25.153  1.00 46.27  ?  20   GLU C O    1 
ATOM   3462  C  CB   . GLU C  1 20 ? 48.523 80.208 27.025  1.00 49.38  ?  20   GLU C CB   1 
ATOM   3463  C  CG   . GLU C  1 20 ? 48.309 79.774 25.584  1.00 46.11  ?  20   GLU C CG   1 
ATOM   3464  C  CD   . GLU C  1 20 ? 47.201 78.749 25.433  1.00 44.87  ?  20   GLU C CD   1 
ATOM   3465  O  OE1  . GLU C  1 20 ? 46.593 78.364 26.455  1.00 44.32  ?  20   GLU C OE1  1 
ATOM   3466  O  OE2  . GLU C  1 20 ? 46.939 78.330 24.287  1.00 44.66  ?  20   GLU C OE2  1 
ATOM   3467  H  H    . GLU C  1 20 ? 49.014 81.470 29.055  1.00 62.30  ?  20   GLU C H    1 
ATOM   3468  H  HA   . GLU C  1 20 ? 50.493 80.801 27.004  1.00 59.79  ?  20   GLU C HA   1 
ATOM   3469  H  HB2  . GLU C  1 20 ? 48.744 79.418 27.543  1.00 59.25  ?  20   GLU C HB2  1 
ATOM   3470  H  HB3  . GLU C  1 20 ? 47.691 80.590 27.347  1.00 59.25  ?  20   GLU C HB3  1 
ATOM   3471  H  HG2  . GLU C  1 20 ? 48.074 80.550 25.052  1.00 55.33  ?  20   GLU C HG2  1 
ATOM   3472  H  HG3  . GLU C  1 20 ? 49.130 79.379 25.249  1.00 55.33  ?  20   GLU C HG3  1 
ATOM   3473  N  N    . GLU C  1 21 ? 48.554 83.302 26.515  1.00 45.24  ?  21   GLU C N    1 
ATOM   3474  C  CA   . GLU C  1 21 ? 48.289 84.439 25.642  1.00 43.77  ?  21   GLU C CA   1 
ATOM   3475  C  C    . GLU C  1 21 ? 49.477 85.395 25.612  1.00 42.15  ?  21   GLU C C    1 
ATOM   3476  O  O    . GLU C  1 21 ? 49.762 86.010 24.585  1.00 40.91  ?  21   GLU C O    1 
ATOM   3477  C  CB   . GLU C  1 21 ? 47.025 85.175 26.088  1.00 48.05  ?  21   GLU C CB   1 
ATOM   3478  C  CG   . GLU C  1 21 ? 45.743 84.410 25.801  1.00 48.99  ?  21   GLU C CG   1 
ATOM   3479  C  CD   . GLU C  1 21 ? 45.518 84.187 24.316  1.00 48.04  ?  21   GLU C CD   1 
ATOM   3480  O  OE1  . GLU C  1 21 ? 45.795 85.115 23.524  1.00 47.79  ?  21   GLU C OE1  1 
ATOM   3481  O  OE2  . GLU C  1 21 ? 45.071 83.081 23.942  1.00 48.09  ?  21   GLU C OE2  1 
ATOM   3482  H  H    . GLU C  1 21 ? 48.082 83.295 27.234  1.00 54.28  ?  21   GLU C H    1 
ATOM   3483  H  HA   . GLU C  1 21 ? 48.142 84.113 24.729  1.00 52.52  ?  21   GLU C HA   1 
ATOM   3484  H  HB2  . GLU C  1 21 ? 47.072 85.327 27.045  1.00 57.66  ?  21   GLU C HB2  1 
ATOM   3485  H  HB3  . GLU C  1 21 ? 46.975 86.024 25.622  1.00 57.66  ?  21   GLU C HB3  1 
ATOM   3486  H  HG2  . GLU C  1 21 ? 45.789 83.542 26.231  1.00 58.79  ?  21   GLU C HG2  1 
ATOM   3487  H  HG3  . GLU C  1 21 ? 44.989 84.913 26.147  1.00 58.79  ?  21   GLU C HG3  1 
ATOM   3488  N  N    . ARG C  1 22 ? 50.167 85.518 26.741  1.00 43.49  ?  22   ARG C N    1 
ATOM   3489  C  CA   . ARG C  1 22 ? 51.371 86.334 26.806  1.00 45.78  ?  22   ARG C CA   1 
ATOM   3490  C  C    . ARG C  1 22 ? 52.416 85.739 25.875  1.00 41.00  ?  22   ARG C C    1 
ATOM   3491  O  O    . ARG C  1 22 ? 53.117 86.455 25.158  1.00 42.29  ?  22   ARG C O    1 
ATOM   3492  C  CB   . ARG C  1 22 ? 51.917 86.367 28.233  1.00 50.88  ?  22   ARG C CB   1 
ATOM   3493  C  CG   . ARG C  1 22 ? 53.074 87.332 28.433  1.00 56.23  ?  22   ARG C CG   1 
ATOM   3494  C  CD   . ARG C  1 22 ? 53.997 86.863 29.545  1.00 61.42  ?  22   ARG C CD   1 
ATOM   3495  N  NE   . ARG C  1 22 ? 55.184 86.191 29.020  1.00 62.85  ?  22   ARG C NE   1 
ATOM   3496  C  CZ   . ARG C  1 22 ? 56.027 85.470 29.753  1.00 66.09  ?  22   ARG C CZ   1 
ATOM   3497  N  NH1  . ARG C  1 22 ? 55.820 85.308 31.054  1.00 70.66  ?  22   ARG C NH1  1 
ATOM   3498  N  NH2  . ARG C  1 22 ? 57.080 84.900 29.182  1.00 63.72  ?  22   ARG C NH2  1 
ATOM   3499  H  H    . ARG C  1 22 ? 49.958 85.138 27.483  1.00 52.19  ?  22   ARG C H    1 
ATOM   3500  H  HA   . ARG C  1 22 ? 51.172 87.250 26.519  1.00 54.94  ?  22   ARG C HA   1 
ATOM   3501  H  HB2  . ARG C  1 22 ? 51.203 86.634 28.834  1.00 61.06  ?  22   ARG C HB2  1 
ATOM   3502  H  HB3  . ARG C  1 22 ? 52.228 85.479 28.468  1.00 61.06  ?  22   ARG C HB3  1 
ATOM   3503  H  HG2  . ARG C  1 22 ? 53.589 87.389 27.613  1.00 67.47  ?  22   ARG C HG2  1 
ATOM   3504  H  HG3  . ARG C  1 22 ? 52.726 88.205 28.673  1.00 67.47  ?  22   ARG C HG3  1 
ATOM   3505  H  HD2  . ARG C  1 22 ? 54.288 87.630 30.063  1.00 73.71  ?  22   ARG C HD2  1 
ATOM   3506  H  HD3  . ARG C  1 22 ? 53.521 86.237 30.113  1.00 73.71  ?  22   ARG C HD3  1 
ATOM   3507  H  HE   . ARG C  1 22 ? 55.348 86.267 28.179  1.00 75.42  ?  22   ARG C HE   1 
ATOM   3508  H  HH11 . ARG C  1 22 ? 55.139 85.675 31.430  1.00 84.80  ?  22   ARG C HH11 1 
ATOM   3509  H  HH12 . ARG C  1 22 ? 56.368 84.839 31.522  1.00 84.80  ?  22   ARG C HH12 1 
ATOM   3510  H  HH21 . ARG C  1 22 ? 57.218 85.000 28.339  1.00 76.47  ?  22   ARG C HH21 1 
ATOM   3511  H  HH22 . ARG C  1 22 ? 57.624 84.431 29.654  1.00 76.47  ?  22   ARG C HH22 1 
ATOM   3512  N  N    . LEU C  1 23 ? 52.506 84.414 25.897  1.00 42.80  ?  23   LEU C N    1 
ATOM   3513  C  CA   . LEU C  1 23 ? 53.466 83.686 25.083  1.00 39.52  ?  23   LEU C CA   1 
ATOM   3514  C  C    . LEU C  1 23 ? 53.124 83.819 23.603  1.00 38.48  ?  23   LEU C C    1 
ATOM   3515  O  O    . LEU C  1 23 ? 54.007 84.022 22.772  1.00 32.39  ?  23   LEU C O    1 
ATOM   3516  C  CB   . LEU C  1 23 ? 53.474 82.212 25.494  1.00 41.74  ?  23   LEU C CB   1 
ATOM   3517  C  CG   . LEU C  1 23 ? 54.812 81.478 25.611  1.00 44.27  ?  23   LEU C CG   1 
ATOM   3518  C  CD1  . LEU C  1 23 ? 55.948 82.394 26.038  1.00 47.78  ?  23   LEU C CD1  1 
ATOM   3519  C  CD2  . LEU C  1 23 ? 54.655 80.345 26.612  1.00 46.63  ?  23   LEU C CD2  1 
ATOM   3520  H  H    . LEU C  1 23 ? 52.011 83.907 26.384  1.00 51.36  ?  23   LEU C H    1 
ATOM   3521  H  HA   . LEU C  1 23 ? 54.363 84.053 25.228  1.00 47.43  ?  23   LEU C HA   1 
ATOM   3522  H  HB2  . LEU C  1 23 ? 53.044 82.146 26.361  1.00 50.09  ?  23   LEU C HB2  1 
ATOM   3523  H  HB3  . LEU C  1 23 ? 52.945 81.723 24.844  1.00 50.09  ?  23   LEU C HB3  1 
ATOM   3524  H  HG   . LEU C  1 23 ? 55.041 81.092 24.751  1.00 53.13  ?  23   LEU C HG   1 
ATOM   3525  H  HD11 . LEU C  1 23 ? 55.739 82.772 26.895  1.00 57.34  ?  23   LEU C HD11 1 
ATOM   3526  H  HD12 . LEU C  1 23 ? 56.758 81.881 26.094  1.00 57.34  ?  23   LEU C HD12 1 
ATOM   3527  H  HD13 . LEU C  1 23 ? 56.047 83.093 25.387  1.00 57.34  ?  23   LEU C HD13 1 
ATOM   3528  H  HD21 . LEU C  1 23 ? 53.974 79.745 26.300  1.00 55.96  ?  23   LEU C HD21 1 
ATOM   3529  H  HD22 . LEU C  1 23 ? 55.491 79.880 26.691  1.00 55.96  ?  23   LEU C HD22 1 
ATOM   3530  H  HD23 . LEU C  1 23 ? 54.403 80.713 27.462  1.00 55.96  ?  23   LEU C HD23 1 
ATOM   3531  N  N    . LYS C  1 24 ? 51.838 83.705 23.278  1.00 44.10  ?  24   LYS C N    1 
ATOM   3532  C  CA   . LYS C  1 24 ? 51.381 83.872 21.903  1.00 47.28  ?  24   LYS C CA   1 
ATOM   3533  C  C    . LYS C  1 24 ? 51.772 85.242 21.364  1.00 47.11  ?  24   LYS C C    1 
ATOM   3534  O  O    . LYS C  1 24 ? 52.146 85.376 20.200  1.00 49.71  ?  24   LYS C O    1 
ATOM   3535  C  CB   . LYS C  1 24 ? 49.863 83.717 21.809  1.00 50.27  ?  24   LYS C CB   1 
ATOM   3536  C  CG   . LYS C  1 24 ? 49.363 82.285 21.754  1.00 50.82  ?  24   LYS C CG   1 
ATOM   3537  C  CD   . LYS C  1 24 ? 47.966 82.242 21.153  1.00 54.58  ?  24   LYS C CD   1 
ATOM   3538  C  CE   . LYS C  1 24 ? 47.070 81.239 21.855  1.00 56.93  ?  24   LYS C CE   1 
ATOM   3539  N  NZ   . LYS C  1 24 ? 45.656 81.356 21.397  1.00 59.67  ?  24   LYS C NZ   1 
ATOM   3540  H  H    . LYS C  1 24 ? 51.210 83.530 23.838  1.00 52.92  ?  24   LYS C H    1 
ATOM   3541  H  HA   . LYS C  1 24 ? 51.796 83.188 21.337  1.00 56.73  ?  24   LYS C HA   1 
ATOM   3542  H  HB2  . LYS C  1 24 ? 49.462 84.137 22.586  1.00 60.32  ?  24   LYS C HB2  1 
ATOM   3543  H  HB3  . LYS C  1 24 ? 49.557 84.164 21.004  1.00 60.32  ?  24   LYS C HB3  1 
ATOM   3544  H  HG2  . LYS C  1 24 ? 49.955 81.756 21.197  1.00 60.98  ?  24   LYS C HG2  1 
ATOM   3545  H  HG3  . LYS C  1 24 ? 49.324 81.920 22.653  1.00 60.98  ?  24   LYS C HG3  1 
ATOM   3546  H  HD2  . LYS C  1 24 ? 47.558 83.118 21.234  1.00 65.49  ?  24   LYS C HD2  1 
ATOM   3547  H  HD3  . LYS C  1 24 ? 48.029 81.988 20.219  1.00 65.49  ?  24   LYS C HD3  1 
ATOM   3548  H  HE2  . LYS C  1 24 ? 47.380 80.341 21.660  1.00 68.32  ?  24   LYS C HE2  1 
ATOM   3549  H  HE3  . LYS C  1 24 ? 47.094 81.402 22.811  1.00 68.32  ?  24   LYS C HE3  1 
ATOM   3550  H  HZ1  . LYS C  1 24 ? 45.608 81.207 20.520  1.00 71.61  ?  24   LYS C HZ1  1 
ATOM   3551  H  HZ2  . LYS C  1 24 ? 45.149 80.760 21.820  1.00 71.61  ?  24   LYS C HZ2  1 
ATOM   3552  H  HZ3  . LYS C  1 24 ? 45.348 82.173 21.569  1.00 71.61  ?  24   LYS C HZ3  1 
ATOM   3553  N  N    . ALA C  1 25 ? 51.675 86.259 22.214  1.00 41.19  ?  25   ALA C N    1 
ATOM   3554  C  CA   . ALA C  1 25 ? 52.000 87.622 21.812  1.00 39.05  ?  25   ALA C CA   1 
ATOM   3555  C  C    . ALA C  1 25 ? 53.474 87.736 21.436  1.00 36.87  ?  25   ALA C C    1 
ATOM   3556  O  O    . ALA C  1 25 ? 53.816 88.314 20.404  1.00 34.89  ?  25   ALA C O    1 
ATOM   3557  C  CB   . ALA C  1 25 ? 51.657 88.600 22.927  1.00 43.22  ?  25   ALA C CB   1 
ATOM   3558  H  H    . ALA C  1 25 ? 51.422 86.185 23.033  1.00 49.43  ?  25   ALA C H    1 
ATOM   3559  H  HA   . ALA C  1 25 ? 51.467 87.859 21.025  1.00 46.86  ?  25   ALA C HA   1 
ATOM   3560  H  HB1  . ALA C  1 25 ? 52.164 88.371 23.709  1.00 51.86  ?  25   ALA C HB1  1 
ATOM   3561  H  HB2  . ALA C  1 25 ? 51.879 89.489 22.641  1.00 51.86  ?  25   ALA C HB2  1 
ATOM   3562  H  HB3  . ALA C  1 25 ? 50.718 88.541 23.116  1.00 51.86  ?  25   ALA C HB3  1 
ATOM   3563  N  N    . SER C  1 26 ? 54.345 87.184 22.276  1.00 39.92  ?  26   SER C N    1 
ATOM   3564  C  CA   . SER C  1 26 ? 55.778 87.202 22.007  1.00 41.26  ?  26   SER C CA   1 
ATOM   3565  C  C    . SER C  1 26 ? 56.099 86.407 20.746  1.00 36.36  ?  26   SER C C    1 
ATOM   3566  O  O    . SER C  1 26 ? 56.923 86.824 19.935  1.00 36.17  ?  26   SER C O    1 
ATOM   3567  C  CB   . SER C  1 26 ? 56.558 86.631 23.193  1.00 45.47  ?  26   SER C CB   1 
ATOM   3568  O  OG   . SER C  1 26 ? 56.377 87.425 24.352  1.00 51.91  ?  26   SER C OG   1 
ATOM   3569  H  H    . SER C  1 26 ? 54.130 86.792 23.011  1.00 47.90  ?  26   SER C H    1 
ATOM   3570  H  HA   . SER C  1 26 ? 56.068 88.128 21.867  1.00 49.51  ?  26   SER C HA   1 
ATOM   3571  H  HB2  . SER C  1 26 ? 56.242 85.732 23.374  1.00 54.56  ?  26   SER C HB2  1 
ATOM   3572  H  HB3  . SER C  1 26 ? 57.502 86.611 22.969  1.00 54.56  ?  26   SER C HB3  1 
ATOM   3573  H  HG   . SER C  1 26 ? 56.800 87.107 24.978  1.00 62.29  ?  26   SER C HG   1 
ATOM   3574  N  N    . ALA C  1 27 ? 55.443 85.263 20.585  1.00 38.35  ?  27   ALA C N    1 
ATOM   3575  C  CA   . ALA C  1 27 ? 55.675 84.407 19.426  1.00 35.16  ?  27   ALA C CA   1 
ATOM   3576  C  C    . ALA C  1 27 ? 55.245 85.106 18.139  1.00 37.11  ?  27   ALA C C    1 
ATOM   3577  O  O    . ALA C  1 27 ? 55.950 85.061 17.130  1.00 38.47  ?  27   ALA C O    1 
ATOM   3578  C  CB   . ALA C  1 27 ? 54.933 83.088 19.587  1.00 32.73  ?  27   ALA C CB   1 
ATOM   3579  H  H    . ALA C  1 27 ? 54.856 84.958 21.134  1.00 46.02  ?  27   ALA C H    1 
ATOM   3580  H  HA   . ALA C  1 27 ? 56.633 84.210 19.360  1.00 42.19  ?  27   ALA C HA   1 
ATOM   3581  H  HB1  . ALA C  1 27 ? 53.993 83.266 19.667  1.00 39.27  ?  27   ALA C HB1  1 
ATOM   3582  H  HB2  . ALA C  1 27 ? 55.098 82.540 18.816  1.00 39.27  ?  27   ALA C HB2  1 
ATOM   3583  H  HB3  . ALA C  1 27 ? 55.251 82.645 20.377  1.00 39.27  ?  27   ALA C HB3  1 
ATOM   3584  N  N    . LYS C  1 28 ? 54.085 85.750 18.180  1.00 35.51  ?  28   LYS C N    1 
ATOM   3585  C  CA   . LYS C  1 28 ? 53.565 86.456 17.017  1.00 36.95  ?  28   LYS C CA   1 
ATOM   3586  C  C    . LYS C  1 28 ? 54.507 87.588 16.625  1.00 39.22  ?  28   LYS C C    1 
ATOM   3587  O  O    . LYS C  1 28 ? 54.770 87.808 15.444  1.00 37.49  ?  28   LYS C O    1 
ATOM   3588  C  CB   . LYS C  1 28 ? 52.166 87.000 17.311  1.00 41.98  ?  28   LYS C CB   1 
ATOM   3589  C  CG   . LYS C  1 28 ? 51.485 87.661 16.126  1.00 44.40  ?  28   LYS C CG   1 
ATOM   3590  C  CD   . LYS C  1 28 ? 49.992 87.824 16.376  1.00 48.03  ?  28   LYS C CD   1 
ATOM   3591  C  CE   . LYS C  1 28 ? 49.312 88.596 15.256  1.00 51.49  ?  28   LYS C CE   1 
ATOM   3592  N  NZ   . LYS C  1 28 ? 47.840 88.700 15.467  1.00 55.89  ?  28   LYS C NZ   1 
ATOM   3593  H  H    . LYS C  1 28 ? 53.578 85.794 18.873  1.00 42.61  ?  28   LYS C H    1 
ATOM   3594  H  HA   . LYS C  1 28 ? 53.501 85.833 16.263  1.00 44.34  ?  28   LYS C HA   1 
ATOM   3595  H  HB2  . LYS C  1 28 ? 51.603 86.266 17.603  1.00 50.37  ?  28   LYS C HB2  1 
ATOM   3596  H  HB3  . LYS C  1 28 ? 52.233 87.661 18.018  1.00 50.37  ?  28   LYS C HB3  1 
ATOM   3597  H  HG2  . LYS C  1 28 ? 51.869 88.540 15.983  1.00 53.27  ?  28   LYS C HG2  1 
ATOM   3598  H  HG3  . LYS C  1 28 ? 51.604 87.108 15.337  1.00 53.27  ?  28   LYS C HG3  1 
ATOM   3599  H  HD2  . LYS C  1 28 ? 49.580 86.948 16.434  1.00 57.63  ?  28   LYS C HD2  1 
ATOM   3600  H  HD3  . LYS C  1 28 ? 49.859 88.312 17.204  1.00 57.63  ?  28   LYS C HD3  1 
ATOM   3601  H  HE2  . LYS C  1 28 ? 49.677 89.494 15.219  1.00 61.79  ?  28   LYS C HE2  1 
ATOM   3602  H  HE3  . LYS C  1 28 ? 49.465 88.138 14.414  1.00 61.79  ?  28   LYS C HE3  1 
ATOM   3603  H  HZ1  . LYS C  1 28 ? 47.672 89.122 16.232  1.00 67.07  ?  28   LYS C HZ1  1 
ATOM   3604  H  HZ2  . LYS C  1 28 ? 47.469 89.155 14.798  1.00 67.07  ?  28   LYS C HZ2  1 
ATOM   3605  H  HZ3  . LYS C  1 28 ? 47.479 87.887 15.499  1.00 67.07  ?  28   LYS C HZ3  1 
ATOM   3606  N  N    . ALA C  1 29 ? 55.022 88.296 17.625  1.00 40.72  ?  29   ALA C N    1 
ATOM   3607  C  CA   . ALA C  1 29 ? 55.938 89.406 17.388  1.00 43.71  ?  29   ALA C CA   1 
ATOM   3608  C  C    . ALA C  1 29 ? 57.279 88.907 16.856  1.00 38.08  ?  29   ALA C C    1 
ATOM   3609  O  O    . ALA C  1 29 ? 57.853 89.496 15.939  1.00 36.99  ?  29   ALA C O    1 
ATOM   3610  C  CB   . ALA C  1 29 ? 56.141 90.201 18.669  1.00 49.73  ?  29   ALA C CB   1 
ATOM   3611  H  H    . ALA C  1 29 ? 54.856 88.152 18.457  1.00 48.86  ?  29   ALA C H    1 
ATOM   3612  H  HA   . ALA C  1 29 ? 55.548 90.004 16.717  1.00 52.45  ?  29   ALA C HA   1 
ATOM   3613  H  HB1  . ALA C  1 29 ? 56.509 89.623 19.340  1.00 59.67  ?  29   ALA C HB1  1 
ATOM   3614  H  HB2  . ALA C  1 29 ? 56.746 90.926 18.494  1.00 59.67  ?  29   ALA C HB2  1 
ATOM   3615  H  HB3  . ALA C  1 29 ? 55.293 90.545 18.961  1.00 59.67  ?  29   ALA C HB3  1 
ATOM   3616  N  N    . ARG C  1 30 ? 57.776 87.821 17.437  1.00 39.52  ?  30   ARG C N    1 
ATOM   3617  C  CA   . ARG C  1 30 ? 59.054 87.256 17.024  1.00 36.86  ?  30   ARG C CA   1 
ATOM   3618  C  C    . ARG C  1 30 ? 58.981 86.724 15.596  1.00 31.01  ?  30   ARG C C    1 
ATOM   3619  O  O    . ARG C  1 30 ? 59.908 86.917 14.810  1.00 29.51  ?  30   ARG C O    1 
ATOM   3620  C  CB   . ARG C  1 30 ? 59.483 86.140 17.983  1.00 36.79  ?  30   ARG C CB   1 
ATOM   3621  C  CG   . ARG C  1 30 ? 60.749 85.400 17.560  1.00 34.27  ?  30   ARG C CG   1 
ATOM   3622  C  CD   . ARG C  1 30 ? 61.931 86.342 17.402  1.00 34.96  ?  30   ARG C CD   1 
ATOM   3623  N  NE   . ARG C  1 30 ? 63.145 85.634 17.003  1.00 32.62  ?  30   ARG C NE   1 
ATOM   3624  C  CZ   . ARG C  1 30 ? 64.185 86.199 16.394  1.00 32.89  ?  30   ARG C CZ   1 
ATOM   3625  N  NH1  . ARG C  1 30 ? 64.173 87.493 16.097  1.00 36.66  ?  30   ARG C NH1  1 
ATOM   3626  N  NH2  . ARG C  1 30 ? 65.242 85.465 16.073  1.00 30.03  ?  30   ARG C NH2  1 
ATOM   3627  H  H    . ARG C  1 30 ? 57.390 87.390 18.074  1.00 47.42  ?  30   ARG C H    1 
ATOM   3628  H  HA   . ARG C  1 30 ? 59.737 87.958 17.052  1.00 44.23  ?  30   ARG C HA   1 
ATOM   3629  H  HB2  . ARG C  1 30 ? 59.645 86.527 18.857  1.00 44.15  ?  30   ARG C HB2  1 
ATOM   3630  H  HB3  . ARG C  1 30 ? 58.766 85.489 18.042  1.00 44.15  ?  30   ARG C HB3  1 
ATOM   3631  H  HG2  . ARG C  1 30 ? 60.974 84.742 18.237  1.00 41.12  ?  30   ARG C HG2  1 
ATOM   3632  H  HG3  . ARG C  1 30 ? 60.593 84.963 16.708  1.00 41.12  ?  30   ARG C HG3  1 
ATOM   3633  H  HD2  . ARG C  1 30 ? 61.726 86.999 16.718  1.00 41.95  ?  30   ARG C HD2  1 
ATOM   3634  H  HD3  . ARG C  1 30 ? 62.102 86.784 18.249  1.00 41.95  ?  30   ARG C HD3  1 
ATOM   3635  H  HE   . ARG C  1 30 ? 63.191 84.792 17.174  1.00 39.14  ?  30   ARG C HE   1 
ATOM   3636  H  HH11 . ARG C  1 30 ? 63.490 87.975 16.302  1.00 43.99  ?  30   ARG C HH11 1 
ATOM   3637  H  HH12 . ARG C  1 30 ? 64.848 87.850 15.703  1.00 43.99  ?  30   ARG C HH12 1 
ATOM   3638  H  HH21 . ARG C  1 30 ? 65.256 84.626 16.261  1.00 36.03  ?  30   ARG C HH21 1 
ATOM   3639  H  HH22 . ARG C  1 30 ? 65.914 85.829 15.678  1.00 36.03  ?  30   ARG C HH22 1 
ATOM   3640  N  N    . SER C  1 31 ? 57.880 86.057 15.260  1.00 30.35  ?  31   SER C N    1 
ATOM   3641  C  CA   . SER C  1 31 ? 57.725 85.493 13.923  1.00 27.82  ?  31   SER C CA   1 
ATOM   3642  C  C    . SER C  1 31 ? 57.509 86.585 12.875  1.00 29.52  ?  31   SER C C    1 
ATOM   3643  O  O    . SER C  1 31 ? 57.924 86.435 11.727  1.00 27.04  ?  31   SER C O    1 
ATOM   3644  C  CB   . SER C  1 31 ? 56.584 84.470 13.879  1.00 29.20  ?  31   SER C CB   1 
ATOM   3645  O  OG   . SER C  1 31 ? 55.338 85.048 14.233  1.00 33.74  ?  31   SER C OG   1 
ATOM   3646  H  H    . SER C  1 31 ? 57.213 85.918 15.784  1.00 36.42  ?  31   SER C H    1 
ATOM   3647  H  HA   . SER C  1 31 ? 58.551 85.021 13.688  1.00 33.39  ?  31   SER C HA   1 
ATOM   3648  H  HB2  . SER C  1 31 ? 56.518 84.114 12.979  1.00 35.04  ?  31   SER C HB2  1 
ATOM   3649  H  HB3  . SER C  1 31 ? 56.784 83.753 14.501  1.00 35.04  ?  31   SER C HB3  1 
ATOM   3650  H  HG   . SER C  1 31 ? 55.437 85.843 14.405  1.00 40.48  ?  31   SER C HG   1 
ATOM   3651  N  N    . ARG C  1 32 ? 56.869 87.684 13.266  1.00 29.54  ?  32   ARG C N    1 
ATOM   3652  C  CA   . ARG C  1 32 ? 56.669 88.799 12.346  1.00 32.84  ?  32   ARG C CA   1 
ATOM   3653  C  C    . ARG C  1 32 ? 58.019 89.301 11.853  1.00 33.06  ?  32   ARG C C    1 
ATOM   3654  O  O    . ARG C  1 32 ? 58.204 89.557 10.664  1.00 31.75  ?  32   ARG C O    1 
ATOM   3655  C  CB   . ARG C  1 32 ? 55.909 89.943 13.017  1.00 38.62  ?  32   ARG C CB   1 
ATOM   3656  C  CG   . ARG C  1 32 ? 56.149 91.296 12.356  1.00 43.17  ?  32   ARG C CG   1 
ATOM   3657  C  CD   . ARG C  1 32 ? 55.291 92.391 12.966  1.00 50.14  ?  32   ARG C CD   1 
ATOM   3658  N  NE   . ARG C  1 32 ? 53.891 92.277 12.570  1.00 53.02  ?  32   ARG C NE   1 
ATOM   3659  C  CZ   . ARG C  1 32 ? 53.400 92.705 11.409  1.00 54.97  ?  32   ARG C CZ   1 
ATOM   3660  N  NH1  . ARG C  1 32 ? 54.193 93.274 10.509  1.00 56.37  ?  32   ARG C NH1  1 
ATOM   3661  N  NH2  . ARG C  1 32 ? 52.110 92.556 11.141  1.00 55.14  ?  32   ARG C NH2  1 
ATOM   3662  H  H    . ARG C  1 32 ? 56.543 87.808 14.052  1.00 35.45  ?  32   ARG C H    1 
ATOM   3663  H  HA   . ARG C  1 32 ? 56.150 88.494 11.573  1.00 39.41  ?  32   ARG C HA   1 
ATOM   3664  H  HB2  . ARG C  1 32 ? 54.958 89.755 12.977  1.00 46.35  ?  32   ARG C HB2  1 
ATOM   3665  H  HB3  . ARG C  1 32 ? 56.193 90.009 13.943  1.00 46.35  ?  32   ARG C HB3  1 
ATOM   3666  H  HG2  . ARG C  1 32 ? 57.080 91.544 12.468  1.00 51.81  ?  32   ARG C HG2  1 
ATOM   3667  H  HG3  . ARG C  1 32 ? 55.931 91.232 11.413  1.00 51.81  ?  32   ARG C HG3  1 
ATOM   3668  H  HD2  . ARG C  1 32 ? 55.337 92.330 13.933  1.00 60.17  ?  32   ARG C HD2  1 
ATOM   3669  H  HD3  . ARG C  1 32 ? 55.620 93.254 12.671  1.00 60.17  ?  32   ARG C HD3  1 
ATOM   3670  H  HE   . ARG C  1 32 ? 53.346 91.908 13.124  1.00 63.62  ?  32   ARG C HE   1 
ATOM   3671  H  HH11 . ARG C  1 32 ? 55.031 93.373 10.677  1.00 67.65  ?  32   ARG C HH11 1 
ATOM   3672  H  HH12 . ARG C  1 32 ? 53.869 93.547 9.761   1.00 67.65  ?  32   ARG C HH12 1 
ATOM   3673  H  HH21 . ARG C  1 32 ? 51.591 92.187 11.718  1.00 66.17  ?  32   ARG C HH21 1 
ATOM   3674  H  HH22 . ARG C  1 32 ? 51.793 92.831 10.390  1.00 66.17  ?  32   ARG C HH22 1 
ATOM   3675  N  N    . THR C  1 33 ? 58.960 89.434 12.778  1.00 36.23  ?  33   THR C N    1 
ATOM   3676  C  CA   . THR C  1 33 ? 60.293 89.919 12.453  1.00 37.67  ?  33   THR C CA   1 
ATOM   3677  C  C    . THR C  1 33 ? 60.965 88.998 11.440  1.00 32.80  ?  33   THR C C    1 
ATOM   3678  O  O    . THR C  1 33 ? 61.477 89.451 10.417  1.00 33.52  ?  33   THR C O    1 
ATOM   3679  C  CB   . THR C  1 33 ? 61.177 90.010 13.714  1.00 40.64  ?  33   THR C CB   1 
ATOM   3680  O  OG1  . THR C  1 33 ? 60.590 90.923 14.651  1.00 45.66  ?  33   THR C OG1  1 
ATOM   3681  C  CG2  . THR C  1 33 ? 62.577 90.491 13.357  1.00 40.80  ?  33   THR C CG2  1 
ATOM   3682  H  H    . THR C  1 33 ? 58.850 89.249 13.611  1.00 43.47  ?  33   THR C H    1 
ATOM   3683  H  HA   . THR C  1 33 ? 60.226 90.814 12.058  1.00 45.20  ?  33   THR C HA   1 
ATOM   3684  H  HB   . THR C  1 33 ? 61.249 89.133 14.121  1.00 48.77  ?  33   THR C HB   1 
ATOM   3685  H  HG1  . THR C  1 33 ? 59.842 90.663 14.866  1.00 54.80  ?  33   THR C HG1  1 
ATOM   3686  H  HG21 . THR C  1 33 ? 62.532 91.360 12.952  1.00 48.97  ?  33   THR C HG21 1 
ATOM   3687  H  HG22 . THR C  1 33 ? 63.117 90.544 14.149  1.00 48.97  ?  33   THR C HG22 1 
ATOM   3688  H  HG23 . THR C  1 33 ? 62.986 89.880 12.741  1.00 48.97  ?  33   THR C HG23 1 
ATOM   3689  N  N    . LEU C  1 34 ? 60.951 87.702 11.731  1.00 33.58  ?  34   LEU C N    1 
ATOM   3690  C  CA   . LEU C  1 34 ? 61.622 86.716 10.891  1.00 28.23  ?  34   LEU C CA   1 
ATOM   3691  C  C    . LEU C  1 34 ? 60.981 86.605 9.511   1.00 27.33  ?  34   LEU C C    1 
ATOM   3692  O  O    . LEU C  1 34 ? 61.675 86.415 8.514   1.00 27.58  ?  34   LEU C O    1 
ATOM   3693  C  CB   . LEU C  1 34 ? 61.622 85.355 11.586  1.00 25.10  ?  34   LEU C CB   1 
ATOM   3694  C  CG   . LEU C  1 34 ? 62.430 85.338 12.884  1.00 26.26  ?  34   LEU C CG   1 
ATOM   3695  C  CD1  . LEU C  1 34 ? 62.073 84.129 13.734  1.00 24.84  ?  34   LEU C CD1  1 
ATOM   3696  C  CD2  . LEU C  1 34 ? 63.919 85.359 12.575  1.00 27.25  ?  34   LEU C CD2  1 
ATOM   3697  H  H    . LEU C  1 34 ? 60.557 87.364 12.417  1.00 40.30  ?  34   LEU C H    1 
ATOM   3698  H  HA   . LEU C  1 34 ? 62.555 86.990 10.767  1.00 33.87  ?  34   LEU C HA   1 
ATOM   3699  H  HB2  . LEU C  1 34 ? 60.707 85.113 11.801  1.00 30.12  ?  34   LEU C HB2  1 
ATOM   3700  H  HB3  . LEU C  1 34 ? 62.006 84.697 10.987  1.00 30.12  ?  34   LEU C HB3  1 
ATOM   3701  H  HG   . LEU C  1 34 ? 62.220 86.134 13.396  1.00 31.51  ?  34   LEU C HG   1 
ATOM   3702  H  HD11 . LEU C  1 34 ? 62.265 83.330 13.237  1.00 29.81  ?  34   LEU C HD11 1 
ATOM   3703  H  HD12 . LEU C  1 34 ? 62.596 84.147 14.539  1.00 29.81  ?  34   LEU C HD12 1 
ATOM   3704  H  HD13 . LEU C  1 34 ? 61.138 84.164 13.949  1.00 29.81  ?  34   LEU C HD13 1 
ATOM   3705  H  HD21 . LEU C  1 34 ? 64.124 86.158 12.083  1.00 32.70  ?  34   LEU C HD21 1 
ATOM   3706  H  HD22 . LEU C  1 34 ? 64.409 85.348 13.401  1.00 32.70  ?  34   LEU C HD22 1 
ATOM   3707  H  HD23 . LEU C  1 34 ? 64.140 84.586 12.052  1.00 32.70  ?  34   LEU C HD23 1 
ATOM   3708  N  N    . GLN C  1 35 ? 59.659 86.723 9.454   1.00 26.24  ?  35   GLN C N    1 
ATOM   3709  C  CA   . GLN C  1 35 ? 58.952 86.679 8.179   1.00 25.14  ?  35   GLN C CA   1 
ATOM   3710  C  C    . GLN C  1 35 ? 59.252 87.922 7.345   1.00 28.03  ?  35   GLN C C    1 
ATOM   3711  O  O    . GLN C  1 35 ? 59.418 87.837 6.131   1.00 25.31  ?  35   GLN C O    1 
ATOM   3712  C  CB   . GLN C  1 35 ? 57.446 86.556 8.402   1.00 26.17  ?  35   GLN C CB   1 
ATOM   3713  C  CG   . GLN C  1 35 ? 57.015 85.224 8.989   1.00 24.43  ?  35   GLN C CG   1 
ATOM   3714  C  CD   . GLN C  1 35 ? 55.527 85.169 9.254   1.00 26.25  ?  35   GLN C CD   1 
ATOM   3715  O  OE1  . GLN C  1 35 ? 54.728 85.013 8.331   1.00 25.59  ?  35   GLN C OE1  1 
ATOM   3716  N  NE2  . GLN C  1 35 ? 55.144 85.308 10.518  1.00 29.61  ?  35   GLN C NE2  1 
ATOM   3717  H  H    . GLN C  1 35 ? 59.148 86.830 10.137  1.00 31.49  ?  35   GLN C H    1 
ATOM   3718  H  HA   . GLN C  1 35 ? 59.251 85.894 7.674   1.00 30.17  ?  35   GLN C HA   1 
ATOM   3719  H  HB2  . GLN C  1 35 ? 57.163 87.254 9.013   1.00 31.40  ?  35   GLN C HB2  1 
ATOM   3720  H  HB3  . GLN C  1 35 ? 56.995 86.664 7.550   1.00 31.40  ?  35   GLN C HB3  1 
ATOM   3721  H  HG2  . GLN C  1 35 ? 57.237 84.516 8.364   1.00 29.32  ?  35   GLN C HG2  1 
ATOM   3722  H  HG3  . GLN C  1 35 ? 57.477 85.084 9.830   1.00 29.32  ?  35   GLN C HG3  1 
ATOM   3723  H  HE21 . GLN C  1 35 ? 55.732 85.422 11.136  1.00 35.53  ?  35   GLN C HE21 1 
ATOM   3724  H  HE22 . GLN C  1 35 ? 54.308 85.283 10.719  1.00 35.53  ?  35   GLN C HE22 1 
ATOM   3725  N  N    . GLU C  1 36 ? 59.319 89.076 8.000   1.00 29.77  ?  36   GLU C N    1 
ATOM   3726  C  CA   . GLU C  1 36 ? 59.623 90.321 7.307   1.00 35.53  ?  36   GLU C CA   1 
ATOM   3727  C  C    . GLU C  1 36 ? 61.033 90.285 6.724   1.00 35.06  ?  36   GLU C C    1 
ATOM   3728  O  O    . GLU C  1 36 ? 61.264 90.763 5.613   1.00 31.91  ?  36   GLU C O    1 
ATOM   3729  C  CB   . GLU C  1 36 ? 59.466 91.515 8.253   1.00 42.44  ?  36   GLU C CB   1 
ATOM   3730  C  CG   . GLU C  1 36 ? 58.016 91.886 8.541   1.00 47.47  ?  36   GLU C CG   1 
ATOM   3731  C  CD   . GLU C  1 36 ? 57.883 92.995 9.571   1.00 53.37  ?  36   GLU C CD   1 
ATOM   3732  O  OE1  . GLU C  1 36 ? 58.863 93.259 10.301  1.00 54.16  ?  36   GLU C OE1  1 
ATOM   3733  O  OE2  . GLU C  1 36 ? 56.795 93.605 9.648   1.00 56.95  ?  36   GLU C OE2  1 
ATOM   3734  H  H    . GLU C  1 36 ? 59.192 89.164 8.846   1.00 35.73  ?  36   GLU C H    1 
ATOM   3735  H  HA   . GLU C  1 36 ? 58.992 90.436 6.567   1.00 42.64  ?  36   GLU C HA   1 
ATOM   3736  H  HB2  . GLU C  1 36 ? 59.892 91.303 9.098   1.00 50.93  ?  36   GLU C HB2  1 
ATOM   3737  H  HB3  . GLU C  1 36 ? 59.896 92.288 7.854   1.00 50.93  ?  36   GLU C HB3  1 
ATOM   3738  H  HG2  . GLU C  1 36 ? 57.599 92.189 7.719   1.00 56.97  ?  36   GLU C HG2  1 
ATOM   3739  H  HG3  . GLU C  1 36 ? 57.552 91.105 8.880   1.00 56.97  ?  36   GLU C HG3  1 
ATOM   3740  N  N    . GLN C  1 37 ? 61.968 89.710 7.473   1.00 36.50  ?  37   GLN C N    1 
ATOM   3741  C  CA   . GLN C  1 37 ? 63.356 89.617 7.032   1.00 40.04  ?  37   GLN C CA   1 
ATOM   3742  C  C    . GLN C  1 37 ? 63.564 88.499 6.006   1.00 36.74  ?  37   GLN C C    1 
ATOM   3743  O  O    . GLN C  1 37 ? 64.601 88.443 5.346   1.00 38.72  ?  37   GLN C O    1 
ATOM   3744  C  CB   . GLN C  1 37 ? 64.282 89.412 8.233   1.00 44.31  ?  37   GLN C CB   1 
ATOM   3745  C  CG   . GLN C  1 37 ? 64.342 90.608 9.170   1.00 51.64  ?  37   GLN C CG   1 
ATOM   3746  C  CD   . GLN C  1 37 ? 65.191 90.348 10.401  1.00 57.86  ?  37   GLN C CD   1 
ATOM   3747  O  OE1  . GLN C  1 37 ? 65.672 89.234 10.616  1.00 58.59  ?  37   GLN C OE1  1 
ATOM   3748  N  NE2  . GLN C  1 37 ? 65.378 91.379 11.217  1.00 61.82  ?  37   GLN C NE2  1 
ATOM   3749  H  H    . GLN C  1 37 ? 61.824 89.363 8.247   1.00 43.80  ?  37   GLN C H    1 
ATOM   3750  H  HA   . GLN C  1 37 ? 63.607 90.463 6.604   1.00 48.05  ?  37   GLN C HA   1 
ATOM   3751  H  HB2  . GLN C  1 37 ? 63.967 88.650 8.744   1.00 53.17  ?  37   GLN C HB2  1 
ATOM   3752  H  HB3  . GLN C  1 37 ? 65.181 89.242 7.909   1.00 53.17  ?  37   GLN C HB3  1 
ATOM   3753  H  HG2  . GLN C  1 37 ? 64.724 91.363 8.695   1.00 61.97  ?  37   GLN C HG2  1 
ATOM   3754  H  HG3  . GLN C  1 37 ? 63.443 90.823 9.466   1.00 61.97  ?  37   GLN C HG3  1 
ATOM   3755  H  HE21 . GLN C  1 37 ? 65.025 92.141 11.034  1.00 74.18  ?  37   GLN C HE21 1 
ATOM   3756  H  HE22 . GLN C  1 37 ? 65.852 91.283 11.928  1.00 74.18  ?  37   GLN C HE22 1 
ATOM   3757  N  N    . GLY C  1 38 ? 62.584 87.608 5.883   1.00 32.81  ?  38   GLY C N    1 
ATOM   3758  C  CA   . GLY C  1 38 ? 62.604 86.595 4.841   1.00 29.37  ?  38   GLY C CA   1 
ATOM   3759  C  C    . GLY C  1 38 ? 63.070 85.212 5.267   1.00 28.46  ?  38   GLY C C    1 
ATOM   3760  O  O    . GLY C  1 38 ? 62.905 84.249 4.517   1.00 27.63  ?  38   GLY C O    1 
ATOM   3761  H  H    . GLY C  1 38 ? 61.894 87.571 6.395   1.00 39.37  ?  38   GLY C H    1 
ATOM   3762  H  HA2  . GLY C  1 38 ? 61.710 86.506 4.476   1.00 35.25  ?  38   GLY C HA2  1 
ATOM   3763  H  HA3  . GLY C  1 38 ? 63.188 86.896 4.126   1.00 35.25  ?  38   GLY C HA3  1 
ATOM   3764  N  N    . GLN C  1 39 ? 63.651 85.100 6.457   1.00 28.36  ?  39   GLN C N    1 
ATOM   3765  C  CA   . GLN C  1 39 ? 64.149 83.810 6.933   1.00 30.04  ?  39   GLN C CA   1 
ATOM   3766  C  C    . GLN C  1 39 ? 63.010 82.823 7.168   1.00 25.72  ?  39   GLN C C    1 
ATOM   3767  O  O    . GLN C  1 39 ? 63.162 81.624 6.941   1.00 27.28  ?  39   GLN C O    1 
ATOM   3768  C  CB   . GLN C  1 39 ? 64.968 83.975 8.214   1.00 34.32  ?  39   GLN C CB   1 
ATOM   3769  C  CG   . GLN C  1 39 ? 66.326 84.626 8.004   1.00 39.50  ?  39   GLN C CG   1 
ATOM   3770  C  CD   . GLN C  1 39 ? 66.296 86.129 8.201   1.00 44.17  ?  39   GLN C CD   1 
ATOM   3771  O  OE1  . GLN C  1 39 ? 65.392 86.664 8.845   1.00 44.37  ?  39   GLN C OE1  1 
ATOM   3772  N  NE2  . GLN C  1 39 ? 67.288 86.818 7.648   1.00 47.65  ?  39   GLN C NE2  1 
ATOM   3773  H  H    . GLN C  1 39 ? 63.769 85.750 7.007   1.00 34.03  ?  39   GLN C H    1 
ATOM   3774  H  HA   . GLN C  1 39 ? 64.738 83.429 6.248   1.00 36.05  ?  39   GLN C HA   1 
ATOM   3775  H  HB2  . GLN C  1 39 ? 64.468 84.528 8.834   1.00 41.19  ?  39   GLN C HB2  1 
ATOM   3776  H  HB3  . GLN C  1 39 ? 65.117 83.099 8.603   1.00 41.19  ?  39   GLN C HB3  1 
ATOM   3777  H  HG2  . GLN C  1 39 ? 66.957 84.253 8.640   1.00 47.40  ?  39   GLN C HG2  1 
ATOM   3778  H  HG3  . GLN C  1 39 ? 66.625 84.449 7.098   1.00 47.40  ?  39   GLN C HG3  1 
ATOM   3779  H  HE21 . GLN C  1 39 ? 67.903 86.409 7.206   1.00 57.18  ?  39   GLN C HE21 1 
ATOM   3780  H  HE22 . GLN C  1 39 ? 67.316 87.674 7.731   1.00 57.18  ?  39   GLN C HE22 1 
ATOM   3781  N  N    . TRP C  1 40 ? 61.876 83.332 7.636   1.00 22.55  ?  40   TRP C N    1 
ATOM   3782  C  CA   . TRP C  1 40 ? 60.677 82.521 7.804   1.00 20.15  ?  40   TRP C CA   1 
ATOM   3783  C  C    . TRP C  1 40 ? 59.810 82.710 6.562   1.00 21.28  ?  40   TRP C C    1 
ATOM   3784  O  O    . TRP C  1 40 ? 58.935 83.575 6.534   1.00 20.90  ?  40   TRP C O    1 
ATOM   3785  C  CB   . TRP C  1 40 ? 59.929 82.959 9.067   1.00 20.92  ?  40   TRP C CB   1 
ATOM   3786  C  CG   . TRP C  1 40 ? 58.993 81.932 9.635   1.00 21.34  ?  40   TRP C CG   1 
ATOM   3787  C  CD1  . TRP C  1 40 ? 58.217 81.049 8.942   1.00 21.74  ?  40   TRP C CD1  1 
ATOM   3788  C  CD2  . TRP C  1 40 ? 58.739 81.684 11.026  1.00 21.56  ?  40   TRP C CD2  1 
ATOM   3789  N  NE1  . TRP C  1 40 ? 57.492 80.270 9.814   1.00 21.31  ?  40   TRP C NE1  1 
ATOM   3790  C  CE2  . TRP C  1 40 ? 57.798 80.638 11.099  1.00 22.25  ?  40   TRP C CE2  1 
ATOM   3791  C  CE3  . TRP C  1 40 ? 59.218 82.244 12.214  1.00 21.03  ?  40   TRP C CE3  1 
ATOM   3792  C  CZ2  . TRP C  1 40 ? 57.327 80.140 12.313  1.00 22.94  ?  40   TRP C CZ2  1 
ATOM   3793  C  CZ3  . TRP C  1 40 ? 58.751 81.749 13.417  1.00 21.78  ?  40   TRP C CZ3  1 
ATOM   3794  C  CH2  . TRP C  1 40 ? 57.815 80.707 13.458  1.00 23.04  ?  40   TRP C CH2  1 
ATOM   3795  H  H    . TRP C  1 40 ? 61.774 84.154 7.866   1.00 27.06  ?  40   TRP C H    1 
ATOM   3796  H  HA   . TRP C  1 40 ? 60.918 81.575 7.885   1.00 24.18  ?  40   TRP C HA   1 
ATOM   3797  H  HB2  . TRP C  1 40 ? 60.580 83.173 9.753   1.00 25.10  ?  40   TRP C HB2  1 
ATOM   3798  H  HB3  . TRP C  1 40 ? 59.405 83.748 8.858   1.00 25.10  ?  40   TRP C HB3  1 
ATOM   3799  H  HD1  . TRP C  1 40 ? 58.178 80.988 8.015   1.00 26.08  ?  40   TRP C HD1  1 
ATOM   3800  H  HE1  . TRP C  1 40 ? 56.941 79.649 9.590   1.00 25.57  ?  40   TRP C HE1  1 
ATOM   3801  H  HE3  . TRP C  1 40 ? 59.841 82.934 12.195  1.00 25.24  ?  40   TRP C HE3  1 
ATOM   3802  H  HZ2  . TRP C  1 40 ? 56.705 79.449 12.343  1.00 27.52  ?  40   TRP C HZ2  1 
ATOM   3803  H  HZ3  . TRP C  1 40 ? 59.063 82.115 14.213  1.00 26.13  ?  40   TRP C HZ3  1 
ATOM   3804  H  HH2  . TRP C  1 40 ? 57.516 80.396 14.282  1.00 27.65  ?  40   TRP C HH2  1 
ATOM   3805  N  N    . ARG C  1 41 ? 60.064 81.904 5.534   1.00 23.27  ?  41   ARG C N    1 
ATOM   3806  C  CA   . ARG C  1 41 ? 59.469 82.132 4.217   1.00 26.02  ?  41   ARG C CA   1 
ATOM   3807  C  C    . ARG C  1 41 ? 57.968 81.855 4.191   1.00 24.90  ?  41   ARG C C    1 
ATOM   3808  O  O    . ARG C  1 41 ? 57.183 82.715 3.793   1.00 25.62  ?  41   ARG C O    1 
ATOM   3809  C  CB   . ARG C  1 41 ? 60.172 81.289 3.149   1.00 27.90  ?  41   ARG C CB   1 
ATOM   3810  C  CG   . ARG C  1 41 ? 59.621 81.508 1.744   1.00 31.69  ?  41   ARG C CG   1 
ATOM   3811  C  CD   . ARG C  1 41 ? 60.269 80.583 0.723   1.00 36.75  ?  41   ARG C CD   1 
ATOM   3812  N  NE   . ARG C  1 41 ? 61.526 81.119 0.213   1.00 41.42  ?  41   ARG C NE   1 
ATOM   3813  C  CZ   . ARG C  1 41 ? 61.656 81.816 -0.913  1.00 45.39  ?  41   ARG C CZ   1 
ATOM   3814  N  NH1  . ARG C  1 41 ? 60.605 82.074 -1.682  1.00 46.61  ?  41   ARG C NH1  1 
ATOM   3815  N  NH2  . ARG C  1 41 ? 62.850 82.257 -1.278  1.00 46.33  ?  41   ARG C NH2  1 
ATOM   3816  H  H    . ARG C  1 41 ? 60.578 81.215 5.572   1.00 27.93  ?  41   ARG C H    1 
ATOM   3817  H  HA   . ARG C  1 41 ? 59.598 83.074 3.979   1.00 31.22  ?  41   ARG C HA   1 
ATOM   3818  H  HB2  . ARG C  1 41 ? 61.114 81.517 3.138   1.00 33.48  ?  41   ARG C HB2  1 
ATOM   3819  H  HB3  . ARG C  1 41 ? 60.062 80.350 3.368   1.00 33.48  ?  41   ARG C HB3  1 
ATOM   3820  H  HG2  . ARG C  1 41 ? 58.667 81.335 1.746   1.00 38.03  ?  41   ARG C HG2  1 
ATOM   3821  H  HG3  . ARG C  1 41 ? 59.794 82.424 1.474   1.00 38.03  ?  41   ARG C HG3  1 
ATOM   3822  H  HD2  . ARG C  1 41 ? 60.453 79.728 1.141   1.00 44.10  ?  41   ARG C HD2  1 
ATOM   3823  H  HD3  . ARG C  1 41 ? 59.665 80.466 -0.027  1.00 44.10  ?  41   ARG C HD3  1 
ATOM   3824  H  HE   . ARG C  1 41 ? 62.237 80.974 0.675   1.00 49.71  ?  41   ARG C HE   1 
ATOM   3825  H  HH11 . ARG C  1 41 ? 59.825 81.792 -1.453  1.00 55.93  ?  41   ARG C HH11 1 
ATOM   3826  H  HH12 . ARG C  1 41 ? 60.703 82.524 -2.408  1.00 55.93  ?  41   ARG C HH12 1 
ATOM   3827  H  HH21 . ARG C  1 41 ? 63.537 82.093 -0.787  1.00 55.59  ?  41   ARG C HH21 1 
ATOM   3828  H  HH22 . ARG C  1 41 ? 62.939 82.706 -2.007  1.00 55.59  ?  41   ARG C HH22 1 
ATOM   3829  N  N    . TYR C  1 42 ? 57.571 80.653 4.599   1.00 24.72  ?  42   TYR C N    1 
ATOM   3830  C  CA   . TYR C  1 42 ? 56.157 80.302 4.641   1.00 23.49  ?  42   TYR C CA   1 
ATOM   3831  C  C    . TYR C  1 42 ? 55.750 79.830 6.029   1.00 24.37  ?  42   TYR C C    1 
ATOM   3832  O  O    . TYR C  1 42 ? 56.560 79.285 6.780   1.00 24.37  ?  42   TYR C O    1 
ATOM   3833  C  CB   . TYR C  1 42 ? 55.828 79.226 3.604   1.00 23.82  ?  42   TYR C CB   1 
ATOM   3834  C  CG   . TYR C  1 42 ? 56.176 79.627 2.192   1.00 25.73  ?  42   TYR C CG   1 
ATOM   3835  C  CD1  . TYR C  1 42 ? 55.665 80.792 1.637   1.00 25.50  ?  42   TYR C CD1  1 
ATOM   3836  C  CD2  . TYR C  1 42 ? 57.014 78.842 1.411   1.00 27.96  ?  42   TYR C CD2  1 
ATOM   3837  C  CE1  . TYR C  1 42 ? 55.984 81.168 0.347   1.00 26.17  ?  42   TYR C CE1  1 
ATOM   3838  C  CE2  . TYR C  1 42 ? 57.335 79.207 0.118   1.00 29.10  ?  42   TYR C CE2  1 
ATOM   3839  C  CZ   . TYR C  1 42 ? 56.817 80.372 -0.409  1.00 28.13  ?  42   TYR C CZ   1 
ATOM   3840  O  OH   . TYR C  1 42 ? 57.136 80.743 -1.694  1.00 29.56  ?  42   TYR C OH   1 
ATOM   3841  H  H    . TYR C  1 42 ? 58.100 80.025 4.855   1.00 29.66  ?  42   TYR C H    1 
ATOM   3842  H  HA   . TYR C  1 42 ? 55.627 81.098 4.427   1.00 28.18  ?  42   TYR C HA   1 
ATOM   3843  H  HB2  . TYR C  1 42 ? 56.327 78.422 3.816   1.00 28.59  ?  42   TYR C HB2  1 
ATOM   3844  H  HB3  . TYR C  1 42 ? 54.876 79.041 3.635   1.00 28.59  ?  42   TYR C HB3  1 
ATOM   3845  H  HD1  . TYR C  1 42 ? 55.104 81.332 2.145   1.00 30.60  ?  42   TYR C HD1  1 
ATOM   3846  H  HD2  . TYR C  1 42 ? 57.365 78.057 1.765   1.00 33.56  ?  42   TYR C HD2  1 
ATOM   3847  H  HE1  . TYR C  1 42 ? 55.634 81.952 -0.012  1.00 31.40  ?  42   TYR C HE1  1 
ATOM   3848  H  HE2  . TYR C  1 42 ? 57.899 78.673 -0.393  1.00 34.92  ?  42   TYR C HE2  1 
ATOM   3849  H  HH   . TYR C  1 42 ? 56.889 80.167 -2.222  1.00 35.47  ?  42   TYR C HH   1 
ATOM   3850  N  N    . LEU C  1 43 ? 54.483 80.050 6.357   1.00 24.16  ?  43   LEU C N    1 
ATOM   3851  C  CA   . LEU C  1 43 ? 53.941 79.674 7.650   1.00 24.73  ?  43   LEU C CA   1 
ATOM   3852  C  C    . LEU C  1 43 ? 52.470 79.323 7.499   1.00 24.18  ?  43   LEU C C    1 
ATOM   3853  O  O    . LEU C  1 43 ? 51.653 80.179 7.159   1.00 27.13  ?  43   LEU C O    1 
ATOM   3854  C  CB   . LEU C  1 43 ? 54.102 80.825 8.643   1.00 24.59  ?  43   LEU C CB   1 
ATOM   3855  C  CG   . LEU C  1 43 ? 53.424 80.656 10.005  1.00 25.57  ?  43   LEU C CG   1 
ATOM   3856  C  CD1  . LEU C  1 43 ? 53.902 79.391 10.703  1.00 25.67  ?  43   LEU C CD1  1 
ATOM   3857  C  CD2  . LEU C  1 43 ? 53.684 81.876 10.871  1.00 26.12  ?  43   LEU C CD2  1 
ATOM   3858  H  H    . LEU C  1 43 ? 53.909 80.422 5.836   1.00 28.99  ?  43   LEU C H    1 
ATOM   3859  H  HA   . LEU C  1 43 ? 54.419 78.891 7.995   1.00 29.68  ?  43   LEU C HA   1 
ATOM   3860  H  HB2  . LEU C  1 43 ? 55.050 80.952 8.809   1.00 29.51  ?  43   LEU C HB2  1 
ATOM   3861  H  HB3  . LEU C  1 43 ? 53.737 81.628 8.239   1.00 29.51  ?  43   LEU C HB3  1 
ATOM   3862  H  HG   . LEU C  1 43 ? 52.465 80.581 9.873   1.00 30.69  ?  43   LEU C HG   1 
ATOM   3863  H  HD11 . LEU C  1 43 ? 54.851 79.447 10.834  1.00 30.80  ?  43   LEU C HD11 1 
ATOM   3864  H  HD12 . LEU C  1 43 ? 53.458 79.316 11.551  1.00 30.80  ?  43   LEU C HD12 1 
ATOM   3865  H  HD13 . LEU C  1 43 ? 53.691 78.632 10.154  1.00 30.80  ?  43   LEU C HD13 1 
ATOM   3866  H  HD21 . LEU C  1 43 ? 53.329 82.652 10.431  1.00 31.34  ?  43   LEU C HD21 1 
ATOM   3867  H  HD22 . LEU C  1 43 ? 53.252 81.754 11.720  1.00 31.34  ?  43   LEU C HD22 1 
ATOM   3868  H  HD23 . LEU C  1 43 ? 54.630 81.974 10.995  1.00 31.34  ?  43   LEU C HD23 1 
ATOM   3869  N  N    . TRP C  1 44 ? 52.139 78.060 7.746   1.00 21.73  ?  44   TRP C N    1 
ATOM   3870  C  CA   . TRP C  1 44 ? 50.758 77.605 7.681   1.00 19.98  ?  44   TRP C CA   1 
ATOM   3871  C  C    . TRP C  1 44 ? 50.354 76.928 8.978   1.00 21.75  ?  44   TRP C C    1 
ATOM   3872  O  O    . TRP C  1 44 ? 51.189 76.367 9.686   1.00 20.33  ?  44   TRP C O    1 
ATOM   3873  C  CB   . TRP C  1 44 ? 50.567 76.623 6.526   1.00 20.10  ?  44   TRP C CB   1 
ATOM   3874  C  CG   . TRP C  1 44 ? 50.933 77.185 5.199   1.00 22.03  ?  44   TRP C CG   1 
ATOM   3875  C  CD1  . TRP C  1 44 ? 50.273 78.163 4.511   1.00 25.23  ?  44   TRP C CD1  1 
ATOM   3876  C  CD2  . TRP C  1 44 ? 52.045 76.800 4.383   1.00 22.33  ?  44   TRP C CD2  1 
ATOM   3877  N  NE1  . TRP C  1 44 ? 50.911 78.414 3.320   1.00 25.30  ?  44   TRP C NE1  1 
ATOM   3878  C  CE2  . TRP C  1 44 ? 51.999 77.589 3.217   1.00 22.89  ?  44   TRP C CE2  1 
ATOM   3879  C  CE3  . TRP C  1 44 ? 53.075 75.867 4.527   1.00 21.85  ?  44   TRP C CE3  1 
ATOM   3880  C  CZ2  . TRP C  1 44 ? 52.944 77.473 2.203   1.00 21.67  ?  44   TRP C CZ2  1 
ATOM   3881  C  CZ3  . TRP C  1 44 ? 54.009 75.753 3.519   1.00 22.04  ?  44   TRP C CZ3  1 
ATOM   3882  C  CH2  . TRP C  1 44 ? 53.940 76.552 2.373   1.00 21.60  ?  44   TRP C CH2  1 
ATOM   3883  H  H    . TRP C  1 44 ? 52.701 77.443 7.954   1.00 26.08  ?  44   TRP C H    1 
ATOM   3884  H  HA   . TRP C  1 44 ? 50.168 78.374 7.535   1.00 23.98  ?  44   TRP C HA   1 
ATOM   3885  H  HB2  . TRP C  1 44 ? 51.124 75.844 6.683   1.00 24.12  ?  44   TRP C HB2  1 
ATOM   3886  H  HB3  . TRP C  1 44 ? 49.634 76.359 6.491   1.00 24.12  ?  44   TRP C HB3  1 
ATOM   3887  H  HD1  . TRP C  1 44 ? 49.507 78.599 4.807   1.00 30.28  ?  44   TRP C HD1  1 
ATOM   3888  H  HE1  . TRP C  1 44 ? 50.665 78.992 2.733   1.00 30.36  ?  44   TRP C HE1  1 
ATOM   3889  H  HE3  . TRP C  1 44 ? 53.128 75.333 5.287   1.00 26.22  ?  44   TRP C HE3  1 
ATOM   3890  H  HZ2  . TRP C  1 44 ? 52.901 78.002 1.439   1.00 26.00  ?  44   TRP C HZ2  1 
ATOM   3891  H  HZ3  . TRP C  1 44 ? 54.699 75.136 3.604   1.00 26.45  ?  44   TRP C HZ3  1 
ATOM   3892  H  HH2  . TRP C  1 44 ? 54.584 76.453 1.710   1.00 25.91  ?  44   TRP C HH2  1 
ATOM   3893  N  N    . ARG C  1 45 ? 49.064 76.985 9.283   1.00 22.61  ?  45   ARG C N    1 
ATOM   3894  C  CA   . ARG C  1 45 ? 48.518 76.278 10.429  1.00 24.47  ?  45   ARG C CA   1 
ATOM   3895  C  C    . ARG C  1 45 ? 48.235 74.834 10.044  1.00 23.62  ?  45   ARG C C    1 
ATOM   3896  O  O    . ARG C  1 45 ? 47.722 74.565 8.959   1.00 25.21  ?  45   ARG C O    1 
ATOM   3897  C  CB   . ARG C  1 45 ? 47.227 76.950 10.895  1.00 25.43  ?  45   ARG C CB   1 
ATOM   3898  C  CG   . ARG C  1 45 ? 46.461 76.169 11.958  1.00 27.38  ?  45   ARG C CG   1 
ATOM   3899  C  CD   . ARG C  1 45 ? 47.182 76.209 13.291  1.00 27.85  ?  45   ARG C CD   1 
ATOM   3900  N  NE   . ARG C  1 45 ? 46.997 77.490 13.966  1.00 28.23  ?  45   ARG C NE   1 
ATOM   3901  C  CZ   . ARG C  1 45 ? 47.811 77.979 14.898  1.00 29.33  ?  45   ARG C CZ   1 
ATOM   3902  N  NH1  . ARG C  1 45 ? 48.888 77.304 15.275  1.00 30.49  ?  45   ARG C NH1  1 
ATOM   3903  N  NH2  . ARG C  1 45 ? 47.548 79.155 15.451  1.00 29.04  ?  45   ARG C NH2  1 
ATOM   3904  H  H    . ARG C  1 45 ? 48.479 77.431 8.836   1.00 27.13  ?  45   ARG C H    1 
ATOM   3905  H  HA   . ARG C  1 45 ? 49.165 76.289 11.166  1.00 29.36  ?  45   ARG C HA   1 
ATOM   3906  H  HB2  . ARG C  1 45 ? 47.445 77.819 11.268  1.00 30.51  ?  45   ARG C HB2  1 
ATOM   3907  H  HB3  . ARG C  1 45 ? 46.640 77.061 10.131  1.00 30.51  ?  45   ARG C HB3  1 
ATOM   3908  H  HG2  . ARG C  1 45 ? 45.582 76.562 12.074  1.00 32.85  ?  45   ARG C HG2  1 
ATOM   3909  H  HG3  . ARG C  1 45 ? 46.383 75.243 11.681  1.00 32.85  ?  45   ARG C HG3  1 
ATOM   3910  H  HD2  . ARG C  1 45 ? 46.832 75.511 13.865  1.00 33.42  ?  45   ARG C HD2  1 
ATOM   3911  H  HD3  . ARG C  1 45 ? 48.132 76.078 13.145  1.00 33.42  ?  45   ARG C HD3  1 
ATOM   3912  H  HE   . ARG C  1 45 ? 46.313 77.962 13.746  1.00 33.87  ?  45   ARG C HE   1 
ATOM   3913  H  HH11 . ARG C  1 45 ? 49.063 76.540 14.920  1.00 34.85  ?  45   ARG C HH11 1 
ATOM   3914  H  HH12 . ARG C  1 45 ? 49.410 77.628 15.877  1.00 34.85  ?  45   ARG C HH12 1 
ATOM   3915  H  HH21 . ARG C  1 45 ? 46.852 79.598 15.209  1.00 36.59  ?  45   ARG C HH21 1 
ATOM   3916  H  HH22 . ARG C  1 45 ? 48.075 79.474 16.051  1.00 36.59  ?  45   ARG C HH22 1 
ATOM   3917  N  N    . THR C  1 46 ? 48.580 73.904 10.927  1.00 23.21  ?  46   THR C N    1 
ATOM   3918  C  CA   . THR C  1 46 ? 48.179 72.514 10.758  1.00 24.40  ?  46   THR C CA   1 
ATOM   3919  C  C    . THR C  1 46 ? 46.736 72.366 11.238  1.00 22.14  ?  46   THR C C    1 
ATOM   3920  O  O    . THR C  1 46 ? 46.466 72.415 12.436  1.00 22.07  ?  46   THR C O    1 
ATOM   3921  C  CB   . THR C  1 46 ? 49.088 71.561 11.555  1.00 28.04  ?  46   THR C CB   1 
ATOM   3922  O  OG1  . THR C  1 46 ? 49.291 72.081 12.875  1.00 30.31  ?  46   THR C OG1  1 
ATOM   3923  C  CG2  . THR C  1 46 ? 50.438 71.405 10.868  1.00 28.07  ?  46   THR C CG2  1 
ATOM   3924  H  H    . THR C  1 46 ? 49.048 74.053 11.633  1.00 27.85  ?  46   THR C H    1 
ATOM   3925  H  HA   . THR C  1 46 ? 48.222 72.271 9.810   1.00 29.27  ?  46   THR C HA   1 
ATOM   3926  H  HB   . THR C  1 46 ? 48.670 70.687 11.613  1.00 33.65  ?  46   THR C HB   1 
ATOM   3927  H  HG1  . THR C  1 46 ? 48.572 72.153 13.262  1.00 36.37  ?  46   THR C HG1  1 
ATOM   3928  H  HG21 . THR C  1 46 ? 50.872 72.259 10.802  1.00 33.68  ?  46   THR C HG21 1 
ATOM   3929  H  HG22 . THR C  1 46 ? 50.996 70.809 11.373  1.00 33.68  ?  46   THR C HG22 1 
ATOM   3930  H  HG23 . THR C  1 46 ? 50.317 71.047 9.986   1.00 33.68  ?  46   THR C HG23 1 
ATOM   3931  N  N    . THR C  1 47 ? 45.816 72.191 10.293  1.00 20.53  ?  47   THR C N    1 
ATOM   3932  C  CA   . THR C  1 47 ? 44.383 72.183 10.590  1.00 21.80  ?  47   THR C CA   1 
ATOM   3933  C  C    . THR C  1 47 ? 44.027 71.238 11.737  1.00 23.76  ?  47   THR C C    1 
ATOM   3934  O  O    . THR C  1 47 ? 44.423 70.075 11.743  1.00 26.21  ?  47   THR C O    1 
ATOM   3935  C  CB   . THR C  1 47 ? 43.563 71.788 9.342   1.00 23.17  ?  47   THR C CB   1 
ATOM   3936  O  OG1  . THR C  1 47 ? 43.940 72.618 8.233   1.00 25.86  ?  47   THR C OG1  1 
ATOM   3937  C  CG2  . THR C  1 47 ? 42.064 71.938 9.605   1.00 23.71  ?  47   THR C CG2  1 
ATOM   3938  H  H    . THR C  1 47 ? 45.997 72.072 9.461   1.00 24.63  ?  47   THR C H    1 
ATOM   3939  H  HA   . THR C  1 47 ? 44.112 73.087 10.852  1.00 26.16  ?  47   THR C HA   1 
ATOM   3940  H  HB   . THR C  1 47 ? 43.741 70.861 9.122   1.00 27.80  ?  47   THR C HB   1 
ATOM   3941  H  HG1  . THR C  1 47 ? 43.796 73.406 8.411   1.00 31.03  ?  47   THR C HG1  1 
ATOM   3942  H  HG21 . THR C  1 47 ? 41.860 72.849 9.828   1.00 28.45  ?  47   THR C HG21 1 
ATOM   3943  H  HG22 . THR C  1 47 ? 41.567 71.690 8.821   1.00 28.45  ?  47   THR C HG22 1 
ATOM   3944  H  HG23 . THR C  1 47 ? 41.801 71.372 10.334  1.00 28.45  ?  47   THR C HG23 1 
ATOM   3945  N  N    . GLY C  1 48 ? 43.251 71.745 12.691  1.00 23.75  ?  48   GLY C N    1 
ATOM   3946  C  CA   . GLY C  1 48 ? 42.876 70.993 13.876  1.00 26.47  ?  48   GLY C CA   1 
ATOM   3947  C  C    . GLY C  1 48 ? 43.941 70.841 14.951  1.00 28.40  ?  48   GLY C C    1 
ATOM   3948  O  O    . GLY C  1 48 ? 43.693 70.188 15.962  1.00 30.59  ?  48   GLY C O    1 
ATOM   3949  H  H    . GLY C  1 48 ? 42.925 72.540 12.671  1.00 28.50  ?  48   GLY C H    1 
ATOM   3950  H  HA2  . GLY C  1 48 ? 42.108 71.422 14.283  1.00 31.76  ?  48   GLY C HA2  1 
ATOM   3951  H  HA3  . GLY C  1 48 ? 42.606 70.102 13.604  1.00 31.76  ?  48   GLY C HA3  1 
ATOM   3952  N  N    . LYS C  1 49 ? 45.114 71.437 14.758  1.00 28.09  ?  49   LYS C N    1 
ATOM   3953  C  CA   . LYS C  1 49 ? 46.226 71.210 15.682  1.00 30.97  ?  49   LYS C CA   1 
ATOM   3954  C  C    . LYS C  1 49 ? 46.956 72.481 16.116  1.00 27.62  ?  49   LYS C C    1 
ATOM   3955  O  O    . LYS C  1 49 ? 47.029 73.463 15.376  1.00 26.08  ?  49   LYS C O    1 
ATOM   3956  C  CB   . LYS C  1 49 ? 47.226 70.227 15.067  1.00 34.04  ?  49   LYS C CB   1 
ATOM   3957  C  CG   . LYS C  1 49 ? 46.704 68.800 14.978  1.00 36.10  ?  49   LYS C CG   1 
ATOM   3958  C  CD   . LYS C  1 49 ? 47.676 67.899 14.239  1.00 36.13  ?  49   LYS C CD   1 
ATOM   3959  C  CE   . LYS C  1 49 ? 47.199 66.457 14.210  1.00 37.98  ?  49   LYS C CE   1 
ATOM   3960  N  NZ   . LYS C  1 49 ? 47.234 65.816 15.558  1.00 39.83  ?  49   LYS C NZ   1 
ATOM   3961  H  H    . LYS C  1 49 ? 45.292 71.972 14.108  1.00 33.71  ?  49   LYS C H    1 
ATOM   3962  H  HA   . LYS C  1 49 ? 45.869 70.791 16.492  1.00 37.17  ?  49   LYS C HA   1 
ATOM   3963  H  HB2  . LYS C  1 49 ? 47.441 70.520 14.168  1.00 40.85  ?  49   LYS C HB2  1 
ATOM   3964  H  HB3  . LYS C  1 49 ? 48.029 70.216 15.610  1.00 40.85  ?  49   LYS C HB3  1 
ATOM   3965  H  HG2  . LYS C  1 49 ? 46.583 68.447 15.874  1.00 43.32  ?  49   LYS C HG2  1 
ATOM   3966  H  HG3  . LYS C  1 49 ? 45.861 68.796 14.499  1.00 43.32  ?  49   LYS C HG3  1 
ATOM   3967  H  HD2  . LYS C  1 49 ? 47.765 68.207 13.324  1.00 43.36  ?  49   LYS C HD2  1 
ATOM   3968  H  HD3  . LYS C  1 49 ? 48.537 67.924 14.686  1.00 43.36  ?  49   LYS C HD3  1 
ATOM   3969  H  HE2  . LYS C  1 49 ? 46.284 66.433 13.889  1.00 45.58  ?  49   LYS C HE2  1 
ATOM   3970  H  HE3  . LYS C  1 49 ? 47.773 65.945 13.619  1.00 45.58  ?  49   LYS C HE3  1 
ATOM   3971  H  HZ1  . LYS C  1 49 ? 46.709 66.264 16.121  1.00 47.80  ?  49   LYS C HZ1  1 
ATOM   3972  H  HZ2  . LYS C  1 49 ? 46.948 64.975 15.502  1.00 47.80  ?  49   LYS C HZ2  1 
ATOM   3973  H  HZ3  . LYS C  1 49 ? 48.066 65.819 15.874  1.00 47.80  ?  49   LYS C HZ3  1 
ATOM   3974  N  N    . TYR C  1 50 ? 47.496 72.439 17.331  1.00 26.00  ?  50   TYR C N    1 
ATOM   3975  C  CA   . TYR C  1 50 ? 48.266 73.545 17.884  1.00 25.46  ?  50   TYR C CA   1 
ATOM   3976  C  C    . TYR C  1 50 ? 49.715 73.416 17.423  1.00 24.22  ?  50   TYR C C    1 
ATOM   3977  O  O    . TYR C  1 50 ? 50.540 72.778 18.078  1.00 23.21  ?  50   TYR C O    1 
ATOM   3978  C  CB   . TYR C  1 50 ? 48.191 73.521 19.413  1.00 28.36  ?  50   TYR C CB   1 
ATOM   3979  C  CG   . TYR C  1 50 ? 48.474 74.849 20.086  1.00 30.64  ?  50   TYR C CG   1 
ATOM   3980  C  CD1  . TYR C  1 50 ? 49.195 75.846 19.443  1.00 29.46  ?  50   TYR C CD1  1 
ATOM   3981  C  CD2  . TYR C  1 50 ? 48.012 75.102 21.372  1.00 35.05  ?  50   TYR C CD2  1 
ATOM   3982  C  CE1  . TYR C  1 50 ? 49.449 77.057 20.063  1.00 32.10  ?  50   TYR C CE1  1 
ATOM   3983  C  CE2  . TYR C  1 50 ? 48.261 76.306 21.999  1.00 37.48  ?  50   TYR C CE2  1 
ATOM   3984  C  CZ   . TYR C  1 50 ? 48.980 77.280 21.342  1.00 36.79  ?  50   TYR C CZ   1 
ATOM   3985  O  OH   . TYR C  1 50 ? 49.229 78.482 21.965  1.00 39.23  ?  50   TYR C OH   1 
ATOM   3986  H  H    . TYR C  1 50 ? 47.428 71.766 17.862  1.00 31.20  ?  50   TYR C H    1 
ATOM   3987  H  HA   . TYR C  1 50 ? 47.905 74.397 17.562  1.00 30.55  ?  50   TYR C HA   1 
ATOM   3988  H  HB2  . TYR C  1 50 ? 47.299 73.244 19.674  1.00 34.03  ?  50   TYR C HB2  1 
ATOM   3989  H  HB3  . TYR C  1 50 ? 48.840 72.881 19.744  1.00 34.03  ?  50   TYR C HB3  1 
ATOM   3990  H  HD1  . TYR C  1 50 ? 49.513 75.698 18.582  1.00 35.35  ?  50   TYR C HD1  1 
ATOM   3991  H  HD2  . TYR C  1 50 ? 47.527 74.446 21.819  1.00 42.06  ?  50   TYR C HD2  1 
ATOM   3992  H  HE1  . TYR C  1 50 ? 49.934 77.716 19.622  1.00 38.53  ?  50   TYR C HE1  1 
ATOM   3993  H  HE2  . TYR C  1 50 ? 47.945 76.459 22.860  1.00 44.98  ?  50   TYR C HE2  1 
ATOM   3994  H  HH   . TYR C  1 50 ? 49.655 78.357 22.654  1.00 47.07  ?  50   TYR C HH   1 
ATOM   3995  N  N    . GLY C  1 51 ? 50.010 74.021 16.280  1.00 26.58  ?  51   GLY C N    1 
ATOM   3996  C  CA   . GLY C  1 51 ? 51.325 73.925 15.680  1.00 28.42  ?  51   GLY C CA   1 
ATOM   3997  C  C    . GLY C  1 51 ? 51.293 74.452 14.260  1.00 29.58  ?  51   GLY C C    1 
ATOM   3998  O  O    . GLY C  1 51 ? 50.276 74.984 13.813  1.00 31.53  ?  51   GLY C O    1 
ATOM   3999  H  H    . GLY C  1 51 ? 49.456 74.499 15.829  1.00 31.89  ?  51   GLY C H    1 
ATOM   4000  H  HA2  . GLY C  1 51 ? 51.962 74.445 16.194  1.00 34.11  ?  51   GLY C HA2  1 
ATOM   4001  H  HA3  . GLY C  1 51 ? 51.614 72.999 15.665  1.00 34.11  ?  51   GLY C HA3  1 
ATOM   4002  N  N    . ASN C  1 52 ? 52.402 74.302 13.545  1.00 28.70  ?  52   ASN C N    1 
ATOM   4003  C  CA   . ASN C  1 52 ? 52.496 74.835 12.195  1.00 26.01  ?  52   ASN C CA   1 
ATOM   4004  C  C    . ASN C  1 52 ? 53.404 74.012 11.292  1.00 25.19  ?  52   ASN C C    1 
ATOM   4005  O  O    . ASN C  1 52 ? 54.211 73.210 11.761  1.00 24.59  ?  52   ASN C O    1 
ATOM   4006  C  CB   . ASN C  1 52 ? 53.011 76.275 12.239  1.00 24.81  ?  52   ASN C CB   1 
ATOM   4007  C  CG   . ASN C  1 52 ? 54.458 76.365 12.691  1.00 23.91  ?  52   ASN C CG   1 
ATOM   4008  O  OD1  . ASN C  1 52 ? 55.381 76.127 11.909  1.00 24.86  ?  52   ASN C OD1  1 
ATOM   4009  N  ND2  . ASN C  1 52 ? 54.664 76.716 13.958  1.00 23.02  ?  52   ASN C ND2  1 
ATOM   4010  H  H    . ASN C  1 52 ? 53.110 73.898 13.818  1.00 34.43  ?  52   ASN C H    1 
ATOM   4011  H  HA   . ASN C  1 52 ? 51.602 74.845 11.794  1.00 31.22  ?  52   ASN C HA   1 
ATOM   4012  H  HB2  . ASN C  1 52 ? 52.949 76.661 11.350  1.00 29.78  ?  52   ASN C HB2  1 
ATOM   4013  H  HB3  . ASN C  1 52 ? 52.469 76.786 12.861  1.00 29.78  ?  52   ASN C HB3  1 
ATOM   4014  H  HD21 . ASN C  1 52 ? 53.995 76.878 14.473  1.00 27.63  ?  52   ASN C HD21 1 
ATOM   4015  H  HD22 . ASN C  1 52 ? 55.466 76.780 14.261  1.00 27.63  ?  52   ASN C HD22 1 
ATOM   4016  N  N    . ILE C  1 53 ? 53.245 74.215 9.989   1.00 24.87  ?  53   ILE C N    1 
ATOM   4017  C  CA   . ILE C  1 53 ? 54.199 73.738 9.001   1.00 24.66  ?  53   ILE C CA   1 
ATOM   4018  C  C    . ILE C  1 53 ? 54.837 74.972 8.402   1.00 21.70  ?  53   ILE C C    1 
ATOM   4019  O  O    . ILE C  1 53 ? 54.135 75.850 7.897   1.00 21.34  ?  53   ILE C O    1 
ATOM   4020  C  CB   . ILE C  1 53 ? 53.522 72.951 7.869   1.00 25.62  ?  53   ILE C CB   1 
ATOM   4021  C  CG1  . ILE C  1 53 ? 53.015 71.604 8.378   1.00 28.92  ?  53   ILE C CG1  1 
ATOM   4022  C  CG2  . ILE C  1 53 ? 54.496 72.744 6.716   1.00 25.75  ?  53   ILE C CG2  1 
ATOM   4023  C  CD1  . ILE C  1 53 ? 54.112 70.596 8.645   1.00 31.21  ?  53   ILE C CD1  1 
ATOM   4024  H  H    . ILE C  1 53 ? 52.578 74.635 9.647   1.00 29.84  ?  53   ILE C H    1 
ATOM   4025  H  HA   . ILE C  1 53 ? 54.888 73.183 9.424   1.00 29.59  ?  53   ILE C HA   1 
ATOM   4026  H  HB   . ILE C  1 53 ? 52.765 73.464 7.546   1.00 30.75  ?  53   ILE C HB   1 
ATOM   4027  H  HG12 . ILE C  1 53 ? 52.533 71.744 9.208   1.00 34.70  ?  53   ILE C HG12 1 
ATOM   4028  H  HG13 . ILE C  1 53 ? 52.419 71.224 7.713   1.00 34.70  ?  53   ILE C HG13 1 
ATOM   4029  H  HG21 . ILE C  1 53 ? 55.257 72.252 7.034   1.00 30.89  ?  53   ILE C HG21 1 
ATOM   4030  H  HG22 . ILE C  1 53 ? 54.056 72.251 6.019   1.00 30.89  ?  53   ILE C HG22 1 
ATOM   4031  H  HG23 . ILE C  1 53 ? 54.775 73.601 6.385   1.00 30.89  ?  53   ILE C HG23 1 
ATOM   4032  H  HD11 . ILE C  1 53 ? 54.706 70.950 9.310   1.00 37.45  ?  53   ILE C HD11 1 
ATOM   4033  H  HD12 . ILE C  1 53 ? 53.717 69.780 8.959   1.00 37.45  ?  53   ILE C HD12 1 
ATOM   4034  H  HD13 . ILE C  1 53 ? 54.593 70.434 7.829   1.00 37.45  ?  53   ILE C HD13 1 
ATOM   4035  N  N    . SER C  1 54 ? 56.163 75.045 8.459   1.00 21.42  ?  54   SER C N    1 
ATOM   4036  C  CA   . SER C  1 54 ? 56.872 76.223 7.995   1.00 21.55  ?  54   SER C CA   1 
ATOM   4037  C  C    . SER C  1 54 ? 57.964 75.871 6.997   1.00 21.57  ?  54   SER C C    1 
ATOM   4038  O  O    . SER C  1 54 ? 58.465 74.747 6.964   1.00 22.58  ?  54   SER C O    1 
ATOM   4039  C  CB   . SER C  1 54 ? 57.495 76.967 9.178   1.00 22.21  ?  54   SER C CB   1 
ATOM   4040  O  OG   . SER C  1 54 ? 56.502 77.477 10.046  1.00 23.19  ?  54   SER C OG   1 
ATOM   4041  H  H    . SER C  1 54 ? 56.673 74.423 8.763   1.00 25.70  ?  54   SER C H    1 
ATOM   4042  H  HA   . SER C  1 54 ? 56.239 76.826 7.553   1.00 25.86  ?  54   SER C HA   1 
ATOM   4043  H  HB2  . SER C  1 54 ? 58.060 76.353 9.673   1.00 26.65  ?  54   SER C HB2  1 
ATOM   4044  H  HB3  . SER C  1 54 ? 58.026 77.705 8.840   1.00 26.65  ?  54   SER C HB3  1 
ATOM   4045  H  HG   . SER C  1 54 ? 55.757 77.285 9.763   1.00 27.82  ?  54   SER C HG   1 
ATOM   4046  N  N    . VAL C  1 55 ? 58.319 76.846 6.173   1.00 21.66  ?  55   VAL C N    1 
ATOM   4047  C  CA   . VAL C  1 55 ? 59.500 76.742 5.338   1.00 20.53  ?  55   VAL C CA   1 
ATOM   4048  C  C    . VAL C  1 55 ? 60.441 77.872 5.718   1.00 21.65  ?  55   VAL C C    1 
ATOM   4049  O  O    . VAL C  1 55 ? 60.072 79.045 5.662   1.00 23.15  ?  55   VAL C O    1 
ATOM   4050  C  CB   . VAL C  1 55 ? 59.168 76.837 3.841   1.00 19.62  ?  55   VAL C CB   1 
ATOM   4051  C  CG1  . VAL C  1 55 ? 60.450 76.903 3.023   1.00 18.56  ?  55   VAL C CG1  1 
ATOM   4052  C  CG2  . VAL C  1 55 ? 58.321 75.654 3.412   1.00 19.42  ?  55   VAL C CG2  1 
ATOM   4053  H  H    . VAL C  1 55 ? 57.887 77.584 6.080   1.00 25.99  ?  55   VAL C H    1 
ATOM   4054  H  HA   . VAL C  1 55 ? 59.950 75.888 5.507   1.00 24.64  ?  55   VAL C HA   1 
ATOM   4055  H  HB   . VAL C  1 55 ? 58.656 77.656 3.676   1.00 23.55  ?  55   VAL C HB   1 
ATOM   4056  H  HG11 . VAL C  1 55 ? 60.965 76.110 3.186   1.00 22.27  ?  55   VAL C HG11 1 
ATOM   4057  H  HG12 . VAL C  1 55 ? 60.223 76.962 2.092   1.00 22.27  ?  55   VAL C HG12 1 
ATOM   4058  H  HG13 . VAL C  1 55 ? 60.950 77.679 3.289   1.00 22.27  ?  55   VAL C HG13 1 
ATOM   4059  H  HG21 . VAL C  1 55 ? 57.505 75.655 3.918   1.00 23.30  ?  55   VAL C HG21 1 
ATOM   4060  H  HG22 . VAL C  1 55 ? 58.126 75.734 2.475   1.00 23.30  ?  55   VAL C HG22 1 
ATOM   4061  H  HG23 . VAL C  1 55 ? 58.809 74.845 3.577   1.00 23.30  ?  55   VAL C HG23 1 
ATOM   4062  N  N    . PHE C  1 56 ? 61.651 77.514 6.122   1.00 21.24  ?  56   PHE C N    1 
ATOM   4063  C  CA   . PHE C  1 56 ? 62.651 78.507 6.478   1.00 21.84  ?  56   PHE C CA   1 
ATOM   4064  C  C    . PHE C  1 56 ? 63.677 78.641 5.366   1.00 24.22  ?  56   PHE C C    1 
ATOM   4065  O  O    . PHE C  1 56 ? 64.078 77.651 4.755   1.00 23.76  ?  56   PHE C O    1 
ATOM   4066  C  CB   . PHE C  1 56 ? 63.338 78.133 7.790   1.00 22.23  ?  56   PHE C CB   1 
ATOM   4067  C  CG   . PHE C  1 56 ? 62.563 78.533 9.008   1.00 24.15  ?  56   PHE C CG   1 
ATOM   4068  C  CD1  . PHE C  1 56 ? 61.575 77.709 9.521   1.00 24.69  ?  56   PHE C CD1  1 
ATOM   4069  C  CD2  . PHE C  1 56 ? 62.817 79.740 9.640   1.00 26.18  ?  56   PHE C CD2  1 
ATOM   4070  C  CE1  . PHE C  1 56 ? 60.859 78.078 10.646  1.00 24.78  ?  56   PHE C CE1  1 
ATOM   4071  C  CE2  . PHE C  1 56 ? 62.103 80.114 10.766  1.00 26.58  ?  56   PHE C CE2  1 
ATOM   4072  C  CZ   . PHE C  1 56 ? 61.122 79.283 11.268  1.00 25.60  ?  56   PHE C CZ   1 
ATOM   4073  H  H    . PHE C  1 56 ? 61.918 76.700 6.199   1.00 25.48  ?  56   PHE C H    1 
ATOM   4074  H  HA   . PHE C  1 56 ? 62.215 79.376 6.597   1.00 26.21  ?  56   PHE C HA   1 
ATOM   4075  H  HB2  . PHE C  1 56 ? 63.458 77.171 7.818   1.00 26.67  ?  56   PHE C HB2  1 
ATOM   4076  H  HB3  . PHE C  1 56 ? 64.201 78.574 7.829   1.00 26.67  ?  56   PHE C HB3  1 
ATOM   4077  H  HD1  . PHE C  1 56 ? 61.394 76.896 9.106   1.00 29.63  ?  56   PHE C HD1  1 
ATOM   4078  H  HD2  . PHE C  1 56 ? 63.477 80.303 9.306   1.00 31.41  ?  56   PHE C HD2  1 
ATOM   4079  H  HE1  . PHE C  1 56 ? 60.198 77.516 10.982  1.00 29.74  ?  56   PHE C HE1  1 
ATOM   4080  H  HE2  . PHE C  1 56 ? 62.283 80.926 11.183  1.00 31.89  ?  56   PHE C HE2  1 
ATOM   4081  H  HZ   . PHE C  1 56 ? 60.641 79.533 12.024  1.00 30.72  ?  56   PHE C HZ   1 
ATOM   4082  N  N    . ASP C  1 57 ? 64.088 79.878 5.109   1.00 24.66  ?  57   ASP C N    1 
ATOM   4083  C  CA   . ASP C  1 57 ? 65.059 80.178 4.069   1.00 27.92  ?  57   ASP C CA   1 
ATOM   4084  C  C    . ASP C  1 57 ? 66.281 80.835 4.696   1.00 25.60  ?  57   ASP C C    1 
ATOM   4085  O  O    . ASP C  1 57 ? 66.300 82.045 4.920   1.00 28.00  ?  57   ASP C O    1 
ATOM   4086  C  CB   . ASP C  1 57 ? 64.435 81.107 3.029   1.00 30.92  ?  57   ASP C CB   1 
ATOM   4087  C  CG   . ASP C  1 57 ? 65.397 81.473 1.919   1.00 34.13  ?  57   ASP C CG   1 
ATOM   4088  O  OD1  . ASP C  1 57 ? 66.483 80.863 1.848   1.00 34.34  ?  57   ASP C OD1  1 
ATOM   4089  O  OD2  . ASP C  1 57 ? 65.060 82.364 1.111   1.00 35.06  ?  57   ASP C OD2  1 
ATOM   4090  H  H    . ASP C  1 57 ? 63.812 80.573 5.534   1.00 29.59  ?  57   ASP C H    1 
ATOM   4091  H  HA   . ASP C  1 57 ? 65.338 79.350 3.626   1.00 33.50  ?  57   ASP C HA   1 
ATOM   4092  H  HB2  . ASP C  1 57 ? 63.669 80.665 2.629   1.00 37.11  ?  57   ASP C HB2  1 
ATOM   4093  H  HB3  . ASP C  1 57 ? 64.154 81.927 3.464   1.00 37.11  ?  57   ASP C HB3  1 
ATOM   4094  N  N    . VAL C  1 58 ? 67.295 80.028 4.989   1.00 22.53  ?  58   VAL C N    1 
ATOM   4095  C  CA   . VAL C  1 58 ? 68.487 80.515 5.670   1.00 22.57  ?  58   VAL C CA   1 
ATOM   4096  C  C    . VAL C  1 58 ? 69.734 79.925 5.024   1.00 24.11  ?  58   VAL C C    1 
ATOM   4097  O  O    . VAL C  1 58 ? 69.640 79.030 4.183   1.00 23.30  ?  58   VAL C O    1 
ATOM   4098  C  CB   . VAL C  1 58 ? 68.456 80.167 7.168   1.00 23.95  ?  58   VAL C CB   1 
ATOM   4099  C  CG1  . VAL C  1 58 ? 67.203 80.743 7.813   1.00 23.29  ?  58   VAL C CG1  1 
ATOM   4100  C  CG2  . VAL C  1 58 ? 68.519 78.662 7.369   1.00 24.18  ?  58   VAL C CG2  1 
ATOM   4101  H  H    . VAL C  1 58 ? 67.316 79.189 4.802   1.00 27.04  ?  58   VAL C H    1 
ATOM   4102  H  HA   . VAL C  1 58 ? 68.531 81.490 5.584   1.00 27.08  ?  58   VAL C HA   1 
ATOM   4103  H  HB   . VAL C  1 58 ? 69.236 80.566 7.607   1.00 28.74  ?  58   VAL C HB   1 
ATOM   4104  H  HG11 . VAL C  1 58 ? 66.431 80.369 7.382   1.00 27.94  ?  58   VAL C HG11 1 
ATOM   4105  H  HG12 . VAL C  1 58 ? 67.200 80.516 8.746   1.00 27.94  ?  58   VAL C HG12 1 
ATOM   4106  H  HG13 . VAL C  1 58 ? 67.208 81.697 7.708   1.00 27.94  ?  58   VAL C HG13 1 
ATOM   4107  H  HG21 . VAL C  1 58 ? 69.333 78.329 6.985   1.00 29.02  ?  58   VAL C HG21 1 
ATOM   4108  H  HG22 . VAL C  1 58 ? 68.498 78.471 8.309   1.00 29.02  ?  58   VAL C HG22 1 
ATOM   4109  H  HG23 . VAL C  1 58 ? 67.763 78.257 6.935   1.00 29.02  ?  58   VAL C HG23 1 
ATOM   4110  N  N    . ASN C  1 59 ? 70.901 80.420 5.422   1.00 24.12  ?  59   ASN C N    1 
ATOM   4111  C  CA   . ASN C  1 59 ? 72.134 80.094 4.712   1.00 26.74  ?  59   ASN C CA   1 
ATOM   4112  C  C    . ASN C  1 59 ? 72.999 79.022 5.369   1.00 24.66  ?  59   ASN C C    1 
ATOM   4113  O  O    . ASN C  1 59 ? 74.073 78.699 4.860   1.00 26.84  ?  59   ASN C O    1 
ATOM   4114  C  CB   . ASN C  1 59 ? 72.956 81.365 4.489   1.00 29.75  ?  59   ASN C CB   1 
ATOM   4115  C  CG   . ASN C  1 59 ? 72.263 82.351 3.563   1.00 30.97  ?  59   ASN C CG   1 
ATOM   4116  O  OD1  . ASN C  1 59 ? 72.056 83.513 3.914   1.00 33.41  ?  59   ASN C OD1  1 
ATOM   4117  N  ND2  . ASN C  1 59 ? 71.898 81.887 2.373   1.00 28.89  ?  59   ASN C ND2  1 
ATOM   4118  H  H    . ASN C  1 59 ? 71.007 80.944 6.095   1.00 28.94  ?  59   ASN C H    1 
ATOM   4119  H  HA   . ASN C  1 59 ? 71.888 79.754 3.826   1.00 32.08  ?  59   ASN C HA   1 
ATOM   4120  H  HB2  . ASN C  1 59 ? 73.099 81.803 5.342   1.00 35.70  ?  59   ASN C HB2  1 
ATOM   4121  H  HB3  . ASN C  1 59 ? 73.808 81.125 4.091   1.00 35.70  ?  59   ASN C HB3  1 
ATOM   4122  H  HD21 . ASN C  1 59 ? 72.057 81.068 2.163   1.00 34.66  ?  59   ASN C HD21 1 
ATOM   4123  H  HD22 . ASN C  1 59 ? 71.502 82.405 1.812   1.00 34.66  ?  59   ASN C HD22 1 
ATOM   4124  N  N    . SER C  1 60 ? 72.542 78.466 6.488   1.00 22.15  ?  60   SER C N    1 
ATOM   4125  C  CA   . SER C  1 60 ? 73.263 77.363 7.120   1.00 21.65  ?  60   SER C CA   1 
ATOM   4126  C  C    . SER C  1 60 ? 72.421 76.659 8.175   1.00 22.37  ?  60   SER C C    1 
ATOM   4127  O  O    . SER C  1 60 ? 71.394 77.178 8.615   1.00 19.47  ?  60   SER C O    1 
ATOM   4128  C  CB   . SER C  1 60 ? 74.554 77.869 7.764   1.00 22.81  ?  60   SER C CB   1 
ATOM   4129  O  OG   . SER C  1 60 ? 74.260 78.713 8.861   1.00 23.55  ?  60   SER C OG   1 
ATOM   4130  H  H    . SER C  1 60 ? 71.824 78.704 6.897   1.00 26.58  ?  60   SER C H    1 
ATOM   4131  H  HA   . SER C  1 60 ? 73.504 76.705 6.436   1.00 25.98  ?  60   SER C HA   1 
ATOM   4132  H  HB2  . SER C  1 60 ? 75.070 77.111 8.077   1.00 27.37  ?  60   SER C HB2  1 
ATOM   4133  H  HB3  . SER C  1 60 ? 75.061 78.370 7.106   1.00 27.37  ?  60   SER C HB3  1 
ATOM   4134  H  HG   . SER C  1 60 ? 73.448 78.780 8.954   1.00 28.26  ?  60   SER C HG   1 
ATOM   4135  N  N    . HIS C  1 61 ? 72.864 75.469 8.571   1.00 28.50  ?  61   HIS C N    1 
ATOM   4136  C  CA   . HIS C  1 61 ? 72.223 74.735 9.653   1.00 30.01  ?  61   HIS C CA   1 
ATOM   4137  C  C    . HIS C  1 61 ? 72.338 75.533 10.948  1.00 30.31  ?  61   HIS C C    1 
ATOM   4138  O  O    . HIS C  1 61 ? 71.372 75.646 11.706  1.00 31.21  ?  61   HIS C O    1 
ATOM   4139  C  CB   . HIS C  1 61 ? 72.879 73.366 9.845   1.00 31.13  ?  61   HIS C CB   1 
ATOM   4140  C  CG   . HIS C  1 61 ? 72.837 72.486 8.634   1.00 31.36  ?  61   HIS C CG   1 
ATOM   4141  N  ND1  . HIS C  1 61 ? 71.970 72.696 7.582   1.00 31.18  ?  61   HIS C ND1  1 
ATOM   4142  C  CD2  . HIS C  1 61 ? 73.556 71.384 8.313   1.00 31.30  ?  61   HIS C CD2  1 
ATOM   4143  C  CE1  . HIS C  1 61 ? 72.159 71.762 6.666   1.00 30.82  ?  61   HIS C CE1  1 
ATOM   4144  N  NE2  . HIS C  1 61 ? 73.115 70.954 7.086   1.00 30.83  ?  61   HIS C NE2  1 
ATOM   4145  H  H    . HIS C  1 61 ? 73.540 75.064 8.226   1.00 34.20  ?  61   HIS C H    1 
ATOM   4146  H  HA   . HIS C  1 61 ? 71.274 74.604 9.447   1.00 36.01  ?  61   HIS C HA   1 
ATOM   4147  H  HB2  . HIS C  1 61 ? 73.811 73.498 10.082  1.00 37.36  ?  61   HIS C HB2  1 
ATOM   4148  H  HB3  . HIS C  1 61 ? 72.422 72.900 10.564  1.00 37.36  ?  61   HIS C HB3  1 
ATOM   4149  H  HD1  . HIS C  1 61 ? 71.397 73.335 7.530   1.00 37.42  ?  61   HIS C HD1  1 
ATOM   4150  H  HD2  . HIS C  1 61 ? 74.223 70.991 8.829   1.00 37.56  ?  61   HIS C HD2  1 
ATOM   4151  H  HE1  . HIS C  1 61 ? 71.698 71.687 5.862   1.00 36.99  ?  61   HIS C HE1  1 
ATOM   4152  H  HE2  . HIS C  1 61 ? 73.414 70.270 6.660   1.00 36.99  ?  61   HIS C HE2  1 
ATOM   4153  N  N    . ASP C  1 62 ? 73.528 76.078 11.195  1.00 27.25  ?  62   ASP C N    1 
ATOM   4154  C  CA   . ASP C  1 62 ? 73.789 76.867 12.397  1.00 29.88  ?  62   ASP C CA   1 
ATOM   4155  C  C    . ASP C  1 62 ? 72.777 77.993 12.544  1.00 29.04  ?  62   ASP C C    1 
ATOM   4156  O  O    . ASP C  1 62 ? 72.261 78.238 13.630  1.00 27.55  ?  62   ASP C O    1 
ATOM   4157  C  CB   . ASP C  1 62 ? 75.199 77.465 12.352  1.00 35.51  ?  62   ASP C CB   1 
ATOM   4158  C  CG   . ASP C  1 62 ? 76.283 76.418 12.497  1.00 39.64  ?  62   ASP C CG   1 
ATOM   4159  O  OD1  . ASP C  1 62 ? 75.974 75.304 12.963  1.00 39.14  ?  62   ASP C OD1  1 
ATOM   4160  O  OD2  . ASP C  1 62 ? 77.447 76.710 12.149  1.00 43.08  ?  62   ASP C OD2  1 
ATOM   4161  H  H    . ASP C  1 62 ? 74.209 76.005 10.674  1.00 32.70  ?  62   ASP C H    1 
ATOM   4162  H  HA   . ASP C  1 62 ? 73.724 76.288 13.185  1.00 35.85  ?  62   ASP C HA   1 
ATOM   4163  H  HB2  . ASP C  1 62 ? 75.325 77.913 11.501  1.00 42.62  ?  62   ASP C HB2  1 
ATOM   4164  H  HB3  . ASP C  1 62 ? 75.296 78.100 13.080  1.00 42.62  ?  62   ASP C HB3  1 
ATOM   4165  N  N    . GLU C  1 63 ? 72.505 78.675 11.438  1.00 31.08  ?  63   GLU C N    1 
ATOM   4166  C  CA   . GLU C  1 63 ? 71.591 79.810 11.433  1.00 32.78  ?  63   GLU C CA   1 
ATOM   4167  C  C    . GLU C  1 63 ? 70.170 79.360 11.751  1.00 29.14  ?  63   GLU C C    1 
ATOM   4168  O  O    . GLU C  1 63 ? 69.457 80.021 12.507  1.00 29.64  ?  63   GLU C O    1 
ATOM   4169  C  CB   . GLU C  1 63 ? 71.630 80.517 10.073  1.00 35.30  ?  63   GLU C CB   1 
ATOM   4170  C  CG   . GLU C  1 63 ? 70.751 81.753 9.985   1.00 37.72  ?  63   GLU C CG   1 
ATOM   4171  C  CD   . GLU C  1 63 ? 70.829 82.432 8.628   1.00 41.13  ?  63   GLU C CD   1 
ATOM   4172  O  OE1  . GLU C  1 63 ? 71.701 82.053 7.817   1.00 44.69  ?  63   GLU C OE1  1 
ATOM   4173  O  OE2  . GLU C  1 63 ? 70.015 83.344 8.369   1.00 40.60  ?  63   GLU C OE2  1 
ATOM   4174  H  H    . GLU C  1 63 ? 72.842 78.497 10.667  1.00 37.30  ?  63   GLU C H    1 
ATOM   4175  H  HA   . GLU C  1 63 ? 71.870 80.452 12.119  1.00 39.33  ?  63   GLU C HA   1 
ATOM   4176  H  HB2  . GLU C  1 63 ? 72.543 80.790 9.891   1.00 42.36  ?  63   GLU C HB2  1 
ATOM   4177  H  HB3  . GLU C  1 63 ? 71.333 79.894 9.391   1.00 42.36  ?  63   GLU C HB3  1 
ATOM   4178  H  HG2  . GLU C  1 63 ? 69.828 81.497 10.140  1.00 45.26  ?  63   GLU C HG2  1 
ATOM   4179  H  HG3  . GLU C  1 63 ? 71.036 82.392 10.657  1.00 45.26  ?  63   GLU C HG3  1 
ATOM   4180  N  N    . LEU C  1 64 ? 69.759 78.237 11.172  1.00 26.79  ?  64   LEU C N    1 
ATOM   4181  C  CA   . LEU C  1 64 ? 68.432 77.694 11.436  1.00 25.13  ?  64   LEU C CA   1 
ATOM   4182  C  C    . LEU C  1 64 ? 68.269 77.358 12.915  1.00 24.89  ?  64   LEU C C    1 
ATOM   4183  O  O    . LEU C  1 64 ? 67.258 77.702 13.527  1.00 23.25  ?  64   LEU C O    1 
ATOM   4184  C  CB   . LEU C  1 64 ? 68.174 76.442 10.597  1.00 24.30  ?  64   LEU C CB   1 
ATOM   4185  C  CG   . LEU C  1 64 ? 66.802 75.796 10.822  1.00 23.69  ?  64   LEU C CG   1 
ATOM   4186  C  CD1  . LEU C  1 64 ? 65.678 76.765 10.479  1.00 22.22  ?  64   LEU C CD1  1 
ATOM   4187  C  CD2  . LEU C  1 64 ? 66.665 74.518 10.012  1.00 23.35  ?  64   LEU C CD2  1 
ATOM   4188  H  H    . LEU C  1 64 ? 70.228 77.770 10.623  1.00 32.14  ?  64   LEU C H    1 
ATOM   4189  H  HA   . LEU C  1 64 ? 67.757 78.364 11.199  1.00 30.16  ?  64   LEU C HA   1 
ATOM   4190  H  HB2  . LEU C  1 64 ? 68.237 76.679 9.659   1.00 29.16  ?  64   LEU C HB2  1 
ATOM   4191  H  HB3  . LEU C  1 64 ? 68.850 75.780 10.813  1.00 29.16  ?  64   LEU C HB3  1 
ATOM   4192  H  HG   . LEU C  1 64 ? 66.716 75.563 11.760  1.00 28.42  ?  64   LEU C HG   1 
ATOM   4193  H  HD11 . LEU C  1 64 ? 65.756 77.018 9.556   1.00 26.66  ?  64   LEU C HD11 1 
ATOM   4194  H  HD12 . LEU C  1 64 ? 64.835 76.332 10.630  1.00 26.66  ?  64   LEU C HD12 1 
ATOM   4195  H  HD13 . LEU C  1 64 ? 65.753 77.541 11.039  1.00 26.66  ?  64   LEU C HD13 1 
ATOM   4196  H  HD21 . LEU C  1 64 ? 67.349 73.902 10.283  1.00 28.02  ?  64   LEU C HD21 1 
ATOM   4197  H  HD22 . LEU C  1 64 ? 65.799 74.138 10.173  1.00 28.02  ?  64   LEU C HD22 1 
ATOM   4198  H  HD23 . LEU C  1 64 ? 66.763 74.728 9.080   1.00 28.02  ?  64   LEU C HD23 1 
ATOM   4199  N  N    . HIS C  1 65 ? 69.263 76.685 13.488  1.00 24.17  ?  65   HIS C N    1 
ATOM   4200  C  CA   . HIS C  1 65 ? 69.189 76.291 14.891  1.00 26.78  ?  65   HIS C CA   1 
ATOM   4201  C  C    . HIS C  1 65 ? 69.072 77.524 15.779  1.00 29.56  ?  65   HIS C C    1 
ATOM   4202  O  O    . HIS C  1 65 ? 68.249 77.564 16.692  1.00 29.59  ?  65   HIS C O    1 
ATOM   4203  C  CB   . HIS C  1 65 ? 70.413 75.468 15.306  1.00 28.40  ?  65   HIS C CB   1 
ATOM   4204  C  CG   . HIS C  1 65 ? 70.465 75.174 16.773  1.00 30.16  ?  65   HIS C CG   1 
ATOM   4205  N  ND1  . HIS C  1 65 ? 70.025 73.984 17.315  1.00 31.08  ?  65   HIS C ND1  1 
ATOM   4206  C  CD2  . HIS C  1 65 ? 70.889 75.926 17.818  1.00 32.01  ?  65   HIS C CD2  1 
ATOM   4207  C  CE1  . HIS C  1 65 ? 70.185 74.013 18.625  1.00 32.21  ?  65   HIS C CE1  1 
ATOM   4208  N  NE2  . HIS C  1 65 ? 70.705 75.179 18.956  1.00 32.73  ?  65   HIS C NE2  1 
ATOM   4209  H  H    . HIS C  1 65 ? 69.987 76.445 13.089  1.00 29.01  ?  65   HIS C H    1 
ATOM   4210  H  HA   . HIS C  1 65 ? 68.391 75.739 15.027  1.00 32.13  ?  65   HIS C HA   1 
ATOM   4211  H  HB2  . HIS C  1 65 ? 70.396 74.621 14.833  1.00 34.08  ?  65   HIS C HB2  1 
ATOM   4212  H  HB3  . HIS C  1 65 ? 71.215 75.960 15.073  1.00 34.08  ?  65   HIS C HB3  1 
ATOM   4213  H  HD1  . HIS C  1 65 ? 69.701 73.324 16.868  1.00 37.29  ?  65   HIS C HD1  1 
ATOM   4214  H  HD2  . HIS C  1 65 ? 71.241 76.785 17.772  1.00 38.41  ?  65   HIS C HD2  1 
ATOM   4215  H  HE1  . HIS C  1 65 ? 69.966 73.328 19.215  1.00 38.65  ?  65   HIS C HE1  1 
ATOM   4216  H  HE2  . HIS C  1 65 ? 70.900 75.430 19.755  1.00 39.28  ?  65   HIS C HE2  1 
ATOM   4217  N  N    . GLU C  1 66 ? 69.901 78.526 15.504  1.00 30.91  ?  66   GLU C N    1 
ATOM   4218  C  CA   . GLU C  1 66 ? 69.882 79.769 16.266  1.00 32.51  ?  66   GLU C CA   1 
ATOM   4219  C  C    . GLU C  1 66 ? 68.472 80.346 16.307  1.00 30.38  ?  66   GLU C C    1 
ATOM   4220  O  O    . GLU C  1 66 ? 67.983 80.749 17.361  1.00 32.13  ?  66   GLU C O    1 
ATOM   4221  C  CB   . GLU C  1 66 ? 70.837 80.791 15.645  1.00 37.56  ?  66   GLU C CB   1 
ATOM   4222  C  CG   . GLU C  1 66 ? 71.813 81.403 16.632  1.00 46.92  ?  66   GLU C CG   1 
ATOM   4223  C  CD   . GLU C  1 66 ? 72.661 82.500 16.012  1.00 55.29  ?  66   GLU C CD   1 
ATOM   4224  O  OE1  . GLU C  1 66 ? 72.905 82.447 14.787  1.00 56.74  ?  66   GLU C OE1  1 
ATOM   4225  O  OE2  . GLU C  1 66 ? 73.078 83.419 16.749  1.00 59.47  ?  66   GLU C OE2  1 
ATOM   4226  H  H    . GLU C  1 66 ? 70.488 78.510 14.876  1.00 37.09  ?  66   GLU C H    1 
ATOM   4227  H  HA   . GLU C  1 66 ? 70.172 79.593 17.185  1.00 39.02  ?  66   GLU C HA   1 
ATOM   4228  H  HB2  . GLU C  1 66 ? 71.353 80.354 14.951  1.00 45.07  ?  66   GLU C HB2  1 
ATOM   4229  H  HB3  . GLU C  1 66 ? 70.314 81.512 15.261  1.00 45.07  ?  66   GLU C HB3  1 
ATOM   4230  H  HG2  . GLU C  1 66 ? 71.317 81.788 17.371  1.00 56.31  ?  66   GLU C HG2  1 
ATOM   4231  H  HG3  . GLU C  1 66 ? 72.410 80.710 16.957  1.00 56.31  ?  66   GLU C HG3  1 
ATOM   4232  N  N    . ILE C  1 67 ? 67.823 80.377 15.149  1.00 28.67  ?  67   ILE C N    1 
ATOM   4233  C  CA   . ILE C  1 67 ? 66.479 80.930 15.035  1.00 25.61  ?  67   ILE C CA   1 
ATOM   4234  C  C    . ILE C  1 67 ? 65.463 80.111 15.831  1.00 25.39  ?  67   ILE C C    1 
ATOM   4235  O  O    . ILE C  1 67 ? 64.715 80.657 16.640  1.00 28.23  ?  67   ILE C O    1 
ATOM   4236  C  CB   . ILE C  1 67 ? 66.047 81.017 13.559  1.00 23.83  ?  67   ILE C CB   1 
ATOM   4237  C  CG1  . ILE C  1 67 ? 66.843 82.113 12.850  1.00 25.57  ?  67   ILE C CG1  1 
ATOM   4238  C  CG2  . ILE C  1 67 ? 64.556 81.303 13.449  1.00 22.43  ?  67   ILE C CG2  1 
ATOM   4239  C  CD1  . ILE C  1 67 ? 66.759 82.056 11.337  1.00 26.79  ?  67   ILE C CD1  1 
ATOM   4240  H  H    . ILE C  1 67 ? 68.142 80.081 14.407  1.00 34.40  ?  67   ILE C H    1 
ATOM   4241  H  HA   . ILE C  1 67 ? 66.481 81.839 15.400  1.00 30.73  ?  67   ILE C HA   1 
ATOM   4242  H  HB   . ILE C  1 67 ? 66.234 80.168 13.129  1.00 28.59  ?  67   ILE C HB   1 
ATOM   4243  H  HG12 . ILE C  1 67 ? 66.504 82.977 13.133  1.00 30.69  ?  67   ILE C HG12 1 
ATOM   4244  H  HG13 . ILE C  1 67 ? 67.777 82.030 13.098  1.00 30.69  ?  67   ILE C HG13 1 
ATOM   4245  H  HG21 . ILE C  1 67 ? 64.366 82.139 13.881  1.00 26.92  ?  67   ILE C HG21 1 
ATOM   4246  H  HG22 . ILE C  1 67 ? 64.315 81.352 12.521  1.00 26.92  ?  67   ILE C HG22 1 
ATOM   4247  H  HG23 . ILE C  1 67 ? 64.070 80.595 13.877  1.00 26.92  ?  67   ILE C HG23 1 
ATOM   4248  H  HD11 . ILE C  1 67 ? 65.841 82.149 11.072  1.00 32.15  ?  67   ILE C HD11 1 
ATOM   4249  H  HD12 . ILE C  1 67 ? 67.281 82.772 10.969  1.00 32.15  ?  67   ILE C HD12 1 
ATOM   4250  H  HD13 . ILE C  1 67 ? 67.103 81.211 11.038  1.00 32.15  ?  67   ILE C HD13 1 
ATOM   4251  N  N    . LEU C  1 68 ? 65.441 78.802 15.605  1.00 22.87  ?  68   LEU C N    1 
ATOM   4252  C  CA   . LEU C  1 68 ? 64.496 77.929 16.296  1.00 23.49  ?  68   LEU C CA   1 
ATOM   4253  C  C    . LEU C  1 68 ? 64.682 78.014 17.810  1.00 27.32  ?  68   LEU C C    1 
ATOM   4254  O  O    . LEU C  1 68 ? 63.712 78.032 18.568  1.00 28.38  ?  68   LEU C O    1 
ATOM   4255  C  CB   . LEU C  1 68 ? 64.661 76.482 15.821  1.00 22.04  ?  68   LEU C CB   1 
ATOM   4256  C  CG   . LEU C  1 68 ? 64.366 76.242 14.336  1.00 18.32  ?  68   LEU C CG   1 
ATOM   4257  C  CD1  . LEU C  1 68 ? 64.694 74.812 13.938  1.00 17.52  ?  68   LEU C CD1  1 
ATOM   4258  C  CD2  . LEU C  1 68 ? 62.911 76.567 14.016  1.00 17.53  ?  68   LEU C CD2  1 
ATOM   4259  H  H    . LEU C  1 68 ? 65.962 78.394 15.056  1.00 27.44  ?  68   LEU C H    1 
ATOM   4260  H  HA   . LEU C  1 68 ? 63.582 78.216 16.085  1.00 28.19  ?  68   LEU C HA   1 
ATOM   4261  H  HB2  . LEU C  1 68 ? 65.577 76.208 15.985  1.00 26.44  ?  68   LEU C HB2  1 
ATOM   4262  H  HB3  . LEU C  1 68 ? 64.058 75.920 16.333  1.00 26.44  ?  68   LEU C HB3  1 
ATOM   4263  H  HG   . LEU C  1 68 ? 64.926 76.832 13.807  1.00 21.98  ?  68   LEU C HG   1 
ATOM   4264  H  HD11 . LEU C  1 68 ? 64.159 74.212 14.462  1.00 21.02  ?  68   LEU C HD11 1 
ATOM   4265  H  HD12 . LEU C  1 68 ? 64.499 74.696 13.005  1.00 21.02  ?  68   LEU C HD12 1 
ATOM   4266  H  HD13 . LEU C  1 68 ? 65.625 74.648 14.101  1.00 21.02  ?  68   LEU C HD13 1 
ATOM   4267  H  HD21 . LEU C  1 68 ? 62.744 77.489 14.224  1.00 21.04  ?  68   LEU C HD21 1 
ATOM   4268  H  HD22 . LEU C  1 68 ? 62.754 76.408 13.082  1.00 21.04  ?  68   LEU C HD22 1 
ATOM   4269  H  HD23 . LEU C  1 68 ? 62.341 76.003 14.544  1.00 21.04  ?  68   LEU C HD23 1 
ATOM   4270  N  N    . TRP C  1 69 ? 65.939 78.075 18.233  1.00 26.16  ?  69   TRP C N    1 
ATOM   4271  C  CA   . TRP C  1 69 ? 66.295 78.134 19.645  1.00 29.80  ?  69   TRP C CA   1 
ATOM   4272  C  C    . TRP C  1 69 ? 65.716 79.374 20.327  1.00 30.61  ?  69   TRP C C    1 
ATOM   4273  O  O    . TRP C  1 69 ? 65.394 79.343 21.517  1.00 31.25  ?  69   TRP C O    1 
ATOM   4274  C  CB   . TRP C  1 69 ? 67.821 78.132 19.775  1.00 31.59  ?  69   TRP C CB   1 
ATOM   4275  C  CG   . TRP C  1 69 ? 68.339 77.949 21.169  1.00 35.39  ?  69   TRP C CG   1 
ATOM   4276  C  CD1  . TRP C  1 69 ? 68.665 78.931 22.058  1.00 37.35  ?  69   TRP C CD1  1 
ATOM   4277  C  CD2  . TRP C  1 69 ? 68.610 76.705 21.828  1.00 38.23  ?  69   TRP C CD2  1 
ATOM   4278  N  NE1  . TRP C  1 69 ? 69.116 78.377 23.231  1.00 40.07  ?  69   TRP C NE1  1 
ATOM   4279  C  CE2  . TRP C  1 69 ? 69.093 77.012 23.116  1.00 41.25  ?  69   TRP C CE2  1 
ATOM   4280  C  CE3  . TRP C  1 69 ? 68.488 75.363 21.456  1.00 38.71  ?  69   TRP C CE3  1 
ATOM   4281  C  CZ2  . TRP C  1 69 ? 69.452 76.026 24.034  1.00 45.47  ?  69   TRP C CZ2  1 
ATOM   4282  C  CZ3  . TRP C  1 69 ? 68.845 74.386 22.368  1.00 42.08  ?  69   TRP C CZ3  1 
ATOM   4283  C  CH2  . TRP C  1 69 ? 69.322 74.722 23.642  1.00 45.42  ?  69   TRP C CH2  1 
ATOM   4284  H  H    . TRP C  1 69 ? 66.620 78.085 17.708  1.00 31.39  ?  69   TRP C H    1 
ATOM   4285  H  HA   . TRP C  1 69 ? 65.946 77.340 20.100  1.00 35.76  ?  69   TRP C HA   1 
ATOM   4286  H  HB2  . TRP C  1 69 ? 68.175 77.408 19.234  1.00 37.91  ?  69   TRP C HB2  1 
ATOM   4287  H  HB3  . TRP C  1 69 ? 68.159 78.979 19.446  1.00 37.91  ?  69   TRP C HB3  1 
ATOM   4288  H  HD1  . TRP C  1 69 ? 68.592 79.843 21.893  1.00 44.81  ?  69   TRP C HD1  1 
ATOM   4289  H  HE1  . TRP C  1 69 ? 69.372 78.816 23.925  1.00 48.08  ?  69   TRP C HE1  1 
ATOM   4290  H  HE3  . TRP C  1 69 ? 68.172 75.132 20.612  1.00 46.45  ?  69   TRP C HE3  1 
ATOM   4291  H  HZ2  . TRP C  1 69 ? 69.768 76.246 24.880  1.00 54.56  ?  69   TRP C HZ2  1 
ATOM   4292  H  HZ3  . TRP C  1 69 ? 68.768 73.490 22.131  1.00 50.50  ?  69   TRP C HZ3  1 
ATOM   4293  H  HH2  . TRP C  1 69 ? 69.554 74.044 24.234  1.00 54.50  ?  69   TRP C HH2  1 
ATOM   4294  N  N    . SER C  1 70 ? 65.579 80.459 19.569  1.00 32.73  ?  70   SER C N    1 
ATOM   4295  C  CA   . SER C  1 70 ? 65.139 81.736 20.127  1.00 34.07  ?  70   SER C CA   1 
ATOM   4296  C  C    . SER C  1 70 ? 63.616 81.880 20.166  1.00 32.25  ?  70   SER C C    1 
ATOM   4297  O  O    . SER C  1 70 ? 63.096 82.833 20.742  1.00 36.11  ?  70   SER C O    1 
ATOM   4298  C  CB   . SER C  1 70 ? 65.740 82.896 19.328  1.00 33.95  ?  70   SER C CB   1 
ATOM   4299  O  OG   . SER C  1 70 ? 65.106 83.047 18.066  1.00 31.31  ?  70   SER C OG   1 
ATOM   4300  H  H    . SER C  1 70 ? 65.736 80.483 18.724  1.00 39.28  ?  70   SER C H    1 
ATOM   4301  H  HA   . SER C  1 70 ? 65.468 81.805 21.048  1.00 40.89  ?  70   SER C HA   1 
ATOM   4302  H  HB2  . SER C  1 70 ? 65.629 83.716 19.834  1.00 40.74  ?  70   SER C HB2  1 
ATOM   4303  H  HB3  . SER C  1 70 ? 66.684 82.723 19.185  1.00 40.74  ?  70   SER C HB3  1 
ATOM   4304  H  HG   . SER C  1 70 ? 64.519 82.482 17.977  1.00 37.57  ?  70   SER C HG   1 
ATOM   4305  N  N    . LEU C  1 71 ? 62.904 80.942 19.550  1.00 28.66  ?  71   LEU C N    1 
ATOM   4306  C  CA   . LEU C  1 71 ? 61.446 81.008 19.505  1.00 27.33  ?  71   LEU C CA   1 
ATOM   4307  C  C    . LEU C  1 71 ? 60.856 80.932 20.915  1.00 31.22  ?  71   LEU C C    1 
ATOM   4308  O  O    . LEU C  1 71 ? 61.233 80.063 21.701  1.00 32.35  ?  71   LEU C O    1 
ATOM   4309  C  CB   . LEU C  1 71 ? 60.886 79.877 18.642  1.00 24.79  ?  71   LEU C CB   1 
ATOM   4310  C  CG   . LEU C  1 71 ? 61.312 79.883 17.171  1.00 22.75  ?  71   LEU C CG   1 
ATOM   4311  C  CD1  . LEU C  1 71 ? 60.584 78.795 16.398  1.00 20.56  ?  71   LEU C CD1  1 
ATOM   4312  C  CD2  . LEU C  1 71 ? 61.066 81.241 16.538  1.00 23.67  ?  71   LEU C CD2  1 
ATOM   4313  H  H    . LEU C  1 71 ? 63.240 80.258 19.151  1.00 34.40  ?  71   LEU C H    1 
ATOM   4314  H  HA   . LEU C  1 71 ? 61.175 81.861 19.106  1.00 32.80  ?  71   LEU C HA   1 
ATOM   4315  H  HB2  . LEU C  1 71 ? 61.172 79.032 19.022  1.00 29.75  ?  71   LEU C HB2  1 
ATOM   4316  H  HB3  . LEU C  1 71 ? 59.917 79.928 18.663  1.00 29.75  ?  71   LEU C HB3  1 
ATOM   4317  H  HG   . LEU C  1 71 ? 62.263 79.699 17.120  1.00 27.30  ?  71   LEU C HG   1 
ATOM   4318  H  HD11 . LEU C  1 71 ? 59.638 78.953 16.452  1.00 24.67  ?  71   LEU C HD11 1 
ATOM   4319  H  HD12 . LEU C  1 71 ? 60.868 78.821 15.481  1.00 24.67  ?  71   LEU C HD12 1 
ATOM   4320  H  HD13 . LEU C  1 71 ? 60.797 77.942 16.783  1.00 24.67  ?  71   LEU C HD13 1 
ATOM   4321  H  HD21 . LEU C  1 71 ? 61.575 81.903 17.013  1.00 28.41  ?  71   LEU C HD21 1 
ATOM   4322  H  HD22 . LEU C  1 71 ? 61.343 81.212 15.619  1.00 28.41  ?  71   LEU C HD22 1 
ATOM   4323  H  HD23 . LEU C  1 71 ? 60.130 81.446 16.592  1.00 28.41  ?  71   LEU C HD23 1 
ATOM   4324  N  N    . PRO C  1 72 ? 59.931 81.850 21.241  1.00 29.38  ?  72   PRO C N    1 
ATOM   4325  C  CA   . PRO C  1 72 ? 59.305 81.863 22.569  1.00 31.00  ?  72   PRO C CA   1 
ATOM   4326  C  C    . PRO C  1 72 ? 58.679 80.522 22.961  1.00 31.48  ?  72   PRO C C    1 
ATOM   4327  O  O    . PRO C  1 72 ? 58.693 80.166 24.140  1.00 32.86  ?  72   PRO C O    1 
ATOM   4328  C  CB   . PRO C  1 72 ? 58.222 82.936 22.429  1.00 31.03  ?  72   PRO C CB   1 
ATOM   4329  C  CG   . PRO C  1 72 ? 58.752 83.860 21.401  1.00 30.91  ?  72   PRO C CG   1 
ATOM   4330  C  CD   . PRO C  1 72 ? 59.500 82.997 20.422  1.00 29.26  ?  72   PRO C CD   1 
ATOM   4331  H  HA   . PRO C  1 72 ? 59.951 82.137 23.252  1.00 37.20  ?  72   PRO C HA   1 
ATOM   4332  H  HB2  . PRO C  1 72 ? 57.393 82.530 22.133  1.00 37.23  ?  72   PRO C HB2  1 
ATOM   4333  H  HB3  . PRO C  1 72 ? 58.101 83.393 23.276  1.00 37.23  ?  72   PRO C HB3  1 
ATOM   4334  H  HG2  . PRO C  1 72 ? 58.017 84.315 20.962  1.00 37.09  ?  72   PRO C HG2  1 
ATOM   4335  H  HG3  . PRO C  1 72 ? 59.350 84.501 21.817  1.00 37.09  ?  72   PRO C HG3  1 
ATOM   4336  H  HD2  . PRO C  1 72 ? 58.909 82.702 19.711  1.00 35.11  ?  72   PRO C HD2  1 
ATOM   4337  H  HD3  . PRO C  1 72 ? 60.270 83.471 20.072  1.00 35.11  ?  72   PRO C HD3  1 
ATOM   4338  N  N    . PHE C  1 73 ? 58.143 79.791 21.989  1.00 32.69  ?  73   PHE C N    1 
ATOM   4339  C  CA   . PHE C  1 73 ? 57.488 78.516 22.271  1.00 32.61  ?  73   PHE C CA   1 
ATOM   4340  C  C    . PHE C  1 73 ? 58.465 77.347 22.354  1.00 30.28  ?  73   PHE C C    1 
ATOM   4341  O  O    . PHE C  1 73 ? 58.063 76.229 22.672  1.00 30.47  ?  73   PHE C O    1 
ATOM   4342  C  CB   . PHE C  1 73 ? 56.437 78.206 21.202  1.00 32.38  ?  73   PHE C CB   1 
ATOM   4343  C  CG   . PHE C  1 73 ? 55.058 78.684 21.549  1.00 35.74  ?  73   PHE C CG   1 
ATOM   4344  C  CD1  . PHE C  1 73 ? 54.313 78.035 22.517  1.00 38.91  ?  73   PHE C CD1  1 
ATOM   4345  C  CD2  . PHE C  1 73 ? 54.501 79.771 20.900  1.00 37.29  ?  73   PHE C CD2  1 
ATOM   4346  C  CE1  . PHE C  1 73 ? 53.043 78.467 22.837  1.00 42.55  ?  73   PHE C CE1  1 
ATOM   4347  C  CE2  . PHE C  1 73 ? 53.228 80.207 21.216  1.00 40.81  ?  73   PHE C CE2  1 
ATOM   4348  C  CZ   . PHE C  1 73 ? 52.499 79.553 22.186  1.00 43.37  ?  73   PHE C CZ   1 
ATOM   4349  H  H    . PHE C  1 73 ? 58.144 80.011 21.158  1.00 39.23  ?  73   PHE C H    1 
ATOM   4350  H  HA   . PHE C  1 73 ? 57.028 78.583 23.134  1.00 39.13  ?  73   PHE C HA   1 
ATOM   4351  H  HB2  . PHE C  1 73 ? 56.699 78.635 20.373  1.00 38.86  ?  73   PHE C HB2  1 
ATOM   4352  H  HB3  . PHE C  1 73 ? 56.394 77.245 21.076  1.00 38.86  ?  73   PHE C HB3  1 
ATOM   4353  H  HD1  . PHE C  1 73 ? 54.675 77.302 22.960  1.00 46.69  ?  73   PHE C HD1  1 
ATOM   4354  H  HD2  . PHE C  1 73 ? 54.989 80.216 20.245  1.00 44.75  ?  73   PHE C HD2  1 
ATOM   4355  H  HE1  . PHE C  1 73 ? 52.553 78.024 23.491  1.00 51.06  ?  73   PHE C HE1  1 
ATOM   4356  H  HE2  . PHE C  1 73 ? 52.864 80.941 20.776  1.00 48.97  ?  73   PHE C HE2  1 
ATOM   4357  H  HZ   . PHE C  1 73 ? 51.643 79.845 22.401  1.00 52.04  ?  73   PHE C HZ   1 
ATOM   4358  N  N    . PHE C  1 74 ? 59.743 77.601 22.083  1.00 28.44  ?  74   PHE C N    1 
ATOM   4359  C  CA   . PHE C  1 74 ? 60.716 76.520 21.928  1.00 27.72  ?  74   PHE C CA   1 
ATOM   4360  C  C    . PHE C  1 74 ? 60.657 75.473 23.041  1.00 28.66  ?  74   PHE C C    1 
ATOM   4361  O  O    . PHE C  1 74 ? 60.709 74.276 22.762  1.00 29.74  ?  74   PHE C O    1 
ATOM   4362  C  CB   . PHE C  1 74 ? 62.138 77.072 21.813  1.00 28.41  ?  74   PHE C CB   1 
ATOM   4363  C  CG   . PHE C  1 74 ? 63.176 76.008 21.593  1.00 30.61  ?  74   PHE C CG   1 
ATOM   4364  C  CD1  . PHE C  1 74 ? 63.403 75.499 20.326  1.00 29.38  ?  74   PHE C CD1  1 
ATOM   4365  C  CD2  . PHE C  1 74 ? 63.911 75.505 22.654  1.00 33.19  ?  74   PHE C CD2  1 
ATOM   4366  C  CE1  . PHE C  1 74 ? 64.349 74.516 20.119  1.00 29.72  ?  74   PHE C CE1  1 
ATOM   4367  C  CE2  . PHE C  1 74 ? 64.860 74.522 22.453  1.00 33.13  ?  74   PHE C CE2  1 
ATOM   4368  C  CZ   . PHE C  1 74 ? 65.079 74.026 21.185  1.00 31.15  ?  74   PHE C CZ   1 
ATOM   4369  H  H    . PHE C  1 74 ? 60.072 78.389 21.985  1.00 34.12  ?  74   PHE C H    1 
ATOM   4370  H  HA   . PHE C  1 74 ? 60.519 76.056 21.087  1.00 33.26  ?  74   PHE C HA   1 
ATOM   4371  H  HB2  . PHE C  1 74 ? 62.177 77.686 21.063  1.00 34.09  ?  74   PHE C HB2  1 
ATOM   4372  H  HB3  . PHE C  1 74 ? 62.361 77.539 22.633  1.00 34.09  ?  74   PHE C HB3  1 
ATOM   4373  H  HD1  . PHE C  1 74 ? 62.915 75.825 19.605  1.00 35.26  ?  74   PHE C HD1  1 
ATOM   4374  H  HD2  . PHE C  1 74 ? 63.766 75.837 23.511  1.00 39.83  ?  74   PHE C HD2  1 
ATOM   4375  H  HE1  . PHE C  1 74 ? 64.496 74.184 19.263  1.00 35.67  ?  74   PHE C HE1  1 
ATOM   4376  H  HE2  . PHE C  1 74 ? 65.350 74.194 23.173  1.00 39.75  ?  74   PHE C HE2  1 
ATOM   4377  H  HZ   . PHE C  1 74 ? 65.718 73.365 21.047  1.00 37.38  ?  74   PHE C HZ   1 
ATOM   4378  N  N    . PRO C  1 75 ? 60.550 75.915 24.305  1.00 28.34  ?  75   PRO C N    1 
ATOM   4379  C  CA   . PRO C  1 75 ? 60.532 74.959 25.421  1.00 30.08  ?  75   PRO C CA   1 
ATOM   4380  C  C    . PRO C  1 75 ? 59.388 73.950 25.336  1.00 30.26  ?  75   PRO C C    1 
ATOM   4381  O  O    . PRO C  1 75 ? 59.474 72.882 25.941  1.00 28.48  ?  75   PRO C O    1 
ATOM   4382  C  CB   . PRO C  1 75 ? 60.347 75.857 26.650  1.00 33.18  ?  75   PRO C CB   1 
ATOM   4383  C  CG   . PRO C  1 75 ? 60.846 77.191 26.231  1.00 32.94  ?  75   PRO C CG   1 
ATOM   4384  C  CD   . PRO C  1 75 ? 60.502 77.310 24.776  1.00 29.64  ?  75   PRO C CD   1 
ATOM   4385  H  HA   . PRO C  1 75 ? 61.387 74.486 25.484  1.00 36.09  ?  75   PRO C HA   1 
ATOM   4386  H  HB2  . PRO C  1 75 ? 59.406 75.900 26.885  1.00 39.81  ?  75   PRO C HB2  1 
ATOM   4387  H  HB3  . PRO C  1 75 ? 60.870 75.511 27.390  1.00 39.81  ?  75   PRO C HB3  1 
ATOM   4388  H  HG2  . PRO C  1 75 ? 60.400 77.882 26.745  1.00 39.53  ?  75   PRO C HG2  1 
ATOM   4389  H  HG3  . PRO C  1 75 ? 61.806 77.235 26.360  1.00 39.53  ?  75   PRO C HG3  1 
ATOM   4390  H  HD2  . PRO C  1 75 ? 59.610 77.674 24.667  1.00 35.57  ?  75   PRO C HD2  1 
ATOM   4391  H  HD3  . PRO C  1 75 ? 61.165 77.846 24.314  1.00 35.57  ?  75   PRO C HD3  1 
ATOM   4392  N  N    . TYR C  1 76 ? 58.337 74.283 24.595  1.00 34.53  ?  76   TYR C N    1 
ATOM   4393  C  CA   . TYR C  1 76 ? 57.145 73.444 24.538  1.00 36.17  ?  76   TYR C CA   1 
ATOM   4394  C  C    . TYR C  1 76 ? 56.913 72.867 23.147  1.00 32.15  ?  76   TYR C C    1 
ATOM   4395  O  O    . TYR C  1 76 ? 55.847 72.320 22.867  1.00 32.38  ?  76   TYR C O    1 
ATOM   4396  C  CB   . TYR C  1 76 ? 55.926 74.259 24.965  1.00 39.19  ?  76   TYR C CB   1 
ATOM   4397  C  CG   . TYR C  1 76 ? 56.190 75.135 26.167  1.00 44.43  ?  76   TYR C CG   1 
ATOM   4398  C  CD1  . TYR C  1 76 ? 56.223 74.599 27.446  1.00 47.81  ?  76   TYR C CD1  1 
ATOM   4399  C  CD2  . TYR C  1 76 ? 56.412 76.496 26.022  1.00 47.46  ?  76   TYR C CD2  1 
ATOM   4400  C  CE1  . TYR C  1 76 ? 56.465 75.394 28.547  1.00 52.54  ?  76   TYR C CE1  1 
ATOM   4401  C  CE2  . TYR C  1 76 ? 56.656 77.300 27.117  1.00 52.06  ?  76   TYR C CE2  1 
ATOM   4402  C  CZ   . TYR C  1 76 ? 56.681 76.744 28.377  1.00 55.37  ?  76   TYR C CZ   1 
ATOM   4403  O  OH   . TYR C  1 76 ? 56.923 77.543 29.472  1.00 60.17  ?  76   TYR C OH   1 
ATOM   4404  H  H    . TYR C  1 76 ? 58.289 74.994 24.113  1.00 41.44  ?  76   TYR C H    1 
ATOM   4405  H  HA   . TYR C  1 76 ? 57.249 72.697 25.165  1.00 43.41  ?  76   TYR C HA   1 
ATOM   4406  H  HB2  . TYR C  1 76 ? 55.658 74.832 24.230  1.00 47.02  ?  76   TYR C HB2  1 
ATOM   4407  H  HB3  . TYR C  1 76 ? 55.205 73.651 25.191  1.00 47.02  ?  76   TYR C HB3  1 
ATOM   4408  H  HD1  . TYR C  1 76 ? 56.077 73.688 27.563  1.00 57.37  ?  76   TYR C HD1  1 
ATOM   4409  H  HD2  . TYR C  1 76 ? 56.395 76.874 25.172  1.00 56.95  ?  76   TYR C HD2  1 
ATOM   4410  H  HE1  . TYR C  1 76 ? 56.482 75.021 29.399  1.00 63.05  ?  76   TYR C HE1  1 
ATOM   4411  H  HE2  . TYR C  1 76 ? 56.802 78.211 27.005  1.00 62.47  ?  76   TYR C HE2  1 
ATOM   4412  H  HH   . TYR C  1 76 ? 56.348 78.125 29.526  1.00 72.21  ?  76   TYR C HH   1 
ATOM   4413  N  N    . LEU C  1 77 ? 57.911 72.984 22.278  1.00 31.75  ?  77   LEU C N    1 
ATOM   4414  C  CA   . LEU C  1 77 ? 57.776 72.514 20.907  1.00 29.03  ?  77   LEU C CA   1 
ATOM   4415  C  C    . LEU C  1 77 ? 58.397 71.142 20.690  1.00 29.32  ?  77   LEU C C    1 
ATOM   4416  O  O    . LEU C  1 77 ? 59.417 70.801 21.286  1.00 30.25  ?  77   LEU C O    1 
ATOM   4417  C  CB   . LEU C  1 77 ? 58.424 73.503 19.931  1.00 29.59  ?  77   LEU C CB   1 
ATOM   4418  C  CG   . LEU C  1 77 ? 57.760 74.872 19.759  1.00 28.92  ?  77   LEU C CG   1 
ATOM   4419  C  CD1  . LEU C  1 77 ? 58.507 75.689 18.715  1.00 28.58  ?  77   LEU C CD1  1 
ATOM   4420  C  CD2  . LEU C  1 77 ? 56.292 74.736 19.384  1.00 26.86  ?  77   LEU C CD2  1 
ATOM   4421  H  H    . LEU C  1 77 ? 58.677 73.333 22.459  1.00 38.10  ?  77   LEU C H    1 
ATOM   4422  H  HA   . LEU C  1 77 ? 56.823 72.453 20.686  1.00 34.84  ?  77   LEU C HA   1 
ATOM   4423  H  HB2  . LEU C  1 77 ? 59.333 73.665 20.229  1.00 35.51  ?  77   LEU C HB2  1 
ATOM   4424  H  HB3  . LEU C  1 77 ? 58.447 73.087 19.055  1.00 35.51  ?  77   LEU C HB3  1 
ATOM   4425  H  HG   . LEU C  1 77 ? 57.809 75.351 20.601  1.00 34.71  ?  77   LEU C HG   1 
ATOM   4426  H  HD11 . LEU C  1 77 ? 58.488 75.218 17.878  1.00 34.30  ?  77   LEU C HD11 1 
ATOM   4427  H  HD12 . LEU C  1 77 ? 58.077 76.542 18.621  1.00 34.30  ?  77   LEU C HD12 1 
ATOM   4428  H  HD13 . LEU C  1 77 ? 59.415 75.809 19.003  1.00 34.30  ?  77   LEU C HD13 1 
ATOM   4429  H  HD21 . LEU C  1 77 ? 55.835 74.258 20.080  1.00 32.23  ?  77   LEU C HD21 1 
ATOM   4430  H  HD22 . LEU C  1 77 ? 55.913 75.613 19.286  1.00 32.23  ?  77   LEU C HD22 1 
ATOM   4431  H  HD23 . LEU C  1 77 ? 56.225 74.255 18.557  1.00 32.23  ?  77   LEU C HD23 1 
ATOM   4432  N  N    . THR C  1 78 ? 57.755 70.358 19.834  1.00 27.30  ?  78   THR C N    1 
ATOM   4433  C  CA   . THR C  1 78 ? 58.388 69.209 19.211  1.00 28.47  ?  78   THR C CA   1 
ATOM   4434  C  C    . THR C  1 78 ? 58.665 69.643 17.780  1.00 27.63  ?  78   THR C C    1 
ATOM   4435  O  O    . THR C  1 78 ? 57.759 70.100 17.082  1.00 25.84  ?  78   THR C O    1 
ATOM   4436  C  CB   . THR C  1 78 ? 57.476 67.975 19.211  1.00 29.16  ?  78   THR C CB   1 
ATOM   4437  O  OG1  . THR C  1 78 ? 57.181 67.594 20.560  1.00 31.87  ?  78   THR C OG1  1 
ATOM   4438  C  CG2  . THR C  1 78 ? 58.145 66.811 18.493  1.00 28.96  ?  78   THR C CG2  1 
ATOM   4439  H  H    . THR C  1 78 ? 56.937 70.474 19.595  1.00 32.76  ?  78   THR C H    1 
ATOM   4440  H  HA   . THR C  1 78 ? 59.233 68.995 19.659  1.00 34.16  ?  78   THR C HA   1 
ATOM   4441  H  HB   . THR C  1 78 ? 56.650 68.186 18.748  1.00 35.00  ?  78   THR C HB   1 
ATOM   4442  H  HG1  . THR C  1 78 ? 56.802 68.208 20.948  1.00 38.25  ?  78   THR C HG1  1 
ATOM   4443  H  HG21 . THR C  1 78 ? 58.968 66.584 18.933  1.00 34.76  ?  78   THR C HG21 1 
ATOM   4444  H  HG22 . THR C  1 78 ? 57.566 66.046 18.499  1.00 34.76  ?  78   THR C HG22 1 
ATOM   4445  H  HG23 . THR C  1 78 ? 58.335 67.052 17.583  1.00 34.76  ?  78   THR C HG23 1 
ATOM   4446  N  N    . ILE C  1 79 ? 59.916 69.521 17.347  1.00 30.79  ?  79   ILE C N    1 
ATOM   4447  C  CA   . ILE C  1 79 ? 60.328 70.082 16.068  1.00 30.83  ?  79   ILE C CA   1 
ATOM   4448  C  C    . ILE C  1 79 ? 60.961 69.047 15.146  1.00 29.78  ?  79   ILE C C    1 
ATOM   4449  O  O    . ILE C  1 79 ? 61.874 68.323 15.540  1.00 29.42  ?  79   ILE C O    1 
ATOM   4450  C  CB   . ILE C  1 79 ? 61.325 71.237 16.270  1.00 31.36  ?  79   ILE C CB   1 
ATOM   4451  C  CG1  . ILE C  1 79 ? 60.624 72.423 16.939  1.00 31.17  ?  79   ILE C CG1  1 
ATOM   4452  C  CG2  . ILE C  1 79 ? 61.931 71.657 14.939  1.00 30.55  ?  79   ILE C CG2  1 
ATOM   4453  C  CD1  . ILE C  1 79 ? 61.523 73.610 17.197  1.00 30.77  ?  79   ILE C CD1  1 
ATOM   4454  H  H    . ILE C  1 79 ? 60.543 69.118 17.776  1.00 36.94  ?  79   ILE C H    1 
ATOM   4455  H  HA   . ILE C  1 79 ? 59.538 70.444 15.614  1.00 36.99  ?  79   ILE C HA   1 
ATOM   4456  H  HB   . ILE C  1 79 ? 62.038 70.931 16.852  1.00 37.63  ?  79   ILE C HB   1 
ATOM   4457  H  HG12 . ILE C  1 79 ? 59.900 72.721 16.365  1.00 37.40  ?  79   ILE C HG12 1 
ATOM   4458  H  HG13 . ILE C  1 79 ? 60.267 72.133 17.793  1.00 37.40  ?  79   ILE C HG13 1 
ATOM   4459  H  HG21 . ILE C  1 79 ? 61.228 71.947 14.353  1.00 36.66  ?  79   ILE C HG21 1 
ATOM   4460  H  HG22 . ILE C  1 79 ? 62.548 72.377 15.091  1.00 36.66  ?  79   ILE C HG22 1 
ATOM   4461  H  HG23 . ILE C  1 79 ? 62.390 70.907 14.555  1.00 36.66  ?  79   ILE C HG23 1 
ATOM   4462  H  HD11 . ILE C  1 79 ? 61.877 73.921 16.360  1.00 36.92  ?  79   ILE C HD11 1 
ATOM   4463  H  HD12 . ILE C  1 79 ? 61.010 74.305 17.615  1.00 36.92  ?  79   ILE C HD12 1 
ATOM   4464  H  HD13 . ILE C  1 79 ? 62.240 73.338 17.775  1.00 36.92  ?  79   ILE C HD13 1 
ATOM   4465  N  N    . ASP C  1 80 ? 60.462 68.987 13.915  1.00 31.56  ?  80   ASP C N    1 
ATOM   4466  C  CA   A ASP C  1 80 ? 61.034 68.118 12.898  0.58 31.73  ?  80   ASP C CA   1 
ATOM   4467  C  CA   B ASP C  1 80 ? 61.038 68.119 12.897  0.42 31.67  ?  80   ASP C CA   1 
ATOM   4468  C  C    . ASP C  1 80 ? 61.603 68.958 11.759  1.00 30.08  ?  80   ASP C C    1 
ATOM   4469  O  O    . ASP C  1 80 ? 60.880 69.723 11.121  1.00 31.19  ?  80   ASP C O    1 
ATOM   4470  C  CB   A ASP C  1 80 ? 59.977 67.150 12.365  0.58 32.92  ?  80   ASP C CB   1 
ATOM   4471  C  CB   B ASP C  1 80 ? 59.991 67.147 12.352  0.42 33.03  ?  80   ASP C CB   1 
ATOM   4472  C  CG   A ASP C  1 80 ? 59.361 66.299 13.461  0.58 35.31  ?  80   ASP C CG   1 
ATOM   4473  C  CG   B ASP C  1 80 ? 60.550 66.235 11.277  0.42 32.78  ?  80   ASP C CG   1 
ATOM   4474  O  OD1  A ASP C  1 80 ? 60.080 65.451 14.030  0.58 38.27  ?  80   ASP C OD1  1 
ATOM   4475  O  OD1  B ASP C  1 80 ? 61.063 65.149 11.623  0.42 35.64  ?  80   ASP C OD1  1 
ATOM   4476  O  OD2  A ASP C  1 80 ? 58.158 66.475 13.752  0.58 37.04  ?  80   ASP C OD2  1 
ATOM   4477  O  OD2  B ASP C  1 80 ? 60.482 66.605 10.086  0.42 32.12  ?  80   ASP C OD2  1 
ATOM   4478  H  H    A ASP C  1 80 ? 59.787 69.445 13.644  0.58 37.87  ?  80   ASP C H    1 
ATOM   4479  H  H    B ASP C  1 80 ? 59.785 69.443 13.644  0.42 37.87  ?  80   ASP C H    1 
ATOM   4480  H  HA   A ASP C  1 80 ? 61.764 67.594 13.290  0.58 38.07  ?  80   ASP C HA   1 
ATOM   4481  H  HA   B ASP C  1 80 ? 61.769 67.597 13.289  0.42 38.01  ?  80   ASP C HA   1 
ATOM   4482  H  HB2  A ASP C  1 80 ? 59.266 67.658 11.944  0.58 39.51  ?  80   ASP C HB2  1 
ATOM   4483  H  HB2  B ASP C  1 80 ? 59.666 66.593 13.079  0.42 39.63  ?  80   ASP C HB2  1 
ATOM   4484  H  HB3  A ASP C  1 80 ? 60.389 66.555 11.719  0.58 39.51  ?  80   ASP C HB3  1 
ATOM   4485  H  HB3  B ASP C  1 80 ? 59.260 67.654 11.967  0.42 39.63  ?  80   ASP C HB3  1 
ATOM   4486  N  N    . VAL C  1 81 ? 62.901 68.811 11.512  1.00 27.82  ?  81   VAL C N    1 
ATOM   4487  C  CA   . VAL C  1 81 ? 63.582 69.581 10.480  1.00 26.14  ?  81   VAL C CA   1 
ATOM   4488  C  C    . VAL C  1 81 ? 63.941 68.697 9.289   1.00 24.89  ?  81   VAL C C    1 
ATOM   4489  O  O    . VAL C  1 81 ? 64.415 67.573 9.450   1.00 25.69  ?  81   VAL C O    1 
ATOM   4490  C  CB   . VAL C  1 81 ? 64.854 70.246 11.038  1.00 28.76  ?  81   VAL C CB   1 
ATOM   4491  C  CG1  . VAL C  1 81 ? 65.647 70.909 9.921   1.00 31.05  ?  81   VAL C CG1  1 
ATOM   4492  C  CG2  . VAL C  1 81 ? 64.485 71.259 12.112  1.00 28.36  ?  81   VAL C CG2  1 
ATOM   4493  H  H    . VAL C  1 81 ? 63.414 68.264 11.934  1.00 33.38  ?  81   VAL C H    1 
ATOM   4494  H  HA   . VAL C  1 81 ? 62.984 70.289 10.163  1.00 31.37  ?  81   VAL C HA   1 
ATOM   4495  H  HB   . VAL C  1 81 ? 65.421 69.560 11.448  1.00 34.51  ?  81   VAL C HB   1 
ATOM   4496  H  HG11 . VAL C  1 81 ? 65.099 71.578 9.504   1.00 37.26  ?  81   VAL C HG11 1 
ATOM   4497  H  HG12 . VAL C  1 81 ? 66.433 71.315 10.295  1.00 37.26  ?  81   VAL C HG12 1 
ATOM   4498  H  HG13 . VAL C  1 81 ? 65.897 70.242 9.278   1.00 37.26  ?  81   VAL C HG13 1 
ATOM   4499  H  HG21 . VAL C  1 81 ? 64.023 70.807 12.822  1.00 34.03  ?  81   VAL C HG21 1 
ATOM   4500  H  HG22 . VAL C  1 81 ? 65.288 71.664 12.448  1.00 34.03  ?  81   VAL C HG22 1 
ATOM   4501  H  HG23 . VAL C  1 81 ? 63.916 71.929 11.726  1.00 34.03  ?  81   VAL C HG23 1 
ATOM   4502  N  N    . GLU C  1 82 ? 63.712 69.223 8.093   1.00 24.50  ?  82   GLU C N    1 
ATOM   4503  C  CA   . GLU C  1 82 ? 63.863 68.449 6.871   1.00 27.52  ?  82   GLU C CA   1 
ATOM   4504  C  C    . GLU C  1 82 ? 64.362 69.342 5.741   1.00 27.51  ?  82   GLU C C    1 
ATOM   4505  O  O    . GLU C  1 82 ? 63.669 70.273 5.334   1.00 29.21  ?  82   GLU C O    1 
ATOM   4506  C  CB   . GLU C  1 82 ? 62.515 67.829 6.501   1.00 30.91  ?  82   GLU C CB   1 
ATOM   4507  C  CG   . GLU C  1 82 ? 62.440 67.230 5.109   1.00 34.92  ?  82   GLU C CG   1 
ATOM   4508  C  CD   . GLU C  1 82 ? 61.080 66.614 4.826   1.00 37.50  ?  82   GLU C CD   1 
ATOM   4509  O  OE1  . GLU C  1 82 ? 60.285 66.469 5.779   1.00 37.57  ?  82   GLU C OE1  1 
ATOM   4510  O  OE2  . GLU C  1 82 ? 60.805 66.279 3.654   1.00 39.58  ?  82   GLU C OE2  1 
ATOM   4511  H  H    . GLU C  1 82 ? 63.466 70.037 7.962   1.00 29.40  ?  82   GLU C H    1 
ATOM   4512  H  HA   . GLU C  1 82 ? 64.512 67.729 7.013   1.00 33.03  ?  82   GLU C HA   1 
ATOM   4513  H  HB2  . GLU C  1 82 ? 62.318 67.121 7.134   1.00 37.09  ?  82   GLU C HB2  1 
ATOM   4514  H  HB3  . GLU C  1 82 ? 61.833 68.516 6.560   1.00 37.09  ?  82   GLU C HB3  1 
ATOM   4515  H  HG2  . GLU C  1 82 ? 62.599 67.927 4.454   1.00 41.90  ?  82   GLU C HG2  1 
ATOM   4516  H  HG3  . GLU C  1 82 ? 63.110 66.533 5.026   1.00 41.90  ?  82   GLU C HG3  1 
ATOM   4517  N  N    . PRO C  1 83 ? 65.572 69.067 5.231   1.00 28.27  ?  83   PRO C N    1 
ATOM   4518  C  CA   . PRO C  1 83 ? 66.108 69.878 4.131   1.00 25.77  ?  83   PRO C CA   1 
ATOM   4519  C  C    . PRO C  1 83 ? 65.295 69.707 2.854   1.00 22.32  ?  83   PRO C C    1 
ATOM   4520  O  O    . PRO C  1 83 ? 64.866 68.597 2.555   1.00 20.70  ?  83   PRO C O    1 
ATOM   4521  C  CB   . PRO C  1 83 ? 67.524 69.317 3.927   1.00 29.08  ?  83   PRO C CB   1 
ATOM   4522  C  CG   . PRO C  1 83 ? 67.813 68.482 5.127   1.00 29.99  ?  83   PRO C CG   1 
ATOM   4523  C  CD   . PRO C  1 83 ? 66.494 67.990 5.623   1.00 29.02  ?  83   PRO C CD   1 
ATOM   4524  H  HA   . PRO C  1 83 ? 66.153 70.825 4.380   1.00 30.93  ?  83   PRO C HA   1 
ATOM   4525  H  HB2  . PRO C  1 83 ? 67.545 68.775 3.122   1.00 34.89  ?  83   PRO C HB2  1 
ATOM   4526  H  HB3  . PRO C  1 83 ? 68.157 70.049 3.861   1.00 34.89  ?  83   PRO C HB3  1 
ATOM   4527  H  HG2  . PRO C  1 83 ? 68.379 67.736 4.873   1.00 35.99  ?  83   PRO C HG2  1 
ATOM   4528  H  HG3  . PRO C  1 83 ? 68.248 69.025 5.802   1.00 35.99  ?  83   PRO C HG3  1 
ATOM   4529  H  HD2  . PRO C  1 83 ? 66.254 67.160 5.183   1.00 34.83  ?  83   PRO C HD2  1 
ATOM   4530  H  HD3  . PRO C  1 83 ? 66.510 67.892 6.588   1.00 34.83  ?  83   PRO C HD3  1 
ATOM   4531  N  N    . LEU C  1 84 ? 65.093 70.792 2.114   1.00 23.51  ?  84   LEU C N    1 
ATOM   4532  C  CA   . LEU C  1 84 ? 64.394 70.732 0.835   1.00 25.27  ?  84   LEU C CA   1 
ATOM   4533  C  C    . LEU C  1 84 ? 65.358 71.035 -0.304  1.00 27.55  ?  84   LEU C C    1 
ATOM   4534  O  O    . LEU C  1 84 ? 66.154 71.966 -0.216  1.00 28.59  ?  84   LEU C O    1 
ATOM   4535  C  CB   . LEU C  1 84 ? 63.239 71.734 0.805   1.00 26.24  ?  84   LEU C CB   1 
ATOM   4536  C  CG   . LEU C  1 84 ? 62.103 71.508 1.804   1.00 25.93  ?  84   LEU C CG   1 
ATOM   4537  C  CD1  . LEU C  1 84 ? 61.180 72.718 1.836   1.00 25.76  ?  84   LEU C CD1  1 
ATOM   4538  C  CD2  . LEU C  1 84 ? 61.322 70.255 1.453   1.00 25.99  ?  84   LEU C CD2  1 
ATOM   4539  H  H    . LEU C  1 84 ? 65.354 71.582 2.332   1.00 28.22  ?  84   LEU C H    1 
ATOM   4540  H  HA   . LEU C  1 84 ? 64.029 69.832 0.703   1.00 30.32  ?  84   LEU C HA   1 
ATOM   4541  H  HB2  . LEU C  1 84 ? 63.601 72.618 0.978   1.00 31.49  ?  84   LEU C HB2  1 
ATOM   4542  H  HB3  . LEU C  1 84 ? 62.847 71.718 -0.082  1.00 31.49  ?  84   LEU C HB3  1 
ATOM   4543  H  HG   . LEU C  1 84 ? 62.479 71.391 2.691   1.00 31.12  ?  84   LEU C HG   1 
ATOM   4544  H  HD11 . LEU C  1 84 ? 60.811 72.852 0.960   1.00 30.91  ?  84   LEU C HD11 1 
ATOM   4545  H  HD12 . LEU C  1 84 ? 60.476 72.556 2.468   1.00 30.91  ?  84   LEU C HD12 1 
ATOM   4546  H  HD13 . LEU C  1 84 ? 61.687 73.489 2.101   1.00 30.91  ?  84   LEU C HD13 1 
ATOM   4547  H  HD21 . LEU C  1 84 ? 61.915 69.501 1.476   1.00 31.18  ?  84   LEU C HD21 1 
ATOM   4548  H  HD22 . LEU C  1 84 ? 60.617 70.137 2.094   1.00 31.18  ?  84   LEU C HD22 1 
ATOM   4549  H  HD23 . LEU C  1 84 ? 60.951 70.355 0.573   1.00 31.18  ?  84   LEU C HD23 1 
ATOM   4550  N  N    . SER C  1 85 ? 65.279 70.246 -1.371  1.00 27.94  ?  85   SER C N    1 
ATOM   4551  C  CA   . SER C  1 85 ? 66.123 70.443 -2.543  1.00 30.40  ?  85   SER C CA   1 
ATOM   4552  C  C    . SER C  1 85 ? 65.289 70.894 -3.737  1.00 28.58  ?  85   SER C C    1 
ATOM   4553  O  O    . SER C  1 85 ? 64.085 70.636 -3.801  1.00 28.68  ?  85   SER C O    1 
ATOM   4554  C  CB   . SER C  1 85 ? 66.859 69.148 -2.890  1.00 31.60  ?  85   SER C CB   1 
ATOM   4555  O  OG   . SER C  1 85 ? 67.806 68.816 -1.892  1.00 32.72  ?  85   SER C OG   1 
ATOM   4556  H  H    . SER C  1 85 ? 64.738 69.581 -1.440  1.00 33.53  ?  85   SER C H    1 
ATOM   4557  H  HA   . SER C  1 85 ? 66.789 71.136 -2.351  1.00 36.47  ?  85   SER C HA   1 
ATOM   4558  H  HB2  . SER C  1 85 ? 66.212 68.428 -2.962  1.00 37.93  ?  85   SER C HB2  1 
ATOM   4559  H  HB3  . SER C  1 85 ? 67.319 69.265 -3.735  1.00 37.93  ?  85   SER C HB3  1 
ATOM   4560  H  HG   . SER C  1 85 ? 67.796 69.380 -1.297  1.00 39.27  ?  85   SER C HG   1 
ATOM   4561  N  N    . HIS C  1 86 ? 65.929 71.577 -4.679  1.00 23.97  ?  86   HIS C N    1 
ATOM   4562  C  CA   . HIS C  1 86 ? 65.255 71.976 -5.905  1.00 24.01  ?  86   HIS C CA   1 
ATOM   4563  C  C    . HIS C  1 86 ? 64.822 70.740 -6.679  1.00 22.88  ?  86   HIS C C    1 
ATOM   4564  O  O    . HIS C  1 86 ? 65.587 69.791 -6.838  1.00 21.34  ?  86   HIS C O    1 
ATOM   4565  C  CB   . HIS C  1 86 ? 66.163 72.837 -6.780  1.00 28.67  ?  86   HIS C CB   1 
ATOM   4566  C  CG   . HIS C  1 86 ? 65.570 73.166 -8.115  1.00 32.13  ?  86   HIS C CG   1 
ATOM   4567  N  ND1  . HIS C  1 86 ? 64.712 74.229 -8.307  1.00 34.50  ?  86   HIS C ND1  1 
ATOM   4568  C  CD2  . HIS C  1 86 ? 65.699 72.565 -9.321  1.00 34.76  ?  86   HIS C CD2  1 
ATOM   4569  C  CE1  . HIS C  1 86 ? 64.345 74.271 -9.575  1.00 37.27  ?  86   HIS C CE1  1 
ATOM   4570  N  NE2  . HIS C  1 86 ? 64.930 73.273 -10.212 1.00 37.46  ?  86   HIS C NE2  1 
ATOM   4571  H  H    . HIS C  1 86 ? 66.753 71.821 -4.632  1.00 28.76  ?  86   HIS C H    1 
ATOM   4572  H  HA   . HIS C  1 86 ? 64.455 72.497 -5.682  1.00 28.81  ?  86   HIS C HA   1 
ATOM   4573  H  HB2  . HIS C  1 86 ? 66.342 73.672 -6.320  1.00 34.40  ?  86   HIS C HB2  1 
ATOM   4574  H  HB3  . HIS C  1 86 ? 66.994 72.360 -6.934  1.00 34.40  ?  86   HIS C HB3  1 
ATOM   4575  H  HD1  . HIS C  1 86 ? 64.459 74.779 -7.697  1.00 41.41  ?  86   HIS C HD1  1 
ATOM   4576  H  HD2  . HIS C  1 86 ? 66.215 71.815 -9.511  1.00 41.71  ?  86   HIS C HD2  1 
ATOM   4577  H  HE1  . HIS C  1 86 ? 63.772 74.898 -9.955  1.00 44.72  ?  86   HIS C HE1  1 
ATOM   4578  H  HE2  . HIS C  1 86 ? 64.844 73.094 -11.049 1.00 44.96  ?  86   HIS C HE2  1 
ATOM   4579  N  N    . HIS C  1 87 ? 63.585 70.756 -7.153  1.00 22.36  ?  87   HIS C N    1 
ATOM   4580  C  CA   . HIS C  1 87 ? 63.039 69.638 -7.902  1.00 22.41  ?  87   HIS C CA   1 
ATOM   4581  C  C    . HIS C  1 87 ? 63.173 69.953 -9.393  1.00 23.01  ?  87   HIS C C    1 
ATOM   4582  O  O    . HIS C  1 87 ? 62.828 71.053 -9.826  1.00 23.33  ?  87   HIS C O    1 
ATOM   4583  C  CB   . HIS C  1 87 ? 61.576 69.424 -7.508  1.00 21.69  ?  87   HIS C CB   1 
ATOM   4584  C  CG   . HIS C  1 87 ? 61.015 68.112 -7.956  1.00 22.15  ?  87   HIS C CG   1 
ATOM   4585  N  ND1  . HIS C  1 87 ? 60.591 67.890 -9.246  1.00 23.82  ?  87   HIS C ND1  1 
ATOM   4586  C  CD2  . HIS C  1 87 ? 60.802 66.956 -7.285  1.00 21.25  ?  87   HIS C CD2  1 
ATOM   4587  C  CE1  . HIS C  1 87 ? 60.145 66.651 -9.356  1.00 23.84  ?  87   HIS C CE1  1 
ATOM   4588  N  NE2  . HIS C  1 87 ? 60.263 66.062 -8.180  1.00 22.26  ?  87   HIS C NE2  1 
ATOM   4589  H  H    . HIS C  1 87 ? 63.036 71.411 -7.052  1.00 26.83  ?  87   HIS C H    1 
ATOM   4590  H  HA   . HIS C  1 87 ? 63.545 68.823 -7.703  1.00 26.89  ?  87   HIS C HA   1 
ATOM   4591  H  HB2  . HIS C  1 87 ? 61.505 69.462 -6.542  1.00 26.02  ?  87   HIS C HB2  1 
ATOM   4592  H  HB3  . HIS C  1 87 ? 61.039 70.127 -7.906  1.00 26.02  ?  87   HIS C HB3  1 
ATOM   4593  H  HD1  . HIS C  1 87 ? 60.615 68.467 -9.884  1.00 28.59  ?  87   HIS C HD1  1 
ATOM   4594  H  HD2  . HIS C  1 87 ? 60.990 66.795 -6.389  1.00 25.50  ?  87   HIS C HD2  1 
ATOM   4595  H  HE1  . HIS C  1 87 ? 59.805 66.261 -10.129 1.00 28.61  ?  87   HIS C HE1  1 
ATOM   4596  H  HE2  . HIS C  1 87 ? 60.036 65.252 -8.001  1.00 26.71  ?  87   HIS C HE2  1 
ATOM   4597  N  N    . PRO C  1 88 ? 63.697 68.997 -10.180 1.00 23.07  ?  88   PRO C N    1 
ATOM   4598  C  CA   . PRO C  1 88 ? 63.958 69.230 -11.610 1.00 27.41  ?  88   PRO C CA   1 
ATOM   4599  C  C    . PRO C  1 88 ? 62.709 69.581 -12.416 1.00 28.66  ?  88   PRO C C    1 
ATOM   4600  O  O    . PRO C  1 88 ? 62.784 70.375 -13.352 1.00 30.03  ?  88   PRO C O    1 
ATOM   4601  C  CB   . PRO C  1 88 ? 64.550 67.896 -12.091 1.00 28.63  ?  88   PRO C CB   1 
ATOM   4602  C  CG   . PRO C  1 88 ? 64.184 66.894 -11.043 1.00 25.55  ?  88   PRO C CG   1 
ATOM   4603  C  CD   . PRO C  1 88 ? 64.112 67.649 -9.756  1.00 22.42  ?  88   PRO C CD   1 
ATOM   4604  H  HA   . PRO C  1 88 ? 64.626 69.939 -11.723 1.00 32.89  ?  88   PRO C HA   1 
ATOM   4605  H  HB2  . PRO C  1 88 ? 64.158 67.656 -12.945 1.00 34.36  ?  88   PRO C HB2  1 
ATOM   4606  H  HB3  . PRO C  1 88 ? 65.514 67.976 -12.167 1.00 34.36  ?  88   PRO C HB3  1 
ATOM   4607  H  HG2  . PRO C  1 88 ? 63.323 66.501 -11.256 1.00 30.66  ?  88   PRO C HG2  1 
ATOM   4608  H  HG3  . PRO C  1 88 ? 64.869 66.208 -10.997 1.00 30.66  ?  88   PRO C HG3  1 
ATOM   4609  H  HD2  . PRO C  1 88 ? 63.444 67.258 -9.171  1.00 26.91  ?  88   PRO C HD2  1 
ATOM   4610  H  HD3  . PRO C  1 88 ? 64.984 67.681 -9.332  1.00 26.91  ?  88   PRO C HD3  1 
ATOM   4611  N  N    . ALA C  1 89 ? 61.581 68.976 -12.062 1.00 26.10  ?  89   ALA C N    1 
ATOM   4612  C  CA   . ALA C  1 89 ? 60.298 69.289 -12.689 1.00 26.54  ?  89   ALA C CA   1 
ATOM   4613  C  C    . ALA C  1 89 ? 59.647 70.577 -12.175 1.00 25.65  ?  89   ALA C C    1 
ATOM   4614  O  O    . ALA C  1 89 ? 58.538 70.917 -12.591 1.00 24.62  ?  89   ALA C O    1 
ATOM   4615  C  CB   . ALA C  1 89 ? 59.335 68.120 -12.510 1.00 25.04  ?  89   ALA C CB   1 
ATOM   4616  H  H    . ALA C  1 89 ? 61.530 68.371 -11.453 1.00 31.32  ?  89   ALA C H    1 
ATOM   4617  H  HA   . ALA C  1 89 ? 60.446 69.401 -13.652 1.00 31.85  ?  89   ALA C HA   1 
ATOM   4618  H  HB1  . ALA C  1 89 ? 59.204 67.965 -11.571 1.00 30.05  ?  89   ALA C HB1  1 
ATOM   4619  H  HB2  . ALA C  1 89 ? 58.498 68.339 -12.926 1.00 30.05  ?  89   ALA C HB2  1 
ATOM   4620  H  HB3  . ALA C  1 89 ? 59.711 67.339 -12.922 1.00 30.05  ?  89   ALA C HB3  1 
ATOM   4621  N  N    . ARG C  1 90 ? 60.317 71.293 -11.275 1.00 29.50  ?  90   ARG C N    1 
ATOM   4622  C  CA   . ARG C  1 90 ? 59.751 72.527 -10.734 1.00 28.29  ?  90   ARG C CA   1 
ATOM   4623  C  C    . ARG C  1 90 ? 59.689 73.616 -11.796 1.00 29.83  ?  90   ARG C C    1 
ATOM   4624  O  O    . ARG C  1 90 ? 60.673 73.888 -12.483 1.00 31.86  ?  90   ARG C O    1 
ATOM   4625  C  CB   . ARG C  1 90 ? 60.556 73.031 -9.533  1.00 26.17  ?  90   ARG C CB   1 
ATOM   4626  C  CG   . ARG C  1 90 ? 60.103 74.391 -8.999  1.00 25.28  ?  90   ARG C CG   1 
ATOM   4627  C  CD   . ARG C  1 90 ? 58.649 74.372 -8.528  1.00 24.30  ?  90   ARG C CD   1 
ATOM   4628  N  NE   . ARG C  1 90 ? 58.197 75.687 -8.069  1.00 26.34  ?  90   ARG C NE   1 
ATOM   4629  C  CZ   . ARG C  1 90 ? 56.921 76.053 -7.954  1.00 27.83  ?  90   ARG C CZ   1 
ATOM   4630  N  NH1  . ARG C  1 90 ? 55.944 75.211 -8.270  1.00 27.27  ?  90   ARG C NH1  1 
ATOM   4631  N  NH2  . ARG C  1 90 ? 56.615 77.271 -7.529  1.00 30.20  ?  90   ARG C NH2  1 
ATOM   4632  H  H    . ARG C  1 90 ? 61.092 71.089 -10.964 1.00 35.40  ?  90   ARG C H    1 
ATOM   4633  H  HA   . ARG C  1 90 ? 58.836 72.350 -10.431 1.00 33.95  ?  90   ARG C HA   1 
ATOM   4634  H  HB2  . ARG C  1 90 ? 60.473 72.388 -8.811  1.00 31.41  ?  90   ARG C HB2  1 
ATOM   4635  H  HB3  . ARG C  1 90 ? 61.487 73.111 -9.794  1.00 31.41  ?  90   ARG C HB3  1 
ATOM   4636  H  HG2  . ARG C  1 90 ? 60.661 74.638 -8.245  1.00 30.34  ?  90   ARG C HG2  1 
ATOM   4637  H  HG3  . ARG C  1 90 ? 60.183 75.052 -9.704  1.00 30.34  ?  90   ARG C HG3  1 
ATOM   4638  H  HD2  . ARG C  1 90 ? 58.080 74.098 -9.264  1.00 29.16  ?  90   ARG C HD2  1 
ATOM   4639  H  HD3  . ARG C  1 90 ? 58.562 73.749 -7.789  1.00 29.16  ?  90   ARG C HD3  1 
ATOM   4640  H  HE   . ARG C  1 90 ? 58.799 76.264 -7.858  1.00 31.61  ?  90   ARG C HE   1 
ATOM   4641  H  HH11 . ARG C  1 90 ? 56.132 74.418 -8.547  1.00 32.72  ?  90   ARG C HH11 1 
ATOM   4642  H  HH12 . ARG C  1 90 ? 55.124 75.456 -8.193  1.00 32.72  ?  90   ARG C HH12 1 
ATOM   4643  H  HH21 . ARG C  1 90 ? 57.241 77.825 -7.323  1.00 36.24  ?  90   ARG C HH21 1 
ATOM   4644  H  HH22 . ARG C  1 90 ? 55.791 77.507 -7.457  1.00 36.24  ?  90   ARG C HH22 1 
ATOM   4645  N  N    . VAL C  1 91 ? 58.516 74.227 -11.920 1.00 27.57  ?  91   VAL C N    1 
ATOM   4646  C  CA   . VAL C  1 91 ? 58.315 75.372 -12.794 1.00 31.11  ?  91   VAL C CA   1 
ATOM   4647  C  C    . VAL C  1 91 ? 58.044 76.592 -11.924 1.00 32.78  ?  91   VAL C C    1 
ATOM   4648  O  O    . VAL C  1 91 ? 57.150 76.574 -11.077 1.00 31.88  ?  91   VAL C O    1 
ATOM   4649  C  CB   . VAL C  1 91 ? 57.119 75.151 -13.741 1.00 33.73  ?  91   VAL C CB   1 
ATOM   4650  C  CG1  . VAL C  1 91 ? 56.892 76.374 -14.613 1.00 34.61  ?  91   VAL C CG1  1 
ATOM   4651  C  CG2  . VAL C  1 91 ? 57.343 73.915 -14.600 1.00 35.84  ?  91   VAL C CG2  1 
ATOM   4652  H  H    . VAL C  1 91 ? 57.806 73.990 -11.497 1.00 33.08  ?  91   VAL C H    1 
ATOM   4653  H  HA   . VAL C  1 91 ? 59.121 75.533 -13.328 1.00 37.33  ?  91   VAL C HA   1 
ATOM   4654  H  HB   . VAL C  1 91 ? 56.311 75.006 -13.206 1.00 40.48  ?  91   VAL C HB   1 
ATOM   4655  H  HG11 . VAL C  1 91 ? 57.682 76.535 -15.135 1.00 41.53  ?  91   VAL C HG11 1 
ATOM   4656  H  HG12 . VAL C  1 91 ? 56.144 76.210 -15.192 1.00 41.53  ?  91   VAL C HG12 1 
ATOM   4657  H  HG13 . VAL C  1 91 ? 56.712 77.129 -14.049 1.00 41.53  ?  91   VAL C HG13 1 
ATOM   4658  H  HG21 . VAL C  1 91 ? 57.439 73.151 -14.027 1.00 43.01  ?  91   VAL C HG21 1 
ATOM   4659  H  HG22 . VAL C  1 91 ? 56.587 73.798 -15.180 1.00 43.01  ?  91   VAL C HG22 1 
ATOM   4660  H  HG23 . VAL C  1 91 ? 58.140 74.038 -15.120 1.00 43.01  ?  91   VAL C HG23 1 
ATOM   4661  N  N    . GLY C  1 92 ? 58.817 77.650 -12.126 1.00 36.47  ?  92   GLY C N    1 
ATOM   4662  C  CA   . GLY C  1 92 ? 58.689 78.839 -11.305 1.00 37.29  ?  92   GLY C CA   1 
ATOM   4663  C  C    . GLY C  1 92 ? 59.636 78.815 -10.119 1.00 36.71  ?  92   GLY C C    1 
ATOM   4664  O  O    . GLY C  1 92 ? 60.636 78.099 -10.126 1.00 34.76  ?  92   GLY C O    1 
ATOM   4665  H  H    . GLY C  1 92 ? 59.424 77.703 -12.733 1.00 43.76  ?  92   GLY C H    1 
ATOM   4666  H  HA2  . GLY C  1 92 ? 58.884 79.625 -11.840 1.00 44.74  ?  92   GLY C HA2  1 
ATOM   4667  H  HA3  . GLY C  1 92 ? 57.780 78.909 -10.974 1.00 44.74  ?  92   GLY C HA3  1 
ATOM   4668  N  N    . LYS C  1 93 ? 59.310 79.594 -9.093  1.00 40.95  ?  93   LYS C N    1 
ATOM   4669  C  CA   . LYS C  1 93 ? 60.217 79.811 -7.971  1.00 44.43  ?  93   LYS C CA   1 
ATOM   4670  C  C    . LYS C  1 93 ? 59.997 78.808 -6.838  1.00 47.85  ?  93   LYS C C    1 
ATOM   4671  O  O    . LYS C  1 93 ? 58.910 78.252 -6.686  1.00 40.20  ?  93   LYS C O    1 
ATOM   4672  C  CB   . LYS C  1 93 ? 60.052 81.241 -7.447  1.00 46.34  ?  93   LYS C CB   1 
ATOM   4673  C  CG   . LYS C  1 93 ? 60.168 82.308 -8.533  1.00 50.16  ?  93   LYS C CG   1 
ATOM   4674  C  CD   . LYS C  1 93 ? 60.045 83.713 -7.962  1.00 53.45  ?  93   LYS C CD   1 
ATOM   4675  C  CE   . LYS C  1 93 ? 60.339 84.781 -9.013  1.00 57.59  ?  93   LYS C CE   1 
ATOM   4676  N  NZ   . LYS C  1 93 ? 59.289 84.874 -10.069 1.00 58.45  ?  93   LYS C NZ   1 
ATOM   4677  H  H    . LYS C  1 93 ? 58.562 80.012 -9.022  1.00 49.14  ?  93   LYS C H    1 
ATOM   4678  H  HA   . LYS C  1 93 ? 61.139 79.711 -8.285  1.00 53.32  ?  93   LYS C HA   1 
ATOM   4679  H  HB2  . LYS C  1 93 ? 59.175 81.326 -7.040  1.00 55.61  ?  93   LYS C HB2  1 
ATOM   4680  H  HB3  . LYS C  1 93 ? 60.740 81.413 -6.786  1.00 55.61  ?  93   LYS C HB3  1 
ATOM   4681  H  HG2  . LYS C  1 93 ? 61.034 82.231 -8.964  1.00 60.20  ?  93   LYS C HG2  1 
ATOM   4682  H  HG3  . LYS C  1 93 ? 59.458 82.181 -9.182  1.00 60.20  ?  93   LYS C HG3  1 
ATOM   4683  H  HD2  . LYS C  1 93 ? 59.140 83.847 -7.639  1.00 64.14  ?  93   LYS C HD2  1 
ATOM   4684  H  HD3  . LYS C  1 93 ? 60.679 83.819 -7.237  1.00 64.14  ?  93   LYS C HD3  1 
ATOM   4685  H  HE2  . LYS C  1 93 ? 60.399 85.644 -8.575  1.00 69.11  ?  93   LYS C HE2  1 
ATOM   4686  H  HE3  . LYS C  1 93 ? 61.180 84.571 -9.447  1.00 69.11  ?  93   LYS C HE3  1 
ATOM   4687  H  HZ1  . LYS C  1 93 ? 58.504 85.075 -9.701  1.00 70.14  ?  93   LYS C HZ1  1 
ATOM   4688  H  HZ2  . LYS C  1 93 ? 59.503 85.507 -10.656 1.00 70.14  ?  93   LYS C HZ2  1 
ATOM   4689  H  HZ3  . LYS C  1 93 ? 59.217 84.096 -10.496 1.00 70.14  ?  93   LYS C HZ3  1 
ATOM   4690  N  N    . ASP C  1 94 ? 61.040 78.583 -6.045  1.00 60.36  ?  94   ASP C N    1 
ATOM   4691  C  CA   . ASP C  1 94 ? 60.970 77.647 -4.926  1.00 64.55  ?  94   ASP C CA   1 
ATOM   4692  C  C    . ASP C  1 94 ? 60.405 78.319 -3.677  1.00 65.24  ?  94   ASP C C    1 
ATOM   4693  O  O    . ASP C  1 94 ? 60.335 77.707 -2.612  1.00 64.32  ?  94   ASP C O    1 
ATOM   4694  C  CB   . ASP C  1 94 ? 62.355 77.068 -4.623  1.00 65.18  ?  94   ASP C CB   1 
ATOM   4695  C  CG   . ASP C  1 94 ? 62.820 76.082 -5.679  1.00 66.37  ?  94   ASP C CG   1 
ATOM   4696  O  OD1  . ASP C  1 94 ? 61.962 75.402 -6.278  1.00 68.64  ?  94   ASP C OD1  1 
ATOM   4697  O  OD2  . ASP C  1 94 ? 64.044 75.983 -5.909  1.00 65.75  ?  94   ASP C OD2  1 
ATOM   4698  O  OXT  . ASP C  1 94 ? 60.007 79.484 -3.696  1.00 66.04  ?  94   ASP C OXT  1 
ATOM   4699  H  H    . ASP C  1 94 ? 61.806 78.963 -6.135  1.00 72.44  ?  94   ASP C H    1 
ATOM   4700  H  HA   . ASP C  1 94 ? 60.376 76.905 -5.166  1.00 77.46  ?  94   ASP C HA   1 
ATOM   4701  H  HB2  . ASP C  1 94 ? 62.999 77.792 -4.584  1.00 78.22  ?  94   ASP C HB2  1 
ATOM   4702  H  HB3  . ASP C  1 94 ? 62.324 76.604 -3.772  1.00 78.22  ?  94   ASP C HB3  1 
ATOM   4703  N  N    . MET D  1 1  ? 24.005 47.743 15.216  1.00 41.58  ?  1    MET D N    1 
ATOM   4704  C  CA   . MET D  1 1  ? 25.320 48.171 15.772  1.00 43.12  ?  1    MET D CA   1 
ATOM   4705  C  C    . MET D  1 1  ? 26.222 48.719 14.673  1.00 35.63  ?  1    MET D C    1 
ATOM   4706  O  O    . MET D  1 1  ? 26.293 48.158 13.579  1.00 36.88  ?  1    MET D O    1 
ATOM   4707  C  CB   . MET D  1 1  ? 26.003 46.999 16.475  1.00 49.57  ?  1    MET D CB   1 
ATOM   4708  C  CG   . MET D  1 1  ? 25.571 46.822 17.918  1.00 54.84  ?  1    MET D CG   1 
ATOM   4709  S  SD   . MET D  1 1  ? 25.832 45.147 18.521  1.00 73.11  ?  1    MET D SD   1 
ATOM   4710  C  CE   . MET D  1 1  ? 24.326 44.361 17.950  1.00 62.75  ?  1    MET D CE   1 
ATOM   4711  H  H1   . MET D  1 1  ? 24.136 47.012 14.608  1.00 49.90  ?  1    MET D H1   1 
ATOM   4712  H  H2   . MET D  1 1  ? 23.431 47.462 15.933  1.00 49.90  ?  1    MET D H2   1 
ATOM   4713  H  H3   . MET D  1 1  ? 23.599 48.478 14.751  1.00 49.90  ?  1    MET D H3   1 
ATOM   4714  H  HA   . MET D  1 1  ? 25.169 48.874 16.437  1.00 51.74  ?  1    MET D HA   1 
ATOM   4715  H  HB2  . MET D  1 1  ? 25.792 46.181 15.998  1.00 59.48  ?  1    MET D HB2  1 
ATOM   4716  H  HB3  . MET D  1 1  ? 26.962 47.146 16.467  1.00 59.48  ?  1    MET D HB3  1 
ATOM   4717  H  HG2  . MET D  1 1  ? 26.084 47.425 18.478  1.00 65.81  ?  1    MET D HG2  1 
ATOM   4718  H  HG3  . MET D  1 1  ? 24.625 47.023 17.992  1.00 65.81  ?  1    MET D HG3  1 
ATOM   4719  H  HE1  . MET D  1 1  ? 24.282 44.429 16.994  1.00 75.30  ?  1    MET D HE1  1 
ATOM   4720  H  HE2  . MET D  1 1  ? 24.338 43.437 18.213  1.00 75.30  ?  1    MET D HE2  1 
ATOM   4721  H  HE3  . MET D  1 1  ? 23.573 44.805 18.345  1.00 75.30  ?  1    MET D HE3  1 
ATOM   4722  N  N    . LEU D  1 2  ? 26.910 49.815 14.979  1.00 30.94  ?  2    LEU D N    1 
ATOM   4723  C  CA   . LEU D  1 2  ? 27.737 50.508 13.999  1.00 27.67  ?  2    LEU D CA   1 
ATOM   4724  C  C    . LEU D  1 2  ? 29.210 50.138 14.140  1.00 29.38  ?  2    LEU D C    1 
ATOM   4725  O  O    . LEU D  1 2  ? 29.706 49.946 15.249  1.00 30.63  ?  2    LEU D O    1 
ATOM   4726  C  CB   . LEU D  1 2  ? 27.569 52.022 14.153  1.00 28.89  ?  2    LEU D CB   1 
ATOM   4727  C  CG   . LEU D  1 2  ? 26.125 52.523 14.065  1.00 31.46  ?  2    LEU D CG   1 
ATOM   4728  C  CD1  . LEU D  1 2  ? 26.049 54.017 14.334  1.00 33.82  ?  2    LEU D CD1  1 
ATOM   4729  C  CD2  . LEU D  1 2  ? 25.522 52.191 12.708  1.00 32.32  ?  2    LEU D CD2  1 
ATOM   4730  H  H    . LEU D  1 2  ? 26.913 50.181 15.758  1.00 37.13  ?  2    LEU D H    1 
ATOM   4731  H  HA   . LEU D  1 2  ? 27.444 50.258 13.098  1.00 33.20  ?  2    LEU D HA   1 
ATOM   4732  H  HB2  . LEU D  1 2  ? 27.918 52.284 15.020  1.00 34.67  ?  2    LEU D HB2  1 
ATOM   4733  H  HB3  . LEU D  1 2  ? 28.075 52.461 13.452  1.00 34.67  ?  2    LEU D HB3  1 
ATOM   4734  H  HG   . LEU D  1 2  ? 25.596 52.072 14.742  1.00 37.75  ?  2    LEU D HG   1 
ATOM   4735  H  HD11 . LEU D  1 2  ? 26.580 54.479 13.681  1.00 40.58  ?  2    LEU D HD11 1 
ATOM   4736  H  HD12 . LEU D  1 2  ? 25.134 54.299 14.271  1.00 40.58  ?  2    LEU D HD12 1 
ATOM   4737  H  HD13 . LEU D  1 2  ? 26.387 54.193 15.215  1.00 40.58  ?  2    LEU D HD13 1 
ATOM   4738  H  HD21 . LEU D  1 2  ? 25.532 51.238 12.586  1.00 38.79  ?  2    LEU D HD21 1 
ATOM   4739  H  HD22 . LEU D  1 2  ? 24.619 52.515 12.680  1.00 38.79  ?  2    LEU D HD22 1 
ATOM   4740  H  HD23 . LEU D  1 2  ? 26.044 52.614 12.022  1.00 38.79  ?  2    LEU D HD23 1 
ATOM   4741  N  N    . TYR D  1 3  ? 29.900 50.034 13.006  1.00 27.18  ?  3    TYR D N    1 
ATOM   4742  C  CA   . TYR D  1 3  ? 31.338 49.783 12.989  1.00 26.26  ?  3    TYR D CA   1 
ATOM   4743  C  C    . TYR D  1 3  ? 32.022 50.745 12.026  1.00 25.58  ?  3    TYR D C    1 
ATOM   4744  O  O    . TYR D  1 3  ? 31.546 50.956 10.911  1.00 22.04  ?  3    TYR D O    1 
ATOM   4745  C  CB   . TYR D  1 3  ? 31.639 48.355 12.530  1.00 26.93  ?  3    TYR D CB   1 
ATOM   4746  C  CG   . TYR D  1 3  ? 31.068 47.264 13.403  1.00 28.93  ?  3    TYR D CG   1 
ATOM   4747  C  CD1  . TYR D  1 3  ? 29.727 46.910 13.319  1.00 28.78  ?  3    TYR D CD1  1 
ATOM   4748  C  CD2  . TYR D  1 3  ? 31.876 46.567 14.293  1.00 30.73  ?  3    TYR D CD2  1 
ATOM   4749  C  CE1  . TYR D  1 3  ? 29.203 45.903 14.109  1.00 29.91  ?  3    TYR D CE1  1 
ATOM   4750  C  CE2  . TYR D  1 3  ? 31.363 45.558 15.086  1.00 32.14  ?  3    TYR D CE2  1 
ATOM   4751  C  CZ   . TYR D  1 3  ? 30.025 45.230 14.990  1.00 31.40  ?  3    TYR D CZ   1 
ATOM   4752  O  OH   . TYR D  1 3  ? 29.508 44.226 15.775  1.00 32.91  ?  3    TYR D OH   1 
ATOM   4753  H  H    . TYR D  1 3  ? 29.552 50.106 12.223  1.00 32.61  ?  3    TYR D H    1 
ATOM   4754  H  HA   . TYR D  1 3  ? 31.711 49.914 13.886  1.00 31.51  ?  3    TYR D HA   1 
ATOM   4755  H  HB2  . TYR D  1 3  ? 31.275 48.235 11.639  1.00 32.32  ?  3    TYR D HB2  1 
ATOM   4756  H  HB3  . TYR D  1 3  ? 32.601 48.236 12.507  1.00 32.32  ?  3    TYR D HB3  1 
ATOM   4757  H  HD1  . TYR D  1 3  ? 29.171 47.362 12.727  1.00 34.53  ?  3    TYR D HD1  1 
ATOM   4758  H  HD2  . TYR D  1 3  ? 32.777 46.787 14.359  1.00 36.87  ?  3    TYR D HD2  1 
ATOM   4759  H  HE1  . TYR D  1 3  ? 28.303 45.679 14.046  1.00 35.89  ?  3    TYR D HE1  1 
ATOM   4760  H  HE2  . TYR D  1 3  ? 31.915 45.103 15.681  1.00 38.56  ?  3    TYR D HE2  1 
ATOM   4761  H  HH   . TYR D  1 3  ? 29.200 43.631 15.302  1.00 39.49  ?  3    TYR D HH   1 
ATOM   4762  N  N    . LEU D  1 4  ? 33.139 51.326 12.450  1.00 29.29  ?  4    LEU D N    1 
ATOM   4763  C  CA   . LEU D  1 4  ? 33.973 52.099 11.540  1.00 31.10  ?  4    LEU D CA   1 
ATOM   4764  C  C    . LEU D  1 4  ? 34.999 51.163 10.918  1.00 28.76  ?  4    LEU D C    1 
ATOM   4765  O  O    . LEU D  1 4  ? 35.771 50.514 11.626  1.00 30.83  ?  4    LEU D O    1 
ATOM   4766  C  CB   . LEU D  1 4  ? 34.683 53.246 12.260  1.00 32.21  ?  4    LEU D CB   1 
ATOM   4767  C  CG   . LEU D  1 4  ? 35.532 54.124 11.332  1.00 33.45  ?  4    LEU D CG   1 
ATOM   4768  C  CD1  . LEU D  1 4  ? 34.648 55.025 10.483  1.00 34.19  ?  4    LEU D CD1  1 
ATOM   4769  C  CD2  . LEU D  1 4  ? 36.545 54.945 12.116  1.00 35.18  ?  4    LEU D CD2  1 
ATOM   4770  H  H    . LEU D  1 4  ? 33.435 51.288 13.257  1.00 35.15  ?  4    LEU D H    1 
ATOM   4771  H  HA   . LEU D  1 4  ? 33.418 52.475 10.824  1.00 37.33  ?  4    LEU D HA   1 
ATOM   4772  H  HB2  . LEU D  1 4  ? 34.016 53.814 12.677  1.00 38.65  ?  4    LEU D HB2  1 
ATOM   4773  H  HB3  . LEU D  1 4  ? 35.270 52.875 12.937  1.00 38.65  ?  4    LEU D HB3  1 
ATOM   4774  H  HG   . LEU D  1 4  ? 36.026 53.548 10.729  1.00 40.14  ?  4    LEU D HG   1 
ATOM   4775  H  HD11 . LEU D  1 4  ? 34.130 55.589 11.061  1.00 41.03  ?  4    LEU D HD11 1 
ATOM   4776  H  HD12 . LEU D  1 4  ? 35.205 55.562 9.914   1.00 41.03  ?  4    LEU D HD12 1 
ATOM   4777  H  HD13 . LEU D  1 4  ? 34.065 54.478 9.950   1.00 41.03  ?  4    LEU D HD13 1 
ATOM   4778  H  HD21 . LEU D  1 4  ? 37.127 54.350 12.594  1.00 42.21  ?  4    LEU D HD21 1 
ATOM   4779  H  HD22 . LEU D  1 4  ? 37.055 55.480 11.503  1.00 42.21  ?  4    LEU D HD22 1 
ATOM   4780  H  HD23 . LEU D  1 4  ? 36.077 55.512 12.734  1.00 42.21  ?  4    LEU D HD23 1 
ATOM   4781  N  N    . VAL D  1 5  ? 35.002 51.095 9.592   1.00 23.49  ?  5    VAL D N    1 
ATOM   4782  C  CA   . VAL D  1 5  ? 35.876 50.176 8.882   1.00 22.05  ?  5    VAL D CA   1 
ATOM   4783  C  C    . VAL D  1 5  ? 36.717 50.913 7.849   1.00 23.43  ?  5    VAL D C    1 
ATOM   4784  O  O    . VAL D  1 5  ? 36.181 51.563 6.950   1.00 22.87  ?  5    VAL D O    1 
ATOM   4785  C  CB   . VAL D  1 5  ? 35.062 49.082 8.176   1.00 21.65  ?  5    VAL D CB   1 
ATOM   4786  C  CG1  . VAL D  1 5  ? 35.981 48.132 7.426   1.00 23.81  ?  5    VAL D CG1  1 
ATOM   4787  C  CG2  . VAL D  1 5  ? 34.208 48.328 9.187   1.00 20.62  ?  5    VAL D CG2  1 
ATOM   4788  H  H    . VAL D  1 5  ? 34.504 51.573 9.080   1.00 28.19  ?  5    VAL D H    1 
ATOM   4789  H  HA   . VAL D  1 5  ? 36.481 49.745 9.521   1.00 26.46  ?  5    VAL D HA   1 
ATOM   4790  H  HB   . VAL D  1 5  ? 34.462 49.501 7.525   1.00 25.98  ?  5    VAL D HB   1 
ATOM   4791  H  HG11 . VAL D  1 5  ? 36.584 47.722 8.051   1.00 28.57  ?  5    VAL D HG11 1 
ATOM   4792  H  HG12 . VAL D  1 5  ? 35.450 47.459 6.995   1.00 28.57  ?  5    VAL D HG12 1 
ATOM   4793  H  HG13 . VAL D  1 5  ? 36.476 48.629 6.771   1.00 28.57  ?  5    VAL D HG13 1 
ATOM   4794  H  HG21 . VAL D  1 5  ? 33.609 48.946 9.613   1.00 24.74  ?  5    VAL D HG21 1 
ATOM   4795  H  HG22 . VAL D  1 5  ? 33.707 47.650 8.728   1.00 24.74  ?  5    VAL D HG22 1 
ATOM   4796  H  HG23 . VAL D  1 5  ? 34.783 47.924 9.842   1.00 24.74  ?  5    VAL D HG23 1 
ATOM   4797  N  N    . ARG D  1 6  ? 38.036 50.813 7.986   1.00 24.42  ?  6    ARG D N    1 
ATOM   4798  C  CA   . ARG D  1 6  ? 38.952 51.385 7.008   1.00 24.29  ?  6    ARG D CA   1 
ATOM   4799  C  C    . ARG D  1 6  ? 39.522 50.270 6.146   1.00 26.23  ?  6    ARG D C    1 
ATOM   4800  O  O    . ARG D  1 6  ? 40.021 49.273 6.663   1.00 25.93  ?  6    ARG D O    1 
ATOM   4801  C  CB   . ARG D  1 6  ? 40.090 52.140 7.698   1.00 24.27  ?  6    ARG D CB   1 
ATOM   4802  C  CG   . ARG D  1 6  ? 41.063 52.793 6.723   1.00 25.08  ?  6    ARG D CG   1 
ATOM   4803  C  CD   . ARG D  1 6  ? 42.294 53.350 7.424   1.00 26.92  ?  6    ARG D CD   1 
ATOM   4804  N  NE   . ARG D  1 6  ? 41.958 54.408 8.372   1.00 27.03  ?  6    ARG D NE   1 
ATOM   4805  C  CZ   . ARG D  1 6  ? 41.778 55.685 8.046   1.00 26.91  ?  6    ARG D CZ   1 
ATOM   4806  N  NH1  . ARG D  1 6  ? 41.892 56.086 6.784   1.00 26.58  ?  6    ARG D NH1  1 
ATOM   4807  N  NH2  . ARG D  1 6  ? 41.474 56.566 8.987   1.00 27.22  ?  6    ARG D NH2  1 
ATOM   4808  H  H    . ARG D  1 6  ? 38.426 50.416 8.642   1.00 29.31  ?  6    ARG D H    1 
ATOM   4809  H  HA   . ARG D  1 6  ? 38.467 52.010 6.430   1.00 29.14  ?  6    ARG D HA   1 
ATOM   4810  H  HB2  . ARG D  1 6  ? 39.712 52.839 8.254   1.00 29.12  ?  6    ARG D HB2  1 
ATOM   4811  H  HB3  . ARG D  1 6  ? 40.592 51.517 8.247   1.00 29.12  ?  6    ARG D HB3  1 
ATOM   4812  H  HG2  . ARG D  1 6  ? 41.357 52.133 6.076   1.00 30.10  ?  6    ARG D HG2  1 
ATOM   4813  H  HG3  . ARG D  1 6  ? 40.616 53.526 6.271   1.00 30.10  ?  6    ARG D HG3  1 
ATOM   4814  H  HD2  . ARG D  1 6  ? 42.732 52.635 7.912   1.00 32.30  ?  6    ARG D HD2  1 
ATOM   4815  H  HD3  . ARG D  1 6  ? 42.898 53.719 6.761   1.00 32.30  ?  6    ARG D HD3  1 
ATOM   4816  H  HE   . ARG D  1 6  ? 41.870 54.190 9.199   1.00 32.43  ?  6    ARG D HE   1 
ATOM   4817  H  HH11 . ARG D  1 6  ? 42.089 55.518 6.169   1.00 31.89  ?  6    ARG D HH11 1 
ATOM   4818  H  HH12 . ARG D  1 6  ? 41.773 56.914 6.583   1.00 31.89  ?  6    ARG D HH12 1 
ATOM   4819  H  HH21 . ARG D  1 6  ? 41.398 56.312 9.805   1.00 32.66  ?  6    ARG D HH21 1 
ATOM   4820  H  HH22 . ARG D  1 6  ? 41.355 57.392 8.781   1.00 32.66  ?  6    ARG D HH22 1 
ATOM   4821  N  N    . MET D  1 7  ? 39.441 50.441 4.831   1.00 27.29  ?  7    MET D N    1 
ATOM   4822  C  CA   . MET D  1 7  ? 39.956 49.448 3.899   1.00 27.91  ?  7    MET D CA   1 
ATOM   4823  C  C    . MET D  1 7  ? 41.016 50.071 3.005   1.00 27.45  ?  7    MET D C    1 
ATOM   4824  O  O    . MET D  1 7  ? 40.857 51.194 2.526   1.00 29.77  ?  7    MET D O    1 
ATOM   4825  C  CB   . MET D  1 7  ? 38.828 48.892 3.028   1.00 28.47  ?  7    MET D CB   1 
ATOM   4826  C  CG   . MET D  1 7  ? 37.596 48.450 3.795   1.00 29.08  ?  7    MET D CG   1 
ATOM   4827  S  SD   . MET D  1 7  ? 36.386 47.662 2.715   1.00 33.77  ?  7    MET D SD   1 
ATOM   4828  C  CE   . MET D  1 7  ? 34.916 47.748 3.737   1.00 28.13  ?  7    MET D CE   1 
ATOM   4829  H  H    . MET D  1 7  ? 39.090 51.128 4.452   1.00 32.75  ?  7    MET D H    1 
ATOM   4830  H  HA   . MET D  1 7  ? 40.351 48.706 4.401   1.00 33.49  ?  7    MET D HA   1 
ATOM   4831  H  HB2  . MET D  1 7  ? 38.553 49.579 2.402   1.00 34.16  ?  7    MET D HB2  1 
ATOM   4832  H  HB3  . MET D  1 7  ? 39.164 48.122 2.542   1.00 34.16  ?  7    MET D HB3  1 
ATOM   4833  H  HG2  . MET D  1 7  ? 37.857 47.810 4.476   1.00 34.89  ?  7    MET D HG2  1 
ATOM   4834  H  HG3  . MET D  1 7  ? 37.180 49.225 4.204   1.00 34.89  ?  7    MET D HG3  1 
ATOM   4835  H  HE1  . MET D  1 7  ? 34.723 48.669 3.929   1.00 33.75  ?  7    MET D HE1  1 
ATOM   4836  H  HE2  . MET D  1 7  ? 34.182 47.351 3.263   1.00 33.75  ?  7    MET D HE2  1 
ATOM   4837  H  HE3  . MET D  1 7  ? 35.076 47.270 4.554   1.00 33.75  ?  7    MET D HE3  1 
ATOM   4838  N  N    . THR D  1 8  ? 42.097 49.334 2.784   1.00 24.34  ?  8    THR D N    1 
ATOM   4839  C  CA   . THR D  1 8  ? 43.157 49.768 1.885   1.00 27.86  ?  8    THR D CA   1 
ATOM   4840  C  C    . THR D  1 8  ? 43.380 48.701 0.824   1.00 28.19  ?  8    THR D C    1 
ATOM   4841  O  O    . THR D  1 8  ? 43.607 47.535 1.145   1.00 29.48  ?  8    THR D O    1 
ATOM   4842  C  CB   . THR D  1 8  ? 44.469 50.017 2.647   1.00 34.43  ?  8    THR D CB   1 
ATOM   4843  O  OG1  . THR D  1 8  ? 44.310 51.143 3.518   1.00 37.06  ?  8    THR D OG1  1 
ATOM   4844  C  CG2  . THR D  1 8  ? 45.614 50.284 1.680   1.00 38.27  ?  8    THR D CG2  1 
ATOM   4845  H  H    . THR D  1 8  ? 42.242 48.569 3.149   1.00 29.21  ?  8    THR D H    1 
ATOM   4846  H  HA   . THR D  1 8  ? 42.891 50.600 1.441   1.00 33.43  ?  8    THR D HA   1 
ATOM   4847  H  HB   . THR D  1 8  ? 44.690 49.232 3.173   1.00 41.32  ?  8    THR D HB   1 
ATOM   4848  H  HG1  . THR D  1 8  ? 45.007 51.281 3.927   1.00 44.47  ?  8    THR D HG1  1 
ATOM   4849  H  HG21 . THR D  1 8  ? 45.419 51.059 1.147   1.00 45.92  ?  8    THR D HG21 1 
ATOM   4850  H  HG22 . THR D  1 8  ? 46.426 50.438 2.168   1.00 45.92  ?  8    THR D HG22 1 
ATOM   4851  H  HG23 . THR D  1 8  ? 45.736 49.529 1.100   1.00 45.92  ?  8    THR D HG23 1 
ATOM   4852  N  N    . VAL D  1 9  ? 43.316 49.101 -0.441  1.00 28.45  ?  9    VAL D N    1 
ATOM   4853  C  CA   . VAL D  1 9  ? 43.439 48.156 -1.545  1.00 31.60  ?  9    VAL D CA   1 
ATOM   4854  C  C    . VAL D  1 9  ? 44.861 48.097 -2.090  1.00 36.03  ?  9    VAL D C    1 
ATOM   4855  O  O    . VAL D  1 9  ? 45.451 49.124 -2.428  1.00 36.90  ?  9    VAL D O    1 
ATOM   4856  C  CB   . VAL D  1 9  ? 42.490 48.519 -2.702  1.00 32.73  ?  9    VAL D CB   1 
ATOM   4857  C  CG1  . VAL D  1 9  ? 42.691 47.567 -3.873  1.00 35.70  ?  9    VAL D CG1  1 
ATOM   4858  C  CG2  . VAL D  1 9  ? 41.043 48.489 -2.233  1.00 31.29  ?  9    VAL D CG2  1 
ATOM   4859  H  H    . VAL D  1 9  ? 43.201 49.917 -0.688  1.00 34.14  ?  9    VAL D H    1 
ATOM   4860  H  HA   . VAL D  1 9  ? 43.199 47.261 -1.226  1.00 37.92  ?  9    VAL D HA   1 
ATOM   4861  H  HB   . VAL D  1 9  ? 42.691 49.427 -3.010  1.00 39.27  ?  9    VAL D HB   1 
ATOM   4862  H  HG11 . VAL D  1 9  ? 42.508 46.670 -3.582  1.00 42.84  ?  9    VAL D HG11 1 
ATOM   4863  H  HG12 . VAL D  1 9  ? 42.091 47.811 -4.581  1.00 42.84  ?  9    VAL D HG12 1 
ATOM   4864  H  HG13 . VAL D  1 9  ? 43.600 47.633 -4.176  1.00 42.84  ?  9    VAL D HG13 1 
ATOM   4865  H  HG21 . VAL D  1 9  ? 40.932 49.124 -1.522  1.00 37.55  ?  9    VAL D HG21 1 
ATOM   4866  H  HG22 . VAL D  1 9  ? 40.471 48.717 -2.969  1.00 37.55  ?  9    VAL D HG22 1 
ATOM   4867  H  HG23 . VAL D  1 9  ? 40.835 47.606 -1.919  1.00 37.55  ?  9    VAL D HG23 1 
ATOM   4868  N  N    . ASN D  1 10 ? 45.404 46.887 -2.172  1.00 38.77  ?  10   ASN D N    1 
ATOM   4869  C  CA   . ASN D  1 10 ? 46.697 46.665 -2.805  1.00 44.03  ?  10   ASN D CA   1 
ATOM   4870  C  C    . ASN D  1 10 ? 46.611 45.561 -3.853  1.00 43.45  ?  10   ASN D C    1 
ATOM   4871  O  O    . ASN D  1 10 ? 46.854 44.391 -3.558  1.00 43.44  ?  10   ASN D O    1 
ATOM   4872  C  CB   . ASN D  1 10 ? 47.760 46.311 -1.765  1.00 48.85  ?  10   ASN D CB   1 
ATOM   4873  C  CG   . ASN D  1 10 ? 49.109 45.999 -2.395  1.00 55.86  ?  10   ASN D CG   1 
ATOM   4874  O  OD1  . ASN D  1 10 ? 49.331 46.263 -3.578  1.00 58.68  ?  10   ASN D OD1  1 
ATOM   4875  N  ND2  . ASN D  1 10 ? 50.016 45.434 -1.605  1.00 59.09  ?  10   ASN D ND2  1 
ATOM   4876  H  H    . ASN D  1 10 ? 45.038 46.171 -1.864  1.00 46.52  ?  10   ASN D H    1 
ATOM   4877  H  HA   . ASN D  1 10 ? 46.976 47.489 -3.256  1.00 52.84  ?  10   ASN D HA   1 
ATOM   4878  H  HB2  . ASN D  1 10 ? 47.877 47.062 -1.162  1.00 58.61  ?  10   ASN D HB2  1 
ATOM   4879  H  HB3  . ASN D  1 10 ? 47.471 45.529 -1.269  1.00 58.61  ?  10   ASN D HB3  1 
ATOM   4880  H  HD21 . ASN D  1 10 ? 49.825 45.265 -0.784  1.00 70.91  ?  10   ASN D HD21 1 
ATOM   4881  H  HD22 . ASN D  1 10 ? 50.794 45.239 -1.915  1.00 70.91  ?  10   ASN D HD22 1 
ATOM   4882  N  N    . LEU D  1 11 ? 46.260 45.939 -5.077  1.00 43.59  ?  11   LEU D N    1 
ATOM   4883  C  CA   . LEU D  1 11 ? 46.200 44.986 -6.177  1.00 45.91  ?  11   LEU D CA   1 
ATOM   4884  C  C    . LEU D  1 11 ? 47.605 44.716 -6.702  1.00 48.51  ?  11   LEU D C    1 
ATOM   4885  O  O    . LEU D  1 11 ? 48.357 45.651 -6.976  1.00 52.16  ?  11   LEU D O    1 
ATOM   4886  C  CB   . LEU D  1 11 ? 45.316 45.519 -7.305  1.00 46.85  ?  11   LEU D CB   1 
ATOM   4887  C  CG   . LEU D  1 11 ? 43.862 45.818 -6.933  1.00 45.01  ?  11   LEU D CG   1 
ATOM   4888  C  CD1  . LEU D  1 11 ? 43.067 46.223 -8.166  1.00 46.51  ?  11   LEU D CD1  1 
ATOM   4889  C  CD2  . LEU D  1 11 ? 43.221 44.621 -6.247  1.00 43.33  ?  11   LEU D CD2  1 
ATOM   4890  H  H    . LEU D  1 11 ? 46.051 46.743 -5.297  1.00 52.31  ?  11   LEU D H    1 
ATOM   4891  H  HA   . LEU D  1 11 ? 45.821 44.141 -5.857  1.00 55.10  ?  11   LEU D HA   1 
ATOM   4892  H  HB2  . LEU D  1 11 ? 45.705 46.345 -7.633  1.00 56.22  ?  11   LEU D HB2  1 
ATOM   4893  H  HB3  . LEU D  1 11 ? 45.302 44.863 -8.018  1.00 56.22  ?  11   LEU D HB3  1 
ATOM   4894  H  HG   . LEU D  1 11 ? 43.844 46.561 -6.310  1.00 54.01  ?  11   LEU D HG   1 
ATOM   4895  H  HD11 . LEU D  1 11 ? 43.089 45.504 -8.801  1.00 55.82  ?  11   LEU D HD11 1 
ATOM   4896  H  HD12 . LEU D  1 11 ? 42.161 46.404 -7.907  1.00 55.82  ?  11   LEU D HD12 1 
ATOM   4897  H  HD13 . LEU D  1 11 ? 43.463 47.010 -8.547  1.00 55.82  ?  11   LEU D HD13 1 
ATOM   4898  H  HD21 . LEU D  1 11 ? 43.714 44.419 -5.448  1.00 51.99  ?  11   LEU D HD21 1 
ATOM   4899  H  HD22 . LEU D  1 11 ? 42.313 44.837 -6.026  1.00 51.99  ?  11   LEU D HD22 1 
ATOM   4900  H  HD23 . LEU D  1 11 ? 43.244 43.870 -6.844  1.00 51.99  ?  11   LEU D HD23 1 
ATOM   4901  N  N    . PRO D  1 12 ? 47.968 43.433 -6.839  1.00 44.43  ?  12   PRO D N    1 
ATOM   4902  C  CA   . PRO D  1 12 ? 49.300 43.073 -7.342  1.00 46.38  ?  12   PRO D CA   1 
ATOM   4903  C  C    . PRO D  1 12 ? 49.487 43.488 -8.800  1.00 47.52  ?  12   PRO D C    1 
ATOM   4904  O  O    . PRO D  1 12 ? 48.523 43.500 -9.565  1.00 43.19  ?  12   PRO D O    1 
ATOM   4905  C  CB   . PRO D  1 12 ? 49.327 41.549 -7.201  1.00 47.96  ?  12   PRO D CB   1 
ATOM   4906  C  CG   . PRO D  1 12 ? 47.897 41.138 -7.250  1.00 45.13  ?  12   PRO D CG   1 
ATOM   4907  C  CD   . PRO D  1 12 ? 47.129 42.247 -6.595  1.00 42.07  ?  12   PRO D CD   1 
ATOM   4908  H  HA   . PRO D  1 12 ? 50.002 43.472 -6.787  1.00 55.66  ?  12   PRO D HA   1 
ATOM   4909  H  HB2  . PRO D  1 12 ? 49.822 41.160 -7.939  1.00 57.55  ?  12   PRO D HB2  1 
ATOM   4910  H  HB3  . PRO D  1 12 ? 49.726 41.305 -6.351  1.00 57.55  ?  12   PRO D HB3  1 
ATOM   4911  H  HG2  . PRO D  1 12 ? 47.622 41.032 -8.174  1.00 54.15  ?  12   PRO D HG2  1 
ATOM   4912  H  HG3  . PRO D  1 12 ? 47.781 40.308 -6.762  1.00 54.15  ?  12   PRO D HG3  1 
ATOM   4913  H  HD2  . PRO D  1 12 ? 46.262 42.353 -7.017  1.00 50.49  ?  12   PRO D HD2  1 
ATOM   4914  H  HD3  . PRO D  1 12 ? 47.044 42.083 -5.643  1.00 50.49  ?  12   PRO D HD3  1 
ATOM   4915  N  N    . ARG D  1 13 ? 50.716 43.822 -9.176  1.00 48.23  ?  13   ARG D N    1 
ATOM   4916  C  CA   . ARG D  1 13 ? 50.992 44.315 -10.520 1.00 54.77  ?  13   ARG D CA   1 
ATOM   4917  C  C    . ARG D  1 13 ? 50.845 43.213 -11.568 1.00 58.26  ?  13   ARG D C    1 
ATOM   4918  O  O    . ARG D  1 13 ? 50.627 43.494 -12.747 1.00 57.29  ?  13   ARG D O    1 
ATOM   4919  C  CB   . ARG D  1 13 ? 52.401 44.907 -10.591 1.00 60.12  ?  13   ARG D CB   1 
ATOM   4920  C  CG   . ARG D  1 13 ? 52.562 45.977 -11.660 1.00 62.28  ?  13   ARG D CG   1 
ATOM   4921  C  CD   . ARG D  1 13 ? 54.023 46.210 -12.014 1.00 64.75  ?  13   ARG D CD   1 
ATOM   4922  N  NE   . ARG D  1 13 ? 54.199 47.401 -12.842 1.00 65.53  ?  13   ARG D NE   1 
ATOM   4923  C  CZ   . ARG D  1 13 ? 55.277 47.654 -13.579 1.00 69.97  ?  13   ARG D CZ   1 
ATOM   4924  N  NH1  . ARG D  1 13 ? 56.288 46.796 -13.610 1.00 73.32  ?  13   ARG D NH1  1 
ATOM   4925  N  NH2  . ARG D  1 13 ? 55.340 48.767 -14.295 1.00 72.27  ?  13   ARG D NH2  1 
ATOM   4926  H  H    . ARG D  1 13 ? 51.410 43.773 -8.670  1.00 57.88  ?  13   ARG D H    1 
ATOM   4927  H  HA   . ARG D  1 13 ? 50.354 45.026 -10.737 1.00 65.72  ?  13   ARG D HA   1 
ATOM   4928  H  HB2  . ARG D  1 13 ? 52.615 45.309 -9.734  1.00 72.15  ?  13   ARG D HB2  1 
ATOM   4929  H  HB3  . ARG D  1 13 ? 53.030 44.195 -10.786 1.00 72.15  ?  13   ARG D HB3  1 
ATOM   4930  H  HG2  . ARG D  1 13 ? 52.097 45.697 -12.464 1.00 74.73  ?  13   ARG D HG2  1 
ATOM   4931  H  HG3  . ARG D  1 13 ? 52.193 46.813 -11.333 1.00 74.73  ?  13   ARG D HG3  1 
ATOM   4932  H  HD2  . ARG D  1 13 ? 54.533 46.330 -11.198 1.00 77.70  ?  13   ARG D HD2  1 
ATOM   4933  H  HD3  . ARG D  1 13 ? 54.357 45.445 -12.508 1.00 77.70  ?  13   ARG D HD3  1 
ATOM   4934  H  HE   . ARG D  1 13 ? 53.562 47.978 -12.853 1.00 78.64  ?  13   ARG D HE   1 
ATOM   4935  H  HH11 . ARG D  1 13 ? 56.252 46.072 -13.147 1.00 87.98  ?  13   ARG D HH11 1 
ATOM   4936  H  HH12 . ARG D  1 13 ? 56.981 46.966 -14.090 1.00 87.98  ?  13   ARG D HH12 1 
ATOM   4937  H  HH21 . ARG D  1 13 ? 54.687 49.326 -14.281 1.00 86.73  ?  13   ARG D HH21 1 
ATOM   4938  H  HH22 . ARG D  1 13 ? 56.036 48.930 -14.775 1.00 86.73  ?  13   ARG D HH22 1 
ATOM   4939  N  N    . ASN D  1 14 ? 50.961 41.961 -11.135 1.00 62.21  ?  14   ASN D N    1 
ATOM   4940  C  CA   . ASN D  1 14 ? 50.885 40.825 -12.050 1.00 66.43  ?  14   ASN D CA   1 
ATOM   4941  C  C    . ASN D  1 14 ? 49.457 40.320 -12.247 1.00 61.74  ?  14   ASN D C    1 
ATOM   4942  O  O    . ASN D  1 14 ? 49.244 39.212 -12.741 1.00 62.71  ?  14   ASN D O    1 
ATOM   4943  C  CB   . ASN D  1 14 ? 51.774 39.682 -11.551 1.00 71.37  ?  14   ASN D CB   1 
ATOM   4944  C  CG   . ASN D  1 14 ? 51.379 39.194 -10.168 1.00 72.21  ?  14   ASN D CG   1 
ATOM   4945  O  OD1  . ASN D  1 14 ? 50.207 39.225 -9.795  1.00 69.54  ?  14   ASN D OD1  1 
ATOM   4946  N  ND2  . ASN D  1 14 ? 52.363 38.746 -9.397  1.00 76.25  ?  14   ASN D ND2  1 
ATOM   4947  H  H    . ASN D  1 14 ? 51.085 41.741 -10.313 1.00 74.65  ?  14   ASN D H    1 
ATOM   4948  H  HA   . ASN D  1 14 ? 51.224 41.105 -12.926 1.00 79.71  ?  14   ASN D HA   1 
ATOM   4949  H  HB2  . ASN D  1 14 ? 51.703 38.935 -12.165 1.00 85.65  ?  14   ASN D HB2  1 
ATOM   4950  H  HB3  . ASN D  1 14 ? 52.692 39.992 -11.509 1.00 85.65  ?  14   ASN D HB3  1 
ATOM   4951  H  HD21 . ASN D  1 14 ? 53.172 38.744 -9.690  1.00 91.50  ?  14   ASN D HD21 1 
ATOM   4952  H  HD22 . ASN D  1 14 ? 52.192 38.458 -8.605  1.00 91.50  ?  14   ASN D HD22 1 
ATOM   4953  N  N    . LEU D  1 15 ? 48.481 41.136 -11.864 1.00 63.94  ?  15   LEU D N    1 
ATOM   4954  C  CA   . LEU D  1 15 ? 47.079 40.757 -11.978 1.00 62.23  ?  15   LEU D CA   1 
ATOM   4955  C  C    . LEU D  1 15 ? 46.608 40.817 -13.430 1.00 65.10  ?  15   LEU D C    1 
ATOM   4956  O  O    . LEU D  1 15 ? 46.747 41.842 -14.097 1.00 64.34  ?  15   LEU D O    1 
ATOM   4957  C  CB   . LEU D  1 15 ? 46.216 41.674 -11.108 1.00 59.86  ?  15   LEU D CB   1 
ATOM   4958  C  CG   . LEU D  1 15 ? 44.728 41.330 -11.008 1.00 58.59  ?  15   LEU D CG   1 
ATOM   4959  C  CD1  . LEU D  1 15 ? 44.528 39.916 -10.487 1.00 59.47  ?  15   LEU D CD1  1 
ATOM   4960  C  CD2  . LEU D  1 15 ? 44.015 42.334 -10.114 1.00 55.88  ?  15   LEU D CD2  1 
ATOM   4961  H  H    . LEU D  1 15 ? 48.606 41.919 -11.532 1.00 76.73  ?  15   LEU D H    1 
ATOM   4962  H  HA   . LEU D  1 15 ? 46.967 39.837 -11.658 1.00 74.68  ?  15   LEU D HA   1 
ATOM   4963  H  HB2  . LEU D  1 15 ? 46.574 41.660 -10.207 1.00 71.83  ?  15   LEU D HB2  1 
ATOM   4964  H  HB3  . LEU D  1 15 ? 46.278 42.574 -11.464 1.00 71.83  ?  15   LEU D HB3  1 
ATOM   4965  H  HG   . LEU D  1 15 ? 44.332 41.382 -11.892 1.00 70.30  ?  15   LEU D HG   1 
ATOM   4966  H  HD11 . LEU D  1 15 ? 44.924 39.846 -9.615  1.00 71.36  ?  15   LEU D HD11 1 
ATOM   4967  H  HD12 . LEU D  1 15 ? 43.587 39.732 -10.436 1.00 71.36  ?  15   LEU D HD12 1 
ATOM   4968  H  HD13 . LEU D  1 15 ? 44.951 39.299 -11.088 1.00 71.36  ?  15   LEU D HD13 1 
ATOM   4969  H  HD21 . LEU D  1 15 ? 44.113 43.211 -10.490 1.00 67.05  ?  15   LEU D HD21 1 
ATOM   4970  H  HD22 . LEU D  1 15 ? 43.084 42.101 -10.064 1.00 67.05  ?  15   LEU D HD22 1 
ATOM   4971  H  HD23 . LEU D  1 15 ? 44.407 42.306 -9.238  1.00 67.05  ?  15   LEU D HD23 1 
ATOM   4972  N  N    . ASP D  1 16 ? 46.055 39.708 -13.911 1.00 70.61  ?  16   ASP D N    1 
ATOM   4973  C  CA   . ASP D  1 16 ? 45.516 39.635 -15.264 1.00 74.93  ?  16   ASP D CA   1 
ATOM   4974  C  C    . ASP D  1 16 ? 44.563 40.802 -15.521 1.00 73.38  ?  16   ASP D C    1 
ATOM   4975  O  O    . ASP D  1 16 ? 43.692 41.083 -14.698 1.00 69.56  ?  16   ASP D O    1 
ATOM   4976  C  CB   . ASP D  1 16 ? 44.792 38.300 -15.460 1.00 78.30  ?  16   ASP D CB   1 
ATOM   4977  C  CG   . ASP D  1 16 ? 44.160 38.165 -16.835 1.00 82.02  ?  16   ASP D CG   1 
ATOM   4978  O  OD1  . ASP D  1 16 ? 43.541 39.137 -17.316 1.00 81.35  ?  16   ASP D OD1  1 
ATOM   4979  O  OD2  . ASP D  1 16 ? 44.280 37.076 -17.435 1.00 85.48  ?  16   ASP D OD2  1 
ATOM   4980  H  H    . ASP D  1 16 ? 45.978 38.975 -13.467 1.00 84.74  ?  16   ASP D H    1 
ATOM   4981  H  HA   . ASP D  1 16 ? 46.250 39.687 -15.911 1.00 89.92  ?  16   ASP D HA   1 
ATOM   4982  H  HB2  . ASP D  1 16 ? 45.429 37.577 -15.351 1.00 93.96  ?  16   ASP D HB2  1 
ATOM   4983  H  HB3  . ASP D  1 16 ? 44.087 38.223 -14.798 1.00 93.96  ?  16   ASP D HB3  1 
ATOM   4984  N  N    . PRO D  1 17 ? 44.727 41.488 -16.666 1.00 90.25  ?  17   PRO D N    1 
ATOM   4985  C  CA   . PRO D  1 17 ? 43.895 42.646 -17.017 1.00 91.21  ?  17   PRO D CA   1 
ATOM   4986  C  C    . PRO D  1 17 ? 42.401 42.349 -16.951 1.00 91.67  ?  17   PRO D C    1 
ATOM   4987  O  O    . PRO D  1 17 ? 41.648 43.123 -16.360 1.00 88.93  ?  17   PRO D O    1 
ATOM   4988  C  CB   . PRO D  1 17 ? 44.309 42.948 -18.460 1.00 97.68  ?  17   PRO D CB   1 
ATOM   4989  C  CG   . PRO D  1 17 ? 45.694 42.435 -18.566 1.00 98.12  ?  17   PRO D CG   1 
ATOM   4990  C  CD   . PRO D  1 17 ? 45.748 41.218 -17.693 1.00 95.68  ?  17   PRO D CD   1 
ATOM   4991  H  HA   . PRO D  1 17 ? 44.107 43.413 -16.445 1.00 109.45 ?  17   PRO D HA   1 
ATOM   4992  H  HB2  . PRO D  1 17 ? 43.721 42.481 -19.075 1.00 117.22 ?  17   PRO D HB2  1 
ATOM   4993  H  HB3  . PRO D  1 17 ? 44.283 43.905 -18.616 1.00 117.22 ?  17   PRO D HB3  1 
ATOM   4994  H  HG2  . PRO D  1 17 ? 45.884 42.202 -19.488 1.00 117.75 ?  17   PRO D HG2  1 
ATOM   4995  H  HG3  . PRO D  1 17 ? 46.315 43.110 -18.249 1.00 117.75 ?  17   PRO D HG3  1 
ATOM   4996  H  HD2  . PRO D  1 17 ? 45.514 40.426 -18.202 1.00 114.82 ?  17   PRO D HD2  1 
ATOM   4997  H  HD3  . PRO D  1 17 ? 46.624 41.133 -17.285 1.00 114.82 ?  17   PRO D HD3  1 
ATOM   4998  N  N    . ARG D  1 18 ? 41.981 41.244 -17.557 1.00 88.73  ?  18   ARG D N    1 
ATOM   4999  C  CA   . ARG D  1 18 ? 40.573 40.864 -17.551 1.00 91.41  ?  18   ARG D CA   1 
ATOM   5000  C  C    . ARG D  1 18 ? 40.109 40.489 -16.149 1.00 87.61  ?  18   ARG D C    1 
ATOM   5001  O  O    . ARG D  1 18 ? 39.070 40.957 -15.687 1.00 82.49  ?  18   ARG D O    1 
ATOM   5002  C  CB   . ARG D  1 18 ? 40.321 39.697 -18.509 1.00 99.07  ?  18   ARG D CB   1 
ATOM   5003  C  CG   . ARG D  1 18 ? 39.718 40.099 -19.850 1.00 108.03 ?  18   ARG D CG   1 
ATOM   5004  C  CD   . ARG D  1 18 ? 38.515 41.023 -19.688 1.00 109.57 ?  18   ARG D CD   1 
ATOM   5005  N  NE   . ARG D  1 18 ? 37.583 40.560 -18.662 1.00 107.39 ?  18   ARG D NE   1 
ATOM   5006  C  CZ   . ARG D  1 18 ? 36.503 41.231 -18.271 1.00 106.60 ?  18   ARG D CZ   1 
ATOM   5007  N  NH1  . ARG D  1 18 ? 36.209 42.405 -18.815 1.00 107.06 ?  18   ARG D NH1  1 
ATOM   5008  N  NH2  . ARG D  1 18 ? 35.715 40.728 -17.331 1.00 105.39 ?  18   ARG D NH2  1 
ATOM   5009  H  H    . ARG D  1 18 ? 42.492 40.696 -17.980 1.00 106.48 ?  18   ARG D H    1 
ATOM   5010  H  HA   . ARG D  1 18 ? 40.036 41.626 -17.854 1.00 109.69 ?  18   ARG D HA   1 
ATOM   5011  H  HB2  . ARG D  1 18 ? 41.165 39.254 -18.687 1.00 118.89 ?  18   ARG D HB2  1 
ATOM   5012  H  HB3  . ARG D  1 18 ? 39.709 39.075 -18.086 1.00 118.89 ?  18   ARG D HB3  1 
ATOM   5013  H  HG2  . ARG D  1 18 ? 40.388 40.565 -20.373 1.00 129.64 ?  18   ARG D HG2  1 
ATOM   5014  H  HG3  . ARG D  1 18 ? 39.424 39.301 -20.318 1.00 129.64 ?  18   ARG D HG3  1 
ATOM   5015  H  HD2  . ARG D  1 18 ? 38.827 41.906 -19.433 1.00 131.48 ?  18   ARG D HD2  1 
ATOM   5016  H  HD3  . ARG D  1 18 ? 38.036 41.070 -20.530 1.00 131.48 ?  18   ARG D HD3  1 
ATOM   5017  H  HE   . ARG D  1 18 ? 37.743 39.804 -18.286 1.00 128.87 ?  18   ARG D HE   1 
ATOM   5018  H  HH11 . ARG D  1 18 ? 36.716 42.736 -19.425 1.00 128.47 ?  18   ARG D HH11 1 
ATOM   5019  H  HH12 . ARG D  1 18 ? 35.509 42.835 -18.558 1.00 128.47 ?  18   ARG D HH12 1 
ATOM   5020  H  HH21 . ARG D  1 18 ? 35.902 39.968 -16.975 1.00 126.47 ?  18   ARG D HH21 1 
ATOM   5021  H  HH22 . ARG D  1 18 ? 35.017 41.162 -17.078 1.00 126.47 ?  18   ARG D HH22 1 
ATOM   5022  N  N    . GLU D  1 19 ? 40.881 39.640 -15.478 1.00 104.09 ?  19   GLU D N    1 
ATOM   5023  C  CA   . GLU D  1 19 ? 40.550 39.218 -14.124 1.00 103.00 ?  19   GLU D CA   1 
ATOM   5024  C  C    . GLU D  1 19 ? 40.318 40.444 -13.248 1.00 91.70  ?  19   GLU D C    1 
ATOM   5025  O  O    . GLU D  1 19 ? 39.335 40.517 -12.512 1.00 94.34  ?  19   GLU D O    1 
ATOM   5026  C  CB   . GLU D  1 19 ? 41.676 38.361 -13.542 1.00 105.18 ?  19   GLU D CB   1 
ATOM   5027  C  CG   . GLU D  1 19 ? 41.235 37.425 -12.427 1.00 105.88 ?  19   GLU D CG   1 
ATOM   5028  C  CD   . GLU D  1 19 ? 40.527 38.144 -11.296 1.00 102.87 ?  19   GLU D CD   1 
ATOM   5029  O  OE1  . GLU D  1 19 ? 41.075 39.143 -10.785 1.00 99.44  ?  19   GLU D OE1  1 
ATOM   5030  O  OE2  . GLU D  1 19 ? 39.418 37.710 -10.919 1.00 103.97 ?  19   GLU D OE2  1 
ATOM   5031  H  H    . GLU D  1 19 ? 41.605 39.294 -15.787 1.00 124.91 ?  19   GLU D H    1 
ATOM   5032  H  HA   . GLU D  1 19 ? 39.728 38.685 -14.139 1.00 123.60 ?  19   GLU D HA   1 
ATOM   5033  H  HB2  . GLU D  1 19 ? 42.052 37.818 -14.252 1.00 126.22 ?  19   GLU D HB2  1 
ATOM   5034  H  HB3  . GLU D  1 19 ? 42.359 38.948 -13.182 1.00 126.22 ?  19   GLU D HB3  1 
ATOM   5035  H  HG2  . GLU D  1 19 ? 40.624 36.766 -12.792 1.00 127.05 ?  19   GLU D HG2  1 
ATOM   5036  H  HG3  . GLU D  1 19 ? 42.017 36.984 -12.059 1.00 127.05 ?  19   GLU D HG3  1 
ATOM   5037  N  N    . GLU D  1 20 ? 41.228 41.408 -13.341 1.00 78.32  ?  20   GLU D N    1 
ATOM   5038  C  CA   . GLU D  1 20 ? 41.129 42.639 -12.568 1.00 66.39  ?  20   GLU D CA   1 
ATOM   5039  C  C    . GLU D  1 20 ? 39.853 43.398 -12.905 1.00 68.63  ?  20   GLU D C    1 
ATOM   5040  O  O    . GLU D  1 20 ? 39.022 43.652 -12.035 1.00 65.39  ?  20   GLU D O    1 
ATOM   5041  C  CB   . GLU D  1 20 ? 42.338 43.533 -12.839 1.00 63.14  ?  20   GLU D CB   1 
ATOM   5042  C  CG   . GLU D  1 20 ? 42.202 44.929 -12.260 1.00 62.15  ?  20   GLU D CG   1 
ATOM   5043  C  CD   . GLU D  1 20 ? 43.507 45.699 -12.273 1.00 65.00  ?  20   GLU D CD   1 
ATOM   5044  O  OE1  . GLU D  1 20 ? 44.519 45.153 -12.761 1.00 69.08  ?  20   GLU D OE1  1 
ATOM   5045  O  OE2  . GLU D  1 20 ? 43.519 46.852 -11.791 1.00 63.84  ?  20   GLU D OE2  1 
ATOM   5046  H  H    . GLU D  1 20 ? 41.920 41.371 -13.850 1.00 93.98  ?  20   GLU D H    1 
ATOM   5047  H  HA   . GLU D  1 20 ? 41.114 42.422 -11.613 1.00 79.67  ?  20   GLU D HA   1 
ATOM   5048  H  HB2  . GLU D  1 20 ? 43.124 43.124 -12.446 1.00 75.76  ?  20   GLU D HB2  1 
ATOM   5049  H  HB3  . GLU D  1 20 ? 42.456 43.619 -13.798 1.00 75.76  ?  20   GLU D HB3  1 
ATOM   5050  H  HG2  . GLU D  1 20 ? 41.555 45.426 -12.785 1.00 74.58  ?  20   GLU D HG2  1 
ATOM   5051  H  HG3  . GLU D  1 20 ? 41.902 44.861 -11.340 1.00 74.58  ?  20   GLU D HG3  1 
ATOM   5052  N  N    . GLU D  1 21 ? 39.711 43.761 -14.175 1.00 64.36  ?  21   GLU D N    1 
ATOM   5053  C  CA   . GLU D  1 21 ? 38.546 44.498 -14.647 1.00 69.41  ?  21   GLU D CA   1 
ATOM   5054  C  C    . GLU D  1 21 ? 37.262 43.884 -14.101 1.00 71.85  ?  21   GLU D C    1 
ATOM   5055  O  O    . GLU D  1 21 ? 36.350 44.596 -13.679 1.00 69.35  ?  21   GLU D O    1 
ATOM   5056  C  CB   . GLU D  1 21 ? 38.519 44.497 -16.176 1.00 77.27  ?  21   GLU D CB   1 
ATOM   5057  C  CG   . GLU D  1 21 ? 37.446 45.379 -16.788 1.00 83.18  ?  21   GLU D CG   1 
ATOM   5058  C  CD   . GLU D  1 21 ? 37.572 45.481 -18.296 1.00 92.92  ?  21   GLU D CD   1 
ATOM   5059  O  OE1  . GLU D  1 21 ? 38.596 45.015 -18.840 1.00 94.67  ?  21   GLU D OE1  1 
ATOM   5060  O  OE2  . GLU D  1 21 ? 36.651 46.030 -18.937 1.00 99.09  ?  21   GLU D OE2  1 
ATOM   5061  H  H    . GLU D  1 21 ? 40.285 43.589 -14.792 1.00 77.23  ?  21   GLU D H    1 
ATOM   5062  H  HA   . GLU D  1 21 ? 38.601 45.427 -14.338 1.00 83.30  ?  21   GLU D HA   1 
ATOM   5063  H  HB2  . GLU D  1 21 ? 39.378 44.810 -16.501 1.00 92.73  ?  21   GLU D HB2  1 
ATOM   5064  H  HB3  . GLU D  1 21 ? 38.365 43.590 -16.483 1.00 92.73  ?  21   GLU D HB3  1 
ATOM   5065  H  HG2  . GLU D  1 21 ? 36.574 45.006 -16.583 1.00 99.82  ?  21   GLU D HG2  1 
ATOM   5066  H  HG3  . GLU D  1 21 ? 37.521 46.273 -16.418 1.00 99.82  ?  21   GLU D HG3  1 
ATOM   5067  N  N    . ARG D  1 22 ? 37.202 42.557 -14.109 1.00 75.46  ?  22   ARG D N    1 
ATOM   5068  C  CA   . ARG D  1 22 ? 36.039 41.831 -13.616 1.00 79.46  ?  22   ARG D CA   1 
ATOM   5069  C  C    . ARG D  1 22 ? 35.901 42.012 -12.111 1.00 70.00  ?  22   ARG D C    1 
ATOM   5070  O  O    . ARG D  1 22 ? 34.812 42.272 -11.599 1.00 71.19  ?  22   ARG D O    1 
ATOM   5071  C  CB   . ARG D  1 22 ? 36.179 40.343 -13.933 1.00 86.14  ?  22   ARG D CB   1 
ATOM   5072  C  CG   . ARG D  1 22 ? 34.919 39.536 -13.677 1.00 92.31  ?  22   ARG D CG   1 
ATOM   5073  C  CD   . ARG D  1 22 ? 35.220 38.049 -13.599 1.00 95.97  ?  22   ARG D CD   1 
ATOM   5074  N  NE   . ARG D  1 22 ? 36.111 37.731 -12.486 1.00 89.85  ?  22   ARG D NE   1 
ATOM   5075  C  CZ   . ARG D  1 22 ? 35.731 37.665 -11.213 1.00 84.37  ?  22   ARG D CZ   1 
ATOM   5076  N  NH1  . ARG D  1 22 ? 34.470 37.900 -10.873 1.00 86.26  ?  22   ARG D NH1  1 
ATOM   5077  N  NH2  . ARG D  1 22 ? 36.617 37.367 -10.272 1.00 77.39  ?  22   ARG D NH2  1 
ATOM   5078  H  H    . ARG D  1 22 ? 37.832 42.048 -14.399 1.00 90.55  ?  22   ARG D H    1 
ATOM   5079  H  HA   . ARG D  1 22 ? 35.229 42.171 -14.050 1.00 95.35  ?  22   ARG D HA   1 
ATOM   5080  H  HB2  . ARG D  1 22 ? 36.408 40.245 -14.871 1.00 103.37 ?  22   ARG D HB2  1 
ATOM   5081  H  HB3  . ARG D  1 22 ? 36.885 39.972 -13.382 1.00 103.37 ?  22   ARG D HB3  1 
ATOM   5082  H  HG2  . ARG D  1 22 ? 34.528 39.812 -12.834 1.00 110.77 ?  22   ARG D HG2  1 
ATOM   5083  H  HG3  . ARG D  1 22 ? 34.292 39.682 -14.403 1.00 110.77 ?  22   ARG D HG3  1 
ATOM   5084  H  HD2  . ARG D  1 22 ? 34.391 37.562 -13.472 1.00 115.16 ?  22   ARG D HD2  1 
ATOM   5085  H  HD3  . ARG D  1 22 ? 35.650 37.767 -14.422 1.00 115.16 ?  22   ARG D HD3  1 
ATOM   5086  H  HE   . ARG D  1 22 ? 36.938 37.576 -12.666 1.00 107.82 ?  22   ARG D HE   1 
ATOM   5087  H  HH11 . ARG D  1 22 ? 33.891 38.094 -11.479 1.00 103.52 ?  22   ARG D HH11 1 
ATOM   5088  H  HH12 . ARG D  1 22 ? 34.232 37.857 -10.048 1.00 103.52 ?  22   ARG D HH12 1 
ATOM   5089  H  HH21 . ARG D  1 22 ? 37.436 37.215 -10.485 1.00 92.87  ?  22   ARG D HH21 1 
ATOM   5090  H  HH22 . ARG D  1 22 ? 36.372 37.326 -9.449  1.00 92.87  ?  22   ARG D HH22 1 
ATOM   5091  N  N    . LEU D  1 23 ? 37.019 41.865 -11.410 1.00 74.63  ?  23   LEU D N    1 
ATOM   5092  C  CA   . LEU D  1 23 ? 37.048 41.979 -9.959  1.00 65.73  ?  23   LEU D CA   1 
ATOM   5093  C  C    . LEU D  1 23 ? 36.436 43.299 -9.502  1.00 62.61  ?  23   LEU D C    1 
ATOM   5094  O  O    . LEU D  1 23 ? 35.741 43.353 -8.488  1.00 55.68  ?  23   LEU D O    1 
ATOM   5095  C  CB   . LEU D  1 23 ? 38.492 41.873 -9.465  1.00 62.08  ?  23   LEU D CB   1 
ATOM   5096  C  CG   . LEU D  1 23 ? 38.703 41.658 -7.966  1.00 57.16  ?  23   LEU D CG   1 
ATOM   5097  C  CD1  . LEU D  1 23 ? 38.121 40.326 -7.522  1.00 57.33  ?  23   LEU D CD1  1 
ATOM   5098  C  CD2  . LEU D  1 23 ? 40.185 41.735 -7.634  1.00 55.84  ?  23   LEU D CD2  1 
ATOM   5099  H  H    . LEU D  1 23 ? 37.787 41.695 -11.759 1.00 89.55  ?  23   LEU D H    1 
ATOM   5100  H  HA   . LEU D  1 23 ? 36.532 41.245 -9.565  1.00 78.88  ?  23   LEU D HA   1 
ATOM   5101  H  HB2  . LEU D  1 23 ? 38.913 41.129 -9.922  1.00 74.49  ?  23   LEU D HB2  1 
ATOM   5102  H  HB3  . LEU D  1 23 ? 38.952 42.694 -9.702  1.00 74.49  ?  23   LEU D HB3  1 
ATOM   5103  H  HG   . LEU D  1 23 ? 38.248 42.362 -7.478  1.00 68.59  ?  23   LEU D HG   1 
ATOM   5104  H  HD11 . LEU D  1 23 ? 38.556 39.618 -8.004  1.00 68.79  ?  23   LEU D HD11 1 
ATOM   5105  H  HD12 . LEU D  1 23 ? 38.268 40.219 -6.579  1.00 68.79  ?  23   LEU D HD12 1 
ATOM   5106  H  HD13 . LEU D  1 23 ? 37.179 40.318 -7.709  1.00 68.79  ?  23   LEU D HD13 1 
ATOM   5107  H  HD21 . LEU D  1 23 ? 40.516 42.602 -7.883  1.00 67.01  ?  23   LEU D HD21 1 
ATOM   5108  H  HD22 . LEU D  1 23 ? 40.301 41.598 -6.691  1.00 67.01  ?  23   LEU D HD22 1 
ATOM   5109  H  HD23 . LEU D  1 23 ? 40.651 41.054 -8.124  1.00 67.01  ?  23   LEU D HD23 1 
ATOM   5110  N  N    . LYS D  1 24 ? 36.694 44.360 -10.262 1.00 66.37  ?  24   LYS D N    1 
ATOM   5111  C  CA   . LYS D  1 24 ? 36.224 45.694 -9.904  1.00 65.54  ?  24   LYS D CA   1 
ATOM   5112  C  C    . LYS D  1 24 ? 34.709 45.811 -10.048 1.00 62.91  ?  24   LYS D C    1 
ATOM   5113  O  O    . LYS D  1 24 ? 34.039 46.383 -9.188  1.00 62.45  ?  24   LYS D O    1 
ATOM   5114  C  CB   . LYS D  1 24 ? 36.916 46.752 -10.766 1.00 69.02  ?  24   LYS D CB   1 
ATOM   5115  C  CG   . LYS D  1 24 ? 38.432 46.629 -10.787 1.00 68.97  ?  24   LYS D CG   1 
ATOM   5116  C  CD   . LYS D  1 24 ? 39.106 47.944 -11.140 1.00 70.87  ?  24   LYS D CD   1 
ATOM   5117  C  CE   . LYS D  1 24 ? 40.621 47.810 -11.100 1.00 70.49  ?  24   LYS D CE   1 
ATOM   5118  N  NZ   . LYS D  1 24 ? 41.316 49.119 -11.229 1.00 70.39  ?  24   LYS D NZ   1 
ATOM   5119  H  H    . LYS D  1 24 ? 37.142 44.332 -10.995 1.00 79.65  ?  24   LYS D H    1 
ATOM   5120  H  HA   . LYS D  1 24 ? 36.453 45.871 -8.967  1.00 78.64  ?  24   LYS D HA   1 
ATOM   5121  H  HB2  . LYS D  1 24 ? 36.599 46.668 -11.679 1.00 82.83  ?  24   LYS D HB2  1 
ATOM   5122  H  HB3  . LYS D  1 24 ? 36.695 47.631 -10.421 1.00 82.83  ?  24   LYS D HB3  1 
ATOM   5123  H  HG2  . LYS D  1 24 ? 38.741 46.357 -9.909  1.00 82.76  ?  24   LYS D HG2  1 
ATOM   5124  H  HG3  . LYS D  1 24 ? 38.689 45.970 -11.451 1.00 82.76  ?  24   LYS D HG3  1 
ATOM   5125  H  HD2  . LYS D  1 24 ? 38.846 48.208 -12.036 1.00 85.05  ?  24   LYS D HD2  1 
ATOM   5126  H  HD3  . LYS D  1 24 ? 38.842 48.623 -10.499 1.00 85.05  ?  24   LYS D HD3  1 
ATOM   5127  H  HE2  . LYS D  1 24 ? 40.881 47.414 -10.253 1.00 84.59  ?  24   LYS D HE2  1 
ATOM   5128  H  HE3  . LYS D  1 24 ? 40.908 47.243 -11.833 1.00 84.59  ?  24   LYS D HE3  1 
ATOM   5129  H  HZ1  . LYS D  1 24 ? 41.076 49.658 -10.563 1.00 84.46  ?  24   LYS D HZ1  1 
ATOM   5130  H  HZ2  . LYS D  1 24 ? 42.198 48.999 -11.201 1.00 84.46  ?  24   LYS D HZ2  1 
ATOM   5131  H  HZ3  . LYS D  1 24 ? 41.101 49.502 -12.003 1.00 84.46  ?  24   LYS D HZ3  1 
ATOM   5132  N  N    . ALA D  1 25 ? 34.174 45.269 -11.137 1.00 51.91  ?  25   ALA D N    1 
ATOM   5133  C  CA   . ALA D  1 25 ? 32.735 45.289 -11.367 1.00 51.40  ?  25   ALA D CA   1 
ATOM   5134  C  C    . ALA D  1 25 ? 32.017 44.494 -10.283 1.00 49.47  ?  25   ALA D C    1 
ATOM   5135  O  O    . ALA D  1 25 ? 30.949 44.889 -9.813  1.00 47.83  ?  25   ALA D O    1 
ATOM   5136  C  CB   . ALA D  1 25 ? 32.411 44.726 -12.741 1.00 58.41  ?  25   ALA D CB   1 
ATOM   5137  H  H    . ALA D  1 25 ? 34.624 44.882 -11.759 1.00 62.29  ?  25   ALA D H    1 
ATOM   5138  H  HA   . ALA D  1 25 ? 32.415 46.215 -11.331 1.00 61.68  ?  25   ALA D HA   1 
ATOM   5139  H  HB1  . ALA D  1 25 ? 32.726 43.821 -12.790 1.00 70.09  ?  25   ALA D HB1  1 
ATOM   5140  H  HB2  . ALA D  1 25 ? 31.460 44.749 -12.871 1.00 70.09  ?  25   ALA D HB2  1 
ATOM   5141  H  HB3  . ALA D  1 25 ? 32.846 45.262 -13.408 1.00 70.09  ?  25   ALA D HB3  1 
ATOM   5142  N  N    . SER D  1 26 ? 32.610 43.371 -9.889  1.00 53.58  ?  26   SER D N    1 
ATOM   5143  C  CA   . SER D  1 26 ? 32.049 42.541 -8.830  1.00 54.39  ?  26   SER D CA   1 
ATOM   5144  C  C    . SER D  1 26 ? 31.960 43.337 -7.535  1.00 47.87  ?  26   SER D C    1 
ATOM   5145  O  O    . SER D  1 26 ? 30.924 43.345 -6.870  1.00 45.81  ?  26   SER D O    1 
ATOM   5146  C  CB   . SER D  1 26 ? 32.913 41.299 -8.610  1.00 56.78  ?  26   SER D CB   1 
ATOM   5147  O  OG   . SER D  1 26 ? 33.090 40.572 -9.812  1.00 64.38  ?  26   SER D OG   1 
ATOM   5148  H  H    . SER D  1 26 ? 33.342 43.067 -10.221 1.00 64.29  ?  26   SER D H    1 
ATOM   5149  H  HA   . SER D  1 26 ? 31.147 42.253 -9.082  1.00 65.27  ?  26   SER D HA   1 
ATOM   5150  H  HB2  . SER D  1 26 ? 33.783 41.575 -8.280  1.00 68.13  ?  26   SER D HB2  1 
ATOM   5151  H  HB3  . SER D  1 26 ? 32.480 40.726 -7.958  1.00 68.13  ?  26   SER D HB3  1 
ATOM   5152  H  HG   . SER D  1 26 ? 32.694 40.946 -10.426 1.00 77.25  ?  26   SER D HG   1 
ATOM   5153  N  N    . ALA D  1 27 ? 33.055 44.006 -7.185  1.00 49.69  ?  27   ALA D N    1 
ATOM   5154  C  CA   . ALA D  1 27 ? 33.120 44.792 -5.958  1.00 44.97  ?  27   ALA D CA   1 
ATOM   5155  C  C    . ALA D  1 27 ? 32.049 45.875 -5.945  1.00 47.74  ?  27   ALA D C    1 
ATOM   5156  O  O    . ALA D  1 27 ? 31.410 46.116 -4.921  1.00 45.54  ?  27   ALA D O    1 
ATOM   5157  C  CB   . ALA D  1 27 ? 34.499 45.414 -5.807  1.00 39.94  ?  27   ALA D CB   1 
ATOM   5158  H  H    . ALA D  1 27 ? 33.780 44.020 -7.646  1.00 59.63  ?  27   ALA D H    1 
ATOM   5159  H  HA   . ALA D  1 27 ? 32.967 44.202 -5.191  1.00 53.96  ?  27   ALA D HA   1 
ATOM   5160  H  HB1  . ALA D  1 27 ? 34.669 45.984 -6.561  1.00 47.92  ?  27   ALA D HB1  1 
ATOM   5161  H  HB2  . ALA D  1 27 ? 34.524 45.926 -4.996  1.00 47.92  ?  27   ALA D HB2  1 
ATOM   5162  H  HB3  . ALA D  1 27 ? 35.155 44.714 -5.772  1.00 47.92  ?  27   ALA D HB3  1 
ATOM   5163  N  N    . LYS D  1 28 ? 31.854 46.523 -7.088  1.00 48.71  ?  28   LYS D N    1 
ATOM   5164  C  CA   . LYS D  1 28 ? 30.876 47.598 -7.197  1.00 50.64  ?  28   LYS D CA   1 
ATOM   5165  C  C    . LYS D  1 28 ? 29.456 47.077 -6.995  1.00 50.26  ?  28   LYS D C    1 
ATOM   5166  O  O    . LYS D  1 28 ? 28.658 47.690 -6.287  1.00 52.22  ?  28   LYS D O    1 
ATOM   5167  C  CB   . LYS D  1 28 ? 30.996 48.290 -8.557  1.00 55.44  ?  28   LYS D CB   1 
ATOM   5168  C  CG   . LYS D  1 28 ? 30.037 49.454 -8.744  1.00 57.91  ?  28   LYS D CG   1 
ATOM   5169  C  CD   . LYS D  1 28 ? 30.506 50.390 -9.847  1.00 61.56  ?  28   LYS D CD   1 
ATOM   5170  C  CE   . LYS D  1 28 ? 29.572 51.580 -10.002 1.00 65.34  ?  28   LYS D CE   1 
ATOM   5171  N  NZ   . LYS D  1 28 ? 30.053 52.541 -11.033 1.00 69.18  ?  28   LYS D NZ   1 
ATOM   5172  H  H    . LYS D  1 28 ? 32.277 46.358 -7.818  1.00 58.46  ?  28   LYS D H    1 
ATOM   5173  H  HA   . LYS D  1 28 ? 31.056 48.264 -6.501  1.00 60.77  ?  28   LYS D HA   1 
ATOM   5174  H  HB2  . LYS D  1 28 ? 31.899 48.631 -8.655  1.00 66.53  ?  28   LYS D HB2  1 
ATOM   5175  H  HB3  . LYS D  1 28 ? 30.813 47.641 -9.254  1.00 66.53  ?  28   LYS D HB3  1 
ATOM   5176  H  HG2  . LYS D  1 28 ? 29.162 49.113 -8.986  1.00 69.49  ?  28   LYS D HG2  1 
ATOM   5177  H  HG3  . LYS D  1 28 ? 29.983 49.961 -7.918  1.00 69.49  ?  28   LYS D HG3  1 
ATOM   5178  H  HD2  . LYS D  1 28 ? 31.390 50.724 -9.629  1.00 73.87  ?  28   LYS D HD2  1 
ATOM   5179  H  HD3  . LYS D  1 28 ? 30.527 49.908 -10.688 1.00 73.87  ?  28   LYS D HD3  1 
ATOM   5180  H  HE2  . LYS D  1 28 ? 28.696 51.263 -10.270 1.00 78.41  ?  28   LYS D HE2  1 
ATOM   5181  H  HE3  . LYS D  1 28 ? 29.513 52.050 -9.156  1.00 78.41  ?  28   LYS D HE3  1 
ATOM   5182  H  HZ1  . LYS D  1 28 ? 30.111 52.135 -11.823 1.00 83.02  ?  28   LYS D HZ1  1 
ATOM   5183  H  HZ2  . LYS D  1 28 ? 29.486 53.224 -11.100 1.00 83.02  ?  28   LYS D HZ2  1 
ATOM   5184  H  HZ3  . LYS D  1 28 ? 30.856 52.852 -10.808 1.00 83.02  ?  28   LYS D HZ3  1 
ATOM   5185  N  N    . ALA D  1 29 ? 29.148 45.942 -7.616  1.00 44.25  ?  29   ALA D N    1 
ATOM   5186  C  CA   . ALA D  1 29 ? 27.812 45.362 -7.529  1.00 43.99  ?  29   ALA D CA   1 
ATOM   5187  C  C    . ALA D  1 29 ? 27.520 44.858 -6.118  1.00 42.00  ?  29   ALA D C    1 
ATOM   5188  O  O    . ALA D  1 29 ? 26.394 44.967 -5.635  1.00 41.10  ?  29   ALA D O    1 
ATOM   5189  C  CB   . ALA D  1 29 ? 27.663 44.231 -8.534  1.00 48.47  ?  29   ALA D CB   1 
ATOM   5190  H  H    . ALA D  1 29 ? 29.697 45.487 -8.096  1.00 53.09  ?  29   ALA D H    1 
ATOM   5191  H  HA   . ALA D  1 29 ? 27.150 46.051 -7.747  1.00 52.79  ?  29   ALA D HA   1 
ATOM   5192  H  HB1  . ALA D  1 29 ? 28.316 43.555 -8.342  1.00 58.16  ?  29   ALA D HB1  1 
ATOM   5193  H  HB2  . ALA D  1 29 ? 26.779 43.864 -8.461  1.00 58.16  ?  29   ALA D HB2  1 
ATOM   5194  H  HB3  . ALA D  1 29 ? 27.801 44.579 -9.418  1.00 58.16  ?  29   ALA D HB3  1 
ATOM   5195  N  N    . ARG D  1 30 ? 28.537 44.304 -5.466  1.00 46.75  ?  30   ARG D N    1 
ATOM   5196  C  CA   . ARG D  1 30 ? 28.391 43.803 -4.104  1.00 47.57  ?  30   ARG D CA   1 
ATOM   5197  C  C    . ARG D  1 30 ? 28.128 44.956 -3.139  1.00 43.17  ?  30   ARG D C    1 
ATOM   5198  O  O    . ARG D  1 30 ? 27.200 44.901 -2.333  1.00 43.47  ?  30   ARG D O    1 
ATOM   5199  C  CB   . ARG D  1 30 ? 29.648 43.036 -3.681  1.00 46.94  ?  30   ARG D CB   1 
ATOM   5200  C  CG   . ARG D  1 30 ? 29.602 42.476 -2.262  1.00 46.39  ?  30   ARG D CG   1 
ATOM   5201  C  CD   . ARG D  1 30 ? 28.650 41.292 -2.144  1.00 52.14  ?  30   ARG D CD   1 
ATOM   5202  N  NE   . ARG D  1 30 ? 28.604 40.770 -0.777  1.00 50.09  ?  30   ARG D NE   1 
ATOM   5203  C  CZ   . ARG D  1 30 ? 27.492 40.523 -0.086  1.00 51.09  ?  30   ARG D CZ   1 
ATOM   5204  N  NH1  . ARG D  1 30 ? 26.291 40.737 -0.614  1.00 55.35  ?  30   ARG D NH1  1 
ATOM   5205  N  NH2  . ARG D  1 30 ? 27.579 40.051 1.150   1.00 48.00  ?  30   ARG D NH2  1 
ATOM   5206  H  H    . ARG D  1 30 ? 29.326 44.206 -5.792  1.00 56.10  ?  30   ARG D H    1 
ATOM   5207  H  HA   . ARG D  1 30 ? 27.628 43.189 -4.065  1.00 57.08  ?  30   ARG D HA   1 
ATOM   5208  H  HB2  . ARG D  1 30 ? 29.774 42.290 -4.287  1.00 56.33  ?  30   ARG D HB2  1 
ATOM   5209  H  HB3  . ARG D  1 30 ? 30.409 43.634 -3.736  1.00 56.33  ?  30   ARG D HB3  1 
ATOM   5210  H  HG2  . ARG D  1 30 ? 30.489 42.176 -2.009  1.00 55.67  ?  30   ARG D HG2  1 
ATOM   5211  H  HG3  . ARG D  1 30 ? 29.299 43.170 -1.655  1.00 55.67  ?  30   ARG D HG3  1 
ATOM   5212  H  HD2  . ARG D  1 30 ? 27.755 41.576 -2.390  1.00 62.56  ?  30   ARG D HD2  1 
ATOM   5213  H  HD3  . ARG D  1 30 ? 28.950 40.581 -2.731  1.00 62.56  ?  30   ARG D HD3  1 
ATOM   5214  H  HE   . ARG D  1 30 ? 29.355 40.609 -0.390  1.00 60.11  ?  30   ARG D HE   1 
ATOM   5215  H  HH11 . ARG D  1 30 ? 26.222 41.043 -1.415  1.00 66.42  ?  30   ARG D HH11 1 
ATOM   5216  H  HH12 . ARG D  1 30 ? 25.584 40.571 -0.154  1.00 66.42  ?  30   ARG D HH12 1 
ATOM   5217  H  HH21 . ARG D  1 30 ? 28.351 39.907 1.502   1.00 57.60  ?  30   ARG D HH21 1 
ATOM   5218  H  HH22 . ARG D  1 30 ? 26.865 39.888 1.600   1.00 57.60  ?  30   ARG D HH22 1 
ATOM   5219  N  N    . SER D  1 31 ? 28.946 46.001 -3.225  1.00 41.89  ?  31   SER D N    1 
ATOM   5220  C  CA   . SER D  1 31 ? 28.784 47.155 -2.351  1.00 36.18  ?  31   SER D CA   1 
ATOM   5221  C  C    . SER D  1 31 ? 27.459 47.859 -2.627  1.00 39.52  ?  31   SER D C    1 
ATOM   5222  O  O    . SER D  1 31 ? 26.882 48.476 -1.733  1.00 36.49  ?  31   SER D O    1 
ATOM   5223  C  CB   . SER D  1 31 ? 29.954 48.132 -2.503  1.00 33.10  ?  31   SER D CB   1 
ATOM   5224  O  OG   . SER D  1 31 ? 30.014 48.688 -3.805  1.00 37.67  ?  31   SER D OG   1 
ATOM   5225  H  H    . SER D  1 31 ? 29.600 46.066 -3.780  1.00 50.27  ?  31   SER D H    1 
ATOM   5226  H  HA   . SER D  1 31 ? 28.771 46.847 -1.421  1.00 43.42  ?  31   SER D HA   1 
ATOM   5227  H  HB2  . SER D  1 31 ? 29.846 48.852 -1.861  1.00 39.72  ?  31   SER D HB2  1 
ATOM   5228  H  HB3  . SER D  1 31 ? 30.782 47.658 -2.327  1.00 39.72  ?  31   SER D HB3  1 
ATOM   5229  H  HG   . SER D  1 31 ? 29.404 48.389 -4.265  1.00 45.20  ?  31   SER D HG   1 
ATOM   5230  N  N    . ARG D  1 32 ? 26.971 47.761 -3.859  1.00 37.65  ?  32   ARG D N    1 
ATOM   5231  C  CA   . ARG D  1 32 ? 25.675 48.338 -4.201  1.00 42.44  ?  32   ARG D CA   1 
ATOM   5232  C  C    . ARG D  1 32 ? 24.562 47.626 -3.442  1.00 42.98  ?  32   ARG D C    1 
ATOM   5233  O  O    . ARG D  1 32 ? 23.679 48.265 -2.869  1.00 42.84  ?  32   ARG D O    1 
ATOM   5234  C  CB   . ARG D  1 32 ? 25.414 48.250 -5.705  1.00 50.08  ?  32   ARG D CB   1 
ATOM   5235  C  CG   . ARG D  1 32 ? 23.949 48.441 -6.073  1.00 58.90  ?  32   ARG D CG   1 
ATOM   5236  C  CD   . ARG D  1 32 ? 23.742 48.520 -7.576  1.00 69.47  ?  32   ARG D CD   1 
ATOM   5237  N  NE   . ARG D  1 32 ? 23.970 49.868 -8.092  1.00 73.39  ?  32   ARG D NE   1 
ATOM   5238  C  CZ   . ARG D  1 32 ? 23.079 50.855 -8.037  1.00 76.97  ?  32   ARG D CZ   1 
ATOM   5239  N  NH1  . ARG D  1 32 ? 21.890 50.658 -7.480  1.00 78.27  ?  32   ARG D NH1  1 
ATOM   5240  N  NH2  . ARG D  1 32 ? 23.378 52.047 -8.535  1.00 78.81  ?  32   ARG D NH2  1 
ATOM   5241  H  H    . ARG D  1 32 ? 27.367 47.367 -4.513  1.00 45.18  ?  32   ARG D H    1 
ATOM   5242  H  HA   . ARG D  1 32 ? 25.666 49.283 -3.943  1.00 50.93  ?  32   ARG D HA   1 
ATOM   5243  H  HB2  . ARG D  1 32 ? 25.927 48.940 -6.154  1.00 60.09  ?  32   ARG D HB2  1 
ATOM   5244  H  HB3  . ARG D  1 32 ? 25.689 47.375 -6.021  1.00 60.09  ?  32   ARG D HB3  1 
ATOM   5245  H  HG2  . ARG D  1 32 ? 23.435 47.690 -5.737  1.00 70.67  ?  32   ARG D HG2  1 
ATOM   5246  H  HG3  . ARG D  1 32 ? 23.628 49.268 -5.680  1.00 70.67  ?  32   ARG D HG3  1 
ATOM   5247  H  HD2  . ARG D  1 32 ? 24.365 47.920 -8.015  1.00 83.37  ?  32   ARG D HD2  1 
ATOM   5248  H  HD3  . ARG D  1 32 ? 22.830 48.267 -7.786  1.00 83.37  ?  32   ARG D HD3  1 
ATOM   5249  H  HE   . ARG D  1 32 ? 24.732 50.035 -8.456  1.00 88.07  ?  32   ARG D HE   1 
ATOM   5250  H  HH11 . ARG D  1 32 ? 21.690 49.888 -7.155  1.00 93.92  ?  32   ARG D HH11 1 
ATOM   5251  H  HH12 . ARG D  1 32 ? 21.320 51.301 -7.447  1.00 93.92  ?  32   ARG D HH12 1 
ATOM   5252  H  HH21 . ARG D  1 32 ? 24.147 52.181 -8.896  1.00 94.57  ?  32   ARG D HH21 1 
ATOM   5253  H  HH22 . ARG D  1 32 ? 22.803 52.685 -8.498  1.00 94.57  ?  32   ARG D HH22 1 
ATOM   5254  N  N    . THR D  1 33 ? 24.609 46.298 -3.442  1.00 45.29  ?  33   THR D N    1 
ATOM   5255  C  CA   . THR D  1 33 ? 23.590 45.500 -2.773  1.00 48.07  ?  33   THR D CA   1 
ATOM   5256  C  C    . THR D  1 33 ? 23.615 45.754 -1.269  1.00 40.80  ?  33   THR D C    1 
ATOM   5257  O  O    . THR D  1 33 ? 22.570 45.887 -0.634  1.00 42.19  ?  33   THR D O    1 
ATOM   5258  C  CB   . THR D  1 33 ? 23.793 43.994 -3.027  1.00 53.42  ?  33   THR D CB   1 
ATOM   5259  O  OG1  . THR D  1 33 ? 23.713 43.724 -4.432  1.00 59.82  ?  33   THR D OG1  1 
ATOM   5260  C  CG2  . THR D  1 33 ? 22.732 43.178 -2.301  1.00 56.91  ?  33   THR D CG2  1 
ATOM   5261  H  H    . THR D  1 33 ? 25.223 45.834 -3.825  1.00 54.35  ?  33   THR D H    1 
ATOM   5262  H  HA   . THR D  1 33 ? 22.706 45.753 -3.112  1.00 57.69  ?  33   THR D HA   1 
ATOM   5263  H  HB   . THR D  1 33 ? 24.665 43.725 -2.697  1.00 64.10  ?  33   THR D HB   1 
ATOM   5264  H  HG1  . THR D  1 33 ? 24.293 44.144 -4.832  1.00 71.78  ?  33   THR D HG1  1 
ATOM   5265  H  HG21 . THR D  1 33 ? 21.858 43.426 -2.612  1.00 68.29  ?  33   THR D HG21 1 
ATOM   5266  H  HG22 . THR D  1 33 ? 22.868 42.242 -2.467  1.00 68.29  ?  33   THR D HG22 1 
ATOM   5267  H  HG23 . THR D  1 33 ? 22.784 43.339 -1.356  1.00 68.29  ?  33   THR D HG23 1 
ATOM   5268  N  N    . LEU D  1 34 ? 24.816 45.825 -0.705  1.00 42.41  ?  34   LEU D N    1 
ATOM   5269  C  CA   . LEU D  1 34 ? 24.973 46.003 0.733   1.00 38.73  ?  34   LEU D CA   1 
ATOM   5270  C  C    . LEU D  1 34 ? 24.543 47.396 1.186   1.00 36.44  ?  34   LEU D C    1 
ATOM   5271  O  O    . LEU D  1 34 ? 24.035 47.564 2.295   1.00 34.16  ?  34   LEU D O    1 
ATOM   5272  C  CB   . LEU D  1 34 ? 26.420 45.729 1.145   1.00 35.61  ?  34   LEU D CB   1 
ATOM   5273  C  CG   . LEU D  1 34 ? 26.828 44.258 1.042   1.00 36.82  ?  34   LEU D CG   1 
ATOM   5274  C  CD1  . LEU D  1 34 ? 28.338 44.109 1.096   1.00 34.21  ?  34   LEU D CD1  1 
ATOM   5275  C  CD2  . LEU D  1 34 ? 26.171 43.452 2.151   1.00 35.90  ?  34   LEU D CD2  1 
ATOM   5276  H  H    . LEU D  1 34 ? 25.559 45.773 -1.136  1.00 50.90  ?  34   LEU D H    1 
ATOM   5277  H  HA   . LEU D  1 34 ? 24.403 45.351 1.194   1.00 46.47  ?  34   LEU D HA   1 
ATOM   5278  H  HB2  . LEU D  1 34 ? 27.010 46.241 0.569   1.00 42.73  ?  34   LEU D HB2  1 
ATOM   5279  H  HB3  . LEU D  1 34 ? 26.540 46.006 2.067   1.00 42.73  ?  34   LEU D HB3  1 
ATOM   5280  H  HG   . LEU D  1 34 ? 26.522 43.904 0.193   1.00 44.19  ?  34   LEU D HG   1 
ATOM   5281  H  HD11 . LEU D  1 34 ? 28.657 44.465 1.929   1.00 41.05  ?  34   LEU D HD11 1 
ATOM   5282  H  HD12 . LEU D  1 34 ? 28.562 43.178 1.030   1.00 41.05  ?  34   LEU D HD12 1 
ATOM   5283  H  HD13 . LEU D  1 34 ? 28.726 44.593 0.363   1.00 41.05  ?  34   LEU D HD13 1 
ATOM   5284  H  HD21 . LEU D  1 34 ? 25.218 43.524 2.066   1.00 43.07  ?  34   LEU D HD21 1 
ATOM   5285  H  HD22 . LEU D  1 34 ? 26.439 42.534 2.070   1.00 43.07  ?  34   LEU D HD22 1 
ATOM   5286  H  HD23 . LEU D  1 34 ? 26.452 43.802 3.000   1.00 43.07  ?  34   LEU D HD23 1 
ATOM   5287  N  N    . GLN D  1 35 ? 24.744 48.393 0.330   1.00 40.83  ?  35   GLN D N    1 
ATOM   5288  C  CA   . GLN D  1 35 ? 24.300 49.749 0.632   1.00 41.34  ?  35   GLN D CA   1 
ATOM   5289  C  C    . GLN D  1 35 ? 22.786 49.856 0.490   1.00 47.29  ?  35   GLN D C    1 
ATOM   5290  O  O    . GLN D  1 35 ? 22.117 50.492 1.306   1.00 48.24  ?  35   GLN D O    1 
ATOM   5291  C  CB   . GLN D  1 35 ? 24.983 50.760 -0.289  1.00 40.51  ?  35   GLN D CB   1 
ATOM   5292  C  CG   . GLN D  1 35 ? 26.474 50.909 -0.043  1.00 34.60  ?  35   GLN D CG   1 
ATOM   5293  C  CD   . GLN D  1 35 ? 27.140 51.812 -1.057  1.00 34.30  ?  35   GLN D CD   1 
ATOM   5294  O  OE1  . GLN D  1 35 ? 26.995 53.031 -1.004  1.00 33.93  ?  35   GLN D OE1  1 
ATOM   5295  N  NE2  . GLN D  1 35 ? 27.872 51.219 -1.992  1.00 34.69  ?  35   GLN D NE2  1 
ATOM   5296  H  H    . GLN D  1 35 ? 25.136 48.310 -0.432  1.00 48.99  ?  35   GLN D H    1 
ATOM   5297  H  HA   . GLN D  1 35 ? 24.537 49.968 1.557   1.00 49.61  ?  35   GLN D HA   1 
ATOM   5298  H  HB2  . GLN D  1 35 ? 24.861 50.477 -1.208  1.00 48.61  ?  35   GLN D HB2  1 
ATOM   5299  H  HB3  . GLN D  1 35 ? 24.573 51.630 -0.156  1.00 48.61  ?  35   GLN D HB3  1 
ATOM   5300  H  HG2  . GLN D  1 35 ? 26.614 51.291 0.837   1.00 41.52  ?  35   GLN D HG2  1 
ATOM   5301  H  HG3  . GLN D  1 35 ? 26.893 50.036 -0.097  1.00 41.52  ?  35   GLN D HG3  1 
ATOM   5302  H  HE21 . GLN D  1 35 ? 27.948 50.362 -1.999  1.00 41.62  ?  35   GLN D HE21 1 
ATOM   5303  H  HE22 . GLN D  1 35 ? 28.270 51.691 -2.590  1.00 41.62  ?  35   GLN D HE22 1 
ATOM   5304  N  N    . GLU D  1 36 ? 22.250 49.228 -0.550  1.00 40.33  ?  36   GLU D N    1 
ATOM   5305  C  CA   . GLU D  1 36 ? 20.811 49.225 -0.784  1.00 45.67  ?  36   GLU D CA   1 
ATOM   5306  C  C    . GLU D  1 36 ? 20.074 48.549 0.368   1.00 46.30  ?  36   GLU D C    1 
ATOM   5307  O  O    . GLU D  1 36 ? 18.945 48.916 0.692   1.00 46.63  ?  36   GLU D O    1 
ATOM   5308  C  CB   . GLU D  1 36 ? 20.489 48.520 -2.104  1.00 52.50  ?  36   GLU D CB   1 
ATOM   5309  C  CG   . GLU D  1 36 ? 20.854 49.331 -3.340  1.00 55.74  ?  36   GLU D CG   1 
ATOM   5310  C  CD   . GLU D  1 36 ? 20.707 48.540 -4.628  1.00 62.34  ?  36   GLU D CD   1 
ATOM   5311  O  OE1  . GLU D  1 36 ? 20.613 47.296 -4.563  1.00 63.62  ?  36   GLU D OE1  1 
ATOM   5312  O  OE2  . GLU D  1 36 ? 20.683 49.167 -5.708  1.00 66.49  ?  36   GLU D OE2  1 
ATOM   5313  H  H    . GLU D  1 36 ? 22.702 48.793 -1.139  1.00 48.39  ?  36   GLU D H    1 
ATOM   5314  H  HA   . GLU D  1 36 ? 20.495 50.150 -0.848  1.00 54.80  ?  36   GLU D HA   1 
ATOM   5315  H  HB2  . GLU D  1 36 ? 20.983 47.685 -2.141  1.00 63.00  ?  36   GLU D HB2  1 
ATOM   5316  H  HB3  . GLU D  1 36 ? 19.537 48.339 -2.138  1.00 63.00  ?  36   GLU D HB3  1 
ATOM   5317  H  HG2  . GLU D  1 36 ? 20.269 50.103 -3.394  1.00 66.89  ?  36   GLU D HG2  1 
ATOM   5318  H  HG3  . GLU D  1 36 ? 21.777 49.618 -3.268  1.00 66.89  ?  36   GLU D HG3  1 
ATOM   5319  N  N    . GLN D  1 37 ? 20.721 47.566 0.988   1.00 52.47  ?  37   GLN D N    1 
ATOM   5320  C  CA   . GLN D  1 37 ? 20.112 46.818 2.084   1.00 53.96  ?  37   GLN D CA   1 
ATOM   5321  C  C    . GLN D  1 37 ? 20.281 47.530 3.427   1.00 46.22  ?  37   GLN D C    1 
ATOM   5322  O  O    . GLN D  1 37 ? 19.500 47.311 4.353   1.00 48.02  ?  37   GLN D O    1 
ATOM   5323  C  CB   . GLN D  1 37 ? 20.705 45.410 2.157   1.00 55.97  ?  37   GLN D CB   1 
ATOM   5324  C  CG   . GLN D  1 37 ? 20.313 44.514 0.991   1.00 64.28  ?  37   GLN D CG   1 
ATOM   5325  C  CD   . GLN D  1 37 ? 21.098 43.216 0.960   1.00 66.78  ?  37   GLN D CD   1 
ATOM   5326  O  OE1  . GLN D  1 37 ? 22.020 43.016 1.752   1.00 63.64  ?  37   GLN D OE1  1 
ATOM   5327  N  NE2  . GLN D  1 37 ? 20.736 42.327 0.043   1.00 73.12  ?  37   GLN D NE2  1 
ATOM   5328  H  H    . GLN D  1 37 ? 21.518 47.311 0.792   1.00 62.97  ?  37   GLN D H    1 
ATOM   5329  H  HA   . GLN D  1 37 ? 19.152 46.730 1.911   1.00 64.75  ?  37   GLN D HA   1 
ATOM   5330  H  HB2  . GLN D  1 37 ? 21.672 45.478 2.166   1.00 67.16  ?  37   GLN D HB2  1 
ATOM   5331  H  HB3  . GLN D  1 37 ? 20.398 44.984 2.973   1.00 67.16  ?  37   GLN D HB3  1 
ATOM   5332  H  HG2  . GLN D  1 37 ? 19.371 44.294 1.063   1.00 77.13  ?  37   GLN D HG2  1 
ATOM   5333  H  HG3  . GLN D  1 37 ? 20.480 44.986 0.160   1.00 77.13  ?  37   GLN D HG3  1 
ATOM   5334  H  HE21 . GLN D  1 37 ? 20.087 42.502 -0.494  1.00 87.75  ?  37   GLN D HE21 1 
ATOM   5335  H  HE22 . GLN D  1 37 ? 21.150 41.575 -0.015  1.00 87.75  ?  37   GLN D HE22 1 
ATOM   5336  N  N    . GLY D  1 38 ? 21.301 48.376 3.531   1.00 41.88  ?  38   GLY D N    1 
ATOM   5337  C  CA   . GLY D  1 38 ? 21.501 49.178 4.726   1.00 39.94  ?  38   GLY D CA   1 
ATOM   5338  C  C    . GLY D  1 38 ? 22.641 48.715 5.618   1.00 39.10  ?  38   GLY D C    1 
ATOM   5339  O  O    . GLY D  1 38 ? 22.977 49.384 6.596   1.00 40.02  ?  38   GLY D O    1 
ATOM   5340  H  H    . GLY D  1 38 ? 21.892 48.502 2.920   1.00 50.25  ?  38   GLY D H    1 
ATOM   5341  H  HA2  . GLY D  1 38 ? 21.680 50.095 4.464   1.00 47.93  ?  38   GLY D HA2  1 
ATOM   5342  H  HA3  . GLY D  1 38 ? 20.686 49.170 5.252   1.00 47.93  ?  38   GLY D HA3  1 
ATOM   5343  N  N    . GLN D  1 39 ? 23.238 47.573 5.292   1.00 39.56  ?  39   GLN D N    1 
ATOM   5344  C  CA   . GLN D  1 39 ? 24.355 47.056 6.076   1.00 41.15  ?  39   GLN D CA   1 
ATOM   5345  C  C    . GLN D  1 39 ? 25.596 47.917 5.871   1.00 38.40  ?  39   GLN D C    1 
ATOM   5346  O  O    . GLN D  1 39 ? 26.328 48.202 6.817   1.00 37.70  ?  39   GLN D O    1 
ATOM   5347  C  CB   . GLN D  1 39 ? 24.649 45.606 5.697   1.00 44.48  ?  39   GLN D CB   1 
ATOM   5348  C  CG   . GLN D  1 39 ? 23.601 44.623 6.183   1.00 50.90  ?  39   GLN D CG   1 
ATOM   5349  C  CD   . GLN D  1 39 ? 23.173 43.654 5.103   1.00 56.66  ?  39   GLN D CD   1 
ATOM   5350  O  OE1  . GLN D  1 39 ? 22.588 44.051 4.095   1.00 58.33  ?  39   GLN D OE1  1 
ATOM   5351  N  NE2  . GLN D  1 39 ? 23.466 42.373 5.303   1.00 60.06  ?  39   GLN D NE2  1 
ATOM   5352  H  H    . GLN D  1 39 ? 23.016 47.079 4.624   1.00 47.47  ?  39   GLN D H    1 
ATOM   5353  H  HA   . GLN D  1 39 ? 24.119 47.081 7.026   1.00 49.38  ?  39   GLN D HA   1 
ATOM   5354  H  HB2  . GLN D  1 39 ? 24.695 45.538 4.731   1.00 53.37  ?  39   GLN D HB2  1 
ATOM   5355  H  HB3  . GLN D  1 39 ? 25.500 45.348 6.085   1.00 53.37  ?  39   GLN D HB3  1 
ATOM   5356  H  HG2  . GLN D  1 39 ? 23.965 44.110 6.921   1.00 61.07  ?  39   GLN D HG2  1 
ATOM   5357  H  HG3  . GLN D  1 39 ? 22.817 45.115 6.474   1.00 61.07  ?  39   GLN D HG3  1 
ATOM   5358  H  HE21 . GLN D  1 39 ? 23.879 42.134 6.019   1.00 72.07  ?  39   GLN D HE21 1 
ATOM   5359  H  HE22 . GLN D  1 39 ? 23.244 41.784 4.717   1.00 72.07  ?  39   GLN D HE22 1 
ATOM   5360  N  N    . TRP D  1 40 ? 25.826 48.322 4.626   1.00 37.19  ?  40   TRP D N    1 
ATOM   5361  C  CA   . TRP D  1 40 ? 26.908 49.239 4.300   1.00 34.83  ?  40   TRP D CA   1 
ATOM   5362  C  C    . TRP D  1 40 ? 26.335 50.650 4.300   1.00 35.07  ?  40   TRP D C    1 
ATOM   5363  O  O    . TRP D  1 40 ? 25.910 51.161 3.264   1.00 35.60  ?  40   TRP D O    1 
ATOM   5364  C  CB   . TRP D  1 40 ? 27.499 48.891 2.934   1.00 32.19  ?  40   TRP D CB   1 
ATOM   5365  C  CG   . TRP D  1 40 ? 28.896 49.383 2.728   1.00 30.04  ?  40   TRP D CG   1 
ATOM   5366  C  CD1  . TRP D  1 40 ? 29.439 50.541 3.201   1.00 29.42  ?  40   TRP D CD1  1 
ATOM   5367  C  CD2  . TRP D  1 40 ? 29.937 48.720 1.998   1.00 28.50  ?  40   TRP D CD2  1 
ATOM   5368  N  NE1  . TRP D  1 40 ? 30.752 50.643 2.807   1.00 28.26  ?  40   TRP D NE1  1 
ATOM   5369  C  CE2  . TRP D  1 40 ? 31.082 49.536 2.068   1.00 28.41  ?  40   TRP D CE2  1 
ATOM   5370  C  CE3  . TRP D  1 40 ? 30.010 47.515 1.292   1.00 27.39  ?  40   TRP D CE3  1 
ATOM   5371  C  CZ2  . TRP D  1 40 ? 32.285 49.188 1.458   1.00 28.01  ?  40   TRP D CZ2  1 
ATOM   5372  C  CZ3  . TRP D  1 40 ? 31.204 47.172 0.686   1.00 26.82  ?  40   TRP D CZ3  1 
ATOM   5373  C  CH2  . TRP D  1 40 ? 32.325 48.005 0.773   1.00 27.45  ?  40   TRP D CH2  1 
ATOM   5374  H  H    . TRP D  1 40 ? 25.363 48.075 3.945   1.00 44.62  ?  40   TRP D H    1 
ATOM   5375  H  HA   . TRP D  1 40 ? 27.614 49.181 4.977   1.00 41.80  ?  40   TRP D HA   1 
ATOM   5376  H  HB2  . TRP D  1 40 ? 27.508 47.926 2.836   1.00 38.63  ?  40   TRP D HB2  1 
ATOM   5377  H  HB3  . TRP D  1 40 ? 26.942 49.285 2.244   1.00 38.63  ?  40   TRP D HB3  1 
ATOM   5378  H  HD1  . TRP D  1 40 ? 28.986 51.171 3.713   1.00 35.30  ?  40   TRP D HD1  1 
ATOM   5379  H  HE1  . TRP D  1 40 ? 31.281 51.294 2.994   1.00 33.91  ?  40   TRP D HE1  1 
ATOM   5380  H  HE3  . TRP D  1 40 ? 29.269 46.957 1.229   1.00 32.87  ?  40   TRP D HE3  1 
ATOM   5381  H  HZ2  . TRP D  1 40 ? 33.032 49.740 1.514   1.00 33.61  ?  40   TRP D HZ2  1 
ATOM   5382  H  HZ3  . TRP D  1 40 ? 31.264 46.373 0.214   1.00 32.18  ?  40   TRP D HZ3  1 
ATOM   5383  H  HH2  . TRP D  1 40 ? 33.116 47.748 0.356   1.00 32.94  ?  40   TRP D HH2  1 
ATOM   5384  N  N    . ARG D  1 41 ? 26.324 51.273 5.473   1.00 33.66  ?  41   ARG D N    1 
ATOM   5385  C  CA   . ARG D  1 41 ? 25.582 52.512 5.679   1.00 33.89  ?  41   ARG D CA   1 
ATOM   5386  C  C    . ARG D  1 41 ? 26.242 53.726 5.031   1.00 33.57  ?  41   ARG D C    1 
ATOM   5387  O  O    . ARG D  1 41 ? 25.575 54.507 4.354   1.00 36.38  ?  41   ARG D O    1 
ATOM   5388  C  CB   . ARG D  1 41 ? 25.378 52.756 7.174   1.00 33.95  ?  41   ARG D CB   1 
ATOM   5389  C  CG   . ARG D  1 41 ? 24.633 54.035 7.497   1.00 37.26  ?  41   ARG D CG   1 
ATOM   5390  C  CD   . ARG D  1 41 ? 23.904 53.918 8.824   1.00 45.04  ?  41   ARG D CD   1 
ATOM   5391  N  NE   . ARG D  1 41 ? 23.371 55.200 9.271   1.00 52.89  ?  41   ARG D NE   1 
ATOM   5392  C  CZ   . ARG D  1 41 ? 22.586 55.357 10.332  1.00 60.04  ?  41   ARG D CZ   1 
ATOM   5393  N  NH1  . ARG D  1 41 ? 22.230 54.308 11.064  1.00 61.06  ?  41   ARG D NH1  1 
ATOM   5394  N  NH2  . ARG D  1 41 ? 22.152 56.566 10.661  1.00 64.42  ?  41   ARG D NH2  1 
ATOM   5395  H  H    . ARG D  1 41 ? 26.742 50.996 6.172   1.00 40.39  ?  41   ARG D H    1 
ATOM   5396  H  HA   . ARG D  1 41 ? 24.695 52.411 5.274   1.00 40.66  ?  41   ARG D HA   1 
ATOM   5397  H  HB2  . ARG D  1 41 ? 24.871 52.017 7.544   1.00 40.74  ?  41   ARG D HB2  1 
ATOM   5398  H  HB3  . ARG D  1 41 ? 26.247 52.805 7.603   1.00 40.74  ?  41   ARG D HB3  1 
ATOM   5399  H  HG2  . ARG D  1 41 ? 25.264 54.769 7.558   1.00 44.71  ?  41   ARG D HG2  1 
ATOM   5400  H  HG3  . ARG D  1 41 ? 23.978 54.209 6.803   1.00 44.71  ?  41   ARG D HG3  1 
ATOM   5401  H  HD2  . ARG D  1 41 ? 23.163 53.300 8.727   1.00 54.05  ?  41   ARG D HD2  1 
ATOM   5402  H  HD3  . ARG D  1 41 ? 24.522 53.596 9.499   1.00 54.05  ?  41   ARG D HD3  1 
ATOM   5403  H  HE   . ARG D  1 41 ? 23.578 55.901 8.818   1.00 63.47  ?  41   ARG D HE   1 
ATOM   5404  H  HH11 . ARG D  1 41 ? 22.510 53.523 10.854  1.00 73.28  ?  41   ARG D HH11 1 
ATOM   5405  H  HH12 . ARG D  1 41 ? 21.721 54.415 11.749  1.00 73.28  ?  41   ARG D HH12 1 
ATOM   5406  H  HH21 . ARG D  1 41 ? 22.379 57.248 10.189  1.00 77.30  ?  41   ARG D HH21 1 
ATOM   5407  H  HH22 . ARG D  1 41 ? 21.642 56.668 11.346  1.00 77.30  ?  41   ARG D HH22 1 
ATOM   5408  N  N    . TYR D  1 42 ? 27.544 53.890 5.245   1.00 32.02  ?  42   TYR D N    1 
ATOM   5409  C  CA   . TYR D  1 42 ? 28.274 55.006 4.651   1.00 29.33  ?  42   TYR D CA   1 
ATOM   5410  C  C    . TYR D  1 42 ? 29.541 54.522 3.961   1.00 29.42  ?  42   TYR D C    1 
ATOM   5411  O  O    . TYR D  1 42 ? 30.155 53.538 4.378   1.00 28.70  ?  42   TYR D O    1 
ATOM   5412  C  CB   . TYR D  1 42 ? 28.621 56.054 5.714   1.00 29.44  ?  42   TYR D CB   1 
ATOM   5413  C  CG   . TYR D  1 42 ? 27.408 56.655 6.386   1.00 32.31  ?  42   TYR D CG   1 
ATOM   5414  C  CD1  . TYR D  1 42 ? 26.374 57.201 5.636   1.00 34.44  ?  42   TYR D CD1  1 
ATOM   5415  C  CD2  . TYR D  1 42 ? 27.288 56.661 7.770   1.00 33.37  ?  42   TYR D CD2  1 
ATOM   5416  C  CE1  . TYR D  1 42 ? 25.259 57.744 6.245   1.00 37.28  ?  42   TYR D CE1  1 
ATOM   5417  C  CE2  . TYR D  1 42 ? 26.176 57.204 8.388   1.00 36.22  ?  42   TYR D CE2  1 
ATOM   5418  C  CZ   . TYR D  1 42 ? 25.165 57.744 7.620   1.00 38.27  ?  42   TYR D CZ   1 
ATOM   5419  O  OH   . TYR D  1 42 ? 24.055 58.282 8.231   1.00 42.63  ?  42   TYR D OH   1 
ATOM   5420  H  H    . TYR D  1 42 ? 28.028 53.370 5.730   1.00 38.43  ?  42   TYR D H    1 
ATOM   5421  H  HA   . TYR D  1 42 ? 27.707 55.435 3.977   1.00 35.19  ?  42   TYR D HA   1 
ATOM   5422  H  HB2  . TYR D  1 42 ? 29.165 55.637 6.400   1.00 35.33  ?  42   TYR D HB2  1 
ATOM   5423  H  HB3  . TYR D  1 42 ? 29.116 56.775 5.294   1.00 35.33  ?  42   TYR D HB3  1 
ATOM   5424  H  HD1  . TYR D  1 42 ? 26.435 57.203 4.708   1.00 41.33  ?  42   TYR D HD1  1 
ATOM   5425  H  HD2  . TYR D  1 42 ? 27.968 56.298 8.290   1.00 40.05  ?  42   TYR D HD2  1 
ATOM   5426  H  HE1  . TYR D  1 42 ? 24.576 58.109 5.729   1.00 44.73  ?  42   TYR D HE1  1 
ATOM   5427  H  HE2  . TYR D  1 42 ? 26.109 57.203 9.315   1.00 43.47  ?  42   TYR D HE2  1 
ATOM   5428  H  HH   . TYR D  1 42 ? 24.277 58.901 8.722   1.00 51.16  ?  42   TYR D HH   1 
ATOM   5429  N  N    . LEU D  1 43 ? 29.923 55.224 2.899   1.00 33.66  ?  43   LEU D N    1 
ATOM   5430  C  CA   . LEU D  1 43 ? 31.104 54.875 2.122   1.00 35.06  ?  43   LEU D CA   1 
ATOM   5431  C  C    . LEU D  1 43 ? 31.749 56.139 1.567   1.00 35.02  ?  43   LEU D C    1 
ATOM   5432  O  O    . LEU D  1 43 ? 31.110 56.906 0.846   1.00 38.72  ?  43   LEU D O    1 
ATOM   5433  C  CB   . LEU D  1 43 ? 30.720 53.931 0.979   1.00 35.39  ?  43   LEU D CB   1 
ATOM   5434  C  CG   . LEU D  1 43 ? 31.802 53.601 -0.053  1.00 33.01  ?  43   LEU D CG   1 
ATOM   5435  C  CD1  . LEU D  1 43 ? 32.927 52.788 0.568   1.00 31.66  ?  43   LEU D CD1  1 
ATOM   5436  C  CD2  . LEU D  1 43 ? 31.193 52.862 -1.235  1.00 32.65  ?  43   LEU D CD2  1 
ATOM   5437  H  H    . LEU D  1 43 ? 29.508 55.917 2.605   1.00 40.39  ?  43   LEU D H    1 
ATOM   5438  H  HA   . LEU D  1 43 ? 31.753 54.420 2.699   1.00 42.07  ?  43   LEU D HA   1 
ATOM   5439  H  HB2  . LEU D  1 43 ? 30.432 53.090 1.368   1.00 42.47  ?  43   LEU D HB2  1 
ATOM   5440  H  HB3  . LEU D  1 43 ? 29.979 54.329 0.497   1.00 42.47  ?  43   LEU D HB3  1 
ATOM   5441  H  HG   . LEU D  1 43 ? 32.182 54.429 -0.384  1.00 39.61  ?  43   LEU D HG   1 
ATOM   5442  H  HD11 . LEU D  1 43 ? 32.566 51.967 0.912   1.00 37.99  ?  43   LEU D HD11 1 
ATOM   5443  H  HD12 . LEU D  1 43 ? 33.585 52.600 -0.105  1.00 37.99  ?  43   LEU D HD12 1 
ATOM   5444  H  HD13 . LEU D  1 43 ? 33.322 53.296 1.281   1.00 37.99  ?  43   LEU D HD13 1 
ATOM   5445  H  HD21 . LEU D  1 43 ? 30.525 53.420 -1.641  1.00 39.18  ?  43   LEU D HD21 1 
ATOM   5446  H  HD22 . LEU D  1 43 ? 31.885 52.664 -1.870  1.00 39.18  ?  43   LEU D HD22 1 
ATOM   5447  H  HD23 . LEU D  1 43 ? 30.793 52.047 -0.922  1.00 39.18  ?  43   LEU D HD23 1 
ATOM   5448  N  N    . TRP D  1 44 ? 33.013 56.358 1.915   1.00 29.64  ?  44   TRP D N    1 
ATOM   5449  C  CA   . TRP D  1 44 ? 33.751 57.513 1.420   1.00 28.34  ?  44   TRP D CA   1 
ATOM   5450  C  C    . TRP D  1 44 ? 35.119 57.094 0.901   1.00 27.81  ?  44   TRP D C    1 
ATOM   5451  O  O    . TRP D  1 44 ? 35.698 56.110 1.364   1.00 29.47  ?  44   TRP D O    1 
ATOM   5452  C  CB   . TRP D  1 44 ? 33.936 58.561 2.521   1.00 28.06  ?  44   TRP D CB   1 
ATOM   5453  C  CG   . TRP D  1 44 ? 32.660 59.079 3.101   1.00 28.51  ?  44   TRP D CG   1 
ATOM   5454  C  CD1  . TRP D  1 44 ? 31.743 59.879 2.483   1.00 30.68  ?  44   TRP D CD1  1 
ATOM   5455  C  CD2  . TRP D  1 44 ? 32.164 58.846 4.423   1.00 29.79  ?  44   TRP D CD2  1 
ATOM   5456  N  NE1  . TRP D  1 44 ? 30.704 60.155 3.338   1.00 32.03  ?  44   TRP D NE1  1 
ATOM   5457  C  CE2  . TRP D  1 44 ? 30.938 59.531 4.536   1.00 31.13  ?  44   TRP D CE2  1 
ATOM   5458  C  CE3  . TRP D  1 44 ? 32.635 58.122 5.522   1.00 30.17  ?  44   TRP D CE3  1 
ATOM   5459  C  CZ2  . TRP D  1 44 ? 30.178 59.514 5.702   1.00 32.60  ?  44   TRP D CZ2  1 
ATOM   5460  C  CZ3  . TRP D  1 44 ? 31.878 58.107 6.681   1.00 32.55  ?  44   TRP D CZ3  1 
ATOM   5461  C  CH2  . TRP D  1 44 ? 30.663 58.797 6.761   1.00 33.27  ?  44   TRP D CH2  1 
ATOM   5462  H  H    . TRP D  1 44 ? 33.468 55.849 2.439   1.00 35.57  ?  44   TRP D H    1 
ATOM   5463  H  HA   . TRP D  1 44 ? 33.254 57.925 0.682   1.00 34.01  ?  44   TRP D HA   1 
ATOM   5464  H  HB2  . TRP D  1 44 ? 34.448 58.165 3.243   1.00 33.67  ?  44   TRP D HB2  1 
ATOM   5465  H  HB3  . TRP D  1 44 ? 34.420 59.316 2.152   1.00 33.67  ?  44   TRP D HB3  1 
ATOM   5466  H  HD1  . TRP D  1 44 ? 31.811 60.192 1.610   1.00 36.82  ?  44   TRP D HD1  1 
ATOM   5467  H  HE1  . TRP D  1 44 ? 30.018 60.639 3.152   1.00 38.44  ?  44   TRP D HE1  1 
ATOM   5468  H  HE3  . TRP D  1 44 ? 33.441 57.660 5.475   1.00 36.20  ?  44   TRP D HE3  1 
ATOM   5469  H  HZ2  . TRP D  1 44 ? 29.371 59.972 5.759   1.00 39.12  ?  44   TRP D HZ2  1 
ATOM   5470  H  HZ3  . TRP D  1 44 ? 32.181 57.628 7.419   1.00 39.06  ?  44   TRP D HZ3  1 
ATOM   5471  H  HH2  . TRP D  1 44 ? 30.176 58.769 7.552   1.00 39.92  ?  44   TRP D HH2  1 
ATOM   5472  N  N    . ARG D  1 45 ? 35.631 57.853 -0.060  1.00 27.11  ?  45   ARG D N    1 
ATOM   5473  C  CA   . ARG D  1 45 ? 36.966 57.625 -0.588  1.00 24.50  ?  45   ARG D CA   1 
ATOM   5474  C  C    . ARG D  1 45 ? 38.016 58.301 0.285   1.00 22.99  ?  45   ARG D C    1 
ATOM   5475  O  O    . ARG D  1 45 ? 37.873 59.466 0.649   1.00 23.22  ?  45   ARG D O    1 
ATOM   5476  C  CB   . ARG D  1 45 ? 37.067 58.171 -2.014  1.00 25.20  ?  45   ARG D CB   1 
ATOM   5477  C  CG   . ARG D  1 45 ? 38.484 58.182 -2.570  1.00 26.52  ?  45   ARG D CG   1 
ATOM   5478  C  CD   . ARG D  1 45 ? 38.973 56.770 -2.814  1.00 27.78  ?  45   ARG D CD   1 
ATOM   5479  N  NE   . ARG D  1 45 ? 38.438 56.227 -4.058  1.00 29.38  ?  45   ARG D NE   1 
ATOM   5480  C  CZ   . ARG D  1 45 ? 38.187 54.940 -4.279  1.00 29.71  ?  45   ARG D CZ   1 
ATOM   5481  N  NH1  . ARG D  1 45 ? 38.409 54.033 -3.337  1.00 29.33  ?  45   ARG D NH1  1 
ATOM   5482  N  NH2  . ARG D  1 45 ? 37.703 54.558 -5.452  1.00 30.18  ?  45   ARG D NH2  1 
ATOM   5483  H  H    . ARG D  1 45 ? 35.220 58.514 -0.425  1.00 32.53  ?  45   ARG D H    1 
ATOM   5484  H  HA   . ARG D  1 45 ? 37.150 56.663 -0.609  1.00 29.40  ?  45   ARG D HA   1 
ATOM   5485  H  HB2  . ARG D  1 45 ? 36.524 57.621 -2.599  1.00 30.24  ?  45   ARG D HB2  1 
ATOM   5486  H  HB3  . ARG D  1 45 ? 36.739 59.084 -2.022  1.00 30.24  ?  45   ARG D HB3  1 
ATOM   5487  H  HG2  . ARG D  1 45 ? 38.496 58.661 -3.413  1.00 31.83  ?  45   ARG D HG2  1 
ATOM   5488  H  HG3  . ARG D  1 45 ? 39.078 58.606 -1.931  1.00 31.83  ?  45   ARG D HG3  1 
ATOM   5489  H  HD2  . ARG D  1 45 ? 39.941 56.773 -2.875  1.00 33.34  ?  45   ARG D HD2  1 
ATOM   5490  H  HD3  . ARG D  1 45 ? 38.684 56.200 -2.084  1.00 33.34  ?  45   ARG D HD3  1 
ATOM   5491  H  HE   . ARG D  1 45 ? 38.271 56.780 -4.695  1.00 35.26  ?  45   ARG D HE   1 
ATOM   5492  H  HH11 . ARG D  1 45 ? 38.724 54.274 -2.574  1.00 35.20  ?  45   ARG D HH11 1 
ATOM   5493  H  HH12 . ARG D  1 45 ? 38.242 53.204 -3.491  1.00 35.20  ?  45   ARG D HH12 1 
ATOM   5494  H  HH21 . ARG D  1 45 ? 37.554 55.141 -6.067  1.00 36.21  ?  45   ARG D HH21 1 
ATOM   5495  H  HH22 . ARG D  1 45 ? 37.536 53.727 -5.599  1.00 36.21  ?  45   ARG D HH22 1 
ATOM   5496  N  N    . THR D  1 46 ? 39.068 57.564 0.624   1.00 22.93  ?  46   THR D N    1 
ATOM   5497  C  CA   . THR D  1 46 ? 40.213 58.150 1.305   1.00 24.72  ?  46   THR D CA   1 
ATOM   5498  C  C    . THR D  1 46 ? 41.005 58.973 0.296   1.00 24.61  ?  46   THR D C    1 
ATOM   5499  O  O    . THR D  1 46 ? 41.614 58.427 -0.621  1.00 23.56  ?  46   THR D O    1 
ATOM   5500  C  CB   . THR D  1 46 ? 41.128 57.074 1.906   1.00 27.29  ?  46   THR D CB   1 
ATOM   5501  O  OG1  . THR D  1 46 ? 41.420 56.088 0.909   1.00 29.81  ?  46   THR D OG1  1 
ATOM   5502  C  CG2  . THR D  1 46 ? 40.459 56.401 3.094   1.00 25.98  ?  46   THR D CG2  1 
ATOM   5503  H  H    . THR D  1 46 ? 39.142 56.722 0.469   1.00 27.51  ?  46   THR D H    1 
ATOM   5504  H  HA   . THR D  1 46 ? 39.906 58.741 2.024   1.00 29.66  ?  46   THR D HA   1 
ATOM   5505  H  HB   . THR D  1 46 ? 41.954 57.482 2.208   1.00 32.75  ?  46   THR D HB   1 
ATOM   5506  H  HG1  . THR D  1 46 ? 41.797 56.438 0.270   1.00 35.77  ?  46   THR D HG1  1 
ATOM   5507  H  HG21 . THR D  1 46 ? 39.639 55.985 2.817   1.00 31.17  ?  46   THR D HG21 1 
ATOM   5508  H  HG22 . THR D  1 46 ? 41.040 55.730 3.461   1.00 31.17  ?  46   THR D HG22 1 
ATOM   5509  H  HG23 . THR D  1 46 ? 40.266 57.051 3.773   1.00 31.17  ?  46   THR D HG23 1 
ATOM   5510  N  N    . THR D  1 47 ? 40.992 60.289 0.474   1.00 24.75  ?  47   THR D N    1 
ATOM   5511  C  CA   . THR D  1 47 ? 41.559 61.206 -0.509  1.00 25.21  ?  47   THR D CA   1 
ATOM   5512  C  C    . THR D  1 47 ? 43.047 60.943 -0.745  1.00 23.95  ?  47   THR D C    1 
ATOM   5513  O  O    . THR D  1 47 ? 43.831 60.890 0.200   1.00 24.42  ?  47   THR D O    1 
ATOM   5514  C  CB   . THR D  1 47 ? 41.368 62.673 -0.076  1.00 27.32  ?  47   THR D CB   1 
ATOM   5515  O  OG1  . THR D  1 47 ? 39.975 62.939 0.143   1.00 28.45  ?  47   THR D OG1  1 
ATOM   5516  C  CG2  . THR D  1 47 ? 41.891 63.617 -1.147  1.00 26.47  ?  47   THR D CG2  1 
ATOM   5517  H  H    . THR D  1 47 ? 40.658 60.680 1.163   1.00 29.70  ?  47   THR D H    1 
ATOM   5518  H  HA   . THR D  1 47 ? 41.093 61.081 -1.362  1.00 30.25  ?  47   THR D HA   1 
ATOM   5519  H  HB   . THR D  1 47 ? 41.860 62.835 0.744   1.00 32.78  ?  47   THR D HB   1 
ATOM   5520  H  HG1  . THR D  1 47 ? 39.685 62.447 0.731   1.00 34.14  ?  47   THR D HG1  1 
ATOM   5521  H  HG21 . THR D  1 47 ? 41.417 63.475 -1.969  1.00 31.76  ?  47   THR D HG21 1 
ATOM   5522  H  HG22 . THR D  1 47 ? 41.769 64.528 -0.869  1.00 31.76  ?  47   THR D HG22 1 
ATOM   5523  H  HG23 . THR D  1 47 ? 42.827 63.459 -1.294  1.00 31.76  ?  47   THR D HG23 1 
ATOM   5524  N  N    . GLY D  1 48 ? 43.425 60.800 -2.013  1.00 22.76  ?  48   GLY D N    1 
ATOM   5525  C  CA   . GLY D  1 48 ? 44.795 60.497 -2.390  1.00 24.30  ?  48   GLY D CA   1 
ATOM   5526  C  C    . GLY D  1 48 ? 45.167 59.022 -2.407  1.00 26.38  ?  48   GLY D C    1 
ATOM   5527  O  O    . GLY D  1 48 ? 46.282 58.675 -2.795  1.00 26.55  ?  48   GLY D O    1 
ATOM   5528  H  H    . GLY D  1 48 ? 42.892 60.876 -2.683  1.00 27.31  ?  48   GLY D H    1 
ATOM   5529  H  HA2  . GLY D  1 48 ? 44.959 60.853 -3.277  1.00 29.16  ?  48   GLY D HA2  1 
ATOM   5530  H  HA3  . GLY D  1 48 ? 45.394 60.946 -1.774  1.00 29.16  ?  48   GLY D HA3  1 
ATOM   5531  N  N    . LYS D  1 49 ? 44.252 58.147 -1.997  1.00 28.20  ?  49   LYS D N    1 
ATOM   5532  C  CA   . LYS D  1 49 ? 44.580 56.728 -1.862  1.00 30.33  ?  49   LYS D CA   1 
ATOM   5533  C  C    . LYS D  1 49 ? 43.516 55.801 -2.438  1.00 28.45  ?  49   LYS D C    1 
ATOM   5534  O  O    . LYS D  1 49 ? 42.363 56.195 -2.620  1.00 28.66  ?  49   LYS D O    1 
ATOM   5535  C  CB   . LYS D  1 49 ? 44.799 56.384 -0.390  1.00 32.71  ?  49   LYS D CB   1 
ATOM   5536  C  CG   . LYS D  1 49 ? 46.041 57.013 0.210   1.00 36.36  ?  49   LYS D CG   1 
ATOM   5537  C  CD   . LYS D  1 49 ? 45.996 56.972 1.728   1.00 38.94  ?  49   LYS D CD   1 
ATOM   5538  C  CE   . LYS D  1 49 ? 47.295 57.469 2.336   1.00 41.58  ?  49   LYS D CE   1 
ATOM   5539  N  NZ   . LYS D  1 49 ? 48.431 56.542 2.065   1.00 42.90  ?  49   LYS D NZ   1 
ATOM   5540  H  H    . LYS D  1 49 ? 43.441 58.346 -1.792  1.00 33.83  ?  49   LYS D H    1 
ATOM   5541  H  HA   . LYS D  1 49 ? 45.419 56.553 -2.339  1.00 36.39  ?  49   LYS D HA   1 
ATOM   5542  H  HB2  . LYS D  1 49 ? 44.034 56.694 0.120   1.00 39.25  ?  49   LYS D HB2  1 
ATOM   5543  H  HB3  . LYS D  1 49 ? 44.884 55.422 -0.303  1.00 39.25  ?  49   LYS D HB3  1 
ATOM   5544  H  HG2  . LYS D  1 49 ? 46.824 56.523 -0.085  1.00 43.63  ?  49   LYS D HG2  1 
ATOM   5545  H  HG3  . LYS D  1 49 ? 46.098 57.940 -0.068  1.00 43.63  ?  49   LYS D HG3  1 
ATOM   5546  H  HD2  . LYS D  1 49 ? 45.276 57.541 2.043   1.00 46.72  ?  49   LYS D HD2  1 
ATOM   5547  H  HD3  . LYS D  1 49 ? 45.854 56.058 2.020   1.00 46.72  ?  49   LYS D HD3  1 
ATOM   5548  H  HE2  . LYS D  1 49 ? 47.513 58.334 1.956   1.00 49.90  ?  49   LYS D HE2  1 
ATOM   5549  H  HE3  . LYS D  1 49 ? 47.188 57.544 3.297   1.00 49.90  ?  49   LYS D HE3  1 
ATOM   5550  H  HZ1  . LYS D  1 49 ? 48.554 56.460 1.187   1.00 51.48  ?  49   LYS D HZ1  1 
ATOM   5551  H  HZ2  . LYS D  1 49 ? 49.177 56.859 2.433   1.00 51.48  ?  49   LYS D HZ2  1 
ATOM   5552  H  HZ3  . LYS D  1 49 ? 48.258 55.740 2.409   1.00 51.48  ?  49   LYS D HZ3  1 
ATOM   5553  N  N    . TYR D  1 50 ? 43.920 54.564 -2.721  1.00 30.12  ?  50   TYR D N    1 
ATOM   5554  C  CA   . TYR D  1 50 ? 42.993 53.532 -3.165  1.00 31.04  ?  50   TYR D CA   1 
ATOM   5555  C  C    . TYR D  1 50 ? 42.450 52.791 -1.951  1.00 34.21  ?  50   TYR D C    1 
ATOM   5556  O  O    . TYR D  1 50 ? 42.990 51.764 -1.541  1.00 33.63  ?  50   TYR D O    1 
ATOM   5557  C  CB   . TYR D  1 50 ? 43.686 52.544 -4.103  1.00 32.46  ?  50   TYR D CB   1 
ATOM   5558  C  CG   . TYR D  1 50 ? 42.733 51.731 -4.957  1.00 35.29  ?  50   TYR D CG   1 
ATOM   5559  C  CD1  . TYR D  1 50 ? 41.365 51.727 -4.703  1.00 36.16  ?  50   TYR D CD1  1 
ATOM   5560  C  CD2  . TYR D  1 50 ? 43.202 50.971 -6.019  1.00 37.28  ?  50   TYR D CD2  1 
ATOM   5561  C  CE1  . TYR D  1 50 ? 40.495 50.989 -5.484  1.00 37.91  ?  50   TYR D CE1  1 
ATOM   5562  C  CE2  . TYR D  1 50 ? 42.338 50.229 -6.805  1.00 39.33  ?  50   TYR D CE2  1 
ATOM   5563  C  CZ   . TYR D  1 50 ? 40.986 50.243 -6.533  1.00 40.09  ?  50   TYR D CZ   1 
ATOM   5564  O  OH   . TYR D  1 50 ? 40.122 49.508 -7.311  1.00 42.50  ?  50   TYR D OH   1 
ATOM   5565  H  H    . TYR D  1 50 ? 44.735 54.298 -2.663  1.00 36.15  ?  50   TYR D H    1 
ATOM   5566  H  HA   . TYR D  1 50 ? 42.243 53.945 -3.642  1.00 37.25  ?  50   TYR D HA   1 
ATOM   5567  H  HB2  . TYR D  1 50 ? 44.270 53.037 -4.700  1.00 38.95  ?  50   TYR D HB2  1 
ATOM   5568  H  HB3  . TYR D  1 50 ? 44.209 51.923 -3.572  1.00 38.95  ?  50   TYR D HB3  1 
ATOM   5569  H  HD1  . TYR D  1 50 ? 41.029 52.231 -3.997  1.00 43.39  ?  50   TYR D HD1  1 
ATOM   5570  H  HD2  . TYR D  1 50 ? 44.113 50.960 -6.206  1.00 44.73  ?  50   TYR D HD2  1 
ATOM   5571  H  HE1  . TYR D  1 50 ? 39.582 50.996 -5.303  1.00 45.49  ?  50   TYR D HE1  1 
ATOM   5572  H  HE2  . TYR D  1 50 ? 42.668 49.724 -7.513  1.00 47.20  ?  50   TYR D HE2  1 
ATOM   5573  H  HH   . TYR D  1 50 ? 40.319 48.713 -7.275  1.00 51.00  ?  50   TYR D HH   1 
ATOM   5574  N  N    . GLY D  1 51 ? 41.380 53.323 -1.376  1.00 35.59  ?  51   GLY D N    1 
ATOM   5575  C  CA   . GLY D  1 51 ? 40.752 52.715 -0.220  1.00 38.06  ?  51   GLY D CA   1 
ATOM   5576  C  C    . GLY D  1 51 ? 39.492 53.468 0.150   1.00 36.77  ?  51   GLY D C    1 
ATOM   5577  O  O    . GLY D  1 51 ? 39.047 54.351 -0.585  1.00 38.67  ?  51   GLY D O    1 
ATOM   5578  H  H    . GLY D  1 51 ? 40.997 54.046 -1.642  1.00 42.70  ?  51   GLY D H    1 
ATOM   5579  H  HA2  . GLY D  1 51 ? 40.521 51.794 -0.417  1.00 45.68  ?  51   GLY D HA2  1 
ATOM   5580  H  HA3  . GLY D  1 51 ? 41.361 52.732 0.534   1.00 45.68  ?  51   GLY D HA3  1 
ATOM   5581  N  N    . ASN D  1 52 ? 38.908 53.126 1.290   1.00 30.31  ?  52   ASN D N    1 
ATOM   5582  C  CA   . ASN D  1 52 ? 37.708 53.813 1.736   1.00 27.22  ?  52   ASN D CA   1 
ATOM   5583  C  C    . ASN D  1 52 ? 37.589 53.863 3.249   1.00 27.03  ?  52   ASN D C    1 
ATOM   5584  O  O    . ASN D  1 52 ? 38.240 53.101 3.965   1.00 25.50  ?  52   ASN D O    1 
ATOM   5585  C  CB   . ASN D  1 52 ? 36.462 53.141 1.153   1.00 27.52  ?  52   ASN D CB   1 
ATOM   5586  C  CG   . ASN D  1 52 ? 36.216 51.766 1.737   1.00 27.26  ?  52   ASN D CG   1 
ATOM   5587  O  OD1  . ASN D  1 52 ? 35.798 51.634 2.889   1.00 28.75  ?  52   ASN D OD1  1 
ATOM   5588  N  ND2  . ASN D  1 52 ? 36.464 50.731 0.943   1.00 27.39  ?  52   ASN D ND2  1 
ATOM   5589  H  H    . ASN D  1 52 ? 39.184 52.506 1.818   1.00 36.37  ?  52   ASN D H    1 
ATOM   5590  H  HA   . ASN D  1 52 ? 37.733 54.736 1.407   1.00 32.66  ?  52   ASN D HA   1 
ATOM   5591  H  HB2  . ASN D  1 52 ? 35.687 53.692 1.344   1.00 33.02  ?  52   ASN D HB2  1 
ATOM   5592  H  HB3  . ASN D  1 52 ? 36.573 53.045 0.194   1.00 33.02  ?  52   ASN D HB3  1 
ATOM   5593  H  HD21 . ASN D  1 52 ? 36.749 50.862 0.142   1.00 32.87  ?  52   ASN D HD21 1 
ATOM   5594  H  HD22 . ASN D  1 52 ? 36.339 49.929 1.229   1.00 32.87  ?  52   ASN D HD22 1 
ATOM   5595  N  N    . ILE D  1 53 ? 36.765 54.791 3.720   1.00 26.55  ?  53   ILE D N    1 
ATOM   5596  C  CA   . ILE D  1 53 ? 36.280 54.780 5.088   1.00 27.17  ?  53   ILE D CA   1 
ATOM   5597  C  C    . ILE D  1 53 ? 34.812 54.407 5.020   1.00 27.02  ?  53   ILE D C    1 
ATOM   5598  O  O    . ILE D  1 53 ? 34.058 54.988 4.239   1.00 27.27  ?  53   ILE D O    1 
ATOM   5599  C  CB   . ILE D  1 53 ? 36.407 56.155 5.757   1.00 29.14  ?  53   ILE D CB   1 
ATOM   5600  C  CG1  . ILE D  1 53 ? 37.876 56.508 5.974   1.00 30.69  ?  53   ILE D CG1  1 
ATOM   5601  C  CG2  . ILE D  1 53 ? 35.660 56.169 7.085   1.00 29.52  ?  53   ILE D CG2  1 
ATOM   5602  C  CD1  . ILE D  1 53 ? 38.612 55.532 6.861   1.00 31.78  ?  53   ILE D CD1  1 
ATOM   5603  H  H    . ILE D  1 53 ? 36.468 55.451 3.254   1.00 31.86  ?  53   ILE D H    1 
ATOM   5604  H  HA   . ILE D  1 53 ? 36.763 54.112 5.618   1.00 32.60  ?  53   ILE D HA   1 
ATOM   5605  H  HB   . ILE D  1 53 ? 36.012 56.821 5.173   1.00 34.97  ?  53   ILE D HB   1 
ATOM   5606  H  HG12 . ILE D  1 53 ? 38.324 56.523 5.114   1.00 36.83  ?  53   ILE D HG12 1 
ATOM   5607  H  HG13 . ILE D  1 53 ? 37.929 57.384 6.388   1.00 36.83  ?  53   ILE D HG13 1 
ATOM   5608  H  HG21 . ILE D  1 53 ? 36.036 55.500 7.662   1.00 35.42  ?  53   ILE D HG21 1 
ATOM   5609  H  HG22 . ILE D  1 53 ? 35.752 57.036 7.486   1.00 35.42  ?  53   ILE D HG22 1 
ATOM   5610  H  HG23 . ILE D  1 53 ? 34.733 55.979 6.924   1.00 35.42  ?  53   ILE D HG23 1 
ATOM   5611  H  HD11 . ILE D  1 53 ? 38.579 54.661 6.460   1.00 38.14  ?  53   ILE D HD11 1 
ATOM   5612  H  HD12 . ILE D  1 53 ? 39.524 55.819 6.951   1.00 38.14  ?  53   ILE D HD12 1 
ATOM   5613  H  HD13 . ILE D  1 53 ? 38.188 55.513 7.722   1.00 38.14  ?  53   ILE D HD13 1 
ATOM   5614  N  N    . SER D  1 54 ? 34.405 53.434 5.825   1.00 26.03  ?  54   SER D N    1 
ATOM   5615  C  CA   . SER D  1 54 ? 33.028 52.965 5.793   1.00 27.06  ?  54   SER D CA   1 
ATOM   5616  C  C    . SER D  1 54 ? 32.427 52.898 7.185   1.00 26.21  ?  54   SER D C    1 
ATOM   5617  O  O    . SER D  1 54 ? 33.138 52.765 8.182   1.00 26.02  ?  54   SER D O    1 
ATOM   5618  C  CB   . SER D  1 54 ? 32.951 51.580 5.145   1.00 27.09  ?  54   SER D CB   1 
ATOM   5619  O  OG   . SER D  1 54 ? 33.339 51.622 3.783   1.00 27.29  ?  54   SER D OG   1 
ATOM   5620  H  H    . SER D  1 54 ? 34.904 53.031 6.397   1.00 31.23  ?  54   SER D H    1 
ATOM   5621  H  HA   . SER D  1 54 ? 32.490 53.584 5.257   1.00 32.47  ?  54   SER D HA   1 
ATOM   5622  H  HB2  . SER D  1 54 ? 33.543 50.977 5.622   1.00 32.51  ?  54   SER D HB2  1 
ATOM   5623  H  HB3  . SER D  1 54 ? 32.037 51.258 5.202   1.00 32.51  ?  54   SER D HB3  1 
ATOM   5624  H  HG   . SER D  1 54 ? 33.541 52.389 3.573   1.00 32.75  ?  54   SER D HG   1 
ATOM   5625  N  N    . VAL D  1 55 ? 31.106 53.000 7.240   1.00 24.23  ?  55   VAL D N    1 
ATOM   5626  C  CA   . VAL D  1 55 ? 30.367 52.718 8.457   1.00 24.24  ?  55   VAL D CA   1 
ATOM   5627  C  C    . VAL D  1 55 ? 29.390 51.586 8.167   1.00 26.23  ?  55   VAL D C    1 
ATOM   5628  O  O    . VAL D  1 55 ? 28.533 51.705 7.290   1.00 27.39  ?  55   VAL D O    1 
ATOM   5629  C  CB   . VAL D  1 55 ? 29.599 53.949 8.961   1.00 22.86  ?  55   VAL D CB   1 
ATOM   5630  C  CG1  . VAL D  1 55 ? 28.748 53.585 10.170  1.00 23.03  ?  55   VAL D CG1  1 
ATOM   5631  C  CG2  . VAL D  1 55 ? 30.565 55.071 9.303   1.00 21.36  ?  55   VAL D CG2  1 
ATOM   5632  H  H    . VAL D  1 55 ? 30.610 53.234 6.577   1.00 29.08  ?  55   VAL D H    1 
ATOM   5633  H  HA   . VAL D  1 55 ? 30.986 52.426 9.159   1.00 29.09  ?  55   VAL D HA   1 
ATOM   5634  H  HB   . VAL D  1 55 ? 29.002 54.267 8.253   1.00 27.43  ?  55   VAL D HB   1 
ATOM   5635  H  HG11 . VAL D  1 55 ? 29.321 53.261 10.869  1.00 27.64  ?  55   VAL D HG11 1 
ATOM   5636  H  HG12 . VAL D  1 55 ? 28.278 54.367 10.468  1.00 27.64  ?  55   VAL D HG12 1 
ATOM   5637  H  HG13 . VAL D  1 55 ? 28.122 52.903 9.917   1.00 27.64  ?  55   VAL D HG13 1 
ATOM   5638  H  HG21 . VAL D  1 55 ? 31.061 55.307 8.516   1.00 25.63  ?  55   VAL D HG21 1 
ATOM   5639  H  HG22 . VAL D  1 55 ? 30.066 55.829 9.615   1.00 25.63  ?  55   VAL D HG22 1 
ATOM   5640  H  HG23 . VAL D  1 55 ? 31.165 54.768 9.989   1.00 25.63  ?  55   VAL D HG23 1 
ATOM   5641  N  N    . PHE D  1 56 ? 29.536 50.482 8.890   1.00 27.22  ?  56   PHE D N    1 
ATOM   5642  C  CA   . PHE D  1 56 ? 28.655 49.337 8.711   1.00 28.16  ?  56   PHE D CA   1 
ATOM   5643  C  C    . PHE D  1 56 ? 27.640 49.256 9.837   1.00 31.48  ?  56   PHE D C    1 
ATOM   5644  O  O    . PHE D  1 56 ? 27.942 49.577 10.986  1.00 33.24  ?  56   PHE D O    1 
ATOM   5645  C  CB   . PHE D  1 56 ? 29.459 48.038 8.637   1.00 26.62  ?  56   PHE D CB   1 
ATOM   5646  C  CG   . PHE D  1 56 ? 30.078 47.790 7.295   1.00 27.30  ?  56   PHE D CG   1 
ATOM   5647  C  CD1  . PHE D  1 56 ? 31.286 48.378 6.954   1.00 26.67  ?  56   PHE D CD1  1 
ATOM   5648  C  CD2  . PHE D  1 56 ? 29.452 46.972 6.370   1.00 29.46  ?  56   PHE D CD2  1 
ATOM   5649  C  CE1  . PHE D  1 56 ? 31.856 48.154 5.715   1.00 26.04  ?  56   PHE D CE1  1 
ATOM   5650  C  CE2  . PHE D  1 56 ? 30.019 46.743 5.129   1.00 28.84  ?  56   PHE D CE2  1 
ATOM   5651  C  CZ   . PHE D  1 56 ? 31.222 47.336 4.801   1.00 26.88  ?  56   PHE D CZ   1 
ATOM   5652  H  H    . PHE D  1 56 ? 30.139 50.371 9.493   1.00 32.66  ?  56   PHE D H    1 
ATOM   5653  H  HA   . PHE D  1 56 ? 28.166 49.439 7.868   1.00 33.80  ?  56   PHE D HA   1 
ATOM   5654  H  HB2  . PHE D  1 56 ? 30.173 48.074 9.292   1.00 31.95  ?  56   PHE D HB2  1 
ATOM   5655  H  HB3  . PHE D  1 56 ? 28.869 47.294 8.834   1.00 31.95  ?  56   PHE D HB3  1 
ATOM   5656  H  HD1  . PHE D  1 56 ? 31.717 48.931 7.565   1.00 32.00  ?  56   PHE D HD1  1 
ATOM   5657  H  HD2  . PHE D  1 56 ? 28.641 46.572 6.585   1.00 35.35  ?  56   PHE D HD2  1 
ATOM   5658  H  HE1  . PHE D  1 56 ? 32.667 48.553 5.497   1.00 31.25  ?  56   PHE D HE1  1 
ATOM   5659  H  HE2  . PHE D  1 56 ? 29.590 46.192 4.515   1.00 34.61  ?  56   PHE D HE2  1 
ATOM   5660  H  HZ   . PHE D  1 56 ? 31.606 47.183 3.968   1.00 32.25  ?  56   PHE D HZ   1 
ATOM   5661  N  N    . ASP D  1 57 ? 26.433 48.827 9.485   1.00 28.62  ?  57   ASP D N    1 
ATOM   5662  C  CA   . ASP D  1 57 ? 25.345 48.679 10.435  1.00 31.96  ?  57   ASP D CA   1 
ATOM   5663  C  C    . ASP D  1 57 ? 24.845 47.243 10.371  1.00 34.09  ?  57   ASP D C    1 
ATOM   5664  O  O    . ASP D  1 57 ? 24.062 46.888 9.488   1.00 37.14  ?  57   ASP D O    1 
ATOM   5665  C  CB   . ASP D  1 57 ? 24.214 49.645 10.086  1.00 33.67  ?  57   ASP D CB   1 
ATOM   5666  C  CG   . ASP D  1 57 ? 23.057 49.572 11.064  1.00 39.20  ?  57   ASP D CG   1 
ATOM   5667  O  OD1  . ASP D  1 57 ? 23.047 48.663 11.920  1.00 38.27  ?  57   ASP D OD1  1 
ATOM   5668  O  OD2  . ASP D  1 57 ? 22.149 50.424 10.968  1.00 44.24  ?  57   ASP D OD2  1 
ATOM   5669  H  H    . ASP D  1 57 ? 26.218 48.611 8.681   1.00 34.34  ?  57   ASP D H    1 
ATOM   5670  H  HA   . ASP D  1 57 ? 25.662 48.869 11.343  1.00 38.36  ?  57   ASP D HA   1 
ATOM   5671  H  HB2  . ASP D  1 57 ? 24.558 50.552 10.095  1.00 40.40  ?  57   ASP D HB2  1 
ATOM   5672  H  HB3  . ASP D  1 57 ? 23.875 49.428 9.203   1.00 40.40  ?  57   ASP D HB3  1 
ATOM   5673  N  N    . VAL D  1 58 ? 25.308 46.417 11.303  1.00 35.81  ?  58   VAL D N    1 
ATOM   5674  C  CA   . VAL D  1 58 ? 24.939 45.008 11.328  1.00 36.94  ?  58   VAL D CA   1 
ATOM   5675  C  C    . VAL D  1 58 ? 24.487 44.607 12.727  1.00 38.84  ?  58   VAL D C    1 
ATOM   5676  O  O    . VAL D  1 58 ? 24.531 45.414 13.655  1.00 40.38  ?  58   VAL D O    1 
ATOM   5677  C  CB   . VAL D  1 58 ? 26.116 44.118 10.895  1.00 35.70  ?  58   VAL D CB   1 
ATOM   5678  C  CG1  . VAL D  1 58 ? 26.494 44.407 9.448   1.00 36.31  ?  58   VAL D CG1  1 
ATOM   5679  C  CG2  . VAL D  1 58 ? 27.303 44.326 11.815  1.00 33.15  ?  58   VAL D CG2  1 
ATOM   5680  H  H    . VAL D  1 58 ? 25.840 46.651 11.936  1.00 42.97  ?  58   VAL D H    1 
ATOM   5681  H  HA   . VAL D  1 58 ? 24.195 44.857 10.709  1.00 44.33  ?  58   VAL D HA   1 
ATOM   5682  H  HB   . VAL D  1 58 ? 25.845 43.178 10.956  1.00 42.83  ?  58   VAL D HB   1 
ATOM   5683  H  HG11 . VAL D  1 58 ? 26.749 45.329 9.371   1.00 43.57  ?  58   VAL D HG11 1 
ATOM   5684  H  HG12 . VAL D  1 58 ? 27.229 43.841 9.199   1.00 43.57  ?  58   VAL D HG12 1 
ATOM   5685  H  HG13 . VAL D  1 58 ? 25.737 44.228 8.886   1.00 43.57  ?  58   VAL D HG13 1 
ATOM   5686  H  HG21 . VAL D  1 58 ? 27.047 44.099 12.712  1.00 39.78  ?  58   VAL D HG21 1 
ATOM   5687  H  HG22 . VAL D  1 58 ? 28.025 43.762 11.527  1.00 39.78  ?  58   VAL D HG22 1 
ATOM   5688  H  HG23 . VAL D  1 58 ? 27.571 45.247 11.774  1.00 39.78  ?  58   VAL D HG23 1 
ATOM   5689  N  N    . ASN D  1 59 ? 24.058 43.359 12.878  1.00 35.22  ?  59   ASN D N    1 
ATOM   5690  C  CA   . ASN D  1 59 ? 23.489 42.905 14.142  1.00 38.08  ?  59   ASN D CA   1 
ATOM   5691  C  C    . ASN D  1 59 ? 24.472 42.149 15.035  1.00 35.71  ?  59   ASN D C    1 
ATOM   5692  O  O    . ASN D  1 59 ? 24.138 41.810 16.168  1.00 39.21  ?  59   ASN D O    1 
ATOM   5693  C  CB   . ASN D  1 59 ? 22.252 42.039 13.887  1.00 43.82  ?  59   ASN D CB   1 
ATOM   5694  C  CG   . ASN D  1 59 ? 21.167 42.783 13.129  1.00 48.30  ?  59   ASN D CG   1 
ATOM   5695  O  OD1  . ASN D  1 59 ? 20.597 43.752 13.631  1.00 50.27  ?  59   ASN D OD1  1 
ATOM   5696  N  ND2  . ASN D  1 59 ? 20.869 42.327 11.916  1.00 50.28  ?  59   ASN D ND2  1 
ATOM   5697  H  H    . ASN D  1 59 ? 24.084 42.756 12.266  1.00 42.27  ?  59   ASN D H    1 
ATOM   5698  H  HA   . ASN D  1 59 ? 23.193 43.694 14.643  1.00 45.70  ?  59   ASN D HA   1 
ATOM   5699  H  HB2  . ASN D  1 59 ? 22.510 41.266 13.361  1.00 52.58  ?  59   ASN D HB2  1 
ATOM   5700  H  HB3  . ASN D  1 59 ? 21.884 41.755 14.738  1.00 52.58  ?  59   ASN D HB3  1 
ATOM   5701  H  HD21 . ASN D  1 59 ? 21.285 41.644 11.600  1.00 60.34  ?  59   ASN D HD21 1 
ATOM   5702  H  HD22 . ASN D  1 59 ? 20.261 42.715 11.448  1.00 60.34  ?  59   ASN D HD22 1 
ATOM   5703  N  N    . SER D  1 60 ? 25.677 41.883 14.535  1.00 33.78  ?  60   SER D N    1 
ATOM   5704  C  CA   . SER D  1 60 ? 26.680 41.179 15.333  1.00 32.37  ?  60   SER D CA   1 
ATOM   5705  C  C    . SER D  1 60 ? 28.058 41.197 14.686  1.00 31.62  ?  60   SER D C    1 
ATOM   5706  O  O    . SER D  1 60 ? 28.197 41.517 13.506  1.00 30.09  ?  60   SER D O    1 
ATOM   5707  C  CB   . SER D  1 60 ? 26.255 39.725 15.561  1.00 34.27  ?  60   SER D CB   1 
ATOM   5708  O  OG   . SER D  1 60 ? 26.374 38.971 14.366  1.00 34.26  ?  60   SER D OG   1 
ATOM   5709  H  H    . SER D  1 60 ? 25.938 42.097 13.744  1.00 40.53  ?  60   SER D H    1 
ATOM   5710  H  HA   . SER D  1 60 ? 26.751 41.613 16.209  1.00 38.84  ?  60   SER D HA   1 
ATOM   5711  H  HB2  . SER D  1 60 ? 26.825 39.333 16.240  1.00 41.13  ?  60   SER D HB2  1 
ATOM   5712  H  HB3  . SER D  1 60 ? 25.331 39.709 15.853  1.00 41.13  ?  60   SER D HB3  1 
ATOM   5713  H  HG   . SER D  1 60 ? 26.145 38.195 14.500  1.00 41.12  ?  60   SER D HG   1 
ATOM   5714  N  N    . HIS D  1 61 ? 29.073 40.850 15.474  1.00 34.95  ?  61   HIS D N    1 
ATOM   5715  C  CA   . HIS D  1 61 ? 30.438 40.747 14.971  1.00 33.80  ?  61   HIS D CA   1 
ATOM   5716  C  C    . HIS D  1 61 ? 30.490 39.733 13.838  1.00 34.86  ?  61   HIS D C    1 
ATOM   5717  O  O    . HIS D  1 61 ? 31.078 39.987 12.788  1.00 35.04  ?  61   HIS D O    1 
ATOM   5718  C  CB   . HIS D  1 61 ? 31.397 40.305 16.082  1.00 33.41  ?  61   HIS D CB   1 
ATOM   5719  C  CG   . HIS D  1 61 ? 31.438 41.227 17.262  1.00 32.70  ?  61   HIS D CG   1 
ATOM   5720  N  ND1  . HIS D  1 61 ? 31.039 42.546 17.199  1.00 31.97  ?  61   HIS D ND1  1 
ATOM   5721  C  CD2  . HIS D  1 61 ? 31.834 41.016 18.540  1.00 33.02  ?  61   HIS D CD2  1 
ATOM   5722  C  CE1  . HIS D  1 61 ? 31.189 43.106 18.386  1.00 31.40  ?  61   HIS D CE1  1 
ATOM   5723  N  NE2  . HIS D  1 61 ? 31.669 42.200 19.218  1.00 32.12  ?  61   HIS D NE2  1 
ATOM   5724  H  H    . HIS D  1 61 ? 28.995 40.667 16.311  1.00 41.94  ?  61   HIS D H    1 
ATOM   5725  H  HA   . HIS D  1 61 ? 30.731 41.618 14.629  1.00 40.56  ?  61   HIS D HA   1 
ATOM   5726  H  HB2  . HIS D  1 61 ? 31.123 39.431 16.400  1.00 40.10  ?  61   HIS D HB2  1 
ATOM   5727  H  HB3  . HIS D  1 61 ? 32.294 40.254 15.716  1.00 40.10  ?  61   HIS D HB3  1 
ATOM   5728  H  HD1  . HIS D  1 61 ? 30.741 42.942 16.496  1.00 38.36  ?  61   HIS D HD1  1 
ATOM   5729  H  HD2  . HIS D  1 61 ? 32.158 40.219 18.893  1.00 39.63  ?  61   HIS D HD2  1 
ATOM   5730  H  HE1  . HIS D  1 61 ? 30.988 43.989 18.599  1.00 37.68  ?  61   HIS D HE1  1 
ATOM   5731  H  HE2  . HIS D  1 61 ? 31.849 42.330 20.048  1.00 38.54  ?  61   HIS D HE2  1 
ATOM   5732  N  N    . ASP D  1 62 ? 29.872 38.577 14.065  1.00 30.89  ?  62   ASP D N    1 
ATOM   5733  C  CA   . ASP D  1 62 ? 29.858 37.499 13.082  1.00 34.63  ?  62   ASP D CA   1 
ATOM   5734  C  C    . ASP D  1 62 ? 29.301 37.970 11.746  1.00 37.72  ?  62   ASP D C    1 
ATOM   5735  O  O    . ASP D  1 62 ? 29.862 37.672 10.693  1.00 37.12  ?  62   ASP D O    1 
ATOM   5736  C  CB   . ASP D  1 62 ? 29.026 36.321 13.595  1.00 39.53  ?  62   ASP D CB   1 
ATOM   5737  C  CG   . ASP D  1 62 ? 29.675 35.615 14.770  1.00 39.13  ?  62   ASP D CG   1 
ATOM   5738  O  OD1  . ASP D  1 62 ? 30.915 35.695 14.904  1.00 35.33  ?  62   ASP D OD1  1 
ATOM   5739  O  OD2  . ASP D  1 62 ? 28.943 34.975 15.555  1.00 42.28  ?  62   ASP D OD2  1 
ATOM   5740  H  H    . ASP D  1 62 ? 29.448 38.391 14.790  1.00 37.07  ?  62   ASP D H    1 
ATOM   5741  H  HA   . ASP D  1 62 ? 30.775 37.185 12.937  1.00 41.56  ?  62   ASP D HA   1 
ATOM   5742  H  HB2  . ASP D  1 62 ? 28.159 36.646 13.882  1.00 47.43  ?  62   ASP D HB2  1 
ATOM   5743  H  HB3  . ASP D  1 62 ? 28.918 35.675 12.879  1.00 47.43  ?  62   ASP D HB3  1 
ATOM   5744  N  N    . GLU D  1 63 ? 28.194 38.703 11.791  1.00 38.78  ?  63   GLU D N    1 
ATOM   5745  C  CA   . GLU D  1 63 ? 27.559 39.190 10.575  1.00 44.28  ?  63   GLU D CA   1 
ATOM   5746  C  C    . GLU D  1 63 ? 28.513 40.103 9.811   1.00 39.32  ?  63   GLU D C    1 
ATOM   5747  O  O    . GLU D  1 63 ? 28.572 40.064 8.582   1.00 41.47  ?  63   GLU D O    1 
ATOM   5748  C  CB   . GLU D  1 63 ? 26.262 39.931 10.906  1.00 49.69  ?  63   GLU D CB   1 
ATOM   5749  C  CG   . GLU D  1 63 ? 25.461 40.356 9.684   1.00 54.97  ?  63   GLU D CG   1 
ATOM   5750  C  CD   . GLU D  1 63 ? 24.132 40.994 10.048  1.00 58.03  ?  63   GLU D CD   1 
ATOM   5751  O  OE1  . GLU D  1 63 ? 23.656 40.773 11.183  1.00 60.40  ?  63   GLU D OE1  1 
ATOM   5752  O  OE2  . GLU D  1 63 ? 23.564 41.718 9.202   1.00 57.99  ?  63   GLU D OE2  1 
ATOM   5753  H  H    . GLU D  1 63 ? 27.791 38.931 12.516  1.00 46.54  ?  63   GLU D H    1 
ATOM   5754  H  HA   . GLU D  1 63 ? 27.338 38.428 9.999   1.00 53.13  ?  63   GLU D HA   1 
ATOM   5755  H  HB2  . GLU D  1 63 ? 25.699 39.351 11.441  1.00 59.62  ?  63   GLU D HB2  1 
ATOM   5756  H  HB3  . GLU D  1 63 ? 26.480 40.731 11.409  1.00 59.62  ?  63   GLU D HB3  1 
ATOM   5757  H  HG2  . GLU D  1 63 ? 25.976 41.003 9.177   1.00 65.96  ?  63   GLU D HG2  1 
ATOM   5758  H  HG3  . GLU D  1 63 ? 25.279 39.575 9.138   1.00 65.96  ?  63   GLU D HG3  1 
ATOM   5759  N  N    . LEU D  1 64 ? 29.263 40.920 10.545  1.00 36.77  ?  64   LEU D N    1 
ATOM   5760  C  CA   . LEU D  1 64 ? 30.235 41.813 9.926   1.00 31.05  ?  64   LEU D CA   1 
ATOM   5761  C  C    . LEU D  1 64 ? 31.384 41.033 9.294   1.00 30.13  ?  64   LEU D C    1 
ATOM   5762  O  O    . LEU D  1 64 ? 31.785 41.320 8.165   1.00 29.53  ?  64   LEU D O    1 
ATOM   5763  C  CB   . LEU D  1 64 ? 30.793 42.807 10.946  1.00 26.57  ?  64   LEU D CB   1 
ATOM   5764  C  CG   . LEU D  1 64 ? 31.886 43.728 10.402  1.00 24.78  ?  64   LEU D CG   1 
ATOM   5765  C  CD1  . LEU D  1 64 ? 31.349 44.597 9.272   1.00 23.91  ?  64   LEU D CD1  1 
ATOM   5766  C  CD2  . LEU D  1 64 ? 32.463 44.590 11.513  1.00 24.78  ?  64   LEU D CD2  1 
ATOM   5767  H  H    . LEU D  1 64 ? 29.228 40.976 11.402  1.00 44.12  ?  64   LEU D H    1 
ATOM   5768  H  HA   . LEU D  1 64 ? 29.791 42.325 9.217   1.00 37.26  ?  64   LEU D HA   1 
ATOM   5769  H  HB2  . LEU D  1 64 ? 30.067 43.366 11.262  1.00 31.89  ?  64   LEU D HB2  1 
ATOM   5770  H  HB3  . LEU D  1 64 ? 31.170 42.310 11.689  1.00 31.89  ?  64   LEU D HB3  1 
ATOM   5771  H  HG   . LEU D  1 64 ? 32.605 43.185 10.044  1.00 29.73  ?  64   LEU D HG   1 
ATOM   5772  H  HD11 . LEU D  1 64 ? 30.625 45.131 9.606   1.00 28.69  ?  64   LEU D HD11 1 
ATOM   5773  H  HD12 . LEU D  1 64 ? 32.054 45.163 8.951   1.00 28.69  ?  64   LEU D HD12 1 
ATOM   5774  H  HD13 . LEU D  1 64 ? 31.037 44.029 8.564   1.00 28.69  ?  64   LEU D HD13 1 
ATOM   5775  H  HD21 . LEU D  1 64 ? 32.839 44.019 12.187  1.00 29.73  ?  64   LEU D HD21 1 
ATOM   5776  H  HD22 . LEU D  1 64 ? 33.145 45.157 11.146  1.00 29.73  ?  64   LEU D HD22 1 
ATOM   5777  H  HD23 . LEU D  1 64 ? 31.760 45.124 11.890  1.00 29.73  ?  64   LEU D HD23 1 
ATOM   5778  N  N    . HIS D  1 65 ? 31.918 40.051 10.017  1.00 30.78  ?  65   HIS D N    1 
ATOM   5779  C  CA   . HIS D  1 65 ? 33.048 39.283 9.503   1.00 32.34  ?  65   HIS D CA   1 
ATOM   5780  C  C    . HIS D  1 65 ? 32.683 38.587 8.199   1.00 37.83  ?  65   HIS D C    1 
ATOM   5781  O  O    . HIS D  1 65 ? 33.446 38.620 7.238   1.00 36.41  ?  65   HIS D O    1 
ATOM   5782  C  CB   . HIS D  1 65 ? 33.538 38.246 10.516  1.00 33.24  ?  65   HIS D CB   1 
ATOM   5783  C  CG   . HIS D  1 65 ? 34.589 37.330 9.971   1.00 33.36  ?  65   HIS D CG   1 
ATOM   5784  N  ND1  . HIS D  1 65 ? 35.899 37.721 9.788   1.00 30.14  ?  65   HIS D ND1  1 
ATOM   5785  C  CD2  . HIS D  1 65 ? 34.521 36.045 9.545   1.00 36.87  ?  65   HIS D CD2  1 
ATOM   5786  C  CE1  . HIS D  1 65 ? 36.592 36.718 9.283   1.00 31.44  ?  65   HIS D CE1  1 
ATOM   5787  N  NE2  . HIS D  1 65 ? 35.780 35.688 9.127   1.00 35.49  ?  65   HIS D NE2  1 
ATOM   5788  H  H    . HIS D  1 65 ? 31.648 39.812 10.798  1.00 36.94  ?  65   HIS D H    1 
ATOM   5789  H  HA   . HIS D  1 65 ? 33.790 39.897 9.319   1.00 38.81  ?  65   HIS D HA   1 
ATOM   5790  H  HB2  . HIS D  1 65 ? 33.914 38.708 11.282  1.00 39.89  ?  65   HIS D HB2  1 
ATOM   5791  H  HB3  . HIS D  1 65 ? 32.785 37.702 10.797  1.00 39.89  ?  65   HIS D HB3  1 
ATOM   5792  H  HD1  . HIS D  1 65 ? 36.215 38.498 9.975   1.00 36.16  ?  65   HIS D HD1  1 
ATOM   5793  H  HD2  . HIS D  1 65 ? 33.764 35.505 9.541   1.00 44.24  ?  65   HIS D HD2  1 
ATOM   5794  H  HE1  . HIS D  1 65 ? 37.498 36.732 9.075   1.00 37.72  ?  65   HIS D HE1  1 
ATOM   5795  H  HE2  . HIS D  1 65 ? 36.003 34.919 8.814   1.00 42.59  ?  65   HIS D HE2  1 
ATOM   5796  N  N    . GLU D  1 66 ? 31.514 37.956 8.173   1.00 39.87  ?  66   GLU D N    1 
ATOM   5797  C  CA   . GLU D  1 66 ? 31.064 37.242 6.986   1.00 46.72  ?  66   GLU D CA   1 
ATOM   5798  C  C    . GLU D  1 66 ? 30.972 38.173 5.782   1.00 42.59  ?  66   GLU D C    1 
ATOM   5799  O  O    . GLU D  1 66 ? 31.400 37.821 4.684   1.00 44.06  ?  66   GLU D O    1 
ATOM   5800  C  CB   . GLU D  1 66 ? 29.711 36.576 7.241   1.00 55.89  ?  66   GLU D CB   1 
ATOM   5801  C  CG   . GLU D  1 66 ? 29.802 35.302 8.070   1.00 63.71  ?  66   GLU D CG   1 
ATOM   5802  C  CD   . GLU D  1 66 ? 28.571 34.421 7.937   1.00 72.53  ?  66   GLU D CD   1 
ATOM   5803  O  OE1  . GLU D  1 66 ? 27.832 34.570 6.939   1.00 76.80  ?  66   GLU D OE1  1 
ATOM   5804  O  OE2  . GLU D  1 66 ? 28.345 33.578 8.832   1.00 74.66  ?  66   GLU D OE2  1 
ATOM   5805  H  H    . GLU D  1 66 ? 30.962 37.927 8.831   1.00 47.84  ?  66   GLU D H    1 
ATOM   5806  H  HA   . GLU D  1 66 ? 31.712 36.538 6.774   1.00 56.06  ?  66   GLU D HA   1 
ATOM   5807  H  HB2  . GLU D  1 66 ? 29.140 37.200 7.717   1.00 67.07  ?  66   GLU D HB2  1 
ATOM   5808  H  HB3  . GLU D  1 66 ? 29.309 36.348 6.388   1.00 67.07  ?  66   GLU D HB3  1 
ATOM   5809  H  HG2  . GLU D  1 66 ? 30.570 34.789 7.775   1.00 76.45  ?  66   GLU D HG2  1 
ATOM   5810  H  HG3  . GLU D  1 66 ? 29.900 35.540 9.005   1.00 76.45  ?  66   GLU D HG3  1 
ATOM   5811  N  N    . ILE D  1 67 ? 30.415 39.361 5.994   1.00 41.07  ?  67   ILE D N    1 
ATOM   5812  C  CA   . ILE D  1 67 ? 30.288 40.344 4.925   1.00 39.21  ?  67   ILE D CA   1 
ATOM   5813  C  C    . ILE D  1 67 ? 31.654 40.749 4.375   1.00 36.26  ?  67   ILE D C    1 
ATOM   5814  O  O    . ILE D  1 67 ? 31.877 40.711 3.164   1.00 39.02  ?  67   ILE D O    1 
ATOM   5815  C  CB   . ILE D  1 67 ? 29.526 41.595 5.404   1.00 38.21  ?  67   ILE D CB   1 
ATOM   5816  C  CG1  . ILE D  1 67 ? 28.033 41.279 5.523   1.00 38.98  ?  67   ILE D CG1  1 
ATOM   5817  C  CG2  . ILE D  1 67 ? 29.740 42.755 4.439   1.00 38.60  ?  67   ILE D CG2  1 
ATOM   5818  C  CD1  . ILE D  1 67 ? 27.220 42.365 6.191   1.00 37.17  ?  67   ILE D CD1  1 
ATOM   5819  H  H    . ILE D  1 67 ? 30.102 39.622 6.751   1.00 49.28  ?  67   ILE D H    1 
ATOM   5820  H  HA   . ILE D  1 67 ? 29.776 39.945 4.191   1.00 47.05  ?  67   ILE D HA   1 
ATOM   5821  H  HB   . ILE D  1 67 ? 29.862 41.849 6.278   1.00 45.86  ?  67   ILE D HB   1 
ATOM   5822  H  HG12 . ILE D  1 67 ? 27.672 41.145 4.633   1.00 46.78  ?  67   ILE D HG12 1 
ATOM   5823  H  HG13 . ILE D  1 67 ? 27.927 40.468 6.045   1.00 46.78  ?  67   ILE D HG13 1 
ATOM   5824  H  HG21 . ILE D  1 67 ? 29.416 42.503 3.571   1.00 46.32  ?  67   ILE D HG21 1 
ATOM   5825  H  HG22 . ILE D  1 67 ? 29.257 43.520 4.759   1.00 46.32  ?  67   ILE D HG22 1 
ATOM   5826  H  HG23 . ILE D  1 67 ? 30.678 42.955 4.394   1.00 46.32  ?  67   ILE D HG23 1 
ATOM   5827  H  HD11 . ILE D  1 67 ? 27.302 43.174 5.681   1.00 44.60  ?  67   ILE D HD11 1 
ATOM   5828  H  HD12 . ILE D  1 67 ? 26.301 42.091 6.226   1.00 44.60  ?  67   ILE D HD12 1 
ATOM   5829  H  HD13 . ILE D  1 67 ? 27.555 42.504 7.080   1.00 44.60  ?  67   ILE D HD13 1 
ATOM   5830  N  N    . LEU D  1 68 ? 32.567 41.130 5.264   1.00 33.91  ?  68   LEU D N    1 
ATOM   5831  C  CA   . LEU D  1 68 ? 33.904 41.545 4.851   1.00 29.14  ?  68   LEU D CA   1 
ATOM   5832  C  C    . LEU D  1 68 ? 34.644 40.398 4.172   1.00 31.93  ?  68   LEU D C    1 
ATOM   5833  O  O    . LEU D  1 68 ? 35.261 40.578 3.125   1.00 31.97  ?  68   LEU D O    1 
ATOM   5834  C  CB   . LEU D  1 68 ? 34.702 42.053 6.054   1.00 25.60  ?  68   LEU D CB   1 
ATOM   5835  C  CG   . LEU D  1 68 ? 34.167 43.335 6.697   1.00 24.52  ?  68   LEU D CG   1 
ATOM   5836  C  CD1  . LEU D  1 68 ? 34.978 43.703 7.931   1.00 24.10  ?  68   LEU D CD1  1 
ATOM   5837  C  CD2  . LEU D  1 68 ? 34.169 44.482 5.696   1.00 23.73  ?  68   LEU D CD2  1 
ATOM   5838  H  H    . LEU D  1 68 ? 32.437 41.156 6.114   1.00 40.69  ?  68   LEU D H    1 
ATOM   5839  H  HA   . LEU D  1 68 ? 33.826 42.279 4.207   1.00 34.97  ?  68   LEU D HA   1 
ATOM   5840  H  HB2  . LEU D  1 68 ? 34.703 41.363 6.736   1.00 30.72  ?  68   LEU D HB2  1 
ATOM   5841  H  HB3  . LEU D  1 68 ? 35.612 42.228 5.768   1.00 30.72  ?  68   LEU D HB3  1 
ATOM   5842  H  HG   . LEU D  1 68 ? 33.251 43.186 6.977   1.00 29.42  ?  68   LEU D HG   1 
ATOM   5843  H  HD11 . LEU D  1 68 ? 35.892 43.841 7.673   1.00 28.92  ?  68   LEU D HD11 1 
ATOM   5844  H  HD12 . LEU D  1 68 ? 34.619 44.509 8.310   1.00 28.92  ?  68   LEU D HD12 1 
ATOM   5845  H  HD13 . LEU D  1 68 ? 34.920 42.987 8.567   1.00 28.92  ?  68   LEU D HD13 1 
ATOM   5846  H  HD21 . LEU D  1 68 ? 33.610 44.247 4.952   1.00 28.47  ?  68   LEU D HD21 1 
ATOM   5847  H  HD22 . LEU D  1 68 ? 33.830 45.271 6.125   1.00 28.47  ?  68   LEU D HD22 1 
ATOM   5848  H  HD23 . LEU D  1 68 ? 35.068 44.633 5.395   1.00 28.47  ?  68   LEU D HD23 1 
ATOM   5849  N  N    . TRP D  1 69 ? 34.567 39.218 4.779   1.00 29.80  ?  69   TRP D N    1 
ATOM   5850  C  CA   . TRP D  1 69 ? 35.190 38.012 4.242   1.00 33.19  ?  69   TRP D CA   1 
ATOM   5851  C  C    . TRP D  1 69 ? 34.727 37.742 2.810   1.00 36.84  ?  69   TRP D C    1 
ATOM   5852  O  O    . TRP D  1 69 ? 35.484 37.221 1.992   1.00 38.99  ?  69   TRP D O    1 
ATOM   5853  C  CB   . TRP D  1 69 ? 34.834 36.824 5.142   1.00 34.99  ?  69   TRP D CB   1 
ATOM   5854  C  CG   . TRP D  1 69 ? 35.639 35.574 4.917   1.00 37.48  ?  69   TRP D CG   1 
ATOM   5855  C  CD1  . TRP D  1 69 ? 35.279 34.490 4.170   1.00 41.27  ?  69   TRP D CD1  1 
ATOM   5856  C  CD2  . TRP D  1 69 ? 36.929 35.272 5.466   1.00 37.28  ?  69   TRP D CD2  1 
ATOM   5857  N  NE1  . TRP D  1 69 ? 36.267 33.535 4.215   1.00 42.67  ?  69   TRP D NE1  1 
ATOM   5858  C  CE2  . TRP D  1 69 ? 37.291 33.992 5.002   1.00 40.25  ?  69   TRP D CE2  1 
ATOM   5859  C  CE3  . TRP D  1 69 ? 37.814 35.961 6.300   1.00 34.40  ?  69   TRP D CE3  1 
ATOM   5860  C  CZ2  . TRP D  1 69 ? 38.499 33.388 5.343   1.00 40.75  ?  69   TRP D CZ2  1 
ATOM   5861  C  CZ3  . TRP D  1 69 ? 39.012 35.360 6.637   1.00 34.80  ?  69   TRP D CZ3  1 
ATOM   5862  C  CH2  . TRP D  1 69 ? 39.344 34.087 6.160   1.00 37.81  ?  69   TRP D CH2  1 
ATOM   5863  H  H    . TRP D  1 69 ? 34.150 39.088 5.520   1.00 35.76  ?  69   TRP D H    1 
ATOM   5864  H  HA   . TRP D  1 69 ? 36.164 38.120 4.239   1.00 39.83  ?  69   TRP D HA   1 
ATOM   5865  H  HB2  . TRP D  1 69 ? 34.963 37.090 6.066   1.00 41.99  ?  69   TRP D HB2  1 
ATOM   5866  H  HB3  . TRP D  1 69 ? 33.902 36.599 4.998   1.00 41.99  ?  69   TRP D HB3  1 
ATOM   5867  H  HD1  . TRP D  1 69 ? 34.481 34.408 3.700   1.00 49.53  ?  69   TRP D HD1  1 
ATOM   5868  H  HE1  . TRP D  1 69 ? 36.247 32.775 3.811   1.00 51.20  ?  69   TRP D HE1  1 
ATOM   5869  H  HE3  . TRP D  1 69 ? 37.601 36.807 6.621   1.00 41.28  ?  69   TRP D HE3  1 
ATOM   5870  H  HZ2  . TRP D  1 69 ? 38.723 32.542 5.027   1.00 48.90  ?  69   TRP D HZ2  1 
ATOM   5871  H  HZ3  . TRP D  1 69 ? 39.609 35.810 7.191   1.00 41.76  ?  69   TRP D HZ3  1 
ATOM   5872  H  HH2  . TRP D  1 69 ? 40.157 33.708 6.403   1.00 45.37  ?  69   TRP D HH2  1 
ATOM   5873  N  N    . SER D  1 70 ? 33.483 38.108 2.510   1.00 36.29  ?  70   SER D N    1 
ATOM   5874  C  CA   . SER D  1 70 ? 32.880 37.799 1.216   1.00 41.59  ?  70   SER D CA   1 
ATOM   5875  C  C    . SER D  1 70 ? 33.217 38.829 0.140   1.00 37.97  ?  70   SER D C    1 
ATOM   5876  O  O    . SER D  1 70 ? 33.052 38.563 -1.051  1.00 43.35  ?  70   SER D O    1 
ATOM   5877  C  CB   . SER D  1 70 ? 31.357 37.683 1.354   1.00 47.79  ?  70   SER D CB   1 
ATOM   5878  O  OG   . SER D  1 70 ? 30.739 38.954 1.503   1.00 48.77  ?  70   SER D OG   1 
ATOM   5879  H  H    . SER D  1 70 ? 32.964 38.540 3.043   1.00 43.55  ?  70   SER D H    1 
ATOM   5880  H  HA   . SER D  1 70 ? 33.219 36.930 0.912   1.00 49.90  ?  70   SER D HA   1 
ATOM   5881  H  HB2  . SER D  1 70 ? 31.003 37.255 0.558   1.00 57.34  ?  70   SER D HB2  1 
ATOM   5882  H  HB3  . SER D  1 70 ? 31.154 37.144 2.134   1.00 57.34  ?  70   SER D HB3  1 
ATOM   5883  H  HG   . SER D  1 70 ? 31.307 39.545 1.490   1.00 58.53  ?  70   SER D HG   1 
ATOM   5884  N  N    . LEU D  1 71 ? 33.676 40.004 0.558   1.00 38.75  ?  71   LEU D N    1 
ATOM   5885  C  CA   . LEU D  1 71 ? 33.994 41.069 -0.387  1.00 36.21  ?  71   LEU D CA   1 
ATOM   5886  C  C    . LEU D  1 71 ? 34.962 40.570 -1.454  1.00 37.33  ?  71   LEU D C    1 
ATOM   5887  O  O    . LEU D  1 71 ? 35.951 39.910 -1.138  1.00 38.48  ?  71   LEU D O    1 
ATOM   5888  C  CB   . LEU D  1 71 ? 34.599 42.270 0.340   1.00 34.54  ?  71   LEU D CB   1 
ATOM   5889  C  CG   . LEU D  1 71 ? 33.673 42.977 1.330   1.00 32.55  ?  71   LEU D CG   1 
ATOM   5890  C  CD1  . LEU D  1 71 ? 34.413 44.108 2.029   1.00 30.31  ?  71   LEU D CD1  1 
ATOM   5891  C  CD2  . LEU D  1 71 ? 32.428 43.498 0.629   1.00 32.65  ?  71   LEU D CD2  1 
ATOM   5892  H  H    . LEU D  1 71 ? 33.812 40.210 1.381   1.00 46.50  ?  71   LEU D H    1 
ATOM   5893  H  HA   . LEU D  1 71 ? 33.171 41.363 -0.832  1.00 43.45  ?  71   LEU D HA   1 
ATOM   5894  H  HB2  . LEU D  1 71 ? 35.377 41.969 0.835   1.00 41.44  ?  71   LEU D HB2  1 
ATOM   5895  H  HB3  . LEU D  1 71 ? 34.870 42.925 -0.322  1.00 41.44  ?  71   LEU D HB3  1 
ATOM   5896  H  HG   . LEU D  1 71 ? 33.391 42.342 2.007   1.00 39.05  ?  71   LEU D HG   1 
ATOM   5897  H  HD11 . LEU D  1 71 ? 34.714 44.738 1.370   1.00 36.38  ?  71   LEU D HD11 1 
ATOM   5898  H  HD12 . LEU D  1 71 ? 33.815 44.538 2.645   1.00 36.38  ?  71   LEU D HD12 1 
ATOM   5899  H  HD13 . LEU D  1 71 ? 35.164 43.743 2.501   1.00 36.38  ?  71   LEU D HD13 1 
ATOM   5900  H  HD21 . LEU D  1 71 ? 31.959 42.758 0.235   1.00 39.18  ?  71   LEU D HD21 1 
ATOM   5901  H  HD22 . LEU D  1 71 ? 31.867 43.936 1.273   1.00 39.18  ?  71   LEU D HD22 1 
ATOM   5902  H  HD23 . LEU D  1 71 ? 32.691 44.119 -0.054  1.00 39.18  ?  71   LEU D HD23 1 
ATOM   5903  N  N    . PRO D  1 72 ? 34.675 40.877 -2.728  1.00 34.02  ?  72   PRO D N    1 
ATOM   5904  C  CA   . PRO D  1 72 ? 35.550 40.453 -3.827  1.00 34.05  ?  72   PRO D CA   1 
ATOM   5905  C  C    . PRO D  1 72 ? 37.010 40.869 -3.630  1.00 33.67  ?  72   PRO D C    1 
ATOM   5906  O  O    . PRO D  1 72 ? 37.915 40.104 -3.959  1.00 32.88  ?  72   PRO D O    1 
ATOM   5907  C  CB   . PRO D  1 72 ? 34.950 41.167 -5.040  1.00 35.79  ?  72   PRO D CB   1 
ATOM   5908  C  CG   . PRO D  1 72 ? 33.510 41.316 -4.705  1.00 37.05  ?  72   PRO D CG   1 
ATOM   5909  C  CD   . PRO D  1 72 ? 33.465 41.558 -3.222  1.00 34.97  ?  72   PRO D CD   1 
ATOM   5910  H  HA   . PRO D  1 72 ? 35.498 39.483 -3.956  1.00 40.86  ?  72   PRO D HA   1 
ATOM   5911  H  HB2  . PRO D  1 72 ? 35.370 42.034 -5.153  1.00 42.94  ?  72   PRO D HB2  1 
ATOM   5912  H  HB3  . PRO D  1 72 ? 35.065 40.620 -5.834  1.00 42.94  ?  72   PRO D HB3  1 
ATOM   5913  H  HG2  . PRO D  1 72 ? 33.141 42.073 -5.186  1.00 44.45  ?  72   PRO D HG2  1 
ATOM   5914  H  HG3  . PRO D  1 72 ? 33.037 40.501 -4.933  1.00 44.45  ?  72   PRO D HG3  1 
ATOM   5915  H  HD2  . PRO D  1 72 ? 33.511 42.509 -3.033  1.00 41.96  ?  72   PRO D HD2  1 
ATOM   5916  H  HD3  . PRO D  1 72 ? 32.670 41.157 -2.837  1.00 41.96  ?  72   PRO D HD3  1 
ATOM   5917  N  N    . PHE D  1 73 ? 37.234 42.065 -3.095  1.00 38.55  ?  73   PHE D N    1 
ATOM   5918  C  CA   . PHE D  1 73 ? 38.590 42.579 -2.929  1.00 39.37  ?  73   PHE D CA   1 
ATOM   5919  C  C    . PHE D  1 73 ? 39.297 42.022 -1.696  1.00 36.45  ?  73   PHE D C    1 
ATOM   5920  O  O    . PHE D  1 73 ? 40.490 42.258 -1.513  1.00 35.05  ?  73   PHE D O    1 
ATOM   5921  C  CB   . PHE D  1 73 ? 38.574 44.109 -2.840  1.00 40.87  ?  73   PHE D CB   1 
ATOM   5922  C  CG   . PHE D  1 73 ? 38.637 44.800 -4.174  1.00 45.76  ?  73   PHE D CG   1 
ATOM   5923  C  CD1  . PHE D  1 73 ? 39.552 44.404 -5.136  1.00 49.12  ?  73   PHE D CD1  1 
ATOM   5924  C  CD2  . PHE D  1 73 ? 37.783 45.851 -4.464  1.00 47.22  ?  73   PHE D CD2  1 
ATOM   5925  C  CE1  . PHE D  1 73 ? 39.612 45.043 -6.362  1.00 50.94  ?  73   PHE D CE1  1 
ATOM   5926  C  CE2  . PHE D  1 73 ? 37.838 46.493 -5.689  1.00 49.08  ?  73   PHE D CE2  1 
ATOM   5927  C  CZ   . PHE D  1 73 ? 38.754 46.088 -6.638  1.00 50.64  ?  73   PHE D CZ   1 
ATOM   5928  H  H    . PHE D  1 73 ? 36.618 42.598 -2.820  1.00 46.26  ?  73   PHE D H    1 
ATOM   5929  H  HA   . PHE D  1 73 ? 39.119 42.330 -3.715  1.00 47.24  ?  73   PHE D HA   1 
ATOM   5930  H  HB2  . PHE D  1 73 ? 37.755 44.387 -2.402  1.00 49.04  ?  73   PHE D HB2  1 
ATOM   5931  H  HB3  . PHE D  1 73 ? 39.339 44.399 -2.320  1.00 49.04  ?  73   PHE D HB3  1 
ATOM   5932  H  HD1  . PHE D  1 73 ? 40.133 43.701 -4.956  1.00 58.94  ?  73   PHE D HD1  1 
ATOM   5933  H  HD2  . PHE D  1 73 ? 37.164 46.128 -3.828  1.00 56.67  ?  73   PHE D HD2  1 
ATOM   5934  H  HE1  . PHE D  1 73 ? 40.230 44.768 -7.001  1.00 61.13  ?  73   PHE D HE1  1 
ATOM   5935  H  HE2  . PHE D  1 73 ? 37.259 47.197 -5.872  1.00 58.89  ?  73   PHE D HE2  1 
ATOM   5936  H  HZ   . PHE D  1 73 ? 38.792 46.518 -7.462  1.00 60.77  ?  73   PHE D HZ   1 
ATOM   5937  N  N    . PHE D  1 74 ? 38.575 41.277 -0.862  1.00 38.14  ?  74   PHE D N    1 
ATOM   5938  C  CA   . PHE D  1 74 ? 39.092 40.900 0.454   1.00 37.47  ?  74   PHE D CA   1 
ATOM   5939  C  C    . PHE D  1 74 ? 40.548 40.428 0.449   1.00 38.27  ?  74   PHE D C    1 
ATOM   5940  O  O    . PHE D  1 74 ? 41.335 40.855 1.293   1.00 36.36  ?  74   PHE D O    1 
ATOM   5941  C  CB   . PHE D  1 74 ? 38.217 39.835 1.118   1.00 38.04  ?  74   PHE D CB   1 
ATOM   5942  C  CG   . PHE D  1 74 ? 38.701 39.437 2.483   1.00 37.02  ?  74   PHE D CG   1 
ATOM   5943  C  CD1  . PHE D  1 74 ? 38.374 40.196 3.593   1.00 35.97  ?  74   PHE D CD1  1 
ATOM   5944  C  CD2  . PHE D  1 74 ? 39.506 38.321 2.652   1.00 36.92  ?  74   PHE D CD2  1 
ATOM   5945  C  CE1  . PHE D  1 74 ? 38.827 39.842 4.851   1.00 35.21  ?  74   PHE D CE1  1 
ATOM   5946  C  CE2  . PHE D  1 74 ? 39.962 37.962 3.906   1.00 35.91  ?  74   PHE D CE2  1 
ATOM   5947  C  CZ   . PHE D  1 74 ? 39.622 38.724 5.007   1.00 35.32  ?  74   PHE D CZ   1 
ATOM   5948  H  H    . PHE D  1 74 ? 37.787 40.979 -1.031  1.00 45.76  ?  74   PHE D H    1 
ATOM   5949  H  HA   . PHE D  1 74 ? 39.055 41.694 1.027   1.00 44.96  ?  74   PHE D HA   1 
ATOM   5950  H  HB2  . PHE D  1 74 ? 37.316 40.181 1.210   1.00 45.64  ?  74   PHE D HB2  1 
ATOM   5951  H  HB3  . PHE D  1 74 ? 38.211 39.041 0.560   1.00 45.64  ?  74   PHE D HB3  1 
ATOM   5952  H  HD1  . PHE D  1 74 ? 37.839 40.950 3.493   1.00 43.17  ?  74   PHE D HD1  1 
ATOM   5953  H  HD2  . PHE D  1 74 ? 39.737 37.805 1.913   1.00 44.30  ?  74   PHE D HD2  1 
ATOM   5954  H  HE1  . PHE D  1 74 ? 38.596 40.356 5.590   1.00 42.26  ?  74   PHE D HE1  1 
ATOM   5955  H  HE2  . PHE D  1 74 ? 40.497 37.208 4.009   1.00 43.09  ?  74   PHE D HE2  1 
ATOM   5956  H  HZ   . PHE D  1 74 ? 39.927 38.483 5.852   1.00 42.38  ?  74   PHE D HZ   1 
ATOM   5957  N  N    . PRO D  1 75 ? 40.913 39.545 -0.495  1.00 41.04  ?  75   PRO D N    1 
ATOM   5958  C  CA   . PRO D  1 75 ? 42.282 39.012 -0.511  1.00 40.42  ?  75   PRO D CA   1 
ATOM   5959  C  C    . PRO D  1 75 ? 43.355 40.088 -0.678  1.00 36.24  ?  75   PRO D C    1 
ATOM   5960  O  O    . PRO D  1 75 ? 44.522 39.833 -0.379  1.00 35.46  ?  75   PRO D O    1 
ATOM   5961  C  CB   . PRO D  1 75 ? 42.282 38.078 -1.727  1.00 43.69  ?  75   PRO D CB   1 
ATOM   5962  C  CG   . PRO D  1 75 ? 40.851 37.737 -1.954  1.00 45.50  ?  75   PRO D CG   1 
ATOM   5963  C  CD   . PRO D  1 75 ? 40.083 38.958 -1.560  1.00 44.60  ?  75   PRO D CD   1 
ATOM   5964  H  HA   . PRO D  1 75 ? 42.460 38.493 0.301   1.00 48.50  ?  75   PRO D HA   1 
ATOM   5965  H  HB2  . PRO D  1 75 ? 42.650 38.542 -2.496  1.00 52.43  ?  75   PRO D HB2  1 
ATOM   5966  H  HB3  . PRO D  1 75 ? 42.798 37.281 -1.528  1.00 52.43  ?  75   PRO D HB3  1 
ATOM   5967  H  HG2  . PRO D  1 75 ? 40.710 37.532 -2.891  1.00 54.59  ?  75   PRO D HG2  1 
ATOM   5968  H  HG3  . PRO D  1 75 ? 40.604 36.983 -1.396  1.00 54.59  ?  75   PRO D HG3  1 
ATOM   5969  H  HD2  . PRO D  1 75 ? 40.010 39.569 -2.309  1.00 53.52  ?  75   PRO D HD2  1 
ATOM   5970  H  HD3  . PRO D  1 75 ? 39.211 38.712 -1.213  1.00 53.52  ?  75   PRO D HD3  1 
ATOM   5971  N  N    . TYR D  1 76 ? 42.964 41.269 -1.146  1.00 32.42  ?  76   TYR D N    1 
ATOM   5972  C  CA   . TYR D  1 76 ? 43.912 42.348 -1.397  1.00 32.31  ?  76   TYR D CA   1 
ATOM   5973  C  C    . TYR D  1 76 ? 43.690 43.532 -0.462  1.00 29.21  ?  76   TYR D C    1 
ATOM   5974  O  O    . TYR D  1 76 ? 44.251 44.608 -0.674  1.00 32.48  ?  76   TYR D O    1 
ATOM   5975  C  CB   . TYR D  1 76 ? 43.788 42.816 -2.846  1.00 33.90  ?  76   TYR D CB   1 
ATOM   5976  C  CG   . TYR D  1 76 ? 43.730 41.676 -3.835  1.00 37.14  ?  76   TYR D CG   1 
ATOM   5977  C  CD1  . TYR D  1 76 ? 44.860 40.922 -4.120  1.00 40.34  ?  76   TYR D CD1  1 
ATOM   5978  C  CD2  . TYR D  1 76 ? 42.544 41.351 -4.480  1.00 38.72  ?  76   TYR D CD2  1 
ATOM   5979  C  CE1  . TYR D  1 76 ? 44.812 39.874 -5.022  1.00 44.13  ?  76   TYR D CE1  1 
ATOM   5980  C  CE2  . TYR D  1 76 ? 42.485 40.306 -5.383  1.00 42.57  ?  76   TYR D CE2  1 
ATOM   5981  C  CZ   . TYR D  1 76 ? 43.622 39.572 -5.651  1.00 46.07  ?  76   TYR D CZ   1 
ATOM   5982  O  OH   . TYR D  1 76 ? 43.569 38.531 -6.549  1.00 49.28  ?  76   TYR D OH   1 
ATOM   5983  H  H    . TYR D  1 76 ? 42.148 41.471 -1.328  1.00 38.90  ?  76   TYR D H    1 
ATOM   5984  H  HA   . TYR D  1 76 ? 44.823 42.016 -1.259  1.00 38.77  ?  76   TYR D HA   1 
ATOM   5985  H  HB2  . TYR D  1 76 ? 42.974 43.335 -2.941  1.00 40.68  ?  76   TYR D HB2  1 
ATOM   5986  H  HB3  . TYR D  1 76 ? 44.557 43.364 -3.067  1.00 40.68  ?  76   TYR D HB3  1 
ATOM   5987  H  HD1  . TYR D  1 76 ? 45.663 41.125 -3.697  1.00 48.41  ?  76   TYR D HD1  1 
ATOM   5988  H  HD2  . TYR D  1 76 ? 41.776 41.844 -4.301  1.00 46.46  ?  76   TYR D HD2  1 
ATOM   5989  H  HE1  . TYR D  1 76 ? 45.577 39.378 -5.204  1.00 52.95  ?  76   TYR D HE1  1 
ATOM   5990  H  HE2  . TYR D  1 76 ? 41.685 40.099 -5.808  1.00 51.08  ?  76   TYR D HE2  1 
ATOM   5991  H  HH   . TYR D  1 76 ? 43.338 38.808 -7.286  1.00 59.14  ?  76   TYR D HH   1 
ATOM   5992  N  N    . LEU D  1 77 ? 42.877 43.334 0.571   1.00 27.76  ?  77   LEU D N    1 
ATOM   5993  C  CA   . LEU D  1 77 ? 42.529 44.420 1.479   1.00 25.58  ?  77   LEU D CA   1 
ATOM   5994  C  C    . LEU D  1 77 ? 43.320 44.373 2.774   1.00 25.87  ?  77   LEU D C    1 
ATOM   5995  O  O    . LEU D  1 77 ? 43.607 43.300 3.306   1.00 27.22  ?  77   LEU D O    1 
ATOM   5996  C  CB   . LEU D  1 77 ? 41.038 44.375 1.828   1.00 26.82  ?  77   LEU D CB   1 
ATOM   5997  C  CG   . LEU D  1 77 ? 40.029 44.648 0.713   1.00 28.12  ?  77   LEU D CG   1 
ATOM   5998  C  CD1  . LEU D  1 77 ? 38.621 44.686 1.285   1.00 26.67  ?  77   LEU D CD1  1 
ATOM   5999  C  CD2  . LEU D  1 77 ? 40.350 45.945 -0.012  1.00 30.93  ?  77   LEU D CD2  1 
ATOM   6000  H  H    . LEU D  1 77 ? 42.513 42.580 0.767   1.00 33.31  ?  77   LEU D H    1 
ATOM   6001  H  HA   . LEU D  1 77 ? 42.714 45.276 1.040   1.00 30.70  ?  77   LEU D HA   1 
ATOM   6002  H  HB2  . LEU D  1 77 ? 40.840 43.492 2.177   1.00 32.19  ?  77   LEU D HB2  1 
ATOM   6003  H  HB3  . LEU D  1 77 ? 40.875 45.033 2.522   1.00 32.19  ?  77   LEU D HB3  1 
ATOM   6004  H  HG   . LEU D  1 77 ? 40.070 43.926 0.067   1.00 33.75  ?  77   LEU D HG   1 
ATOM   6005  H  HD11 . LEU D  1 77 ? 38.570 45.384 1.942   1.00 32.01  ?  77   LEU D HD11 1 
ATOM   6006  H  HD12 . LEU D  1 77 ? 38.000 44.857 0.574   1.00 32.01  ?  77   LEU D HD12 1 
ATOM   6007  H  HD13 . LEU D  1 77 ? 38.427 43.838 1.693   1.00 32.01  ?  77   LEU D HD13 1 
ATOM   6008  H  HD21 . LEU D  1 77 ? 41.227 45.879 -0.396  1.00 37.11  ?  77   LEU D HD21 1 
ATOM   6009  H  HD22 . LEU D  1 77 ? 39.699 46.086 -0.703  1.00 37.11  ?  77   LEU D HD22 1 
ATOM   6010  H  HD23 . LEU D  1 77 ? 40.321 46.670 0.618   1.00 37.11  ?  77   LEU D HD23 1 
ATOM   6011  N  N    . THR D  1 78 ? 43.669 45.553 3.272   1.00 25.14  ?  78   THR D N    1 
ATOM   6012  C  CA   . THR D  1 78 ? 44.096 45.711 4.654   1.00 26.17  ?  78   THR D CA   1 
ATOM   6013  C  C    . THR D  1 78 ? 42.944 46.386 5.387   1.00 28.19  ?  78   THR D C    1 
ATOM   6014  O  O    . THR D  1 78 ? 42.526 47.483 5.015   1.00 25.34  ?  78   THR D O    1 
ATOM   6015  C  CB   . THR D  1 78 ? 45.362 46.571 4.767   1.00 26.96  ?  78   THR D CB   1 
ATOM   6016  O  OG1  . THR D  1 78 ? 46.431 45.941 4.052   1.00 28.40  ?  78   THR D OG1  1 
ATOM   6017  C  CG2  . THR D  1 78 ? 45.763 46.744 6.224   1.00 24.99  ?  78   THR D CG2  1 
ATOM   6018  H  H    . THR D  1 78 ? 43.667 46.286 2.823   1.00 30.17  ?  78   THR D H    1 
ATOM   6019  H  HA   . THR D  1 78 ? 44.266 44.834 5.058   1.00 31.40  ?  78   THR D HA   1 
ATOM   6020  H  HB   . THR D  1 78 ? 45.192 47.448 4.389   1.00 32.36  ?  78   THR D HB   1 
ATOM   6021  H  HG1  . THR D  1 78 ? 47.111 46.396 4.108   1.00 34.08  ?  78   THR D HG1  1 
ATOM   6022  H  HG21 . THR D  1 78 ? 45.937 45.887 6.620   1.00 29.99  ?  78   THR D HG21 1 
ATOM   6023  H  HG22 . THR D  1 78 ? 46.555 47.283 6.284   1.00 29.99  ?  78   THR D HG22 1 
ATOM   6024  H  HG23 . THR D  1 78 ? 45.055 47.174 6.710   1.00 29.99  ?  78   THR D HG23 1 
ATOM   6025  N  N    . ILE D  1 79 ? 42.427 45.726 6.418   1.00 30.96  ?  79   ILE D N    1 
ATOM   6026  C  CA   . ILE D  1 79 ? 41.183 46.158 7.045   1.00 32.56  ?  79   ILE D CA   1 
ATOM   6027  C  C    . ILE D  1 79 ? 41.328 46.435 8.536   1.00 31.15  ?  79   ILE D C    1 
ATOM   6028  O  O    . ILE D  1 79 ? 41.887 45.626 9.278   1.00 31.37  ?  79   ILE D O    1 
ATOM   6029  C  CB   . ILE D  1 79 ? 40.080 45.096 6.863   1.00 32.62  ?  79   ILE D CB   1 
ATOM   6030  C  CG1  . ILE D  1 79 ? 39.744 44.928 5.380   1.00 35.17  ?  79   ILE D CG1  1 
ATOM   6031  C  CG2  . ILE D  1 79 ? 38.831 45.485 7.640   1.00 30.71  ?  79   ILE D CG2  1 
ATOM   6032  C  CD1  . ILE D  1 79 ? 38.840 43.754 5.089   1.00 36.74  ?  79   ILE D CD1  1 
ATOM   6033  H  H    . ILE D  1 79 ? 42.776 45.026 6.773   1.00 37.16  ?  79   ILE D H    1 
ATOM   6034  H  HA   . ILE D  1 79 ? 40.881 46.985 6.613   1.00 39.08  ?  79   ILE D HA   1 
ATOM   6035  H  HB   . ILE D  1 79 ? 40.406 44.249 7.205   1.00 39.15  ?  79   ILE D HB   1 
ATOM   6036  H  HG12 . ILE D  1 79 ? 39.298 45.731 5.068   1.00 42.21  ?  79   ILE D HG12 1 
ATOM   6037  H  HG13 . ILE D  1 79 ? 40.569 44.797 4.886   1.00 42.21  ?  79   ILE D HG13 1 
ATOM   6038  H  HG21 . ILE D  1 79 ? 38.512 46.330 7.315   1.00 36.85  ?  79   ILE D HG21 1 
ATOM   6039  H  HG22 . ILE D  1 79 ? 38.161 44.810 7.511   1.00 36.85  ?  79   ILE D HG22 1 
ATOM   6040  H  HG23 . ILE D  1 79 ? 39.052 45.554 8.572   1.00 36.85  ?  79   ILE D HG23 1 
ATOM   6041  H  HD11 . ILE D  1 79 ? 38.013 43.872 5.562   1.00 44.08  ?  79   ILE D HD11 1 
ATOM   6042  H  HD12 . ILE D  1 79 ? 38.675 43.713 4.144   1.00 44.08  ?  79   ILE D HD12 1 
ATOM   6043  H  HD13 . ILE D  1 79 ? 39.271 42.947 5.382   1.00 44.08  ?  79   ILE D HD13 1 
ATOM   6044  N  N    . ASP D  1 80 ? 40.811 47.584 8.962   1.00 32.42  ?  80   ASP D N    1 
ATOM   6045  C  CA   A ASP D  1 80 ? 40.764 47.935 10.377  0.49 31.67  ?  80   ASP D CA   1 
ATOM   6046  C  CA   B ASP D  1 80 ? 40.766 47.927 10.377  0.51 31.68  ?  80   ASP D CA   1 
ATOM   6047  C  C    . ASP D  1 80 ? 39.318 48.135 10.813  1.00 31.85  ?  80   ASP D C    1 
ATOM   6048  O  O    . ASP D  1 80 ? 38.574 48.893 10.191  1.00 31.64  ?  80   ASP D O    1 
ATOM   6049  C  CB   A ASP D  1 80 ? 41.560 49.212 10.644  0.49 32.48  ?  80   ASP D CB   1 
ATOM   6050  C  CB   B ASP D  1 80 ? 41.592 49.184 10.651  0.51 33.27  ?  80   ASP D CB   1 
ATOM   6051  C  CG   A ASP D  1 80 ? 41.512 49.632 12.099  0.49 34.06  ?  80   ASP D CG   1 
ATOM   6052  C  CG   B ASP D  1 80 ? 43.033 49.046 10.191  0.51 34.77  ?  80   ASP D CG   1 
ATOM   6053  O  OD1  A ASP D  1 80 ? 41.582 48.745 12.976  0.49 35.87  ?  80   ASP D OD1  1 
ATOM   6054  O  OD1  B ASP D  1 80 ? 43.781 48.255 10.805  0.51 36.65  ?  80   ASP D OD1  1 
ATOM   6055  O  OD2  A ASP D  1 80 ? 41.396 50.846 12.367  0.49 36.64  ?  80   ASP D OD2  1 
ATOM   6056  O  OD2  B ASP D  1 80 ? 43.421 49.731 9.220   0.51 35.25  ?  80   ASP D OD2  1 
ATOM   6057  H  H    A ASP D  1 80 ? 40.477 48.184 8.445   0.49 38.90  ?  80   ASP D H    1 
ATOM   6058  H  H    B ASP D  1 80 ? 40.478 48.186 8.446   0.51 38.90  ?  80   ASP D H    1 
ATOM   6059  H  HA   A ASP D  1 80 ? 41.153 47.209 10.908  0.49 38.01  ?  80   ASP D HA   1 
ATOM   6060  H  HA   B ASP D  1 80 ? 41.143 47.190 10.901  0.51 38.01  ?  80   ASP D HA   1 
ATOM   6061  H  HB2  A ASP D  1 80 ? 42.488 49.063 10.404  0.49 38.97  ?  80   ASP D HB2  1 
ATOM   6062  H  HB2  B ASP D  1 80 ? 41.196 49.933 10.179  0.51 39.93  ?  80   ASP D HB2  1 
ATOM   6063  H  HB3  A ASP D  1 80 ? 41.191 49.933 10.110  0.49 38.97  ?  80   ASP D HB3  1 
ATOM   6064  H  HB3  B ASP D  1 80 ? 41.597 49.358 11.606  0.51 39.93  ?  80   ASP D HB3  1 
ATOM   6065  N  N    . VAL D  1 81 ? 38.925 47.455 11.884  1.00 31.05  ?  81   VAL D N    1 
ATOM   6066  C  CA   . VAL D  1 81 ? 37.561 47.537 12.392  1.00 29.82  ?  81   VAL D CA   1 
ATOM   6067  C  C    . VAL D  1 81 ? 37.546 48.073 13.816  1.00 29.43  ?  81   VAL D C    1 
ATOM   6068  O  O    . VAL D  1 81 ? 38.363 47.675 14.646  1.00 28.55  ?  81   VAL D O    1 
ATOM   6069  C  CB   . VAL D  1 81 ? 36.885 46.152 12.400  1.00 31.22  ?  81   VAL D CB   1 
ATOM   6070  C  CG1  . VAL D  1 81 ? 35.475 46.248 12.969  1.00 30.48  ?  81   VAL D CG1  1 
ATOM   6071  C  CG2  . VAL D  1 81 ? 36.863 45.558 11.000  1.00 32.33  ?  81   VAL D CG2  1 
ATOM   6072  H  H    . VAL D  1 81 ? 39.435 46.932 12.339  1.00 37.26  ?  81   VAL D H    1 
ATOM   6073  H  HA   . VAL D  1 81 ? 37.035 48.139 11.825  1.00 35.79  ?  81   VAL D HA   1 
ATOM   6074  H  HB   . VAL D  1 81 ? 37.401 45.550 12.976  1.00 37.46  ?  81   VAL D HB   1 
ATOM   6075  H  HG11 . VAL D  1 81 ? 34.959 46.848 12.424  1.00 36.58  ?  81   VAL D HG11 1 
ATOM   6076  H  HG12 . VAL D  1 81 ? 35.076 45.375 12.963  1.00 36.58  ?  81   VAL D HG12 1 
ATOM   6077  H  HG13 . VAL D  1 81 ? 35.523 46.582 13.868  1.00 36.58  ?  81   VAL D HG13 1 
ATOM   6078  H  HG21 . VAL D  1 81 ? 37.766 45.466 10.686  1.00 38.80  ?  81   VAL D HG21 1 
ATOM   6079  H  HG22 . VAL D  1 81 ? 36.438 44.698 11.032  1.00 38.80  ?  81   VAL D HG22 1 
ATOM   6080  H  HG23 . VAL D  1 81 ? 36.372 46.144 10.419  1.00 38.80  ?  81   VAL D HG23 1 
ATOM   6081  N  N    . GLU D  1 82 ? 36.617 48.979 14.096  1.00 31.29  ?  82   GLU D N    1 
ATOM   6082  C  CA   . GLU D  1 82 ? 36.405 49.440 15.460  1.00 33.25  ?  82   GLU D CA   1 
ATOM   6083  C  C    . GLU D  1 82 ? 34.933 49.767 15.697  1.00 32.54  ?  82   GLU D C    1 
ATOM   6084  O  O    . GLU D  1 82 ? 34.276 50.365 14.844  1.00 32.36  ?  82   GLU D O    1 
ATOM   6085  C  CB   . GLU D  1 82 ? 37.281 50.655 15.772  1.00 34.57  ?  82   GLU D CB   1 
ATOM   6086  C  CG   . GLU D  1 82 ? 36.871 51.931 15.064  1.00 36.77  ?  82   GLU D CG   1 
ATOM   6087  C  CD   . GLU D  1 82 ? 37.760 53.101 15.433  1.00 40.61  ?  82   GLU D CD   1 
ATOM   6088  O  OE1  . GLU D  1 82 ? 37.556 53.690 16.516  1.00 41.70  ?  82   GLU D OE1  1 
ATOM   6089  O  OE2  . GLU D  1 82 ? 38.668 53.427 14.642  1.00 42.38  ?  82   GLU D OE2  1 
ATOM   6090  H  H    . GLU D  1 82 ? 36.097 49.342 13.514  1.00 37.55  ?  82   GLU D H    1 
ATOM   6091  H  HA   . GLU D  1 82 ? 36.656 48.723 16.078  1.00 39.90  ?  82   GLU D HA   1 
ATOM   6092  H  HB2  . GLU D  1 82 ? 37.245 50.825 16.726  1.00 41.48  ?  82   GLU D HB2  1 
ATOM   6093  H  HB3  . GLU D  1 82 ? 38.193 50.455 15.510  1.00 41.48  ?  82   GLU D HB3  1 
ATOM   6094  H  HG2  . GLU D  1 82 ? 36.932 51.796 14.106  1.00 44.13  ?  82   GLU D HG2  1 
ATOM   6095  H  HG3  . GLU D  1 82 ? 35.960 52.154 15.313  1.00 44.13  ?  82   GLU D HG3  1 
ATOM   6096  N  N    . PRO D  1 83 ? 34.409 49.363 16.862  1.00 31.62  ?  83   PRO D N    1 
ATOM   6097  C  CA   . PRO D  1 83 ? 33.001 49.597 17.201  1.00 30.96  ?  83   PRO D CA   1 
ATOM   6098  C  C    . PRO D  1 83 ? 32.692 51.060 17.503  1.00 30.08  ?  83   PRO D C    1 
ATOM   6099  O  O    . PRO D  1 83 ? 33.518 51.768 18.077  1.00 30.08  ?  83   PRO D O    1 
ATOM   6100  C  CB   . PRO D  1 83 ? 32.791 48.735 18.451  1.00 32.68  ?  83   PRO D CB   1 
ATOM   6101  C  CG   . PRO D  1 83 ? 34.144 48.581 19.044  1.00 32.16  ?  83   PRO D CG   1 
ATOM   6102  C  CD   . PRO D  1 83 ? 35.107 48.577 17.895  1.00 31.26  ?  83   PRO D CD   1 
ATOM   6103  H  HA   . PRO D  1 83 ? 32.416 49.278 16.482  1.00 37.16  ?  83   PRO D HA   1 
ATOM   6104  H  HB2  . PRO D  1 83 ? 32.196 49.190 19.067  1.00 39.22  ?  83   PRO D HB2  1 
ATOM   6105  H  HB3  . PRO D  1 83 ? 32.428 47.872 18.197  1.00 39.22  ?  83   PRO D HB3  1 
ATOM   6106  H  HG2  . PRO D  1 83 ? 34.325 49.328 19.636  1.00 38.59  ?  83   PRO D HG2  1 
ATOM   6107  H  HG3  . PRO D  1 83 ? 34.192 47.743 19.530  1.00 38.59  ?  83   PRO D HG3  1 
ATOM   6108  H  HD2  . PRO D  1 83 ? 35.937 49.012 18.147  1.00 37.51  ?  83   PRO D HD2  1 
ATOM   6109  H  HD3  . PRO D  1 83 ? 35.259 47.671 17.584  1.00 37.51  ?  83   PRO D HD3  1 
ATOM   6110  N  N    . LEU D  1 84 ? 31.503 51.500 17.105  1.00 29.98  ?  84   LEU D N    1 
ATOM   6111  C  CA   . LEU D  1 84 ? 31.040 52.852 17.385  1.00 29.30  ?  84   LEU D CA   1 
ATOM   6112  C  C    . LEU D  1 84 ? 29.820 52.788 18.297  1.00 30.01  ?  84   LEU D C    1 
ATOM   6113  O  O    . LEU D  1 84 ? 28.980 51.900 18.154  1.00 32.84  ?  84   LEU D O    1 
ATOM   6114  C  CB   . LEU D  1 84 ? 30.676 53.570 16.086  1.00 28.96  ?  84   LEU D CB   1 
ATOM   6115  C  CG   . LEU D  1 84 ? 31.794 53.721 15.052  1.00 30.58  ?  84   LEU D CG   1 
ATOM   6116  C  CD1  . LEU D  1 84 ? 31.245 54.318 13.765  1.00 32.84  ?  84   LEU D CD1  1 
ATOM   6117  C  CD2  . LEU D  1 84 ? 32.927 54.578 15.598  1.00 30.00  ?  84   LEU D CD2  1 
ATOM   6118  H  H    . LEU D  1 84 ? 30.938 51.026 16.663  1.00 35.98  ?  84   LEU D H    1 
ATOM   6119  H  HA   . LEU D  1 84 ? 31.747 53.358 17.838  1.00 35.16  ?  84   LEU D HA   1 
ATOM   6120  H  HB2  . LEU D  1 84 ? 29.956 53.080 15.660  1.00 34.75  ?  84   LEU D HB2  1 
ATOM   6121  H  HB3  . LEU D  1 84 ? 30.368 54.463 16.308  1.00 34.75  ?  84   LEU D HB3  1 
ATOM   6122  H  HG   . LEU D  1 84 ? 32.154 52.844 14.846  1.00 36.69  ?  84   LEU D HG   1 
ATOM   6123  H  HD11 . LEU D  1 84 ? 30.870 55.181 13.956  1.00 39.41  ?  84   LEU D HD11 1 
ATOM   6124  H  HD12 . LEU D  1 84 ? 31.961 54.405 13.131  1.00 39.41  ?  84   LEU D HD12 1 
ATOM   6125  H  HD13 . LEU D  1 84 ? 30.566 53.736 13.416  1.00 39.41  ?  84   LEU D HD13 1 
ATOM   6126  H  HD21 . LEU D  1 84 ? 33.283 54.160 16.385  1.00 36.00  ?  84   LEU D HD21 1 
ATOM   6127  H  HD22 . LEU D  1 84 ? 33.611 54.654 14.929  1.00 36.00  ?  84   LEU D HD22 1 
ATOM   6128  H  HD23 . LEU D  1 84 ? 32.583 55.448 15.816  1.00 36.00  ?  84   LEU D HD23 1 
ATOM   6129  N  N    . SER D  1 85 ? 29.730 53.731 19.232  1.00 29.17  ?  85   SER D N    1 
ATOM   6130  C  CA   . SER D  1 85 ? 28.612 53.790 20.169  1.00 29.52  ?  85   SER D CA   1 
ATOM   6131  C  C    . SER D  1 85 ? 27.833 55.085 19.985  1.00 29.76  ?  85   SER D C    1 
ATOM   6132  O  O    . SER D  1 85 ? 28.337 56.041 19.394  1.00 27.34  ?  85   SER D O    1 
ATOM   6133  C  CB   . SER D  1 85 ? 29.119 53.709 21.611  1.00 30.69  ?  85   SER D CB   1 
ATOM   6134  O  OG   . SER D  1 85 ? 29.596 52.414 21.918  1.00 33.08  ?  85   SER D OG   1 
ATOM   6135  H  H    . SER D  1 85 ? 30.310 54.355 19.345  1.00 35.00  ?  85   SER D H    1 
ATOM   6136  H  HA   . SER D  1 85 ? 28.008 53.036 20.008  1.00 35.43  ?  85   SER D HA   1 
ATOM   6137  H  HB2  . SER D  1 85 ? 29.842 54.345 21.726  1.00 36.82  ?  85   SER D HB2  1 
ATOM   6138  H  HB3  . SER D  1 85 ? 28.390 53.926 22.213  1.00 36.82  ?  85   SER D HB3  1 
ATOM   6139  H  HG   . SER D  1 85 ? 29.863 52.390 22.692  1.00 39.69  ?  85   SER D HG   1 
ATOM   6140  N  N    . HIS D  1 86 ? 26.606 55.115 20.495  1.00 33.80  ?  86   HIS D N    1 
ATOM   6141  C  CA   . HIS D  1 86 ? 25.810 56.334 20.465  1.00 37.08  ?  86   HIS D CA   1 
ATOM   6142  C  C    . HIS D  1 86 ? 26.399 57.378 21.409  1.00 35.06  ?  86   HIS D C    1 
ATOM   6143  O  O    . HIS D  1 86 ? 26.723 57.077 22.557  1.00 36.22  ?  86   HIS D O    1 
ATOM   6144  C  CB   . HIS D  1 86 ? 24.359 56.051 20.854  1.00 42.55  ?  86   HIS D CB   1 
ATOM   6145  C  CG   . HIS D  1 86 ? 23.523 57.286 20.982  1.00 44.93  ?  86   HIS D CG   1 
ATOM   6146  N  ND1  . HIS D  1 86 ? 22.984 57.937 19.892  1.00 46.21  ?  86   HIS D ND1  1 
ATOM   6147  C  CD2  . HIS D  1 86 ? 23.148 58.001 22.069  1.00 44.83  ?  86   HIS D CD2  1 
ATOM   6148  C  CE1  . HIS D  1 86 ? 22.306 58.993 20.304  1.00 45.40  ?  86   HIS D CE1  1 
ATOM   6149  N  NE2  . HIS D  1 86 ? 22.391 59.056 21.620  1.00 44.47  ?  86   HIS D NE2  1 
ATOM   6150  H  H    . HIS D  1 86 ? 26.213 54.445 20.862  1.00 40.56  ?  86   HIS D H    1 
ATOM   6151  H  HA   . HIS D  1 86 ? 25.818 56.703 19.557  1.00 44.50  ?  86   HIS D HA   1 
ATOM   6152  H  HB2  . HIS D  1 86 ? 23.956 55.488 20.174  1.00 51.05  ?  86   HIS D HB2  1 
ATOM   6153  H  HB3  . HIS D  1 86 ? 24.347 55.594 21.710  1.00 51.05  ?  86   HIS D HB3  1 
ATOM   6154  H  HD1  . HIS D  1 86 ? 23.071 57.691 19.073  1.00 55.45  ?  86   HIS D HD1  1 
ATOM   6155  H  HD2  . HIS D  1 86 ? 23.362 57.812 22.954  1.00 53.80  ?  86   HIS D HD2  1 
ATOM   6156  H  HE1  . HIS D  1 86 ? 21.848 59.592 19.759  1.00 54.48  ?  86   HIS D HE1  1 
ATOM   6157  H  HE2  . HIS D  1 86 ? 22.029 59.658 22.116  1.00 53.36  ?  86   HIS D HE2  1 
ATOM   6158  N  N    . HIS D  1 87 ? 26.535 58.604 20.914  1.00 33.08  ?  87   HIS D N    1 
ATOM   6159  C  CA   . HIS D  1 87 ? 27.076 59.705 21.705  1.00 28.00  ?  87   HIS D CA   1 
ATOM   6160  C  C    . HIS D  1 87 ? 25.924 60.412 22.408  1.00 28.26  ?  87   HIS D C    1 
ATOM   6161  O  O    . HIS D  1 87 ? 24.910 60.707 21.779  1.00 27.23  ?  87   HIS D O    1 
ATOM   6162  C  CB   . HIS D  1 87 ? 27.813 60.691 20.793  1.00 25.90  ?  87   HIS D CB   1 
ATOM   6163  C  CG   . HIS D  1 87 ? 28.985 61.365 21.437  1.00 26.02  ?  87   HIS D CG   1 
ATOM   6164  N  ND1  . HIS D  1 87 ? 28.858 62.429 22.305  1.00 25.68  ?  87   HIS D ND1  1 
ATOM   6165  C  CD2  . HIS D  1 87 ? 30.316 61.141 21.316  1.00 27.37  ?  87   HIS D CD2  1 
ATOM   6166  C  CE1  . HIS D  1 87 ? 30.056 62.822 22.699  1.00 26.11  ?  87   HIS D CE1  1 
ATOM   6167  N  NE2  . HIS D  1 87 ? 30.958 62.057 22.114  1.00 27.14  ?  87   HIS D NE2  1 
ATOM   6168  H  H    . HIS D  1 87 ? 26.318 58.827 20.112  1.00 39.69  ?  87   HIS D H    1 
ATOM   6169  H  HA   . HIS D  1 87 ? 27.701 59.361 22.378  1.00 33.60  ?  87   HIS D HA   1 
ATOM   6170  H  HB2  . HIS D  1 87 ? 28.139 60.211 20.015  1.00 31.08  ?  87   HIS D HB2  1 
ATOM   6171  H  HB3  . HIS D  1 87 ? 27.191 61.381 20.515  1.00 31.08  ?  87   HIS D HB3  1 
ATOM   6172  H  HD1  . HIS D  1 87 ? 28.113 62.780 22.554  1.00 30.82  ?  87   HIS D HD1  1 
ATOM   6173  H  HD2  . HIS D  1 87 ? 30.720 60.485 20.794  1.00 32.84  ?  87   HIS D HD2  1 
ATOM   6174  H  HE1  . HIS D  1 87 ? 30.233 63.519 23.289  1.00 31.33  ?  87   HIS D HE1  1 
ATOM   6175  H  HE2  . HIS D  1 87 ? 31.809 62.121 22.216  1.00 32.57  ?  87   HIS D HE2  1 
ATOM   6176  N  N    . PRO D  1 88 ? 26.074 60.690 23.714  1.00 29.67  ?  88   PRO D N    1 
ATOM   6177  C  CA   . PRO D  1 88 ? 25.026 61.378 24.481  1.00 32.60  ?  88   PRO D CA   1 
ATOM   6178  C  C    . PRO D  1 88 ? 24.769 62.811 24.005  1.00 34.04  ?  88   PRO D C    1 
ATOM   6179  O  O    . PRO D  1 88 ? 23.797 63.438 24.425  1.00 36.33  ?  88   PRO D O    1 
ATOM   6180  C  CB   . PRO D  1 88 ? 25.581 61.382 25.912  1.00 32.44  ?  88   PRO D CB   1 
ATOM   6181  C  CG   . PRO D  1 88 ? 27.054 61.193 25.764  1.00 31.24  ?  88   PRO D CG   1 
ATOM   6182  C  CD   . PRO D  1 88 ? 27.235 60.340 24.552  1.00 30.12  ?  88   PRO D CD   1 
ATOM   6183  H  HA   . PRO D  1 88 ? 24.190 60.868 24.456  1.00 39.12  ?  88   PRO D HA   1 
ATOM   6184  H  HB2  . PRO D  1 88 ? 25.386 62.233 26.335  1.00 38.93  ?  88   PRO D HB2  1 
ATOM   6185  H  HB3  . PRO D  1 88 ? 25.190 60.651 26.416  1.00 38.93  ?  88   PRO D HB3  1 
ATOM   6186  H  HG2  . PRO D  1 88 ? 27.482 62.055 25.642  1.00 37.49  ?  88   PRO D HG2  1 
ATOM   6187  H  HG3  . PRO D  1 88 ? 27.405 60.746 26.550  1.00 37.49  ?  88   PRO D HG3  1 
ATOM   6188  H  HD2  . PRO D  1 88 ? 28.061 60.569 24.098  1.00 36.14  ?  88   PRO D HD2  1 
ATOM   6189  H  HD3  . PRO D  1 88 ? 27.209 59.401 24.792  1.00 36.14  ?  88   PRO D HD3  1 
ATOM   6190  N  N    . ALA D  1 89 ? 25.625 63.309 23.120  1.00 32.20  ?  89   ALA D N    1 
ATOM   6191  C  CA   . ALA D  1 89 ? 25.544 64.685 22.649  1.00 31.19  ?  89   ALA D CA   1 
ATOM   6192  C  C    . ALA D  1 89 ? 25.047 64.708 21.210  1.00 29.09  ?  89   ALA D C    1 
ATOM   6193  O  O    . ALA D  1 89 ? 24.878 65.774 20.620  1.00 30.26  ?  89   ALA D O    1 
ATOM   6194  C  CB   . ALA D  1 89 ? 26.907 65.366 22.753  1.00 31.16  ?  89   ALA D CB   1 
ATOM   6195  H  H    . ALA D  1 89 ? 26.271 62.861 22.773  1.00 38.64  ?  89   ALA D H    1 
ATOM   6196  H  HA   . ALA D  1 89 ? 24.907 65.182 23.204  1.00 37.43  ?  89   ALA D HA   1 
ATOM   6197  H  HB1  . ALA D  1 89 ? 27.539 64.884 22.215  1.00 37.40  ?  89   ALA D HB1  1 
ATOM   6198  H  HB2  . ALA D  1 89 ? 26.829 66.269 22.438  1.00 37.40  ?  89   ALA D HB2  1 
ATOM   6199  H  HB3  . ALA D  1 89 ? 27.188 65.362 23.671  1.00 37.40  ?  89   ALA D HB3  1 
ATOM   6200  N  N    . ARG D  1 90 ? 24.819 63.524 20.648  1.00 27.30  ?  90   ARG D N    1 
ATOM   6201  C  CA   . ARG D  1 90 ? 24.311 63.406 19.288  1.00 29.39  ?  90   ARG D CA   1 
ATOM   6202  C  C    . ARG D  1 90 ? 22.899 63.966 19.201  1.00 34.44  ?  90   ARG D C    1 
ATOM   6203  O  O    . ARG D  1 90 ? 22.065 63.707 20.068  1.00 31.27  ?  90   ARG D O    1 
ATOM   6204  C  CB   . ARG D  1 90 ? 24.320 61.940 18.846  1.00 30.77  ?  90   ARG D CB   1 
ATOM   6205  C  CG   . ARG D  1 90 ? 23.726 61.685 17.465  1.00 31.67  ?  90   ARG D CG   1 
ATOM   6206  C  CD   . ARG D  1 90 ? 24.478 62.437 16.379  1.00 31.20  ?  90   ARG D CD   1 
ATOM   6207  N  NE   . ARG D  1 90 ? 23.954 62.144 15.046  1.00 32.42  ?  90   ARG D NE   1 
ATOM   6208  C  CZ   . ARG D  1 90 ? 24.058 62.956 13.996  1.00 32.64  ?  90   ARG D CZ   1 
ATOM   6209  N  NH1  . ARG D  1 90 ? 24.661 64.134 14.108  1.00 32.43  ?  90   ARG D NH1  1 
ATOM   6210  N  NH2  . ARG D  1 90 ? 23.550 62.593 12.825  1.00 33.73  ?  90   ARG D NH2  1 
ATOM   6211  H  H    . ARG D  1 90 ? 24.952 62.769 21.038  1.00 32.76  ?  90   ARG D H    1 
ATOM   6212  H  HA   . ARG D  1 90 ? 24.885 63.917 18.679  1.00 35.26  ?  90   ARG D HA   1 
ATOM   6213  H  HB2  . ARG D  1 90 ? 25.238 61.627 18.832  1.00 36.92  ?  90   ARG D HB2  1 
ATOM   6214  H  HB3  . ARG D  1 90 ? 23.809 61.421 19.486  1.00 36.92  ?  90   ARG D HB3  1 
ATOM   6215  H  HG2  . ARG D  1 90 ? 23.774 60.737 17.267  1.00 38.00  ?  90   ARG D HG2  1 
ATOM   6216  H  HG3  . ARG D  1 90 ? 22.803 61.983 17.456  1.00 38.00  ?  90   ARG D HG3  1 
ATOM   6217  H  HD2  . ARG D  1 90 ? 24.392 63.390 16.534  1.00 37.44  ?  90   ARG D HD2  1 
ATOM   6218  H  HD3  . ARG D  1 90 ? 25.412 62.177 16.400  1.00 37.44  ?  90   ARG D HD3  1 
ATOM   6219  H  HE   . ARG D  1 90 ? 23.551 61.393 14.931  1.00 38.91  ?  90   ARG D HE   1 
ATOM   6220  H  HH11 . ARG D  1 90 ? 24.993 64.377 14.864  1.00 38.91  ?  90   ARG D HH11 1 
ATOM   6221  H  HH12 . ARG D  1 90 ? 24.722 64.653 13.425  1.00 38.91  ?  90   ARG D HH12 1 
ATOM   6222  H  HH21 . ARG D  1 90 ? 23.156 61.833 12.745  1.00 40.48  ?  90   ARG D HH21 1 
ATOM   6223  H  HH22 . ARG D  1 90 ? 23.614 63.118 12.147  1.00 40.48  ?  90   ARG D HH22 1 
ATOM   6224  N  N    . VAL D  1 91 ? 22.641 64.739 18.152  1.00 43.07  ?  91   VAL D N    1 
ATOM   6225  C  CA   . VAL D  1 91 ? 21.311 65.281 17.902  1.00 48.53  ?  91   VAL D CA   1 
ATOM   6226  C  C    . VAL D  1 91 ? 20.649 64.540 16.747  1.00 50.67  ?  91   VAL D C    1 
ATOM   6227  O  O    . VAL D  1 91 ? 21.207 64.458 15.654  1.00 51.09  ?  91   VAL D O    1 
ATOM   6228  C  CB   . VAL D  1 91 ? 21.373 66.782 17.567  1.00 48.90  ?  91   VAL D CB   1 
ATOM   6229  C  CG1  . VAL D  1 91 ? 20.016 67.279 17.086  1.00 52.31  ?  91   VAL D CG1  1 
ATOM   6230  C  CG2  . VAL D  1 91 ? 21.839 67.574 18.779  1.00 45.50  ?  91   VAL D CG2  1 
ATOM   6231  H  H    . VAL D  1 91 ? 23.226 64.968 17.564  1.00 51.68  ?  91   VAL D H    1 
ATOM   6232  H  HA   . VAL D  1 91 ? 20.757 65.165 18.702  1.00 58.24  ?  91   VAL D HA   1 
ATOM   6233  H  HB   . VAL D  1 91 ? 22.021 66.921 16.846  1.00 58.68  ?  91   VAL D HB   1 
ATOM   6234  H  HG11 . VAL D  1 91 ? 19.367 67.138 17.779  1.00 62.77  ?  91   VAL D HG11 1 
ATOM   6235  H  HG12 . VAL D  1 91 ? 20.081 68.216 16.884  1.00 62.77  ?  91   VAL D HG12 1 
ATOM   6236  H  HG13 . VAL D  1 91 ? 19.766 66.791 16.298  1.00 62.77  ?  91   VAL D HG13 1 
ATOM   6237  H  HG21 . VAL D  1 91 ? 22.713 67.269 19.033  1.00 54.61  ?  91   VAL D HG21 1 
ATOM   6238  H  HG22 . VAL D  1 91 ? 21.871 68.506 18.549  1.00 54.61  ?  91   VAL D HG22 1 
ATOM   6239  H  HG23 . VAL D  1 91 ? 21.221 67.435 19.500  1.00 54.61  ?  91   VAL D HG23 1 
ATOM   6240  N  N    . MET E  1 1  ? 87.273 51.788 20.741  1.00 53.04  ?  1    MET E N    1 
ATOM   6241  C  CA   . MET E  1 1  ? 86.385 51.600 19.562  1.00 51.29  ?  1    MET E CA   1 
ATOM   6242  C  C    . MET E  1 1  ? 85.267 52.630 19.564  1.00 42.76  ?  1    MET E C    1 
ATOM   6243  O  O    . MET E  1 1  ? 85.034 53.307 20.564  1.00 42.45  ?  1    MET E O    1 
ATOM   6244  C  CB   . MET E  1 1  ? 85.807 50.189 19.545  1.00 55.39  ?  1    MET E CB   1 
ATOM   6245  C  CG   . MET E  1 1  ? 85.292 49.707 20.885  1.00 57.47  ?  1    MET E CG   1 
ATOM   6246  S  SD   . MET E  1 1  ? 85.261 47.910 20.954  1.00 69.52  ?  1    MET E SD   1 
ATOM   6247  C  CE   . MET E  1 1  ? 87.008 47.539 20.797  1.00 55.84  ?  1    MET E CE   1 
ATOM   6248  H  H1   . MET E  1 1  ? 86.745 52.036 21.503  1.00 63.65  ?  1    MET E H1   1 
ATOM   6249  H  H2   . MET E  1 1  ? 87.737 50.968 20.926  1.00 63.65  ?  1    MET E H2   1 
ATOM   6250  H  H3   . MET E  1 1  ? 87.911 52.481 20.554  1.00 63.65  ?  1    MET E H3   1 
ATOM   6251  H  HA   . MET E  1 1  ? 86.917 51.715 18.746  1.00 61.55  ?  1    MET E HA   1 
ATOM   6252  H  HB2  . MET E  1 1  ? 85.066 50.165 18.919  1.00 66.47  ?  1    MET E HB2  1 
ATOM   6253  H  HB3  . MET E  1 1  ? 86.499 49.573 19.257  1.00 66.47  ?  1    MET E HB3  1 
ATOM   6254  H  HG2  . MET E  1 1  ? 85.875 50.030 21.589  1.00 68.97  ?  1    MET E HG2  1 
ATOM   6255  H  HG3  . MET E  1 1  ? 84.388 50.033 21.019  1.00 68.97  ?  1    MET E HG3  1 
ATOM   6256  H  HE1  . MET E  1 1  ? 87.480 47.947 21.527  1.00 67.01  ?  1    MET E HE1  1 
ATOM   6257  H  HE2  . MET E  1 1  ? 87.128 46.586 20.821  1.00 67.01  ?  1    MET E HE2  1 
ATOM   6258  H  HE3  . MET E  1 1  ? 87.328 47.889 19.963  1.00 67.01  ?  1    MET E HE3  1 
ATOM   6259  N  N    . LEU E  1 2  ? 84.568 52.728 18.439  1.00 35.93  ?  2    LEU E N    1 
ATOM   6260  C  CA   . LEU E  1 2  ? 83.671 53.849 18.192  1.00 31.45  ?  2    LEU E CA   1 
ATOM   6261  C  C    . LEU E  1 2  ? 82.216 53.541 18.534  1.00 29.43  ?  2    LEU E C    1 
ATOM   6262  O  O    . LEU E  1 2  ? 81.741 52.421 18.348  1.00 29.07  ?  2    LEU E O    1 
ATOM   6263  C  CB   . LEU E  1 2  ? 83.789 54.278 16.728  1.00 30.84  ?  2    LEU E CB   1 
ATOM   6264  C  CG   . LEU E  1 2  ? 85.228 54.538 16.266  1.00 30.98  ?  2    LEU E CG   1 
ATOM   6265  C  CD1  . LEU E  1 2  ? 85.281 54.823 14.773  1.00 31.19  ?  2    LEU E CD1  1 
ATOM   6266  C  CD2  . LEU E  1 2  ? 85.850 55.682 17.051  1.00 30.69  ?  2    LEU E CD2  1 
ATOM   6267  H  H    . LEU E  1 2  ? 84.597 52.155 17.799  1.00 43.12  ?  2    LEU E H    1 
ATOM   6268  H  HA   . LEU E  1 2  ? 83.954 54.605 18.748  1.00 37.74  ?  2    LEU E HA   1 
ATOM   6269  H  HB2  . LEU E  1 2  ? 83.421 53.577 16.167  1.00 37.01  ?  2    LEU E HB2  1 
ATOM   6270  H  HB3  . LEU E  1 2  ? 83.286 55.098 16.602  1.00 37.01  ?  2    LEU E HB3  1 
ATOM   6271  H  HG   . LEU E  1 2  ? 85.757 53.742 16.434  1.00 37.17  ?  2    LEU E HG   1 
ATOM   6272  H  HD11 . LEU E  1 2  ? 84.749 55.600 14.584  1.00 37.43  ?  2    LEU E HD11 1 
ATOM   6273  H  HD12 . LEU E  1 2  ? 86.193 54.981 14.518  1.00 37.43  ?  2    LEU E HD12 1 
ATOM   6274  H  HD13 . LEU E  1 2  ? 84.934 54.065 14.297  1.00 37.43  ?  2    LEU E HD13 1 
ATOM   6275  H  HD21 . LEU E  1 2  ? 85.857 55.454 17.983  1.00 36.83  ?  2    LEU E HD21 1 
ATOM   6276  H  HD22 . LEU E  1 2  ? 86.748 55.821 16.741  1.00 36.83  ?  2    LEU E HD22 1 
ATOM   6277  H  HD23 . LEU E  1 2  ? 85.329 56.476 16.912  1.00 36.83  ?  2    LEU E HD23 1 
ATOM   6278  N  N    . TYR E  1 3  ? 81.519 54.556 19.039  1.00 29.79  ?  3    TYR E N    1 
ATOM   6279  C  CA   . TYR E  1 3  ? 80.095 54.462 19.329  1.00 27.77  ?  3    TYR E CA   1 
ATOM   6280  C  C    . TYR E  1 3  ? 79.391 55.717 18.833  1.00 27.80  ?  3    TYR E C    1 
ATOM   6281  O  O    . TYR E  1 3  ? 79.843 56.829 19.100  1.00 26.84  ?  3    TYR E O    1 
ATOM   6282  C  CB   . TYR E  1 3  ? 79.850 54.354 20.835  1.00 27.72  ?  3    TYR E CB   1 
ATOM   6283  C  CG   . TYR E  1 3  ? 80.444 53.141 21.509  1.00 30.84  ?  3    TYR E CG   1 
ATOM   6284  C  CD1  . TYR E  1 3  ? 81.791 53.095 21.837  1.00 32.46  ?  3    TYR E CD1  1 
ATOM   6285  C  CD2  . TYR E  1 3  ? 79.650 52.054 21.847  1.00 32.77  ?  3    TYR E CD2  1 
ATOM   6286  C  CE1  . TYR E  1 3  ? 82.335 51.991 22.465  1.00 35.09  ?  3    TYR E CE1  1 
ATOM   6287  C  CE2  . TYR E  1 3  ? 80.184 50.947 22.476  1.00 35.52  ?  3    TYR E CE2  1 
ATOM   6288  C  CZ   . TYR E  1 3  ? 81.528 50.922 22.784  1.00 37.02  ?  3    TYR E CZ   1 
ATOM   6289  O  OH   . TYR E  1 3  ? 82.066 49.824 23.411  1.00 39.65  ?  3    TYR E OH   1 
ATOM   6290  H  H    . TYR E  1 3  ? 81.857 55.324 19.226  1.00 35.75  ?  3    TYR E H    1 
ATOM   6291  H  HA   . TYR E  1 3  ? 79.709 53.678 18.883  1.00 33.33  ?  3    TYR E HA   1 
ATOM   6292  H  HB2  . TYR E  1 3  ? 80.228 55.138 21.263  1.00 33.26  ?  3    TYR E HB2  1 
ATOM   6293  H  HB3  . TYR E  1 3  ? 78.893 54.332 20.989  1.00 33.26  ?  3    TYR E HB3  1 
ATOM   6294  H  HD1  . TYR E  1 3  ? 82.339 53.815 21.623  1.00 38.95  ?  3    TYR E HD1  1 
ATOM   6295  H  HD2  . TYR E  1 3  ? 78.743 52.069 21.641  1.00 39.33  ?  3    TYR E HD2  1 
ATOM   6296  H  HE1  . TYR E  1 3  ? 83.241 51.972 22.674  1.00 42.11  ?  3    TYR E HE1  1 
ATOM   6297  H  HE2  . TYR E  1 3  ? 79.641 50.223 22.692  1.00 42.62  ?  3    TYR E HE2  1 
ATOM   6298  H  HH   . TYR E  1 3  ? 82.393 50.043 24.130  1.00 47.58  ?  3    TYR E HH   1 
ATOM   6299  N  N    . LEU E  1 4  ? 78.286 55.544 18.116  1.00 28.45  ?  4    LEU E N    1 
ATOM   6300  C  CA   . LEU E  1 4  ? 77.420 56.670 17.789  1.00 28.32  ?  4    LEU E CA   1 
ATOM   6301  C  C    . LEU E  1 4  ? 76.408 56.845 18.911  1.00 27.28  ?  4    LEU E C    1 
ATOM   6302  O  O    . LEU E  1 4  ? 75.641 55.932 19.213  1.00 27.49  ?  4    LEU E O    1 
ATOM   6303  C  CB   . LEU E  1 4  ? 76.688 56.443 16.465  1.00 28.04  ?  4    LEU E CB   1 
ATOM   6304  C  CG   . LEU E  1 4  ? 75.816 57.625 16.036  1.00 29.14  ?  4    LEU E CG   1 
ATOM   6305  C  CD1  . LEU E  1 4  ? 76.684 58.775 15.551  1.00 29.05  ?  4    LEU E CD1  1 
ATOM   6306  C  CD2  . LEU E  1 4  ? 74.814 57.214 14.968  1.00 30.93  ?  4    LEU E CD2  1 
ATOM   6307  H  H    . LEU E  1 4  ? 78.016 54.788 17.808  1.00 34.14  ?  4    LEU E H    1 
ATOM   6308  H  HA   . LEU E  1 4  ? 77.954 57.488 17.717  1.00 33.98  ?  4    LEU E HA   1 
ATOM   6309  H  HB2  . LEU E  1 4  ? 77.344 56.289 15.768  1.00 33.64  ?  4    LEU E HB2  1 
ATOM   6310  H  HB3  . LEU E  1 4  ? 76.114 55.667 16.554  1.00 33.64  ?  4    LEU E HB3  1 
ATOM   6311  H  HG   . LEU E  1 4  ? 75.315 57.938 16.806  1.00 34.96  ?  4    LEU E HG   1 
ATOM   6312  H  HD11 . LEU E  1 4  ? 77.205 58.478 14.802  1.00 34.86  ?  4    LEU E HD11 1 
ATOM   6313  H  HD12 . LEU E  1 4  ? 76.117 59.504 15.287  1.00 34.86  ?  4    LEU E HD12 1 
ATOM   6314  H  HD13 . LEU E  1 4  ? 77.263 59.052 16.265  1.00 34.86  ?  4    LEU E HD13 1 
ATOM   6315  H  HD21 . LEU E  1 4  ? 74.248 56.524 15.320  1.00 37.12  ?  4    LEU E HD21 1 
ATOM   6316  H  HD22 . LEU E  1 4  ? 74.287 57.979 14.724  1.00 37.12  ?  4    LEU E HD22 1 
ATOM   6317  H  HD23 . LEU E  1 4  ? 75.292 56.888 14.202  1.00 37.12  ?  4    LEU E HD23 1 
ATOM   6318  N  N    . VAL E  1 5  ? 76.411 58.021 19.529  1.00 26.17  ?  5    VAL E N    1 
ATOM   6319  C  CA   . VAL E  1 5  ? 75.543 58.286 20.666  1.00 26.15  ?  5    VAL E CA   1 
ATOM   6320  C  C    . VAL E  1 5  ? 74.688 59.519 20.419  1.00 26.75  ?  5    VAL E C    1 
ATOM   6321  O  O    . VAL E  1 5  ? 75.211 60.605 20.185  1.00 27.15  ?  5    VAL E O    1 
ATOM   6322  C  CB   . VAL E  1 5  ? 76.362 58.515 21.952  1.00 27.26  ?  5    VAL E CB   1 
ATOM   6323  C  CG1  . VAL E  1 5  ? 75.437 58.754 23.140  1.00 28.06  ?  5    VAL E CG1  1 
ATOM   6324  C  CG2  . VAL E  1 5  ? 77.284 57.333 22.215  1.00 28.28  ?  5    VAL E CG2  1 
ATOM   6325  H  H    . VAL E  1 5  ? 76.910 58.685 19.307  1.00 31.41  ?  5    VAL E H    1 
ATOM   6326  H  HA   . VAL E  1 5  ? 74.949 57.519 20.809  1.00 31.38  ?  5    VAL E HA   1 
ATOM   6327  H  HB   . VAL E  1 5  ? 76.919 59.313 21.837  1.00 32.71  ?  5    VAL E HB   1 
ATOM   6328  H  HG11 . VAL E  1 5  ? 74.874 57.986 23.257  1.00 33.68  ?  5    VAL E HG11 1 
ATOM   6329  H  HG12 . VAL E  1 5  ? 75.969 58.894 23.926  1.00 33.68  ?  5    VAL E HG12 1 
ATOM   6330  H  HG13 . VAL E  1 5  ? 74.900 59.531 22.965  1.00 33.68  ?  5    VAL E HG13 1 
ATOM   6331  H  HG21 . VAL E  1 5  ? 77.883 57.234 21.472  1.00 33.94  ?  5    VAL E HG21 1 
ATOM   6332  H  HG22 . VAL E  1 5  ? 77.782 57.499 23.019  1.00 33.94  ?  5    VAL E HG22 1 
ATOM   6333  H  HG23 . VAL E  1 5  ? 76.753 56.540 22.316  1.00 33.94  ?  5    VAL E HG23 1 
ATOM   6334  N  N    . ARG E  1 6  ? 73.371 59.344 20.474  1.00 26.63  ?  6    ARG E N    1 
ATOM   6335  C  CA   . ARG E  1 6  ? 72.446 60.464 20.369  1.00 27.63  ?  6    ARG E CA   1 
ATOM   6336  C  C    . ARG E  1 6  ? 71.909 60.807 21.750  1.00 27.39  ?  6    ARG E C    1 
ATOM   6337  O  O    . ARG E  1 6  ? 71.453 59.930 22.482  1.00 27.55  ?  6    ARG E O    1 
ATOM   6338  C  CB   . ARG E  1 6  ? 71.283 60.124 19.437  1.00 28.27  ?  6    ARG E CB   1 
ATOM   6339  C  CG   . ARG E  1 6  ? 70.263 61.249 19.296  1.00 30.50  ?  6    ARG E CG   1 
ATOM   6340  C  CD   . ARG E  1 6  ? 69.061 60.808 18.483  1.00 31.88  ?  6    ARG E CD   1 
ATOM   6341  N  NE   . ARG E  1 6  ? 69.446 60.365 17.145  1.00 32.84  ?  6    ARG E NE   1 
ATOM   6342  C  CZ   . ARG E  1 6  ? 69.539 61.162 16.084  1.00 33.55  ?  6    ARG E CZ   1 
ATOM   6343  N  NH1  . ARG E  1 6  ? 69.275 62.460 16.188  1.00 33.29  ?  6    ARG E NH1  1 
ATOM   6344  N  NH2  . ARG E  1 6  ? 69.897 60.658 14.911  1.00 34.75  ?  6    ARG E NH2  1 
ATOM   6345  H  H    . ARG E  1 6  ? 72.986 58.581 20.571  1.00 31.96  ?  6    ARG E H    1 
ATOM   6346  H  HA   . ARG E  1 6  ? 72.915 61.247 20.012  1.00 33.16  ?  6    ARG E HA   1 
ATOM   6347  H  HB2  . ARG E  1 6  ? 71.635 59.930 18.555  1.00 33.93  ?  6    ARG E HB2  1 
ATOM   6348  H  HB3  . ARG E  1 6  ? 70.820 59.346 19.785  1.00 33.93  ?  6    ARG E HB3  1 
ATOM   6349  H  HG2  . ARG E  1 6  ? 69.954 61.514 20.176  1.00 36.60  ?  6    ARG E HG2  1 
ATOM   6350  H  HG3  . ARG E  1 6  ? 70.677 62.001 18.844  1.00 36.60  ?  6    ARG E HG3  1 
ATOM   6351  H  HD2  . ARG E  1 6  ? 68.626 60.067 18.933  1.00 38.26  ?  6    ARG E HD2  1 
ATOM   6352  H  HD3  . ARG E  1 6  ? 68.447 61.553 18.391  1.00 38.26  ?  6    ARG E HD3  1 
ATOM   6353  H  HE   . ARG E  1 6  ? 69.624 59.531 17.035  1.00 39.40  ?  6    ARG E HE   1 
ATOM   6354  H  HH11 . ARG E  1 6  ? 69.042 62.792 16.946  1.00 39.94  ?  6    ARG E HH11 1 
ATOM   6355  H  HH12 . ARG E  1 6  ? 69.337 62.968 15.497  1.00 39.94  ?  6    ARG E HH12 1 
ATOM   6356  H  HH21 . ARG E  1 6  ? 70.069 59.819 14.839  1.00 41.70  ?  6    ARG E HH21 1 
ATOM   6357  H  HH22 . ARG E  1 6  ? 69.958 61.171 14.224  1.00 41.70  ?  6    ARG E HH22 1 
ATOM   6358  N  N    . MET E  1 7  ? 71.965 62.085 22.103  1.00 30.42  ?  7    MET E N    1 
ATOM   6359  C  CA   . MET E  1 7  ? 71.466 62.537 23.394  1.00 30.06  ?  7    MET E CA   1 
ATOM   6360  C  C    . MET E  1 7  ? 70.372 63.572 23.188  1.00 32.77  ?  7    MET E C    1 
ATOM   6361  O  O    . MET E  1 7  ? 70.485 64.443 22.326  1.00 32.98  ?  7    MET E O    1 
ATOM   6362  C  CB   . MET E  1 7  ? 72.596 63.145 24.222  1.00 29.46  ?  7    MET E CB   1 
ATOM   6363  C  CG   . MET E  1 7  ? 73.827 62.265 24.340  1.00 28.90  ?  7    MET E CG   1 
ATOM   6364  S  SD   . MET E  1 7  ? 75.092 62.998 25.397  1.00 33.00  ?  7    MET E SD   1 
ATOM   6365  C  CE   . MET E  1 7  ? 76.505 61.975 24.993  1.00 30.96  ?  7    MET E CE   1 
ATOM   6366  H  H    . MET E  1 7  ? 72.288 62.712 21.612  1.00 36.51  ?  7    MET E H    1 
ATOM   6367  H  HA   . MET E  1 7  ? 71.100 61.772 23.886  1.00 36.07  ?  7    MET E HA   1 
ATOM   6368  H  HB2  . MET E  1 7  ? 72.869 63.980 23.811  1.00 35.35  ?  7    MET E HB2  1 
ATOM   6369  H  HB3  . MET E  1 7  ? 72.268 63.314 25.119  1.00 35.35  ?  7    MET E HB3  1 
ATOM   6370  H  HG2  . MET E  1 7  ? 73.571 61.411 24.723  1.00 34.68  ?  7    MET E HG2  1 
ATOM   6371  H  HG3  . MET E  1 7  ? 74.209 62.134 23.458  1.00 34.68  ?  7    MET E HG3  1 
ATOM   6372  H  HE1  . MET E  1 7  ? 76.690 62.056 24.055  1.00 37.15  ?  7    MET E HE1  1 
ATOM   6373  H  HE2  . MET E  1 7  ? 77.262 62.273 25.504  1.00 37.15  ?  7    MET E HE2  1 
ATOM   6374  H  HE3  . MET E  1 7  ? 76.301 61.063 25.210  1.00 37.15  ?  7    MET E HE3  1 
ATOM   6375  N  N    . THR E  1 8  ? 69.313 63.471 23.982  1.00 31.85  ?  8    THR E N    1 
ATOM   6376  C  CA   . THR E  1 8  ? 68.219 64.429 23.915  1.00 33.95  ?  8    THR E CA   1 
ATOM   6377  C  C    . THR E  1 8  ? 67.909 64.953 25.310  1.00 33.68  ?  8    THR E C    1 
ATOM   6378  O  O    . THR E  1 8  ? 67.680 64.181 26.240  1.00 35.55  ?  8    THR E O    1 
ATOM   6379  C  CB   . THR E  1 8  ? 66.960 63.802 23.297  1.00 35.76  ?  8    THR E CB   1 
ATOM   6380  O  OG1  . THR E  1 8  ? 67.266 63.320 21.983  1.00 35.79  ?  8    THR E OG1  1 
ATOM   6381  C  CG2  . THR E  1 8  ? 65.839 64.826 23.209  1.00 37.66  ?  8    THR E CG2  1 
ATOM   6382  H  H    . THR E  1 8  ? 69.203 62.853 24.570  1.00 38.22  ?  8    THR E H    1 
ATOM   6383  H  HA   . THR E  1 8  ? 68.489 65.188 23.356  1.00 40.74  ?  8    THR E HA   1 
ATOM   6384  H  HB   . THR E  1 8  ? 66.661 63.064 23.851  1.00 42.92  ?  8    THR E HB   1 
ATOM   6385  H  HG1  . THR E  1 8  ? 67.520 63.939 21.509  1.00 42.95  ?  8    THR E HG1  1 
ATOM   6386  H  HG21 . THR E  1 8  ? 66.112 65.566 22.662  1.00 45.19  ?  8    THR E HG21 1 
ATOM   6387  H  HG22 . THR E  1 8  ? 65.057 64.424 22.822  1.00 45.19  ?  8    THR E HG22 1 
ATOM   6388  H  HG23 . THR E  1 8  ? 65.621 65.149 24.086  1.00 45.19  ?  8    THR E HG23 1 
ATOM   6389  N  N    . VAL E  1 9  ? 67.906 66.275 25.444  1.00 33.30  ?  9    VAL E N    1 
ATOM   6390  C  CA   . VAL E  1 9  ? 67.741 66.919 26.739  1.00 33.91  ?  9    VAL E CA   1 
ATOM   6391  C  C    . VAL E  1 9  ? 66.282 67.267 27.014  1.00 39.38  ?  9    VAL E C    1 
ATOM   6392  O  O    . VAL E  1 9  ? 65.625 67.919 26.201  1.00 37.38  ?  9    VAL E O    1 
ATOM   6393  C  CB   . VAL E  1 9  ? 68.575 68.211 26.816  1.00 34.45  ?  9    VAL E CB   1 
ATOM   6394  C  CG1  . VAL E  1 9  ? 68.448 68.847 28.192  1.00 36.59  ?  9    VAL E CG1  1 
ATOM   6395  C  CG2  . VAL E  1 9  ? 70.032 67.919 26.491  1.00 33.90  ?  9    VAL E CG2  1 
ATOM   6396  H  H    . VAL E  1 9  ? 67.999 66.826 24.791  1.00 39.96  ?  9    VAL E H    1 
ATOM   6397  H  HA   . VAL E  1 9  ? 68.050 66.312 27.443  1.00 40.69  ?  9    VAL E HA   1 
ATOM   6398  H  HB   . VAL E  1 9  ? 68.238 68.849 26.154  1.00 41.34  ?  9    VAL E HB   1 
ATOM   6399  H  HG11 . VAL E  1 9  ? 68.764 68.227 28.853  1.00 43.91  ?  9    VAL E HG11 1 
ATOM   6400  H  HG12 . VAL E  1 9  ? 68.975 69.649 28.214  1.00 43.91  ?  9    VAL E HG12 1 
ATOM   6401  H  HG13 . VAL E  1 9  ? 67.525 69.057 28.354  1.00 43.91  ?  9    VAL E HG13 1 
ATOM   6402  H  HG21 . VAL E  1 9  ? 70.088 67.558 25.603  1.00 40.68  ?  9    VAL E HG21 1 
ATOM   6403  H  HG22 . VAL E  1 9  ? 70.533 68.736 26.545  1.00 40.68  ?  9    VAL E HG22 1 
ATOM   6404  H  HG23 . VAL E  1 9  ? 70.372 67.284 27.125  1.00 40.68  ?  9    VAL E HG23 1 
ATOM   6405  N  N    . ASN E  1 10 ? 65.783 66.825 28.166  1.00 43.18  ?  10   ASN E N    1 
ATOM   6406  C  CA   . ASN E  1 10 ? 64.438 67.172 28.610  1.00 49.69  ?  10   ASN E CA   1 
ATOM   6407  C  C    . ASN E  1 10 ? 64.482 67.723 30.031  1.00 50.53  ?  10   ASN E C    1 
ATOM   6408  O  O    . ASN E  1 10 ? 64.379 66.974 31.002  1.00 52.12  ?  10   ASN E O    1 
ATOM   6409  C  CB   . ASN E  1 10 ? 63.518 65.952 28.554  1.00 52.14  ?  10   ASN E CB   1 
ATOM   6410  C  CG   . ASN E  1 10 ? 63.868 65.010 27.419  1.00 54.53  ?  10   ASN E CG   1 
ATOM   6411  O  OD1  . ASN E  1 10 ? 63.364 65.148 26.303  1.00 55.90  ?  10   ASN E OD1  1 
ATOM   6412  N  ND2  . ASN E  1 10 ? 64.738 64.043 27.700  1.00 55.64  ?  10   ASN E ND2  1 
ATOM   6413  H  H    . ASN E  1 10 ? 66.210 66.317 28.713  1.00 51.82  ?  10   ASN E H    1 
ATOM   6414  H  HA   . ASN E  1 10 ? 64.070 67.864 28.022  1.00 59.62  ?  10   ASN E HA   1 
ATOM   6415  H  HB2  . ASN E  1 10 ? 63.594 65.459 29.387  1.00 62.57  ?  10   ASN E HB2  1 
ATOM   6416  H  HB3  . ASN E  1 10 ? 62.604 66.250 28.427  1.00 62.57  ?  10   ASN E HB3  1 
ATOM   6417  H  HD21 . ASN E  1 10 ? 65.068 63.979 28.492  1.00 66.76  ?  10   ASN E HD21 1 
ATOM   6418  H  HD22 . ASN E  1 10 ? 64.969 63.483 27.091  1.00 66.76  ?  10   ASN E HD22 1 
ATOM   6419  N  N    . LEU E  1 11 ? 64.644 69.037 30.147  1.00 52.28  ?  11   LEU E N    1 
ATOM   6420  C  CA   . LEU E  1 11 ? 64.743 69.682 31.450  1.00 51.74  ?  11   LEU E CA   1 
ATOM   6421  C  C    . LEU E  1 11 ? 63.369 69.838 32.096  1.00 53.81  ?  11   LEU E C    1 
ATOM   6422  O  O    . LEU E  1 11 ? 62.379 70.076 31.404  1.00 52.78  ?  11   LEU E O    1 
ATOM   6423  C  CB   . LEU E  1 11 ? 65.406 71.053 31.311  1.00 50.77  ?  11   LEU E CB   1 
ATOM   6424  C  CG   . LEU E  1 11 ? 66.871 71.041 30.872  1.00 47.57  ?  11   LEU E CG   1 
ATOM   6425  C  CD1  . LEU E  1 11 ? 67.366 72.458 30.637  1.00 48.87  ?  11   LEU E CD1  1 
ATOM   6426  C  CD2  . LEU E  1 11 ? 67.734 70.335 31.905  1.00 46.38  ?  11   LEU E CD2  1 
ATOM   6427  H  H    . LEU E  1 11 ? 64.699 69.579 29.482  1.00 62.74  ?  11   LEU E H    1 
ATOM   6428  H  HA   . LEU E  1 11 ? 65.298 69.132 32.041  1.00 62.08  ?  11   LEU E HA   1 
ATOM   6429  H  HB2  . LEU E  1 11 ? 64.910 71.568 30.655  1.00 60.92  ?  11   LEU E HB2  1 
ATOM   6430  H  HB3  . LEU E  1 11 ? 65.364 71.501 32.171  1.00 60.92  ?  11   LEU E HB3  1 
ATOM   6431  H  HG   . LEU E  1 11 ? 66.945 70.555 30.036  1.00 57.08  ?  11   LEU E HG   1 
ATOM   6432  H  HD11 . LEU E  1 11 ? 67.285 72.957 31.454  1.00 58.65  ?  11   LEU E HD11 1 
ATOM   6433  H  HD12 . LEU E  1 11 ? 68.286 72.426 30.363  1.00 58.65  ?  11   LEU E HD12 1 
ATOM   6434  H  HD13 . LEU E  1 11 ? 66.833 72.865 29.950  1.00 58.65  ?  11   LEU E HD13 1 
ATOM   6435  H  HD21 . LEU E  1 11 ? 67.427 69.430 32.003  1.00 55.66  ?  11   LEU E HD21 1 
ATOM   6436  H  HD22 . LEU E  1 11 ? 68.646 70.341 31.607  1.00 55.66  ?  11   LEU E HD22 1 
ATOM   6437  H  HD23 . LEU E  1 11 ? 67.660 70.798 32.743  1.00 55.66  ?  11   LEU E HD23 1 
ATOM   6438  N  N    . PRO E  1 12 ? 63.305 69.703 33.430  1.00 53.19  ?  12   PRO E N    1 
ATOM   6439  C  CA   . PRO E  1 12 ? 62.041 69.880 34.155  1.00 56.79  ?  12   PRO E CA   1 
ATOM   6440  C  C    . PRO E  1 12 ? 61.497 71.297 34.000  1.00 65.72  ?  12   PRO E C    1 
ATOM   6441  O  O    . PRO E  1 12 ? 62.277 72.231 33.811  1.00 60.33  ?  12   PRO E O    1 
ATOM   6442  C  CB   . PRO E  1 12 ? 62.429 69.617 35.616  1.00 56.54  ?  12   PRO E CB   1 
ATOM   6443  C  CG   . PRO E  1 12 ? 63.711 68.860 35.556  1.00 55.05  ?  12   PRO E CG   1 
ATOM   6444  C  CD   . PRO E  1 12 ? 64.413 69.353 34.334  1.00 53.78  ?  12   PRO E CD   1 
ATOM   6445  H  HA   . PRO E  1 12 ? 61.372 69.227 33.862  1.00 68.14  ?  12   PRO E HA   1 
ATOM   6446  H  HB2  . PRO E  1 12 ? 62.551 70.461 36.078  1.00 67.85  ?  12   PRO E HB2  1 
ATOM   6447  H  HB3  . PRO E  1 12 ? 61.739 69.088 36.047  1.00 67.85  ?  12   PRO E HB3  1 
ATOM   6448  H  HG2  . PRO E  1 12 ? 64.236 69.046 36.350  1.00 66.06  ?  12   PRO E HG2  1 
ATOM   6449  H  HG3  . PRO E  1 12 ? 63.525 67.911 35.484  1.00 66.06  ?  12   PRO E HG3  1 
ATOM   6450  H  HD2  . PRO E  1 12 ? 64.943 70.138 34.541  1.00 64.53  ?  12   PRO E HD2  1 
ATOM   6451  H  HD3  . PRO E  1 12 ? 64.956 68.647 33.948  1.00 64.53  ?  12   PRO E HD3  1 
ATOM   6452  N  N    . ARG E  1 13 ? 60.178 71.451 34.082  1.00 87.26  ?  13   ARG E N    1 
ATOM   6453  C  CA   . ARG E  1 13 ? 59.548 72.759 33.941  1.00 98.55  ?  13   ARG E CA   1 
ATOM   6454  C  C    . ARG E  1 13 ? 60.259 73.806 34.792  1.00 100.66 ?  13   ARG E C    1 
ATOM   6455  O  O    . ARG E  1 13 ? 60.687 74.845 34.288  1.00 101.60 ?  13   ARG E O    1 
ATOM   6456  C  CB   . ARG E  1 13 ? 58.073 72.690 34.345  1.00 104.33 ?  13   ARG E CB   1 
ATOM   6457  C  CG   . ARG E  1 13 ? 57.337 74.019 34.226  1.00 107.88 ?  13   ARG E CG   1 
ATOM   6458  C  CD   . ARG E  1 13 ? 56.990 74.344 32.781  1.00 106.78 ?  13   ARG E CD   1 
ATOM   6459  N  NE   . ARG E  1 13 ? 56.683 75.761 32.594  1.00 108.87 ?  13   ARG E NE   1 
ATOM   6460  C  CZ   . ARG E  1 13 ? 55.539 76.340 32.950  1.00 112.10 ?  13   ARG E CZ   1 
ATOM   6461  N  NH1  . ARG E  1 13 ? 54.576 75.634 33.527  1.00 112.99 ?  13   ARG E NH1  1 
ATOM   6462  N  NH2  . ARG E  1 13 ? 55.361 77.636 32.735  1.00 114.54 ?  13   ARG E NH2  1 
ATOM   6463  H  H    . ARG E  1 13 ? 59.623 70.808 34.219  1.00 104.71 ?  13   ARG E H    1 
ATOM   6464  H  HA   . ARG E  1 13 ? 59.596 73.042 33.003  1.00 118.26 ?  13   ARG E HA   1 
ATOM   6465  H  HB2  . ARG E  1 13 ? 57.622 72.050 33.773  1.00 125.19 ?  13   ARG E HB2  1 
ATOM   6466  H  HB3  . ARG E  1 13 ? 58.016 72.402 35.269  1.00 125.19 ?  13   ARG E HB3  1 
ATOM   6467  H  HG2  . ARG E  1 13 ? 56.511 73.972 34.733  1.00 129.46 ?  13   ARG E HG2  1 
ATOM   6468  H  HG3  . ARG E  1 13 ? 57.901 74.728 34.570  1.00 129.46 ?  13   ARG E HG3  1 
ATOM   6469  H  HD2  . ARG E  1 13 ? 57.746 74.122 32.215  1.00 128.14 ?  13   ARG E HD2  1 
ATOM   6470  H  HD3  . ARG E  1 13 ? 56.212 73.829 32.516  1.00 128.14 ?  13   ARG E HD3  1 
ATOM   6471  H  HE   . ARG E  1 13 ? 57.284 76.255 32.227  1.00 130.64 ?  13   ARG E HE   1 
ATOM   6472  H  HH11 . ARG E  1 13 ? 54.686 74.793 33.670  1.00 135.59 ?  13   ARG E HH11 1 
ATOM   6473  H  HH12 . ARG E  1 13 ? 53.840 76.016 33.756  1.00 135.59 ?  13   ARG E HH12 1 
ATOM   6474  H  HH21 . ARG E  1 13 ? 55.982 78.100 32.362  1.00 137.45 ?  13   ARG E HH21 1 
ATOM   6475  H  HH22 . ARG E  1 13 ? 54.623 78.013 32.966  1.00 137.45 ?  13   ARG E HH22 1 
ATOM   6476  N  N    . ASN E  1 14 ? 60.386 73.523 36.085  1.00 97.15  ?  14   ASN E N    1 
ATOM   6477  C  CA   . ASN E  1 14 ? 60.984 74.473 37.018  1.00 99.46  ?  14   ASN E CA   1 
ATOM   6478  C  C    . ASN E  1 14 ? 62.473 74.210 37.211  1.00 97.37  ?  14   ASN E C    1 
ATOM   6479  O  O    . ASN E  1 14 ? 62.883 73.100 37.546  1.00 99.18  ?  14   ASN E O    1 
ATOM   6480  C  CB   . ASN E  1 14 ? 60.259 74.448 38.369  1.00 101.93 ?  14   ASN E CB   1 
ATOM   6481  C  CG   . ASN E  1 14 ? 59.207 73.357 38.452  1.00 101.21 ?  14   ASN E CG   1 
ATOM   6482  O  OD1  . ASN E  1 14 ? 59.458 72.278 38.987  1.00 99.46  ?  14   ASN E OD1  1 
ATOM   6483  N  ND2  . ASN E  1 14 ? 58.024 73.633 37.916  1.00 102.67 ?  14   ASN E ND2  1 
ATOM   6484  H  H    . ASN E  1 14 ? 60.134 72.786 36.448  1.00 116.58 ?  14   ASN E H    1 
ATOM   6485  H  HA   . ASN E  1 14 ? 60.888 75.375 36.647  1.00 119.35 ?  14   ASN E HA   1 
ATOM   6486  H  HB2  . ASN E  1 14 ? 60.909 74.292 39.072  1.00 122.31 ?  14   ASN E HB2  1 
ATOM   6487  H  HB3  . ASN E  1 14 ? 59.818 75.301 38.507  1.00 122.31 ?  14   ASN E HB3  1 
ATOM   6488  H  HD21 . ASN E  1 14 ? 57.887 74.398 37.547  1.00 123.20 ?  14   ASN E HD21 1 
ATOM   6489  H  HD22 . ASN E  1 14 ? 57.395 73.047 37.938  1.00 123.20 ?  14   ASN E HD22 1 
ATOM   6490  N  N    . LEU E  1 15 ? 63.276 75.246 36.995  1.00 94.90  ?  15   LEU E N    1 
ATOM   6491  C  CA   . LEU E  1 15 ? 64.725 75.139 37.099  1.00 90.65  ?  15   LEU E CA   1 
ATOM   6492  C  C    . LEU E  1 15 ? 65.326 76.538 37.014  1.00 92.46  ?  15   LEU E C    1 
ATOM   6493  O  O    . LEU E  1 15 ? 65.185 77.220 35.998  1.00 91.09  ?  15   LEU E O    1 
ATOM   6494  C  CB   . LEU E  1 15 ? 65.273 74.257 35.974  1.00 86.92  ?  15   LEU E CB   1 
ATOM   6495  C  CG   . LEU E  1 15 ? 66.534 73.449 36.287  1.00 85.36  ?  15   LEU E CG   1 
ATOM   6496  C  CD1  . LEU E  1 15 ? 66.223 72.323 37.262  1.00 84.99  ?  15   LEU E CD1  1 
ATOM   6497  C  CD2  . LEU E  1 15 ? 67.139 72.890 35.010  1.00 82.86  ?  15   LEU E CD2  1 
ATOM   6498  H  H    . LEU E  1 15 ? 63.001 76.033 36.783  1.00 113.88 ?  15   LEU E H    1 
ATOM   6499  H  HA   . LEU E  1 15 ? 64.968 74.741 37.960  1.00 108.78 ?  15   LEU E HA   1 
ATOM   6500  H  HB2  . LEU E  1 15 ? 64.583 73.625 35.721  1.00 104.31 ?  15   LEU E HB2  1 
ATOM   6501  H  HB3  . LEU E  1 15 ? 65.478 74.827 35.216  1.00 104.31 ?  15   LEU E HB3  1 
ATOM   6502  H  HG   . LEU E  1 15 ? 67.190 74.032 36.701  1.00 102.43 ?  15   LEU E HG   1 
ATOM   6503  H  HD11 . LEU E  1 15 ? 65.568 71.742 36.869  1.00 101.99 ?  15   LEU E HD11 1 
ATOM   6504  H  HD12 . LEU E  1 15 ? 67.030 71.833 37.440  1.00 101.99 ?  15   LEU E HD12 1 
ATOM   6505  H  HD13 . LEU E  1 15 ? 65.881 72.700 38.076  1.00 101.99 ?  15   LEU E HD13 1 
ATOM   6506  H  HD21 . LEU E  1 15 ? 67.367 73.619 34.428  1.00 99.43  ?  15   LEU E HD21 1 
ATOM   6507  H  HD22 . LEU E  1 15 ? 67.927 72.388 35.231  1.00 99.43  ?  15   LEU E HD22 1 
ATOM   6508  H  HD23 . LEU E  1 15 ? 66.496 72.319 34.583  1.00 99.43  ?  15   LEU E HD23 1 
ATOM   6509  N  N    . ASP E  1 16 ? 65.993 76.964 38.083  1.00 92.79  ?  16   ASP E N    1 
ATOM   6510  C  CA   . ASP E  1 16 ? 66.475 78.341 38.180  1.00 96.30  ?  16   ASP E CA   1 
ATOM   6511  C  C    . ASP E  1 16 ? 67.506 78.632 37.094  1.00 95.91  ?  16   ASP E C    1 
ATOM   6512  O  O    . ASP E  1 16 ? 68.267 79.596 37.188  1.00 98.27  ?  16   ASP E O    1 
ATOM   6513  C  CB   . ASP E  1 16 ? 67.076 78.624 39.563  1.00 98.18  ?  16   ASP E CB   1 
ATOM   6514  C  CG   . ASP E  1 16 ? 66.450 77.784 40.659  1.00 98.63  ?  16   ASP E CG   1 
ATOM   6515  O  OD1  . ASP E  1 16 ? 65.323 77.285 40.456  1.00 97.84  ?  16   ASP E OD1  1 
ATOM   6516  O  OD2  . ASP E  1 16 ? 67.085 77.623 41.722  1.00 99.91  ?  16   ASP E OD2  1 
ATOM   6517  H  H    . ASP E  1 16 ? 66.180 76.477 38.767  1.00 111.35 ?  16   ASP E H    1 
ATOM   6518  H  HA   . ASP E  1 16 ? 65.719 78.951 38.049  1.00 115.56 ?  16   ASP E HA   1 
ATOM   6519  H  HB2  . ASP E  1 16 ? 68.025 78.429 39.540  1.00 117.82 ?  16   ASP E HB2  1 
ATOM   6520  H  HB3  . ASP E  1 16 ? 66.934 79.558 39.783  1.00 117.82 ?  16   ASP E HB3  1 
ATOM   6521  N  N    . GLU E  1 19 ? 71.400 78.012 38.037  1.00 105.60 ?  19   GLU E N    1 
ATOM   6522  C  CA   . GLU E  1 19 ? 71.053 76.617 38.280  1.00 104.47 ?  19   GLU E CA   1 
ATOM   6523  C  C    . GLU E  1 19 ? 71.073 75.815 36.985  1.00 99.01  ?  19   GLU E C    1 
ATOM   6524  O  O    . GLU E  1 19 ? 71.882 74.903 36.825  1.00 99.22  ?  19   GLU E O    1 
ATOM   6525  C  CB   . GLU E  1 19 ? 69.675 76.521 38.933  1.00 107.45 ?  19   GLU E CB   1 
ATOM   6526  C  CG   . GLU E  1 19 ? 69.008 75.161 38.806  1.00 107.09 ?  19   GLU E CG   1 
ATOM   6527  C  CD   . GLU E  1 19 ? 69.855 74.025 39.350  1.00 108.21 ?  19   GLU E CD   1 
ATOM   6528  O  OE1  . GLU E  1 19 ? 70.961 74.290 39.866  1.00 109.78 ?  19   GLU E OE1  1 
ATOM   6529  O  OE2  . GLU E  1 19 ? 69.411 72.861 39.260  1.00 107.52 ?  19   GLU E OE2  1 
ATOM   6530  H  HA   . GLU E  1 19 ? 71.709 76.224 38.892  1.00 125.36 ?  19   GLU E HA   1 
ATOM   6531  H  HB2  . GLU E  1 19 ? 69.766 76.717 39.878  1.00 128.94 ?  19   GLU E HB2  1 
ATOM   6532  H  HB3  . GLU E  1 19 ? 69.090 77.175 38.519  1.00 128.94 ?  19   GLU E HB3  1 
ATOM   6533  H  HG2  . GLU E  1 19 ? 68.173 75.173 39.301  1.00 128.51 ?  19   GLU E HG2  1 
ATOM   6534  H  HG3  . GLU E  1 19 ? 68.834 74.982 37.869  1.00 128.51 ?  19   GLU E HG3  1 
ATOM   6535  N  N    . GLU E  1 20 ? 70.176 76.148 36.064  1.00 98.97  ?  20   GLU E N    1 
ATOM   6536  C  CA   . GLU E  1 20 ? 70.202 75.538 34.743  1.00 91.19  ?  20   GLU E CA   1 
ATOM   6537  C  C    . GLU E  1 20 ? 71.534 75.856 34.080  1.00 88.55  ?  20   GLU E C    1 
ATOM   6538  O  O    . GLU E  1 20 ? 72.128 75.008 33.413  1.00 84.99  ?  20   GLU E O    1 
ATOM   6539  C  CB   . GLU E  1 20 ? 69.053 76.052 33.876  1.00 90.48  ?  20   GLU E CB   1 
ATOM   6540  C  CG   . GLU E  1 20 ? 69.228 75.743 32.396  1.00 87.93  ?  20   GLU E CG   1 
ATOM   6541  C  CD   . GLU E  1 20 ? 67.966 75.974 31.591  1.00 87.50  ?  20   GLU E CD   1 
ATOM   6542  O  OE1  . GLU E  1 20 ? 66.975 76.476 32.163  1.00 89.28  ?  20   GLU E OE1  1 
ATOM   6543  O  OE2  . GLU E  1 20 ? 67.965 75.651 30.384  1.00 85.22  ?  20   GLU E OE2  1 
ATOM   6544  H  H    . GLU E  1 20 ? 69.545 76.721 36.179  1.00 118.76 ?  20   GLU E H    1 
ATOM   6545  H  HA   . GLU E  1 20 ? 70.119 74.565 34.828  1.00 109.43 ?  20   GLU E HA   1 
ATOM   6546  H  HB2  . GLU E  1 20 ? 68.227 75.636 34.171  1.00 108.58 ?  20   GLU E HB2  1 
ATOM   6547  H  HB3  . GLU E  1 20 ? 68.991 77.015 33.975  1.00 108.58 ?  20   GLU E HB3  1 
ATOM   6548  H  HG2  . GLU E  1 20 ? 69.923 76.316 32.035  1.00 105.51 ?  20   GLU E HG2  1 
ATOM   6549  H  HG3  . GLU E  1 20 ? 69.481 74.812 32.296  1.00 105.51 ?  20   GLU E HG3  1 
ATOM   6550  N  N    . GLU E  1 21 ? 71.999 77.086 34.275  1.00 85.15  ?  21   GLU E N    1 
ATOM   6551  C  CA   . GLU E  1 21 ? 73.276 77.524 33.727  1.00 84.75  ?  21   GLU E CA   1 
ATOM   6552  C  C    . GLU E  1 21 ? 74.443 76.903 34.487  1.00 82.71  ?  21   GLU E C    1 
ATOM   6553  O  O    . GLU E  1 21 ? 75.570 76.877 33.991  1.00 83.01  ?  21   GLU E O    1 
ATOM   6554  C  CB   . GLU E  1 21 ? 73.371 79.050 33.758  1.00 90.03  ?  21   GLU E CB   1 
ATOM   6555  C  CG   . GLU E  1 21 ? 72.649 79.733 32.604  1.00 92.22  ?  21   GLU E CG   1 
ATOM   6556  C  CD   . GLU E  1 21 ? 73.439 79.681 31.309  1.00 93.79  ?  21   GLU E CD   1 
ATOM   6557  O  OE1  . GLU E  1 21 ? 74.659 79.949 31.346  1.00 97.63  ?  21   GLU E OE1  1 
ATOM   6558  O  OE2  . GLU E  1 21 ? 72.843 79.370 30.257  1.00 91.36  ?  21   GLU E OE2  1 
ATOM   6559  H  H    . GLU E  1 21 ? 71.588 77.691 34.727  1.00 102.18 ?  21   GLU E H    1 
ATOM   6560  H  HA   . GLU E  1 21 ? 73.336 77.236 32.792  1.00 101.69 ?  21   GLU E HA   1 
ATOM   6561  H  HB2  . GLU E  1 21 ? 72.979 79.372 34.585  1.00 108.04 ?  21   GLU E HB2  1 
ATOM   6562  H  HB3  . GLU E  1 21 ? 74.306 79.306 33.716  1.00 108.04 ?  21   GLU E HB3  1 
ATOM   6563  H  HG2  . GLU E  1 21 ? 71.800 79.289 32.456  1.00 110.66 ?  21   GLU E HG2  1 
ATOM   6564  H  HG3  . GLU E  1 21 ? 72.503 80.665 32.830  1.00 110.66 ?  21   GLU E HG3  1 
ATOM   6565  N  N    . ARG E  1 22 ? 74.173 76.410 35.692  1.00 81.25  ?  22   ARG E N    1 
ATOM   6566  C  CA   . ARG E  1 22 ? 75.172 75.667 36.450  1.00 79.70  ?  22   ARG E CA   1 
ATOM   6567  C  C    . ARG E  1 22 ? 75.396 74.312 35.788  1.00 72.33  ?  22   ARG E C    1 
ATOM   6568  O  O    . ARG E  1 22 ? 76.534 73.896 35.574  1.00 72.75  ?  22   ARG E O    1 
ATOM   6569  C  CB   . ARG E  1 22 ? 74.723 75.471 37.898  1.00 83.16  ?  22   ARG E CB   1 
ATOM   6570  C  CG   . ARG E  1 22 ? 75.757 74.780 38.775  1.00 86.51  ?  22   ARG E CG   1 
ATOM   6571  C  CD   . ARG E  1 22 ? 75.122 74.186 40.022  1.00 89.59  ?  22   ARG E CD   1 
ATOM   6572  N  NE   . ARG E  1 22 ? 74.116 73.176 39.697  1.00 87.93  ?  22   ARG E NE   1 
ATOM   6573  C  CZ   . ARG E  1 22 ? 74.379 71.893 39.458  1.00 85.03  ?  22   ARG E CZ   1 
ATOM   6574  N  NH1  . ARG E  1 22 ? 75.626 71.437 39.500  1.00 85.03  ?  22   ARG E NH1  1 
ATOM   6575  N  NH2  . ARG E  1 22 ? 73.389 71.059 39.172  1.00 81.87  ?  22   ARG E NH2  1 
ATOM   6576  H  H    . ARG E  1 22 ? 73.417 76.492 36.093  1.00 97.51  ?  22   ARG E H    1 
ATOM   6577  H  HA   . ARG E  1 22 ? 76.019 76.159 36.448  1.00 95.64  ?  22   ARG E HA   1 
ATOM   6578  H  HB2  . ARG E  1 22 ? 74.538 76.339 38.288  1.00 99.79  ?  22   ARG E HB2  1 
ATOM   6579  H  HB3  . ARG E  1 22 ? 73.919 74.929 37.906  1.00 99.79  ?  22   ARG E HB3  1 
ATOM   6580  H  HG2  . ARG E  1 22 ? 76.173 74.061 38.273  1.00 103.81 ?  22   ARG E HG2  1 
ATOM   6581  H  HG3  . ARG E  1 22 ? 76.425 75.426 39.052  1.00 103.81 ?  22   ARG E HG3  1 
ATOM   6582  H  HD2  . ARG E  1 22 ? 75.810 73.765 40.561  1.00 107.51 ?  22   ARG E HD2  1 
ATOM   6583  H  HD3  . ARG E  1 22 ? 74.689 74.893 40.526  1.00 107.51 ?  22   ARG E HD3  1 
ATOM   6584  H  HE   . ARG E  1 22 ? 73.295 73.429 39.658  1.00 105.51 ?  22   ARG E HE   1 
ATOM   6585  H  HH11 . ARG E  1 22 ? 76.273 71.972 39.685  1.00 102.03 ?  22   ARG E HH11 1 
ATOM   6586  H  HH12 . ARG E  1 22 ? 75.785 70.607 39.343  1.00 102.03 ?  22   ARG E HH12 1 
ATOM   6587  H  HH21 . ARG E  1 22 ? 72.579 71.347 39.142  1.00 98.25  ?  22   ARG E HH21 1 
ATOM   6588  H  HH22 . ARG E  1 22 ? 73.557 70.230 39.016  1.00 98.25  ?  22   ARG E HH22 1 
ATOM   6589  N  N    . LEU E  1 23 ? 74.302 73.625 35.471  1.00 69.59  ?  23   LEU E N    1 
ATOM   6590  C  CA   . LEU E  1 23 ? 74.379 72.366 34.742  1.00 63.68  ?  23   LEU E CA   1 
ATOM   6591  C  C    . LEU E  1 23 ? 75.078 72.584 33.407  1.00 60.86  ?  23   LEU E C    1 
ATOM   6592  O  O    . LEU E  1 23 ? 75.927 71.790 33.007  1.00 59.79  ?  23   LEU E O    1 
ATOM   6593  C  CB   . LEU E  1 23 ? 72.982 71.785 34.508  1.00 61.77  ?  23   LEU E CB   1 
ATOM   6594  C  CG   . LEU E  1 23 ? 72.303 71.115 35.705  1.00 62.29  ?  23   LEU E CG   1 
ATOM   6595  C  CD1  . LEU E  1 23 ? 70.840 70.836 35.396  1.00 61.79  ?  23   LEU E CD1  1 
ATOM   6596  C  CD2  . LEU E  1 23 ? 73.022 69.831 36.090  1.00 60.29  ?  23   LEU E CD2  1 
ATOM   6597  H  H    . LEU E  1 23 ? 73.501 73.869 35.668  1.00 83.50  ?  23   LEU E H    1 
ATOM   6598  H  HA   . LEU E  1 23 ? 74.900 71.719 35.262  1.00 76.42  ?  23   LEU E HA   1 
ATOM   6599  H  HB2  . LEU E  1 23 ? 72.401 72.504 34.214  1.00 74.12  ?  23   LEU E HB2  1 
ATOM   6600  H  HB3  . LEU E  1 23 ? 73.046 71.119 33.805  1.00 74.12  ?  23   LEU E HB3  1 
ATOM   6601  H  HG   . LEU E  1 23 ? 72.338 71.717 36.464  1.00 74.75  ?  23   LEU E HG   1 
ATOM   6602  H  HD11 . LEU E  1 23 ? 70.787 70.253 34.635  1.00 74.15  ?  23   LEU E HD11 1 
ATOM   6603  H  HD12 . LEU E  1 23 ? 70.434 70.417 36.159  1.00 74.15  ?  23   LEU E HD12 1 
ATOM   6604  H  HD13 . LEU E  1 23 ? 70.397 71.666 35.204  1.00 74.15  ?  23   LEU E HD13 1 
ATOM   6605  H  HD21 . LEU E  1 23 ? 73.930 70.040 36.323  1.00 72.35  ?  23   LEU E HD21 1 
ATOM   6606  H  HD22 . LEU E  1 23 ? 72.574 69.436 36.841  1.00 72.35  ?  23   LEU E HD22 1 
ATOM   6607  H  HD23 . LEU E  1 23 ? 73.006 69.228 35.344  1.00 72.35  ?  23   LEU E HD23 1 
ATOM   6608  N  N    . LYS E  1 24 ? 74.717 73.665 32.720  1.00 60.91  ?  24   LYS E N    1 
ATOM   6609  C  CA   . LYS E  1 24 ? 75.339 73.998 31.443  1.00 61.05  ?  24   LYS E CA   1 
ATOM   6610  C  C    . LYS E  1 24 ? 76.843 74.175 31.611  1.00 60.87  ?  24   LYS E C    1 
ATOM   6611  O  O    . LYS E  1 24 ? 77.626 73.731 30.773  1.00 60.87  ?  24   LYS E O    1 
ATOM   6612  C  CB   . LYS E  1 24 ? 74.739 75.279 30.857  1.00 65.64  ?  24   LYS E CB   1 
ATOM   6613  C  CG   . LYS E  1 24 ? 73.317 75.139 30.335  1.00 65.99  ?  24   LYS E CG   1 
ATOM   6614  C  CD   . LYS E  1 24 ? 73.064 76.104 29.183  1.00 67.90  ?  24   LYS E CD   1 
ATOM   6615  C  CE   . LYS E  1 24 ? 71.600 76.132 28.775  1.00 66.19  ?  24   LYS E CE   1 
ATOM   6616  N  NZ   . LYS E  1 24 ? 71.390 76.875 27.499  1.00 65.49  ?  24   LYS E NZ   1 
ATOM   6617  H  H    . LYS E  1 24 ? 74.114 74.223 32.973  1.00 73.10  ?  24   LYS E H    1 
ATOM   6618  H  HA   . LYS E  1 24 ? 75.184 73.268 30.808  1.00 73.26  ?  24   LYS E HA   1 
ATOM   6619  H  HB2  . LYS E  1 24 ? 74.732 75.961 31.547  1.00 78.76  ?  24   LYS E HB2  1 
ATOM   6620  H  HB3  . LYS E  1 24 ? 75.295 75.570 30.118  1.00 78.76  ?  24   LYS E HB3  1 
ATOM   6621  H  HG2  . LYS E  1 24 ? 73.180 74.234 30.013  1.00 79.19  ?  24   LYS E HG2  1 
ATOM   6622  H  HG3  . LYS E  1 24 ? 72.691 75.342 31.048  1.00 79.19  ?  24   LYS E HG3  1 
ATOM   6623  H  HD2  . LYS E  1 24 ? 73.319 76.999 29.456  1.00 81.48  ?  24   LYS E HD2  1 
ATOM   6624  H  HD3  . LYS E  1 24 ? 73.587 75.827 28.415  1.00 81.48  ?  24   LYS E HD3  1 
ATOM   6625  H  HE2  . LYS E  1 24 ? 71.286 75.223 28.650  1.00 79.43  ?  24   LYS E HE2  1 
ATOM   6626  H  HE3  . LYS E  1 24 ? 71.084 76.572 29.469  1.00 79.43  ?  24   LYS E HE3  1 
ATOM   6627  H  HZ1  . LYS E  1 24 ? 71.849 76.487 26.843  1.00 78.59  ?  24   LYS E HZ1  1 
ATOM   6628  H  HZ2  . LYS E  1 24 ? 70.525 76.874 27.286  1.00 78.59  ?  24   LYS E HZ2  1 
ATOM   6629  H  HZ3  . LYS E  1 24 ? 71.665 77.716 27.588  1.00 78.59  ?  24   LYS E HZ3  1 
ATOM   6630  N  N    . ALA E  1 25 ? 77.240 74.827 32.698  1.00 58.59  ?  25   ALA E N    1 
ATOM   6631  C  CA   . ALA E  1 25 ? 78.650 75.088 32.963  1.00 58.01  ?  25   ALA E CA   1 
ATOM   6632  C  C    . ALA E  1 25 ? 79.404 73.786 33.202  1.00 57.05  ?  25   ALA E C    1 
ATOM   6633  O  O    . ALA E  1 25 ? 80.376 73.486 32.509  1.00 53.84  ?  25   ALA E O    1 
ATOM   6634  C  CB   . ALA E  1 25 ? 78.799 76.011 34.161  1.00 60.52  ?  25   ALA E CB   1 
ATOM   6635  H  H    . ALA E  1 25 ? 76.708 75.131 33.302  1.00 70.31  ?  25   ALA E H    1 
ATOM   6636  H  HA   . ALA E  1 25 ? 79.046 75.531 32.184  1.00 69.61  ?  25   ALA E HA   1 
ATOM   6637  H  HB1  . ALA E  1 25 ? 78.403 75.592 34.929  1.00 72.62  ?  25   ALA E HB1  1 
ATOM   6638  H  HB2  . ALA E  1 25 ? 79.732 76.170 34.319  1.00 72.62  ?  25   ALA E HB2  1 
ATOM   6639  H  HB3  . ALA E  1 25 ? 78.352 76.840 33.974  1.00 72.62  ?  25   ALA E HB3  1 
ATOM   6640  N  N    . SER E  1 26 ? 78.950 73.016 34.185  1.00 62.20  ?  26   SER E N    1 
ATOM   6641  C  CA   . SER E  1 26 ? 79.594 71.753 34.527  1.00 65.94  ?  26   SER E CA   1 
ATOM   6642  C  C    . SER E  1 26 ? 79.482 70.739 33.391  1.00 63.00  ?  26   SER E C    1 
ATOM   6643  O  O    . SER E  1 26 ? 80.301 69.827 33.284  1.00 62.79  ?  26   SER E O    1 
ATOM   6644  C  CB   . SER E  1 26 ? 78.999 71.177 35.816  1.00 69.11  ?  26   SER E CB   1 
ATOM   6645  O  OG   . SER E  1 26 ? 77.586 71.101 35.751  1.00 69.49  ?  26   SER E OG   1 
ATOM   6646  H  H    . SER E  1 26 ? 78.267 73.205 34.673  1.00 74.64  ?  26   SER E H    1 
ATOM   6647  H  HA   . SER E  1 26 ? 80.546 71.919 34.686  1.00 79.12  ?  26   SER E HA   1 
ATOM   6648  H  HB2  . SER E  1 26 ? 79.355 70.285 35.953  1.00 82.93  ?  26   SER E HB2  1 
ATOM   6649  H  HB3  . SER E  1 26 ? 79.248 71.749 36.559  1.00 82.93  ?  26   SER E HB3  1 
ATOM   6650  H  HG   . SER E  1 26 ? 77.322 71.381 35.027  1.00 83.39  ?  26   SER E HG   1 
ATOM   6651  N  N    . ALA E  1 27 ? 78.468 70.898 32.546  1.00 63.02  ?  27   ALA E N    1 
ATOM   6652  C  CA   . ALA E  1 27 ? 78.310 70.034 31.381  1.00 59.89  ?  27   ALA E CA   1 
ATOM   6653  C  C    . ALA E  1 27 ? 79.362 70.388 30.338  1.00 61.72  ?  27   ALA E C    1 
ATOM   6654  O  O    . ALA E  1 27 ? 80.012 69.510 29.771  1.00 58.19  ?  27   ALA E O    1 
ATOM   6655  C  CB   . ALA E  1 27 ? 76.916 70.177 30.797  1.00 58.11  ?  27   ALA E CB   1 
ATOM   6656  H  H    . ALA E  1 27 ? 77.858 71.499 32.624  1.00 75.62  ?  27   ALA E H    1 
ATOM   6657  H  HA   . ALA E  1 27 ? 78.440 69.100 31.648  1.00 71.87  ?  27   ALA E HA   1 
ATOM   6658  H  HB1  . ALA E  1 27 ? 76.781 71.090 30.533  1.00 69.73  ?  27   ALA E HB1  1 
ATOM   6659  H  HB2  . ALA E  1 27 ? 76.837 69.600 30.034  1.00 69.73  ?  27   ALA E HB2  1 
ATOM   6660  H  HB3  . ALA E  1 27 ? 76.271 69.929 31.464  1.00 69.73  ?  27   ALA E HB3  1 
ATOM   6661  N  N    . LYS E  1 28 ? 79.524 71.683 30.095  1.00 65.61  ?  28   LYS E N    1 
ATOM   6662  C  CA   . LYS E  1 28 ? 80.518 72.166 29.148  1.00 69.42  ?  28   LYS E CA   1 
ATOM   6663  C  C    . LYS E  1 28 ? 81.918 71.814 29.637  1.00 68.58  ?  28   LYS E C    1 
ATOM   6664  O  O    . LYS E  1 28 ? 82.799 71.485 28.842  1.00 72.43  ?  28   LYS E O    1 
ATOM   6665  C  CB   . LYS E  1 28 ? 80.388 73.679 28.970  1.00 74.06  ?  28   LYS E CB   1 
ATOM   6666  C  CG   . LYS E  1 28 ? 81.218 74.245 27.831  1.00 76.95  ?  28   LYS E CG   1 
ATOM   6667  C  CD   . LYS E  1 28 ? 81.021 75.747 27.700  1.00 80.91  ?  28   LYS E CD   1 
ATOM   6668  C  CE   . LYS E  1 28 ? 81.786 76.308 26.511  1.00 82.86  ?  28   LYS E CE   1 
ATOM   6669  N  NZ   . LYS E  1 28 ? 81.595 77.778 26.364  1.00 86.05  ?  28   LYS E NZ   1 
ATOM   6670  H  H    . LYS E  1 28 ? 79.066 72.308 30.470  1.00 78.73  ?  28   LYS E H    1 
ATOM   6671  H  HA   . LYS E  1 28 ? 80.376 71.737 28.278  1.00 83.30  ?  28   LYS E HA   1 
ATOM   6672  H  HB2  . LYS E  1 28 ? 79.459 73.893 28.793  1.00 88.87  ?  28   LYS E HB2  1 
ATOM   6673  H  HB3  . LYS E  1 28 ? 80.674 74.114 29.789  1.00 88.87  ?  28   LYS E HB3  1 
ATOM   6674  H  HG2  . LYS E  1 28 ? 82.157 74.074 28.003  1.00 92.34  ?  28   LYS E HG2  1 
ATOM   6675  H  HG3  . LYS E  1 28 ? 80.947 73.828 26.999  1.00 92.34  ?  28   LYS E HG3  1 
ATOM   6676  H  HD2  . LYS E  1 28 ? 80.079 75.937 27.572  1.00 97.09  ?  28   LYS E HD2  1 
ATOM   6677  H  HD3  . LYS E  1 28 ? 81.346 76.184 28.503  1.00 97.09  ?  28   LYS E HD3  1 
ATOM   6678  H  HE2  . LYS E  1 28 ? 82.733 76.137 26.633  1.00 99.43  ?  28   LYS E HE2  1 
ATOM   6679  H  HE3  . LYS E  1 28 ? 81.470 75.879 25.700  1.00 99.43  ?  28   LYS E HE3  1 
ATOM   6680  H  HZ1  . LYS E  1 28 ? 81.882 78.196 27.095  1.00 103.26 ?  28   LYS E HZ1  1 
ATOM   6681  H  HZ2  . LYS E  1 28 ? 82.054 78.075 25.661  1.00 103.26 ?  28   LYS E HZ2  1 
ATOM   6682  H  HZ3  . LYS E  1 28 ? 80.732 77.962 26.245  1.00 103.26 ?  28   LYS E HZ3  1 
ATOM   6683  N  N    . ALA E  1 29 ? 82.114 71.880 30.950  1.00 60.92  ?  29   ALA E N    1 
ATOM   6684  C  CA   . ALA E  1 29 ? 83.406 71.566 31.550  1.00 57.80  ?  29   ALA E CA   1 
ATOM   6685  C  C    . ALA E  1 29 ? 83.718 70.078 31.427  1.00 54.68  ?  29   ALA E C    1 
ATOM   6686  O  O    . ALA E  1 29 ? 84.822 69.699 31.038  1.00 54.93  ?  29   ALA E O    1 
ATOM   6687  C  CB   . ALA E  1 29 ? 83.426 71.992 33.011  1.00 59.02  ?  29   ALA E CB   1 
ATOM   6688  H  H    . ALA E  1 29 ? 81.510 72.105 31.519  1.00 73.10  ?  29   ALA E H    1 
ATOM   6689  H  HA   . ALA E  1 29 ? 84.106 72.064 31.079  1.00 69.36  ?  29   ALA E HA   1 
ATOM   6690  H  HB1  . ALA E  1 29 ? 82.734 71.521 33.483  1.00 70.82  ?  29   ALA E HB1  1 
ATOM   6691  H  HB2  . ALA E  1 29 ? 84.283 71.777 33.387  1.00 70.82  ?  29   ALA E HB2  1 
ATOM   6692  H  HB3  . ALA E  1 29 ? 83.273 72.938 33.063  1.00 70.82  ?  29   ALA E HB3  1 
ATOM   6693  N  N    . ARG E  1 30 ? 82.745 69.238 31.764  1.00 56.06  ?  30   ARG E N    1 
ATOM   6694  C  CA   . ARG E  1 30 ? 82.927 67.793 31.688  1.00 54.80  ?  30   ARG E CA   1 
ATOM   6695  C  C    . ARG E  1 30 ? 83.203 67.365 30.250  1.00 54.41  ?  30   ARG E C    1 
ATOM   6696  O  O    . ARG E  1 30 ? 84.097 66.557 29.994  1.00 54.58  ?  30   ARG E O    1 
ATOM   6697  C  CB   . ARG E  1 30 ? 81.688 67.065 32.215  1.00 52.72  ?  30   ARG E CB   1 
ATOM   6698  C  CG   . ARG E  1 30 ? 81.804 65.543 32.202  1.00 52.28  ?  30   ARG E CG   1 
ATOM   6699  C  CD   . ARG E  1 30 ? 82.530 65.019 33.435  1.00 55.45  ?  30   ARG E CD   1 
ATOM   6700  N  NE   . ARG E  1 30 ? 82.750 63.575 33.372  1.00 55.18  ?  30   ARG E NE   1 
ATOM   6701  C  CZ   . ARG E  1 30 ? 83.887 62.990 32.998  1.00 55.96  ?  30   ARG E CZ   1 
ATOM   6702  N  NH1  . ARG E  1 30 ? 84.944 63.714 32.647  1.00 59.25  ?  30   ARG E NH1  1 
ATOM   6703  N  NH2  . ARG E  1 30 ? 83.971 61.666 32.978  1.00 53.89  ?  30   ARG E NH2  1 
ATOM   6704  H  H    . ARG E  1 30 ? 81.968 69.480 32.042  1.00 67.27  ?  30   ARG E H    1 
ATOM   6705  H  HA   . ARG E  1 30 ? 83.694 67.533 32.239  1.00 65.76  ?  30   ARG E HA   1 
ATOM   6706  H  HB2  . ARG E  1 30 ? 81.531 67.341 33.132  1.00 63.27  ?  30   ARG E HB2  1 
ATOM   6707  H  HB3  . ARG E  1 30 ? 80.926 67.308 31.666  1.00 63.27  ?  30   ARG E HB3  1 
ATOM   6708  H  HG2  . ARG E  1 30 ? 80.914 65.155 32.187  1.00 62.74  ?  30   ARG E HG2  1 
ATOM   6709  H  HG3  . ARG E  1 30 ? 82.302 65.267 31.417  1.00 62.74  ?  30   ARG E HG3  1 
ATOM   6710  H  HD2  . ARG E  1 30 ? 83.395 65.454 33.503  1.00 66.54  ?  30   ARG E HD2  1 
ATOM   6711  H  HD3  . ARG E  1 30 ? 81.998 65.210 34.223  1.00 66.54  ?  30   ARG E HD3  1 
ATOM   6712  H  HE   . ARG E  1 30 ? 82.095 63.063 33.594  1.00 66.21  ?  30   ARG E HE   1 
ATOM   6713  H  HH11 . ARG E  1 30 ? 84.900 64.573 32.657  1.00 71.10  ?  30   ARG E HH11 1 
ATOM   6714  H  HH12 . ARG E  1 30 ? 85.672 63.324 32.409  1.00 71.10  ?  30   ARG E HH12 1 
ATOM   6715  H  HH21 . ARG E  1 30 ? 83.293 61.189 33.205  1.00 64.66  ?  30   ARG E HH21 1 
ATOM   6716  H  HH22 . ARG E  1 30 ? 84.704 61.286 32.739  1.00 64.66  ?  30   ARG E HH22 1 
ATOM   6717  N  N    . SER E  1 31 ? 82.433 67.907 29.312  1.00 55.15  ?  31   SER E N    1 
ATOM   6718  C  CA   . SER E  1 31 ? 82.597 67.558 27.906  1.00 54.60  ?  31   SER E CA   1 
ATOM   6719  C  C    . SER E  1 31 ? 83.954 68.023 27.383  1.00 53.98  ?  31   SER E C    1 
ATOM   6720  O  O    . SER E  1 31 ? 84.556 67.367 26.535  1.00 50.46  ?  31   SER E O    1 
ATOM   6721  C  CB   . SER E  1 31 ? 81.461 68.145 27.060  1.00 56.64  ?  31   SER E CB   1 
ATOM   6722  O  OG   . SER E  1 31 ? 81.367 69.552 27.206  1.00 60.88  ?  31   SER E OG   1 
ATOM   6723  H  H    . SER E  1 31 ? 81.808 68.478 29.464  1.00 66.18  ?  31   SER E H    1 
ATOM   6724  H  HA   . SER E  1 31 ? 82.561 66.583 27.818  1.00 65.52  ?  31   SER E HA   1 
ATOM   6725  H  HB2  . SER E  1 31 ? 81.628 67.939 26.127  1.00 67.97  ?  31   SER E HB2  1 
ATOM   6726  H  HB3  . SER E  1 31 ? 80.623 67.745 27.340  1.00 67.97  ?  31   SER E HB3  1 
ATOM   6727  H  HG   . SER E  1 31 ? 81.943 69.819 27.725  1.00 73.06  ?  31   SER E HG   1 
ATOM   6728  N  N    . ARG E  1 32 ? 84.438 69.148 27.899  1.00 50.35  ?  32   ARG E N    1 
ATOM   6729  C  CA   . ARG E  1 32 ? 85.736 69.671 27.485  1.00 54.18  ?  32   ARG E CA   1 
ATOM   6730  C  C    . ARG E  1 32 ? 86.851 68.683 27.809  1.00 52.68  ?  32   ARG E C    1 
ATOM   6731  O  O    . ARG E  1 32 ? 87.632 68.309 26.936  1.00 52.21  ?  32   ARG E O    1 
ATOM   6732  C  CB   . ARG E  1 32 ? 86.018 71.017 28.157  1.00 62.00  ?  32   ARG E CB   1 
ATOM   6733  C  CG   . ARG E  1 32 ? 87.491 71.392 28.178  1.00 69.34  ?  32   ARG E CG   1 
ATOM   6734  C  CD   . ARG E  1 32 ? 87.695 72.879 28.420  1.00 76.09  ?  32   ARG E CD   1 
ATOM   6735  N  NE   . ARG E  1 32 ? 87.491 73.663 27.203  1.00 78.52  ?  32   ARG E NE   1 
ATOM   6736  C  CZ   . ARG E  1 32 ? 88.399 73.806 26.240  1.00 80.71  ?  32   ARG E CZ   1 
ATOM   6737  N  NH1  . ARG E  1 32 ? 89.583 73.216 26.339  1.00 80.88  ?  32   ARG E NH1  1 
ATOM   6738  N  NH2  . ARG E  1 32 ? 88.121 74.539 25.171  1.00 82.55  ?  32   ARG E NH2  1 
ATOM   6739  H  H    . ARG E  1 32 ? 84.036 69.627 28.489  1.00 60.42  ?  32   ARG E H    1 
ATOM   6740  H  HA   . ARG E  1 32 ? 85.728 69.812 26.516  1.00 65.02  ?  32   ARG E HA   1 
ATOM   6741  H  HB2  . ARG E  1 32 ? 85.542 71.713 27.676  1.00 74.40  ?  32   ARG E HB2  1 
ATOM   6742  H  HB3  . ARG E  1 32 ? 85.707 70.980 29.075  1.00 74.40  ?  32   ARG E HB3  1 
ATOM   6743  H  HG2  . ARG E  1 32 ? 87.933 70.906 28.892  1.00 83.20  ?  32   ARG E HG2  1 
ATOM   6744  H  HG3  . ARG E  1 32 ? 87.889 71.166 27.323  1.00 83.20  ?  32   ARG E HG3  1 
ATOM   6745  H  HD2  . ARG E  1 32 ? 87.059 73.184 29.086  1.00 91.31  ?  32   ARG E HD2  1 
ATOM   6746  H  HD3  . ARG E  1 32 ? 88.602 73.031 28.729  1.00 91.31  ?  32   ARG E HD3  1 
ATOM   6747  H  HE   . ARG E  1 32 ? 86.734 74.057 27.102  1.00 94.22  ?  32   ARG E HE   1 
ATOM   6748  H  HH11 . ARG E  1 32 ? 89.770 72.739 27.030  1.00 97.05  ?  32   ARG E HH11 1 
ATOM   6749  H  HH12 . ARG E  1 32 ? 90.165 73.312 25.713  1.00 97.05  ?  32   ARG E HH12 1 
ATOM   6750  H  HH21 . ARG E  1 32 ? 87.355 74.923 25.100  1.00 99.06  ?  32   ARG E HH21 1 
ATOM   6751  H  HH22 . ARG E  1 32 ? 88.708 74.630 24.548  1.00 99.06  ?  32   ARG E HH22 1 
ATOM   6752  N  N    . THR E  1 33 ? 86.919 68.262 29.067  1.00 53.86  ?  33   THR E N    1 
ATOM   6753  C  CA   . THR E  1 33 ? 87.936 67.311 29.501  1.00 56.54  ?  33   THR E CA   1 
ATOM   6754  C  C    . THR E  1 33 ? 87.881 66.039 28.659  1.00 53.30  ?  33   THR E C    1 
ATOM   6755  O  O    . THR E  1 33 ? 88.902 65.562 28.165  1.00 55.97  ?  33   THR E O    1 
ATOM   6756  C  CB   . THR E  1 33 ? 87.742 66.923 30.977  1.00 59.02  ?  33   THR E CB   1 
ATOM   6757  O  OG1  . THR E  1 33 ? 87.574 68.103 31.772  1.00 63.04  ?  33   THR E OG1  1 
ATOM   6758  C  CG2  . THR E  1 33 ? 88.939 66.132 31.485  1.00 61.03  ?  33   THR E CG2  1 
ATOM   6759  H  H    . THR E  1 33 ? 86.385 68.513 29.692  1.00 64.63  ?  33   THR E H    1 
ATOM   6760  H  HA   . THR E  1 33 ? 88.824 67.713 29.399  1.00 67.85  ?  33   THR E HA   1 
ATOM   6761  H  HB   . THR E  1 33 ? 86.953 66.366 31.061  1.00 70.82  ?  33   THR E HB   1 
ATOM   6762  H  HG1  . THR E  1 33 ? 87.471 67.899 32.560  1.00 75.65  ?  33   THR E HG1  1 
ATOM   6763  H  HG21 . THR E  1 33 ? 89.737 66.661 31.408  1.00 73.24  ?  33   THR E HG21 1 
ATOM   6764  H  HG22 . THR E  1 33 ? 88.809 65.895 32.406  1.00 73.24  ?  33   THR E HG22 1 
ATOM   6765  H  HG23 . THR E  1 33 ? 89.046 65.330 30.968  1.00 73.24  ?  33   THR E HG23 1 
ATOM   6766  N  N    . LEU E  1 34 ? 86.678 65.496 28.500  1.00 53.81  ?  34   LEU E N    1 
ATOM   6767  C  CA   . LEU E  1 34 ? 86.488 64.239 27.787  1.00 49.43  ?  34   LEU E CA   1 
ATOM   6768  C  C    . LEU E  1 34 ? 86.918 64.340 26.325  1.00 48.66  ?  34   LEU E C    1 
ATOM   6769  O  O    . LEU E  1 34 ? 87.345 63.351 25.731  1.00 46.27  ?  34   LEU E O    1 
ATOM   6770  C  CB   . LEU E  1 34 ? 85.025 63.805 27.877  1.00 45.61  ?  34   LEU E CB   1 
ATOM   6771  C  CG   . LEU E  1 34 ? 84.559 63.389 29.273  1.00 45.87  ?  34   LEU E CG   1 
ATOM   6772  C  CD1  . LEU E  1 34 ? 83.044 63.414 29.368  1.00 43.22  ?  34   LEU E CD1  1 
ATOM   6773  C  CD2  . LEU E  1 34 ? 85.090 62.006 29.617  1.00 46.15  ?  34   LEU E CD2  1 
ATOM   6774  H  H    . LEU E  1 34 ? 85.949 65.841 28.799  1.00 64.57  ?  34   LEU E H    1 
ATOM   6775  H  HA   . LEU E  1 34 ? 87.035 63.547 28.214  1.00 59.31  ?  34   LEU E HA   1 
ATOM   6776  H  HB2  . LEU E  1 34 ? 84.465 64.544 27.590  1.00 54.73  ?  34   LEU E HB2  1 
ATOM   6777  H  HB3  . LEU E  1 34 ? 84.891 63.047 27.286  1.00 54.73  ?  34   LEU E HB3  1 
ATOM   6778  H  HG   . LEU E  1 34 ? 84.912 64.016 29.924  1.00 55.04  ?  34   LEU E HG   1 
ATOM   6779  H  HD11 . LEU E  1 34 ? 82.681 62.804 28.723  1.00 51.87  ?  34   LEU E HD11 1 
ATOM   6780  H  HD12 . LEU E  1 34 ? 82.783 63.149 30.253  1.00 51.87  ?  34   LEU E HD12 1 
ATOM   6781  H  HD13 . LEU E  1 34 ? 82.735 64.305 29.188  1.00 51.87  ?  34   LEU E HD13 1 
ATOM   6782  H  HD21 . LEU E  1 34 ? 86.050 62.026 29.594  1.00 55.38  ?  34   LEU E HD21 1 
ATOM   6783  H  HD22 . LEU E  1 34 ? 84.788 61.765 30.495  1.00 55.38  ?  34   LEU E HD22 1 
ATOM   6784  H  HD23 . LEU E  1 34 ? 84.761 61.376 28.972  1.00 55.38  ?  34   LEU E HD23 1 
ATOM   6785  N  N    . GLN E  1 35 ? 86.803 65.532 25.748  1.00 48.81  ?  35   GLN E N    1 
ATOM   6786  C  CA   . GLN E  1 35 ? 87.194 65.745 24.358  1.00 48.93  ?  35   GLN E CA   1 
ATOM   6787  C  C    . GLN E  1 35 ? 88.707 65.899 24.232  1.00 50.62  ?  35   GLN E C    1 
ATOM   6788  O  O    . GLN E  1 35 ? 89.314 65.398 23.286  1.00 51.42  ?  35   GLN E O    1 
ATOM   6789  C  CB   . GLN E  1 35 ? 86.489 66.974 23.782  1.00 48.41  ?  35   GLN E CB   1 
ATOM   6790  C  CG   . GLN E  1 35 ? 85.006 66.760 23.506  1.00 44.49  ?  35   GLN E CG   1 
ATOM   6791  C  CD   . GLN E  1 35 ? 84.326 68.007 22.982  1.00 44.40  ?  35   GLN E CD   1 
ATOM   6792  O  OE1  . GLN E  1 35 ? 84.485 68.373 21.816  1.00 44.13  ?  35   GLN E OE1  1 
ATOM   6793  N  NE2  . GLN E  1 35 ? 83.565 68.673 23.843  1.00 44.49  ?  35   GLN E NE2  1 
ATOM   6794  H  H    . GLN E  1 35 ? 86.500 66.235 26.141  1.00 58.57  ?  35   GLN E H    1 
ATOM   6795  H  HA   . GLN E  1 35 ? 86.925 64.966 23.829  1.00 58.71  ?  35   GLN E HA   1 
ATOM   6796  H  HB2  . GLN E  1 35 ? 86.570 67.705 24.414  1.00 58.09  ?  35   GLN E HB2  1 
ATOM   6797  H  HB3  . GLN E  1 35 ? 86.915 67.215 22.945  1.00 58.09  ?  35   GLN E HB3  1 
ATOM   6798  H  HG2  . GLN E  1 35 ? 84.906 66.061 22.841  1.00 53.39  ?  35   GLN E HG2  1 
ATOM   6799  H  HG3  . GLN E  1 35 ? 84.565 66.501 24.330  1.00 53.39  ?  35   GLN E HG3  1 
ATOM   6800  H  HE21 . GLN E  1 35 ? 83.480 68.389 24.651  1.00 53.39  ?  35   GLN E HE21 1 
ATOM   6801  H  HE22 . GLN E  1 35 ? 83.157 69.388 23.594  1.00 53.39  ?  35   GLN E HE22 1 
ATOM   6802  N  N    . GLU E  1 36 ? 89.311 66.595 25.189  1.00 44.28  ?  36   GLU E N    1 
ATOM   6803  C  CA   . GLU E  1 36 ? 90.758 66.771 25.202  1.00 48.81  ?  36   GLU E CA   1 
ATOM   6804  C  C    . GLU E  1 36 ? 91.450 65.417 25.312  1.00 51.15  ?  36   GLU E C    1 
ATOM   6805  O  O    . GLU E  1 36 ? 92.409 65.139 24.592  1.00 51.62  ?  36   GLU E O    1 
ATOM   6806  C  CB   . GLU E  1 36 ? 91.173 67.672 26.366  1.00 52.59  ?  36   GLU E CB   1 
ATOM   6807  C  CG   . GLU E  1 36 ? 90.692 69.110 26.236  1.00 55.79  ?  36   GLU E CG   1 
ATOM   6808  C  CD   . GLU E  1 36 ? 90.910 69.916 27.502  1.00 60.91  ?  36   GLU E CD   1 
ATOM   6809  O  OE1  . GLU E  1 36 ? 91.334 69.328 28.520  1.00 64.14  ?  36   GLU E OE1  1 
ATOM   6810  O  OE2  . GLU E  1 36 ? 90.658 71.139 27.480  1.00 62.20  ?  36   GLU E OE2  1 
ATOM   6811  H  H    . GLU E  1 36 ? 88.905 66.976 25.844  1.00 53.14  ?  36   GLU E H    1 
ATOM   6812  H  HA   . GLU E  1 36 ? 91.042 67.197 24.366  1.00 58.57  ?  36   GLU E HA   1 
ATOM   6813  H  HB2  . GLU E  1 36 ? 90.805 67.310 27.187  1.00 63.11  ?  36   GLU E HB2  1 
ATOM   6814  H  HB3  . GLU E  1 36 ? 92.141 67.687 26.419  1.00 63.11  ?  36   GLU E HB3  1 
ATOM   6815  H  HG2  . GLU E  1 36 ? 91.178 69.542 25.517  1.00 66.95  ?  36   GLU E HG2  1 
ATOM   6816  H  HG3  . GLU E  1 36 ? 89.742 69.109 26.040  1.00 66.95  ?  36   GLU E HG3  1 
ATOM   6817  N  N    . GLN E  1 37 ? 90.952 64.576 26.213  1.00 50.34  ?  37   GLN E N    1 
ATOM   6818  C  CA   . GLN E  1 37 ? 91.493 63.234 26.400  1.00 54.02  ?  37   GLN E CA   1 
ATOM   6819  C  C    . GLN E  1 37 ? 91.223 62.352 25.180  1.00 54.57  ?  37   GLN E C    1 
ATOM   6820  O  O    . GLN E  1 37 ? 91.948 61.390 24.929  1.00 57.01  ?  37   GLN E O    1 
ATOM   6821  C  CB   . GLN E  1 37 ? 90.893 62.592 27.651  1.00 53.64  ?  37   GLN E CB   1 
ATOM   6822  C  CG   . GLN E  1 37 ? 91.263 63.294 28.946  1.00 58.58  ?  37   GLN E CG   1 
ATOM   6823  C  CD   . GLN E  1 37 ? 90.536 62.719 30.145  1.00 60.80  ?  37   GLN E CD   1 
ATOM   6824  O  OE1  . GLN E  1 37 ? 89.475 62.107 30.006  1.00 58.31  ?  37   GLN E OE1  1 
ATOM   6825  N  NE2  . GLN E  1 37 ? 91.104 62.909 31.330  1.00 65.69  ?  37   GLN E NE2  1 
ATOM   6826  H  H    . GLN E  1 37 ? 90.294 64.761 26.735  1.00 60.41  ?  37   GLN E H    1 
ATOM   6827  H  HA   . GLN E  1 37 ? 92.463 63.294 26.523  1.00 64.83  ?  37   GLN E HA   1 
ATOM   6828  H  HB2  . GLN E  1 37 ? 89.926 62.603 27.574  1.00 64.37  ?  37   GLN E HB2  1 
ATOM   6829  H  HB3  . GLN E  1 37 ? 91.207 61.676 27.711  1.00 64.37  ?  37   GLN E HB3  1 
ATOM   6830  H  HG2  . GLN E  1 37 ? 92.216 63.198 29.098  1.00 70.30  ?  37   GLN E HG2  1 
ATOM   6831  H  HG3  . GLN E  1 37 ? 91.031 64.233 28.875  1.00 70.30  ?  37   GLN E HG3  1 
ATOM   6832  H  HE21 . GLN E  1 37 ? 91.846 63.339 31.387  1.00 78.82  ?  37   GLN E HE21 1 
ATOM   6833  H  HE22 . GLN E  1 37 ? 90.729 62.601 32.041  1.00 78.82  ?  37   GLN E HE22 1 
ATOM   6834  N  N    . GLY E  1 38 ? 90.173 62.674 24.432  1.00 54.41  ?  38   GLY E N    1 
ATOM   6835  C  CA   . GLY E  1 38 ? 89.896 61.994 23.179  1.00 54.96  ?  38   GLY E CA   1 
ATOM   6836  C  C    . GLY E  1 38 ? 88.870 60.876 23.253  1.00 52.22  ?  38   GLY E C    1 
ATOM   6837  O  O    . GLY E  1 38 ? 88.713 60.115 22.296  1.00 54.29  ?  38   GLY E O    1 
ATOM   6838  H  H    . GLY E  1 38 ? 89.604 63.287 24.632  1.00 65.30  ?  38   GLY E H    1 
ATOM   6839  H  HA2  . GLY E  1 38 ? 89.578 62.645 22.533  1.00 65.96  ?  38   GLY E HA2  1 
ATOM   6840  H  HA3  . GLY E  1 38 ? 90.722 61.616 22.839  1.00 65.96  ?  38   GLY E HA3  1 
ATOM   6841  N  N    . GLN E  1 39 ? 88.169 60.766 24.378  1.00 47.29  ?  39   GLN E N    1 
ATOM   6842  C  CA   . GLN E  1 39 ? 87.103 59.776 24.509  1.00 43.92  ?  39   GLN E CA   1 
ATOM   6843  C  C    . GLN E  1 39 ? 85.836 60.290 23.838  1.00 41.96  ?  39   GLN E C    1 
ATOM   6844  O  O    . GLN E  1 39 ? 85.112 59.536 23.191  1.00 42.29  ?  39   GLN E O    1 
ATOM   6845  C  CB   . GLN E  1 39 ? 86.836 59.461 25.978  1.00 44.80  ?  39   GLN E CB   1 
ATOM   6846  C  CG   . GLN E  1 39 ? 87.905 58.595 26.616  1.00 51.34  ?  39   GLN E CG   1 
ATOM   6847  C  CD   . GLN E  1 39 ? 88.359 59.129 27.955  1.00 57.30  ?  39   GLN E CD   1 
ATOM   6848  O  OE1  . GLN E  1 39 ? 88.900 60.232 28.043  1.00 58.18  ?  39   GLN E OE1  1 
ATOM   6849  N  NE2  . GLN E  1 39 ? 88.138 58.352 29.010  1.00 61.01  ?  39   GLN E NE2  1 
ATOM   6850  H  H    . GLN E  1 39 ? 88.290 61.251 25.077  1.00 56.74  ?  39   GLN E H    1 
ATOM   6851  H  HA   . GLN E  1 39 ? 87.374 58.948 24.061  1.00 52.71  ?  39   GLN E HA   1 
ATOM   6852  H  HB2  . GLN E  1 39 ? 86.792 60.294 26.474  1.00 53.76  ?  39   GLN E HB2  1 
ATOM   6853  H  HB3  . GLN E  1 39 ? 85.991 58.991 26.048  1.00 53.76  ?  39   GLN E HB3  1 
ATOM   6854  H  HG2  . GLN E  1 39 ? 87.550 57.703 26.753  1.00 61.61  ?  39   GLN E HG2  1 
ATOM   6855  H  HG3  . GLN E  1 39 ? 88.677 58.560 26.029  1.00 61.61  ?  39   GLN E HG3  1 
ATOM   6856  H  HE21 . GLN E  1 39 ? 87.754 57.589 28.910  1.00 73.21  ?  39   GLN E HE21 1 
ATOM   6857  H  HE22 . GLN E  1 39 ? 88.378 58.612 29.794  1.00 73.21  ?  39   GLN E HE22 1 
ATOM   6858  N  N    . TRP E  1 40 ? 85.574 61.579 24.007  1.00 43.67  ?  40   TRP E N    1 
ATOM   6859  C  CA   . TRP E  1 40 ? 84.500 62.247 23.290  1.00 40.51  ?  40   TRP E CA   1 
ATOM   6860  C  C    . TRP E  1 40 ? 85.099 62.802 22.004  1.00 41.87  ?  40   TRP E C    1 
ATOM   6861  O  O    . TRP E  1 40 ? 85.620 63.915 21.975  1.00 45.80  ?  40   TRP E O    1 
ATOM   6862  C  CB   . TRP E  1 40 ? 83.912 63.363 24.149  1.00 37.83  ?  40   TRP E CB   1 
ATOM   6863  C  CG   . TRP E  1 40 ? 82.526 63.770 23.767  1.00 35.89  ?  40   TRP E CG   1 
ATOM   6864  C  CD1  . TRP E  1 40 ? 81.997 63.818 22.510  1.00 36.05  ?  40   TRP E CD1  1 
ATOM   6865  C  CD2  . TRP E  1 40 ? 81.483 64.182 24.657  1.00 35.06  ?  40   TRP E CD2  1 
ATOM   6866  N  NE1  . TRP E  1 40 ? 80.690 64.239 22.563  1.00 35.37  ?  40   TRP E NE1  1 
ATOM   6867  C  CE2  . TRP E  1 40 ? 80.351 64.469 23.870  1.00 35.27  ?  40   TRP E CE2  1 
ATOM   6868  C  CE3  . TRP E  1 40 ? 81.399 64.337 26.044  1.00 35.06  ?  40   TRP E CE3  1 
ATOM   6869  C  CZ2  . TRP E  1 40 ? 79.147 64.903 24.426  1.00 34.87  ?  40   TRP E CZ2  1 
ATOM   6870  C  CZ3  . TRP E  1 40 ? 80.204 64.766 26.593  1.00 34.68  ?  40   TRP E CZ3  1 
ATOM   6871  C  CH2  . TRP E  1 40 ? 79.095 65.045 25.785  1.00 34.60  ?  40   TRP E CH2  1 
ATOM   6872  H  H    . TRP E  1 40 ? 86.010 62.095 24.540  1.00 52.40  ?  40   TRP E H    1 
ATOM   6873  H  HA   . TRP E  1 40 ? 83.793 61.607 23.066  1.00 48.61  ?  40   TRP E HA   1 
ATOM   6874  H  HB2  . TRP E  1 40 ? 83.888 63.065 25.072  1.00 45.40  ?  40   TRP E HB2  1 
ATOM   6875  H  HB3  . TRP E  1 40 ? 84.481 64.146 24.073  1.00 45.40  ?  40   TRP E HB3  1 
ATOM   6876  H  HD1  . TRP E  1 40 ? 82.456 63.601 21.731  1.00 43.26  ?  40   TRP E HD1  1 
ATOM   6877  H  HE1  . TRP E  1 40 ? 80.170 64.341 21.886  1.00 42.45  ?  40   TRP E HE1  1 
ATOM   6878  H  HE3  . TRP E  1 40 ? 82.132 64.155 26.586  1.00 42.08  ?  40   TRP E HE3  1 
ATOM   6879  H  HZ2  . TRP E  1 40 ? 78.408 65.088 23.892  1.00 41.85  ?  40   TRP E HZ2  1 
ATOM   6880  H  HZ3  . TRP E  1 40 ? 80.138 64.874 27.514  1.00 41.62  ?  40   TRP E HZ3  1 
ATOM   6881  H  HH2  . TRP E  1 40 ? 78.305 65.333 26.182  1.00 41.52  ?  40   TRP E HH2  1 
ATOM   6882  N  N    . ARG E  1 41 ? 85.034 62.005 20.943  1.00 38.29  ?  41   ARG E N    1 
ATOM   6883  C  CA   . ARG E  1 41 ? 85.763 62.299 19.715  1.00 39.44  ?  41   ARG E CA   1 
ATOM   6884  C  C    . ARG E  1 41 ? 85.068 63.348 18.850  1.00 36.33  ?  41   ARG E C    1 
ATOM   6885  O  O    . ARG E  1 41 ? 85.709 64.289 18.377  1.00 38.63  ?  41   ARG E O    1 
ATOM   6886  C  CB   . ARG E  1 41 ? 85.971 61.007 18.926  1.00 42.72  ?  41   ARG E CB   1 
ATOM   6887  C  CG   . ARG E  1 41 ? 86.694 61.178 17.605  1.00 48.02  ?  41   ARG E CG   1 
ATOM   6888  C  CD   . ARG E  1 41 ? 87.492 59.928 17.280  1.00 54.74  ?  41   ARG E CD   1 
ATOM   6889  N  NE   . ARG E  1 41 ? 87.729 59.772 15.850  1.00 61.21  ?  41   ARG E NE   1 
ATOM   6890  C  CZ   . ARG E  1 41 ? 88.396 58.757 15.310  1.00 69.22  ?  41   ARG E CZ   1 
ATOM   6891  N  NH1  . ARG E  1 41 ? 88.902 57.803 16.082  1.00 71.47  ?  41   ARG E NH1  1 
ATOM   6892  N  NH2  . ARG E  1 41 ? 88.561 58.696 13.996  1.00 74.17  ?  41   ARG E NH2  1 
ATOM   6893  H  H    . ARG E  1 41 ? 84.571 61.282 20.909  1.00 45.95  ?  41   ARG E H    1 
ATOM   6894  H  HA   . ARG E  1 41 ? 86.647 62.648 19.952  1.00 47.32  ?  41   ARG E HA   1 
ATOM   6895  H  HB2  . ARG E  1 41 ? 86.492 60.394 19.468  1.00 51.27  ?  41   ARG E HB2  1 
ATOM   6896  H  HB3  . ARG E  1 41 ? 85.103 60.617 18.736  1.00 51.27  ?  41   ARG E HB3  1 
ATOM   6897  H  HG2  . ARG E  1 41 ? 86.047 61.323 16.897  1.00 57.63  ?  41   ARG E HG2  1 
ATOM   6898  H  HG3  . ARG E  1 41 ? 87.306 61.928 17.665  1.00 57.63  ?  41   ARG E HG3  1 
ATOM   6899  H  HD2  . ARG E  1 41 ? 88.354 59.978 17.724  1.00 65.68  ?  41   ARG E HD2  1 
ATOM   6900  H  HD3  . ARG E  1 41 ? 87.003 59.150 17.591  1.00 65.68  ?  41   ARG E HD3  1 
ATOM   6901  H  HE   . ARG E  1 41 ? 87.395 60.361 15.320  1.00 73.45  ?  41   ARG E HE   1 
ATOM   6902  H  HH11 . ARG E  1 41 ? 88.797 57.839 16.934  1.00 85.76  ?  41   ARG E HH11 1 
ATOM   6903  H  HH12 . ARG E  1 41 ? 89.334 57.148 15.729  1.00 85.76  ?  41   ARG E HH12 1 
ATOM   6904  H  HH21 . ARG E  1 41 ? 88.235 59.313 13.493  1.00 89.00  ?  41   ARG E HH21 1 
ATOM   6905  H  HH22 . ARG E  1 41 ? 88.994 58.040 13.647  1.00 89.00  ?  41   ARG E HH22 1 
ATOM   6906  N  N    . TYR E  1 42 ? 83.763 63.188 18.644  1.00 34.10  ?  42   TYR E N    1 
ATOM   6907  C  CA   . TYR E  1 42 ? 82.999 64.143 17.850  1.00 31.59  ?  42   TYR E CA   1 
ATOM   6908  C  C    . TYR E  1 42 ? 81.751 64.614 18.589  1.00 30.59  ?  42   TYR E C    1 
ATOM   6909  O  O    . TYR E  1 42 ? 81.128 63.857 19.337  1.00 27.49  ?  42   TYR E O    1 
ATOM   6910  C  CB   . TYR E  1 42 ? 82.613 63.533 16.503  1.00 32.26  ?  42   TYR E CB   1 
ATOM   6911  C  CG   . TYR E  1 42 ? 83.804 63.154 15.657  1.00 37.29  ?  42   TYR E CG   1 
ATOM   6912  C  CD1  . TYR E  1 42 ? 84.892 64.010 15.538  1.00 40.38  ?  42   TYR E CD1  1 
ATOM   6913  C  CD2  . TYR E  1 42 ? 83.850 61.938 14.989  1.00 39.94  ?  42   TYR E CD2  1 
ATOM   6914  C  CE1  . TYR E  1 42 ? 85.989 63.669 14.772  1.00 43.85  ?  42   TYR E CE1  1 
ATOM   6915  C  CE2  . TYR E  1 42 ? 84.946 61.587 14.219  1.00 43.69  ?  42   TYR E CE2  1 
ATOM   6916  C  CZ   . TYR E  1 42 ? 86.012 62.458 14.115  1.00 45.50  ?  42   TYR E CZ   1 
ATOM   6917  O  OH   . TYR E  1 42 ? 87.104 62.118 13.353  1.00 48.60  ?  42   TYR E OH   1 
ATOM   6918  H  H    . TYR E  1 42 ? 83.297 62.534 18.953  1.00 40.92  ?  42   TYR E H    1 
ATOM   6919  H  HA   . TYR E  1 42 ? 83.559 64.929 17.675  1.00 37.91  ?  42   TYR E HA   1 
ATOM   6920  H  HB2  . TYR E  1 42 ? 82.091 62.730 16.659  1.00 38.71  ?  42   TYR E HB2  1 
ATOM   6921  H  HB3  . TYR E  1 42 ? 82.086 64.177 16.005  1.00 38.71  ?  42   TYR E HB3  1 
ATOM   6922  H  HD1  . TYR E  1 42 ? 84.880 64.828 15.980  1.00 48.46  ?  42   TYR E HD1  1 
ATOM   6923  H  HD2  . TYR E  1 42 ? 83.133 61.350 15.058  1.00 47.93  ?  42   TYR E HD2  1 
ATOM   6924  H  HE1  . TYR E  1 42 ? 86.709 64.253 14.700  1.00 52.62  ?  42   TYR E HE1  1 
ATOM   6925  H  HE2  . TYR E  1 42 ? 84.964 60.770 13.775  1.00 52.43  ?  42   TYR E HE2  1 
ATOM   6926  H  HH   . TYR E  1 42 ? 86.877 61.997 12.575  1.00 58.31  ?  42   TYR E HH   1 
ATOM   6927  N  N    . LEU E  1 43 ? 81.399 65.875 18.369  1.00 35.85  ?  43   LEU E N    1 
ATOM   6928  C  CA   . LEU E  1 43 ? 80.235 66.470 19.003  1.00 36.26  ?  43   LEU E CA   1 
ATOM   6929  C  C    . LEU E  1 43 ? 79.574 67.461 18.055  1.00 34.84  ?  43   LEU E C    1 
ATOM   6930  O  O    . LEU E  1 43 ? 80.211 68.404 17.589  1.00 37.83  ?  43   LEU E O    1 
ATOM   6931  C  CB   . LEU E  1 43 ? 80.642 67.174 20.298  1.00 37.55  ?  43   LEU E CB   1 
ATOM   6932  C  CG   . LEU E  1 43 ? 79.527 67.900 21.052  1.00 35.90  ?  43   LEU E CG   1 
ATOM   6933  C  CD1  . LEU E  1 43 ? 78.384 66.951 21.367  1.00 34.83  ?  43   LEU E CD1  1 
ATOM   6934  C  CD2  . LEU E  1 43 ? 80.073 68.528 22.326  1.00 36.00  ?  43   LEU E CD2  1 
ATOM   6935  H  H    . LEU E  1 43 ? 81.825 66.412 17.850  1.00 43.02  ?  43   LEU E H    1 
ATOM   6936  H  HA   . LEU E  1 43 ? 79.586 65.768 19.221  1.00 43.51  ?  43   LEU E HA   1 
ATOM   6937  H  HB2  . LEU E  1 43 ? 81.013 66.511 20.901  1.00 45.06  ?  43   LEU E HB2  1 
ATOM   6938  H  HB3  . LEU E  1 43 ? 81.322 67.832 20.085  1.00 45.06  ?  43   LEU E HB3  1 
ATOM   6939  H  HG   . LEU E  1 43 ? 79.180 68.611 20.492  1.00 43.08  ?  43   LEU E HG   1 
ATOM   6940  H  HD11 . LEU E  1 43 ? 78.715 66.233 21.912  1.00 41.79  ?  43   LEU E HD11 1 
ATOM   6941  H  HD12 . LEU E  1 43 ? 77.700 67.432 21.839  1.00 41.79  ?  43   LEU E HD12 1 
ATOM   6942  H  HD13 . LEU E  1 43 ? 78.031 66.602 20.545  1.00 41.79  ?  43   LEU E HD13 1 
ATOM   6943  H  HD21 . LEU E  1 43 ? 80.760 69.157 22.095  1.00 43.20  ?  43   LEU E HD21 1 
ATOM   6944  H  HD22 . LEU E  1 43 ? 79.358 68.978 22.783  1.00 43.20  ?  43   LEU E HD22 1 
ATOM   6945  H  HD23 . LEU E  1 43 ? 80.435 67.837 22.885  1.00 43.20  ?  43   LEU E HD23 1 
ATOM   6946  N  N    . TRP E  1 44 ? 78.297 67.238 17.767  1.00 29.56  ?  44   TRP E N    1 
ATOM   6947  C  CA   . TRP E  1 44 ? 77.533 68.146 16.924  1.00 28.06  ?  44   TRP E CA   1 
ATOM   6948  C  C    . TRP E  1 44 ? 76.174 68.432 17.546  1.00 26.92  ?  44   TRP E C    1 
ATOM   6949  O  O    . TRP E  1 44 ? 75.620 67.599 18.262  1.00 23.79  ?  44   TRP E O    1 
ATOM   6950  C  CB   . TRP E  1 44 ? 77.328 67.554 15.528  1.00 29.31  ?  44   TRP E CB   1 
ATOM   6951  C  CG   . TRP E  1 44 ? 78.596 67.241 14.804  1.00 30.77  ?  44   TRP E CG   1 
ATOM   6952  C  CD1  . TRP E  1 44 ? 79.498 68.135 14.302  1.00 32.99  ?  44   TRP E CD1  1 
ATOM   6953  C  CD2  . TRP E  1 44 ? 79.101 65.940 14.485  1.00 31.03  ?  44   TRP E CD2  1 
ATOM   6954  N  NE1  . TRP E  1 44 ? 80.534 67.469 13.693  1.00 34.00  ?  44   TRP E NE1  1 
ATOM   6955  C  CE2  . TRP E  1 44 ? 80.314 66.120 13.792  1.00 32.62  ?  44   TRP E CE2  1 
ATOM   6956  C  CE3  . TRP E  1 44 ? 78.644 64.639 14.719  1.00 29.08  ?  44   TRP E CE3  1 
ATOM   6957  C  CZ2  . TRP E  1 44 ? 81.079 65.049 13.335  1.00 33.60  ?  44   TRP E CZ2  1 
ATOM   6958  C  CZ3  . TRP E  1 44 ? 79.403 63.577 14.262  1.00 30.29  ?  44   TRP E CZ3  1 
ATOM   6959  C  CH2  . TRP E  1 44 ? 80.607 63.788 13.579  1.00 32.44  ?  44   TRP E CH2  1 
ATOM   6960  H  H    . TRP E  1 44 ? 77.848 66.561 18.050  1.00 35.48  ?  44   TRP E H    1 
ATOM   6961  H  HA   . TRP E  1 44 ? 78.017 68.994 16.833  1.00 33.67  ?  44   TRP E HA   1 
ATOM   6962  H  HB2  . TRP E  1 44 ? 76.824 66.730 15.611  1.00 35.17  ?  44   TRP E HB2  1 
ATOM   6963  H  HB3  . TRP E  1 44 ? 76.830 68.190 14.991  1.00 35.17  ?  44   TRP E HB3  1 
ATOM   6964  H  HD1  . TRP E  1 44 ? 79.422 69.060 14.363  1.00 39.59  ?  44   TRP E HD1  1 
ATOM   6965  H  HE1  . TRP E  1 44 ? 81.212 67.839 13.314  1.00 40.79  ?  44   TRP E HE1  1 
ATOM   6966  H  HE3  . TRP E  1 44 ? 77.846 64.491 15.173  1.00 34.90  ?  44   TRP E HE3  1 
ATOM   6967  H  HZ2  . TRP E  1 44 ? 81.878 65.186 12.880  1.00 40.32  ?  44   TRP E HZ2  1 
ATOM   6968  H  HZ3  . TRP E  1 44 ? 79.110 62.707 14.414  1.00 36.35  ?  44   TRP E HZ3  1 
ATOM   6969  H  HH2  . TRP E  1 44 ? 81.097 63.055 13.284  1.00 38.93  ?  44   TRP E HH2  1 
ATOM   6970  N  N    . ARG E  1 45 ? 75.641 69.614 17.263  1.00 32.50  ?  45   ARG E N    1 
ATOM   6971  C  CA   . ARG E  1 45 ? 74.309 69.981 17.716  1.00 32.81  ?  45   ARG E CA   1 
ATOM   6972  C  C    . ARG E  1 45 ? 73.253 69.389 16.794  1.00 31.96  ?  45   ARG E C    1 
ATOM   6973  O  O    . ARG E  1 45 ? 73.395 69.426 15.571  1.00 32.55  ?  45   ARG E O    1 
ATOM   6974  C  CB   . ARG E  1 45 ? 74.159 71.504 17.747  1.00 33.20  ?  45   ARG E CB   1 
ATOM   6975  C  CG   . ARG E  1 45 ? 72.743 71.979 18.036  1.00 33.32  ?  45   ARG E CG   1 
ATOM   6976  C  CD   . ARG E  1 45 ? 72.315 71.598 19.443  1.00 33.55  ?  45   ARG E CD   1 
ATOM   6977  N  NE   . ARG E  1 45 ? 72.801 72.553 20.434  1.00 35.40  ?  45   ARG E NE   1 
ATOM   6978  C  CZ   . ARG E  1 45 ? 72.988 72.276 21.722  1.00 36.51  ?  45   ARG E CZ   1 
ATOM   6979  N  NH1  . ARG E  1 45 ? 72.746 71.061 22.195  1.00 35.28  ?  45   ARG E NH1  1 
ATOM   6980  N  NH2  . ARG E  1 45 ? 73.429 73.220 22.540  1.00 38.97  ?  45   ARG E NH2  1 
ATOM   6981  H  H    . ARG E  1 45 ? 76.035 70.226 16.806  1.00 39.00  ?  45   ARG E H    1 
ATOM   6982  H  HA   . ARG E  1 45 ? 74.163 69.635 18.621  1.00 39.37  ?  45   ARG E HA   1 
ATOM   6983  H  HB2  . ARG E  1 45 ? 74.738 71.860 18.438  1.00 39.84  ?  45   ARG E HB2  1 
ATOM   6984  H  HB3  . ARG E  1 45 ? 74.421 71.860 16.883  1.00 39.84  ?  45   ARG E HB3  1 
ATOM   6985  H  HG2  . ARG E  1 45 ? 72.705 72.945 17.956  1.00 39.99  ?  45   ARG E HG2  1 
ATOM   6986  H  HG3  . ARG E  1 45 ? 72.130 71.564 17.409  1.00 39.99  ?  45   ARG E HG3  1 
ATOM   6987  H  HD2  . ARG E  1 45 ? 71.346 71.582 19.489  1.00 40.26  ?  45   ARG E HD2  1 
ATOM   6988  H  HD3  . ARG E  1 45 ? 72.676 70.725 19.661  1.00 40.26  ?  45   ARG E HD3  1 
ATOM   6989  H  HE   . ARG E  1 45 ? 72.980 73.350 20.167  1.00 42.48  ?  45   ARG E HE   1 
ATOM   6990  H  HH11 . ARG E  1 45 ? 72.458 70.444 21.669  1.00 42.33  ?  45   ARG E HH11 1 
ATOM   6991  H  HH12 . ARG E  1 45 ? 72.872 70.891 23.029  1.00 42.33  ?  45   ARG E HH12 1 
ATOM   6992  H  HH21 . ARG E  1 45 ? 73.591 74.009 22.239  1.00 46.76  ?  45   ARG E HH21 1 
ATOM   6993  H  HH22 . ARG E  1 45 ? 73.555 73.043 23.372  1.00 46.76  ?  45   ARG E HH22 1 
ATOM   6994  N  N    . THR E  1 46 ? 72.198 68.839 17.384  1.00 32.22  ?  46   THR E N    1 
ATOM   6995  C  CA   . THR E  1 46 ? 71.051 68.381 16.613  1.00 32.97  ?  46   THR E CA   1 
ATOM   6996  C  C    . THR E  1 46 ? 70.195 69.582 16.233  1.00 31.01  ?  46   THR E C    1 
ATOM   6997  O  O    . THR E  1 46 ? 69.433 70.098 17.051  1.00 31.87  ?  46   THR E O    1 
ATOM   6998  C  CB   . THR E  1 46 ? 70.197 67.372 17.403  1.00 35.85  ?  46   THR E CB   1 
ATOM   6999  O  OG1  . THR E  1 46 ? 70.071 67.802 18.764  1.00 38.45  ?  46   THR E OG1  1 
ATOM   7000  C  CG2  . THR E  1 46 ? 70.839 66.005 17.370  1.00 36.45  ?  46   THR E CG2  1 
ATOM   7001  H  H    . THR E  1 46 ? 72.122 68.720 18.232  1.00 38.66  ?  46   THR E H    1 
ATOM   7002  H  HA   . THR E  1 46 ? 71.361 67.949 15.790  1.00 39.57  ?  46   THR E HA   1 
ATOM   7003  H  HB   . THR E  1 46 ? 69.317 67.308 17.001  1.00 43.01  ?  46   THR E HB   1 
ATOM   7004  H  HG1  . THR E  1 46 ? 69.710 68.537 18.794  1.00 46.14  ?  46   THR E HG1  1 
ATOM   7005  H  HG21 . THR E  1 46 ? 71.714 66.045 17.762  1.00 43.74  ?  46   THR E HG21 1 
ATOM   7006  H  HG22 . THR E  1 46 ? 70.303 65.380 17.863  1.00 43.74  ?  46   THR E HG22 1 
ATOM   7007  H  HG23 . THR E  1 46 ? 70.916 65.702 16.462  1.00 43.74  ?  46   THR E HG23 1 
ATOM   7008  N  N    . THR E  1 47 ? 70.331 70.020 14.986  1.00 27.59  ?  47   THR E N    1 
ATOM   7009  C  CA   . THR E  1 47 ? 69.671 71.234 14.513  1.00 26.52  ?  47   THR E CA   1 
ATOM   7010  C  C    . THR E  1 47 ? 68.186 71.255 14.880  1.00 26.87  ?  47   THR E C    1 
ATOM   7011  O  O    . THR E  1 47 ? 67.455 70.303 14.608  1.00 26.52  ?  47   THR E O    1 
ATOM   7012  C  CB   . THR E  1 47 ? 69.829 71.389 12.984  1.00 25.71  ?  47   THR E CB   1 
ATOM   7013  O  OG1  . THR E  1 47 ? 71.218 71.534 12.653  1.00 25.33  ?  47   THR E OG1  1 
ATOM   7014  C  CG2  . THR E  1 47 ? 69.071 72.610 12.484  1.00 26.94  ?  47   THR E CG2  1 
ATOM   7015  H  H    . THR E  1 47 ? 70.806 69.628 14.387  1.00 33.10  ?  47   THR E H    1 
ATOM   7016  H  HA   . THR E  1 47 ? 70.094 72.008 14.937  1.00 31.82  ?  47   THR E HA   1 
ATOM   7017  H  HB   . THR E  1 47 ? 69.471 70.603 12.541  1.00 30.85  ?  47   THR E HB   1 
ATOM   7018  H  HG1  . THR E  1 47 ? 71.636 70.873 12.899  1.00 30.39  ?  47   THR E HG1  1 
ATOM   7019  H  HG21 . THR E  1 47 ? 69.409 73.402 12.908  1.00 32.32  ?  47   THR E HG21 1 
ATOM   7020  H  HG22 . THR E  1 47 ? 69.177 72.695 11.534  1.00 32.32  ?  47   THR E HG22 1 
ATOM   7021  H  HG23 . THR E  1 47 ? 68.137 72.522 12.687  1.00 32.32  ?  47   THR E HG23 1 
ATOM   7022  N  N    . GLY E  1 48 ? 67.750 72.353 15.493  1.00 30.58  ?  48   GLY E N    1 
ATOM   7023  C  CA   . GLY E  1 48 ? 66.376 72.501 15.943  1.00 32.59  ?  48   GLY E CA   1 
ATOM   7024  C  C    . GLY E  1 48 ? 66.014 71.766 17.224  1.00 33.04  ?  48   GLY E C    1 
ATOM   7025  O  O    . GLY E  1 48 ? 64.853 71.780 17.636  1.00 35.81  ?  48   GLY E O    1 
ATOM   7026  H  H    . GLY E  1 48 ? 68.243 73.037 15.661  1.00 36.70  ?  48   GLY E H    1 
ATOM   7027  H  HA2  . GLY E  1 48 ? 66.195 73.444 16.082  1.00 39.11  ?  48   GLY E HA2  1 
ATOM   7028  H  HA3  . GLY E  1 48 ? 65.784 72.184 15.243  1.00 39.11  ?  48   GLY E HA3  1 
ATOM   7029  N  N    . LYS E  1 49 ? 66.990 71.129 17.865  1.00 29.59  ?  49   LYS E N    1 
ATOM   7030  C  CA   . LYS E  1 49 ? 66.710 70.323 19.051  1.00 29.38  ?  49   LYS E CA   1 
ATOM   7031  C  C    . LYS E  1 49 ? 67.725 70.535 20.172  1.00 30.58  ?  49   LYS E C    1 
ATOM   7032  O  O    . LYS E  1 49 ? 68.896 70.817 19.922  1.00 29.46  ?  49   LYS E O    1 
ATOM   7033  C  CB   . LYS E  1 49 ? 66.668 68.840 18.678  1.00 31.53  ?  49   LYS E CB   1 
ATOM   7034  C  CG   . LYS E  1 49 ? 65.420 68.433 17.914  1.00 34.72  ?  49   LYS E CG   1 
ATOM   7035  C  CD   . LYS E  1 49 ? 65.513 66.999 17.420  1.00 37.27  ?  49   LYS E CD   1 
ATOM   7036  C  CE   . LYS E  1 49 ? 64.231 66.560 16.729  1.00 37.24  ?  49   LYS E CE   1 
ATOM   7037  N  NZ   . LYS E  1 49 ? 63.093 66.408 17.683  1.00 36.44  ?  49   LYS E NZ   1 
ATOM   7038  H  H    . LYS E  1 49 ? 67.819 71.147 17.635  1.00 35.51  ?  49   LYS E H    1 
ATOM   7039  H  HA   . LYS E  1 49 ? 65.827 70.569 19.397  1.00 35.25  ?  49   LYS E HA   1 
ATOM   7040  H  HB2  . LYS E  1 49 ? 67.436 68.636 18.121  1.00 37.83  ?  49   LYS E HB2  1 
ATOM   7041  H  HB3  . LYS E  1 49 ? 66.703 68.312 19.491  1.00 37.83  ?  49   LYS E HB3  1 
ATOM   7042  H  HG2  . LYS E  1 49 ? 64.650 68.503 18.499  1.00 41.66  ?  49   LYS E HG2  1 
ATOM   7043  H  HG3  . LYS E  1 49 ? 65.312 69.013 17.145  1.00 41.66  ?  49   LYS E HG3  1 
ATOM   7044  H  HD2  . LYS E  1 49 ? 66.241 66.927 16.784  1.00 44.73  ?  49   LYS E HD2  1 
ATOM   7045  H  HD3  . LYS E  1 49 ? 65.668 66.411 18.175  1.00 44.73  ?  49   LYS E HD3  1 
ATOM   7046  H  HE2  . LYS E  1 49 ? 63.983 67.225 16.068  1.00 44.68  ?  49   LYS E HE2  1 
ATOM   7047  H  HE3  . LYS E  1 49 ? 64.380 65.703 16.299  1.00 44.68  ?  49   LYS E HE3  1 
ATOM   7048  H  HZ1  . LYS E  1 49 ? 62.930 67.183 18.088  1.00 43.73  ?  49   LYS E HZ1  1 
ATOM   7049  H  HZ2  . LYS E  1 49 ? 62.362 66.150 17.246  1.00 43.73  ?  49   LYS E HZ2  1 
ATOM   7050  H  HZ3  . LYS E  1 49 ? 63.292 65.796 18.299  1.00 43.73  ?  49   LYS E HZ3  1 
ATOM   7051  N  N    . TYR E  1 50 ? 67.259 70.397 21.410  1.00 33.79  ?  50   TYR E N    1 
ATOM   7052  C  CA   . TYR E  1 50 ? 68.136 70.455 22.571  1.00 36.89  ?  50   TYR E CA   1 
ATOM   7053  C  C    . TYR E  1 50 ? 68.760 69.082 22.768  1.00 36.44  ?  50   TYR E C    1 
ATOM   7054  O  O    . TYR E  1 50 ? 68.243 68.254 23.518  1.00 37.75  ?  50   TYR E O    1 
ATOM   7055  C  CB   . TYR E  1 50 ? 67.351 70.858 23.821  1.00 37.41  ?  50   TYR E CB   1 
ATOM   7056  C  CG   . TYR E  1 50 ? 68.205 71.411 24.945  1.00 40.09  ?  50   TYR E CG   1 
ATOM   7057  C  CD1  . TYR E  1 50 ? 69.585 71.238 24.955  1.00 41.81  ?  50   TYR E CD1  1 
ATOM   7058  C  CD2  . TYR E  1 50 ? 67.628 72.111 25.996  1.00 40.96  ?  50   TYR E CD2  1 
ATOM   7059  C  CE1  . TYR E  1 50 ? 70.363 71.748 25.981  1.00 44.98  ?  50   TYR E CE1  1 
ATOM   7060  C  CE2  . TYR E  1 50 ? 68.397 72.625 27.025  1.00 44.19  ?  50   TYR E CE2  1 
ATOM   7061  C  CZ   . TYR E  1 50 ? 69.763 72.439 27.014  1.00 45.95  ?  50   TYR E CZ   1 
ATOM   7062  O  OH   . TYR E  1 50 ? 70.531 72.946 28.038  1.00 48.59  ?  50   TYR E OH   1 
ATOM   7063  H  H    . TYR E  1 50 ? 66.431 70.269 21.604  1.00 40.55  ?  50   TYR E H    1 
ATOM   7064  H  HA   . TYR E  1 50 ? 68.849 71.109 22.418  1.00 44.26  ?  50   TYR E HA   1 
ATOM   7065  H  HB2  . TYR E  1 50 ? 66.708 71.542 23.576  1.00 44.89  ?  50   TYR E HB2  1 
ATOM   7066  H  HB3  . TYR E  1 50 ? 66.886 70.078 24.161  1.00 44.89  ?  50   TYR E HB3  1 
ATOM   7067  H  HD1  . TYR E  1 50 ? 69.992 70.773 24.261  1.00 50.17  ?  50   TYR E HD1  1 
ATOM   7068  H  HD2  . TYR E  1 50 ? 66.706 72.239 26.008  1.00 49.15  ?  50   TYR E HD2  1 
ATOM   7069  H  HE1  . TYR E  1 50 ? 71.285 71.623 25.975  1.00 53.98  ?  50   TYR E HE1  1 
ATOM   7070  H  HE2  . TYR E  1 50 ? 67.994 73.090 27.722  1.00 53.03  ?  50   TYR E HE2  1 
ATOM   7071  H  HH   . TYR E  1 50 ? 70.296 72.621 28.753  1.00 58.30  ?  50   TYR E HH   1 
ATOM   7072  N  N    . GLY E  1 51 ? 69.868 68.842 22.078  1.00 34.22  ?  51   GLY E N    1 
ATOM   7073  C  CA   . GLY E  1 51 ? 70.548 67.564 22.144  1.00 33.43  ?  51   GLY E CA   1 
ATOM   7074  C  C    . GLY E  1 51 ? 71.760 67.551 21.238  1.00 32.87  ?  51   GLY E C    1 
ATOM   7075  O  O    . GLY E  1 51 ? 72.109 68.569 20.644  1.00 34.89  ?  51   GLY E O    1 
ATOM   7076  H  H    . GLY E  1 51 ? 70.248 69.413 21.559  1.00 41.06  ?  51   GLY E H    1 
ATOM   7077  H  HA2  . GLY E  1 51 ? 70.837 67.392 23.054  1.00 40.12  ?  51   GLY E HA2  1 
ATOM   7078  H  HA3  . GLY E  1 51 ? 69.945 66.856 21.869  1.00 40.12  ?  51   GLY E HA3  1 
ATOM   7079  N  N    . ASN E  1 52 ? 72.407 66.398 21.125  1.00 28.51  ?  52   ASN E N    1 
ATOM   7080  C  CA   . ASN E  1 52 ? 73.590 66.284 20.284  1.00 26.53  ?  52   ASN E CA   1 
ATOM   7081  C  C    . ASN E  1 52 ? 73.713 64.909 19.650  1.00 25.27  ?  52   ASN E C    1 
ATOM   7082  O  O    . ASN E  1 52 ? 73.110 63.945 20.120  1.00 22.78  ?  52   ASN E O    1 
ATOM   7083  C  CB   . ASN E  1 52 ? 74.849 66.560 21.107  1.00 28.43  ?  52   ASN E CB   1 
ATOM   7084  C  CG   . ASN E  1 52 ? 75.160 65.442 22.087  1.00 29.67  ?  52   ASN E CG   1 
ATOM   7085  O  OD1  . ASN E  1 52 ? 75.670 64.389 21.701  1.00 30.76  ?  52   ASN E OD1  1 
ATOM   7086  N  ND2  . ASN E  1 52 ? 74.858 65.668 23.361  1.00 30.10  ?  52   ASN E ND2  1 
ATOM   7087  H  H    . ASN E  1 52 ? 72.183 65.670 21.523  1.00 34.21  ?  52   ASN E H    1 
ATOM   7088  H  HA   . ASN E  1 52 ? 73.541 66.949 19.566  1.00 31.84  ?  52   ASN E HA   1 
ATOM   7089  H  HB2  . ASN E  1 52 ? 75.606 66.654 20.508  1.00 34.12  ?  52   ASN E HB2  1 
ATOM   7090  H  HB3  . ASN E  1 52 ? 74.723 67.377 21.614  1.00 34.12  ?  52   ASN E HB3  1 
ATOM   7091  H  HD21 . ASN E  1 52 ? 74.506 66.417 23.594  1.00 36.12  ?  52   ASN E HD21 1 
ATOM   7092  H  HD22 . ASN E  1 52 ? 75.016 65.065 23.954  1.00 36.12  ?  52   ASN E HD22 1 
ATOM   7093  N  N    . ILE E  1 53 ? 74.483 64.837 18.569  1.00 27.43  ?  53   ILE E N    1 
ATOM   7094  C  CA   . ILE E  1 53 ? 74.996 63.568 18.072  1.00 29.06  ?  53   ILE E CA   1 
ATOM   7095  C  C    . ILE E  1 53 ? 76.485 63.556 18.355  1.00 30.17  ?  53   ILE E C    1 
ATOM   7096  O  O    . ILE E  1 53 ? 77.191 64.514 18.044  1.00 29.86  ?  53   ILE E O    1 
ATOM   7097  C  CB   . ILE E  1 53 ? 74.773 63.376 16.560  1.00 30.91  ?  53   ILE E CB   1 
ATOM   7098  C  CG1  . ILE E  1 53 ? 73.419 62.726 16.302  1.00 35.52  ?  53   ILE E CG1  1 
ATOM   7099  C  CG2  . ILE E  1 53 ? 75.846 62.477 15.971  1.00 29.11  ?  53   ILE E CG2  1 
ATOM   7100  C  CD1  . ILE E  1 53 ? 72.268 63.617 16.608  1.00 38.82  ?  53   ILE E CD1  1 
ATOM   7101  H  H    . ILE E  1 53 ? 74.725 65.517 18.102  1.00 32.92  ?  53   ILE E H    1 
ATOM   7102  H  HA   . ILE E  1 53 ? 74.575 62.826 18.553  1.00 34.87  ?  53   ILE E HA   1 
ATOM   7103  H  HB   . ILE E  1 53 ? 74.802 64.240 16.120  1.00 37.10  ?  53   ILE E HB   1 
ATOM   7104  H  HG12 . ILE E  1 53 ? 73.363 62.478 15.366  1.00 42.63  ?  53   ILE E HG12 1 
ATOM   7105  H  HG13 . ILE E  1 53 ? 73.339 61.936 16.859  1.00 42.63  ?  53   ILE E HG13 1 
ATOM   7106  H  HG21 . ILE E  1 53 ? 75.810 61.622 16.406  1.00 34.93  ?  53   ILE E HG21 1 
ATOM   7107  H  HG22 . ILE E  1 53 ? 75.685 62.373 15.031  1.00 34.93  ?  53   ILE E HG22 1 
ATOM   7108  H  HG23 . ILE E  1 53 ? 76.705 62.881 16.114  1.00 34.93  ?  53   ILE E HG23 1 
ATOM   7109  H  HD11 . ILE E  1 53 ? 72.326 64.402 16.057  1.00 46.58  ?  53   ILE E HD11 1 
ATOM   7110  H  HD12 . ILE E  1 53 ? 71.452 63.147 16.424  1.00 46.58  ?  53   ILE E HD12 1 
ATOM   7111  H  HD13 . ILE E  1 53 ? 72.302 63.865 17.535  1.00 46.58  ?  53   ILE E HD13 1 
ATOM   7112  N  N    . SER E  1 54 ? 76.958 62.469 18.948  1.00 27.68  ?  54   SER E N    1 
ATOM   7113  C  CA   . SER E  1 54 ? 78.350 62.368 19.340  1.00 29.53  ?  54   SER E CA   1 
ATOM   7114  C  C    . SER E  1 54 ? 78.944 61.046 18.897  1.00 29.21  ?  54   SER E C    1 
ATOM   7115  O  O    . SER E  1 54 ? 78.230 60.061 18.711  1.00 29.72  ?  54   SER E O    1 
ATOM   7116  C  CB   . SER E  1 54 ? 78.475 62.490 20.859  1.00 29.79  ?  54   SER E CB   1 
ATOM   7117  O  OG   . SER E  1 54 ? 78.074 63.773 21.303  1.00 29.45  ?  54   SER E OG   1 
ATOM   7118  H  H    . SER E  1 54 ? 76.488 61.773 19.134  1.00 33.22  ?  54   SER E H    1 
ATOM   7119  H  HA   . SER E  1 54 ? 78.861 63.095 18.926  1.00 35.43  ?  54   SER E HA   1 
ATOM   7120  H  HB2  . SER E  1 54 ? 77.909 61.821 21.276  1.00 35.75  ?  54   SER E HB2  1 
ATOM   7121  H  HB3  . SER E  1 54 ? 79.400 62.344 21.111  1.00 35.75  ?  54   SER E HB3  1 
ATOM   7122  H  HG   . SER E  1 54 ? 78.147 63.822 22.119  1.00 35.34  ?  54   SER E HG   1 
ATOM   7123  N  N    . VAL E  1 55 ? 80.259 61.037 18.722  1.00 28.72  ?  55   VAL E N    1 
ATOM   7124  C  CA   . VAL E  1 55 ? 80.988 59.800 18.516  1.00 30.01  ?  55   VAL E CA   1 
ATOM   7125  C  C    . VAL E  1 55 ? 81.984 59.631 19.654  1.00 32.99  ?  55   VAL E C    1 
ATOM   7126  O  O    . VAL E  1 55 ? 82.870 60.463 19.846  1.00 33.54  ?  55   VAL E O    1 
ATOM   7127  C  CB   . VAL E  1 55 ? 81.737 59.789 17.176  1.00 29.96  ?  55   VAL E CB   1 
ATOM   7128  C  CG1  . VAL E  1 55 ? 82.602 58.539 17.066  1.00 31.01  ?  55   VAL E CG1  1 
ATOM   7129  C  CG2  . VAL E  1 55 ? 80.750 59.869 16.020  1.00 30.21  ?  55   VAL E CG2  1 
ATOM   7130  H  H    . VAL E  1 55 ? 80.753 61.741 18.719  1.00 34.46  ?  55   VAL E H    1 
ATOM   7131  H  HA   . VAL E  1 55 ? 80.364 59.044 18.531  1.00 36.01  ?  55   VAL E HA   1 
ATOM   7132  H  HB   . VAL E  1 55 ? 82.324 60.572 17.130  1.00 35.95  ?  55   VAL E HB   1 
ATOM   7133  H  HG11 . VAL E  1 55 ? 82.039 57.764 17.121  1.00 37.21  ?  55   VAL E HG11 1 
ATOM   7134  H  HG12 . VAL E  1 55 ? 83.061 58.551 16.222  1.00 37.21  ?  55   VAL E HG12 1 
ATOM   7135  H  HG13 . VAL E  1 55 ? 83.238 58.535 17.785  1.00 37.21  ?  55   VAL E HG13 1 
ATOM   7136  H  HG21 . VAL E  1 55 ? 80.246 60.683 16.096  1.00 36.26  ?  55   VAL E HG21 1 
ATOM   7137  H  HG22 . VAL E  1 55 ? 81.237 59.861 15.193  1.00 36.26  ?  55   VAL E HG22 1 
ATOM   7138  H  HG23 . VAL E  1 55 ? 80.160 59.113 16.061  1.00 36.26  ?  55   VAL E HG23 1 
ATOM   7139  N  N    . PHE E  1 56 ? 81.820 58.560 20.420  1.00 34.49  ?  56   PHE E N    1 
ATOM   7140  C  CA   . PHE E  1 56 ? 82.724 58.275 21.522  1.00 37.73  ?  56   PHE E CA   1 
ATOM   7141  C  C    . PHE E  1 56 ? 83.722 57.210 21.109  1.00 39.84  ?  56   PHE E C    1 
ATOM   7142  O  O    . PHE E  1 56 ? 83.406 56.325 20.313  1.00 41.62  ?  56   PHE E O    1 
ATOM   7143  C  CB   . PHE E  1 56 ? 81.947 57.822 22.757  1.00 36.22  ?  56   PHE E CB   1 
ATOM   7144  C  CG   . PHE E  1 56 ? 81.297 58.949 23.507  1.00 35.19  ?  56   PHE E CG   1 
ATOM   7145  C  CD1  . PHE E  1 56 ? 80.051 59.422 23.132  1.00 33.24  ?  56   PHE E CD1  1 
ATOM   7146  C  CD2  . PHE E  1 56 ? 81.935 59.536 24.589  1.00 37.78  ?  56   PHE E CD2  1 
ATOM   7147  C  CE1  . PHE E  1 56 ? 79.453 60.459 23.823  1.00 33.13  ?  56   PHE E CE1  1 
ATOM   7148  C  CE2  . PHE E  1 56 ? 81.342 60.574 25.283  1.00 37.38  ?  56   PHE E CE2  1 
ATOM   7149  C  CZ   . PHE E  1 56 ? 80.100 61.037 24.899  1.00 35.47  ?  56   PHE E CZ   1 
ATOM   7150  H  H    . PHE E  1 56 ? 81.192 57.981 20.321  1.00 41.39  ?  56   PHE E H    1 
ATOM   7151  H  HA   . PHE E  1 56 ? 83.220 59.088 21.752  1.00 45.28  ?  56   PHE E HA   1 
ATOM   7152  H  HB2  . PHE E  1 56 ? 81.248 57.209 22.480  1.00 43.46  ?  56   PHE E HB2  1 
ATOM   7153  H  HB3  . PHE E  1 56 ? 82.557 57.374 23.364  1.00 43.46  ?  56   PHE E HB3  1 
ATOM   7154  H  HD1  . PHE E  1 56 ? 79.612 59.037 22.408  1.00 39.88  ?  56   PHE E HD1  1 
ATOM   7155  H  HD2  . PHE E  1 56 ? 82.773 59.228 24.851  1.00 45.34  ?  56   PHE E HD2  1 
ATOM   7156  H  HE1  . PHE E  1 56 ? 78.616 60.769 23.562  1.00 39.75  ?  56   PHE E HE1  1 
ATOM   7157  H  HE2  . PHE E  1 56 ? 81.779 60.960 26.007  1.00 44.85  ?  56   PHE E HE2  1 
ATOM   7158  H  HZ   . PHE E  1 56 ? 79.699 61.734 25.365  1.00 42.57  ?  56   PHE E HZ   1 
ATOM   7159  N  N    . ASP E  1 57 ? 84.929 57.308 21.656  1.00 37.70  ?  57   ASP E N    1 
ATOM   7160  C  CA   . ASP E  1 57 ? 86.000 56.376 21.343  1.00 39.94  ?  57   ASP E CA   1 
ATOM   7161  C  C    . ASP E  1 57 ? 86.606 55.850 22.638  1.00 41.21  ?  57   ASP E C    1 
ATOM   7162  O  O    . ASP E  1 57 ? 87.510 56.463 23.204  1.00 44.13  ?  57   ASP E O    1 
ATOM   7163  C  CB   . ASP E  1 57 ? 87.070 57.072 20.500  1.00 43.36  ?  57   ASP E CB   1 
ATOM   7164  C  CG   . ASP E  1 57 ? 88.285 56.200 20.261  1.00 48.64  ?  57   ASP E CG   1 
ATOM   7165  O  OD1  . ASP E  1 57 ? 88.124 54.966 20.151  1.00 47.92  ?  57   ASP E OD1  1 
ATOM   7166  O  OD2  . ASP E  1 57 ? 89.402 56.751 20.181  1.00 54.01  ?  57   ASP E OD2  1 
ATOM   7167  H  H    . ASP E  1 57 ? 85.153 57.916 22.220  1.00 45.24  ?  57   ASP E H    1 
ATOM   7168  H  HA   . ASP E  1 57 ? 85.642 55.620 20.834  1.00 47.92  ?  57   ASP E HA   1 
ATOM   7169  H  HB2  . ASP E  1 57 ? 86.691 57.303 19.638  1.00 52.04  ?  57   ASP E HB2  1 
ATOM   7170  H  HB3  . ASP E  1 57 ? 87.362 57.874 20.960  1.00 52.04  ?  57   ASP E HB3  1 
ATOM   7171  N  N    . VAL E  1 58 ? 86.097 54.713 23.105  1.00 38.12  ?  58   VAL E N    1 
ATOM   7172  C  CA   . VAL E  1 58 ? 86.533 54.140 24.372  1.00 38.26  ?  58   VAL E CA   1 
ATOM   7173  C  C    . VAL E  1 58 ? 86.878 52.662 24.212  1.00 39.09  ?  58   VAL E C    1 
ATOM   7174  O  O    . VAL E  1 58 ? 86.663 52.080 23.151  1.00 37.24  ?  58   VAL E O    1 
ATOM   7175  C  CB   . VAL E  1 58 ? 85.453 54.300 25.455  1.00 37.17  ?  58   VAL E CB   1 
ATOM   7176  C  CG1  . VAL E  1 58 ? 85.256 55.770 25.789  1.00 35.89  ?  58   VAL E CG1  1 
ATOM   7177  C  CG2  . VAL E  1 58 ? 84.147 53.672 25.002  1.00 36.69  ?  58   VAL E CG2  1 
ATOM   7178  H  H    . VAL E  1 58 ? 85.493 54.252 22.702  1.00 45.75  ?  58   VAL E H    1 
ATOM   7179  H  HA   . VAL E  1 58 ? 87.339 54.609 24.674  1.00 45.91  ?  58   VAL E HA   1 
ATOM   7180  H  HB   . VAL E  1 58 ? 85.745 53.840 26.270  1.00 44.60  ?  58   VAL E HB   1 
ATOM   7181  H  HG11 . VAL E  1 58 ? 84.982 56.236 24.996  1.00 43.07  ?  58   VAL E HG11 1 
ATOM   7182  H  HG12 . VAL E  1 58 ? 84.579 55.849 26.466  1.00 43.07  ?  58   VAL E HG12 1 
ATOM   7183  H  HG13 . VAL E  1 58 ? 86.085 56.131 26.111  1.00 43.07  ?  58   VAL E HG13 1 
ATOM   7184  H  HG21 . VAL E  1 58 ? 84.291 52.738 24.835  1.00 44.03  ?  58   VAL E HG21 1 
ATOM   7185  H  HG22 . VAL E  1 58 ? 83.490 53.785 25.693  1.00 44.03  ?  58   VAL E HG22 1 
ATOM   7186  H  HG23 . VAL E  1 58 ? 83.854 54.107 24.197  1.00 44.03  ?  58   VAL E HG23 1 
ATOM   7187  N  N    . ASN E  1 59 ? 87.404 52.059 25.273  1.00 40.85  ?  59   ASN E N    1 
ATOM   7188  C  CA   . ASN E  1 59 ? 87.939 50.704 25.194  1.00 45.53  ?  59   ASN E CA   1 
ATOM   7189  C  C    . ASN E  1 59 ? 86.943 49.598 25.540  1.00 44.05  ?  59   ASN E C    1 
ATOM   7190  O  O    . ASN E  1 59 ? 87.229 48.421 25.316  1.00 48.95  ?  59   ASN E O    1 
ATOM   7191  C  CB   . ASN E  1 59 ? 89.170 50.575 26.096  1.00 50.49  ?  59   ASN E CB   1 
ATOM   7192  C  CG   . ASN E  1 59 ? 90.267 51.557 25.730  1.00 54.28  ?  59   ASN E CG   1 
ATOM   7193  O  OD1  . ASN E  1 59 ? 90.713 52.345 26.564  1.00 56.28  ?  59   ASN E OD1  1 
ATOM   7194  N  ND2  . ASN E  1 59 ? 90.707 51.516 24.477  1.00 55.49  ?  59   ASN E ND2  1 
ATOM   7195  H  H    . ASN E  1 59 ? 87.463 52.414 26.054  1.00 49.01  ?  59   ASN E H    1 
ATOM   7196  H  HA   . ASN E  1 59 ? 88.235 50.547 24.273  1.00 54.63  ?  59   ASN E HA   1 
ATOM   7197  H  HB2  . ASN E  1 59 ? 88.909 50.745 27.014  1.00 60.59  ?  59   ASN E HB2  1 
ATOM   7198  H  HB3  . ASN E  1 59 ? 89.530 49.678 26.013  1.00 60.59  ?  59   ASN E HB3  1 
ATOM   7199  H  HD21 . ASN E  1 59 ? 90.371 50.952 23.921  1.00 66.59  ?  59   ASN E HD21 1 
ATOM   7200  H  HD22 . ASN E  1 59 ? 91.328 52.053 24.221  1.00 66.59  ?  59   ASN E HD22 1 
ATOM   7201  N  N    . SER E  1 60 ? 85.783 49.958 26.083  1.00 39.92  ?  60   SER E N    1 
ATOM   7202  C  CA   . SER E  1 60 ? 84.792 48.950 26.459  1.00 36.11  ?  60   SER E CA   1 
ATOM   7203  C  C    . SER E  1 60 ? 83.405 49.544 26.665  1.00 33.68  ?  60   SER E C    1 
ATOM   7204  O  O    . SER E  1 60 ? 83.258 50.752 26.854  1.00 31.13  ?  60   SER E O    1 
ATOM   7205  C  CB   . SER E  1 60 ? 85.222 48.240 27.744  1.00 37.17  ?  60   SER E CB   1 
ATOM   7206  O  OG   . SER E  1 60 ? 84.984 49.060 28.877  1.00 36.44  ?  60   SER E OG   1 
ATOM   7207  H  H    . SER E  1 60 ? 85.546 50.769 26.243  1.00 47.90  ?  60   SER E H    1 
ATOM   7208  H  HA   . SER E  1 60 ? 84.733 48.279 25.746  1.00 43.33  ?  60   SER E HA   1 
ATOM   7209  H  HB2  . SER E  1 60 ? 84.715 47.419 27.837  1.00 44.60  ?  60   SER E HB2  1 
ATOM   7210  H  HB3  . SER E  1 60 ? 86.170 48.040 27.693  1.00 44.60  ?  60   SER E HB3  1 
ATOM   7211  H  HG   . SER E  1 60 ? 85.218 48.670 29.559  1.00 43.73  ?  60   SER E HG   1 
ATOM   7212  N  N    . HIS E  1 61 ? 82.391 48.684 26.630  1.00 43.76  ?  61   HIS E N    1 
ATOM   7213  C  CA   . HIS E  1 61 ? 81.030 49.094 26.951  1.00 41.25  ?  61   HIS E CA   1 
ATOM   7214  C  C    . HIS E  1 61 ? 81.008 49.687 28.354  1.00 42.98  ?  61   HIS E C    1 
ATOM   7215  O  O    . HIS E  1 61 ? 80.415 50.739 28.590  1.00 40.94  ?  61   HIS E O    1 
ATOM   7216  C  CB   . HIS E  1 61 ? 80.073 47.901 26.906  1.00 41.02  ?  61   HIS E CB   1 
ATOM   7217  C  CG   . HIS E  1 61 ? 79.994 47.226 25.573  1.00 40.58  ?  61   HIS E CG   1 
ATOM   7218  N  ND1  . HIS E  1 61 ? 80.303 47.860 24.389  1.00 39.03  ?  61   HIS E ND1  1 
ATOM   7219  C  CD2  . HIS E  1 61 ? 79.630 45.965 25.239  1.00 41.36  ?  61   HIS E CD2  1 
ATOM   7220  C  CE1  . HIS E  1 61 ? 80.133 47.019 23.384  1.00 37.50  ?  61   HIS E CE1  1 
ATOM   7221  N  NE2  . HIS E  1 61 ? 79.726 45.861 23.873  1.00 38.87  ?  61   HIS E NE2  1 
ATOM   7222  H  H    . HIS E  1 61 ? 82.467 47.853 26.421  1.00 52.51  ?  61   HIS E H    1 
ATOM   7223  H  HA   . HIS E  1 61 ? 80.725 49.773 26.313  1.00 49.50  ?  61   HIS E HA   1 
ATOM   7224  H  HB2  . HIS E  1 61 ? 80.368 47.242 27.554  1.00 49.23  ?  61   HIS E HB2  1 
ATOM   7225  H  HB3  . HIS E  1 61 ? 79.182 48.208 27.135  1.00 49.23  ?  61   HIS E HB3  1 
ATOM   7226  H  HD1  . HIS E  1 61 ? 80.563 48.676 24.315  1.00 46.84  ?  61   HIS E HD1  1 
ATOM   7227  H  HD2  . HIS E  1 61 ? 79.364 45.293 25.825  1.00 49.63  ?  61   HIS E HD2  1 
ATOM   7228  H  HE1  . HIS E  1 61 ? 80.278 47.208 22.485  1.00 45.00  ?  61   HIS E HE1  1 
ATOM   7229  H  HE2  . HIS E  1 61 ? 79.551 45.158 23.411  1.00 46.64  ?  61   HIS E HE2  1 
ATOM   7230  N  N    . ASP E  1 62 ? 81.660 48.996 29.284  1.00 39.46  ?  62   ASP E N    1 
ATOM   7231  C  CA   . ASP E  1 62 ? 81.691 49.422 30.678  1.00 42.02  ?  62   ASP E CA   1 
ATOM   7232  C  C    . ASP E  1 62 ? 82.224 50.844 30.802  1.00 41.47  ?  62   ASP E C    1 
ATOM   7233  O  O    . ASP E  1 62 ? 81.650 51.671 31.510  1.00 39.48  ?  62   ASP E O    1 
ATOM   7234  C  CB   . ASP E  1 62 ? 82.551 48.470 31.512  1.00 49.68  ?  62   ASP E CB   1 
ATOM   7235  C  CG   . ASP E  1 62 ? 81.991 47.062 31.554  1.00 53.70  ?  62   ASP E CG   1 
ATOM   7236  O  OD1  . ASP E  1 62 ? 80.785 46.892 31.278  1.00 51.86  ?  62   ASP E OD1  1 
ATOM   7237  O  OD2  . ASP E  1 62 ? 82.756 46.126 31.869  1.00 59.16  ?  62   ASP E OD2  1 
ATOM   7238  H  H    . ASP E  1 62 ? 82.096 48.271 29.131  1.00 47.35  ?  62   ASP E H    1 
ATOM   7239  H  HA   . ASP E  1 62 ? 80.780 49.406 31.039  1.00 50.42  ?  62   ASP E HA   1 
ATOM   7240  H  HB2  . ASP E  1 62 ? 83.441 48.428 31.127  1.00 59.61  ?  62   ASP E HB2  1 
ATOM   7241  H  HB3  . ASP E  1 62 ? 82.599 48.801 32.422  1.00 59.61  ?  62   ASP E HB3  1 
ATOM   7242  N  N    . GLU E  1 63 ? 83.324 51.124 30.111  1.00 42.27  ?  63   GLU E N    1 
ATOM   7243  C  CA   . GLU E  1 63 ? 83.919 52.452 30.138  1.00 45.38  ?  63   GLU E CA   1 
ATOM   7244  C  C    . GLU E  1 63 ? 82.925 53.492 29.628  1.00 40.48  ?  63   GLU E C    1 
ATOM   7245  O  O    . GLU E  1 63 ? 82.768 54.555 30.227  1.00 42.65  ?  63   GLU E O    1 
ATOM   7246  C  CB   . GLU E  1 63 ? 85.198 52.490 29.298  1.00 50.28  ?  63   GLU E CB   1 
ATOM   7247  C  CG   . GLU E  1 63 ? 85.886 53.847 29.286  1.00 55.33  ?  63   GLU E CG   1 
ATOM   7248  C  CD   . GLU E  1 63 ? 87.212 53.828 28.545  1.00 61.11  ?  63   GLU E CD   1 
ATOM   7249  O  OE1  . GLU E  1 63 ? 87.623 52.740 28.089  1.00 63.67  ?  63   GLU E OE1  1 
ATOM   7250  O  OE2  . GLU E  1 63 ? 87.843 54.900 28.420  1.00 63.05  ?  63   GLU E OE2  1 
ATOM   7251  H  H    . GLU E  1 63 ? 83.746 50.559 29.618  1.00 50.73  ?  63   GLU E H    1 
ATOM   7252  H  HA   . GLU E  1 63 ? 84.153 52.681 31.062  1.00 54.45  ?  63   GLU E HA   1 
ATOM   7253  H  HB2  . GLU E  1 63 ? 85.825 51.843 29.656  1.00 60.34  ?  63   GLU E HB2  1 
ATOM   7254  H  HB3  . GLU E  1 63 ? 84.976 52.261 28.382  1.00 60.34  ?  63   GLU E HB3  1 
ATOM   7255  H  HG2  . GLU E  1 63 ? 85.307 54.491 28.847  1.00 66.40  ?  63   GLU E HG2  1 
ATOM   7256  H  HG3  . GLU E  1 63 ? 86.056 54.124 30.200  1.00 66.40  ?  63   GLU E HG3  1 
ATOM   7257  N  N    . LEU E  1 64 ? 82.250 53.181 28.526  1.00 43.10  ?  64   LEU E N    1 
ATOM   7258  C  CA   . LEU E  1 64 ? 81.281 54.106 27.949  1.00 38.21  ?  64   LEU E CA   1 
ATOM   7259  C  C    . LEU E  1 64 ? 80.155 54.424 28.930  1.00 36.22  ?  64   LEU E C    1 
ATOM   7260  O  O    . LEU E  1 64 ? 79.807 55.586 29.123  1.00 34.09  ?  64   LEU E O    1 
ATOM   7261  C  CB   . LEU E  1 64 ? 80.686 53.542 26.656  1.00 36.86  ?  64   LEU E CB   1 
ATOM   7262  C  CG   . LEU E  1 64 ? 79.660 54.460 25.989  1.00 33.88  ?  64   LEU E CG   1 
ATOM   7263  C  CD1  . LEU E  1 64 ? 80.275 55.819 25.684  1.00 33.15  ?  64   LEU E CD1  1 
ATOM   7264  C  CD2  . LEU E  1 64 ? 79.106 53.828 24.723  1.00 32.75  ?  64   LEU E CD2  1 
ATOM   7265  H  H    . LEU E  1 64 ? 82.335 52.442 28.094  1.00 51.72  ?  64   LEU E H    1 
ATOM   7266  H  HA   . LEU E  1 64 ? 81.736 54.946 27.730  1.00 45.85  ?  64   LEU E HA   1 
ATOM   7267  H  HB2  . LEU E  1 64 ? 81.405 53.392 26.022  1.00 44.23  ?  64   LEU E HB2  1 
ATOM   7268  H  HB3  . LEU E  1 64 ? 80.245 52.702 26.857  1.00 44.23  ?  64   LEU E HB3  1 
ATOM   7269  H  HG   . LEU E  1 64 ? 78.920 54.599 26.601  1.00 40.66  ?  64   LEU E HG   1 
ATOM   7270  H  HD11 . LEU E  1 64 ? 81.021 55.698 25.092  1.00 39.77  ?  64   LEU E HD11 1 
ATOM   7271  H  HD12 . LEU E  1 64 ? 79.612 56.374 25.267  1.00 39.77  ?  64   LEU E HD12 1 
ATOM   7272  H  HD13 . LEU E  1 64 ? 80.569 56.220 26.505  1.00 39.77  ?  64   LEU E HD13 1 
ATOM   7273  H  HD21 . LEU E  1 64 ? 78.681 52.997 24.949  1.00 39.30  ?  64   LEU E HD21 1 
ATOM   7274  H  HD22 . LEU E  1 64 ? 78.467 54.426 24.329  1.00 39.30  ?  64   LEU E HD22 1 
ATOM   7275  H  HD23 . LEU E  1 64 ? 79.828 53.671 24.110  1.00 39.30  ?  64   LEU E HD23 1 
ATOM   7276  N  N    . HIS E  1 65 ? 79.586 53.391 29.544  1.00 34.93  ?  65   HIS E N    1 
ATOM   7277  C  CA   . HIS E  1 65 ? 78.479 53.575 30.478  1.00 36.40  ?  65   HIS E CA   1 
ATOM   7278  C  C    . HIS E  1 65 ? 78.875 54.497 31.626  1.00 42.31  ?  65   HIS E C    1 
ATOM   7279  O  O    . HIS E  1 65 ? 78.152 55.439 31.949  1.00 40.07  ?  65   HIS E O    1 
ATOM   7280  C  CB   . HIS E  1 65 ? 78.002 52.226 31.026  1.00 37.53  ?  65   HIS E CB   1 
ATOM   7281  C  CG   . HIS E  1 65 ? 77.025 52.340 32.156  1.00 36.67  ?  65   HIS E CG   1 
ATOM   7282  N  ND1  . HIS E  1 65 ? 75.689 52.626 31.966  1.00 32.87  ?  65   HIS E ND1  1 
ATOM   7283  C  CD2  . HIS E  1 65 ? 77.190 52.202 33.494  1.00 39.88  ?  65   HIS E CD2  1 
ATOM   7284  C  CE1  . HIS E  1 65 ? 75.075 52.659 33.135  1.00 33.73  ?  65   HIS E CE1  1 
ATOM   7285  N  NE2  . HIS E  1 65 ? 75.964 52.406 34.078  1.00 38.07  ?  65   HIS E NE2  1 
ATOM   7286  H  H    . HIS E  1 65 ? 79.823 52.571 29.437  1.00 41.91  ?  65   HIS E H    1 
ATOM   7287  H  HA   . HIS E  1 65 ? 77.728 53.990 30.003  1.00 43.68  ?  65   HIS E HA   1 
ATOM   7288  H  HB2  . HIS E  1 65 ? 77.571 51.734 30.310  1.00 45.04  ?  65   HIS E HB2  1 
ATOM   7289  H  HB3  . HIS E  1 65 ? 78.772 51.731 31.348  1.00 45.04  ?  65   HIS E HB3  1 
ATOM   7290  H  HD1  . HIS E  1 65 ? 75.314 52.761 31.204  1.00 39.44  ?  65   HIS E HD1  1 
ATOM   7291  H  HD2  . HIS E  1 65 ? 77.986 52.006 33.935  1.00 47.85  ?  65   HIS E HD2  1 
ATOM   7292  H  HE1  . HIS E  1 65 ? 74.172 52.833 33.271  1.00 40.48  ?  65   HIS E HE1  1 
ATOM   7293  H  HE2  . HIS E  1 65 ? 75.801 52.374 34.922  1.00 45.69  ?  65   HIS E HE2  1 
ATOM   7294  N  N    . GLU E  1 66 ? 80.025 54.226 32.237  1.00 40.96  ?  66   GLU E N    1 
ATOM   7295  C  CA   . GLU E  1 66 ? 80.500 55.024 33.362  1.00 47.11  ?  66   GLU E CA   1 
ATOM   7296  C  C    . GLU E  1 66 ? 80.602 56.497 32.974  1.00 41.22  ?  66   GLU E C    1 
ATOM   7297  O  O    . GLU E  1 66 ? 80.185 57.379 33.725  1.00 43.20  ?  66   GLU E O    1 
ATOM   7298  C  CB   . GLU E  1 66 ? 81.860 54.514 33.844  1.00 57.06  ?  66   GLU E CB   1 
ATOM   7299  C  CG   . GLU E  1 66 ? 82.386 55.234 35.077  1.00 66.54  ?  66   GLU E CG   1 
ATOM   7300  C  CD   . GLU E  1 66 ? 83.745 54.721 35.522  1.00 76.42  ?  66   GLU E CD   1 
ATOM   7301  O  OE1  . GLU E  1 66 ? 84.349 53.913 34.784  1.00 78.99  ?  66   GLU E OE1  1 
ATOM   7302  O  OE2  . GLU E  1 66 ? 84.209 55.124 36.611  1.00 81.62  ?  66   GLU E OE2  1 
ATOM   7303  H  H    . GLU E  1 66 ? 80.551 53.581 32.018  1.00 49.15  ?  66   GLU E H    1 
ATOM   7304  H  HA   . GLU E  1 66 ? 79.864 54.946 34.103  1.00 56.54  ?  66   GLU E HA   1 
ATOM   7305  H  HB2  . GLU E  1 66 ? 81.781 53.572 34.062  1.00 68.47  ?  66   GLU E HB2  1 
ATOM   7306  H  HB3  . GLU E  1 66 ? 82.508 54.634 33.133  1.00 68.47  ?  66   GLU E HB3  1 
ATOM   7307  H  HG2  . GLU E  1 66 ? 82.473 56.179 34.878  1.00 79.85  ?  66   GLU E HG2  1 
ATOM   7308  H  HG3  . GLU E  1 66 ? 81.762 55.104 35.809  1.00 79.85  ?  66   GLU E HG3  1 
ATOM   7309  N  N    . ILE E  1 67 ? 81.161 56.754 31.797  1.00 42.42  ?  67   ILE E N    1 
ATOM   7310  C  CA   . ILE E  1 67 ? 81.290 58.114 31.286  1.00 39.44  ?  67   ILE E CA   1 
ATOM   7311  C  C    . ILE E  1 67 ? 79.924 58.792 31.166  1.00 35.76  ?  67   ILE E C    1 
ATOM   7312  O  O    . ILE E  1 67 ? 79.712 59.875 31.710  1.00 38.41  ?  67   ILE E O    1 
ATOM   7313  C  CB   . ILE E  1 67 ? 82.001 58.122 29.917  1.00 37.88  ?  67   ILE E CB   1 
ATOM   7314  C  CG1  . ILE E  1 67 ? 83.513 57.987 30.116  1.00 42.83  ?  67   ILE E CG1  1 
ATOM   7315  C  CG2  . ILE E  1 67 ? 81.686 59.397 29.149  1.00 35.35  ?  67   ILE E CG2  1 
ATOM   7316  C  CD1  . ILE E  1 67 ? 84.281 57.721 28.841  1.00 42.24  ?  67   ILE E CD1  1 
ATOM   7317  H  H    . ILE E  1 67 ? 81.477 56.152 31.270  1.00 50.90  ?  67   ILE E H    1 
ATOM   7318  H  HA   . ILE E  1 67 ? 81.833 58.638 31.912  1.00 47.33  ?  67   ILE E HA   1 
ATOM   7319  H  HB   . ILE E  1 67 ? 81.687 57.363 29.401  1.00 45.46  ?  67   ILE E HB   1 
ATOM   7320  H  HG12 . ILE E  1 67 ? 83.851 58.812 30.499  1.00 51.40  ?  67   ILE E HG12 1 
ATOM   7321  H  HG13 . ILE E  1 67 ? 83.683 57.250 30.724  1.00 51.40  ?  67   ILE E HG13 1 
ATOM   7322  H  HG21 . ILE E  1 67 ? 81.985 60.152 29.661  1.00 42.41  ?  67   ILE E HG21 1 
ATOM   7323  H  HG22 . ILE E  1 67 ? 82.141 59.373 28.304  1.00 42.41  ?  67   ILE E HG22 1 
ATOM   7324  H  HG23 . ILE E  1 67 ? 80.738 59.451 29.008  1.00 42.41  ?  67   ILE E HG23 1 
ATOM   7325  H  HD11 . ILE E  1 67 ? 84.135 58.448 28.231  1.00 50.69  ?  67   ILE E HD11 1 
ATOM   7326  H  HD12 . ILE E  1 67 ? 85.216 57.650 29.049  1.00 50.69  ?  67   ILE E HD12 1 
ATOM   7327  H  HD13 . ILE E  1 67 ? 83.969 56.900 28.453  1.00 50.69  ?  67   ILE E HD13 1 
ATOM   7328  N  N    . LEU E  1 68 ? 79.001 58.149 30.459  1.00 35.79  ?  68   LEU E N    1 
ATOM   7329  C  CA   . LEU E  1 68 ? 77.667 58.709 30.252  1.00 32.52  ?  68   LEU E CA   1 
ATOM   7330  C  C    . LEU E  1 68 ? 76.933 58.891 31.577  1.00 36.19  ?  68   LEU E C    1 
ATOM   7331  O  O    . LEU E  1 68 ? 76.279 59.909 31.806  1.00 34.17  ?  68   LEU E O    1 
ATOM   7332  C  CB   . LEU E  1 68 ? 76.852 57.800 29.332  1.00 29.92  ?  68   LEU E CB   1 
ATOM   7333  C  CG   . LEU E  1 68 ? 77.439 57.577 27.938  1.00 29.41  ?  68   LEU E CG   1 
ATOM   7334  C  CD1  . LEU E  1 68 ? 76.704 56.454 27.225  1.00 28.25  ?  68   LEU E CD1  1 
ATOM   7335  C  CD2  . LEU E  1 68 ? 77.383 58.863 27.125  1.00 28.16  ?  68   LEU E CD2  1 
ATOM   7336  H  H    . LEU E  1 68 ? 79.121 57.384 30.086  1.00 42.94  ?  68   LEU E H    1 
ATOM   7337  H  HA   . LEU E  1 68 ? 77.748 59.587 29.823  1.00 39.02  ?  68   LEU E HA   1 
ATOM   7338  H  HB2  . LEU E  1 68 ? 76.769 56.931 29.755  1.00 35.91  ?  68   LEU E HB2  1 
ATOM   7339  H  HB3  . LEU E  1 68 ? 75.971 58.189 29.217  1.00 35.91  ?  68   LEU E HB3  1 
ATOM   7340  H  HG   . LEU E  1 68 ? 78.370 57.318 28.025  1.00 35.29  ?  68   LEU E HG   1 
ATOM   7341  H  HD11 . LEU E  1 68 ? 75.777 56.690 27.144  1.00 33.90  ?  68   LEU E HD11 1 
ATOM   7342  H  HD12 . LEU E  1 68 ? 77.089 56.333 26.354  1.00 33.90  ?  68   LEU E HD12 1 
ATOM   7343  H  HD13 . LEU E  1 68 ? 76.793 55.648 27.739  1.00 33.90  ?  68   LEU E HD13 1 
ATOM   7344  H  HD21 . LEU E  1 68 ? 77.891 59.540 27.577  1.00 33.79  ?  68   LEU E HD21 1 
ATOM   7345  H  HD22 . LEU E  1 68 ? 77.756 58.699 26.256  1.00 33.79  ?  68   LEU E HD22 1 
ATOM   7346  H  HD23 . LEU E  1 68 ? 76.468 59.140 27.042  1.00 33.79  ?  68   LEU E HD23 1 
ATOM   7347  N  N    . TRP E  1 69 ? 77.050 57.890 32.442  1.00 36.34  ?  69   TRP E N    1 
ATOM   7348  C  CA   . TRP E  1 69 ? 76.417 57.905 33.753  1.00 40.19  ?  69   TRP E CA   1 
ATOM   7349  C  C    . TRP E  1 69 ? 76.803 59.154 34.538  1.00 40.96  ?  69   TRP E C    1 
ATOM   7350  O  O    . TRP E  1 69 ? 75.999 59.687 35.304  1.00 43.92  ?  69   TRP E O    1 
ATOM   7351  C  CB   . TRP E  1 69 ? 76.837 56.655 34.531  1.00 43.97  ?  69   TRP E CB   1 
ATOM   7352  C  CG   . TRP E  1 69 ? 76.071 56.411 35.799  1.00 46.32  ?  69   TRP E CG   1 
ATOM   7353  C  CD1  . TRP E  1 69 ? 76.474 56.700 37.070  1.00 50.73  ?  69   TRP E CD1  1 
ATOM   7354  C  CD2  . TRP E  1 69 ? 74.776 55.810 35.916  1.00 44.41  ?  69   TRP E CD2  1 
ATOM   7355  N  NE1  . TRP E  1 69 ? 75.510 56.319 37.971  1.00 51.90  ?  69   TRP E NE1  1 
ATOM   7356  C  CE2  . TRP E  1 69 ? 74.456 55.770 37.288  1.00 48.44  ?  69   TRP E CE2  1 
ATOM   7357  C  CE3  . TRP E  1 69 ? 73.854 55.303 34.993  1.00 40.19  ?  69   TRP E CE3  1 
ATOM   7358  C  CZ2  . TRP E  1 69 ? 73.254 55.246 37.761  1.00 49.69  ?  69   TRP E CZ2  1 
ATOM   7359  C  CZ3  . TRP E  1 69 ? 72.660 54.783 35.463  1.00 41.40  ?  69   TRP E CZ3  1 
ATOM   7360  C  CH2  . TRP E  1 69 ? 72.372 54.758 36.836  1.00 46.27  ?  69   TRP E CH2  1 
ATOM   7361  H  H    . TRP E  1 69 ? 77.502 57.175 32.287  1.00 43.61  ?  69   TRP E H    1 
ATOM   7362  H  HA   . TRP E  1 69 ? 75.443 57.892 33.647  1.00 48.22  ?  69   TRP E HA   1 
ATOM   7363  H  HB2  . TRP E  1 69 ? 76.714 55.881 33.960  1.00 52.76  ?  69   TRP E HB2  1 
ATOM   7364  H  HB3  . TRP E  1 69 ? 77.774 56.739 34.767  1.00 52.76  ?  69   TRP E HB3  1 
ATOM   7365  H  HD1  . TRP E  1 69 ? 77.286 57.095 37.294  1.00 60.87  ?  69   TRP E HD1  1 
ATOM   7366  H  HE1  . TRP E  1 69 ? 75.558 56.412 38.825  1.00 62.28  ?  69   TRP E HE1  1 
ATOM   7367  H  HE3  . TRP E  1 69 ? 74.039 55.315 34.082  1.00 48.23  ?  69   TRP E HE3  1 
ATOM   7368  H  HZ2  . TRP E  1 69 ? 73.059 55.230 38.670  1.00 59.63  ?  69   TRP E HZ2  1 
ATOM   7369  H  HZ3  . TRP E  1 69 ? 72.040 54.443 34.859  1.00 49.68  ?  69   TRP E HZ3  1 
ATOM   7370  H  HH2  . TRP E  1 69 ? 71.562 54.404 37.123  1.00 55.52  ?  69   TRP E HH2  1 
ATOM   7371  N  N    . SER E  1 70 ? 78.032 59.621 34.337  1.00 37.14  ?  70   SER E N    1 
ATOM   7372  C  CA   . SER E  1 70 ? 78.571 60.728 35.122  1.00 39.51  ?  70   SER E CA   1 
ATOM   7373  C  C    . SER E  1 70 ? 78.241 62.095 34.527  1.00 39.66  ?  70   SER E C    1 
ATOM   7374  O  O    . SER E  1 70 ? 78.368 63.113 35.205  1.00 44.04  ?  70   SER E O    1 
ATOM   7375  C  CB   . SER E  1 70 ? 80.089 60.583 35.273  1.00 43.02  ?  70   SER E CB   1 
ATOM   7376  O  OG   . SER E  1 70 ? 80.752 60.730 34.028  1.00 41.56  ?  70   SER E OG   1 
ATOM   7377  H  H    . SER E  1 70 ? 78.577 59.313 33.747  1.00 44.56  ?  70   SER E H    1 
ATOM   7378  H  HA   . SER E  1 70 ? 78.178 60.694 36.020  1.00 47.41  ?  70   SER E HA   1 
ATOM   7379  H  HB2  . SER E  1 70 ? 80.410 61.266 35.883  1.00 51.62  ?  70   SER E HB2  1 
ATOM   7380  H  HB3  . SER E  1 70 ? 80.285 59.703 35.631  1.00 51.62  ?  70   SER E HB3  1 
ATOM   7381  H  HG   . SER E  1 70 ? 80.205 60.870 33.434  1.00 49.87  ?  70   SER E HG   1 
ATOM   7382  N  N    . LEU E  1 71 ? 77.826 62.120 33.264  1.00 40.63  ?  71   LEU E N    1 
ATOM   7383  C  CA   . LEU E  1 71 ? 77.465 63.375 32.613  1.00 39.10  ?  71   LEU E CA   1 
ATOM   7384  C  C    . LEU E  1 71 ? 76.452 64.139 33.461  1.00 39.46  ?  71   LEU E C    1 
ATOM   7385  O  O    . LEU E  1 71 ? 75.480 63.558 33.940  1.00 38.67  ?  71   LEU E O    1 
ATOM   7386  C  CB   . LEU E  1 71 ? 76.892 63.117 31.220  1.00 36.53  ?  71   LEU E CB   1 
ATOM   7387  C  CG   . LEU E  1 71 ? 77.875 62.588 30.172  1.00 37.30  ?  71   LEU E CG   1 
ATOM   7388  C  CD1  . LEU E  1 71 ? 77.203 62.511 28.808  1.00 34.52  ?  71   LEU E CD1  1 
ATOM   7389  C  CD2  . LEU E  1 71 ? 79.128 63.451 30.103  1.00 40.90  ?  71   LEU E CD2  1 
ATOM   7390  H  H    . LEU E  1 71 ? 77.744 61.426 32.763  1.00 48.75  ?  71   LEU E H    1 
ATOM   7391  H  HA   . LEU E  1 71 ? 78.267 63.931 32.518  1.00 46.92  ?  71   LEU E HA   1 
ATOM   7392  H  HB2  . LEU E  1 71 ? 76.178 62.465 31.300  1.00 43.83  ?  71   LEU E HB2  1 
ATOM   7393  H  HB3  . LEU E  1 71 ? 76.529 63.950 30.880  1.00 43.83  ?  71   LEU E HB3  1 
ATOM   7394  H  HG   . LEU E  1 71 ? 78.145 61.691 30.421  1.00 44.76  ?  71   LEU E HG   1 
ATOM   7395  H  HD11 . LEU E  1 71 ? 76.911 63.390 28.554  1.00 41.42  ?  71   LEU E HD11 1 
ATOM   7396  H  HD12 . LEU E  1 71 ? 77.836 62.178 28.167  1.00 41.42  ?  71   LEU E HD12 1 
ATOM   7397  H  HD13 . LEU E  1 71 ? 76.450 61.919 28.864  1.00 41.42  ?  71   LEU E HD13 1 
ATOM   7398  H  HD21 . LEU E  1 71 ? 79.558 63.446 30.962  1.00 49.08  ?  71   LEU E HD21 1 
ATOM   7399  H  HD22 . LEU E  1 71 ? 79.719 63.091 29.438  1.00 49.08  ?  71   LEU E HD22 1 
ATOM   7400  H  HD23 . LEU E  1 71 ? 78.877 64.347 29.868  1.00 49.08  ?  71   LEU E HD23 1 
ATOM   7401  N  N    . PRO E  1 72 ? 76.679 65.447 33.654  1.00 41.46  ?  72   PRO E N    1 
ATOM   7402  C  CA   . PRO E  1 72 ? 75.777 66.251 34.487  1.00 43.74  ?  72   PRO E CA   1 
ATOM   7403  C  C    . PRO E  1 72 ? 74.324 66.235 34.009  1.00 44.58  ?  72   PRO E C    1 
ATOM   7404  O  O    . PRO E  1 72 ? 73.417 66.310 34.838  1.00 44.33  ?  72   PRO E O    1 
ATOM   7405  C  CB   . PRO E  1 72 ? 76.362 67.661 34.372  1.00 44.47  ?  72   PRO E CB   1 
ATOM   7406  C  CG   . PRO E  1 72 ? 77.797 67.446 34.061  1.00 45.74  ?  72   PRO E CG   1 
ATOM   7407  C  CD   . PRO E  1 72 ? 77.840 66.227 33.193  1.00 42.71  ?  72   PRO E CD   1 
ATOM   7408  H  HA   . PRO E  1 72 ? 75.818 65.956 35.421  1.00 52.48  ?  72   PRO E HA   1 
ATOM   7409  H  HB2  . PRO E  1 72 ? 75.922 68.142 33.654  1.00 53.36  ?  72   PRO E HB2  1 
ATOM   7410  H  HB3  . PRO E  1 72 ? 76.259 68.129 35.216  1.00 53.36  ?  72   PRO E HB3  1 
ATOM   7411  H  HG2  . PRO E  1 72 ? 78.147 68.216 33.586  1.00 54.89  ?  72   PRO E HG2  1 
ATOM   7412  H  HG3  . PRO E  1 72 ? 78.290 67.298 34.883  1.00 54.89  ?  72   PRO E HG3  1 
ATOM   7413  H  HD2  . PRO E  1 72 ? 77.736 66.472 32.261  1.00 51.25  ?  72   PRO E HD2  1 
ATOM   7414  H  HD3  . PRO E  1 72 ? 78.661 65.733 33.343  1.00 51.25  ?  72   PRO E HD3  1 
ATOM   7415  N  N    . PHE E  1 73 ? 74.107 66.135 32.701  1.00 49.92  ?  73   PHE E N    1 
ATOM   7416  C  CA   . PHE E  1 73 ? 72.753 66.144 32.151  1.00 49.90  ?  73   PHE E CA   1 
ATOM   7417  C  C    . PHE E  1 73 ? 72.072 64.777 32.230  1.00 45.21  ?  73   PHE E C    1 
ATOM   7418  O  O    . PHE E  1 73 ? 70.872 64.668 31.978  1.00 44.37  ?  73   PHE E O    1 
ATOM   7419  C  CB   . PHE E  1 73 ? 72.766 66.608 30.689  1.00 50.43  ?  73   PHE E CB   1 
ATOM   7420  C  CG   . PHE E  1 73 ? 72.655 68.098 30.519  1.00 53.55  ?  73   PHE E CG   1 
ATOM   7421  C  CD1  . PHE E  1 73 ? 71.425 68.727 30.605  1.00 54.10  ?  73   PHE E CD1  1 
ATOM   7422  C  CD2  . PHE E  1 73 ? 73.775 68.868 30.258  1.00 55.42  ?  73   PHE E CD2  1 
ATOM   7423  C  CE1  . PHE E  1 73 ? 71.318 70.096 30.445  1.00 55.05  ?  73   PHE E CE1  1 
ATOM   7424  C  CE2  . PHE E  1 73 ? 73.672 70.236 30.096  1.00 56.52  ?  73   PHE E CE2  1 
ATOM   7425  C  CZ   . PHE E  1 73 ? 72.442 70.850 30.190  1.00 56.05  ?  73   PHE E CZ   1 
ATOM   7426  H  H    . PHE E  1 73 ? 74.727 66.062 32.109  1.00 59.90  ?  73   PHE E H    1 
ATOM   7427  H  HA   . PHE E  1 73 ? 72.209 66.779 32.662  1.00 59.88  ?  73   PHE E HA   1 
ATOM   7428  H  HB2  . PHE E  1 73 ? 73.599 66.324 30.280  1.00 60.52  ?  73   PHE E HB2  1 
ATOM   7429  H  HB3  . PHE E  1 73 ? 72.018 66.200 30.226  1.00 60.52  ?  73   PHE E HB3  1 
ATOM   7430  H  HD1  . PHE E  1 73 ? 70.662 68.224 30.778  1.00 64.92  ?  73   PHE E HD1  1 
ATOM   7431  H  HD2  . PHE E  1 73 ? 74.609 68.460 30.194  1.00 66.51  ?  73   PHE E HD2  1 
ATOM   7432  H  HE1  . PHE E  1 73 ? 70.487 70.509 30.508  1.00 66.06  ?  73   PHE E HE1  1 
ATOM   7433  H  HE2  . PHE E  1 73 ? 74.433 70.743 29.924  1.00 67.82  ?  73   PHE E HE2  1 
ATOM   7434  H  HZ   . PHE E  1 73 ? 72.372 71.771 30.081  1.00 67.25  ?  73   PHE E HZ   1 
ATOM   7435  N  N    . PHE E  1 74 ? 72.828 63.742 32.586  1.00 42.37  ?  74   PHE E N    1 
ATOM   7436  C  CA   . PHE E  1 74 ? 72.334 62.369 32.485  1.00 39.09  ?  74   PHE E CA   1 
ATOM   7437  C  C    . PHE E  1 74 ? 70.912 62.173 33.012  1.00 39.62  ?  74   PHE E C    1 
ATOM   7438  O  O    . PHE E  1 74 ? 70.100 61.512 32.368  1.00 40.62  ?  74   PHE E O    1 
ATOM   7439  C  CB   . PHE E  1 74 ? 73.268 61.386 33.190  1.00 39.56  ?  74   PHE E CB   1 
ATOM   7440  C  CG   . PHE E  1 74 ? 72.797 59.963 33.115  1.00 39.57  ?  74   PHE E CG   1 
ATOM   7441  C  CD1  . PHE E  1 74 ? 73.071 59.190 32.000  1.00 38.56  ?  74   PHE E CD1  1 
ATOM   7442  C  CD2  . PHE E  1 74 ? 72.060 59.406 34.148  1.00 41.60  ?  74   PHE E CD2  1 
ATOM   7443  C  CE1  . PHE E  1 74 ? 72.630 57.884 31.920  1.00 39.10  ?  74   PHE E CE1  1 
ATOM   7444  C  CE2  . PHE E  1 74 ? 71.616 58.101 34.074  1.00 42.20  ?  74   PHE E CE2  1 
ATOM   7445  C  CZ   . PHE E  1 74 ? 71.902 57.339 32.957  1.00 41.01  ?  74   PHE E CZ   1 
ATOM   7446  H  H    . PHE E  1 74 ? 73.631 63.807 32.889  1.00 50.85  ?  74   PHE E H    1 
ATOM   7447  H  HA   . PHE E  1 74 ? 72.323 62.123 31.537  1.00 46.91  ?  74   PHE E HA   1 
ATOM   7448  H  HB2  . PHE E  1 74 ? 74.144 61.433 32.776  1.00 47.48  ?  74   PHE E HB2  1 
ATOM   7449  H  HB3  . PHE E  1 74 ? 73.333 61.630 34.127  1.00 47.48  ?  74   PHE E HB3  1 
ATOM   7450  H  HD1  . PHE E  1 74 ? 73.561 59.553 31.298  1.00 46.27  ?  74   PHE E HD1  1 
ATOM   7451  H  HD2  . PHE E  1 74 ? 71.866 59.916 34.901  1.00 49.92  ?  74   PHE E HD2  1 
ATOM   7452  H  HE1  . PHE E  1 74 ? 72.824 57.373 31.168  1.00 46.92  ?  74   PHE E HE1  1 
ATOM   7453  H  HE2  . PHE E  1 74 ? 71.126 57.736 34.775  1.00 50.64  ?  74   PHE E HE2  1 
ATOM   7454  H  HZ   . PHE E  1 74 ? 71.606 56.459 32.905  1.00 49.21  ?  74   PHE E HZ   1 
ATOM   7455  N  N    . PRO E  1 75 ? 70.605 62.732 34.190  1.00 40.87  ?  75   PRO E N    1 
ATOM   7456  C  CA   . PRO E  1 75 ? 69.262 62.516 34.738  1.00 41.60  ?  75   PRO E CA   1 
ATOM   7457  C  C    . PRO E  1 75 ? 68.160 63.005 33.798  1.00 41.44  ?  75   PRO E C    1 
ATOM   7458  O  O    . PRO E  1 75 ? 67.037 62.502 33.854  1.00 41.23  ?  75   PRO E O    1 
ATOM   7459  C  CB   . PRO E  1 75 ? 69.270 63.344 36.027  1.00 43.58  ?  75   PRO E CB   1 
ATOM   7460  C  CG   . PRO E  1 75 ? 70.710 63.497 36.380  1.00 44.22  ?  75   PRO E CG   1 
ATOM   7461  C  CD   . PRO E  1 75 ? 71.439 63.559 35.077  1.00 42.43  ?  75   PRO E CD   1 
ATOM   7462  H  HA   . PRO E  1 75 ? 69.121 61.570 34.952  1.00 49.92  ?  75   PRO E HA   1 
ATOM   7463  H  HB2  . PRO E  1 75 ? 68.862 64.208 35.863  1.00 52.30  ?  75   PRO E HB2  1 
ATOM   7464  H  HB3  . PRO E  1 75 ? 68.794 62.866 36.725  1.00 52.30  ?  75   PRO E HB3  1 
ATOM   7465  H  HG2  . PRO E  1 75 ? 70.836 64.318 36.881  1.00 53.06  ?  75   PRO E HG2  1 
ATOM   7466  H  HG3  . PRO E  1 75 ? 71.001 62.731 36.898  1.00 53.06  ?  75   PRO E HG3  1 
ATOM   7467  H  HD2  . PRO E  1 75 ? 71.477 64.473 34.753  1.00 50.92  ?  75   PRO E HD2  1 
ATOM   7468  H  HD3  . PRO E  1 75 ? 72.325 63.174 35.166  1.00 50.92  ?  75   PRO E HD3  1 
ATOM   7469  N  N    . TYR E  1 76 ? 68.486 63.969 32.944  1.00 42.21  ?  76   TYR E N    1 
ATOM   7470  C  CA   . TYR E  1 76 ? 67.503 64.561 32.043  1.00 44.32  ?  76   TYR E CA   1 
ATOM   7471  C  C    . TYR E  1 76 ? 67.707 64.124 30.593  1.00 42.42  ?  76   TYR E C    1 
ATOM   7472  O  O    . TYR E  1 76 ? 67.073 64.661 29.684  1.00 45.15  ?  76   TYR E O    1 
ATOM   7473  C  CB   . TYR E  1 76 ? 67.577 66.086 32.133  1.00 46.92  ?  76   TYR E CB   1 
ATOM   7474  C  CG   . TYR E  1 76 ? 67.727 66.596 33.547  1.00 49.62  ?  76   TYR E CG   1 
ATOM   7475  C  CD1  . TYR E  1 76 ? 66.661 66.556 34.436  1.00 51.70  ?  76   TYR E CD1  1 
ATOM   7476  C  CD2  . TYR E  1 76 ? 68.935 67.114 33.995  1.00 50.55  ?  76   TYR E CD2  1 
ATOM   7477  C  CE1  . TYR E  1 76 ? 66.793 67.019 35.731  1.00 54.20  ?  76   TYR E CE1  1 
ATOM   7478  C  CE2  . TYR E  1 76 ? 69.077 67.579 35.289  1.00 53.07  ?  76   TYR E CE2  1 
ATOM   7479  C  CZ   . TYR E  1 76 ? 68.003 67.529 36.154  1.00 55.52  ?  76   TYR E CZ   1 
ATOM   7480  O  OH   . TYR E  1 76 ? 68.140 67.991 37.444  1.00 58.58  ?  76   TYR E OH   1 
ATOM   7481  H  H    . TYR E  1 76 ? 69.275 64.301 32.866  1.00 50.65  ?  76   TYR E H    1 
ATOM   7482  H  HA   . TYR E  1 76 ? 66.606 64.282 32.321  1.00 53.19  ?  76   TYR E HA   1 
ATOM   7483  H  HB2  . TYR E  1 76 ? 68.343 66.393 31.622  1.00 56.30  ?  76   TYR E HB2  1 
ATOM   7484  H  HB3  . TYR E  1 76 ? 66.762 66.462 31.765  1.00 56.30  ?  76   TYR E HB3  1 
ATOM   7485  H  HD1  . TYR E  1 76 ? 65.844 66.212 34.155  1.00 62.04  ?  76   TYR E HD1  1 
ATOM   7486  H  HD2  . TYR E  1 76 ? 69.661 67.148 33.415  1.00 60.65  ?  76   TYR E HD2  1 
ATOM   7487  H  HE1  . TYR E  1 76 ? 66.070 66.986 36.316  1.00 65.04  ?  76   TYR E HE1  1 
ATOM   7488  H  HE2  . TYR E  1 76 ? 69.892 67.924 35.576  1.00 63.68  ?  76   TYR E HE2  1 
ATOM   7489  H  HH   . TYR E  1 76 ? 68.348 68.784 37.438  1.00 70.29  ?  76   TYR E HH   1 
ATOM   7490  N  N    . LEU E  1 77 ? 68.585 63.149 30.377  1.00 39.34  ?  77   LEU E N    1 
ATOM   7491  C  CA   . LEU E  1 77 ? 68.915 62.718 29.023  1.00 36.54  ?  77   LEU E CA   1 
ATOM   7492  C  C    . LEU E  1 77 ? 68.132 61.491 28.575  1.00 34.59  ?  77   LEU E C    1 
ATOM   7493  O  O    . LEU E  1 77 ? 67.890 60.568 29.352  1.00 36.69  ?  77   LEU E O    1 
ATOM   7494  C  CB   . LEU E  1 77 ? 70.411 62.407 28.905  1.00 37.51  ?  77   LEU E CB   1 
ATOM   7495  C  CG   . LEU E  1 77 ? 71.387 63.583 28.955  1.00 37.04  ?  77   LEU E CG   1 
ATOM   7496  C  CD1  . LEU E  1 77 ? 72.815 63.090 28.774  1.00 36.15  ?  77   LEU E CD1  1 
ATOM   7497  C  CD2  . LEU E  1 77 ? 71.043 64.629 27.906  1.00 36.91  ?  77   LEU E CD2  1 
ATOM   7498  H  H    . LEU E  1 77 ? 69.003 62.723 30.995  1.00 47.20  ?  77   LEU E H    1 
ATOM   7499  H  HA   . LEU E  1 77 ? 68.711 63.447 28.401  1.00 43.85  ?  77   LEU E HA   1 
ATOM   7500  H  HB2  . LEU E  1 77 ? 70.650 61.809 29.630  1.00 45.02  ?  77   LEU E HB2  1 
ATOM   7501  H  HB3  . LEU E  1 77 ? 70.556 61.954 28.059  1.00 45.02  ?  77   LEU E HB3  1 
ATOM   7502  H  HG   . LEU E  1 77 ? 71.326 64.004 29.827  1.00 44.44  ?  77   LEU E HG   1 
ATOM   7503  H  HD11 . LEU E  1 77 ? 72.888 62.652 27.922  1.00 43.38  ?  77   LEU E HD11 1 
ATOM   7504  H  HD12 . LEU E  1 77 ? 73.412 63.841 28.808  1.00 43.38  ?  77   LEU E HD12 1 
ATOM   7505  H  HD13 . LEU E  1 77 ? 73.024 62.472 29.479  1.00 43.38  ?  77   LEU E HD13 1 
ATOM   7506  H  HD21 . LEU E  1 77 ? 70.155 64.956 28.071  1.00 44.29  ?  77   LEU E HD21 1 
ATOM   7507  H  HD22 . LEU E  1 77 ? 71.674 65.350 27.966  1.00 44.29  ?  77   LEU E HD22 1 
ATOM   7508  H  HD23 . LEU E  1 77 ? 71.088 64.226 27.036  1.00 44.29  ?  77   LEU E HD23 1 
ATOM   7509  N  N    . THR E  1 78 ? 67.738 61.501 27.308  1.00 32.16  ?  78   THR E N    1 
ATOM   7510  C  CA   . THR E  1 78 ? 67.302 60.297 26.621  1.00 31.58  ?  78   THR E CA   1 
ATOM   7511  C  C    . THR E  1 78 ? 68.440 59.910 25.691  1.00 30.91  ?  78   THR E C    1 
ATOM   7512  O  O    . THR E  1 78 ? 68.838 60.698 24.836  1.00 28.33  ?  78   THR E O    1 
ATOM   7513  C  CB   . THR E  1 78 ? 66.029 60.539 25.796  1.00 35.73  ?  78   THR E CB   1 
ATOM   7514  O  OG1  . THR E  1 78 ? 64.967 60.964 26.661  1.00 37.31  ?  78   THR E OG1  1 
ATOM   7515  C  CG2  . THR E  1 78 ? 65.614 59.267 25.068  1.00 37.37  ?  78   THR E CG2  1 
ATOM   7516  H  H    . THR E  1 78 ? 67.715 62.207 26.817  1.00 38.60  ?  78   THR E H    1 
ATOM   7517  H  HA   . THR E  1 78 ? 67.144 59.574 27.263  1.00 37.89  ?  78   THR E HA   1 
ATOM   7518  H  HB   . THR E  1 78 ? 66.200 61.227 25.135  1.00 42.88  ?  78   THR E HB   1 
ATOM   7519  H  HG1  . THR E  1 78 ? 64.285 61.094 26.225  1.00 44.77  ?  78   THR E HG1  1 
ATOM   7520  H  HG21 . THR E  1 78 ? 65.442 58.567 25.702  1.00 44.84  ?  78   THR E HG21 1 
ATOM   7521  H  HG22 . THR E  1 78 ? 64.818 59.427 24.556  1.00 44.84  ?  78   THR E HG22 1 
ATOM   7522  H  HG23 . THR E  1 78 ? 66.315 58.985 24.476  1.00 44.84  ?  78   THR E HG23 1 
ATOM   7523  N  N    . ILE E  1 79 ? 68.975 58.707 25.861  1.00 33.32  ?  79   ILE E N    1 
ATOM   7524  C  CA   . ILE E  1 79 ? 70.194 58.325 25.160  1.00 37.06  ?  79   ILE E CA   1 
ATOM   7525  C  C    . ILE E  1 79 ? 70.030 57.093 24.277  1.00 36.59  ?  79   ILE E C    1 
ATOM   7526  O  O    . ILE E  1 79 ? 69.391 56.114 24.660  1.00 37.11  ?  79   ILE E O    1 
ATOM   7527  C  CB   . ILE E  1 79 ? 71.344 58.050 26.151  1.00 39.75  ?  79   ILE E CB   1 
ATOM   7528  C  CG1  . ILE E  1 79 ? 71.592 59.283 27.024  1.00 42.21  ?  79   ILE E CG1  1 
ATOM   7529  C  CG2  . ILE E  1 79 ? 72.608 57.646 25.400  1.00 39.02  ?  79   ILE E CG2  1 
ATOM   7530  C  CD1  . ILE E  1 79 ? 72.992 59.365 27.597  1.00 43.88  ?  79   ILE E CD1  1 
ATOM   7531  H  H    . ILE E  1 79 ? 68.653 58.096 26.374  1.00 39.98  ?  79   ILE E H    1 
ATOM   7532  H  HA   . ILE E  1 79 ? 70.469 59.068 24.584  1.00 44.47  ?  79   ILE E HA   1 
ATOM   7533  H  HB   . ILE E  1 79 ? 71.082 57.315 26.728  1.00 47.70  ?  79   ILE E HB   1 
ATOM   7534  H  HG12 . ILE E  1 79 ? 71.445 60.078 26.488  1.00 50.65  ?  79   ILE E HG12 1 
ATOM   7535  H  HG13 . ILE E  1 79 ? 70.969 59.269 27.767  1.00 50.65  ?  79   ILE E HG13 1 
ATOM   7536  H  HG21 . ILE E  1 79 ? 72.862 58.360 24.810  1.00 46.82  ?  79   ILE E HG21 1 
ATOM   7537  H  HG22 . ILE E  1 79 ? 73.309 57.481 26.035  1.00 46.82  ?  79   ILE E HG22 1 
ATOM   7538  H  HG23 . ILE E  1 79 ? 72.430 56.850 24.894  1.00 46.82  ?  79   ILE E HG23 1 
ATOM   7539  H  HD11 . ILE E  1 79 ? 73.624 59.393 26.875  1.00 52.65  ?  79   ILE E HD11 1 
ATOM   7540  H  HD12 . ILE E  1 79 ? 73.065 60.161 28.129  1.00 52.65  ?  79   ILE E HD12 1 
ATOM   7541  H  HD13 . ILE E  1 79 ? 73.151 58.591 28.143  1.00 52.65  ?  79   ILE E HD13 1 
ATOM   7542  N  N    . ASP E  1 80 ? 70.618 57.164 23.088  1.00 35.73  ?  80   ASP E N    1 
ATOM   7543  C  CA   A ASP E  1 80 ? 70.674 56.021 22.189  0.49 35.17  ?  80   ASP E CA   1 
ATOM   7544  C  CA   B ASP E  1 80 ? 70.676 56.022 22.183  0.51 35.17  ?  80   ASP E CA   1 
ATOM   7545  C  C    . ASP E  1 80 ? 72.129 55.693 21.875  1.00 34.39  ?  80   ASP E C    1 
ATOM   7546  O  O    . ASP E  1 80 ? 72.887 56.556 21.434  1.00 35.47  ?  80   ASP E O    1 
ATOM   7547  C  CB   A ASP E  1 80 ? 69.905 56.311 20.900  0.49 36.93  ?  80   ASP E CB   1 
ATOM   7548  C  CB   B ASP E  1 80 ? 69.936 56.319 20.880  0.51 37.52  ?  80   ASP E CB   1 
ATOM   7549  C  CG   A ASP E  1 80 ? 68.430 56.559 21.146  0.49 37.19  ?  80   ASP E CG   1 
ATOM   7550  C  CG   B ASP E  1 80 ? 70.090 55.207 19.858  0.51 37.18  ?  80   ASP E CG   1 
ATOM   7551  O  OD1  A ASP E  1 80 ? 67.693 55.577 21.375  0.49 41.03  ?  80   ASP E OD1  1 
ATOM   7552  O  OD1  B ASP E  1 80 ? 69.873 54.031 20.219  0.51 39.28  ?  80   ASP E OD1  1 
ATOM   7553  O  OD2  A ASP E  1 80 ? 68.006 57.733 21.107  0.49 39.06  ?  80   ASP E OD2  1 
ATOM   7554  O  OD2  B ASP E  1 80 ? 70.441 55.506 18.697  0.51 39.19  ?  80   ASP E OD2  1 
ATOM   7555  H  H    A ASP E  1 80 ? 70.996 57.871 22.776  0.49 42.88  ?  80   ASP E H    1 
ATOM   7556  H  H    B ASP E  1 80 ? 70.997 57.871 22.778  0.51 42.88  ?  80   ASP E H    1 
ATOM   7557  H  HA   A ASP E  1 80 ? 70.268 55.243 22.625  0.49 42.21  ?  80   ASP E HA   1 
ATOM   7558  H  HA   B ASP E  1 80 ? 70.261 55.243 22.609  0.51 42.21  ?  80   ASP E HA   1 
ATOM   7559  H  HB2  A ASP E  1 80 ? 70.278 57.102 20.481  0.49 44.31  ?  80   ASP E HB2  1 
ATOM   7560  H  HB2  B ASP E  1 80 ? 68.990 56.425 21.070  0.51 45.02  ?  80   ASP E HB2  1 
ATOM   7561  H  HB3  A ASP E  1 80 ? 69.987 55.549 20.305  0.49 44.31  ?  80   ASP E HB3  1 
ATOM   7562  H  HB3  B ASP E  1 80 ? 70.290 57.135 20.493  0.51 45.02  ?  80   ASP E HB3  1 
ATOM   7563  N  N    . VAL E  1 81 ? 72.513 54.445 22.111  1.00 30.65  ?  81   VAL E N    1 
ATOM   7564  C  CA   . VAL E  1 81 ? 73.883 54.013 21.870  1.00 30.44  ?  81   VAL E CA   1 
ATOM   7565  C  C    . VAL E  1 81 ? 73.910 52.993 20.745  1.00 32.31  ?  81   VAL E C    1 
ATOM   7566  O  O    . VAL E  1 81 ? 73.016 52.156 20.628  1.00 34.85  ?  81   VAL E O    1 
ATOM   7567  C  CB   . VAL E  1 81 ? 74.516 53.408 23.136  1.00 30.80  ?  81   VAL E CB   1 
ATOM   7568  C  CG1  . VAL E  1 81 ? 75.912 52.888 22.839  1.00 31.76  ?  81   VAL E CG1  1 
ATOM   7569  C  CG2  . VAL E  1 81 ? 74.555 54.446 24.247  1.00 30.50  ?  81   VAL E CG2  1 
ATOM   7570  H  H    . VAL E  1 81 ? 71.998 53.826 22.412  1.00 36.78  ?  81   VAL E H    1 
ATOM   7571  H  HA   . VAL E  1 81 ? 74.421 54.785 21.597  1.00 36.53  ?  81   VAL E HA   1 
ATOM   7572  H  HB   . VAL E  1 81 ? 73.968 52.655 23.441  1.00 36.96  ?  81   VAL E HB   1 
ATOM   7573  H  HG11 . VAL E  1 81 ? 76.457 53.616 22.531  1.00 38.11  ?  81   VAL E HG11 1 
ATOM   7574  H  HG12 . VAL E  1 81 ? 76.285 52.517 23.642  1.00 38.11  ?  81   VAL E HG12 1 
ATOM   7575  H  HG13 . VAL E  1 81 ? 75.855 52.211 22.161  1.00 38.11  ?  81   VAL E HG13 1 
ATOM   7576  H  HG21 . VAL E  1 81 ? 73.659 54.729 24.442  1.00 36.60  ?  81   VAL E HG21 1 
ATOM   7577  H  HG22 . VAL E  1 81 ? 74.952 54.053 25.028  1.00 36.60  ?  81   VAL E HG22 1 
ATOM   7578  H  HG23 . VAL E  1 81 ? 75.079 55.196 23.955  1.00 36.60  ?  81   VAL E HG23 1 
ATOM   7579  N  N    . GLU E  1 82 ? 74.948 53.072 19.921  1.00 31.53  ?  82   GLU E N    1 
ATOM   7580  C  CA   . GLU E  1 82 ? 75.041 52.257 18.723  1.00 32.07  ?  82   GLU E CA   1 
ATOM   7581  C  C    . GLU E  1 82 ? 76.507 52.053 18.353  1.00 33.93  ?  82   GLU E C    1 
ATOM   7582  O  O    . GLU E  1 82 ? 77.234 53.021 18.126  1.00 32.33  ?  82   GLU E O    1 
ATOM   7583  C  CB   . GLU E  1 82 ? 74.292 52.952 17.586  1.00 32.13  ?  82   GLU E CB   1 
ATOM   7584  C  CG   . GLU E  1 82 ? 74.420 52.296 16.229  1.00 34.60  ?  82   GLU E CG   1 
ATOM   7585  C  CD   . GLU E  1 82 ? 73.708 53.089 15.148  1.00 37.05  ?  82   GLU E CD   1 
ATOM   7586  O  OE1  . GLU E  1 82 ? 72.847 53.926 15.497  1.00 37.54  ?  82   GLU E OE1  1 
ATOM   7587  O  OE2  . GLU E  1 82 ? 74.015 52.883 13.954  1.00 39.08  ?  82   GLU E OE2  1 
ATOM   7588  H  H    . GLU E  1 82 ? 75.619 53.597 20.038  1.00 37.84  ?  82   GLU E H    1 
ATOM   7589  H  HA   . GLU E  1 82 ? 74.631 51.382 18.884  1.00 38.48  ?  82   GLU E HA   1 
ATOM   7590  H  HB2  . GLU E  1 82 ? 73.349 52.977 17.810  1.00 38.56  ?  82   GLU E HB2  1 
ATOM   7591  H  HB3  . GLU E  1 82 ? 74.630 53.858 17.505  1.00 38.56  ?  82   GLU E HB3  1 
ATOM   7592  H  HG2  . GLU E  1 82 ? 75.358 52.235 15.991  1.00 41.52  ?  82   GLU E HG2  1 
ATOM   7593  H  HG3  . GLU E  1 82 ? 74.025 51.411 16.265  1.00 41.52  ?  82   GLU E HG3  1 
ATOM   7594  N  N    . PRO E  1 83 ? 76.953 50.790 18.298  1.00 36.12  ?  83   PRO E N    1 
ATOM   7595  C  CA   . PRO E  1 83 ? 78.353 50.518 17.960  1.00 38.41  ?  83   PRO E CA   1 
ATOM   7596  C  C    . PRO E  1 83 ? 78.643 50.765 16.485  1.00 37.20  ?  83   PRO E C    1 
ATOM   7597  O  O    . PRO E  1 83 ? 77.802 50.466 15.636  1.00 39.32  ?  83   PRO E O    1 
ATOM   7598  C  CB   . PRO E  1 83 ? 78.507 49.034 18.293  1.00 39.87  ?  83   PRO E CB   1 
ATOM   7599  C  CG   . PRO E  1 83 ? 77.144 48.471 18.115  1.00 39.44  ?  83   PRO E CG   1 
ATOM   7600  C  CD   . PRO E  1 83 ? 76.192 49.552 18.538  1.00 38.00  ?  83   PRO E CD   1 
ATOM   7601  H  HA   . PRO E  1 83 ? 78.959 51.050 18.517  1.00 46.09  ?  83   PRO E HA   1 
ATOM   7602  H  HB2  . PRO E  1 83 ? 79.133 48.622 17.677  1.00 47.84  ?  83   PRO E HB2  1 
ATOM   7603  H  HB3  . PRO E  1 83 ? 78.805 48.931 19.210  1.00 47.84  ?  83   PRO E HB3  1 
ATOM   7604  H  HG2  . PRO E  1 83 ? 77.007 48.243 17.182  1.00 47.32  ?  83   PRO E HG2  1 
ATOM   7605  H  HG3  . PRO E  1 83 ? 77.041 47.687 18.677  1.00 47.32  ?  83   PRO E HG3  1 
ATOM   7606  H  HD2  . PRO E  1 83 ? 75.393 49.534 17.988  1.00 45.60  ?  83   PRO E HD2  1 
ATOM   7607  H  HD3  . PRO E  1 83 ? 75.978 49.464 19.480  1.00 45.60  ?  83   PRO E HD3  1 
ATOM   7608  N  N    . LEU E  1 84 ? 79.817 51.316 16.194  1.00 31.90  ?  84   LEU E N    1 
ATOM   7609  C  CA   . LEU E  1 84 ? 80.236 51.553 14.819  1.00 30.16  ?  84   LEU E CA   1 
ATOM   7610  C  C    . LEU E  1 84 ? 81.442 50.680 14.487  1.00 34.09  ?  84   LEU E C    1 
ATOM   7611  O  O    . LEU E  1 84 ? 82.369 50.558 15.288  1.00 34.24  ?  84   LEU E O    1 
ATOM   7612  C  CB   . LEU E  1 84 ? 80.601 53.025 14.615  1.00 28.63  ?  84   LEU E CB   1 
ATOM   7613  C  CG   . LEU E  1 84 ? 79.501 54.066 14.823  1.00 28.53  ?  84   LEU E CG   1 
ATOM   7614  C  CD1  . LEU E  1 84 ? 80.093 55.466 14.743  1.00 29.89  ?  84   LEU E CD1  1 
ATOM   7615  C  CD2  . LEU E  1 84 ? 78.385 53.898 13.803  1.00 27.94  ?  84   LEU E CD2  1 
ATOM   7616  H  H    . LEU E  1 84 ? 80.394 51.563 16.781  1.00 38.28  ?  84   LEU E H    1 
ATOM   7617  H  HA   . LEU E  1 84 ? 79.505 51.324 14.208  1.00 36.19  ?  84   LEU E HA   1 
ATOM   7618  H  HB2  . LEU E  1 84 ? 81.318 53.244 15.231  1.00 34.35  ?  84   LEU E HB2  1 
ATOM   7619  H  HB3  . LEU E  1 84 ? 80.922 53.130 13.705  1.00 34.35  ?  84   LEU E HB3  1 
ATOM   7620  H  HG   . LEU E  1 84 ? 79.120 53.951 15.707  1.00 34.23  ?  84   LEU E HG   1 
ATOM   7621  H  HD11 . LEU E  1 84 ? 80.490 55.588 13.878  1.00 35.87  ?  84   LEU E HD11 1 
ATOM   7622  H  HD12 . LEU E  1 84 ? 79.392 56.109 14.875  1.00 35.87  ?  84   LEU E HD12 1 
ATOM   7623  H  HD13 . LEU E  1 84 ? 80.759 55.562 15.427  1.00 35.87  ?  84   LEU E HD13 1 
ATOM   7624  H  HD21 . LEU E  1 84 ? 78.005 53.022 13.898  1.00 33.53  ?  84   LEU E HD21 1 
ATOM   7625  H  HD22 . LEU E  1 84 ? 77.714 54.566 13.963  1.00 33.53  ?  84   LEU E HD22 1 
ATOM   7626  H  HD23 . LEU E  1 84 ? 78.749 54.004 12.922  1.00 33.53  ?  84   LEU E HD23 1 
ATOM   7627  N  N    . SER E  1 85 ? 81.423 50.075 13.305  1.00 37.46  ?  85   SER E N    1 
ATOM   7628  C  CA   . SER E  1 85 ? 82.537 49.255 12.847  1.00 41.42  ?  85   SER E CA   1 
ATOM   7629  C  C    . SER E  1 85 ? 83.298 49.970 11.739  1.00 41.10  ?  85   SER E C    1 
ATOM   7630  O  O    . SER E  1 85 ? 82.796 50.923 11.142  1.00 42.02  ?  85   SER E O    1 
ATOM   7631  C  CB   . SER E  1 85 ? 82.037 47.902 12.335  1.00 42.82  ?  85   SER E CB   1 
ATOM   7632  O  OG   . SER E  1 85 ? 81.486 47.127 13.384  1.00 44.08  ?  85   SER E OG   1 
ATOM   7633  H  H    . SER E  1 85 ? 80.772 50.124 12.745  1.00 44.95  ?  85   SER E H    1 
ATOM   7634  H  HA   . SER E  1 85 ? 83.153 49.095 13.592  1.00 49.71  ?  85   SER E HA   1 
ATOM   7635  H  HB2  . SER E  1 85 ? 81.353 48.053 11.664  1.00 51.38  ?  85   SER E HB2  1 
ATOM   7636  H  HB3  . SER E  1 85 ? 82.781 47.418 11.945  1.00 51.38  ?  85   SER E HB3  1 
ATOM   7637  H  HG   . SER E  1 85 ? 81.530 47.541 14.091  1.00 52.90  ?  85   SER E HG   1 
ATOM   7638  N  N    . HIS E  1 86 ? 84.513 49.506 11.472  1.00 37.75  ?  86   HIS E N    1 
ATOM   7639  C  CA   . HIS E  1 86 ? 85.315 50.047 10.387  1.00 38.55  ?  86   HIS E CA   1 
ATOM   7640  C  C    . HIS E  1 86 ? 84.710 49.652 9.046   1.00 35.15  ?  86   HIS E C    1 
ATOM   7641  O  O    . HIS E  1 86 ? 84.362 48.490 8.832   1.00 36.03  ?  86   HIS E O    1 
ATOM   7642  C  CB   . HIS E  1 86 ? 86.750 49.531 10.481  1.00 44.80  ?  86   HIS E CB   1 
ATOM   7643  C  CG   . HIS E  1 86 ? 87.605 49.914 9.315   1.00 50.23  ?  86   HIS E CG   1 
ATOM   7644  N  ND1  . HIS E  1 86 ? 88.320 51.091 9.270   1.00 53.67  ?  86   HIS E ND1  1 
ATOM   7645  C  CD2  . HIS E  1 86 ? 87.853 49.279 8.145   1.00 51.14  ?  86   HIS E CD2  1 
ATOM   7646  C  CE1  . HIS E  1 86 ? 88.976 51.162 8.126   1.00 54.30  ?  86   HIS E CE1  1 
ATOM   7647  N  NE2  . HIS E  1 86 ? 88.709 50.075 7.424   1.00 52.78  ?  86   HIS E NE2  1 
ATOM   7648  H  H    . HIS E  1 86 ? 84.897 48.872 11.909  1.00 45.30  ?  86   HIS E H    1 
ATOM   7649  H  HA   . HIS E  1 86 ? 85.330 51.025 10.447  1.00 46.25  ?  86   HIS E HA   1 
ATOM   7650  H  HB2  . HIS E  1 86 ? 87.161 49.893 11.282  1.00 53.76  ?  86   HIS E HB2  1 
ATOM   7651  H  HB3  . HIS E  1 86 ? 86.732 48.562 10.531  1.00 53.76  ?  86   HIS E HB3  1 
ATOM   7652  H  HD1  . HIS E  1 86 ? 88.339 51.685 9.892   1.00 64.40  ?  86   HIS E HD1  1 
ATOM   7653  H  HD2  . HIS E  1 86 ? 87.509 48.456 7.880   1.00 61.37  ?  86   HIS E HD2  1 
ATOM   7654  H  HE1  . HIS E  1 86 ? 89.531 51.860 7.858   1.00 65.16  ?  86   HIS E HE1  1 
ATOM   7655  H  HE2  . HIS E  1 86 ? 89.021 49.895 6.643   1.00 63.34  ?  86   HIS E HE2  1 
ATOM   7656  N  N    . HIS E  1 87 ? 84.583 50.622 8.146   1.00 34.74  ?  87   HIS E N    1 
ATOM   7657  C  CA   . HIS E  1 87 ? 84.036 50.369 6.818   1.00 32.72  ?  87   HIS E CA   1 
ATOM   7658  C  C    . HIS E  1 87 ? 85.170 49.994 5.865   1.00 33.82  ?  87   HIS E C    1 
ATOM   7659  O  O    . HIS E  1 87 ? 86.173 50.700 5.787   1.00 33.52  ?  87   HIS E O    1 
ATOM   7660  C  CB   . HIS E  1 87 ? 83.305 51.613 6.301   1.00 31.80  ?  87   HIS E CB   1 
ATOM   7661  C  CG   . HIS E  1 87 ? 82.136 51.309 5.414   1.00 31.14  ?  87   HIS E CG   1 
ATOM   7662  N  ND1  . HIS E  1 87 ? 82.271 50.974 4.083   1.00 32.26  ?  87   HIS E ND1  1 
ATOM   7663  C  CD2  . HIS E  1 87 ? 80.806 51.299 5.668   1.00 31.24  ?  87   HIS E CD2  1 
ATOM   7664  C  CE1  . HIS E  1 87 ? 81.077 50.765 3.557   1.00 32.46  ?  87   HIS E CE1  1 
ATOM   7665  N  NE2  . HIS E  1 87 ? 80.171 50.956 4.498   1.00 31.89  ?  87   HIS E NE2  1 
ATOM   7666  H  H    . HIS E  1 87 ? 84.809 51.441 8.282   1.00 41.68  ?  87   HIS E H    1 
ATOM   7667  H  HA   . HIS E  1 87 ? 83.399 49.625 6.859   1.00 39.26  ?  87   HIS E HA   1 
ATOM   7668  H  HB2  . HIS E  1 87 ? 82.975 52.119 7.061   1.00 38.15  ?  87   HIS E HB2  1 
ATOM   7669  H  HB3  . HIS E  1 87 ? 83.929 52.154 5.793   1.00 38.15  ?  87   HIS E HB3  1 
ATOM   7670  H  HD1  . HIS E  1 87 ? 83.018 50.908 3.661   1.00 38.72  ?  87   HIS E HD1  1 
ATOM   7671  H  HD2  . HIS E  1 87 ? 80.398 51.486 6.482   1.00 37.49  ?  87   HIS E HD2  1 
ATOM   7672  H  HE1  . HIS E  1 87 ? 80.905 50.526 2.676   1.00 38.95  ?  87   HIS E HE1  1 
ATOM   7673  H  HE2  . HIS E  1 87 ? 79.321 50.879 4.395   1.00 38.27  ?  87   HIS E HE2  1 
ATOM   7674  N  N    . PRO E  1 88 ? 85.015 48.881 5.131   1.00 32.24  ?  88   PRO E N    1 
ATOM   7675  C  CA   . PRO E  1 88 ? 86.056 48.427 4.196   1.00 35.88  ?  88   PRO E CA   1 
ATOM   7676  C  C    . PRO E  1 88 ? 86.284 49.383 3.021   1.00 36.36  ?  88   PRO E C    1 
ATOM   7677  O  O    . PRO E  1 88 ? 87.176 49.153 2.206   1.00 36.52  ?  88   PRO E O    1 
ATOM   7678  C  CB   . PRO E  1 88 ? 85.515 47.085 3.691   1.00 35.32  ?  88   PRO E CB   1 
ATOM   7679  C  CG   . PRO E  1 88 ? 84.043 47.151 3.912   1.00 32.63  ?  88   PRO E CG   1 
ATOM   7680  C  CD   . PRO E  1 88 ? 83.853 47.975 5.146   1.00 31.36  ?  88   PRO E CD   1 
ATOM   7681  H  HA   . PRO E  1 88 ? 86.902 48.281 4.669   1.00 43.05  ?  88   PRO E HA   1 
ATOM   7682  H  HB2  . PRO E  1 88 ? 85.716 46.986 2.747   1.00 42.38  ?  88   PRO E HB2  1 
ATOM   7683  H  HB3  . PRO E  1 88 ? 85.906 46.361 4.204   1.00 42.38  ?  88   PRO E HB3  1 
ATOM   7684  H  HG2  . PRO E  1 88 ? 83.618 47.576 3.150   1.00 39.15  ?  88   PRO E HG2  1 
ATOM   7685  H  HG3  . PRO E  1 88 ? 83.693 46.256 4.043   1.00 39.15  ?  88   PRO E HG3  1 
ATOM   7686  H  HD2  . PRO E  1 88 ? 83.028 48.482 5.091   1.00 37.63  ?  88   PRO E HD2  1 
ATOM   7687  H  HD3  . PRO E  1 88 ? 83.873 47.412 5.935   1.00 37.63  ?  88   PRO E HD3  1 
ATOM   7688  N  N    . ALA E  1 89 ? 85.494 50.448 2.952   1.00 38.82  ?  89   ALA E N    1 
ATOM   7689  C  CA   . ALA E  1 89 ? 85.581 51.410 1.860   1.00 40.65  ?  89   ALA E CA   1 
ATOM   7690  C  C    . ALA E  1 89 ? 86.070 52.750 2.393   1.00 38.73  ?  89   ALA E C    1 
ATOM   7691  O  O    . ALA E  1 89 ? 86.176 53.724 1.646   1.00 40.43  ?  89   ALA E O    1 
ATOM   7692  C  CB   . ALA E  1 89 ? 84.229 51.570 1.176   1.00 40.78  ?  89   ALA E CB   1 
ATOM   7693  H  H    . ALA E  1 89 ? 84.890 50.638 3.534   1.00 46.58  ?  89   ALA E H    1 
ATOM   7694  H  HA   . ALA E  1 89 ? 86.226 51.089 1.196   1.00 48.78  ?  89   ALA E HA   1 
ATOM   7695  H  HB1  . ALA E  1 89 ? 83.588 51.882 1.820   1.00 48.94  ?  89   ALA E HB1  1 
ATOM   7696  H  HB2  . ALA E  1 89 ? 84.313 52.208 0.463   1.00 48.94  ?  89   ALA E HB2  1 
ATOM   7697  H  HB3  . ALA E  1 89 ? 83.954 50.720 0.825   1.00 48.94  ?  89   ALA E HB3  1 
ATOM   7698  N  N    . ARG E  1 90 ? 86.358 52.797 3.691   1.00 34.95  ?  90   ARG E N    1 
ATOM   7699  C  CA   . ARG E  1 90 ? 86.925 53.987 4.306   1.00 35.13  ?  90   ARG E CA   1 
ATOM   7700  C  C    . ARG E  1 90 ? 88.312 54.238 3.731   1.00 40.17  ?  90   ARG E C    1 
ATOM   7701  O  O    . ARG E  1 90 ? 89.107 53.310 3.585   1.00 39.54  ?  90   ARG E O    1 
ATOM   7702  C  CB   . ARG E  1 90 ? 87.008 53.811 5.824   1.00 34.99  ?  90   ARG E CB   1 
ATOM   7703  C  CG   . ARG E  1 90 ? 87.604 55.002 6.565   1.00 35.00  ?  90   ARG E CG   1 
ATOM   7704  C  CD   . ARG E  1 90 ? 86.800 56.272 6.329   1.00 34.35  ?  90   ARG E CD   1 
ATOM   7705  N  NE   . ARG E  1 90 ? 87.372 57.419 7.028   1.00 36.26  ?  90   ARG E NE   1 
ATOM   7706  C  CZ   . ARG E  1 90 ? 87.063 58.688 6.774   1.00 36.81  ?  90   ARG E CZ   1 
ATOM   7707  N  NH1  . ARG E  1 90 ? 86.185 58.990 5.827   1.00 36.32  ?  90   ARG E NH1  1 
ATOM   7708  N  NH2  . ARG E  1 90 ? 87.639 59.661 7.466   1.00 37.64  ?  90   ARG E NH2  1 
ATOM   7709  H  H    . ARG E  1 90 ? 86.233 52.146 4.239   1.00 41.94  ?  90   ARG E H    1 
ATOM   7710  H  HA   . ARG E  1 90 ? 86.358 54.762 4.109   1.00 42.15  ?  90   ARG E HA   1 
ATOM   7711  H  HB2  . ARG E  1 90 ? 86.112 53.668 6.169   1.00 41.99  ?  90   ARG E HB2  1 
ATOM   7712  H  HB3  . ARG E  1 90 ? 87.560 53.038 6.017   1.00 41.99  ?  90   ARG E HB3  1 
ATOM   7713  H  HG2  . ARG E  1 90 ? 87.606 54.817 7.517   1.00 42.00  ?  90   ARG E HG2  1 
ATOM   7714  H  HG3  . ARG E  1 90 ? 88.509 55.153 6.251   1.00 42.00  ?  90   ARG E HG3  1 
ATOM   7715  H  HD2  . ARG E  1 90 ? 86.790 56.470 5.379   1.00 41.22  ?  90   ARG E HD2  1 
ATOM   7716  H  HD3  . ARG E  1 90 ? 85.895 56.141 6.653   1.00 41.22  ?  90   ARG E HD3  1 
ATOM   7717  H  HE   . ARG E  1 90 ? 87.949 57.264 7.647   1.00 43.51  ?  90   ARG E HE   1 
ATOM   7718  H  HH11 . ARG E  1 90 ? 85.808 58.363 5.374   1.00 43.58  ?  90   ARG E HH11 1 
ATOM   7719  H  HH12 . ARG E  1 90 ? 85.990 59.812 5.667   1.00 43.58  ?  90   ARG E HH12 1 
ATOM   7720  H  HH21 . ARG E  1 90 ? 88.210 59.472 8.081   1.00 45.17  ?  90   ARG E HH21 1 
ATOM   7721  H  HH22 . ARG E  1 90 ? 87.440 60.482 7.302   1.00 45.17  ?  90   ARG E HH22 1 
ATOM   7722  N  N    . VAL E  1 91 ? 88.594 55.493 3.397   1.00 43.22  ?  91   VAL E N    1 
ATOM   7723  C  CA   . VAL E  1 91 ? 89.890 55.869 2.845   1.00 49.85  ?  91   VAL E CA   1 
ATOM   7724  C  C    . VAL E  1 91 ? 90.710 56.623 3.885   1.00 51.54  ?  91   VAL E C    1 
ATOM   7725  O  O    . VAL E  1 91 ? 90.170 57.409 4.665   1.00 51.29  ?  91   VAL E O    1 
ATOM   7726  C  CB   . VAL E  1 91 ? 89.728 56.750 1.591   1.00 52.29  ?  91   VAL E CB   1 
ATOM   7727  C  CG1  . VAL E  1 91 ? 91.078 57.284 1.132   1.00 55.87  ?  91   VAL E CG1  1 
ATOM   7728  C  CG2  . VAL E  1 91 ? 89.051 55.966 0.475   1.00 52.52  ?  91   VAL E CG2  1 
ATOM   7729  H  H    . VAL E  1 91 ? 88.046 56.150 3.481   1.00 51.86  ?  91   VAL E H    1 
ATOM   7730  H  HA   . VAL E  1 91 ? 90.381 55.060 2.592   1.00 59.82  ?  91   VAL E HA   1 
ATOM   7731  H  HB   . VAL E  1 91 ? 89.159 57.516 1.811   1.00 62.75  ?  91   VAL E HB   1 
ATOM   7732  H  HG11 . VAL E  1 91 ? 91.653 56.544 0.924   1.00 67.05  ?  91   VAL E HG11 1 
ATOM   7733  H  HG12 . VAL E  1 91 ? 90.949 57.828 0.352   1.00 67.05  ?  91   VAL E HG12 1 
ATOM   7734  H  HG13 . VAL E  1 91 ? 91.462 57.809 1.838   1.00 67.05  ?  91   VAL E HG13 1 
ATOM   7735  H  HG21 . VAL E  1 91 ? 88.185 55.681 0.776   1.00 63.03  ?  91   VAL E HG21 1 
ATOM   7736  H  HG22 . VAL E  1 91 ? 88.961 56.533 -0.294  1.00 63.03  ?  91   VAL E HG22 1 
ATOM   7737  H  HG23 . VAL E  1 91 ? 89.590 55.202 0.259   1.00 63.03  ?  91   VAL E HG23 1 
ATOM   7738  N  N    . MET F  1 1  ? 61.673 27.920 33.677  1.00 44.79  ?  1    MET F N    1 
ATOM   7739  C  CA   . MET F  1 1  ? 61.196 28.640 32.462  1.00 44.88  ?  1    MET F CA   1 
ATOM   7740  C  C    . MET F  1 1  ? 61.901 29.984 32.344  1.00 40.22  ?  1    MET F C    1 
ATOM   7741  O  O    . MET F  1 1  ? 61.977 30.744 33.310  1.00 40.24  ?  1    MET F O    1 
ATOM   7742  C  CB   . MET F  1 1  ? 59.688 28.862 32.530  1.00 48.75  ?  1    MET F CB   1 
ATOM   7743  C  CG   . MET F  1 1  ? 58.903 27.640 32.967  1.00 53.45  ?  1    MET F CG   1 
ATOM   7744  S  SD   . MET F  1 1  ? 57.703 27.130 31.731  1.00 70.16  ?  1    MET F SD   1 
ATOM   7745  C  CE   . MET F  1 1  ? 56.707 28.613 31.602  1.00 49.37  ?  1    MET F CE   1 
ATOM   7746  H  H1   . MET F  1 1  ? 62.572 28.190 33.877  1.00 53.75  ?  1    MET F H1   1 
ATOM   7747  H  H2   . MET F  1 1  ? 61.103 28.133 34.420  1.00 53.75  ?  1    MET F H2   1 
ATOM   7748  H  H3   . MET F  1 1  ? 61.652 26.974 33.518  1.00 53.75  ?  1    MET F H3   1 
ATOM   7749  H  HA   . MET F  1 1  ? 61.393 28.100 31.668  1.00 53.86  ?  1    MET F HA   1 
ATOM   7750  H  HB2  . MET F  1 1  ? 59.505 29.573 33.164  1.00 58.50  ?  1    MET F HB2  1 
ATOM   7751  H  HB3  . MET F  1 1  ? 59.370 29.118 31.650  1.00 58.50  ?  1    MET F HB3  1 
ATOM   7752  H  HG2  . MET F  1 1  ? 59.517 26.903 33.113  1.00 64.14  ?  1    MET F HG2  1 
ATOM   7753  H  HG3  . MET F  1 1  ? 58.426 27.844 33.786  1.00 64.14  ?  1    MET F HG3  1 
ATOM   7754  H  HE1  . MET F  1 1  ? 57.266 29.341 31.322  1.00 59.25  ?  1    MET F HE1  1 
ATOM   7755  H  HE2  . MET F  1 1  ? 56.011 28.466 30.956  1.00 59.25  ?  1    MET F HE2  1 
ATOM   7756  H  HE3  . MET F  1 1  ? 56.322 28.806 32.460  1.00 59.25  ?  1    MET F HE3  1 
ATOM   7757  N  N    . LEU F  1 2  ? 62.405 30.278 31.153  1.00 37.20  ?  2    LEU F N    1 
ATOM   7758  C  CA   . LEU F  1 2  ? 63.187 31.486 30.938  1.00 34.49  ?  2    LEU F CA   1 
ATOM   7759  C  C    . LEU F  1 2  ? 62.349 32.615 30.342  1.00 33.95  ?  2    LEU F C    1 
ATOM   7760  O  O    . LEU F  1 2  ? 61.505 32.388 29.475  1.00 33.18  ?  2    LEU F O    1 
ATOM   7761  C  CB   . LEU F  1 2  ? 64.379 31.176 30.029  1.00 34.77  ?  2    LEU F CB   1 
ATOM   7762  C  CG   . LEU F  1 2  ? 65.302 30.074 30.558  1.00 37.25  ?  2    LEU F CG   1 
ATOM   7763  C  CD1  . LEU F  1 2  ? 66.363 29.710 29.530  1.00 39.98  ?  2    LEU F CD1  1 
ATOM   7764  C  CD2  . LEU F  1 2  ? 65.948 30.497 31.869  1.00 37.10  ?  2    LEU F CD2  1 
ATOM   7765  H  H    . LEU F  1 2  ? 62.307 29.793 30.450  1.00 44.64  ?  2    LEU F H    1 
ATOM   7766  H  HA   . LEU F  1 2  ? 63.538 31.794 31.800  1.00 41.39  ?  2    LEU F HA   1 
ATOM   7767  H  HB2  . LEU F  1 2  ? 64.044 30.890 29.165  1.00 41.72  ?  2    LEU F HB2  1 
ATOM   7768  H  HB3  . LEU F  1 2  ? 64.909 31.981 29.926  1.00 41.72  ?  2    LEU F HB3  1 
ATOM   7769  H  HG   . LEU F  1 2  ? 64.773 29.280 30.731  1.00 44.70  ?  2    LEU F HG   1 
ATOM   7770  H  HD11 . LEU F  1 2  ? 66.888 30.489 29.334  1.00 47.98  ?  2    LEU F HD11 1 
ATOM   7771  H  HD12 . LEU F  1 2  ? 66.923 29.019 29.892  1.00 47.98  ?  2    LEU F HD12 1 
ATOM   7772  H  HD13 . LEU F  1 2  ? 65.930 29.397 28.733  1.00 47.98  ?  2    LEU F HD13 1 
ATOM   7773  H  HD21 . LEU F  1 2  ? 65.259 30.666 32.516  1.00 44.52  ?  2    LEU F HD21 1 
ATOM   7774  H  HD22 . LEU F  1 2  ? 66.520 29.790 32.177  1.00 44.52  ?  2    LEU F HD22 1 
ATOM   7775  H  HD23 . LEU F  1 2  ? 66.462 31.294 31.721  1.00 44.52  ?  2    LEU F HD23 1 
ATOM   7776  N  N    . TYR F  1 3  ? 62.586 33.831 30.828  1.00 33.95  ?  3    TYR F N    1 
ATOM   7777  C  CA   . TYR F  1 3  ? 61.975 35.026 30.261  1.00 31.54  ?  3    TYR F CA   1 
ATOM   7778  C  C    . TYR F  1 3  ? 63.047 36.087 30.064  1.00 31.32  ?  3    TYR F C    1 
ATOM   7779  O  O    . TYR F  1 3  ? 63.865 36.321 30.955  1.00 32.20  ?  3    TYR F O    1 
ATOM   7780  C  CB   . TYR F  1 3  ? 60.907 35.606 31.192  1.00 30.41  ?  3    TYR F CB   1 
ATOM   7781  C  CG   . TYR F  1 3  ? 59.807 34.657 31.607  1.00 30.68  ?  3    TYR F CG   1 
ATOM   7782  C  CD1  . TYR F  1 3  ? 60.048 33.642 32.526  1.00 31.93  ?  3    TYR F CD1  1 
ATOM   7783  C  CD2  . TYR F  1 3  ? 58.515 34.802 31.112  1.00 30.50  ?  3    TYR F CD2  1 
ATOM   7784  C  CE1  . TYR F  1 3  ? 59.042 32.783 32.922  1.00 32.17  ?  3    TYR F CE1  1 
ATOM   7785  C  CE2  . TYR F  1 3  ? 57.500 33.948 31.503  1.00 30.95  ?  3    TYR F CE2  1 
ATOM   7786  C  CZ   . TYR F  1 3  ? 57.770 32.940 32.409  1.00 30.83  ?  3    TYR F CZ   1 
ATOM   7787  O  OH   . TYR F  1 3  ? 56.769 32.084 32.806  1.00 30.30  ?  3    TYR F OH   1 
ATOM   7788  H  H    . TYR F  1 3  ? 63.104 33.991 31.495  1.00 40.74  ?  3    TYR F H    1 
ATOM   7789  H  HA   . TYR F  1 3  ? 61.567 34.818 29.395  1.00 37.84  ?  3    TYR F HA   1 
ATOM   7790  H  HB2  . TYR F  1 3  ? 61.343 35.915 32.001  1.00 36.49  ?  3    TYR F HB2  1 
ATOM   7791  H  HB3  . TYR F  1 3  ? 60.487 36.357 30.745  1.00 36.49  ?  3    TYR F HB3  1 
ATOM   7792  H  HD1  . TYR F  1 3  ? 60.904 33.534 32.873  1.00 38.31  ?  3    TYR F HD1  1 
ATOM   7793  H  HD2  . TYR F  1 3  ? 58.333 35.480 30.502  1.00 36.60  ?  3    TYR F HD2  1 
ATOM   7794  H  HE1  . TYR F  1 3  ? 59.219 32.104 33.532  1.00 38.60  ?  3    TYR F HE1  1 
ATOM   7795  H  HE2  . TYR F  1 3  ? 56.642 34.051 31.158  1.00 37.14  ?  3    TYR F HE2  1 
ATOM   7796  H  HH   . TYR F  1 3  ? 56.662 32.135 33.617  1.00 36.36  ?  3    TYR F HH   1 
ATOM   7797  N  N    . LEU F  1 4  ? 63.043 36.731 28.903  1.00 31.02  ?  4    LEU F N    1 
ATOM   7798  C  CA   . LEU F  1 4  ? 63.863 37.916 28.701  1.00 31.11  ?  4    LEU F CA   1 
ATOM   7799  C  C    . LEU F  1 4  ? 63.080 39.125 29.195  1.00 29.43  ?  4    LEU F C    1 
ATOM   7800  O  O    . LEU F  1 4  ? 61.963 39.382 28.738  1.00 29.67  ?  4    LEU F O    1 
ATOM   7801  C  CB   . LEU F  1 4  ? 64.224 38.091 27.227  1.00 32.66  ?  4    LEU F CB   1 
ATOM   7802  C  CG   . LEU F  1 4  ? 65.116 39.300 26.938  1.00 34.87  ?  4    LEU F CG   1 
ATOM   7803  C  CD1  . LEU F  1 4  ? 66.513 39.079 27.502  1.00 36.56  ?  4    LEU F CD1  1 
ATOM   7804  C  CD2  . LEU F  1 4  ? 65.168 39.592 25.447  1.00 36.00  ?  4    LEU F CD2  1 
ATOM   7805  H  H    . LEU F  1 4  ? 62.576 36.503 28.219  1.00 37.23  ?  4    LEU F H    1 
ATOM   7806  H  HA   . LEU F  1 4  ? 64.690 37.841 29.222  1.00 37.33  ?  4    LEU F HA   1 
ATOM   7807  H  HB2  . LEU F  1 4  ? 64.695 37.298 26.926  1.00 39.19  ?  4    LEU F HB2  1 
ATOM   7808  H  HB3  . LEU F  1 4  ? 63.406 38.200 26.718  1.00 39.19  ?  4    LEU F HB3  1 
ATOM   7809  H  HG   . LEU F  1 4  ? 64.739 40.078 27.379  1.00 41.84  ?  4    LEU F HG   1 
ATOM   7810  H  HD11 . LEU F  1 4  ? 66.895 38.300 27.092  1.00 43.87  ?  4    LEU F HD11 1 
ATOM   7811  H  HD12 . LEU F  1 4  ? 67.053 39.849 27.308  1.00 43.87  ?  4    LEU F HD12 1 
ATOM   7812  H  HD13 . LEU F  1 4  ? 66.451 38.953 28.451  1.00 43.87  ?  4    LEU F HD13 1 
ATOM   7813  H  HD21 . LEU F  1 4  ? 64.280 39.778 25.134  1.00 43.20  ?  4    LEU F HD21 1 
ATOM   7814  H  HD22 . LEU F  1 4  ? 65.734 40.354 25.299  1.00 43.20  ?  4    LEU F HD22 1 
ATOM   7815  H  HD23 . LEU F  1 4  ? 65.523 38.826 24.991  1.00 43.20  ?  4    LEU F HD23 1 
ATOM   7816  N  N    . VAL F  1 5  ? 63.662 39.865 30.130  1.00 27.22  ?  5    VAL F N    1 
ATOM   7817  C  CA   . VAL F  1 5  ? 62.964 40.978 30.758  1.00 26.77  ?  5    VAL F CA   1 
ATOM   7818  C  C    . VAL F  1 5  ? 63.773 42.266 30.663  1.00 26.33  ?  5    VAL F C    1 
ATOM   7819  O  O    . VAL F  1 5  ? 64.857 42.374 31.238  1.00 26.74  ?  5    VAL F O    1 
ATOM   7820  C  CB   . VAL F  1 5  ? 62.667 40.679 32.236  1.00 27.27  ?  5    VAL F CB   1 
ATOM   7821  C  CG1  . VAL F  1 5  ? 61.933 41.847 32.882  1.00 26.58  ?  5    VAL F CG1  1 
ATOM   7822  C  CG2  . VAL F  1 5  ? 61.854 39.399 32.360  1.00 28.75  ?  5    VAL F CG2  1 
ATOM   7823  H  H    . VAL F  1 5  ? 64.463 39.742 30.420  1.00 32.66  ?  5    VAL F H    1 
ATOM   7824  H  HA   . VAL F  1 5  ? 62.110 41.120 30.298  1.00 32.12  ?  5    VAL F HA   1 
ATOM   7825  H  HB   . VAL F  1 5  ? 63.513 40.550 32.714  1.00 32.73  ?  5    VAL F HB   1 
ATOM   7826  H  HG11 . VAL F  1 5  ? 61.105 41.991 32.417  1.00 31.90  ?  5    VAL F HG11 1 
ATOM   7827  H  HG12 . VAL F  1 5  ? 61.759 41.636 33.802  1.00 31.90  ?  5    VAL F HG12 1 
ATOM   7828  H  HG13 . VAL F  1 5  ? 62.483 42.632 32.824  1.00 31.90  ?  5    VAL F HG13 1 
ATOM   7829  H  HG21 . VAL F  1 5  ? 62.356 38.673 31.983  1.00 34.50  ?  5    VAL F HG21 1 
ATOM   7830  H  HG22 . VAL F  1 5  ? 61.678 39.229 33.288  1.00 34.50  ?  5    VAL F HG22 1 
ATOM   7831  H  HG23 . VAL F  1 5  ? 61.027 39.507 31.884  1.00 34.50  ?  5    VAL F HG23 1 
ATOM   7832  N  N    . ARG F  1 6  ? 63.237 43.239 29.933  1.00 27.38  ?  6    ARG F N    1 
ATOM   7833  C  CA   . ARG F  1 6  ? 63.883 44.539 29.799  1.00 27.81  ?  6    ARG F CA   1 
ATOM   7834  C  C    . ARG F  1 6  ? 63.276 45.524 30.786  1.00 28.25  ?  6    ARG F C    1 
ATOM   7835  O  O    . ARG F  1 6  ? 62.056 45.676 30.855  1.00 27.35  ?  6    ARG F O    1 
ATOM   7836  C  CB   . ARG F  1 6  ? 63.729 45.071 28.375  1.00 28.49  ?  6    ARG F CB   1 
ATOM   7837  C  CG   . ARG F  1 6  ? 64.361 46.439 28.154  1.00 31.44  ?  6    ARG F CG   1 
ATOM   7838  C  CD   . ARG F  1 6  ? 64.181 46.906 26.717  1.00 33.73  ?  6    ARG F CD   1 
ATOM   7839  N  NE   . ARG F  1 6  ? 64.764 45.966 25.762  1.00 35.33  ?  6    ARG F NE   1 
ATOM   7840  C  CZ   . ARG F  1 6  ? 66.005 46.041 25.289  1.00 38.74  ?  6    ARG F CZ   1 
ATOM   7841  N  NH1  . ARG F  1 6  ? 66.820 47.018 25.669  1.00 41.65  ?  6    ARG F NH1  1 
ATOM   7842  N  NH2  . ARG F  1 6  ? 66.435 45.131 24.426  1.00 39.94  ?  6    ARG F NH2  1 
ATOM   7843  H  H    . ARG F  1 6  ? 62.496 43.171 29.503  1.00 32.85  ?  6    ARG F H    1 
ATOM   7844  H  HA   . ARG F  1 6  ? 64.839 44.451 29.996  1.00 33.38  ?  6    ARG F HA   1 
ATOM   7845  H  HB2  . ARG F  1 6  ? 64.150 44.448 27.762  1.00 34.18  ?  6    ARG F HB2  1 
ATOM   7846  H  HB3  . ARG F  1 6  ? 62.784 45.145 28.169  1.00 34.18  ?  6    ARG F HB3  1 
ATOM   7847  H  HG2  . ARG F  1 6  ? 63.938 47.086 28.740  1.00 37.73  ?  6    ARG F HG2  1 
ATOM   7848  H  HG3  . ARG F  1 6  ? 65.311 46.387 28.340  1.00 37.73  ?  6    ARG F HG3  1 
ATOM   7849  H  HD2  . ARG F  1 6  ? 63.233 46.984 26.523  1.00 40.48  ?  6    ARG F HD2  1 
ATOM   7850  H  HD3  . ARG F  1 6  ? 64.618 47.764 26.603  1.00 40.48  ?  6    ARG F HD3  1 
ATOM   7851  H  HE   . ARG F  1 6  ? 64.270 45.319 25.487  1.00 42.39  ?  6    ARG F HE   1 
ATOM   7852  H  HH11 . ARG F  1 6  ? 66.548 47.612 26.229  1.00 49.98  ?  6    ARG F HH11 1 
ATOM   7853  H  HH12 . ARG F  1 6  ? 67.620 47.057 25.356  1.00 49.98  ?  6    ARG F HH12 1 
ATOM   7854  H  HH21 . ARG F  1 6  ? 65.913 44.496 24.175  1.00 47.93  ?  6    ARG F HH21 1 
ATOM   7855  H  HH22 . ARG F  1 6  ? 67.236 45.177 24.117  1.00 47.93  ?  6    ARG F HH22 1 
ATOM   7856  N  N    . MET F  1 7  ? 64.133 46.192 31.551  1.00 29.32  ?  7    MET F N    1 
ATOM   7857  C  CA   . MET F  1 7  ? 63.678 47.170 32.527  1.00 30.34  ?  7    MET F CA   1 
ATOM   7858  C  C    . MET F  1 7  ? 64.270 48.541 32.235  1.00 32.70  ?  7    MET F C    1 
ATOM   7859  O  O    . MET F  1 7  ? 65.470 48.673 31.995  1.00 34.10  ?  7    MET F O    1 
ATOM   7860  C  CB   . MET F  1 7  ? 64.064 46.732 33.938  1.00 29.86  ?  7    MET F CB   1 
ATOM   7861  C  CG   . MET F  1 7  ? 63.591 45.339 34.299  1.00 29.26  ?  7    MET F CG   1 
ATOM   7862  S  SD   . MET F  1 7  ? 63.777 44.987 36.057  1.00 33.13  ?  7    MET F SD   1 
ATOM   7863  C  CE   . MET F  1 7  ? 63.656 43.200 36.046  1.00 27.59  ?  7    MET F CE   1 
ATOM   7864  H  H    . MET F  1 7  ? 64.987 46.096 31.522  1.00 35.18  ?  7    MET F H    1 
ATOM   7865  H  HA   . MET F  1 7  ? 62.700 47.230 32.486  1.00 36.41  ?  7    MET F HA   1 
ATOM   7866  H  HB2  . MET F  1 7  ? 65.031 46.746 34.015  1.00 35.84  ?  7    MET F HB2  1 
ATOM   7867  H  HB3  . MET F  1 7  ? 63.675 47.352 34.575  1.00 35.84  ?  7    MET F HB3  1 
ATOM   7868  H  HG2  . MET F  1 7  ? 62.652 45.254 34.073  1.00 35.11  ?  7    MET F HG2  1 
ATOM   7869  H  HG3  . MET F  1 7  ? 64.113 44.688 33.805  1.00 35.11  ?  7    MET F HG3  1 
ATOM   7870  H  HE1  . MET F  1 7  ? 64.360 42.843 35.500  1.00 33.11  ?  7    MET F HE1  1 
ATOM   7871  H  HE2  . MET F  1 7  ? 63.741 42.876 36.945  1.00 33.11  ?  7    MET F HE2  1 
ATOM   7872  H  HE3  . MET F  1 7  ? 62.802 42.948 35.686  1.00 33.11  ?  7    MET F HE3  1 
ATOM   7873  N  N    . THR F  1 8  ? 63.416 49.558 32.257  1.00 34.56  ?  8    THR F N    1 
ATOM   7874  C  CA   . THR F  1 8  ? 63.844 50.932 32.038  1.00 37.29  ?  8    THR F CA   1 
ATOM   7875  C  C    . THR F  1 8  ? 63.313 51.815 33.160  1.00 36.89  ?  8    THR F C    1 
ATOM   7876  O  O    . THR F  1 8  ? 62.107 51.868 33.401  1.00 35.90  ?  8    THR F O    1 
ATOM   7877  C  CB   . THR F  1 8  ? 63.341 51.466 30.686  1.00 39.36  ?  8    THR F CB   1 
ATOM   7878  O  OG1  . THR F  1 8  ? 63.836 50.638 29.625  1.00 38.98  ?  8    THR F OG1  1 
ATOM   7879  C  CG2  . THR F  1 8  ? 63.806 52.899 30.467  1.00 42.44  ?  8    THR F CG2  1 
ATOM   7880  H  H    . THR F  1 8  ? 62.571 49.476 32.398  1.00 41.47  ?  8    THR F H    1 
ATOM   7881  H  HA   . THR F  1 8  ? 64.823 50.974 32.045  1.00 44.75  ?  8    THR F HA   1 
ATOM   7882  H  HB   . THR F  1 8  ? 62.371 51.455 30.676  1.00 47.23  ?  8    THR F HB   1 
ATOM   7883  H  HG1  . THR F  1 8  ? 63.573 49.868 29.725  1.00 46.78  ?  8    THR F HG1  1 
ATOM   7884  H  HG21 . THR F  1 8  ? 64.765 52.937 30.473  1.00 50.93  ?  8    THR F HG21 1 
ATOM   7885  H  HG22 . THR F  1 8  ? 63.486 53.222 29.621  1.00 50.93  ?  8    THR F HG22 1 
ATOM   7886  H  HG23 . THR F  1 8  ? 63.466 53.464 31.165  1.00 50.93  ?  8    THR F HG23 1 
ATOM   7887  N  N    . VAL F  1 9  ? 64.219 52.503 33.845  1.00 36.29  ?  9    VAL F N    1 
ATOM   7888  C  CA   . VAL F  1 9  ? 63.850 53.342 34.976  1.00 38.42  ?  9    VAL F CA   1 
ATOM   7889  C  C    . VAL F  1 9  ? 63.593 54.778 34.535  1.00 42.10  ?  9    VAL F C    1 
ATOM   7890  O  O    . VAL F  1 9  ? 64.381 55.358 33.790  1.00 43.90  ?  9    VAL F O    1 
ATOM   7891  C  CB   . VAL F  1 9  ? 64.958 53.354 36.049  1.00 39.69  ?  9    VAL F CB   1 
ATOM   7892  C  CG1  . VAL F  1 9  ? 64.558 54.244 37.218  1.00 41.30  ?  9    VAL F CG1  1 
ATOM   7893  C  CG2  . VAL F  1 9  ? 65.255 51.941 36.528  1.00 38.66  ?  9    VAL F CG2  1 
ATOM   7894  H  H    . VAL F  1 9  ? 65.062 52.501 33.671  1.00 43.55  ?  9    VAL F H    1 
ATOM   7895  H  HA   . VAL F  1 9  ? 63.030 52.994 35.384  1.00 46.10  ?  9    VAL F HA   1 
ATOM   7896  H  HB   . VAL F  1 9  ? 65.778 53.720 35.657  1.00 47.63  ?  9    VAL F HB   1 
ATOM   7897  H  HG11 . VAL F  1 9  ? 63.747 53.906 37.605  1.00 49.56  ?  9    VAL F HG11 1 
ATOM   7898  H  HG12 . VAL F  1 9  ? 65.262 54.235 37.872  1.00 49.56  ?  9    VAL F HG12 1 
ATOM   7899  H  HG13 . VAL F  1 9  ? 64.420 55.138 36.897  1.00 49.56  ?  9    VAL F HG13 1 
ATOM   7900  H  HG21 . VAL F  1 9  ? 65.547 51.413 35.780  1.00 46.40  ?  9    VAL F HG21 1 
ATOM   7901  H  HG22 . VAL F  1 9  ? 65.946 51.976 37.193  1.00 46.40  ?  9    VAL F HG22 1 
ATOM   7902  H  HG23 . VAL F  1 9  ? 64.457 51.564 36.903  1.00 46.40  ?  9    VAL F HG23 1 
ATOM   7903  N  N    . ASN F  1 10 ? 62.482 55.341 34.998  1.00 44.18  ?  10   ASN F N    1 
ATOM   7904  C  CA   . ASN F  1 10 ? 62.176 56.750 34.780  1.00 46.82  ?  10   ASN F CA   1 
ATOM   7905  C  C    . ASN F  1 10 ? 61.724 57.397 36.085  1.00 44.43  ?  10   ASN F C    1 
ATOM   7906  O  O    . ASN F  1 10 ? 60.546 57.350 36.443  1.00 43.80  ?  10   ASN F O    1 
ATOM   7907  C  CB   . ASN F  1 10 ? 61.099 56.914 33.706  1.00 48.27  ?  10   ASN F CB   1 
ATOM   7908  C  CG   . ASN F  1 10 ? 61.615 56.615 32.309  1.00 49.79  ?  10   ASN F CG   1 
ATOM   7909  O  OD1  . ASN F  1 10 ? 61.225 55.626 31.687  1.00 49.04  ?  10   ASN F OD1  1 
ATOM   7910  N  ND2  . ASN F  1 10 ? 62.495 57.475 31.807  1.00 52.12  ?  10   ASN F ND2  1 
ATOM   7911  H  H    . ASN F  1 10 ? 61.880 54.921 35.447  1.00 53.02  ?  10   ASN F H    1 
ATOM   7912  H  HA   . ASN F  1 10 ? 62.984 57.211 34.474  1.00 56.18  ?  10   ASN F HA   1 
ATOM   7913  H  HB2  . ASN F  1 10 ? 60.369 56.302 33.894  1.00 57.92  ?  10   ASN F HB2  1 
ATOM   7914  H  HB3  . ASN F  1 10 ? 60.777 57.829 33.718  1.00 57.92  ?  10   ASN F HB3  1 
ATOM   7915  H  HD21 . ASN F  1 10 ? 62.741 58.157 32.270  1.00 62.54  ?  10   ASN F HD21 1 
ATOM   7916  H  HD22 . ASN F  1 10 ? 62.817 57.351 31.020  1.00 62.54  ?  10   ASN F HD22 1 
ATOM   7917  N  N    . LEU F  1 11 ? 62.672 57.996 36.795  1.00 43.61  ?  11   LEU F N    1 
ATOM   7918  C  CA   . LEU F  1 11 ? 62.397 58.575 38.102  1.00 45.25  ?  11   LEU F CA   1 
ATOM   7919  C  C    . LEU F  1 11 ? 61.643 59.891 37.988  1.00 51.14  ?  11   LEU F C    1 
ATOM   7920  O  O    . LEU F  1 11 ? 61.941 60.706 37.113  1.00 51.76  ?  11   LEU F O    1 
ATOM   7921  C  CB   . LEU F  1 11 ? 63.704 58.811 38.858  1.00 46.76  ?  11   LEU F CB   1 
ATOM   7922  C  CG   . LEU F  1 11 ? 64.559 57.569 39.099  1.00 46.15  ?  11   LEU F CG   1 
ATOM   7923  C  CD1  . LEU F  1 11 ? 65.844 57.941 39.824  1.00 49.66  ?  11   LEU F CD1  1 
ATOM   7924  C  CD2  . LEU F  1 11 ? 63.776 56.527 39.881  1.00 43.54  ?  11   LEU F CD2  1 
ATOM   7925  H  H    . LEU F  1 11 ? 63.489 58.081 36.539  1.00 52.34  ?  11   LEU F H    1 
ATOM   7926  H  HA   . LEU F  1 11 ? 61.849 57.951 38.623  1.00 54.30  ?  11   LEU F HA   1 
ATOM   7927  H  HB2  . LEU F  1 11 ? 64.241 59.440 38.352  1.00 56.11  ?  11   LEU F HB2  1 
ATOM   7928  H  HB3  . LEU F  1 11 ? 63.492 59.190 39.726  1.00 56.11  ?  11   LEU F HB3  1 
ATOM   7929  H  HG   . LEU F  1 11 ? 64.801 57.181 38.243  1.00 55.38  ?  11   LEU F HG   1 
ATOM   7930  H  HD11 . LEU F  1 11 ? 65.621 58.340 40.669  1.00 59.59  ?  11   LEU F HD11 1 
ATOM   7931  H  HD12 . LEU F  1 11 ? 66.364 57.147 39.964  1.00 59.59  ?  11   LEU F HD12 1 
ATOM   7932  H  HD13 . LEU F  1 11 ? 66.336 58.565 39.287  1.00 59.59  ?  11   LEU F HD13 1 
ATOM   7933  H  HD21 . LEU F  1 11 ? 62.996 56.282 39.378  1.00 52.25  ?  11   LEU F HD21 1 
ATOM   7934  H  HD22 . LEU F  1 11 ? 64.332 55.758 40.020  1.00 52.25  ?  11   LEU F HD22 1 
ATOM   7935  H  HD23 . LEU F  1 11 ? 63.517 56.902 40.726  1.00 52.25  ?  11   LEU F HD23 1 
ATOM   7936  N  N    . PRO F  1 12 ? 60.656 60.101 38.873  1.00 58.10  ?  12   PRO F N    1 
ATOM   7937  C  CA   . PRO F  1 12 ? 60.010 61.413 38.964  1.00 63.17  ?  12   PRO F CA   1 
ATOM   7938  C  C    . PRO F  1 12 ? 61.048 62.479 39.283  1.00 70.14  ?  12   PRO F C    1 
ATOM   7939  O  O    . PRO F  1 12 ? 61.943 62.234 40.092  1.00 64.58  ?  12   PRO F O    1 
ATOM   7940  C  CB   . PRO F  1 12 ? 59.034 61.247 40.132  1.00 62.60  ?  12   PRO F CB   1 
ATOM   7941  C  CG   . PRO F  1 12 ? 58.773 59.783 40.208  1.00 60.18  ?  12   PRO F CG   1 
ATOM   7942  C  CD   . PRO F  1 12 ? 60.049 59.120 39.789  1.00 58.66  ?  12   PRO F CD   1 
ATOM   7943  H  HA   . PRO F  1 12 ? 59.527 61.635 38.140  1.00 75.80  ?  12   PRO F HA   1 
ATOM   7944  H  HB2  . PRO F  1 12 ? 59.445 61.565 40.950  1.00 75.12  ?  12   PRO F HB2  1 
ATOM   7945  H  HB3  . PRO F  1 12 ? 58.215 61.733 39.946  1.00 75.12  ?  12   PRO F HB3  1 
ATOM   7946  H  HG2  . PRO F  1 12 ? 58.545 59.541 41.119  1.00 72.21  ?  12   PRO F HG2  1 
ATOM   7947  H  HG3  . PRO F  1 12 ? 58.052 59.550 39.602  1.00 72.21  ?  12   PRO F HG3  1 
ATOM   7948  H  HD2  . PRO F  1 12 ? 60.623 58.975 40.557  1.00 70.39  ?  12   PRO F HD2  1 
ATOM   7949  H  HD3  . PRO F  1 12 ? 59.863 58.291 39.322  1.00 70.39  ?  12   PRO F HD3  1 
ATOM   7950  N  N    . ARG F  1 13 ? 60.939 63.640 38.650  1.00 81.07  ?  13   ARG F N    1 
ATOM   7951  C  CA   . ARG F  1 13 ? 61.926 64.693 38.842  1.00 91.34  ?  13   ARG F CA   1 
ATOM   7952  C  C    . ARG F  1 13 ? 62.013 65.074 40.317  1.00 92.84  ?  13   ARG F C    1 
ATOM   7953  O  O    . ARG F  1 13 ? 63.091 65.381 40.826  1.00 93.53  ?  13   ARG F O    1 
ATOM   7954  C  CB   . ARG F  1 13 ? 61.578 65.917 37.988  1.00 98.37  ?  13   ARG F CB   1 
ATOM   7955  C  CG   . ARG F  1 13 ? 60.963 67.073 38.759  1.00 103.76 ?  13   ARG F CG   1 
ATOM   7956  C  CD   . ARG F  1 13 ? 62.007 67.799 39.595  1.00 108.17 ?  13   ARG F CD   1 
ATOM   7957  N  NE   . ARG F  1 13 ? 62.332 69.114 39.056  1.00 112.78 ?  13   ARG F NE   1 
ATOM   7958  C  CZ   . ARG F  1 13 ? 61.588 70.202 39.232  1.00 115.38 ?  13   ARG F CZ   1 
ATOM   7959  N  NH1  . ARG F  1 13 ? 60.460 70.141 39.928  1.00 113.18 ?  13   ARG F NH1  1 
ATOM   7960  N  NH2  . ARG F  1 13 ? 61.974 71.353 38.703  1.00 120.08 ?  13   ARG F NH2  1 
ATOM   7961  H  H    . ARG F  1 13 ? 60.305 63.843 38.106  1.00 97.28  ?  13   ARG F H    1 
ATOM   7962  H  HA   . ARG F  1 13 ? 62.805 64.365 38.559  1.00 109.61 ?  13   ARG F HA   1 
ATOM   7963  H  HB2  . ARG F  1 13 ? 62.389 66.243 37.567  1.00 118.04 ?  13   ARG F HB2  1 
ATOM   7964  H  HB3  . ARG F  1 13 ? 60.942 65.648 37.306  1.00 118.04 ?  13   ARG F HB3  1 
ATOM   7965  H  HG2  . ARG F  1 13 ? 60.579 67.708 38.134  1.00 124.51 ?  13   ARG F HG2  1 
ATOM   7966  H  HG3  . ARG F  1 13 ? 60.278 66.732 39.356  1.00 124.51 ?  13   ARG F HG3  1 
ATOM   7967  H  HD2  . ARG F  1 13 ? 61.667 67.917 40.495  1.00 129.80 ?  13   ARG F HD2  1 
ATOM   7968  H  HD3  . ARG F  1 13 ? 62.821 67.271 39.613  1.00 129.80 ?  13   ARG F HD3  1 
ATOM   7969  H  HE   . ARG F  1 13 ? 63.052 69.192 38.593  1.00 135.33 ?  13   ARG F HE   1 
ATOM   7970  H  HH11 . ARG F  1 13 ? 60.208 69.394 40.274  1.00 135.81 ?  13   ARG F HH11 1 
ATOM   7971  H  HH12 . ARG F  1 13 ? 59.983 70.848 40.037  1.00 135.81 ?  13   ARG F HH12 1 
ATOM   7972  H  HH21 . ARG F  1 13 ? 62.703 71.395 38.249  1.00 144.09 ?  13   ARG F HH21 1 
ATOM   7973  H  HH22 . ARG F  1 13 ? 61.494 72.058 38.812  1.00 144.09 ?  13   ARG F HH22 1 
ATOM   7974  N  N    . ASN F  1 14 ? 60.875 65.034 41.003  1.00 95.58  ?  14   ASN F N    1 
ATOM   7975  C  CA   . ASN F  1 14 ? 60.795 65.495 42.385  1.00 98.09  ?  14   ASN F CA   1 
ATOM   7976  C  C    . ASN F  1 14 ? 61.157 64.425 43.414  1.00 91.38  ?  14   ASN F C    1 
ATOM   7977  O  O    . ASN F  1 14 ? 60.883 64.588 44.604  1.00 97.26  ?  14   ASN F O    1 
ATOM   7978  C  CB   . ASN F  1 14 ? 59.390 66.026 42.678  1.00 101.04 ?  14   ASN F CB   1 
ATOM   7979  C  CG   . ASN F  1 14 ? 58.337 64.935 42.650  1.00 99.74  ?  14   ASN F CG   1 
ATOM   7980  O  OD1  . ASN F  1 14 ? 58.528 63.886 42.034  1.00 98.09  ?  14   ASN F OD1  1 
ATOM   7981  N  ND2  . ASN F  1 14 ? 57.215 65.178 43.318  1.00 100.42 ?  14   ASN F ND2  1 
ATOM   7982  H  H    . ASN F  1 14 ? 60.130 64.741 40.689  1.00 114.70 ?  14   ASN F H    1 
ATOM   7983  H  HA   . ASN F  1 14 ? 61.422 66.239 42.501  1.00 117.71 ?  14   ASN F HA   1 
ATOM   7984  H  HB2  . ASN F  1 14 ? 59.381 66.429 43.560  1.00 121.25 ?  14   ASN F HB2  1 
ATOM   7985  H  HB3  . ASN F  1 14 ? 59.155 66.687 42.007  1.00 121.25 ?  14   ASN F HB3  1 
ATOM   7986  H  HD21 . ASN F  1 14 ? 57.117 65.924 43.736  1.00 120.51 ?  14   ASN F HD21 1 
ATOM   7987  H  HD22 . ASN F  1 14 ? 56.588 64.591 43.333  1.00 120.51 ?  14   ASN F HD22 1 
ATOM   7988  N  N    . LEU F  1 15 ? 61.771 63.335 42.965  1.00 72.36  ?  15   LEU F N    1 
ATOM   7989  C  CA   . LEU F  1 15 ? 62.176 62.274 43.880  1.00 62.28  ?  15   LEU F CA   1 
ATOM   7990  C  C    . LEU F  1 15 ? 63.353 62.735 44.731  1.00 64.85  ?  15   LEU F C    1 
ATOM   7991  O  O    . LEU F  1 15 ? 64.425 63.043 44.211  1.00 60.91  ?  15   LEU F O    1 
ATOM   7992  C  CB   . LEU F  1 15 ? 62.560 61.010 43.112  1.00 57.43  ?  15   LEU F CB   1 
ATOM   7993  C  CG   . LEU F  1 15 ? 62.686 59.757 43.982  1.00 55.53  ?  15   LEU F CG   1 
ATOM   7994  C  CD1  . LEU F  1 15 ? 61.310 59.234 44.360  1.00 54.29  ?  15   LEU F CD1  1 
ATOM   7995  C  CD2  . LEU F  1 15 ? 63.500 58.681 43.280  1.00 54.45  ?  15   LEU F CD2  1 
ATOM   7996  H  H    . LEU F  1 15 ? 61.963 63.186 42.141  1.00 86.84  ?  15   LEU F H    1 
ATOM   7997  H  HA   . LEU F  1 15 ? 61.430 62.058 44.477  1.00 74.73  ?  15   LEU F HA   1 
ATOM   7998  H  HB2  . LEU F  1 15 ? 61.882 60.836 42.441  1.00 68.92  ?  15   LEU F HB2  1 
ATOM   7999  H  HB3  . LEU F  1 15 ? 63.417 61.157 42.681  1.00 68.92  ?  15   LEU F HB3  1 
ATOM   8000  H  HG   . LEU F  1 15 ? 63.150 59.991 44.801  1.00 66.64  ?  15   LEU F HG   1 
ATOM   8001  H  HD11 . LEU F  1 15 ? 60.828 59.016 43.559  1.00 65.15  ?  15   LEU F HD11 1 
ATOM   8002  H  HD12 . LEU F  1 15 ? 61.413 58.449 44.904  1.00 65.15  ?  15   LEU F HD12 1 
ATOM   8003  H  HD13 . LEU F  1 15 ? 60.842 59.913 44.850  1.00 65.15  ?  15   LEU F HD13 1 
ATOM   8004  H  HD21 . LEU F  1 15 ? 64.378 59.023 43.099  1.00 65.34  ?  15   LEU F HD21 1 
ATOM   8005  H  HD22 . LEU F  1 15 ? 63.559 57.912 43.852  1.00 65.34  ?  15   LEU F HD22 1 
ATOM   8006  H  HD23 . LEU F  1 15 ? 63.063 58.446 42.458  1.00 65.34  ?  15   LEU F HD23 1 
ATOM   8007  N  N    . ASP F  1 16 ? 63.147 62.780 46.042  1.00 72.63  ?  16   ASP F N    1 
ATOM   8008  C  CA   . ASP F  1 16 ? 64.198 63.192 46.963  1.00 81.82  ?  16   ASP F CA   1 
ATOM   8009  C  C    . ASP F  1 16 ? 65.364 62.209 46.895  1.00 82.50  ?  16   ASP F C    1 
ATOM   8010  O  O    . ASP F  1 16 ? 65.175 61.007 47.073  1.00 80.87  ?  16   ASP F O    1 
ATOM   8011  C  CB   . ASP F  1 16 ? 63.652 63.254 48.390  1.00 85.97  ?  16   ASP F CB   1 
ATOM   8012  C  CG   . ASP F  1 16 ? 64.583 63.981 49.340  1.00 92.54  ?  16   ASP F CG   1 
ATOM   8013  O  OD1  . ASP F  1 16 ? 65.806 63.991 49.088  1.00 95.53  ?  16   ASP F OD1  1 
ATOM   8014  O  OD2  . ASP F  1 16 ? 64.090 64.544 50.341  1.00 94.77  ?  16   ASP F OD2  1 
ATOM   8015  H  H    . ASP F  1 16 ? 62.405 62.576 46.425  1.00 87.15  ?  16   ASP F H    1 
ATOM   8016  H  HA   . ASP F  1 16 ? 64.524 64.081 46.713  1.00 98.19  ?  16   ASP F HA   1 
ATOM   8017  H  HB2  . ASP F  1 16 ? 62.803 63.723 48.384  1.00 103.17 ?  16   ASP F HB2  1 
ATOM   8018  H  HB3  . ASP F  1 16 ? 63.530 62.351 48.722  1.00 103.17 ?  16   ASP F HB3  1 
ATOM   8019  N  N    . PRO F  1 17 ? 66.578 62.717 46.627  1.00 82.60  ?  17   PRO F N    1 
ATOM   8020  C  CA   . PRO F  1 17 ? 67.766 61.859 46.594  1.00 81.22  ?  17   PRO F CA   1 
ATOM   8021  C  C    . PRO F  1 17 ? 67.880 60.950 47.818  1.00 75.49  ?  17   PRO F C    1 
ATOM   8022  O  O    . PRO F  1 17 ? 68.489 59.883 47.724  1.00 76.96  ?  17   PRO F O    1 
ATOM   8023  C  CB   . PRO F  1 17 ? 68.915 62.867 46.553  1.00 86.49  ?  17   PRO F CB   1 
ATOM   8024  C  CG   . PRO F  1 17 ? 68.342 64.034 45.829  1.00 87.76  ?  17   PRO F CG   1 
ATOM   8025  C  CD   . PRO F  1 17 ? 66.894 64.105 46.242  1.00 85.92  ?  17   PRO F CD   1 
ATOM   8026  H  HA   . PRO F  1 17 ? 67.777 61.316 45.778  1.00 97.46  ?  17   PRO F HA   1 
ATOM   8027  H  HB2  . PRO F  1 17 ? 69.172 63.111 47.456  1.00 103.78 ?  17   PRO F HB2  1 
ATOM   8028  H  HB3  . PRO F  1 17 ? 69.666 62.492 46.067  1.00 103.78 ?  17   PRO F HB3  1 
ATOM   8029  H  HG2  . PRO F  1 17 ? 68.812 64.841 46.092  1.00 105.31 ?  17   PRO F HG2  1 
ATOM   8030  H  HG3  . PRO F  1 17 ? 68.418 63.892 44.873  1.00 105.31 ?  17   PRO F HG3  1 
ATOM   8031  H  HD2  . PRO F  1 17 ? 66.788 64.699 47.001  1.00 103.10 ?  17   PRO F HD2  1 
ATOM   8032  H  HD3  . PRO F  1 17 ? 66.343 64.382 45.493  1.00 103.10 ?  17   PRO F HD3  1 
ATOM   8033  N  N    . ARG F  1 18 ? 67.309 61.362 48.946  1.00 71.95  ?  18   ARG F N    1 
ATOM   8034  C  CA   . ARG F  1 18 ? 67.233 60.486 50.108  1.00 67.04  ?  18   ARG F CA   1 
ATOM   8035  C  C    . ARG F  1 18 ? 66.473 59.235 49.706  1.00 61.97  ?  18   ARG F C    1 
ATOM   8036  O  O    . ARG F  1 18 ? 66.928 58.113 49.921  1.00 60.20  ?  18   ARG F O    1 
ATOM   8037  C  CB   . ARG F  1 18 ? 66.491 61.152 51.268  1.00 68.81  ?  18   ARG F CB   1 
ATOM   8038  C  CG   . ARG F  1 18 ? 67.100 62.439 51.788  1.00 74.34  ?  18   ARG F CG   1 
ATOM   8039  C  CD   . ARG F  1 18 ? 66.637 62.704 53.214  1.00 79.56  ?  18   ARG F CD   1 
ATOM   8040  N  NE   . ARG F  1 18 ? 66.408 64.123 53.477  1.00 86.38  ?  18   ARG F NE   1 
ATOM   8041  C  CZ   . ARG F  1 18 ? 65.236 64.740 53.336  1.00 89.12  ?  18   ARG F CZ   1 
ATOM   8042  N  NH1  . ARG F  1 18 ? 64.162 64.075 52.928  1.00 87.51  ?  18   ARG F NH1  1 
ATOM   8043  N  NH2  . ARG F  1 18 ? 65.137 66.035 53.605  1.00 92.63  ?  18   ARG F NH2  1 
ATOM   8044  H  H    . ARG F  1 18 ? 66.961 62.140 49.063  1.00 86.35  ?  18   ARG F H    1 
ATOM   8045  H  HA   . ARG F  1 18 ? 68.134 60.236 50.402  1.00 80.44  ?  18   ARG F HA   1 
ATOM   8046  H  HB2  . ARG F  1 18 ? 65.588 61.356 50.976  1.00 82.57  ?  18   ARG F HB2  1 
ATOM   8047  H  HB3  . ARG F  1 18 ? 66.457 60.527 52.009  1.00 82.57  ?  18   ARG F HB3  1 
ATOM   8048  H  HG2  . ARG F  1 18 ? 68.067 62.363 51.787  1.00 89.20  ?  18   ARG F HG2  1 
ATOM   8049  H  HG3  . ARG F  1 18 ? 66.817 63.180 51.230  1.00 89.20  ?  18   ARG F HG3  1 
ATOM   8050  H  HD2  . ARG F  1 18 ? 65.804 62.231 53.369  1.00 95.47  ?  18   ARG F HD2  1 
ATOM   8051  H  HD3  . ARG F  1 18 ? 67.317 62.390 53.831  1.00 95.47  ?  18   ARG F HD3  1 
ATOM   8052  H  HE   . ARG F  1 18 ? 67.077 64.593 53.743  1.00 103.66 ?  18   ARG F HE   1 
ATOM   8053  H  HH11 . ARG F  1 18 ? 64.217 63.235 52.752  1.00 105.01 ?  18   ARG F HH11 1 
ATOM   8054  H  HH12 . ARG F  1 18 ? 63.410 64.485 52.840  1.00 105.01 ?  18   ARG F HH12 1 
ATOM   8055  H  HH21 . ARG F  1 18 ? 65.828 66.473 53.869  1.00 111.16 ?  18   ARG F HH21 1 
ATOM   8056  H  HH22 . ARG F  1 18 ? 64.382 66.436 53.513  1.00 111.16 ?  18   ARG F HH22 1 
ATOM   8057  N  N    . GLU F  1 19 ? 65.302 59.452 49.118  1.00 61.81  ?  19   GLU F N    1 
ATOM   8058  C  CA   . GLU F  1 19 ? 64.414 58.369 48.732  1.00 58.67  ?  19   GLU F CA   1 
ATOM   8059  C  C    . GLU F  1 19 ? 65.041 57.508 47.642  1.00 53.21  ?  19   GLU F C    1 
ATOM   8060  O  O    . GLU F  1 19 ? 64.849 56.294 47.618  1.00 52.31  ?  19   GLU F O    1 
ATOM   8061  C  CB   . GLU F  1 19 ? 63.079 58.939 48.252  1.00 60.83  ?  19   GLU F CB   1 
ATOM   8062  C  CG   . GLU F  1 19 ? 61.978 57.905 48.103  1.00 61.83  ?  19   GLU F CG   1 
ATOM   8063  C  CD   . GLU F  1 19 ? 60.634 58.531 47.787  1.00 64.37  ?  19   GLU F CD   1 
ATOM   8064  O  OE1  . GLU F  1 19 ? 60.592 59.754 47.532  1.00 67.98  ?  19   GLU F OE1  1 
ATOM   8065  O  OE2  . GLU F  1 19 ? 59.619 57.802 47.797  1.00 62.55  ?  19   GLU F OE2  1 
ATOM   8066  H  H    . GLU F  1 19 ? 64.996 60.234 48.930  1.00 74.17  ?  19   GLU F H    1 
ATOM   8067  H  HA   . GLU F  1 19 ? 64.242 57.800 49.510  1.00 70.40  ?  19   GLU F HA   1 
ATOM   8068  H  HB2  . GLU F  1 19 ? 62.776 59.603 48.891  1.00 72.99  ?  19   GLU F HB2  1 
ATOM   8069  H  HB3  . GLU F  1 19 ? 63.211 59.355 47.386  1.00 72.99  ?  19   GLU F HB3  1 
ATOM   8070  H  HG2  . GLU F  1 19 ? 62.206 57.301 47.379  1.00 74.20  ?  19   GLU F HG2  1 
ATOM   8071  H  HG3  . GLU F  1 19 ? 61.892 57.412 48.934  1.00 74.20  ?  19   GLU F HG3  1 
ATOM   8072  N  N    . GLU F  1 20 ? 65.794 58.136 46.743  1.00 51.79  ?  20   GLU F N    1 
ATOM   8073  C  CA   . GLU F  1 20 ? 66.448 57.402 45.665  1.00 49.28  ?  20   GLU F CA   1 
ATOM   8074  C  C    . GLU F  1 20 ? 67.516 56.461 46.215  1.00 52.60  ?  20   GLU F C    1 
ATOM   8075  O  O    . GLU F  1 20 ? 67.667 55.336 45.739  1.00 50.02  ?  20   GLU F O    1 
ATOM   8076  C  CB   . GLU F  1 20 ? 67.071 58.360 44.648  1.00 50.16  ?  20   GLU F CB   1 
ATOM   8077  C  CG   . GLU F  1 20 ? 67.821 57.652 43.528  1.00 50.97  ?  20   GLU F CG   1 
ATOM   8078  C  CD   . GLU F  1 20 ? 68.215 58.585 42.396  1.00 56.09  ?  20   GLU F CD   1 
ATOM   8079  O  OE1  . GLU F  1 20 ? 67.980 59.807 42.515  1.00 59.76  ?  20   GLU F OE1  1 
ATOM   8080  O  OE2  . GLU F  1 20 ? 68.760 58.093 41.383  1.00 57.26  ?  20   GLU F OE2  1 
ATOM   8081  H  H    . GLU F  1 20 ? 65.942 58.983 46.736  1.00 62.15  ?  20   GLU F H    1 
ATOM   8082  H  HA   . GLU F  1 20 ? 65.779 56.859 45.198  1.00 59.13  ?  20   GLU F HA   1 
ATOM   8083  H  HB2  . GLU F  1 20 ? 66.366 58.891 44.245  1.00 60.20  ?  20   GLU F HB2  1 
ATOM   8084  H  HB3  . GLU F  1 20 ? 67.699 58.940 45.107  1.00 60.20  ?  20   GLU F HB3  1 
ATOM   8085  H  HG2  . GLU F  1 20 ? 68.632 57.261 43.890  1.00 61.17  ?  20   GLU F HG2  1 
ATOM   8086  H  HG3  . GLU F  1 20 ? 67.254 56.957 43.159  1.00 61.17  ?  20   GLU F HG3  1 
ATOM   8087  N  N    . GLU F  1 21 ? 68.255 56.926 47.217  1.00 53.45  ?  21   GLU F N    1 
ATOM   8088  C  CA   . GLU F  1 21 ? 69.297 56.113 47.831  1.00 58.05  ?  21   GLU F CA   1 
ATOM   8089  C  C    . GLU F  1 21 ? 68.685 54.870 48.464  1.00 53.66  ?  21   GLU F C    1 
ATOM   8090  O  O    . GLU F  1 21 ? 69.133 53.750 48.221  1.00 53.64  ?  21   GLU F O    1 
ATOM   8091  C  CB   . GLU F  1 21 ? 70.051 56.918 48.890  1.00 66.62  ?  21   GLU F CB   1 
ATOM   8092  C  CG   . GLU F  1 21 ? 71.275 56.204 49.440  1.00 73.31  ?  21   GLU F CG   1 
ATOM   8093  C  CD   . GLU F  1 21 ? 72.283 55.867 48.357  1.00 77.29  ?  21   GLU F CD   1 
ATOM   8094  O  OE1  . GLU F  1 21 ? 72.657 56.777 47.587  1.00 78.90  ?  21   GLU F OE1  1 
ATOM   8095  O  OE2  . GLU F  1 21 ? 72.694 54.689 48.271  1.00 78.41  ?  21   GLU F OE2  1 
ATOM   8096  H  H    . GLU F  1 21 ? 68.173 57.710 47.559  1.00 64.14  ?  21   GLU F H    1 
ATOM   8097  H  HA   . GLU F  1 21 ? 69.936 55.829 47.145  1.00 69.66  ?  21   GLU F HA   1 
ATOM   8098  H  HB2  . GLU F  1 21 ? 70.346 57.754 48.497  1.00 79.94  ?  21   GLU F HB2  1 
ATOM   8099  H  HB3  . GLU F  1 21 ? 69.453 57.096 49.633  1.00 79.94  ?  21   GLU F HB3  1 
ATOM   8100  H  HG2  . GLU F  1 21 ? 71.712 56.778 50.089  1.00 87.97  ?  21   GLU F HG2  1 
ATOM   8101  H  HG3  . GLU F  1 21 ? 70.997 55.376 49.861  1.00 87.97  ?  21   GLU F HG3  1 
ATOM   8102  N  N    . ARG F  1 22 ? 67.657 55.083 49.278  1.00 53.97  ?  22   ARG F N    1 
ATOM   8103  C  CA   . ARG F  1 22 ? 66.925 53.993 49.908  1.00 51.83  ?  22   ARG F CA   1 
ATOM   8104  C  C    . ARG F  1 22 ? 66.397 53.028 48.851  1.00 45.04  ?  22   ARG F C    1 
ATOM   8105  O  O    . ARG F  1 22 ? 66.487 51.810 49.001  1.00 42.34  ?  22   ARG F O    1 
ATOM   8106  C  CB   . ARG F  1 22 ? 65.760 54.559 50.720  1.00 55.87  ?  22   ARG F CB   1 
ATOM   8107  C  CG   . ARG F  1 22 ? 64.983 53.525 51.513  1.00 58.75  ?  22   ARG F CG   1 
ATOM   8108  C  CD   . ARG F  1 22 ? 63.774 54.155 52.183  1.00 60.78  ?  22   ARG F CD   1 
ATOM   8109  N  NE   . ARG F  1 22 ? 64.126 55.390 52.884  1.00 63.49  ?  22   ARG F NE   1 
ATOM   8110  C  CZ   . ARG F  1 22 ? 63.529 56.568 52.708  1.00 64.42  ?  22   ARG F CZ   1 
ATOM   8111  N  NH1  . ARG F  1 22 ? 62.523 56.710 51.854  1.00 63.19  ?  22   ARG F NH1  1 
ATOM   8112  N  NH2  . ARG F  1 22 ? 63.941 57.620 53.402  1.00 66.83  ?  22   ARG F NH2  1 
ATOM   8113  H  H    . ARG F  1 22 ? 67.360 55.864 49.484  1.00 64.76  ?  22   ARG F H    1 
ATOM   8114  H  HA   . ARG F  1 22 ? 67.519 53.502 50.512  1.00 62.19  ?  22   ARG F HA   1 
ATOM   8115  H  HB2  . ARG F  1 22 ? 66.109 55.211 51.349  1.00 67.04  ?  22   ARG F HB2  1 
ATOM   8116  H  HB3  . ARG F  1 22 ? 65.139 54.991 50.113  1.00 67.04  ?  22   ARG F HB3  1 
ATOM   8117  H  HG2  . ARG F  1 22 ? 64.673 52.827 50.915  1.00 70.50  ?  22   ARG F HG2  1 
ATOM   8118  H  HG3  . ARG F  1 22 ? 65.554 53.151 52.202  1.00 70.50  ?  22   ARG F HG3  1 
ATOM   8119  H  HD2  . ARG F  1 22 ? 63.110 54.368 51.508  1.00 72.94  ?  22   ARG F HD2  1 
ATOM   8120  H  HD3  . ARG F  1 22 ? 63.406 53.533 52.830  1.00 72.94  ?  22   ARG F HD3  1 
ATOM   8121  H  HE   . ARG F  1 22 ? 64.768 55.352 53.455  1.00 76.19  ?  22   ARG F HE   1 
ATOM   8122  H  HH11 . ARG F  1 22 ? 62.247 56.035 51.398  1.00 75.83  ?  22   ARG F HH11 1 
ATOM   8123  H  HH12 . ARG F  1 22 ? 62.149 57.478 51.755  1.00 75.83  ?  22   ARG F HH12 1 
ATOM   8124  H  HH21 . ARG F  1 22 ? 64.591 57.540 53.960  1.00 80.20  ?  22   ARG F HH21 1 
ATOM   8125  H  HH22 . ARG F  1 22 ? 63.558 58.382 53.295  1.00 80.20  ?  22   ARG F HH22 1 
ATOM   8126  N  N    . LEU F  1 23 ? 65.845 53.587 47.780  1.00 45.03  ?  23   LEU F N    1 
ATOM   8127  C  CA   . LEU F  1 23 ? 65.302 52.788 46.690  1.00 41.99  ?  23   LEU F CA   1 
ATOM   8128  C  C    . LEU F  1 23 ? 66.398 51.917 46.080  1.00 40.86  ?  23   LEU F C    1 
ATOM   8129  O  O    . LEU F  1 23 ? 66.211 50.719 45.869  1.00 36.68  ?  23   LEU F O    1 
ATOM   8130  C  CB   . LEU F  1 23 ? 64.706 53.702 45.618  1.00 43.90  ?  23   LEU F CB   1 
ATOM   8131  C  CG   . LEU F  1 23 ? 63.529 53.138 44.823  1.00 44.72  ?  23   LEU F CG   1 
ATOM   8132  C  CD1  . LEU F  1 23 ? 62.307 52.987 45.719  1.00 44.53  ?  23   LEU F CD1  1 
ATOM   8133  C  CD2  . LEU F  1 23 ? 63.218 54.030 43.632  1.00 46.78  ?  23   LEU F CD2  1 
ATOM   8134  H  H    . LEU F  1 23 ? 65.772 54.435 47.660  1.00 54.04  ?  23   LEU F H    1 
ATOM   8135  H  HA   . LEU F  1 23 ? 64.593 52.205 47.032  1.00 50.39  ?  23   LEU F HA   1 
ATOM   8136  H  HB2  . LEU F  1 23 ? 64.400 54.515 46.048  1.00 52.68  ?  23   LEU F HB2  1 
ATOM   8137  H  HB3  . LEU F  1 23 ? 65.405 53.919 44.981  1.00 52.68  ?  23   LEU F HB3  1 
ATOM   8138  H  HG   . LEU F  1 23 ? 63.765 52.259 44.487  1.00 53.66  ?  23   LEU F HG   1 
ATOM   8139  H  HD11 . LEU F  1 23 ? 62.069 53.848 46.070  1.00 53.44  ?  23   LEU F HD11 1 
ATOM   8140  H  HD12 . LEU F  1 23 ? 61.582 52.632 45.200  1.00 53.44  ?  23   LEU F HD12 1 
ATOM   8141  H  HD13 . LEU F  1 23 ? 62.520 52.388 46.438  1.00 53.44  ?  23   LEU F HD13 1 
ATOM   8142  H  HD21 . LEU F  1 23 ? 63.991 54.074 43.065  1.00 56.14  ?  23   LEU F HD21 1 
ATOM   8143  H  HD22 . LEU F  1 23 ? 62.477 53.658 43.148  1.00 56.14  ?  23   LEU F HD22 1 
ATOM   8144  H  HD23 . LEU F  1 23 ? 62.994 54.908 43.950  1.00 56.14  ?  23   LEU F HD23 1 
ATOM   8145  N  N    . LYS F  1 24 ? 67.545 52.528 45.806  1.00 43.91  ?  24   LYS F N    1 
ATOM   8146  C  CA   . LYS F  1 24 ? 68.669 51.822 45.204  1.00 49.30  ?  24   LYS F CA   1 
ATOM   8147  C  C    . LYS F  1 24 ? 69.139 50.674 46.093  1.00 44.73  ?  24   LYS F C    1 
ATOM   8148  O  O    . LYS F  1 24 ? 69.429 49.581 45.606  1.00 44.38  ?  24   LYS F O    1 
ATOM   8149  C  CB   . LYS F  1 24 ? 69.825 52.791 44.949  1.00 59.47  ?  24   LYS F CB   1 
ATOM   8150  C  CG   . LYS F  1 24 ? 71.030 52.158 44.266  1.00 67.10  ?  24   LYS F CG   1 
ATOM   8151  C  CD   . LYS F  1 24 ? 72.299 52.304 45.099  1.00 74.46  ?  24   LYS F CD   1 
ATOM   8152  C  CE   . LYS F  1 24 ? 72.179 51.593 46.441  1.00 76.30  ?  24   LYS F CE   1 
ATOM   8153  N  NZ   . LYS F  1 24 ? 73.465 51.579 47.188  1.00 79.09  ?  24   LYS F NZ   1 
ATOM   8154  H  H    . LYS F  1 24 ? 67.698 53.360 45.960  1.00 52.69  ?  24   LYS F H    1 
ATOM   8155  H  HA   . LYS F  1 24 ? 68.389 51.446 44.343  1.00 59.16  ?  24   LYS F HA   1 
ATOM   8156  H  HB2  . LYS F  1 24 ? 69.508 53.511 44.380  1.00 71.36  ?  24   LYS F HB2  1 
ATOM   8157  H  HB3  . LYS F  1 24 ? 70.122 53.152 45.799  1.00 71.36  ?  24   LYS F HB3  1 
ATOM   8158  H  HG2  . LYS F  1 24 ? 70.861 51.212 44.135  1.00 80.52  ?  24   LYS F HG2  1 
ATOM   8159  H  HG3  . LYS F  1 24 ? 71.177 52.593 43.412  1.00 80.52  ?  24   LYS F HG3  1 
ATOM   8160  H  HD2  . LYS F  1 24 ? 73.044 51.915 44.615  1.00 89.35  ?  24   LYS F HD2  1 
ATOM   8161  H  HD3  . LYS F  1 24 ? 72.463 53.245 45.267  1.00 89.35  ?  24   LYS F HD3  1 
ATOM   8162  H  HE2  . LYS F  1 24 ? 71.519 52.052 46.985  1.00 91.55  ?  24   LYS F HE2  1 
ATOM   8163  H  HE3  . LYS F  1 24 ? 71.907 50.675 46.290  1.00 91.55  ?  24   LYS F HE3  1 
ATOM   8164  H  HZ1  . LYS F  1 24 ? 73.735 52.412 47.345  1.00 94.90  ?  24   LYS F HZ1  1 
ATOM   8165  H  HZ2  . LYS F  1 24 ? 73.361 51.157 47.965  1.00 94.90  ?  24   LYS F HZ2  1 
ATOM   8166  H  HZ3  . LYS F  1 24 ? 74.088 51.157 46.712  1.00 94.90  ?  24   LYS F HZ3  1 
ATOM   8167  N  N    . ALA F  1 25 ? 69.210 50.925 47.396  1.00 40.65  ?  25   ALA F N    1 
ATOM   8168  C  CA   . ALA F  1 25 ? 69.686 49.922 48.341  1.00 40.22  ?  25   ALA F CA   1 
ATOM   8169  C  C    . ALA F  1 25 ? 68.709 48.754 48.441  1.00 36.91  ?  25   ALA F C    1 
ATOM   8170  O  O    . ALA F  1 25 ? 69.116 47.592 48.412  1.00 36.02  ?  25   ALA F O    1 
ATOM   8171  C  CB   . ALA F  1 25 ? 69.908 50.549 49.709  1.00 44.00  ?  25   ALA F CB   1 
ATOM   8172  H  H    . ALA F  1 25 ? 68.987 51.672 47.760  1.00 48.78  ?  25   ALA F H    1 
ATOM   8173  H  HA   . ALA F  1 25 ? 70.545 49.571 48.027  1.00 48.26  ?  25   ALA F HA   1 
ATOM   8174  H  HB1  . ALA F  1 25 ? 69.078 50.914 50.024  1.00 52.80  ?  25   ALA F HB1  1 
ATOM   8175  H  HB2  . ALA F  1 25 ? 70.221 49.874 50.315  1.00 52.80  ?  25   ALA F HB2  1 
ATOM   8176  H  HB3  . ALA F  1 25 ? 70.563 51.247 49.629  1.00 52.80  ?  25   ALA F HB3  1 
ATOM   8177  N  N    . SER F  1 26 ? 67.422 49.068 48.563  1.00 39.44  ?  26   SER F N    1 
ATOM   8178  C  CA   . SER F  1 26 ? 66.387 48.043 48.620  1.00 38.46  ?  26   SER F CA   1 
ATOM   8179  C  C    . SER F  1 26 ? 66.427 47.184 47.364  1.00 36.85  ?  26   SER F C    1 
ATOM   8180  O  O    . SER F  1 26 ? 66.340 45.958 47.434  1.00 39.05  ?  26   SER F O    1 
ATOM   8181  C  CB   . SER F  1 26 ? 65.004 48.683 48.759  1.00 37.59  ?  26   SER F CB   1 
ATOM   8182  O  OG   . SER F  1 26 ? 64.888 49.398 49.974  1.00 40.72  ?  26   SER F OG   1 
ATOM   8183  H  H    . SER F  1 26 ? 67.122 49.872 48.614  1.00 47.33  ?  26   SER F H    1 
ATOM   8184  H  HA   . SER F  1 26 ? 66.541 47.465 49.397  1.00 46.15  ?  26   SER F HA   1 
ATOM   8185  H  HB2  . SER F  1 26 ? 64.866 49.295 48.019  1.00 45.11  ?  26   SER F HB2  1 
ATOM   8186  H  HB3  . SER F  1 26 ? 64.331 47.984 48.740  1.00 45.11  ?  26   SER F HB3  1 
ATOM   8187  H  HG   . SER F  1 26 ? 65.588 49.346 50.398  1.00 48.86  ?  26   SER F HG   1 
ATOM   8188  N  N    . ALA F  1 27 ? 66.556 47.838 46.214  1.00 33.77  ?  27   ALA F N    1 
ATOM   8189  C  CA   . ALA F  1 27 ? 66.608 47.142 44.935  1.00 31.95  ?  27   ALA F CA   1 
ATOM   8190  C  C    . ALA F  1 27 ? 67.819 46.217 44.876  1.00 34.67  ?  27   ALA F C    1 
ATOM   8191  O  O    . ALA F  1 27 ? 67.707 45.057 44.481  1.00 31.88  ?  27   ALA F O    1 
ATOM   8192  C  CB   . ALA F  1 27 ? 66.652 48.147 43.793  1.00 31.46  ?  27   ALA F CB   1 
ATOM   8193  H  H    . ALA F  1 27 ? 66.615 48.694 46.149  1.00 40.53  ?  27   ALA F H    1 
ATOM   8194  H  HA   . ALA F  1 27 ? 65.801 46.597 44.832  1.00 38.34  ?  27   ALA F HA   1 
ATOM   8195  H  HB1  . ALA F  1 27 ? 67.434 48.695 43.889  1.00 37.75  ?  27   ALA F HB1  1 
ATOM   8196  H  HB2  . ALA F  1 27 ? 66.686 47.671 42.960  1.00 37.75  ?  27   ALA F HB2  1 
ATOM   8197  H  HB3  . ALA F  1 27 ? 65.863 48.692 43.826  1.00 37.75  ?  27   ALA F HB3  1 
ATOM   8198  N  N    . LYS F  1 28 ? 68.975 46.735 45.276  1.00 39.17  ?  28   LYS F N    1 
ATOM   8199  C  CA   . LYS F  1 28 ? 70.204 45.953 45.259  1.00 44.79  ?  28   LYS F CA   1 
ATOM   8200  C  C    . LYS F  1 28 ? 70.080 44.727 46.160  1.00 43.75  ?  28   LYS F C    1 
ATOM   8201  O  O    . LYS F  1 28 ? 70.470 43.624 45.776  1.00 46.67  ?  28   LYS F O    1 
ATOM   8202  C  CB   . LYS F  1 28 ? 71.390 46.815 45.698  1.00 50.79  ?  28   LYS F CB   1 
ATOM   8203  C  CG   . LYS F  1 28 ? 72.727 46.093 45.649  1.00 56.62  ?  28   LYS F CG   1 
ATOM   8204  C  CD   . LYS F  1 28 ? 73.893 47.054 45.831  1.00 62.92  ?  28   LYS F CD   1 
ATOM   8205  C  CE   . LYS F  1 28 ? 75.225 46.318 45.792  1.00 68.57  ?  28   LYS F CE   1 
ATOM   8206  N  NZ   . LYS F  1 28 ? 76.389 47.246 45.783  1.00 73.34  ?  28   LYS F NZ   1 
ATOM   8207  H  H    . LYS F  1 28 ? 69.074 47.540 45.563  1.00 47.01  ?  28   LYS F H    1 
ATOM   8208  H  HA   . LYS F  1 28 ? 70.374 45.644 44.345  1.00 53.75  ?  28   LYS F HA   1 
ATOM   8209  H  HB2  . LYS F  1 28 ? 71.449 47.587 45.113  1.00 60.95  ?  28   LYS F HB2  1 
ATOM   8210  H  HB3  . LYS F  1 28 ? 71.244 47.106 46.612  1.00 60.95  ?  28   LYS F HB3  1 
ATOM   8211  H  HG2  . LYS F  1 28 ? 72.762 45.436 46.362  1.00 67.94  ?  28   LYS F HG2  1 
ATOM   8212  H  HG3  . LYS F  1 28 ? 72.824 45.658 44.788  1.00 67.94  ?  28   LYS F HG3  1 
ATOM   8213  H  HD2  . LYS F  1 28 ? 73.885 47.707 45.114  1.00 75.50  ?  28   LYS F HD2  1 
ATOM   8214  H  HD3  . LYS F  1 28 ? 73.814 47.496 46.690  1.00 75.50  ?  28   LYS F HD3  1 
ATOM   8215  H  HE2  . LYS F  1 28 ? 75.297 45.752 46.577  1.00 82.28  ?  28   LYS F HE2  1 
ATOM   8216  H  HE3  . LYS F  1 28 ? 75.265 45.777 44.988  1.00 82.28  ?  28   LYS F HE3  1 
ATOM   8217  H  HZ1  . LYS F  1 28 ? 76.381 47.751 46.516  1.00 88.01  ?  28   LYS F HZ1  1 
ATOM   8218  H  HZ2  . LYS F  1 28 ? 77.148 46.781 45.761  1.00 88.01  ?  28   LYS F HZ2  1 
ATOM   8219  H  HZ3  . LYS F  1 28 ? 76.352 47.774 45.068  1.00 88.01  ?  28   LYS F HZ3  1 
ATOM   8220  N  N    . ALA F  1 29 ? 69.531 44.922 47.355  1.00 39.58  ?  29   ALA F N    1 
ATOM   8221  C  CA   . ALA F  1 29 ? 69.365 43.827 48.304  1.00 38.91  ?  29   ALA F CA   1 
ATOM   8222  C  C    . ALA F  1 29 ? 68.352 42.806 47.791  1.00 41.29  ?  29   ALA F C    1 
ATOM   8223  O  O    . ALA F  1 29 ? 68.538 41.601 47.956  1.00 41.94  ?  29   ALA F O    1 
ATOM   8224  C  CB   . ALA F  1 29 ? 68.937 44.363 49.665  1.00 37.83  ?  29   ALA F CB   1 
ATOM   8225  H  H    . ALA F  1 29 ? 69.245 45.681 47.640  1.00 47.49  ?  29   ALA F H    1 
ATOM   8226  H  HA   . ALA F  1 29 ? 70.225 43.370 48.416  1.00 46.69  ?  29   ALA F HA   1 
ATOM   8227  H  HB1  . ALA F  1 29 ? 68.102 44.828 49.568  1.00 45.40  ?  29   ALA F HB1  1 
ATOM   8228  H  HB2  . ALA F  1 29 ? 68.834 43.627 50.272  1.00 45.40  ?  29   ALA F HB2  1 
ATOM   8229  H  HB3  . ALA F  1 29 ? 69.611 44.965 49.989  1.00 45.40  ?  29   ALA F HB3  1 
ATOM   8230  N  N    . ARG F  1 30 ? 67.282 43.293 47.171  1.00 43.15  ?  30   ARG F N    1 
ATOM   8231  C  CA   . ARG F  1 30 ? 66.248 42.415 46.633  1.00 41.89  ?  30   ARG F CA   1 
ATOM   8232  C  C    . ARG F  1 30 ? 66.794 41.580 45.479  1.00 39.64  ?  30   ARG F C    1 
ATOM   8233  O  O    . ARG F  1 30 ? 66.549 40.377 45.404  1.00 38.89  ?  30   ARG F O    1 
ATOM   8234  C  CB   . ARG F  1 30 ? 65.041 43.229 46.161  1.00 40.37  ?  30   ARG F CB   1 
ATOM   8235  C  CG   . ARG F  1 30 ? 63.892 42.390 45.607  1.00 38.60  ?  30   ARG F CG   1 
ATOM   8236  C  CD   . ARG F  1 30 ? 63.249 41.522 46.685  1.00 38.73  ?  30   ARG F CD   1 
ATOM   8237  N  NE   . ARG F  1 30 ? 61.992 40.924 46.231  1.00 37.53  ?  30   ARG F NE   1 
ATOM   8238  C  CZ   . ARG F  1 30 ? 61.746 39.616 46.147  1.00 39.34  ?  30   ARG F CZ   1 
ATOM   8239  N  NH1  . ARG F  1 30 ? 62.659 38.715 46.493  1.00 41.95  ?  30   ARG F NH1  1 
ATOM   8240  N  NH2  . ARG F  1 30 ? 60.564 39.201 45.718  1.00 39.38  ?  30   ARG F NH2  1 
ATOM   8241  H  H    . ARG F  1 30 ? 67.130 44.131 47.048  1.00 51.78  ?  30   ARG F H    1 
ATOM   8242  H  HA   . ARG F  1 30 ? 65.947 41.803 47.337  1.00 50.26  ?  30   ARG F HA   1 
ATOM   8243  H  HB2  . ARG F  1 30 ? 64.699 43.740 46.911  1.00 48.44  ?  30   ARG F HB2  1 
ATOM   8244  H  HB3  . ARG F  1 30 ? 65.330 43.833 45.459  1.00 48.44  ?  30   ARG F HB3  1 
ATOM   8245  H  HG2  . ARG F  1 30 ? 63.211 42.979 45.247  1.00 46.32  ?  30   ARG F HG2  1 
ATOM   8246  H  HG3  . ARG F  1 30 ? 64.231 41.805 44.911  1.00 46.32  ?  30   ARG F HG3  1 
ATOM   8247  H  HD2  . ARG F  1 30 ? 63.858 40.805 46.921  1.00 46.47  ?  30   ARG F HD2  1 
ATOM   8248  H  HD3  . ARG F  1 30 ? 63.059 42.070 47.462  1.00 46.47  ?  30   ARG F HD3  1 
ATOM   8249  H  HE   . ARG F  1 30 ? 61.361 41.459 45.999  1.00 45.03  ?  30   ARG F HE   1 
ATOM   8250  H  HH11 . ARG F  1 30 ? 63.431 38.970 46.774  1.00 50.34  ?  30   ARG F HH11 1 
ATOM   8251  H  HH12 . ARG F  1 30 ? 62.480 37.876 46.433  1.00 50.34  ?  30   ARG F HH12 1 
ATOM   8252  H  HH21 . ARG F  1 30 ? 59.963 39.774 45.492  1.00 47.26  ?  30   ARG F HH21 1 
ATOM   8253  H  HH22 . ARG F  1 30 ? 60.397 38.359 45.664  1.00 47.26  ?  30   ARG F HH22 1 
ATOM   8254  N  N    . SER F  1 31 ? 67.534 42.219 44.578  1.00 38.15  ?  31   SER F N    1 
ATOM   8255  C  CA   . SER F  1 31 ? 68.077 41.513 43.424  1.00 37.37  ?  31   SER F CA   1 
ATOM   8256  C  C    . SER F  1 31 ? 69.121 40.480 43.847  1.00 39.28  ?  31   SER F C    1 
ATOM   8257  O  O    . SER F  1 31 ? 69.225 39.418 43.237  1.00 37.45  ?  31   SER F O    1 
ATOM   8258  C  CB   . SER F  1 31 ? 68.664 42.491 42.398  1.00 38.14  ?  31   SER F CB   1 
ATOM   8259  O  OG   . SER F  1 31 ? 69.729 43.255 42.935  1.00 41.28  ?  31   SER F OG   1 
ATOM   8260  H  H    . SER F  1 31 ? 67.735 43.054 44.612  1.00 45.78  ?  31   SER F H    1 
ATOM   8261  H  HA   . SER F  1 31 ? 67.347 41.029 42.984  1.00 44.84  ?  31   SER F HA   1 
ATOM   8262  H  HB2  . SER F  1 31 ? 68.995 41.985 41.639  1.00 45.77  ?  31   SER F HB2  1 
ATOM   8263  H  HB3  . SER F  1 31 ? 67.963 43.095 42.108  1.00 45.77  ?  31   SER F HB3  1 
ATOM   8264  H  HG   . SER F  1 31 ? 69.859 43.045 43.717  1.00 49.53  ?  31   SER F HG   1 
ATOM   8265  N  N    . ARG F  1 32 ? 69.883 40.783 44.894  1.00 39.88  ?  32   ARG F N    1 
ATOM   8266  C  CA   . ARG F  1 32 ? 70.895 39.848 45.378  1.00 44.63  ?  32   ARG F CA   1 
ATOM   8267  C  C    . ARG F  1 32 ? 70.251 38.522 45.759  1.00 43.23  ?  32   ARG F C    1 
ATOM   8268  O  O    . ARG F  1 32 ? 70.719 37.456 45.361  1.00 43.23  ?  32   ARG F O    1 
ATOM   8269  C  CB   . ARG F  1 32 ? 71.649 40.416 46.582  1.00 50.62  ?  32   ARG F CB   1 
ATOM   8270  C  CG   . ARG F  1 32 ? 72.373 39.348 47.397  1.00 57.19  ?  32   ARG F CG   1 
ATOM   8271  C  CD   . ARG F  1 32 ? 73.285 39.949 48.455  1.00 63.20  ?  32   ARG F CD   1 
ATOM   8272  N  NE   . ARG F  1 32 ? 74.476 40.560 47.870  1.00 66.34  ?  32   ARG F NE   1 
ATOM   8273  C  CZ   . ARG F  1 32 ? 75.572 39.892 47.518  1.00 68.12  ?  32   ARG F CZ   1 
ATOM   8274  N  NH1  . ARG F  1 32 ? 75.643 38.576 47.682  1.00 70.07  ?  32   ARG F NH1  1 
ATOM   8275  N  NH2  . ARG F  1 32 ? 76.603 40.541 46.995  1.00 67.75  ?  32   ARG F NH2  1 
ATOM   8276  H  H    . ARG F  1 32 ? 69.836 41.517 45.339  1.00 47.86  ?  32   ARG F H    1 
ATOM   8277  H  HA   . ARG F  1 32 ? 71.543 39.678 44.663  1.00 53.56  ?  32   ARG F HA   1 
ATOM   8278  H  HB2  . ARG F  1 32 ? 72.311 41.051 46.267  1.00 60.74  ?  32   ARG F HB2  1 
ATOM   8279  H  HB3  . ARG F  1 32 ? 71.017 40.861 47.168  1.00 60.74  ?  32   ARG F HB3  1 
ATOM   8280  H  HG2  . ARG F  1 32 ? 71.716 38.793 47.846  1.00 68.62  ?  32   ARG F HG2  1 
ATOM   8281  H  HG3  . ARG F  1 32 ? 72.916 38.808 46.802  1.00 68.62  ?  32   ARG F HG3  1 
ATOM   8282  H  HD2  . ARG F  1 32 ? 72.801 40.635 48.941  1.00 75.84  ?  32   ARG F HD2  1 
ATOM   8283  H  HD3  . ARG F  1 32 ? 73.572 39.249 49.062  1.00 75.84  ?  32   ARG F HD3  1 
ATOM   8284  H  HE   . ARG F  1 32 ? 74.469 41.411 47.745  1.00 79.61  ?  32   ARG F HE   1 
ATOM   8285  H  HH11 . ARG F  1 32 ? 74.978 38.148 48.020  1.00 84.09  ?  32   ARG F HH11 1 
ATOM   8286  H  HH12 . ARG F  1 32 ? 76.354 38.152 47.451  1.00 84.09  ?  32   ARG F HH12 1 
ATOM   8287  H  HH21 . ARG F  1 32 ? 76.564 41.393 46.886  1.00 81.30  ?  32   ARG F HH21 1 
ATOM   8288  H  HH22 . ARG F  1 32 ? 77.311 40.111 46.766  1.00 81.30  ?  32   ARG F HH22 1 
ATOM   8289  N  N    . THR F  1 33 ? 69.177 38.597 46.536  1.00 43.83  ?  33   THR F N    1 
ATOM   8290  C  CA   . THR F  1 33 ? 68.479 37.402 46.988  1.00 45.67  ?  33   THR F CA   1 
ATOM   8291  C  C    . THR F  1 33 ? 67.958 36.604 45.798  1.00 43.73  ?  33   THR F C    1 
ATOM   8292  O  O    . THR F  1 33 ? 68.186 35.399 45.700  1.00 47.18  ?  33   THR F O    1 
ATOM   8293  C  CB   . THR F  1 33 ? 67.300 37.759 47.912  1.00 46.34  ?  33   THR F CB   1 
ATOM   8294  O  OG1  . THR F  1 33 ? 67.794 38.398 49.096  1.00 49.17  ?  33   THR F OG1  1 
ATOM   8295  C  CG2  . THR F  1 33 ? 66.521 36.508 48.303  1.00 46.34  ?  33   THR F CG2  1 
ATOM   8296  H  H    . THR F  1 33 ? 68.831 39.332 46.817  1.00 52.59  ?  33   THR F H    1 
ATOM   8297  H  HA   . THR F  1 33 ? 69.101 36.834 47.489  1.00 54.81  ?  33   THR F HA   1 
ATOM   8298  H  HB   . THR F  1 33 ? 66.698 38.362 47.448  1.00 55.60  ?  33   THR F HB   1 
ATOM   8299  H  HG1  . THR F  1 33 ? 67.170 38.590 49.592  1.00 59.01  ?  33   THR F HG1  1 
ATOM   8300  H  HG21 . THR F  1 33 ? 67.097 35.895 48.765  1.00 55.61  ?  33   THR F HG21 1 
ATOM   8301  H  HG22 . THR F  1 33 ? 65.790 36.744 48.879  1.00 55.61  ?  33   THR F HG22 1 
ATOM   8302  H  HG23 . THR F  1 33 ? 66.174 36.079 47.517  1.00 55.61  ?  33   THR F HG23 1 
ATOM   8303  N  N    . LEU F  1 34 ? 67.261 37.284 44.894  1.00 40.92  ?  34   LEU F N    1 
ATOM   8304  C  CA   . LEU F  1 34 ? 66.668 36.627 43.736  1.00 37.37  ?  34   LEU F CA   1 
ATOM   8305  C  C    . LEU F  1 34 ? 67.730 35.983 42.842  1.00 37.13  ?  34   LEU F C    1 
ATOM   8306  O  O    . LEU F  1 34 ? 67.484 34.949 42.222  1.00 34.52  ?  34   LEU F O    1 
ATOM   8307  C  CB   . LEU F  1 34 ? 65.823 37.626 42.943  1.00 34.82  ?  34   LEU F CB   1 
ATOM   8308  C  CG   . LEU F  1 34 ? 64.551 38.064 43.676  1.00 31.57  ?  34   LEU F CG   1 
ATOM   8309  C  CD1  . LEU F  1 34 ? 63.963 39.324 43.065  1.00 28.30  ?  34   LEU F CD1  1 
ATOM   8310  C  CD2  . LEU F  1 34 ? 63.526 36.936 43.668  1.00 30.39  ?  34   LEU F CD2  1 
ATOM   8311  H  H    . LEU F  1 34 ? 67.116 38.131 44.930  1.00 49.11  ?  34   LEU F H    1 
ATOM   8312  H  HA   . LEU F  1 34 ? 66.072 35.916 44.049  1.00 44.84  ?  34   LEU F HA   1 
ATOM   8313  H  HB2  . LEU F  1 34 ? 66.355 38.419 42.771  1.00 41.79  ?  34   LEU F HB2  1 
ATOM   8314  H  HB3  . LEU F  1 34 ? 65.559 37.218 42.104  1.00 41.79  ?  34   LEU F HB3  1 
ATOM   8315  H  HG   . LEU F  1 34 ? 64.773 38.257 44.600  1.00 37.88  ?  34   LEU F HG   1 
ATOM   8316  H  HD11 . LEU F  1 34 ? 63.746 39.153 42.146  1.00 33.96  ?  34   LEU F HD11 1 
ATOM   8317  H  HD12 . LEU F  1 34 ? 63.170 39.565 43.549  1.00 33.96  ?  34   LEU F HD12 1 
ATOM   8318  H  HD13 . LEU F  1 34 ? 64.610 40.030 43.123  1.00 33.96  ?  34   LEU F HD13 1 
ATOM   8319  H  HD21 . LEU F  1 34 ? 63.901 36.171 44.110  1.00 36.47  ?  34   LEU F HD21 1 
ATOM   8320  H  HD22 . LEU F  1 34 ? 62.737 37.229 44.131  1.00 36.47  ?  34   LEU F HD22 1 
ATOM   8321  H  HD23 . LEU F  1 34 ? 63.310 36.717 42.759  1.00 36.47  ?  34   LEU F HD23 1 
ATOM   8322  N  N    . GLN F  1 35 ? 68.910 36.591 42.785  1.00 38.99  ?  35   GLN F N    1 
ATOM   8323  C  CA   . GLN F  1 35 ? 70.012 36.031 42.010  1.00 42.06  ?  35   GLN F CA   1 
ATOM   8324  C  C    . GLN F  1 35 ? 70.612 34.818 42.710  1.00 42.70  ?  35   GLN F C    1 
ATOM   8325  O  O    . GLN F  1 35 ? 70.890 33.800 42.077  1.00 43.20  ?  35   GLN F O    1 
ATOM   8326  C  CB   . GLN F  1 35 ? 71.098 37.082 41.780  1.00 44.03  ?  35   GLN F CB   1 
ATOM   8327  C  CG   . GLN F  1 35 ? 70.699 38.188 40.817  1.00 42.41  ?  35   GLN F CG   1 
ATOM   8328  C  CD   . GLN F  1 35 ? 71.802 39.208 40.620  1.00 44.49  ?  35   GLN F CD   1 
ATOM   8329  O  OE1  . GLN F  1 35 ? 72.760 38.967 39.887  1.00 45.86  ?  35   GLN F OE1  1 
ATOM   8330  N  NE2  . GLN F  1 35 ? 71.675 40.355 41.278  1.00 44.70  ?  35   GLN F NE2  1 
ATOM   8331  H  H    . GLN F  1 35 ? 69.099 37.327 43.186  1.00 46.78  ?  35   GLN F H    1 
ATOM   8332  H  HA   . GLN F  1 35 ? 69.675 35.744 41.135  1.00 50.47  ?  35   GLN F HA   1 
ATOM   8333  H  HB2  . GLN F  1 35 ? 71.316 37.495 42.630  1.00 52.84  ?  35   GLN F HB2  1 
ATOM   8334  H  HB3  . GLN F  1 35 ? 71.883 36.644 41.417  1.00 52.84  ?  35   GLN F HB3  1 
ATOM   8335  H  HG2  . GLN F  1 35 ? 70.493 37.797 39.954  1.00 50.89  ?  35   GLN F HG2  1 
ATOM   8336  H  HG3  . GLN F  1 35 ? 69.922 38.649 41.169  1.00 50.89  ?  35   GLN F HG3  1 
ATOM   8337  H  HE21 . GLN F  1 35 ? 70.992 40.487 41.784  1.00 53.64  ?  35   GLN F HE21 1 
ATOM   8338  H  HE22 . GLN F  1 35 ? 72.275 40.965 41.198  1.00 53.64  ?  35   GLN F HE22 1 
ATOM   8339  N  N    . GLU F  1 36 ? 70.810 34.929 44.020  1.00 39.52  ?  36   GLU F N    1 
ATOM   8340  C  CA   . GLU F  1 36 ? 71.417 33.850 44.792  1.00 41.33  ?  36   GLU F CA   1 
ATOM   8341  C  C    . GLU F  1 36 ? 70.560 32.589 44.759  1.00 41.05  ?  36   GLU F C    1 
ATOM   8342  O  O    . GLU F  1 36 ? 71.085 31.476 44.716  1.00 40.48  ?  36   GLU F O    1 
ATOM   8343  C  CB   . GLU F  1 36 ? 71.655 34.291 46.239  1.00 44.05  ?  36   GLU F CB   1 
ATOM   8344  C  CG   . GLU F  1 36 ? 72.842 35.230 46.411  1.00 48.62  ?  36   GLU F CG   1 
ATOM   8345  C  CD   . GLU F  1 36 ? 73.086 35.609 47.862  1.00 55.57  ?  36   GLU F CD   1 
ATOM   8346  O  OE1  . GLU F  1 36 ? 72.179 35.399 48.698  1.00 56.43  ?  36   GLU F OE1  1 
ATOM   8347  O  OE2  . GLU F  1 36 ? 74.189 36.112 48.168  1.00 60.60  ?  36   GLU F OE2  1 
ATOM   8348  H  H    . GLU F  1 36 ? 70.600 35.620 44.487  1.00 47.42  ?  36   GLU F H    1 
ATOM   8349  H  HA   . GLU F  1 36 ? 72.287 33.631 44.398  1.00 49.60  ?  36   GLU F HA   1 
ATOM   8350  H  HB2  . GLU F  1 36 ? 70.864 34.752 46.559  1.00 52.86  ?  36   GLU F HB2  1 
ATOM   8351  H  HB3  . GLU F  1 36 ? 71.819 33.504 46.782  1.00 52.86  ?  36   GLU F HB3  1 
ATOM   8352  H  HG2  . GLU F  1 36 ? 73.641 34.795 46.076  1.00 58.35  ?  36   GLU F HG2  1 
ATOM   8353  H  HG3  . GLU F  1 36 ? 72.675 36.046 45.912  1.00 58.35  ?  36   GLU F HG3  1 
ATOM   8354  N  N    . GLN F  1 37 ? 69.242 32.765 44.775  1.00 43.64  ?  37   GLN F N    1 
ATOM   8355  C  CA   . GLN F  1 37 ? 68.324 31.632 44.734  1.00 47.84  ?  37   GLN F CA   1 
ATOM   8356  C  C    . GLN F  1 37 ? 68.083 31.153 43.300  1.00 47.78  ?  37   GLN F C    1 
ATOM   8357  O  O    . GLN F  1 37 ? 67.476 30.104 43.083  1.00 48.71  ?  37   GLN F O    1 
ATOM   8358  C  CB   . GLN F  1 37 ? 67.001 31.988 45.415  1.00 50.35  ?  37   GLN F CB   1 
ATOM   8359  C  CG   . GLN F  1 37 ? 67.164 32.441 46.858  1.00 55.77  ?  37   GLN F CG   1 
ATOM   8360  C  CD   . GLN F  1 37 ? 68.150 31.581 47.632  1.00 61.72  ?  37   GLN F CD   1 
ATOM   8361  O  OE1  . GLN F  1 37 ? 68.027 30.356 47.674  1.00 62.43  ?  37   GLN F OE1  1 
ATOM   8362  N  NE2  . GLN F  1 37 ? 69.144 32.222 48.239  1.00 65.76  ?  37   GLN F NE2  1 
ATOM   8363  H  H    . GLN F  1 37 ? 68.854 33.532 44.809  1.00 52.37  ?  37   GLN F H    1 
ATOM   8364  H  HA   . GLN F  1 37 ? 68.723 30.888 45.232  1.00 57.41  ?  37   GLN F HA   1 
ATOM   8365  H  HB2  . GLN F  1 37 ? 66.580 32.709 44.922  1.00 60.42  ?  37   GLN F HB2  1 
ATOM   8366  H  HB3  . GLN F  1 37 ? 66.426 31.207 45.411  1.00 60.42  ?  37   GLN F HB3  1 
ATOM   8367  H  HG2  . GLN F  1 37 ? 67.488 33.355 46.869  1.00 66.92  ?  37   GLN F HG2  1 
ATOM   8368  H  HG3  . GLN F  1 37 ? 66.304 32.388 47.305  1.00 66.92  ?  37   GLN F HG3  1 
ATOM   8369  H  HE21 . GLN F  1 37 ? 69.202 33.078 48.181  1.00 78.92  ?  37   GLN F HE21 1 
ATOM   8370  H  HE22 . GLN F  1 37 ? 69.728 31.781 48.690  1.00 78.92  ?  37   GLN F HE22 1 
ATOM   8371  N  N    . GLY F  1 38 ? 68.554 31.928 42.327  1.00 44.26  ?  38   GLY F N    1 
ATOM   8372  C  CA   . GLY F  1 38 ? 68.574 31.488 40.943  1.00 43.15  ?  38   GLY F CA   1 
ATOM   8373  C  C    . GLY F  1 38 ? 67.391 31.919 40.094  1.00 41.14  ?  38   GLY F C    1 
ATOM   8374  O  O    . GLY F  1 38 ? 67.327 31.590 38.909  1.00 41.36  ?  38   GLY F O    1 
ATOM   8375  H  H    . GLY F  1 38 ? 68.869 32.719 42.448  1.00 53.11  ?  38   GLY F H    1 
ATOM   8376  H  HA2  . GLY F  1 38 ? 69.379 31.826 40.521  1.00 51.78  ?  38   GLY F HA2  1 
ATOM   8377  H  HA3  . GLY F  1 38 ? 68.613 30.519 40.925  1.00 51.78  ?  38   GLY F HA3  1 
ATOM   8378  N  N    . GLN F  1 39 ? 66.451 32.650 40.684  1.00 43.09  ?  39   GLN F N    1 
ATOM   8379  C  CA   . GLN F  1 39 ? 65.285 33.118 39.940  1.00 43.30  ?  39   GLN F CA   1 
ATOM   8380  C  C    . GLN F  1 39 ? 65.669 34.230 38.973  1.00 38.02  ?  39   GLN F C    1 
ATOM   8381  O  O    . GLN F  1 39 ? 65.129 34.320 37.870  1.00 40.46  ?  39   GLN F O    1 
ATOM   8382  C  CB   . GLN F  1 39 ? 64.197 33.600 40.897  1.00 48.03  ?  39   GLN F CB   1 
ATOM   8383  C  CG   . GLN F  1 39 ? 63.397 32.473 41.524  1.00 53.44  ?  39   GLN F CG   1 
ATOM   8384  C  CD   . GLN F  1 39 ? 63.080 32.726 42.981  1.00 57.60  ?  39   GLN F CD   1 
ATOM   8385  O  OE1  . GLN F  1 39 ? 63.983 32.874 43.805  1.00 59.95  ?  39   GLN F OE1  1 
ATOM   8386  N  NE2  . GLN F  1 39 ? 61.793 32.783 43.308  1.00 58.31  ?  39   GLN F NE2  1 
ATOM   8387  H  H    . GLN F  1 39 ? 66.463 32.888 41.511  1.00 51.70  ?  39   GLN F H    1 
ATOM   8388  H  HA   . GLN F  1 39 ? 64.921 32.374 39.417  1.00 51.96  ?  39   GLN F HA   1 
ATOM   8389  H  HB2  . GLN F  1 39 ? 64.611 34.106 41.614  1.00 57.64  ?  39   GLN F HB2  1 
ATOM   8390  H  HB3  . GLN F  1 39 ? 63.579 34.167 40.408  1.00 57.64  ?  39   GLN F HB3  1 
ATOM   8391  H  HG2  . GLN F  1 39 ? 62.559 32.375 41.047  1.00 64.13  ?  39   GLN F HG2  1 
ATOM   8392  H  HG3  . GLN F  1 39 ? 63.910 31.651 41.467  1.00 64.13  ?  39   GLN F HG3  1 
ATOM   8393  H  HE21 . GLN F  1 39 ? 61.190 32.677 42.704  1.00 69.98  ?  39   GLN F HE21 1 
ATOM   8394  H  HE22 . GLN F  1 39 ? 61.562 32.925 44.124  1.00 69.98  ?  39   GLN F HE22 1 
ATOM   8395  N  N    . TRP F  1 40 ? 66.603 35.074 39.396  1.00 33.34  ?  40   TRP F N    1 
ATOM   8396  C  CA   . TRP F  1 40 ? 67.131 36.138 38.552  1.00 30.00  ?  40   TRP F CA   1 
ATOM   8397  C  C    . TRP F  1 40 ? 68.470 35.671 37.994  1.00 32.64  ?  40   TRP F C    1 
ATOM   8398  O  O    . TRP F  1 40 ? 69.523 35.967 38.557  1.00 32.36  ?  40   TRP F O    1 
ATOM   8399  C  CB   . TRP F  1 40 ? 67.303 37.410 39.380  1.00 29.85  ?  40   TRP F CB   1 
ATOM   8400  C  CG   . TRP F  1 40 ? 67.447 38.670 38.585  1.00 30.02  ?  40   TRP F CG   1 
ATOM   8401  C  CD1  . TRP F  1 40 ? 68.035 38.815 37.362  1.00 29.97  ?  40   TRP F CD1  1 
ATOM   8402  C  CD2  . TRP F  1 40 ? 66.985 39.971 38.965  1.00 29.92  ?  40   TRP F CD2  1 
ATOM   8403  N  NE1  . TRP F  1 40 ? 67.971 40.129 36.960  1.00 29.33  ?  40   TRP F NE1  1 
ATOM   8404  C  CE2  . TRP F  1 40 ? 67.330 40.858 37.926  1.00 29.98  ?  40   TRP F CE2  1 
ATOM   8405  C  CE3  . TRP F  1 40 ? 66.313 40.473 40.084  1.00 31.46  ?  40   TRP F CE3  1 
ATOM   8406  C  CZ2  . TRP F  1 40 ? 67.024 42.216 37.973  1.00 29.89  ?  40   TRP F CZ2  1 
ATOM   8407  C  CZ3  . TRP F  1 40 ? 66.012 41.821 40.130  1.00 31.47  ?  40   TRP F CZ3  1 
ATOM   8408  C  CH2  . TRP F  1 40 ? 66.367 42.677 39.081  1.00 30.93  ?  40   TRP F CH2  1 
ATOM   8409  H  H    . TRP F  1 40 ? 66.953 35.051 40.181  1.00 40.00  ?  40   TRP F H    1 
ATOM   8410  H  HA   . TRP F  1 40 ? 66.517 36.316 37.809  1.00 36.00  ?  40   TRP F HA   1 
ATOM   8411  H  HB2  . TRP F  1 40 ? 66.526 37.513 39.952  1.00 35.82  ?  40   TRP F HB2  1 
ATOM   8412  H  HB3  . TRP F  1 40 ? 68.099 37.317 39.927  1.00 35.82  ?  40   TRP F HB3  1 
ATOM   8413  H  HD1  . TRP F  1 40 ? 68.426 38.126 36.874  1.00 35.96  ?  40   TRP F HD1  1 
ATOM   8414  H  HE1  . TRP F  1 40 ? 68.281 40.441 36.220  1.00 35.20  ?  40   TRP F HE1  1 
ATOM   8415  H  HE3  . TRP F  1 40 ? 66.074 39.910 40.785  1.00 37.75  ?  40   TRP F HE3  1 
ATOM   8416  H  HZ2  . TRP F  1 40 ? 67.259 42.789 37.279  1.00 35.87  ?  40   TRP F HZ2  1 
ATOM   8417  H  HZ3  . TRP F  1 40 ? 65.566 42.165 40.869  1.00 37.76  ?  40   TRP F HZ3  1 
ATOM   8418  H  HH2  . TRP F  1 40 ? 66.152 43.580 39.139  1.00 37.12  ?  40   TRP F HH2  1 
ATOM   8419  N  N    . ARG F  1 41 ? 68.428 34.929 36.891  1.00 35.39  ?  41   ARG F N    1 
ATOM   8420  C  CA   . ARG F  1 41 ? 69.618 34.235 36.408  1.00 39.21  ?  41   ARG F CA   1 
ATOM   8421  C  C    . ARG F  1 41 ? 70.693 35.185 35.892  1.00 38.25  ?  41   ARG F C    1 
ATOM   8422  O  O    . ARG F  1 41 ? 71.853 35.085 36.293  1.00 40.35  ?  41   ARG F O    1 
ATOM   8423  C  CB   . ARG F  1 41 ? 69.263 33.219 35.322  1.00 40.24  ?  41   ARG F CB   1 
ATOM   8424  C  CG   . ARG F  1 41 ? 70.479 32.466 34.812  1.00 43.36  ?  41   ARG F CG   1 
ATOM   8425  C  CD   . ARG F  1 41 ? 70.145 31.498 33.697  1.00 46.72  ?  41   ARG F CD   1 
ATOM   8426  N  NE   . ARG F  1 41 ? 69.461 30.308 34.186  1.00 52.13  ?  41   ARG F NE   1 
ATOM   8427  C  CZ   . ARG F  1 41 ? 69.377 29.164 33.514  1.00 56.75  ?  41   ARG F CZ   1 
ATOM   8428  N  NH1  . ARG F  1 41 ? 69.940 29.045 32.318  1.00 56.74  ?  41   ARG F NH1  1 
ATOM   8429  N  NH2  . ARG F  1 41 ? 68.733 28.132 34.041  1.00 60.19  ?  41   ARG F NH2  1 
ATOM   8430  H  H    . ARG F  1 41 ? 67.727 34.811 36.406  1.00 42.47  ?  41   ARG F H    1 
ATOM   8431  H  HA   . ARG F  1 41 ? 70.006 33.736 37.157  1.00 47.05  ?  41   ARG F HA   1 
ATOM   8432  H  HB2  . ARG F  1 41 ? 68.639 32.572 35.685  1.00 48.28  ?  41   ARG F HB2  1 
ATOM   8433  H  HB3  . ARG F  1 41 ? 68.861 33.685 34.572  1.00 48.28  ?  41   ARG F HB3  1 
ATOM   8434  H  HG2  . ARG F  1 41 ? 71.125 33.104 34.471  1.00 52.03  ?  41   ARG F HG2  1 
ATOM   8435  H  HG3  . ARG F  1 41 ? 70.866 31.960 35.543  1.00 52.03  ?  41   ARG F HG3  1 
ATOM   8436  H  HD2  . ARG F  1 41 ? 69.565 31.939 33.057  1.00 56.06  ?  41   ARG F HD2  1 
ATOM   8437  H  HD3  . ARG F  1 41 ? 70.967 31.217 33.264  1.00 56.06  ?  41   ARG F HD3  1 
ATOM   8438  H  HE   . ARG F  1 41 ? 69.087 30.348 34.960  1.00 62.55  ?  41   ARG F HE   1 
ATOM   8439  H  HH11 . ARG F  1 41 ? 70.360 29.711 31.972  1.00 68.09  ?  41   ARG F HH11 1 
ATOM   8440  H  HH12 . ARG F  1 41 ? 69.884 28.302 31.888  1.00 68.09  ?  41   ARG F HH12 1 
ATOM   8441  H  HH21 . ARG F  1 41 ? 68.367 28.203 34.816  1.00 72.22  ?  41   ARG F HH21 1 
ATOM   8442  H  HH22 . ARG F  1 41 ? 68.679 27.391 33.607  1.00 72.22  ?  41   ARG F HH22 1 
ATOM   8443  N  N    . TYR F  1 42 ? 70.316 36.095 34.999  1.00 37.55  ?  42   TYR F N    1 
ATOM   8444  C  CA   . TYR F  1 42 ? 71.277 37.040 34.438  1.00 35.11  ?  42   TYR F CA   1 
ATOM   8445  C  C    . TYR F  1 42 ? 70.825 38.483 34.615  1.00 33.64  ?  42   TYR F C    1 
ATOM   8446  O  O    . TYR F  1 42 ? 69.631 38.788 34.569  1.00 32.11  ?  42   TYR F O    1 
ATOM   8447  C  CB   . TYR F  1 42 ? 71.533 36.739 32.959  1.00 34.27  ?  42   TYR F CB   1 
ATOM   8448  C  CG   . TYR F  1 42 ? 72.057 35.341 32.721  1.00 36.56  ?  42   TYR F CG   1 
ATOM   8449  C  CD1  . TYR F  1 42 ? 73.210 34.899 33.355  1.00 38.65  ?  42   TYR F CD1  1 
ATOM   8450  C  CD2  . TYR F  1 42 ? 71.400 34.464 31.869  1.00 36.58  ?  42   TYR F CD2  1 
ATOM   8451  C  CE1  . TYR F  1 42 ? 73.694 33.621 33.150  1.00 40.37  ?  42   TYR F CE1  1 
ATOM   8452  C  CE2  . TYR F  1 42 ? 71.878 33.184 31.655  1.00 38.34  ?  42   TYR F CE2  1 
ATOM   8453  C  CZ   . TYR F  1 42 ? 73.026 32.768 32.299  1.00 40.18  ?  42   TYR F CZ   1 
ATOM   8454  O  OH   . TYR F  1 42 ? 73.508 31.495 32.095  1.00 42.46  ?  42   TYR F OH   1 
ATOM   8455  H  H    . TYR F  1 42 ? 69.514 36.186 34.702  1.00 45.06  ?  42   TYR F H    1 
ATOM   8456  H  HA   . TYR F  1 42 ? 72.128 36.936 34.913  1.00 42.13  ?  42   TYR F HA   1 
ATOM   8457  H  HB2  . TYR F  1 42 ? 70.701 36.833 32.469  1.00 41.13  ?  42   TYR F HB2  1 
ATOM   8458  H  HB3  . TYR F  1 42 ? 72.190 37.366 32.619  1.00 41.13  ?  42   TYR F HB3  1 
ATOM   8459  H  HD1  . TYR F  1 42 ? 73.663 35.471 33.931  1.00 46.37  ?  42   TYR F HD1  1 
ATOM   8460  H  HD2  . TYR F  1 42 ? 70.625 34.742 31.435  1.00 43.90  ?  42   TYR F HD2  1 
ATOM   8461  H  HE1  . TYR F  1 42 ? 74.467 33.339 33.582  1.00 48.44  ?  42   TYR F HE1  1 
ATOM   8462  H  HE2  . TYR F  1 42 ? 71.427 32.606 31.082  1.00 46.00  ?  42   TYR F HE2  1 
ATOM   8463  H  HH   . TYR F  1 42 ? 73.683 31.385 31.302  1.00 50.96  ?  42   TYR F HH   1 
ATOM   8464  N  N    . LEU F  1 43 ? 71.799 39.363 34.824  1.00 32.73  ?  43   LEU F N    1 
ATOM   8465  C  CA   . LEU F  1 43 ? 71.541 40.781 35.030  1.00 33.60  ?  43   LEU F CA   1 
ATOM   8466  C  C    . LEU F  1 43 ? 72.633 41.598 34.354  1.00 35.56  ?  43   LEU F C    1 
ATOM   8467  O  O    . LEU F  1 43 ? 73.802 41.525 34.735  1.00 37.74  ?  43   LEU F O    1 
ATOM   8468  C  CB   . LEU F  1 43 ? 71.500 41.102 36.524  1.00 34.68  ?  43   LEU F CB   1 
ATOM   8469  C  CG   . LEU F  1 43 ? 71.355 42.578 36.901  1.00 36.37  ?  43   LEU F CG   1 
ATOM   8470  C  CD1  . LEU F  1 43 ? 70.093 43.173 36.297  1.00 35.99  ?  43   LEU F CD1  1 
ATOM   8471  C  CD2  . LEU F  1 43 ? 71.349 42.738 38.412  1.00 38.65  ?  43   LEU F CD2  1 
ATOM   8472  H  H    . LEU F  1 43 ? 72.633 39.157 34.852  1.00 39.28  ?  43   LEU F H    1 
ATOM   8473  H  HA   . LEU F  1 43 ? 70.678 41.020 34.633  1.00 40.32  ?  43   LEU F HA   1 
ATOM   8474  H  HB2  . LEU F  1 43 ? 70.747 40.631 36.915  1.00 41.62  ?  43   LEU F HB2  1 
ATOM   8475  H  HB3  . LEU F  1 43 ? 72.322 40.782 36.926  1.00 41.62  ?  43   LEU F HB3  1 
ATOM   8476  H  HG   . LEU F  1 43 ? 72.114 43.069 36.550  1.00 43.64  ?  43   LEU F HG   1 
ATOM   8477  H  HD11 . LEU F  1 43 ? 69.331 42.690 36.628  1.00 43.19  ?  43   LEU F HD11 1 
ATOM   8478  H  HD12 . LEU F  1 43 ? 70.031 44.097 36.551  1.00 43.19  ?  43   LEU F HD12 1 
ATOM   8479  H  HD13 . LEU F  1 43 ? 70.139 43.098 35.341  1.00 43.19  ?  43   LEU F HD13 1 
ATOM   8480  H  HD21 . LEU F  1 43 ? 72.175 42.400 38.765  1.00 46.38  ?  43   LEU F HD21 1 
ATOM   8481  H  HD22 . LEU F  1 43 ? 71.257 43.669 38.627  1.00 46.38  ?  43   LEU F HD22 1 
ATOM   8482  H  HD23 . LEU F  1 43 ? 70.610 42.244 38.775  1.00 46.38  ?  43   LEU F HD23 1 
ATOM   8483  N  N    . TRP F  1 44 ? 72.246 42.368 33.342  1.00 36.76  ?  44   TRP F N    1 
ATOM   8484  C  CA   . TRP F  1 44 ? 73.188 43.209 32.620  1.00 36.73  ?  44   TRP F CA   1 
ATOM   8485  C  C    . TRP F  1 44 ? 72.703 44.651 32.609  1.00 35.64  ?  44   TRP F C    1 
ATOM   8486  O  O    . TRP F  1 44 ? 71.501 44.913 32.561  1.00 36.89  ?  44   TRP F O    1 
ATOM   8487  C  CB   . TRP F  1 44 ? 73.354 42.723 31.179  1.00 35.52  ?  44   TRP F CB   1 
ATOM   8488  C  CG   . TRP F  1 44 ? 73.953 41.357 31.050  1.00 35.80  ?  44   TRP F CG   1 
ATOM   8489  C  CD1  . TRP F  1 44 ? 75.237 40.993 31.339  1.00 38.29  ?  44   TRP F CD1  1 
ATOM   8490  C  CD2  . TRP F  1 44 ? 73.298 40.172 30.579  1.00 33.32  ?  44   TRP F CD2  1 
ATOM   8491  N  NE1  . TRP F  1 44 ? 75.418 39.655 31.085  1.00 37.09  ?  44   TRP F NE1  1 
ATOM   8492  C  CE2  . TRP F  1 44 ? 74.242 39.129 30.616  1.00 34.56  ?  44   TRP F CE2  1 
ATOM   8493  C  CE3  . TRP F  1 44 ? 72.003 39.893 30.132  1.00 31.12  ?  44   TRP F CE3  1 
ATOM   8494  C  CZ2  . TRP F  1 44 ? 73.933 37.828 30.226  1.00 33.50  ?  44   TRP F CZ2  1 
ATOM   8495  C  CZ3  . TRP F  1 44 ? 71.698 38.600 29.744  1.00 31.09  ?  44   TRP F CZ3  1 
ATOM   8496  C  CH2  . TRP F  1 44 ? 72.658 37.585 29.794  1.00 32.49  ?  44   TRP F CH2  1 
ATOM   8497  H  H    . TRP F  1 44 ? 71.438 42.420 33.054  1.00 44.12  ?  44   TRP F H    1 
ATOM   8498  H  HA   . TRP F  1 44 ? 74.062 43.177 33.062  1.00 44.08  ?  44   TRP F HA   1 
ATOM   8499  H  HB2  . TRP F  1 44 ? 72.481 42.703 30.756  1.00 42.62  ?  44   TRP F HB2  1 
ATOM   8500  H  HB3  . TRP F  1 44 ? 73.931 43.343 30.707  1.00 42.62  ?  44   TRP F HB3  1 
ATOM   8501  H  HD1  . TRP F  1 44 ? 75.892 41.567 31.664  1.00 45.95  ?  44   TRP F HD1  1 
ATOM   8502  H  HE1  . TRP F  1 44 ? 76.150 39.218 31.200  1.00 44.51  ?  44   TRP F HE1  1 
ATOM   8503  H  HE3  . TRP F  1 44 ? 71.358 40.563 30.096  1.00 37.35  ?  44   TRP F HE3  1 
ATOM   8504  H  HZ2  . TRP F  1 44 ? 74.569 37.150 30.258  1.00 40.20  ?  44   TRP F HZ2  1 
ATOM   8505  H  HZ3  . TRP F  1 44 ? 70.840 38.402 29.446  1.00 37.31  ?  44   TRP F HZ3  1 
ATOM   8506  H  HH2  . TRP F  1 44 ? 72.425 36.725 29.527  1.00 38.99  ?  44   TRP F HH2  1 
ATOM   8507  N  N    . ARG F  1 45 ? 73.645 45.586 32.651  1.00 33.03  ?  45   ARG F N    1 
ATOM   8508  C  CA   . ARG F  1 45 ? 73.315 46.994 32.514  1.00 31.36  ?  45   ARG F CA   1 
ATOM   8509  C  C    . ARG F  1 45 ? 73.130 47.341 31.044  1.00 31.82  ?  45   ARG F C    1 
ATOM   8510  O  O    . ARG F  1 45 ? 73.954 46.976 30.206  1.00 30.01  ?  45   ARG F O    1 
ATOM   8511  C  CB   . ARG F  1 45 ? 74.422 47.868 33.105  1.00 31.90  ?  45   ARG F CB   1 
ATOM   8512  C  CG   . ARG F  1 45 ? 74.214 49.358 32.872  1.00 31.45  ?  45   ARG F CG   1 
ATOM   8513  C  CD   . ARG F  1 45 ? 73.051 49.886 33.692  1.00 31.38  ?  45   ARG F CD   1 
ATOM   8514  N  NE   . ARG F  1 45 ? 73.453 50.196 35.061  1.00 34.01  ?  45   ARG F NE   1 
ATOM   8515  C  CZ   . ARG F  1 45 ? 72.608 50.380 36.071  1.00 36.76  ?  45   ARG F CZ   1 
ATOM   8516  N  NH1  . ARG F  1 45 ? 71.298 50.275 35.882  1.00 36.28  ?  45   ARG F NH1  1 
ATOM   8517  N  NH2  . ARG F  1 45 ? 73.076 50.663 37.278  1.00 39.54  ?  45   ARG F NH2  1 
ATOM   8518  H  H    . ARG F  1 45 ? 74.484 45.429 32.758  1.00 39.64  ?  45   ARG F H    1 
ATOM   8519  H  HA   . ARG F  1 45 ? 72.478 47.184 32.988  1.00 37.63  ?  45   ARG F HA   1 
ATOM   8520  H  HB2  . ARG F  1 45 ? 74.460 47.719 34.063  1.00 38.28  ?  45   ARG F HB2  1 
ATOM   8521  H  HB3  . ARG F  1 45 ? 75.267 47.619 32.699  1.00 38.28  ?  45   ARG F HB3  1 
ATOM   8522  H  HG2  . ARG F  1 45 ? 75.015 49.838 33.134  1.00 37.74  ?  45   ARG F HG2  1 
ATOM   8523  H  HG3  . ARG F  1 45 ? 74.020 49.512 31.934  1.00 37.74  ?  45   ARG F HG3  1 
ATOM   8524  H  HD2  . ARG F  1 45 ? 72.715 50.698 33.283  1.00 37.65  ?  45   ARG F HD2  1 
ATOM   8525  H  HD3  . ARG F  1 45 ? 72.353 49.213 33.726  1.00 37.65  ?  45   ARG F HD3  1 
ATOM   8526  H  HE   . ARG F  1 45 ? 74.294 50.264 35.225  1.00 40.82  ?  45   ARG F HE   1 
ATOM   8527  H  HH11 . ARG F  1 45 ? 70.990 50.092 35.100  1.00 43.54  ?  45   ARG F HH11 1 
ATOM   8528  H  HH12 . ARG F  1 45 ? 70.758 50.393 36.540  1.00 43.54  ?  45   ARG F HH12 1 
ATOM   8529  H  HH21 . ARG F  1 45 ? 73.924 50.730 37.406  1.00 47.45  ?  45   ARG F HH21 1 
ATOM   8530  H  HH22 . ARG F  1 45 ? 72.532 50.779 37.934  1.00 47.45  ?  45   ARG F HH22 1 
ATOM   8531  N  N    . THR F  1 46 ? 72.041 48.037 30.732  1.00 36.34  ?  46   THR F N    1 
ATOM   8532  C  CA   . THR F  1 46 ? 71.858 48.590 29.399  1.00 38.31  ?  46   THR F CA   1 
ATOM   8533  C  C    . THR F  1 46 ? 72.762 49.808 29.262  1.00 37.16  ?  46   THR F C    1 
ATOM   8534  O  O    . THR F  1 46 ? 72.564 50.820 29.937  1.00 34.88  ?  46   THR F O    1 
ATOM   8535  C  CB   . THR F  1 46 ? 70.395 48.995 29.142  1.00 39.62  ?  46   THR F CB   1 
ATOM   8536  O  OG1  . THR F  1 46 ? 69.882 49.707 30.276  1.00 41.06  ?  46   THR F OG1  1 
ATOM   8537  C  CG2  . THR F  1 46 ? 69.538 47.766 28.897  1.00 39.02  ?  46   THR F CG2  1 
ATOM   8538  H  H    . THR F  1 46 ? 71.395 48.202 31.276  1.00 43.60  ?  46   THR F H    1 
ATOM   8539  H  HA   . THR F  1 46 ? 72.122 47.927 28.728  1.00 45.98  ?  46   THR F HA   1 
ATOM   8540  H  HB   . THR F  1 46 ? 70.349 49.563 28.357  1.00 47.54  ?  46   THR F HB   1 
ATOM   8541  H  HG1  . THR F  1 46 ? 70.327 50.383 30.408  1.00 49.27  ?  46   THR F HG1  1 
ATOM   8542  H  HG21 . THR F  1 46 ? 69.567 47.188 29.663  1.00 46.83  ?  46   THR F HG21 1 
ATOM   8543  H  HG22 . THR F  1 46 ? 68.628 48.027 28.738  1.00 46.83  ?  46   THR F HG22 1 
ATOM   8544  H  HG23 . THR F  1 46 ? 69.863 47.286 28.132  1.00 46.83  ?  46   THR F HG23 1 
ATOM   8545  N  N    . THR F  1 47 ? 73.763 49.701 28.393  1.00 38.85  ?  47   THR F N    1 
ATOM   8546  C  CA   . THR F  1 47 ? 74.778 50.741 28.262  1.00 39.79  ?  47   THR F CA   1 
ATOM   8547  C  C    . THR F  1 47 ? 74.163 52.103 27.954  1.00 39.68  ?  47   THR F C    1 
ATOM   8548  O  O    . THR F  1 47 ? 73.313 52.229 27.073  1.00 40.24  ?  47   THR F O    1 
ATOM   8549  C  CB   . THR F  1 47 ? 75.796 50.396 27.159  1.00 39.55  ?  47   THR F CB   1 
ATOM   8550  O  OG1  . THR F  1 47 ? 76.346 49.095 27.398  1.00 41.35  ?  47   THR F OG1  1 
ATOM   8551  C  CG2  . THR F  1 47 ? 76.919 51.421 27.129  1.00 38.67  ?  47   THR F CG2  1 
ATOM   8552  H  H    . THR F  1 47 ? 73.877 49.032 27.866  1.00 46.62  ?  47   THR F H    1 
ATOM   8553  H  HA   . THR F  1 47 ? 75.266 50.816 29.108  1.00 47.75  ?  47   THR F HA   1 
ATOM   8554  H  HB   . THR F  1 47 ? 75.352 50.404 26.296  1.00 47.46  ?  47   THR F HB   1 
ATOM   8555  H  HG1  . THR F  1 47 ? 76.724 49.080 28.126  1.00 49.62  ?  47   THR F HG1  1 
ATOM   8556  H  HG21 . THR F  1 47 ? 77.374 51.434 27.974  1.00 46.41  ?  47   THR F HG21 1 
ATOM   8557  H  HG22 . THR F  1 47 ? 77.548 51.198 26.439  1.00 46.41  ?  47   THR F HG22 1 
ATOM   8558  H  HG23 . THR F  1 47 ? 76.561 52.295 26.954  1.00 46.41  ?  47   THR F HG23 1 
ATOM   8559  N  N    . GLY F  1 48 ? 74.616 53.120 28.682  1.00 37.72  ?  48   GLY F N    1 
ATOM   8560  C  CA   . GLY F  1 48 ? 74.121 54.477 28.530  1.00 37.03  ?  48   GLY F CA   1 
ATOM   8561  C  C    . GLY F  1 48 ? 72.747 54.755 29.119  1.00 36.27  ?  48   GLY F C    1 
ATOM   8562  O  O    . GLY F  1 48 ? 72.274 55.892 29.071  1.00 35.28  ?  48   GLY F O    1 
ATOM   8563  H  H    . GLY F  1 48 ? 75.226 53.043 29.283  1.00 45.26  ?  48   GLY F H    1 
ATOM   8564  H  HA2  . GLY F  1 48 ? 74.750 55.086 28.948  1.00 44.44  ?  48   GLY F HA2  1 
ATOM   8565  H  HA3  . GLY F  1 48 ? 74.085 54.691 27.584  1.00 44.44  ?  48   GLY F HA3  1 
ATOM   8566  N  N    . LYS F  1 49 ? 72.104 53.736 29.681  1.00 38.57  ?  49   LYS F N    1 
ATOM   8567  C  CA   . LYS F  1 49 ? 70.729 53.881 30.156  1.00 39.69  ?  49   LYS F CA   1 
ATOM   8568  C  C    . LYS F  1 49 ? 70.561 53.484 31.620  1.00 37.83  ?  49   LYS F C    1 
ATOM   8569  O  O    . LYS F  1 49 ? 71.321 52.673 32.148  1.00 35.65  ?  49   LYS F O    1 
ATOM   8570  C  CB   . LYS F  1 49 ? 69.785 53.043 29.291  1.00 42.47  ?  49   LYS F CB   1 
ATOM   8571  C  CG   . LYS F  1 49 ? 69.600 53.573 27.880  1.00 44.87  ?  49   LYS F CG   1 
ATOM   8572  C  CD   . LYS F  1 49 ? 68.751 52.627 27.045  1.00 45.57  ?  49   LYS F CD   1 
ATOM   8573  C  CE   . LYS F  1 49 ? 68.505 53.174 25.649  1.00 45.91  ?  49   LYS F CE   1 
ATOM   8574  N  NZ   . LYS F  1 49 ? 67.645 54.394 25.660  1.00 46.30  ?  49   LYS F NZ   1 
ATOM   8575  H  H    . LYS F  1 49 ? 72.439 52.953 29.800  1.00 46.29  ?  49   LYS F H    1 
ATOM   8576  H  HA   . LYS F  1 49 ? 70.462 54.820 30.068  1.00 47.62  ?  49   LYS F HA   1 
ATOM   8577  H  HB2  . LYS F  1 49 ? 70.141 52.143 29.224  1.00 50.96  ?  49   LYS F HB2  1 
ATOM   8578  H  HB3  . LYS F  1 49 ? 68.912 53.019 29.714  1.00 50.96  ?  49   LYS F HB3  1 
ATOM   8579  H  HG2  . LYS F  1 49 ? 69.152 54.433 27.916  1.00 53.85  ?  49   LYS F HG2  1 
ATOM   8580  H  HG3  . LYS F  1 49 ? 70.467 53.662 27.454  1.00 53.85  ?  49   LYS F HG3  1 
ATOM   8581  H  HD2  . LYS F  1 49 ? 69.210 51.777 26.961  1.00 54.69  ?  49   LYS F HD2  1 
ATOM   8582  H  HD3  . LYS F  1 49 ? 67.892 52.503 27.478  1.00 54.69  ?  49   LYS F HD3  1 
ATOM   8583  H  HE2  . LYS F  1 49 ? 69.356 53.409 25.246  1.00 55.09  ?  49   LYS F HE2  1 
ATOM   8584  H  HE3  . LYS F  1 49 ? 68.060 52.497 25.116  1.00 55.09  ?  49   LYS F HE3  1 
ATOM   8585  H  HZ1  . LYS F  1 49 ? 68.034 55.036 26.138  1.00 55.56  ?  49   LYS F HZ1  1 
ATOM   8586  H  HZ2  . LYS F  1 49 ? 67.522 54.687 24.829  1.00 55.56  ?  49   LYS F HZ2  1 
ATOM   8587  H  HZ3  . LYS F  1 49 ? 66.854 54.204 26.020  1.00 55.56  ?  49   LYS F HZ3  1 
ATOM   8588  N  N    . TYR F  1 50 ? 69.555 54.067 32.267  1.00 37.06  ?  50   TYR F N    1 
ATOM   8589  C  CA   . TYR F  1 50 ? 69.200 53.693 33.629  1.00 38.98  ?  50   TYR F CA   1 
ATOM   8590  C  C    . TYR F  1 50 ? 68.188 52.558 33.576  1.00 36.53  ?  50   TYR F C    1 
ATOM   8591  O  O    . TYR F  1 50 ? 66.978 52.779 33.633  1.00 37.47  ?  50   TYR F O    1 
ATOM   8592  C  CB   . TYR F  1 50 ? 68.616 54.886 34.386  1.00 41.85  ?  50   TYR F CB   1 
ATOM   8593  C  CG   . TYR F  1 50 ? 68.610 54.726 35.893  1.00 44.95  ?  50   TYR F CG   1 
ATOM   8594  C  CD1  . TYR F  1 50 ? 68.726 53.474 36.486  1.00 46.02  ?  50   TYR F CD1  1 
ATOM   8595  C  CD2  . TYR F  1 50 ? 68.489 55.832 36.724  1.00 47.57  ?  50   TYR F CD2  1 
ATOM   8596  C  CE1  . TYR F  1 50 ? 68.720 53.331 37.861  1.00 48.53  ?  50   TYR F CE1  1 
ATOM   8597  C  CE2  . TYR F  1 50 ? 68.481 55.697 38.099  1.00 50.25  ?  50   TYR F CE2  1 
ATOM   8598  C  CZ   . TYR F  1 50 ? 68.597 54.444 38.661  1.00 50.57  ?  50   TYR F CZ   1 
ATOM   8599  O  OH   . TYR F  1 50 ? 68.592 54.305 40.030  1.00 51.70  ?  50   TYR F OH   1 
ATOM   8600  H  H    . TYR F  1 50 ? 69.060 54.687 31.934  1.00 44.47  ?  50   TYR F H    1 
ATOM   8601  H  HA   . TYR F  1 50 ? 69.998 53.381 34.104  1.00 46.77  ?  50   TYR F HA   1 
ATOM   8602  H  HB2  . TYR F  1 50 ? 69.140 55.675 34.175  1.00 50.22  ?  50   TYR F HB2  1 
ATOM   8603  H  HB3  . TYR F  1 50 ? 67.699 55.017 34.099  1.00 50.22  ?  50   TYR F HB3  1 
ATOM   8604  H  HD1  . TYR F  1 50 ? 68.808 52.720 35.948  1.00 55.23  ?  50   TYR F HD1  1 
ATOM   8605  H  HD2  . TYR F  1 50 ? 68.410 56.679 36.348  1.00 57.09  ?  50   TYR F HD2  1 
ATOM   8606  H  HE1  . TYR F  1 50 ? 68.798 52.486 38.243  1.00 58.24  ?  50   TYR F HE1  1 
ATOM   8607  H  HE2  . TYR F  1 50 ? 68.399 56.447 38.641  1.00 60.30  ?  50   TYR F HE2  1 
ATOM   8608  H  HH   . TYR F  1 50 ? 67.888 54.591 40.339  1.00 62.04  ?  50   TYR F HH   1 
ATOM   8609  N  N    . GLY F  1 51 ? 68.696 51.339 33.457  1.00 34.36  ?  51   GLY F N    1 
ATOM   8610  C  CA   . GLY F  1 51 ? 67.853 50.164 33.381  1.00 33.07  ?  51   GLY F CA   1 
ATOM   8611  C  C    . GLY F  1 51 ? 68.700 48.922 33.213  1.00 34.41  ?  51   GLY F C    1 
ATOM   8612  O  O    . GLY F  1 51 ? 69.908 48.949 33.455  1.00 36.81  ?  51   GLY F O    1 
ATOM   8613  H  H    . GLY F  1 51 ? 69.538 51.167 33.417  1.00 41.23  ?  51   GLY F H    1 
ATOM   8614  H  HA2  . GLY F  1 51 ? 67.329 50.080 34.194  1.00 39.68  ?  51   GLY F HA2  1 
ATOM   8615  H  HA3  . GLY F  1 51 ? 67.250 50.238 32.625  1.00 39.68  ?  51   GLY F HA3  1 
ATOM   8616  N  N    . ASN F  1 52 ? 68.073 47.831 32.792  1.00 34.58  ?  52   ASN F N    1 
ATOM   8617  C  CA   . ASN F  1 52 ? 68.788 46.577 32.630  1.00 32.91  ?  52   ASN F CA   1 
ATOM   8618  C  C    . ASN F  1 52 ? 68.090 45.618 31.688  1.00 32.36  ?  52   ASN F C    1 
ATOM   8619  O  O    . ASN F  1 52 ? 66.907 45.767 31.385  1.00 31.61  ?  52   ASN F O    1 
ATOM   8620  C  CB   . ASN F  1 52 ? 68.943 45.883 33.985  1.00 33.35  ?  52   ASN F CB   1 
ATOM   8621  C  CG   . ASN F  1 52 ? 67.616 45.390 34.541  1.00 32.51  ?  52   ASN F CG   1 
ATOM   8622  O  OD1  . ASN F  1 52 ? 67.055 44.402 34.060  1.00 31.21  ?  52   ASN F OD1  1 
ATOM   8623  N  ND2  . ASN F  1 52 ? 67.110 46.074 35.561  1.00 34.62  ?  52   ASN F ND2  1 
ATOM   8624  H  H    . ASN F  1 52 ? 67.237 47.792 32.594  1.00 41.49  ?  52   ASN F H    1 
ATOM   8625  H  HA   . ASN F  1 52 ? 69.683 46.760 32.274  1.00 39.49  ?  52   ASN F HA   1 
ATOM   8626  H  HB2  . ASN F  1 52 ? 69.529 45.117 33.883  1.00 40.02  ?  52   ASN F HB2  1 
ATOM   8627  H  HB3  . ASN F  1 52 ? 69.321 46.510 34.621  1.00 40.02  ?  52   ASN F HB3  1 
ATOM   8628  H  HD21 . ASN F  1 52 ? 67.531 46.757 35.872  1.00 41.54  ?  52   ASN F HD21 1 
ATOM   8629  H  HD22 . ASN F  1 52 ? 66.361 45.834 35.910  1.00 41.54  ?  52   ASN F HD22 1 
ATOM   8630  N  N    . ILE F  1 53 ? 68.854 44.638 31.221  1.00 33.24  ?  53   ILE F N    1 
ATOM   8631  C  CA   A ILE F  1 53 ? 68.281 43.504 30.521  0.48 31.14  ?  53   ILE F CA   1 
ATOM   8632  C  CA   B ILE F  1 53 ? 68.315 43.488 30.504  0.52 31.21  ?  53   ILE F CA   1 
ATOM   8633  C  C    . ILE F  1 53 ? 68.585 42.259 31.346  1.00 33.19  ?  53   ILE F C    1 
ATOM   8634  O  O    . ILE F  1 53 ? 69.734 41.993 31.699  1.00 33.76  ?  53   ILE F O    1 
ATOM   8635  C  CB   A ILE F  1 53 ? 68.822 43.380 29.081  0.48 39.43  ?  53   ILE F CB   1 
ATOM   8636  C  CB   B ILE F  1 53 ? 68.998 43.279 29.143  0.52 36.27  ?  53   ILE F CB   1 
ATOM   8637  C  CG1  A ILE F  1 53 ? 68.079 42.279 28.323  0.48 35.04  ?  53   ILE F CG1  1 
ATOM   8638  C  CG1  B ILE F  1 53 ? 68.780 44.490 28.240  0.52 34.11  ?  53   ILE F CG1  1 
ATOM   8639  C  CG2  A ILE F  1 53 ? 70.316 43.126 29.082  0.48 34.84  ?  53   ILE F CG2  1 
ATOM   8640  C  CG2  B ILE F  1 53 ? 68.473 42.017 28.475  0.52 34.34  ?  53   ILE F CG2  1 
ATOM   8641  C  CD1  A ILE F  1 53 ? 66.660 42.656 27.942  0.48 35.73  ?  53   ILE F CD1  1 
ATOM   8642  C  CD1  B ILE F  1 53 ? 67.332 44.868 28.073  0.52 36.18  ?  53   ILE F CD1  1 
ATOM   8643  H  H    A ILE F  1 53 ? 69.710 44.610 31.297  0.48 39.89  ?  53   ILE F H    1 
ATOM   8644  H  H    B ILE F  1 53 ? 69.709 44.617 31.308  0.52 39.89  ?  53   ILE F H    1 
ATOM   8645  H  HA   A ILE F  1 53 ? 67.308 43.611 30.474  0.48 37.37  ?  53   ILE F HA   1 
ATOM   8646  H  HA   B ILE F  1 53 ? 67.349 43.588 30.372  0.52 37.45  ?  53   ILE F HA   1 
ATOM   8647  H  HB   A ILE F  1 53 ? 68.661 44.221 28.625  0.48 47.31  ?  53   ILE F HB   1 
ATOM   8648  H  HB   B ILE F  1 53 ? 69.951 43.174 29.291  0.52 43.53  ?  53   ILE F HB   1 
ATOM   8649  H  HG12 A ILE F  1 53 ? 68.563 42.079 27.506  0.48 42.05  ?  53   ILE F HG12 1 
ATOM   8650  H  HG12 B ILE F  1 53 ? 69.243 45.252 28.621  0.52 40.93  ?  53   ILE F HG12 1 
ATOM   8651  H  HG13 A ILE F  1 53 ? 68.036 41.487 28.882  0.48 42.05  ?  53   ILE F HG13 1 
ATOM   8652  H  HG13 B ILE F  1 53 ? 69.138 44.293 27.360  0.52 40.93  ?  53   ILE F HG13 1 
ATOM   8653  H  HG21 A ILE F  1 53 ? 70.493 42.308 29.553  0.48 41.81  ?  53   ILE F HG21 1 
ATOM   8654  H  HG21 B ILE F  1 53 ? 67.526 42.105 28.344  0.52 41.21  ?  53   ILE F HG21 1 
ATOM   8655  H  HG22 A ILE F  1 53 ? 70.620 43.054 28.174  0.48 41.81  ?  53   ILE F HG22 1 
ATOM   8656  H  HG22 B ILE F  1 53 ? 68.912 41.906 27.628  0.52 41.21  ?  53   ILE F HG22 1 
ATOM   8657  H  HG23 A ILE F  1 53 ? 70.757 43.858 29.518  0.48 41.81  ?  53   ILE F HG23 1 
ATOM   8658  H  HG23 B ILE F  1 53 ? 68.657 41.264 29.041  0.52 41.21  ?  53   ILE F HG23 1 
ATOM   8659  H  HD11 A ILE F  1 53 ? 66.685 43.433 27.378  0.48 42.87  ?  53   ILE F HD11 1 
ATOM   8660  H  HD11 B ILE F  1 53 ? 66.963 45.078 28.934  0.52 43.41  ?  53   ILE F HD11 1 
ATOM   8661  H  HD12 A ILE F  1 53 ? 66.257 41.922 27.473  0.48 42.87  ?  53   ILE F HD12 1 
ATOM   8662  H  HD12 B ILE F  1 53 ? 67.274 45.633 27.496  0.52 43.41  ?  53   ILE F HD12 1 
ATOM   8663  H  HD13 A ILE F  1 53 ? 66.163 42.847 28.741  0.48 42.87  ?  53   ILE F HD13 1 
ATOM   8664  H  HD13 B ILE F  1 53 ? 66.859 44.128 27.685  0.52 43.41  ?  53   ILE F HD13 1 
ATOM   8665  N  N    . SER F  1 54 ? 67.539 41.511 31.674  1.00 27.97  ?  54   SER F N    1 
ATOM   8666  C  CA   . SER F  1 54 ? 67.689 40.365 32.557  1.00 28.20  ?  54   SER F CA   1 
ATOM   8667  C  C    . SER F  1 54 ? 67.111 39.099 31.955  1.00 28.92  ?  54   SER F C    1 
ATOM   8668  O  O    . SER F  1 54 ? 66.291 39.143 31.039  1.00 26.87  ?  54   SER F O    1 
ATOM   8669  C  CB   . SER F  1 54 ? 66.993 40.635 33.895  1.00 28.96  ?  54   SER F CB   1 
ATOM   8670  O  OG   . SER F  1 54 ? 67.559 41.751 34.560  1.00 30.27  ?  54   SER F OG   1 
ATOM   8671  H  H    . SER F  1 54 ? 66.735 41.647 31.400  1.00 33.56  ?  54   SER F H    1 
ATOM   8672  H  HA   . SER F  1 54 ? 68.641 40.215 32.731  1.00 33.84  ?  54   SER F HA   1 
ATOM   8673  H  HB2  . SER F  1 54 ? 66.054 40.812 33.729  1.00 34.75  ?  54   SER F HB2  1 
ATOM   8674  H  HB3  . SER F  1 54 ? 67.086 39.853 34.460  1.00 34.75  ?  54   SER F HB3  1 
ATOM   8675  H  HG   . SER F  1 54 ? 68.169 42.065 34.111  1.00 36.32  ?  54   SER F HG   1 
ATOM   8676  N  N    . VAL F  1 55 ? 67.558 37.967 32.483  1.00 32.72  ?  55   VAL F N    1 
ATOM   8677  C  CA   . VAL F  1 55 ? 66.921 36.692 32.208  1.00 33.42  ?  55   VAL F CA   1 
ATOM   8678  C  C    . VAL F  1 55 ? 66.444 36.107 33.528  1.00 33.35  ?  55   VAL F C    1 
ATOM   8679  O  O    . VAL F  1 55 ? 67.228 35.939 34.461  1.00 34.79  ?  55   VAL F O    1 
ATOM   8680  C  CB   . VAL F  1 55 ? 67.882 35.706 31.530  1.00 34.03  ?  55   VAL F CB   1 
ATOM   8681  C  CG1  . VAL F  1 55 ? 67.242 34.328 31.430  1.00 35.18  ?  55   VAL F CG1  1 
ATOM   8682  C  CG2  . VAL F  1 55 ? 68.282 36.220 30.154  1.00 31.86  ?  55   VAL F CG2  1 
ATOM   8683  H  H    . VAL F  1 55 ? 68.236 37.913 33.010  1.00 39.26  ?  55   VAL F H    1 
ATOM   8684  H  HA   . VAL F  1 55 ? 66.146 36.828 31.625  1.00 40.11  ?  55   VAL F HA   1 
ATOM   8685  H  HB   . VAL F  1 55 ? 68.694 35.626 32.073  1.00 40.84  ?  55   VAL F HB   1 
ATOM   8686  H  HG11 . VAL F  1 55 ? 66.437 34.395 30.911  1.00 42.21  ?  55   VAL F HG11 1 
ATOM   8687  H  HG12 . VAL F  1 55 ? 67.858 33.728 31.004  1.00 42.21  ?  55   VAL F HG12 1 
ATOM   8688  H  HG13 . VAL F  1 55 ? 67.037 34.014 32.314  1.00 42.21  ?  55   VAL F HG13 1 
ATOM   8689  H  HG21 . VAL F  1 55 ? 68.717 37.070 30.253  1.00 38.23  ?  55   VAL F HG21 1 
ATOM   8690  H  HG22 . VAL F  1 55 ? 68.882 35.590 29.748  1.00 38.23  ?  55   VAL F HG22 1 
ATOM   8691  H  HG23 . VAL F  1 55 ? 67.494 36.316 29.615  1.00 38.23  ?  55   VAL F HG23 1 
ATOM   8692  N  N    . PHE F  1 56 ? 65.152 35.812 33.609  1.00 29.93  ?  56   PHE F N    1 
ATOM   8693  C  CA   . PHE F  1 56 ? 64.586 35.206 34.803  1.00 29.43  ?  56   PHE F CA   1 
ATOM   8694  C  C    . PHE F  1 56 ? 64.283 33.733 34.564  1.00 29.75  ?  56   PHE F C    1 
ATOM   8695  O  O    . PHE F  1 56 ? 63.840 33.346 33.484  1.00 28.48  ?  56   PHE F O    1 
ATOM   8696  C  CB   . PHE F  1 56 ? 63.314 35.937 35.231  1.00 28.26  ?  56   PHE F CB   1 
ATOM   8697  C  CG   . PHE F  1 56 ? 63.571 37.234 35.941  1.00 28.84  ?  56   PHE F CG   1 
ATOM   8698  C  CD1  . PHE F  1 56 ? 63.725 38.410 35.230  1.00 27.17  ?  56   PHE F CD1  1 
ATOM   8699  C  CD2  . PHE F  1 56 ? 63.657 37.277 37.323  1.00 31.01  ?  56   PHE F CD2  1 
ATOM   8700  C  CE1  . PHE F  1 56 ? 63.959 39.604 35.882  1.00 27.41  ?  56   PHE F CE1  1 
ATOM   8701  C  CE2  . PHE F  1 56 ? 63.890 38.470 37.981  1.00 30.85  ?  56   PHE F CE2  1 
ATOM   8702  C  CZ   . PHE F  1 56 ? 64.043 39.633 37.260  1.00 28.98  ?  56   PHE F CZ   1 
ATOM   8703  H  H    . PHE F  1 56 ? 64.581 35.955 32.982  1.00 35.91  ?  56   PHE F H    1 
ATOM   8704  H  HA   . PHE F  1 56 ? 65.236 35.269 35.535  1.00 35.32  ?  56   PHE F HA   1 
ATOM   8705  H  HB2  . PHE F  1 56 ? 62.785 36.131 34.442  1.00 33.91  ?  56   PHE F HB2  1 
ATOM   8706  H  HB3  . PHE F  1 56 ? 62.812 35.365 35.832  1.00 33.91  ?  56   PHE F HB3  1 
ATOM   8707  H  HD1  . PHE F  1 56 ? 63.669 38.397 34.301  1.00 32.60  ?  56   PHE F HD1  1 
ATOM   8708  H  HD2  . PHE F  1 56 ? 63.555 36.494 37.814  1.00 37.22  ?  56   PHE F HD2  1 
ATOM   8709  H  HE1  . PHE F  1 56 ? 64.061 40.389 35.394  1.00 32.89  ?  56   PHE F HE1  1 
ATOM   8710  H  HE2  . PHE F  1 56 ? 63.947 38.487 38.909  1.00 37.02  ?  56   PHE F HE2  1 
ATOM   8711  H  HZ   . PHE F  1 56 ? 64.201 40.437 37.700  1.00 34.77  ?  56   PHE F HZ   1 
ATOM   8712  N  N    . ASP F  1 57 ? 64.537 32.922 35.584  1.00 30.37  ?  57   ASP F N    1 
ATOM   8713  C  CA   . ASP F  1 57 ? 64.249 31.498 35.539  1.00 31.72  ?  57   ASP F CA   1 
ATOM   8714  C  C    . ASP F  1 57 ? 63.268 31.163 36.657  1.00 31.64  ?  57   ASP F C    1 
ATOM   8715  O  O    . ASP F  1 57 ? 63.665 31.017 37.810  1.00 31.69  ?  57   ASP F O    1 
ATOM   8716  C  CB   . ASP F  1 57 ? 65.541 30.694 35.706  1.00 34.98  ?  57   ASP F CB   1 
ATOM   8717  C  CG   . ASP F  1 57 ? 65.310 29.195 35.659  1.00 40.35  ?  57   ASP F CG   1 
ATOM   8718  O  OD1  . ASP F  1 57 ? 64.174 28.751 35.928  1.00 41.45  ?  57   ASP F OD1  1 
ATOM   8719  O  OD2  . ASP F  1 57 ? 66.270 28.456 35.360  1.00 43.87  ?  57   ASP F OD2  1 
ATOM   8720  H  H    . ASP F  1 57 ? 64.883 33.180 36.328  1.00 36.44  ?  57   ASP F H    1 
ATOM   8721  H  HA   . ASP F  1 57 ? 63.840 31.268 34.679  1.00 38.07  ?  57   ASP F HA   1 
ATOM   8722  H  HB2  . ASP F  1 57 ? 66.152 30.926 34.990  1.00 41.97  ?  57   ASP F HB2  1 
ATOM   8723  H  HB3  . ASP F  1 57 ? 65.938 30.910 36.565  1.00 41.97  ?  57   ASP F HB3  1 
ATOM   8724  N  N    . VAL F  1 58 ? 61.989 31.050 36.310  1.00 31.71  ?  58   VAL F N    1 
ATOM   8725  C  CA   . VAL F  1 58 ? 60.950 30.770 37.295  1.00 33.44  ?  58   VAL F CA   1 
ATOM   8726  C  C    . VAL F  1 58 ? 60.005 29.681 36.798  1.00 34.97  ?  58   VAL F C    1 
ATOM   8727  O  O    . VAL F  1 58 ? 60.069 29.270 35.639  1.00 33.74  ?  58   VAL F O    1 
ATOM   8728  C  CB   . VAL F  1 58 ? 60.139 32.036 37.637  1.00 33.00  ?  58   VAL F CB   1 
ATOM   8729  C  CG1  . VAL F  1 58 ? 61.010 33.043 38.374  1.00 33.75  ?  58   VAL F CG1  1 
ATOM   8730  C  CG2  . VAL F  1 58 ? 59.552 32.652 36.379  1.00 31.66  ?  58   VAL F CG2  1 
ATOM   8731  H  H    . VAL F  1 58 ? 61.696 31.132 35.506  1.00 38.05  ?  58   VAL F H    1 
ATOM   8732  H  HA   . VAL F  1 58 ? 61.372 30.450 38.120  1.00 40.13  ?  58   VAL F HA   1 
ATOM   8733  H  HB   . VAL F  1 58 ? 59.397 31.790 38.228  1.00 39.60  ?  58   VAL F HB   1 
ATOM   8734  H  HG11 . VAL F  1 58 ? 61.751 33.284 37.812  1.00 40.50  ?  58   VAL F HG11 1 
ATOM   8735  H  HG12 . VAL F  1 58 ? 60.485 33.821 38.576  1.00 40.50  ?  58   VAL F HG12 1 
ATOM   8736  H  HG13 . VAL F  1 58 ? 61.330 32.644 39.186  1.00 40.50  ?  58   VAL F HG13 1 
ATOM   8737  H  HG21 . VAL F  1 58 ? 58.974 32.011 35.959  1.00 38.00  ?  58   VAL F HG21 1 
ATOM   8738  H  HG22 . VAL F  1 58 ? 59.053 33.436 36.619  1.00 38.00  ?  58   VAL F HG22 1 
ATOM   8739  H  HG23 . VAL F  1 58 ? 60.268 32.888 35.784  1.00 38.00  ?  58   VAL F HG23 1 
ATOM   8740  N  N    . ASN F  1 59 ? 59.124 29.221 37.681  1.00 39.30  ?  59   ASN F N    1 
ATOM   8741  C  CA   . ASN F  1 59 ? 58.264 28.083 37.382  1.00 43.82  ?  59   ASN F CA   1 
ATOM   8742  C  C    . ASN F  1 59 ? 56.969 28.451 36.661  1.00 40.01  ?  59   ASN F C    1 
ATOM   8743  O  O    . ASN F  1 59 ? 56.411 27.628 35.935  1.00 41.28  ?  59   ASN F O    1 
ATOM   8744  C  CB   . ASN F  1 59 ? 57.935 27.321 38.667  1.00 51.01  ?  59   ASN F CB   1 
ATOM   8745  C  CG   . ASN F  1 59 ? 59.167 26.735 39.330  1.00 57.26  ?  59   ASN F CG   1 
ATOM   8746  O  OD1  . ASN F  1 59 ? 60.218 26.598 38.702  1.00 59.47  ?  59   ASN F OD1  1 
ATOM   8747  N  ND2  . ASN F  1 59 ? 59.043 26.380 40.604  1.00 60.08  ?  59   ASN F ND2  1 
ATOM   8748  H  H    . ASN F  1 59 ? 59.005 29.554 38.465  1.00 47.16  ?  59   ASN F H    1 
ATOM   8749  H  HA   . ASN F  1 59 ? 58.758 27.471 36.797  1.00 52.58  ?  59   ASN F HA   1 
ATOM   8750  H  HB2  . ASN F  1 59 ? 57.515 27.928 39.297  1.00 61.21  ?  59   ASN F HB2  1 
ATOM   8751  H  HB3  . ASN F  1 59 ? 57.331 26.591 38.457  1.00 61.21  ?  59   ASN F HB3  1 
ATOM   8752  H  HD21 . ASN F  1 59 ? 58.292 26.487 41.008  1.00 72.10  ?  59   ASN F HD21 1 
ATOM   8753  H  HD22 . ASN F  1 59 ? 59.714 26.043 41.023  1.00 72.10  ?  59   ASN F HD22 1 
ATOM   8754  N  N    . SER F  1 60 ? 56.487 29.675 36.857  1.00 36.70  ?  60   SER F N    1 
ATOM   8755  C  CA   . SER F  1 60 ? 55.214 30.080 36.263  1.00 33.39  ?  60   SER F CA   1 
ATOM   8756  C  C    . SER F  1 60 ? 55.142 31.572 35.970  1.00 31.73  ?  60   SER F C    1 
ATOM   8757  O  O    . SER F  1 60 ? 55.899 32.366 36.532  1.00 30.94  ?  60   SER F O    1 
ATOM   8758  C  CB   . SER F  1 60 ? 54.060 29.708 37.194  1.00 32.18  ?  60   SER F CB   1 
ATOM   8759  O  OG   . SER F  1 60 ? 54.032 30.558 38.327  1.00 30.99  ?  60   SER F OG   1 
ATOM   8760  H  H    . SER F  1 60 ? 56.873 30.286 37.324  1.00 44.04  ?  60   SER F H    1 
ATOM   8761  H  HA   . SER F  1 60 ? 55.090 29.599 35.419  1.00 40.07  ?  60   SER F HA   1 
ATOM   8762  H  HB2  . SER F  1 60 ? 53.223 29.798 36.710  1.00 38.61  ?  60   SER F HB2  1 
ATOM   8763  H  HB3  . SER F  1 60 ? 54.175 28.791 37.489  1.00 38.61  ?  60   SER F HB3  1 
ATOM   8764  H  HG   . SER F  1 60 ? 53.409 30.350 38.818  1.00 37.19  ?  60   SER F HG   1 
ATOM   8765  N  N    . HIS F  1 61 ? 54.217 31.942 35.087  1.00 33.61  ?  61   HIS F N    1 
ATOM   8766  C  CA   . HIS F  1 61 ? 53.922 33.345 34.826  1.00 31.77  ?  61   HIS F CA   1 
ATOM   8767  C  C    . HIS F  1 61 ? 53.542 34.027 36.133  1.00 33.08  ?  61   HIS F C    1 
ATOM   8768  O  O    . HIS F  1 61 ? 53.948 35.158 36.398  1.00 32.08  ?  61   HIS F O    1 
ATOM   8769  C  CB   . HIS F  1 61 ? 52.756 33.488 33.847  1.00 30.24  ?  61   HIS F CB   1 
ATOM   8770  C  CG   . HIS F  1 61 ? 52.990 32.855 32.512  1.00 29.60  ?  61   HIS F CG   1 
ATOM   8771  N  ND1  . HIS F  1 61 ? 54.249 32.643 31.992  1.00 29.47  ?  61   HIS F ND1  1 
ATOM   8772  C  CD2  . HIS F  1 61 ? 52.117 32.397 31.582  1.00 28.90  ?  61   HIS F CD2  1 
ATOM   8773  C  CE1  . HIS F  1 61 ? 54.141 32.077 30.803  1.00 28.42  ?  61   HIS F CE1  1 
ATOM   8774  N  NE2  . HIS F  1 61 ? 52.858 31.917 30.531  1.00 28.09  ?  61   HIS F NE2  1 
ATOM   8775  H  H    . HIS F  1 61 ? 53.743 31.394 34.624  1.00 40.33  ?  61   HIS F H    1 
ATOM   8776  H  HA   . HIS F  1 61 ? 54.711 33.789 34.451  1.00 38.13  ?  61   HIS F HA   1 
ATOM   8777  H  HB2  . HIS F  1 61 ? 51.970 33.074 34.237  1.00 36.29  ?  61   HIS F HB2  1 
ATOM   8778  H  HB3  . HIS F  1 61 ? 52.588 34.432 33.700  1.00 36.29  ?  61   HIS F HB3  1 
ATOM   8779  H  HD1  . HIS F  1 61 ? 54.988 32.846 32.381  1.00 35.37  ?  61   HIS F HD1  1 
ATOM   8780  H  HD2  . HIS F  1 61 ? 51.189 32.404 31.646  1.00 34.68  ?  61   HIS F HD2  1 
ATOM   8781  H  HE1  . HIS F  1 61 ? 54.848 31.833 30.251  1.00 34.11  ?  61   HIS F HE1  1 
ATOM   8782  H  HE2  . HIS F  1 61 ? 52.539 31.569 29.813  1.00 33.70  ?  61   HIS F HE2  1 
ATOM   8783  N  N    . ASP F  1 62 ? 52.748 33.329 36.939  1.00 33.42  ?  62   ASP F N    1 
ATOM   8784  C  CA   . ASP F  1 62 ? 52.276 33.864 38.210  1.00 35.26  ?  62   ASP F CA   1 
ATOM   8785  C  C    . ASP F  1 62 ? 53.445 34.235 39.112  1.00 36.41  ?  62   ASP F C    1 
ATOM   8786  O  O    . ASP F  1 62 ? 53.425 35.274 39.769  1.00 33.91  ?  62   ASP F O    1 
ATOM   8787  C  CB   . ASP F  1 62 ? 51.377 32.847 38.918  1.00 38.55  ?  62   ASP F CB   1 
ATOM   8788  C  CG   . ASP F  1 62 ? 50.075 32.606 38.179  1.00 41.24  ?  62   ASP F CG   1 
ATOM   8789  O  OD1  . ASP F  1 62 ? 49.688 33.466 37.362  1.00 39.49  ?  62   ASP F OD1  1 
ATOM   8790  O  OD2  . ASP F  1 62 ? 49.433 31.561 38.421  1.00 45.43  ?  62   ASP F OD2  1 
ATOM   8791  H  H    . ASP F  1 62 ? 52.465 32.535 36.770  1.00 40.10  ?  62   ASP F H    1 
ATOM   8792  H  HA   . ASP F  1 62 ? 51.750 34.674 38.043  1.00 42.31  ?  62   ASP F HA   1 
ATOM   8793  H  HB2  . ASP F  1 62 ? 51.846 32.001 38.984  1.00 46.26  ?  62   ASP F HB2  1 
ATOM   8794  H  HB3  . ASP F  1 62 ? 51.162 33.178 39.804  1.00 46.26  ?  62   ASP F HB3  1 
ATOM   8795  N  N    . GLU F  1 63 ? 54.465 33.384 39.141  1.00 36.62  ?  63   GLU F N    1 
ATOM   8796  C  CA   . GLU F  1 63 ? 55.630 33.641 39.976  1.00 40.03  ?  63   GLU F CA   1 
ATOM   8797  C  C    . GLU F  1 63 ? 56.394 34.852 39.456  1.00 36.11  ?  63   GLU F C    1 
ATOM   8798  O  O    . GLU F  1 63 ? 56.826 35.702 40.233  1.00 37.22  ?  63   GLU F O    1 
ATOM   8799  C  CB   . GLU F  1 63 ? 56.550 32.419 40.027  1.00 44.78  ?  63   GLU F CB   1 
ATOM   8800  C  CG   . GLU F  1 63 ? 57.724 32.586 40.984  1.00 50.19  ?  63   GLU F CG   1 
ATOM   8801  C  CD   . GLU F  1 63 ? 58.625 31.365 41.035  1.00 55.38  ?  63   GLU F CD   1 
ATOM   8802  O  OE1  . GLU F  1 63 ? 58.315 30.363 40.356  1.00 57.10  ?  63   GLU F OE1  1 
ATOM   8803  O  OE2  . GLU F  1 63 ? 59.645 31.408 41.757  1.00 57.00  ?  63   GLU F OE2  1 
ATOM   8804  H  H    . GLU F  1 63 ? 54.506 32.654 38.688  1.00 43.94  ?  63   GLU F H    1 
ATOM   8805  H  HA   . GLU F  1 63 ? 55.333 33.837 40.889  1.00 48.04  ?  63   GLU F HA   1 
ATOM   8806  H  HB2  . GLU F  1 63 ? 56.035 31.651 40.319  1.00 53.73  ?  63   GLU F HB2  1 
ATOM   8807  H  HB3  . GLU F  1 63 ? 56.909 32.259 39.140  1.00 53.73  ?  63   GLU F HB3  1 
ATOM   8808  H  HG2  . GLU F  1 63 ? 58.260 33.342 40.696  1.00 60.23  ?  63   GLU F HG2  1 
ATOM   8809  H  HG3  . GLU F  1 63 ? 57.382 32.744 41.878  1.00 60.23  ?  63   GLU F HG3  1 
ATOM   8810  N  N    . LEU F  1 64 ? 56.553 34.932 38.138  1.00 34.38  ?  64   LEU F N    1 
ATOM   8811  C  CA   . LEU F  1 64 ? 57.269 36.047 37.532  1.00 30.39  ?  64   LEU F CA   1 
ATOM   8812  C  C    . LEU F  1 64 ? 56.603 37.377 37.868  1.00 27.49  ?  64   LEU F C    1 
ATOM   8813  O  O    . LEU F  1 64 ? 57.277 38.326 38.261  1.00 27.61  ?  64   LEU F O    1 
ATOM   8814  C  CB   . LEU F  1 64 ? 57.355 35.885 36.014  1.00 29.51  ?  64   LEU F CB   1 
ATOM   8815  C  CG   . LEU F  1 64 ? 58.120 37.010 35.311  1.00 29.29  ?  64   LEU F CG   1 
ATOM   8816  C  CD1  . LEU F  1 64 ? 59.567 37.060 35.787  1.00 28.95  ?  64   LEU F CD1  1 
ATOM   8817  C  CD2  . LEU F  1 64 ? 58.058 36.850 33.799  1.00 30.08  ?  64   LEU F CD2  1 
ATOM   8818  H  H    . LEU F  1 64 ? 56.256 34.354 37.575  1.00 41.26  ?  64   LEU F H    1 
ATOM   8819  H  HA   . LEU F  1 64 ? 58.182 36.068 37.886  1.00 36.47  ?  64   LEU F HA   1 
ATOM   8820  H  HB2  . LEU F  1 64 ? 57.806 35.050 35.814  1.00 35.41  ?  64   LEU F HB2  1 
ATOM   8821  H  HB3  . LEU F  1 64 ? 56.455 35.867 35.651  1.00 35.41  ?  64   LEU F HB3  1 
ATOM   8822  H  HG   . LEU F  1 64 ? 57.705 37.858 35.536  1.00 35.15  ?  64   LEU F HG   1 
ATOM   8823  H  HD11 . LEU F  1 64 ? 59.990 36.222 35.589  1.00 34.75  ?  64   LEU F HD11 1 
ATOM   8824  H  HD12 . LEU F  1 64 ? 60.021 37.773 35.331  1.00 34.75  ?  64   LEU F HD12 1 
ATOM   8825  H  HD13 . LEU F  1 64 ? 59.579 37.218 36.734  1.00 34.75  ?  64   LEU F HD13 1 
ATOM   8826  H  HD21 . LEU F  1 64 ? 57.139 36.875 33.520  1.00 36.09  ?  64   LEU F HD21 1 
ATOM   8827  H  HD22 . LEU F  1 64 ? 58.545 37.568 33.389  1.00 36.09  ?  64   LEU F HD22 1 
ATOM   8828  H  HD23 . LEU F  1 64 ? 58.450 36.008 33.558  1.00 36.09  ?  64   LEU F HD23 1 
ATOM   8829  N  N    . HIS F  1 65 ? 55.283 37.447 37.709  1.00 27.05  ?  65   HIS F N    1 
ATOM   8830  C  CA   . HIS F  1 65 ? 54.555 38.685 37.972  1.00 26.41  ?  65   HIS F CA   1 
ATOM   8831  C  C    . HIS F  1 65 ? 54.731 39.128 39.421  1.00 30.60  ?  65   HIS F C    1 
ATOM   8832  O  O    . HIS F  1 65 ? 54.953 40.306 39.691  1.00 26.90  ?  65   HIS F O    1 
ATOM   8833  C  CB   . HIS F  1 65 ? 53.063 38.535 37.655  1.00 27.16  ?  65   HIS F CB   1 
ATOM   8834  C  CG   . HIS F  1 65 ? 52.229 39.683 38.135  1.00 28.28  ?  65   HIS F CG   1 
ATOM   8835  N  ND1  . HIS F  1 65 ? 52.121 40.871 37.444  1.00 28.29  ?  65   HIS F ND1  1 
ATOM   8836  C  CD2  . HIS F  1 65 ? 51.469 39.828 39.248  1.00 31.73  ?  65   HIS F CD2  1 
ATOM   8837  C  CE1  . HIS F  1 65 ? 51.329 41.695 38.106  1.00 29.79  ?  65   HIS F CE1  1 
ATOM   8838  N  NE2  . HIS F  1 65 ? 50.921 41.087 39.204  1.00 31.88  ?  65   HIS F NE2  1 
ATOM   8839  H  H    . HIS F  1 65 ? 54.787 36.793 37.452  1.00 32.46  ?  65   HIS F H    1 
ATOM   8840  H  HA   . HIS F  1 65 ? 54.915 39.392 37.396  1.00 31.70  ?  65   HIS F HA   1 
ATOM   8841  H  HB2  . HIS F  1 65 ? 52.952 38.468 36.694  1.00 32.59  ?  65   HIS F HB2  1 
ATOM   8842  H  HB3  . HIS F  1 65 ? 52.732 37.729 38.082  1.00 32.59  ?  65   HIS F HB3  1 
ATOM   8843  H  HD1  . HIS F  1 65 ? 52.509 41.048 36.697  1.00 33.94  ?  65   HIS F HD1  1 
ATOM   8844  H  HD2  . HIS F  1 65 ? 51.341 39.194 39.916  1.00 38.08  ?  65   HIS F HD2  1 
ATOM   8845  H  HE1  . HIS F  1 65 ? 51.098 42.557 37.843  1.00 35.75  ?  65   HIS F HE1  1 
ATOM   8846  H  HE2  . HIS F  1 65 ? 50.395 41.424 39.795  1.00 38.25  ?  65   HIS F HE2  1 
ATOM   8847  N  N    . GLU F  1 66 ? 54.627 38.184 40.351  1.00 34.43  ?  66   GLU F N    1 
ATOM   8848  C  CA   . GLU F  1 66 ? 54.787 38.500 41.766  1.00 38.95  ?  66   GLU F CA   1 
ATOM   8849  C  C    . GLU F  1 66 ? 56.170 39.085 42.030  1.00 36.60  ?  66   GLU F C    1 
ATOM   8850  O  O    . GLU F  1 66 ? 56.307 40.081 42.739  1.00 37.61  ?  66   GLU F O    1 
ATOM   8851  C  CB   . GLU F  1 66 ? 54.566 37.256 42.630  1.00 42.73  ?  66   GLU F CB   1 
ATOM   8852  C  CG   . GLU F  1 66 ? 53.120 36.789 42.681  1.00 46.21  ?  66   GLU F CG   1 
ATOM   8853  C  CD   . GLU F  1 66 ? 52.166 37.884 43.126  1.00 49.58  ?  66   GLU F CD   1 
ATOM   8854  O  OE1  . GLU F  1 66 ? 52.546 38.692 44.002  1.00 52.84  ?  66   GLU F OE1  1 
ATOM   8855  O  OE2  . GLU F  1 66 ? 51.037 37.942 42.593  1.00 49.03  ?  66   GLU F OE2  1 
ATOM   8856  H  H    . GLU F  1 66 ? 54.465 37.355 40.190  1.00 41.32  ?  66   GLU F H    1 
ATOM   8857  H  HA   . GLU F  1 66 ? 54.120 39.170 42.022  1.00 46.74  ?  66   GLU F HA   1 
ATOM   8858  H  HB2  . GLU F  1 66 ? 55.100 36.529 42.274  1.00 51.27  ?  66   GLU F HB2  1 
ATOM   8859  H  HB3  . GLU F  1 66 ? 54.845 37.454 43.538  1.00 51.27  ?  66   GLU F HB3  1 
ATOM   8860  H  HG2  . GLU F  1 66 ? 52.851 36.498 41.795  1.00 55.46  ?  66   GLU F HG2  1 
ATOM   8861  H  HG3  . GLU F  1 66 ? 53.047 36.053 43.309  1.00 55.46  ?  66   GLU F HG3  1 
ATOM   8862  N  N    . ILE F  1 67 ? 57.193 38.466 41.451  1.00 34.47  ?  67   ILE F N    1 
ATOM   8863  C  CA   . ILE F  1 67 ? 58.560 38.953 41.601  1.00 34.74  ?  67   ILE F CA   1 
ATOM   8864  C  C    . ILE F  1 67 ? 58.705 40.370 41.047  1.00 33.63  ?  67   ILE F C    1 
ATOM   8865  O  O    . ILE F  1 67 ? 59.135 41.283 41.757  1.00 35.71  ?  67   ILE F O    1 
ATOM   8866  C  CB   . ILE F  1 67 ? 59.566 38.024 40.897  1.00 34.71  ?  67   ILE F CB   1 
ATOM   8867  C  CG1  . ILE F  1 67 ? 59.706 36.717 41.684  1.00 37.90  ?  67   ILE F CG1  1 
ATOM   8868  C  CG2  . ILE F  1 67 ? 60.920 38.711 40.758  1.00 32.74  ?  67   ILE F CG2  1 
ATOM   8869  C  CD1  . ILE F  1 67 ? 60.678 35.728 41.079  1.00 39.04  ?  67   ILE F CD1  1 
ATOM   8870  H  H    . ILE F  1 67 ? 57.123 37.760 40.965  1.00 41.37  ?  67   ILE F H    1 
ATOM   8871  H  HA   . ILE F  1 67 ? 58.786 38.977 42.554  1.00 41.68  ?  67   ILE F HA   1 
ATOM   8872  H  HB   . ILE F  1 67 ? 59.230 37.818 40.010  1.00 41.65  ?  67   ILE F HB   1 
ATOM   8873  H  HG12 . ILE F  1 67 ? 60.016 36.925 42.579  1.00 45.48  ?  67   ILE F HG12 1 
ATOM   8874  H  HG13 . ILE F  1 67 ? 58.838 36.287 41.730  1.00 45.48  ?  67   ILE F HG13 1 
ATOM   8875  H  HG21 . ILE F  1 67 ? 61.250 38.930 41.632  1.00 39.28  ?  67   ILE F HG21 1 
ATOM   8876  H  HG22 . ILE F  1 67 ? 61.529 38.115 40.317  1.00 39.28  ?  67   ILE F HG22 1 
ATOM   8877  H  HG23 . ILE F  1 67 ? 60.812 39.512 40.238  1.00 39.28  ?  67   ILE F HG23 1 
ATOM   8878  H  HD11 . ILE F  1 67 ? 61.548 36.131 41.038  1.00 46.85  ?  67   ILE F HD11 1 
ATOM   8879  H  HD12 . ILE F  1 67 ? 60.706 34.942 41.630  1.00 46.85  ?  67   ILE F HD12 1 
ATOM   8880  H  HD13 . ILE F  1 67 ? 60.380 35.499 40.195  1.00 46.85  ?  67   ILE F HD13 1 
ATOM   8881  N  N    . LEU F  1 68 ? 58.343 40.549 39.780  1.00 32.48  ?  68   LEU F N    1 
ATOM   8882  C  CA   . LEU F  1 68 ? 58.479 41.843 39.123  1.00 30.82  ?  68   LEU F CA   1 
ATOM   8883  C  C    . LEU F  1 68 ? 57.693 42.917 39.867  1.00 30.52  ?  68   LEU F C    1 
ATOM   8884  O  O    . LEU F  1 68 ? 58.175 44.031 40.072  1.00 30.00  ?  68   LEU F O    1 
ATOM   8885  C  CB   . LEU F  1 68 ? 58.009 41.752 37.669  1.00 30.56  ?  68   LEU F CB   1 
ATOM   8886  C  CG   . LEU F  1 68 ? 58.871 40.872 36.758  1.00 30.03  ?  68   LEU F CG   1 
ATOM   8887  C  CD1  . LEU F  1 68 ? 58.288 40.800 35.352  1.00 28.15  ?  68   LEU F CD1  1 
ATOM   8888  C  CD2  . LEU F  1 68 ? 60.304 41.385 36.716  1.00 30.89  ?  68   LEU F CD2  1 
ATOM   8889  H  H    . LEU F  1 68 ? 58.013 39.933 39.278  1.00 38.97  ?  68   LEU F H    1 
ATOM   8890  H  HA   . LEU F  1 68 ? 59.424 42.104 39.121  1.00 36.98  ?  68   LEU F HA   1 
ATOM   8891  H  HB2  . LEU F  1 68 ? 57.109 41.389 37.660  1.00 36.67  ?  68   LEU F HB2  1 
ATOM   8892  H  HB3  . LEU F  1 68 ? 58.002 42.645 37.291  1.00 36.67  ?  68   LEU F HB3  1 
ATOM   8893  H  HG   . LEU F  1 68 ? 58.889 39.972 37.119  1.00 36.03  ?  68   LEU F HG   1 
ATOM   8894  H  HD11 . LEU F  1 68 ? 58.251 41.686 34.984  1.00 33.78  ?  68   LEU F HD11 1 
ATOM   8895  H  HD12 . LEU F  1 68 ? 58.851 40.243 34.809  1.00 33.78  ?  68   LEU F HD12 1 
ATOM   8896  H  HD13 . LEU F  1 68 ? 57.405 40.427 35.399  1.00 33.78  ?  68   LEU F HD13 1 
ATOM   8897  H  HD21 . LEU F  1 68 ? 60.668 41.369 37.604  1.00 37.07  ?  68   LEU F HD21 1 
ATOM   8898  H  HD22 . LEU F  1 68 ? 60.822 40.817 36.140  1.00 37.07  ?  68   LEU F HD22 1 
ATOM   8899  H  HD23 . LEU F  1 68 ? 60.304 42.283 36.377  1.00 37.07  ?  68   LEU F HD23 1 
ATOM   8900  N  N    . TRP F  1 69 ? 56.480 42.566 40.276  1.00 30.00  ?  69   TRP F N    1 
ATOM   8901  C  CA   . TRP F  1 69 ? 55.618 43.474 41.018  1.00 30.31  ?  69   TRP F CA   1 
ATOM   8902  C  C    . TRP F  1 69 ? 56.262 43.912 42.335  1.00 30.97  ?  69   TRP F C    1 
ATOM   8903  O  O    . TRP F  1 69 ? 56.016 45.018 42.814  1.00 31.73  ?  69   TRP F O    1 
ATOM   8904  C  CB   . TRP F  1 69 ? 54.275 42.793 41.290  1.00 31.33  ?  69   TRP F CB   1 
ATOM   8905  C  CG   . TRP F  1 69 ? 53.283 43.651 42.013  1.00 35.19  ?  69   TRP F CG   1 
ATOM   8906  C  CD1  . TRP F  1 69 ? 53.161 43.803 43.364  1.00 38.42  ?  69   TRP F CD1  1 
ATOM   8907  C  CD2  . TRP F  1 69 ? 52.263 44.466 41.423  1.00 37.04  ?  69   TRP F CD2  1 
ATOM   8908  N  NE1  . TRP F  1 69 ? 52.131 44.666 43.651  1.00 40.43  ?  69   TRP F NE1  1 
ATOM   8909  C  CE2  . TRP F  1 69 ? 51.563 45.087 42.477  1.00 39.80  ?  69   TRP F CE2  1 
ATOM   8910  C  CE3  . TRP F  1 69 ? 51.875 44.733 40.106  1.00 38.25  ?  69   TRP F CE3  1 
ATOM   8911  C  CZ2  . TRP F  1 69 ? 50.498 45.959 42.256  1.00 40.58  ?  69   TRP F CZ2  1 
ATOM   8912  C  CZ3  . TRP F  1 69 ? 50.817 45.599 39.888  1.00 39.82  ?  69   TRP F CZ3  1 
ATOM   8913  C  CH2  . TRP F  1 69 ? 50.141 46.201 40.958  1.00 40.84  ?  69   TRP F CH2  1 
ATOM   8914  H  H    . TRP F  1 69 ? 56.129 41.794 40.134  1.00 36.00  ?  69   TRP F H    1 
ATOM   8915  H  HA   . TRP F  1 69 ? 55.452 44.274 40.477  1.00 36.37  ?  69   TRP F HA   1 
ATOM   8916  H  HB2  . TRP F  1 69 ? 53.880 42.536 40.442  1.00 37.60  ?  69   TRP F HB2  1 
ATOM   8917  H  HB3  . TRP F  1 69 ? 54.431 42.003 41.831  1.00 37.60  ?  69   TRP F HB3  1 
ATOM   8918  H  HD1  . TRP F  1 69 ? 53.697 43.385 43.997  1.00 46.11  ?  69   TRP F HD1  1 
ATOM   8919  H  HE1  . TRP F  1 69 ? 51.883 44.904 44.440  1.00 48.52  ?  69   TRP F HE1  1 
ATOM   8920  H  HE3  . TRP F  1 69 ? 52.319 44.336 39.392  1.00 45.90  ?  69   TRP F HE3  1 
ATOM   8921  H  HZ2  . TRP F  1 69 ? 50.048 46.360 42.963  1.00 48.70  ?  69   TRP F HZ2  1 
ATOM   8922  H  HZ3  . TRP F  1 69 ? 50.550 45.783 39.017  1.00 47.79  ?  69   TRP F HZ3  1 
ATOM   8923  H  HH2  . TRP F  1 69 ? 49.434 46.779 40.781  1.00 49.01  ?  69   TRP F HH2  1 
ATOM   8924  N  N    . SER F  1 70 ? 57.089 43.047 42.915  1.00 30.39  ?  70   SER F N    1 
ATOM   8925  C  CA   . SER F  1 70 ? 57.688 43.322 44.220  1.00 31.43  ?  70   SER F CA   1 
ATOM   8926  C  C    . SER F  1 70 ? 58.942 44.194 44.127  1.00 32.59  ?  70   SER F C    1 
ATOM   8927  O  O    . SER F  1 70 ? 59.422 44.707 45.137  1.00 33.65  ?  70   SER F O    1 
ATOM   8928  C  CB   . SER F  1 70 ? 58.021 42.010 44.943  1.00 31.83  ?  70   SER F CB   1 
ATOM   8929  O  OG   . SER F  1 70 ? 59.233 41.435 44.478  1.00 31.02  ?  70   SER F OG   1 
ATOM   8930  H  H    . SER F  1 70 ? 57.320 42.292 42.574  1.00 36.47  ?  70   SER F H    1 
ATOM   8931  H  HA   . SER F  1 70 ? 57.033 43.804 44.767  1.00 37.72  ?  70   SER F HA   1 
ATOM   8932  H  HB2  . SER F  1 70 ? 58.106 42.191 45.892  1.00 38.20  ?  70   SER F HB2  1 
ATOM   8933  H  HB3  . SER F  1 70 ? 57.299 41.380 44.793  1.00 38.20  ?  70   SER F HB3  1 
ATOM   8934  H  HG   . SER F  1 70 ? 59.559 41.905 43.891  1.00 37.23  ?  70   SER F HG   1 
ATOM   8935  N  N    . LEU F  1 71 ? 59.469 44.361 42.919  1.00 31.68  ?  71   LEU F N    1 
ATOM   8936  C  CA   . LEU F  1 71 ? 60.704 45.114 42.725  1.00 32.51  ?  71   LEU F CA   1 
ATOM   8937  C  C    . LEU F  1 71 ? 60.552 46.555 43.212  1.00 31.70  ?  71   LEU F C    1 
ATOM   8938  O  O    . LEU F  1 71 ? 59.611 47.247 42.829  1.00 31.32  ?  71   LEU F O    1 
ATOM   8939  C  CB   . LEU F  1 71 ? 61.108 45.100 41.251  1.00 32.84  ?  71   LEU F CB   1 
ATOM   8940  C  CG   . LEU F  1 71 ? 61.417 43.722 40.659  1.00 34.02  ?  71   LEU F CG   1 
ATOM   8941  C  CD1  . LEU F  1 71 ? 61.830 43.856 39.202  1.00 33.83  ?  71   LEU F CD1  1 
ATOM   8942  C  CD2  . LEU F  1 71 ? 62.498 43.009 41.459  1.00 35.12  ?  71   LEU F CD2  1 
ATOM   8943  H  H    . LEU F  1 71 ? 59.131 44.047 42.193  1.00 38.02  ?  71   LEU F H    1 
ATOM   8944  H  HA   . LEU F  1 71 ? 61.422 44.692 43.242  1.00 39.01  ?  71   LEU F HA   1 
ATOM   8945  H  HB2  . LEU F  1 71 ? 60.383 45.482 40.731  1.00 39.40  ?  71   LEU F HB2  1 
ATOM   8946  H  HB3  . LEU F  1 71 ? 61.903 45.645 41.146  1.00 39.40  ?  71   LEU F HB3  1 
ATOM   8947  H  HG   . LEU F  1 71 ? 60.615 43.178 40.692  1.00 40.83  ?  71   LEU F HG   1 
ATOM   8948  H  HD11 . LEU F  1 71 ? 62.613 44.408 39.149  1.00 40.60  ?  71   LEU F HD11 1 
ATOM   8949  H  HD12 . LEU F  1 71 ? 62.019 42.983 38.850  1.00 40.60  ?  71   LEU F HD12 1 
ATOM   8950  H  HD13 . LEU F  1 71 ? 61.111 44.259 38.710  1.00 40.60  ?  71   LEU F HD13 1 
ATOM   8951  H  HD21 . LEU F  1 71 ? 62.194 42.897 42.363  1.00 42.14  ?  71   LEU F HD21 1 
ATOM   8952  H  HD22 . LEU F  1 71 ? 62.666 42.152 41.061  1.00 42.14  ?  71   LEU F HD22 1 
ATOM   8953  H  HD23 . LEU F  1 71 ? 63.297 43.540 41.445  1.00 42.14  ?  71   LEU F HD23 1 
ATOM   8954  N  N    . PRO F  1 72 ? 61.481 47.012 44.066  1.00 30.58  ?  72   PRO F N    1 
ATOM   8955  C  CA   . PRO F  1 72 ? 61.406 48.373 44.608  1.00 31.65  ?  72   PRO F CA   1 
ATOM   8956  C  C    . PRO F  1 72 ? 61.225 49.455 43.544  1.00 31.43  ?  72   PRO F C    1 
ATOM   8957  O  O    . PRO F  1 72 ? 60.553 50.449 43.814  1.00 32.63  ?  72   PRO F O    1 
ATOM   8958  C  CB   . PRO F  1 72 ? 62.752 48.532 45.315  1.00 31.68  ?  72   PRO F CB   1 
ATOM   8959  C  CG   . PRO F  1 72 ? 63.088 47.155 45.755  1.00 30.51  ?  72   PRO F CG   1 
ATOM   8960  C  CD   . PRO F  1 72 ? 62.596 46.251 44.659  1.00 29.37  ?  72   PRO F CD   1 
ATOM   8961  H  HA   . PRO F  1 72 ? 60.683 48.439 45.266  1.00 37.98  ?  72   PRO F HA   1 
ATOM   8962  H  HB2  . PRO F  1 72 ? 63.415 48.869 44.692  1.00 38.01  ?  72   PRO F HB2  1 
ATOM   8963  H  HB3  . PRO F  1 72 ? 62.658 49.125 46.076  1.00 38.01  ?  72   PRO F HB3  1 
ATOM   8964  H  HG2  . PRO F  1 72 ? 64.049 47.072 45.860  1.00 36.61  ?  72   PRO F HG2  1 
ATOM   8965  H  HG3  . PRO F  1 72 ? 62.634 46.959 46.589  1.00 36.61  ?  72   PRO F HG3  1 
ATOM   8966  H  HD2  . PRO F  1 72 ? 63.293 46.105 44.001  1.00 35.24  ?  72   PRO F HD2  1 
ATOM   8967  H  HD3  . PRO F  1 72 ? 62.274 45.414 45.030  1.00 35.24  ?  72   PRO F HD3  1 
ATOM   8968  N  N    . PHE F  1 73 ? 61.806 49.266 42.362  1.00 30.11  ?  73   PHE F N    1 
ATOM   8969  C  CA   . PHE F  1 73 ? 61.717 50.268 41.300  1.00 30.59  ?  73   PHE F CA   1 
ATOM   8970  C  C    . PHE F  1 73 ? 60.430 50.171 40.481  1.00 29.07  ?  73   PHE F C    1 
ATOM   8971  O  O    . PHE F  1 73 ? 60.201 50.990 39.590  1.00 27.57  ?  73   PHE F O    1 
ATOM   8972  C  CB   . PHE F  1 73 ? 62.914 50.153 40.349  1.00 30.66  ?  73   PHE F CB   1 
ATOM   8973  C  CG   . PHE F  1 73 ? 64.113 50.951 40.775  1.00 33.24  ?  73   PHE F CG   1 
ATOM   8974  C  CD1  . PHE F  1 73 ? 64.155 52.320 40.579  1.00 35.66  ?  73   PHE F CD1  1 
ATOM   8975  C  CD2  . PHE F  1 73 ? 65.204 50.332 41.356  1.00 33.26  ?  73   PHE F CD2  1 
ATOM   8976  C  CE1  . PHE F  1 73 ? 65.260 53.057 40.966  1.00 37.76  ?  73   PHE F CE1  1 
ATOM   8977  C  CE2  . PHE F  1 73 ? 66.311 51.063 41.745  1.00 35.62  ?  73   PHE F CE2  1 
ATOM   8978  C  CZ   . PHE F  1 73 ? 66.338 52.427 41.550  1.00 37.56  ?  73   PHE F CZ   1 
ATOM   8979  H  H    . PHE F  1 73 ? 62.257 48.566 42.148  1.00 36.13  ?  73   PHE F H    1 
ATOM   8980  H  HA   . PHE F  1 73 ? 61.744 51.159 41.708  1.00 36.70  ?  73   PHE F HA   1 
ATOM   8981  H  HB2  . PHE F  1 73 ? 63.182 49.222 40.296  1.00 36.79  ?  73   PHE F HB2  1 
ATOM   8982  H  HB3  . PHE F  1 73 ? 62.646 50.468 39.471  1.00 36.79  ?  73   PHE F HB3  1 
ATOM   8983  H  HD1  . PHE F  1 73 ? 63.430 52.750 40.187  1.00 42.79  ?  73   PHE F HD1  1 
ATOM   8984  H  HD2  . PHE F  1 73 ? 65.191 49.412 41.492  1.00 39.92  ?  73   PHE F HD2  1 
ATOM   8985  H  HE1  . PHE F  1 73 ? 65.276 53.977 40.833  1.00 45.31  ?  73   PHE F HE1  1 
ATOM   8986  H  HE2  . PHE F  1 73 ? 67.037 50.634 42.138  1.00 42.74  ?  73   PHE F HE2  1 
ATOM   8987  H  HZ   . PHE F  1 73 ? 67.083 52.920 41.810  1.00 45.07  ?  73   PHE F HZ   1 
ATOM   8988  N  N    . PHE F  1 74 ? 59.589 49.184 40.782  1.00 32.38  ?  74   PHE F N    1 
ATOM   8989  C  CA   . PHE F  1 74 ? 58.435 48.888 39.933  1.00 32.15  ?  74   PHE F CA   1 
ATOM   8990  C  C    . PHE F  1 74 ? 57.611 50.119 39.547  1.00 35.40  ?  74   PHE F C    1 
ATOM   8991  O  O    . PHE F  1 74 ? 57.195 50.245 38.397  1.00 34.07  ?  74   PHE F O    1 
ATOM   8992  C  CB   . PHE F  1 74 ? 57.521 47.844 40.580  1.00 31.79  ?  74   PHE F CB   1 
ATOM   8993  C  CG   . PHE F  1 74 ? 56.429 47.361 39.669  1.00 30.79  ?  74   PHE F CG   1 
ATOM   8994  C  CD1  . PHE F  1 74 ? 56.690 46.400 38.707  1.00 29.54  ?  74   PHE F CD1  1 
ATOM   8995  C  CD2  . PHE F  1 74 ? 55.149 47.883 39.757  1.00 32.02  ?  74   PHE F CD2  1 
ATOM   8996  C  CE1  . PHE F  1 74 ? 55.693 45.959 37.858  1.00 29.77  ?  74   PHE F CE1  1 
ATOM   8997  C  CE2  . PHE F  1 74 ? 54.146 47.446 38.910  1.00 31.90  ?  74   PHE F CE2  1 
ATOM   8998  C  CZ   . PHE F  1 74 ? 54.419 46.483 37.959  1.00 31.09  ?  74   PHE F CZ   1 
ATOM   8999  H  H    . PHE F  1 74 ? 59.663 48.673 41.469  1.00 38.86  ?  74   PHE F H    1 
ATOM   9000  H  HA   . PHE F  1 74 ? 58.769 48.497 39.099  1.00 38.58  ?  74   PHE F HA   1 
ATOM   9001  H  HB2  . PHE F  1 74 ? 58.055 47.076 40.838  1.00 38.15  ?  74   PHE F HB2  1 
ATOM   9002  H  HB3  . PHE F  1 74 ? 57.104 48.235 41.364  1.00 38.15  ?  74   PHE F HB3  1 
ATOM   9003  H  HD1  . PHE F  1 74 ? 57.546 46.044 38.634  1.00 35.45  ?  74   PHE F HD1  1 
ATOM   9004  H  HD2  . PHE F  1 74 ? 54.961 48.533 40.396  1.00 38.42  ?  74   PHE F HD2  1 
ATOM   9005  H  HE1  . PHE F  1 74 ? 55.880 45.310 37.219  1.00 35.72  ?  74   PHE F HE1  1 
ATOM   9006  H  HE2  . PHE F  1 74 ? 53.290 47.801 38.981  1.00 38.28  ?  74   PHE F HE2  1 
ATOM   9007  H  HZ   . PHE F  1 74 ? 53.747 46.187 37.389  1.00 37.31  ?  74   PHE F HZ   1 
ATOM   9008  N  N    . PRO F  1 75 ? 57.367 51.028 40.503  1.00 40.22  ?  75   PRO F N    1 
ATOM   9009  C  CA   . PRO F  1 75 ? 56.537 52.203 40.209  1.00 42.53  ?  75   PRO F CA   1 
ATOM   9010  C  C    . PRO F  1 75 ? 57.095 53.072 39.087  1.00 40.04  ?  75   PRO F C    1 
ATOM   9011  O  O    . PRO F  1 75 ? 56.341 53.798 38.442  1.00 42.26  ?  75   PRO F O    1 
ATOM   9012  C  CB   . PRO F  1 75 ? 56.558 52.988 41.524  1.00 46.52  ?  75   PRO F CB   1 
ATOM   9013  C  CG   . PRO F  1 75 ? 56.887 51.990 42.563  1.00 47.74  ?  75   PRO F CG   1 
ATOM   9014  C  CD   . PRO F  1 75 ? 57.797 50.999 41.911  1.00 45.15  ?  75   PRO F CD   1 
ATOM   9015  H  HA   . PRO F  1 75 ? 55.618 51.936 39.997  1.00 51.03  ?  75   PRO F HA   1 
ATOM   9016  H  HB2  . PRO F  1 75 ? 57.240 53.677 41.483  1.00 55.82  ?  75   PRO F HB2  1 
ATOM   9017  H  HB3  . PRO F  1 75 ? 55.685 53.377 41.687  1.00 55.82  ?  75   PRO F HB3  1 
ATOM   9018  H  HG2  . PRO F  1 75 ? 57.335 52.428 43.303  1.00 57.29  ?  75   PRO F HG2  1 
ATOM   9019  H  HG3  . PRO F  1 75 ? 56.073 51.557 42.866  1.00 57.29  ?  75   PRO F HG3  1 
ATOM   9020  H  HD2  . PRO F  1 75 ? 58.721 51.285 41.990  1.00 54.18  ?  75   PRO F HD2  1 
ATOM   9021  H  HD3  . PRO F  1 75 ? 57.663 50.116 42.288  1.00 54.18  ?  75   PRO F HD3  1 
ATOM   9022  N  N    . TYR F  1 76 ? 58.403 52.998 38.867  1.00 36.30  ?  76   TYR F N    1 
ATOM   9023  C  CA   . TYR F  1 76 ? 59.068 53.875 37.914  1.00 33.00  ?  76   TYR F CA   1 
ATOM   9024  C  C    . TYR F  1 76 ? 59.604 53.095 36.719  1.00 30.68  ?  76   TYR F C    1 
ATOM   9025  O  O    . TYR F  1 76 ? 60.399 53.614 35.937  1.00 30.85  ?  76   TYR F O    1 
ATOM   9026  C  CB   . TYR F  1 76 ? 60.216 54.608 38.609  1.00 35.00  ?  76   TYR F CB   1 
ATOM   9027  C  CG   . TYR F  1 76 ? 59.854 55.124 39.984  1.00 39.10  ?  76   TYR F CG   1 
ATOM   9028  C  CD1  . TYR F  1 76 ? 58.880 56.098 40.145  1.00 41.92  ?  76   TYR F CD1  1 
ATOM   9029  C  CD2  . TYR F  1 76 ? 60.490 54.640 41.120  1.00 42.37  ?  76   TYR F CD2  1 
ATOM   9030  C  CE1  . TYR F  1 76 ? 58.543 56.574 41.398  1.00 46.72  ?  76   TYR F CE1  1 
ATOM   9031  C  CE2  . TYR F  1 76 ? 60.161 55.110 42.379  1.00 46.95  ?  76   TYR F CE2  1 
ATOM   9032  C  CZ   . TYR F  1 76 ? 59.187 56.077 42.512  1.00 49.65  ?  76   TYR F CZ   1 
ATOM   9033  O  OH   . TYR F  1 76 ? 58.856 56.549 43.763  1.00 53.12  ?  76   TYR F OH   1 
ATOM   9034  H  H    . TYR F  1 76 ? 58.930 52.444 39.259  1.00 43.55  ?  76   TYR F H    1 
ATOM   9035  H  HA   . TYR F  1 76 ? 58.430 54.542 37.586  1.00 39.60  ?  76   TYR F HA   1 
ATOM   9036  H  HB2  . TYR F  1 76 ? 60.964 53.999 38.707  1.00 42.00  ?  76   TYR F HB2  1 
ATOM   9037  H  HB3  . TYR F  1 76 ? 60.478 55.367 38.065  1.00 42.00  ?  76   TYR F HB3  1 
ATOM   9038  H  HD1  . TYR F  1 76 ? 58.443 56.435 39.396  1.00 50.30  ?  76   TYR F HD1  1 
ATOM   9039  H  HD2  . TYR F  1 76 ? 61.147 53.987 41.033  1.00 50.84  ?  76   TYR F HD2  1 
ATOM   9040  H  HE1  . TYR F  1 76 ? 57.887 57.226 41.490  1.00 56.07  ?  76   TYR F HE1  1 
ATOM   9041  H  HE2  . TYR F  1 76 ? 60.594 54.776 43.131  1.00 56.34  ?  76   TYR F HE2  1 
ATOM   9042  H  HH   . TYR F  1 76 ? 59.514 56.885 44.119  1.00 63.74  ?  76   TYR F HH   1 
ATOM   9043  N  N    . LEU F  1 77 ? 59.160 51.851 36.576  1.00 30.92  ?  77   LEU F N    1 
ATOM   9044  C  CA   . LEU F  1 77 ? 59.701 50.966 35.554  1.00 29.10  ?  77   LEU F CA   1 
ATOM   9045  C  C    . LEU F  1 77 ? 58.789 50.788 34.347  1.00 27.97  ?  77   LEU F C    1 
ATOM   9046  O  O    . LEU F  1 77 ? 57.571 50.656 34.476  1.00 26.31  ?  77   LEU F O    1 
ATOM   9047  C  CB   . LEU F  1 77 ? 59.990 49.585 36.147  1.00 29.58  ?  77   LEU F CB   1 
ATOM   9048  C  CG   . LEU F  1 77 ? 61.319 49.401 36.879  1.00 30.18  ?  77   LEU F CG   1 
ATOM   9049  C  CD1  . LEU F  1 77 ? 61.409 47.994 37.455  1.00 30.30  ?  77   LEU F CD1  1 
ATOM   9050  C  CD2  . LEU F  1 77 ? 62.491 49.674 35.949  1.00 30.90  ?  77   LEU F CD2  1 
ATOM   9051  H  H    . LEU F  1 77 ? 58.544 51.496 37.060  1.00 37.10  ?  77   LEU F H    1 
ATOM   9052  H  HA   . LEU F  1 77 ? 60.549 51.337 35.234  1.00 34.92  ?  77   LEU F HA   1 
ATOM   9053  H  HB2  . LEU F  1 77 ? 59.285 49.376 36.780  1.00 35.49  ?  77   LEU F HB2  1 
ATOM   9054  H  HB3  . LEU F  1 77 ? 59.971 48.938 35.424  1.00 35.49  ?  77   LEU F HB3  1 
ATOM   9055  H  HG   . LEU F  1 77 ? 61.366 50.031 37.615  1.00 36.22  ?  77   LEU F HG   1 
ATOM   9056  H  HD11 . LEU F  1 77 ? 61.350 47.358 36.738  1.00 36.36  ?  77   LEU F HD11 1 
ATOM   9057  H  HD12 . LEU F  1 77 ? 62.249 47.896 37.911  1.00 36.36  ?  77   LEU F HD12 1 
ATOM   9058  H  HD13 . LEU F  1 77 ? 60.685 47.862 38.071  1.00 36.36  ?  77   LEU F HD13 1 
ATOM   9059  H  HD21 . LEU F  1 77 ? 62.432 50.577 35.629  1.00 37.08  ?  77   LEU F HD21 1 
ATOM   9060  H  HD22 . LEU F  1 77 ? 63.310 49.551 36.434  1.00 37.08  ?  77   LEU F HD22 1 
ATOM   9061  H  HD23 . LEU F  1 77 ? 62.453 49.062 35.211  1.00 37.08  ?  77   LEU F HD23 1 
ATOM   9062  N  N    . THR F  1 78 ? 59.406 50.791 33.171  1.00 28.55  ?  78   THR F N    1 
ATOM   9063  C  CA   . THR F  1 78 ? 58.785 50.261 31.970  1.00 27.44  ?  78   THR F CA   1 
ATOM   9064  C  C    . THR F  1 78 ? 59.349 48.860 31.785  1.00 28.30  ?  78   THR F C    1 
ATOM   9065  O  O    . THR F  1 78 ? 60.567 48.679 31.755  1.00 27.39  ?  78   THR F O    1 
ATOM   9066  C  CB   . THR F  1 78 ? 59.115 51.114 30.739  1.00 26.47  ?  78   THR F CB   1 
ATOM   9067  O  OG1  . THR F  1 78 ? 58.602 52.438 30.924  1.00 28.03  ?  78   THR F OG1  1 
ATOM   9068  C  CG2  . THR F  1 78 ? 58.508 50.505 29.481  1.00 24.03  ?  78   THR F CG2  1 
ATOM   9069  H  H    . THR F  1 78 ? 60.198 51.100 33.044  1.00 34.26  ?  78   THR F H    1 
ATOM   9070  H  HA   . THR F  1 78 ? 57.812 50.209 32.081  1.00 32.92  ?  78   THR F HA   1 
ATOM   9071  H  HB   . THR F  1 78 ? 60.077 51.155 30.624  1.00 31.77  ?  78   THR F HB   1 
ATOM   9072  H  HG1  . THR F  1 78 ? 58.775 52.900 30.269  1.00 33.64  ?  78   THR F HG1  1 
ATOM   9073  H  HG21 . THR F  1 78 ? 57.553 50.453 29.570  1.00 28.84  ?  78   THR F HG21 1 
ATOM   9074  H  HG22 . THR F  1 78 ? 58.721 51.047 28.718  1.00 28.84  ?  78   THR F HG22 1 
ATOM   9075  H  HG23 . THR F  1 78 ? 58.857 49.621 29.343  1.00 28.84  ?  78   THR F HG23 1 
ATOM   9076  N  N    . ILE F  1 79 ? 58.470 47.868 31.672  1.00 31.21  ?  79   ILE F N    1 
ATOM   9077  C  CA   . ILE F  1 79 ? 58.905 46.477 31.627  1.00 32.96  ?  79   ILE F CA   1 
ATOM   9078  C  C    . ILE F  1 79 ? 58.420 45.748 30.375  1.00 32.71  ?  79   ILE F C    1 
ATOM   9079  O  O    . ILE F  1 79 ? 57.236 45.792 30.032  1.00 29.88  ?  79   ILE F O    1 
ATOM   9080  C  CB   . ILE F  1 79 ? 58.419 45.702 32.865  1.00 34.06  ?  79   ILE F CB   1 
ATOM   9081  C  CG1  . ILE F  1 79 ? 58.843 46.433 34.142  1.00 34.30  ?  79   ILE F CG1  1 
ATOM   9082  C  CG2  . ILE F  1 79 ? 58.965 44.280 32.845  1.00 35.51  ?  79   ILE F CG2  1 
ATOM   9083  C  CD1  . ILE F  1 79 ? 58.488 45.707 35.422  1.00 34.77  ?  79   ILE F CD1  1 
ATOM   9084  H  H    . ILE F  1 79 ? 57.619 47.974 31.620  1.00 37.45  ?  79   ILE F H    1 
ATOM   9085  H  HA   . ILE F  1 79 ? 59.885 46.453 31.625  1.00 39.55  ?  79   ILE F HA   1 
ATOM   9086  H  HB   . ILE F  1 79 ? 57.450 45.660 32.842  1.00 40.87  ?  79   ILE F HB   1 
ATOM   9087  H  HG12 . ILE F  1 79 ? 59.806 46.551 34.128  1.00 41.16  ?  79   ILE F HG12 1 
ATOM   9088  H  HG13 . ILE F  1 79 ? 58.407 47.299 34.164  1.00 41.16  ?  79   ILE F HG13 1 
ATOM   9089  H  HG21 . ILE F  1 79 ? 59.924 44.314 32.848  1.00 42.61  ?  79   ILE F HG21 1 
ATOM   9090  H  HG22 . ILE F  1 79 ? 58.651 43.814 33.624  1.00 42.61  ?  79   ILE F HG22 1 
ATOM   9091  H  HG23 . ILE F  1 79 ? 58.655 43.837 32.052  1.00 42.61  ?  79   ILE F HG23 1 
ATOM   9092  H  HD11 . ILE F  1 79 ? 58.922 44.851 35.426  1.00 41.72  ?  79   ILE F HD11 1 
ATOM   9093  H  HD12 . ILE F  1 79 ? 58.786 46.229 36.170  1.00 41.72  ?  79   ILE F HD12 1 
ATOM   9094  H  HD13 . ILE F  1 79 ? 57.536 45.592 35.462  1.00 41.72  ?  79   ILE F HD13 1 
ATOM   9095  N  N    . ASP F  1 80 ? 59.349 45.080 29.700  1.00 36.55  ?  80   ASP F N    1 
ATOM   9096  C  CA   . ASP F  1 80 ? 59.016 44.224 28.570  1.00 39.15  ?  80   ASP F CA   1 
ATOM   9097  C  C    . ASP F  1 80 ? 59.349 42.780 28.923  1.00 35.85  ?  80   ASP F C    1 
ATOM   9098  O  O    . ASP F  1 80 ? 60.451 42.485 29.386  1.00 36.37  ?  80   ASP F O    1 
ATOM   9099  C  CB   . ASP F  1 80 ? 59.786 44.648 27.318  1.00 45.13  ?  80   ASP F CB   1 
ATOM   9100  C  CG   . ASP F  1 80 ? 59.476 46.072 26.896  1.00 52.60  ?  80   ASP F CG   1 
ATOM   9101  O  OD1  . ASP F  1 80 ? 58.309 46.497 27.040  1.00 56.65  ?  80   ASP F OD1  1 
ATOM   9102  O  OD2  . ASP F  1 80 ? 60.400 46.769 26.422  1.00 54.93  ?  80   ASP F OD2  1 
ATOM   9103  H  H    . ASP F  1 80 ? 60.190 45.108 29.879  1.00 43.86  ?  80   ASP F H    1 
ATOM   9104  H  HA   . ASP F  1 80 ? 58.056 44.286 28.382  1.00 46.99  ?  80   ASP F HA   1 
ATOM   9105  H  HB2  . ASP F  1 80 ? 60.738 44.589 27.497  1.00 54.15  ?  80   ASP F HB2  1 
ATOM   9106  H  HB3  . ASP F  1 80 ? 59.548 44.059 26.586  1.00 54.15  ?  80   ASP F HB3  1 
ATOM   9107  N  N    . VAL F  1 81 ? 58.389 41.888 28.706  1.00 34.76  ?  81   VAL F N    1 
ATOM   9108  C  CA   . VAL F  1 81 ? 58.553 40.479 29.033  1.00 34.29  ?  81   VAL F CA   1 
ATOM   9109  C  C    . VAL F  1 81 ? 58.331 39.623 27.794  1.00 34.13  ?  81   VAL F C    1 
ATOM   9110  O  O    . VAL F  1 81 ? 57.388 39.851 27.038  1.00 35.70  ?  81   VAL F O    1 
ATOM   9111  C  CB   . VAL F  1 81 ? 57.540 40.038 30.109  1.00 36.20  ?  81   VAL F CB   1 
ATOM   9112  C  CG1  . VAL F  1 81 ? 57.711 38.560 30.436  1.00 35.53  ?  81   VAL F CG1  1 
ATOM   9113  C  CG2  . VAL F  1 81 ? 57.689 40.887 31.362  1.00 38.69  ?  81   VAL F CG2  1 
ATOM   9114  H  H    . VAL F  1 81 ? 57.623 42.078 28.364  1.00 41.71  ?  81   VAL F H    1 
ATOM   9115  H  HA   . VAL F  1 81 ? 59.460 40.319 29.369  1.00 41.15  ?  81   VAL F HA   1 
ATOM   9116  H  HB   . VAL F  1 81 ? 56.633 40.168 29.763  1.00 43.44  ?  81   VAL F HB   1 
ATOM   9117  H  HG11 . VAL F  1 81 ? 58.601 38.413 30.764  1.00 42.63  ?  81   VAL F HG11 1 
ATOM   9118  H  HG12 . VAL F  1 81 ? 57.070 38.313 31.107  1.00 42.63  ?  81   VAL F HG12 1 
ATOM   9119  H  HG13 . VAL F  1 81 ? 57.566 38.045 29.639  1.00 42.63  ?  81   VAL F HG13 1 
ATOM   9120  H  HG21 . VAL F  1 81 ? 57.530 41.807 31.136  1.00 46.42  ?  81   VAL F HG21 1 
ATOM   9121  H  HG22 . VAL F  1 81 ? 57.049 40.594 32.015  1.00 46.42  ?  81   VAL F HG22 1 
ATOM   9122  H  HG23 . VAL F  1 81 ? 58.579 40.783 31.705  1.00 46.42  ?  81   VAL F HG23 1 
ATOM   9123  N  N    . GLU F  1 82 ? 59.199 38.640 27.582  1.00 33.04  ?  82   GLU F N    1 
ATOM   9124  C  CA   . GLU F  1 82 ? 58.982 37.676 26.509  1.00 33.49  ?  82   GLU F CA   1 
ATOM   9125  C  C    . GLU F  1 82 ? 59.564 36.309 26.856  1.00 33.96  ?  82   GLU F C    1 
ATOM   9126  O  O    . GLU F  1 82 ? 60.655 36.216 27.418  1.00 32.45  ?  82   GLU F O    1 
ATOM   9127  C  CB   . GLU F  1 82 ? 59.563 38.183 25.185  1.00 35.64  ?  82   GLU F CB   1 
ATOM   9128  C  CG   . GLU F  1 82 ? 61.074 38.321 25.158  1.00 38.17  ?  82   GLU F CG   1 
ATOM   9129  C  CD   . GLU F  1 82 ? 61.572 38.910 23.849  1.00 39.52  ?  82   GLU F CD   1 
ATOM   9130  O  OE1  . GLU F  1 82 ? 61.673 38.159 22.854  1.00 39.25  ?  82   GLU F OE1  1 
ATOM   9131  O  OE2  . GLU F  1 82 ? 61.858 40.126 23.814  1.00 40.58  ?  82   GLU F OE2  1 
ATOM   9132  H  H    . GLU F  1 82 ? 59.915 38.509 28.040  1.00 39.65  ?  82   GLU F H    1 
ATOM   9133  H  HA   . GLU F  1 82 ? 58.017 37.562 26.384  1.00 40.18  ?  82   GLU F HA   1 
ATOM   9134  H  HB2  . GLU F  1 82 ? 59.313 37.564 24.482  1.00 42.76  ?  82   GLU F HB2  1 
ATOM   9135  H  HB3  . GLU F  1 82 ? 59.187 39.057 24.998  1.00 42.76  ?  82   GLU F HB3  1 
ATOM   9136  H  HG2  . GLU F  1 82 ? 61.354 38.907 25.878  1.00 45.80  ?  82   GLU F HG2  1 
ATOM   9137  H  HG3  . GLU F  1 82 ? 61.476 37.444 25.266  1.00 45.80  ?  82   GLU F HG3  1 
ATOM   9138  N  N    . PRO F  1 83 ? 58.823 35.240 26.528  1.00 36.39  ?  83   PRO F N    1 
ATOM   9139  C  CA   . PRO F  1 83 ? 59.278 33.866 26.770  1.00 38.21  ?  83   PRO F CA   1 
ATOM   9140  C  C    . PRO F  1 83 ? 60.524 33.512 25.971  1.00 36.38  ?  83   PRO F C    1 
ATOM   9141  O  O    . PRO F  1 83 ? 60.676 33.960 24.834  1.00 35.86  ?  83   PRO F O    1 
ATOM   9142  C  CB   . PRO F  1 83 ? 58.102 33.013 26.281  1.00 39.05  ?  83   PRO F CB   1 
ATOM   9143  C  CG   . PRO F  1 83 ? 56.932 33.920 26.275  1.00 38.33  ?  83   PRO F CG   1 
ATOM   9144  C  CD   . PRO F  1 83 ? 57.463 35.276 25.966  1.00 36.88  ?  83   PRO F CD   1 
ATOM   9145  H  HA   . PRO F  1 83 ? 59.433 33.709 27.725  1.00 45.85  ?  83   PRO F HA   1 
ATOM   9146  H  HB2  . PRO F  1 83 ? 58.286 32.686 25.387  1.00 46.86  ?  83   PRO F HB2  1 
ATOM   9147  H  HB3  . PRO F  1 83 ? 57.959 32.274 26.893  1.00 46.86  ?  83   PRO F HB3  1 
ATOM   9148  H  HG2  . PRO F  1 83 ? 56.305 33.636 25.591  1.00 46.00  ?  83   PRO F HG2  1 
ATOM   9149  H  HG3  . PRO F  1 83 ? 56.510 33.911 27.149  1.00 46.00  ?  83   PRO F HG3  1 
ATOM   9150  H  HD2  . PRO F  1 83 ? 57.496 35.417 25.007  1.00 44.26  ?  83   PRO F HD2  1 
ATOM   9151  H  HD3  . PRO F  1 83 ? 56.932 35.957 26.409  1.00 44.26  ?  83   PRO F HD3  1 
ATOM   9152  N  N    . LEU F  1 84 ? 61.404 32.717 26.571  1.00 33.53  ?  84   LEU F N    1 
ATOM   9153  C  CA   . LEU F  1 84 ? 62.531 32.139 25.854  1.00 32.68  ?  84   LEU F CA   1 
ATOM   9154  C  C    . LEU F  1 84 ? 62.378 30.626 25.847  1.00 34.21  ?  84   LEU F C    1 
ATOM   9155  O  O    . LEU F  1 84 ? 61.866 30.042 26.802  1.00 33.88  ?  84   LEU F O    1 
ATOM   9156  C  CB   . LEU F  1 84 ? 63.857 32.527 26.511  1.00 32.41  ?  84   LEU F CB   1 
ATOM   9157  C  CG   . LEU F  1 84 ? 64.245 34.007 26.466  1.00 31.80  ?  84   LEU F CG   1 
ATOM   9158  C  CD1  . LEU F  1 84 ? 65.592 34.209 27.140  1.00 33.70  ?  84   LEU F CD1  1 
ATOM   9159  C  CD2  . LEU F  1 84 ? 64.277 34.529 25.038  1.00 29.86  ?  84   LEU F CD2  1 
ATOM   9160  H  H    . LEU F  1 84 ? 61.368 32.496 27.401  1.00 40.24  ?  84   LEU F H    1 
ATOM   9161  H  HA   . LEU F  1 84 ? 62.533 32.460 24.928  1.00 39.21  ?  84   LEU F HA   1 
ATOM   9162  H  HB2  . LEU F  1 84 ? 63.818 32.270 27.446  1.00 38.90  ?  84   LEU F HB2  1 
ATOM   9163  H  HB3  . LEU F  1 84 ? 64.567 32.032 26.073  1.00 38.90  ?  84   LEU F HB3  1 
ATOM   9164  H  HG   . LEU F  1 84 ? 63.585 34.520 26.957  1.00 38.16  ?  84   LEU F HG   1 
ATOM   9165  H  HD11 . LEU F  1 84 ? 66.254 33.690 26.678  1.00 40.44  ?  84   LEU F HD11 1 
ATOM   9166  H  HD12 . LEU F  1 84 ? 65.822 35.141 27.105  1.00 40.44  ?  84   LEU F HD12 1 
ATOM   9167  H  HD13 . LEU F  1 84 ? 65.530 33.922 28.054  1.00 40.44  ?  84   LEU F HD13 1 
ATOM   9168  H  HD21 . LEU F  1 84 ? 63.405 34.427 24.649  1.00 35.83  ?  84   LEU F HD21 1 
ATOM   9169  H  HD22 . LEU F  1 84 ? 64.523 35.457 25.051  1.00 35.83  ?  84   LEU F HD22 1 
ATOM   9170  H  HD23 . LEU F  1 84 ? 64.922 34.026 24.536  1.00 35.83  ?  84   LEU F HD23 1 
ATOM   9171  N  N    . SER F  1 85 ? 62.819 29.995 24.764  1.00 37.19  ?  85   SER F N    1 
ATOM   9172  C  CA   . SER F  1 85 ? 62.744 28.547 24.640  1.00 39.44  ?  85   SER F CA   1 
ATOM   9173  C  C    . SER F  1 85 ? 64.129 27.980 24.390  1.00 41.02  ?  85   SER F C    1 
ATOM   9174  O  O    . SER F  1 85 ? 65.025 28.693 23.942  1.00 38.41  ?  85   SER F O    1 
ATOM   9175  C  CB   . SER F  1 85 ? 61.824 28.156 23.486  1.00 40.34  ?  85   SER F CB   1 
ATOM   9176  O  OG   . SER F  1 85 ? 60.482 28.510 23.755  1.00 42.37  ?  85   SER F OG   1 
ATOM   9177  H  H    . SER F  1 85 ? 63.168 30.387 24.083  1.00 44.63  ?  85   SER F H    1 
ATOM   9178  H  HA   . SER F  1 85 ? 62.391 28.161 25.469  1.00 47.33  ?  85   SER F HA   1 
ATOM   9179  H  HB2  . SER F  1 85 ? 62.115 28.615 22.683  1.00 48.41  ?  85   SER F HB2  1 
ATOM   9180  H  HB3  . SER F  1 85 ? 61.875 27.196 23.354  1.00 48.41  ?  85   SER F HB3  1 
ATOM   9181  H  HG   . SER F  1 85 ? 60.003 28.293 23.126  1.00 50.84  ?  85   SER F HG   1 
ATOM   9182  N  N    . HIS F  1 86 ? 64.304 26.696 24.682  1.00 44.47  ?  86   HIS F N    1 
ATOM   9183  C  CA   . HIS F  1 86 ? 65.553 26.026 24.360  1.00 46.90  ?  86   HIS F CA   1 
ATOM   9184  C  C    . HIS F  1 86 ? 65.734 26.014 22.849  1.00 42.90  ?  86   HIS F C    1 
ATOM   9185  O  O    . HIS F  1 86 ? 64.797 25.736 22.102  1.00 42.89  ?  86   HIS F O    1 
ATOM   9186  C  CB   . HIS F  1 86 ? 65.572 24.597 24.900  1.00 51.02  ?  86   HIS F CB   1 
ATOM   9187  C  CG   . HIS F  1 86 ? 66.827 23.851 24.567  1.00 53.33  ?  86   HIS F CG   1 
ATOM   9188  N  ND1  . HIS F  1 86 ? 68.016 24.060 25.233  1.00 54.86  ?  86   HIS F ND1  1 
ATOM   9189  C  CD2  . HIS F  1 86 ? 67.083 22.911 23.627  1.00 54.07  ?  86   HIS F CD2  1 
ATOM   9190  C  CE1  . HIS F  1 86 ? 68.948 23.274 24.724  1.00 55.93  ?  86   HIS F CE1  1 
ATOM   9191  N  NE2  . HIS F  1 86 ? 68.407 22.567 23.747  1.00 55.48  ?  86   HIS F NE2  1 
ATOM   9192  H  H    . HIS F  1 86 ? 63.719 26.195 25.064  1.00 53.37  ?  86   HIS F H    1 
ATOM   9193  H  HA   . HIS F  1 86 ? 66.300 26.519 24.759  1.00 56.28  ?  86   HIS F HA   1 
ATOM   9194  H  HB2  . HIS F  1 86 ? 65.490 24.626 25.866  1.00 61.22  ?  86   HIS F HB2  1 
ATOM   9195  H  HB3  . HIS F  1 86 ? 64.826 24.108 24.520  1.00 61.22  ?  86   HIS F HB3  1 
ATOM   9196  H  HD1  . HIS F  1 86 ? 68.132 24.613 25.881  1.00 65.83  ?  86   HIS F HD1  1 
ATOM   9197  H  HD2  . HIS F  1 86 ? 66.475 22.560 23.017  1.00 64.88  ?  86   HIS F HD2  1 
ATOM   9198  H  HE1  . HIS F  1 86 ? 69.833 23.227 25.004  1.00 67.12  ?  86   HIS F HE1  1 
ATOM   9199  H  HE2  . HIS F  1 86 ? 68.818 21.984 23.266  1.00 66.58  ?  86   HIS F HE2  1 
ATOM   9200  N  N    . HIS F  1 87 ? 66.946 26.324 22.407  1.00 39.36  ?  87   HIS F N    1 
ATOM   9201  C  CA   . HIS F  1 87 ? 67.251 26.401 20.987  1.00 35.23  ?  87   HIS F CA   1 
ATOM   9202  C  C    . HIS F  1 87 ? 67.934 25.103 20.561  1.00 37.41  ?  87   HIS F C    1 
ATOM   9203  O  O    . HIS F  1 87 ? 68.898 24.675 21.192  1.00 38.65  ?  87   HIS F O    1 
ATOM   9204  C  CB   . HIS F  1 87 ? 68.159 27.605 20.729  1.00 33.02  ?  87   HIS F CB   1 
ATOM   9205  C  CG   . HIS F  1 87 ? 68.210 28.035 19.298  1.00 32.81  ?  87   HIS F CG   1 
ATOM   9206  N  ND1  . HIS F  1 87 ? 68.895 27.328 18.334  1.00 34.60  ?  87   HIS F ND1  1 
ATOM   9207  C  CD2  . HIS F  1 87 ? 67.676 29.109 18.668  1.00 32.05  ?  87   HIS F CD2  1 
ATOM   9208  C  CE1  . HIS F  1 87 ? 68.774 27.942 17.171  1.00 34.01  ?  87   HIS F CE1  1 
ATOM   9209  N  NE2  . HIS F  1 87 ? 68.040 29.025 17.346  1.00 32.40  ?  87   HIS F NE2  1 
ATOM   9210  H  H    . HIS F  1 87 ? 67.617 26.495 22.917  1.00 47.24  ?  87   HIS F H    1 
ATOM   9211  H  HA   . HIS F  1 87 ? 66.424 26.510 20.473  1.00 42.28  ?  87   HIS F HA   1 
ATOM   9212  H  HB2  . HIS F  1 87 ? 67.837 28.356 21.252  1.00 39.62  ?  87   HIS F HB2  1 
ATOM   9213  H  HB3  . HIS F  1 87 ? 69.062 27.379 21.002  1.00 39.62  ?  87   HIS F HB3  1 
ATOM   9214  H  HD1  . HIS F  1 87 ? 69.330 26.599 18.468  1.00 41.51  ?  87   HIS F HD1  1 
ATOM   9215  H  HD2  . HIS F  1 87 ? 67.157 29.776 19.057  1.00 38.46  ?  87   HIS F HD2  1 
ATOM   9216  H  HE1  . HIS F  1 87 ? 69.144 27.660 16.366  1.00 40.82  ?  87   HIS F HE1  1 
ATOM   9217  H  HE2  . HIS F  1 87 ? 67.824 29.587 16.732  1.00 38.88  ?  87   HIS F HE2  1 
ATOM   9218  N  N    . PRO F  1 88 ? 67.430 24.461 19.495  1.00 36.37  ?  88   PRO F N    1 
ATOM   9219  C  CA   . PRO F  1 88 ? 67.963 23.158 19.070  1.00 39.08  ?  88   PRO F CA   1 
ATOM   9220  C  C    . PRO F  1 88 ? 69.474 23.170 18.838  1.00 42.24  ?  88   PRO F C    1 
ATOM   9221  O  O    . PRO F  1 88 ? 70.174 22.262 19.285  1.00 45.98  ?  88   PRO F O    1 
ATOM   9222  C  CB   . PRO F  1 88 ? 67.217 22.873 17.758  1.00 37.85  ?  88   PRO F CB   1 
ATOM   9223  C  CG   . PRO F  1 88 ? 66.627 24.184 17.336  1.00 36.53  ?  88   PRO F CG   1 
ATOM   9224  C  CD   . PRO F  1 88 ? 66.370 24.942 18.595  1.00 35.85  ?  88   PRO F CD   1 
ATOM   9225  H  HA   . PRO F  1 88 ? 67.740 22.466 19.728  1.00 46.90  ?  88   PRO F HA   1 
ATOM   9226  H  HB2  . PRO F  1 88 ? 67.843 22.550 17.091  1.00 45.42  ?  88   PRO F HB2  1 
ATOM   9227  H  HB3  . PRO F  1 88 ? 66.519 22.219 17.916  1.00 45.42  ?  88   PRO F HB3  1 
ATOM   9228  H  HG2  . PRO F  1 88 ? 67.259 24.659 16.775  1.00 43.84  ?  88   PRO F HG2  1 
ATOM   9229  H  HG3  . PRO F  1 88 ? 65.798 24.027 16.858  1.00 43.84  ?  88   PRO F HG3  1 
ATOM   9230  H  HD2  . PRO F  1 88 ? 66.461 25.895 18.442  1.00 43.02  ?  88   PRO F HD2  1 
ATOM   9231  H  HD3  . PRO F  1 88 ? 65.495 24.720 18.952  1.00 43.02  ?  88   PRO F HD3  1 
ATOM   9232  N  N    . ALA F  1 89 ? 69.962 24.189 18.141  1.00 40.93  ?  89   ALA F N    1 
ATOM   9233  C  CA   . ALA F  1 89 ? 71.395 24.351 17.901  1.00 40.76  ?  89   ALA F CA   1 
ATOM   9234  C  C    . ALA F  1 89 ? 72.185 24.800 19.137  1.00 40.34  ?  89   ALA F C    1 
ATOM   9235  O  O    . ALA F  1 89 ? 73.364 25.134 19.029  1.00 40.90  ?  89   ALA F O    1 
ATOM   9236  C  CB   . ALA F  1 89 ? 71.617 25.333 16.760  1.00 39.69  ?  89   ALA F CB   1 
ATOM   9237  H  H    . ALA F  1 89 ? 69.479 24.808 17.790  1.00 49.12  ?  89   ALA F H    1 
ATOM   9238  H  HA   . ALA F  1 89 ? 71.760 23.486 17.620  1.00 48.91  ?  89   ALA F HA   1 
ATOM   9239  H  HB1  . ALA F  1 89 ? 71.233 26.180 16.997  1.00 47.63  ?  89   ALA F HB1  1 
ATOM   9240  H  HB2  . ALA F  1 89 ? 72.561 25.432 16.612  1.00 47.63  ?  89   ALA F HB2  1 
ATOM   9241  H  HB3  . ALA F  1 89 ? 71.195 24.992 15.968  1.00 47.63  ?  89   ALA F HB3  1 
ATOM   9242  N  N    . ARG F  1 90 ? 71.548 24.810 20.305  1.00 37.55  ?  90   ARG F N    1 
ATOM   9243  C  CA   . ARG F  1 90 ? 72.228 25.213 21.535  1.00 38.24  ?  90   ARG F CA   1 
ATOM   9244  C  C    . ARG F  1 90 ? 73.217 24.147 21.996  1.00 44.92  ?  90   ARG F C    1 
ATOM   9245  O  O    . ARG F  1 90 ? 72.897 22.959 22.024  1.00 44.44  ?  90   ARG F O    1 
ATOM   9246  C  CB   . ARG F  1 90 ? 71.213 25.493 22.648  1.00 37.14  ?  90   ARG F CB   1 
ATOM   9247  C  CG   . ARG F  1 90 ? 71.832 25.777 24.014  1.00 39.14  ?  90   ARG F CG   1 
ATOM   9248  C  CD   . ARG F  1 90 ? 72.802 26.950 23.971  1.00 40.28  ?  90   ARG F CD   1 
ATOM   9249  N  NE   . ARG F  1 90 ? 73.419 27.199 25.272  1.00 40.80  ?  90   ARG F NE   1 
ATOM   9250  C  CZ   . ARG F  1 90 ? 74.494 27.960 25.466  1.00 40.17  ?  90   ARG F CZ   1 
ATOM   9251  N  NH1  . ARG F  1 90 ? 75.094 28.550 24.442  1.00 40.62  ?  90   ARG F NH1  1 
ATOM   9252  N  NH2  . ARG F  1 90 ? 74.976 28.125 26.689  1.00 38.99  ?  90   ARG F NH2  1 
ATOM   9253  H  H    . ARG F  1 90 ? 70.724 24.589 20.413  1.00 45.06  ?  90   ARG F H    1 
ATOM   9254  H  HA   . ARG F  1 90 ? 72.729 26.039 21.367  1.00 45.89  ?  90   ARG F HA   1 
ATOM   9255  H  HB2  . ARG F  1 90 ? 70.684 26.266 22.398  1.00 44.57  ?  90   ARG F HB2  1 
ATOM   9256  H  HB3  . ARG F  1 90 ? 70.636 24.719 22.742  1.00 44.57  ?  90   ARG F HB3  1 
ATOM   9257  H  HG2  . ARG F  1 90 ? 71.126 25.992 24.644  1.00 46.96  ?  90   ARG F HG2  1 
ATOM   9258  H  HG3  . ARG F  1 90 ? 72.318 24.993 24.312  1.00 46.96  ?  90   ARG F HG3  1 
ATOM   9259  H  HD2  . ARG F  1 90 ? 73.508 26.756 23.334  1.00 48.34  ?  90   ARG F HD2  1 
ATOM   9260  H  HD3  . ARG F  1 90 ? 72.323 27.751 23.706  1.00 48.34  ?  90   ARG F HD3  1 
ATOM   9261  H  HE   . ARG F  1 90 ? 73.063 26.828 25.962  1.00 48.96  ?  90   ARG F HE   1 
ATOM   9262  H  HH11 . ARG F  1 90 ? 74.786 28.448 23.646  1.00 48.74  ?  90   ARG F HH11 1 
ATOM   9263  H  HH12 . ARG F  1 90 ? 75.789 29.039 24.575  1.00 48.74  ?  90   ARG F HH12 1 
ATOM   9264  H  HH21 . ARG F  1 90 ? 74.593 27.743 27.357  1.00 46.79  ?  90   ARG F HH21 1 
ATOM   9265  H  HH22 . ARG F  1 90 ? 75.672 28.614 26.814  1.00 46.79  ?  90   ARG F HH22 1 
ATOM   9266  N  N    . VAL F  1 91 ? 74.420 24.586 22.352  1.00 52.91  ?  91   VAL F N    1 
ATOM   9267  C  CA   . VAL F  1 91 ? 75.444 23.701 22.894  1.00 59.56  ?  91   VAL F CA   1 
ATOM   9268  C  C    . VAL F  1 91 ? 75.734 24.055 24.349  1.00 62.24  ?  91   VAL F C    1 
ATOM   9269  O  O    . VAL F  1 91 ? 76.114 25.185 24.659  1.00 62.29  ?  91   VAL F O    1 
ATOM   9270  C  CB   . VAL F  1 91 ? 76.748 23.801 22.081  1.00 60.02  ?  91   VAL F CB   1 
ATOM   9271  C  CG1  . VAL F  1 91 ? 77.924 23.239 22.869  1.00 61.93  ?  91   VAL F CG1  1 
ATOM   9272  C  CG2  . VAL F  1 91 ? 76.595 23.083 20.749  1.00 59.58  ?  91   VAL F CG2  1 
ATOM   9273  H  H    . VAL F  1 91 ? 74.672 25.406 22.288  1.00 63.49  ?  91   VAL F H    1 
ATOM   9274  H  HA   . VAL F  1 91 ? 75.127 22.775 22.858  1.00 71.47  ?  91   VAL F HA   1 
ATOM   9275  H  HB   . VAL F  1 91 ? 76.935 24.745 21.895  1.00 72.03  ?  91   VAL F HB   1 
ATOM   9276  H  HG11 . VAL F  1 91 ? 77.752 22.317 23.073  1.00 74.32  ?  91   VAL F HG11 1 
ATOM   9277  H  HG12 . VAL F  1 91 ? 78.720 23.314 22.339  1.00 74.32  ?  91   VAL F HG12 1 
ATOM   9278  H  HG13 . VAL F  1 91 ? 78.023 23.741 23.682  1.00 74.32  ?  91   VAL F HG13 1 
ATOM   9279  H  HG21 . VAL F  1 91 ? 75.881 23.492 20.255  1.00 71.49  ?  91   VAL F HG21 1 
ATOM   9280  H  HG22 . VAL F  1 91 ? 77.417 23.157 20.259  1.00 71.49  ?  91   VAL F HG22 1 
ATOM   9281  H  HG23 . VAL F  1 91 ? 76.393 22.159 20.914  1.00 71.49  ?  91   VAL F HG23 1 
ATOM   9282  N  N    . MET G  1 1  ? 78.810 72.401 4.901   1.00 43.47  ?  1    MET G N    1 
ATOM   9283  C  CA   . MET G  1 1  ? 78.148 72.101 6.198   1.00 42.75  ?  1    MET G CA   1 
ATOM   9284  C  C    . MET G  1 1  ? 77.779 70.628 6.288   1.00 37.17  ?  1    MET G C    1 
ATOM   9285  O  O    . MET G  1 1  ? 77.833 69.901 5.297   1.00 37.27  ?  1    MET G O    1 
ATOM   9286  C  CB   . MET G  1 1  ? 76.910 72.969 6.379   1.00 45.29  ?  1    MET G CB   1 
ATOM   9287  C  CG   . MET G  1 1  ? 75.950 72.933 5.215   1.00 46.09  ?  1    MET G CG   1 
ATOM   9288  S  SD   . MET G  1 1  ? 74.787 74.298 5.317   1.00 57.21  ?  1    MET G SD   1 
ATOM   9289  C  CE   . MET G  1 1  ? 75.898 75.695 5.145   1.00 40.27  ?  1    MET G CE   1 
ATOM   9290  H  H1   . MET G  1 1  ? 78.331 71.969 4.190   1.00 52.16  ?  1    MET G H1   1 
ATOM   9291  H  H2   . MET G  1 1  ? 78.812 73.350 4.754   1.00 52.16  ?  1    MET G H2   1 
ATOM   9292  H  H3   . MET G  1 1  ? 79.714 72.079 4.921   1.00 52.16  ?  1    MET G H3   1 
ATOM   9293  H  HA   . MET G  1 1  ? 78.770 72.314 6.925   1.00 51.29  ?  1    MET G HA   1 
ATOM   9294  H  HB2  . MET G  1 1  ? 76.431 72.666 7.166   1.00 54.35  ?  1    MET G HB2  1 
ATOM   9295  H  HB3  . MET G  1 1  ? 77.191 73.890 6.502   1.00 54.35  ?  1    MET G HB3  1 
ATOM   9296  H  HG2  . MET G  1 1  ? 76.445 73.013 4.384   1.00 55.31  ?  1    MET G HG2  1 
ATOM   9297  H  HG3  . MET G  1 1  ? 75.450 72.102 5.233   1.00 55.31  ?  1    MET G HG3  1 
ATOM   9298  H  HE1  . MET G  1 1  ? 76.350 75.632 4.300   1.00 48.33  ?  1    MET G HE1  1 
ATOM   9299  H  HE2  . MET G  1 1  ? 75.387 76.507 5.184   1.00 48.33  ?  1    MET G HE2  1 
ATOM   9300  H  HE3  . MET G  1 1  ? 76.537 75.675 5.861   1.00 48.33  ?  1    MET G HE3  1 
ATOM   9301  N  N    . LEU G  1 2  ? 77.385 70.201 7.481   1.00 32.00  ?  2    LEU G N    1 
ATOM   9302  C  CA   . LEU G  1 2  ? 77.365 68.784 7.810   1.00 27.60  ?  2    LEU G CA   1 
ATOM   9303  C  C    . LEU G  1 2  ? 75.970 68.167 7.828   1.00 25.52  ?  2    LEU G C    1 
ATOM   9304  O  O    . LEU G  1 2  ? 74.996 68.790 8.254   1.00 25.47  ?  2    LEU G O    1 
ATOM   9305  C  CB   . LEU G  1 2  ? 78.041 68.572 9.164   1.00 26.94  ?  2    LEU G CB   1 
ATOM   9306  C  CG   . LEU G  1 2  ? 79.419 69.229 9.285   1.00 28.13  ?  2    LEU G CG   1 
ATOM   9307  C  CD1  . LEU G  1 2  ? 79.967 69.075 10.695  1.00 29.01  ?  2    LEU G CD1  1 
ATOM   9308  C  CD2  . LEU G  1 2  ? 80.384 68.644 8.265   1.00 28.44  ?  2    LEU G CD2  1 
ATOM   9309  H  H    . LEU G  1 2  ? 77.124 70.714 8.120   1.00 38.40  ?  2    LEU G H    1 
ATOM   9310  H  HA   . LEU G  1 2  ? 77.891 68.302 7.138   1.00 33.12  ?  2    LEU G HA   1 
ATOM   9311  H  HB2  . LEU G  1 2  ? 77.474 68.945 9.857   1.00 32.33  ?  2    LEU G HB2  1 
ATOM   9312  H  HB3  . LEU G  1 2  ? 78.154 67.619 9.310   1.00 32.33  ?  2    LEU G HB3  1 
ATOM   9313  H  HG   . LEU G  1 2  ? 79.331 70.177 9.101   1.00 33.75  ?  2    LEU G HG   1 
ATOM   9314  H  HD11 . LEU G  1 2  ? 80.045 68.141 10.899  1.00 34.81  ?  2    LEU G HD11 1 
ATOM   9315  H  HD12 . LEU G  1 2  ? 80.829 69.495 10.742  1.00 34.81  ?  2    LEU G HD12 1 
ATOM   9316  H  HD13 . LEU G  1 2  ? 79.363 69.496 11.312  1.00 34.81  ?  2    LEU G HD13 1 
ATOM   9317  H  HD21 . LEU G  1 2  ? 80.038 68.799 7.383   1.00 34.13  ?  2    LEU G HD21 1 
ATOM   9318  H  HD22 . LEU G  1 2  ? 81.238 69.073 8.363   1.00 34.13  ?  2    LEU G HD22 1 
ATOM   9319  H  HD23 . LEU G  1 2  ? 80.471 67.701 8.423   1.00 34.13  ?  2    LEU G HD23 1 
ATOM   9320  N  N    . TYR G  1 3  ? 75.894 66.928 7.356   1.00 25.78  ?  3    TYR G N    1 
ATOM   9321  C  CA   . TYR G  1 3  ? 74.680 66.136 7.451   1.00 25.66  ?  3    TYR G CA   1 
ATOM   9322  C  C    . TYR G  1 3  ? 75.043 64.764 7.990   1.00 25.78  ?  3    TYR G C    1 
ATOM   9323  O  O    . TYR G  1 3  ? 76.071 64.201 7.618   1.00 26.83  ?  3    TYR G O    1 
ATOM   9324  C  CB   . TYR G  1 3  ? 74.030 65.962 6.079   1.00 25.22  ?  3    TYR G CB   1 
ATOM   9325  C  CG   . TYR G  1 3  ? 73.701 67.247 5.356   1.00 24.00  ?  3    TYR G CG   1 
ATOM   9326  C  CD1  . TYR G  1 3  ? 74.705 68.039 4.813   1.00 23.54  ?  3    TYR G CD1  1 
ATOM   9327  C  CD2  . TYR G  1 3  ? 72.381 67.653 5.190   1.00 23.90  ?  3    TYR G CD2  1 
ATOM   9328  C  CE1  . TYR G  1 3  ? 74.407 69.208 4.138   1.00 23.25  ?  3    TYR G CE1  1 
ATOM   9329  C  CE2  . TYR G  1 3  ? 72.071 68.821 4.515   1.00 23.43  ?  3    TYR G CE2  1 
ATOM   9330  C  CZ   . TYR G  1 3  ? 73.090 69.593 3.990   1.00 23.31  ?  3    TYR G CZ   1 
ATOM   9331  O  OH   . TYR G  1 3  ? 72.794 70.755 3.317   1.00 23.00  ?  3    TYR G OH   1 
ATOM   9332  H  H    . TYR G  1 3  ? 76.544 66.519 6.971   1.00 30.93  ?  3    TYR G H    1 
ATOM   9333  H  HA   . TYR G  1 3  ? 74.041 66.564 8.059   1.00 30.79  ?  3    TYR G HA   1 
ATOM   9334  H  HB2  . TYR G  1 3  ? 74.635 65.456 5.514   1.00 30.27  ?  3    TYR G HB2  1 
ATOM   9335  H  HB3  . TYR G  1 3  ? 73.202 65.469 6.190   1.00 30.27  ?  3    TYR G HB3  1 
ATOM   9336  H  HD1  . TYR G  1 3  ? 75.594 67.781 4.910   1.00 28.25  ?  3    TYR G HD1  1 
ATOM   9337  H  HD2  . TYR G  1 3  ? 71.695 67.133 5.541   1.00 28.68  ?  3    TYR G HD2  1 
ATOM   9338  H  HE1  . TYR G  1 3  ? 75.089 69.730 3.783   1.00 27.90  ?  3    TYR G HE1  1 
ATOM   9339  H  HE2  . TYR G  1 3  ? 71.185 69.083 4.414   1.00 28.12  ?  3    TYR G HE2  1 
ATOM   9340  H  HH   . TYR G  1 3  ? 73.074 70.713 2.548   1.00 27.61  ?  3    TYR G HH   1 
ATOM   9341  N  N    . LEU G  1 4  ? 74.204 64.228 8.870   1.00 23.73  ?  4    LEU G N    1 
ATOM   9342  C  CA   . LEU G  1 4  ? 74.321 62.835 9.268   1.00 21.85  ?  4    LEU G CA   1 
ATOM   9343  C  C    . LEU G  1 4  ? 73.428 62.014 8.351   1.00 21.51  ?  4    LEU G C    1 
ATOM   9344  O  O    . LEU G  1 4  ? 72.229 62.281 8.237   1.00 22.23  ?  4    LEU G O    1 
ATOM   9345  C  CB   . LEU G  1 4  ? 73.896 62.637 10.721  1.00 21.27  ?  4    LEU G CB   1 
ATOM   9346  C  CG   . LEU G  1 4  ? 74.134 61.223 11.259  1.00 21.34  ?  4    LEU G CG   1 
ATOM   9347  C  CD1  . LEU G  1 4  ? 75.628 60.960 11.431  1.00 22.57  ?  4    LEU G CD1  1 
ATOM   9348  C  CD2  . LEU G  1 4  ? 73.392 61.004 12.566  1.00 21.56  ?  4    LEU G CD2  1 
ATOM   9349  H  H    . LEU G  1 4  ? 73.560 64.652 9.250   1.00 28.47  ?  4    LEU G H    1 
ATOM   9350  H  HA   . LEU G  1 4  ? 75.247 62.534 9.163   1.00 26.22  ?  4    LEU G HA   1 
ATOM   9351  H  HB2  . LEU G  1 4  ? 74.397 63.253 11.279  1.00 25.52  ?  4    LEU G HB2  1 
ATOM   9352  H  HB3  . LEU G  1 4  ? 72.947 62.825 10.797  1.00 25.52  ?  4    LEU G HB3  1 
ATOM   9353  H  HG   . LEU G  1 4  ? 73.794 60.583 10.614  1.00 25.60  ?  4    LEU G HG   1 
ATOM   9354  H  HD11 . LEU G  1 4  ? 75.988 61.598 12.051  1.00 27.09  ?  4    LEU G HD11 1 
ATOM   9355  H  HD12 . LEU G  1 4  ? 75.751 60.069 11.768  1.00 27.09  ?  4    LEU G HD12 1 
ATOM   9356  H  HD13 . LEU G  1 4  ? 76.061 61.051 10.579  1.00 27.09  ?  4    LEU G HD13 1 
ATOM   9357  H  HD21 . LEU G  1 4  ? 72.452 61.125 12.415  1.00 25.87  ?  4    LEU G HD21 1 
ATOM   9358  H  HD22 . LEU G  1 4  ? 73.562 60.111 12.875  1.00 25.87  ?  4    LEU G HD22 1 
ATOM   9359  H  HD23 . LEU G  1 4  ? 73.705 61.640 13.213  1.00 25.87  ?  4    LEU G HD23 1 
ATOM   9360  N  N    . VAL G  1 5  ? 74.014 61.019 7.696   1.00 21.54  ?  5    VAL G N    1 
ATOM   9361  C  CA   . VAL G  1 5  ? 73.289 60.211 6.729   1.00 21.86  ?  5    VAL G CA   1 
ATOM   9362  C  C    . VAL G  1 5  ? 73.401 58.730 7.062   1.00 23.28  ?  5    VAL G C    1 
ATOM   9363  O  O    . VAL G  1 5  ? 74.501 58.189 7.170   1.00 26.38  ?  5    VAL G O    1 
ATOM   9364  C  CB   . VAL G  1 5  ? 73.825 60.442 5.304   1.00 21.85  ?  5    VAL G CB   1 
ATOM   9365  C  CG1  . VAL G  1 5  ? 73.092 59.561 4.306   1.00 22.01  ?  5    VAL G CG1  1 
ATOM   9366  C  CG2  . VAL G  1 5  ? 73.700 61.912 4.923   1.00 21.91  ?  5    VAL G CG2  1 
ATOM   9367  H  H    . VAL G  1 5  ? 74.838 60.791 7.796   1.00 25.84  ?  5    VAL G H    1 
ATOM   9368  H  HA   . VAL G  1 5  ? 72.341 60.460 6.745   1.00 26.23  ?  5    VAL G HA   1 
ATOM   9369  H  HB   . VAL G  1 5  ? 74.775 60.203 5.279   1.00 26.22  ?  5    VAL G HB   1 
ATOM   9370  H  HG11 . VAL G  1 5  ? 72.156 59.776 4.329   1.00 26.41  ?  5    VAL G HG11 1 
ATOM   9371  H  HG12 . VAL G  1 5  ? 73.444 59.724 3.428   1.00 26.41  ?  5    VAL G HG12 1 
ATOM   9372  H  HG13 . VAL G  1 5  ? 73.223 58.641 4.547   1.00 26.41  ?  5    VAL G HG13 1 
ATOM   9373  H  HG21 . VAL G  1 5  ? 74.209 62.440 5.543   1.00 26.29  ?  5    VAL G HG21 1 
ATOM   9374  H  HG22 . VAL G  1 5  ? 74.040 62.034 4.033   1.00 26.29  ?  5    VAL G HG22 1 
ATOM   9375  H  HG23 . VAL G  1 5  ? 72.775 62.166 4.958   1.00 26.29  ?  5    VAL G HG23 1 
ATOM   9376  N  N    . ARG G  1 6  ? 72.257 58.076 7.230   1.00 22.65  ?  6    ARG G N    1 
ATOM   9377  C  CA   . ARG G  1 6  ? 72.238 56.637 7.445   1.00 24.42  ?  6    ARG G CA   1 
ATOM   9378  C  C    . ARG G  1 6  ? 71.741 55.949 6.186   1.00 26.03  ?  6    ARG G C    1 
ATOM   9379  O  O    . ARG G  1 6  ? 70.736 56.351 5.606   1.00 25.93  ?  6    ARG G O    1 
ATOM   9380  C  CB   . ARG G  1 6  ? 71.344 56.269 8.630   1.00 25.85  ?  6    ARG G CB   1 
ATOM   9381  C  CG   . ARG G  1 6  ? 71.277 54.768 8.900   1.00 28.79  ?  6    ARG G CG   1 
ATOM   9382  C  CD   . ARG G  1 6  ? 70.233 54.433 9.954   1.00 31.84  ?  6    ARG G CD   1 
ATOM   9383  N  NE   . ARG G  1 6  ? 70.479 55.141 11.207  1.00 33.68  ?  6    ARG G NE   1 
ATOM   9384  C  CZ   . ARG G  1 6  ? 71.219 54.674 12.209  1.00 34.40  ?  6    ARG G CZ   1 
ATOM   9385  N  NH1  . ARG G  1 6  ? 71.796 53.481 12.128  1.00 35.63  ?  6    ARG G NH1  1 
ATOM   9386  N  NH2  . ARG G  1 6  ? 71.380 55.405 13.303  1.00 33.34  ?  6    ARG G NH2  1 
ATOM   9387  H  H    . ARG G  1 6  ? 71.480 58.443 7.224   1.00 27.19  ?  6    ARG G H    1 
ATOM   9388  H  HA   . ARG G  1 6  ? 73.147 56.323 7.632   1.00 29.30  ?  6    ARG G HA   1 
ATOM   9389  H  HB2  . ARG G  1 6  ? 71.689 56.700 9.428   1.00 31.02  ?  6    ARG G HB2  1 
ATOM   9390  H  HB3  . ARG G  1 6  ? 70.443 56.580 8.452   1.00 31.02  ?  6    ARG G HB3  1 
ATOM   9391  H  HG2  . ARG G  1 6  ? 71.041 54.307 8.080   1.00 34.54  ?  6    ARG G HG2  1 
ATOM   9392  H  HG3  . ARG G  1 6  ? 72.140 54.462 9.220   1.00 34.54  ?  6    ARG G HG3  1 
ATOM   9393  H  HD2  . ARG G  1 6  ? 69.356 54.691 9.628   1.00 38.21  ?  6    ARG G HD2  1 
ATOM   9394  H  HD3  . ARG G  1 6  ? 70.256 53.480 10.134  1.00 38.21  ?  6    ARG G HD3  1 
ATOM   9395  H  HE   . ARG G  1 6  ? 70.120 55.916 11.304  1.00 40.42  ?  6    ARG G HE   1 
ATOM   9396  H  HH11 . ARG G  1 6  ? 71.697 53.002 11.421  1.00 42.76  ?  6    ARG G HH11 1 
ATOM   9397  H  HH12 . ARG G  1 6  ? 72.272 53.188 12.782  1.00 42.76  ?  6    ARG G HH12 1 
ATOM   9398  H  HH21 . ARG G  1 6  ? 71.007 56.178 13.363  1.00 40.01  ?  6    ARG G HH21 1 
ATOM   9399  H  HH22 . ARG G  1 6  ? 71.855 55.106 13.955  1.00 40.01  ?  6    ARG G HH22 1 
ATOM   9400  N  N    . MET G  1 7  ? 72.455 54.911 5.766   1.00 24.61  ?  7    MET G N    1 
ATOM   9401  C  CA   . MET G  1 7  ? 72.096 54.172 4.565   1.00 26.17  ?  7    MET G CA   1 
ATOM   9402  C  C    . MET G  1 7  ? 71.944 52.698 4.896   1.00 28.69  ?  7    MET G C    1 
ATOM   9403  O  O    . MET G  1 7  ? 72.767 52.129 5.613   1.00 31.14  ?  7    MET G O    1 
ATOM   9404  C  CB   . MET G  1 7  ? 73.176 54.333 3.494   1.00 26.72  ?  7    MET G CB   1 
ATOM   9405  C  CG   . MET G  1 7  ? 73.615 55.765 3.246   1.00 26.89  ?  7    MET G CG   1 
ATOM   9406  S  SD   . MET G  1 7  ? 74.762 55.880 1.857   1.00 29.90  ?  7    MET G SD   1 
ATOM   9407  C  CE   . MET G  1 7  ? 75.349 57.561 2.038   1.00 28.26  ?  7    MET G CE   1 
ATOM   9408  H  H    . MET G  1 7  ? 73.157 54.613 6.162   1.00 29.53  ?  7    MET G H    1 
ATOM   9409  H  HA   . MET G  1 7  ? 71.251 54.516 4.208   1.00 31.41  ?  7    MET G HA   1 
ATOM   9410  H  HB2  . MET G  1 7  ? 73.959 53.829 3.765   1.00 32.07  ?  7    MET G HB2  1 
ATOM   9411  H  HB3  . MET G  1 7  ? 72.836 53.982 2.656   1.00 32.07  ?  7    MET G HB3  1 
ATOM   9412  H  HG2  . MET G  1 7  ? 72.837 56.307 3.043   1.00 32.27  ?  7    MET G HG2  1 
ATOM   9413  H  HG3  . MET G  1 7  ? 74.062 56.103 4.038   1.00 32.27  ?  7    MET G HG3  1 
ATOM   9414  H  HE1  . MET G  1 7  ? 75.771 57.654 2.895   1.00 33.91  ?  7    MET G HE1  1 
ATOM   9415  H  HE2  . MET G  1 7  ? 75.982 57.747 1.340   1.00 33.91  ?  7    MET G HE2  1 
ATOM   9416  H  HE3  . MET G  1 7  ? 74.603 58.161 1.972   1.00 33.91  ?  7    MET G HE3  1 
ATOM   9417  N  N    . THR G  1 8  ? 70.891 52.082 4.371   1.00 30.01  ?  8    THR G N    1 
ATOM   9418  C  CA   . THR G  1 8  ? 70.690 50.647 4.523   1.00 31.31  ?  8    THR G CA   1 
ATOM   9419  C  C    . THR G  1 8  ? 70.488 50.014 3.152   1.00 32.82  ?  8    THR G C    1 
ATOM   9420  O  O    . THR G  1 8  ? 69.651 50.462 2.372   1.00 33.18  ?  8    THR G O    1 
ATOM   9421  C  CB   . THR G  1 8  ? 69.477 50.338 5.416   1.00 33.07  ?  8    THR G CB   1 
ATOM   9422  O  OG1  . THR G  1 8  ? 69.656 50.953 6.698   1.00 31.17  ?  8    THR G OG1  1 
ATOM   9423  C  CG2  . THR G  1 8  ? 69.317 48.838 5.600   1.00 35.87  ?  8    THR G CG2  1 
ATOM   9424  H  H    . THR G  1 8  ? 70.274 52.477 3.920   1.00 36.01  ?  8    THR G H    1 
ATOM   9425  H  HA   . THR G  1 8  ? 71.485 50.249 4.934   1.00 37.57  ?  8    THR G HA   1 
ATOM   9426  H  HB   . THR G  1 8  ? 68.672 50.685 5.000   1.00 39.69  ?  8    THR G HB   1 
ATOM   9427  H  HG1  . THR G  1 8  ? 69.727 51.766 6.612   1.00 37.41  ?  8    THR G HG1  1 
ATOM   9428  H  HG21 . THR G  1 8  ? 70.104 48.473 6.012   1.00 43.04  ?  8    THR G HG21 1 
ATOM   9429  H  HG22 . THR G  1 8  ? 68.558 48.655 6.158   1.00 43.04  ?  8    THR G HG22 1 
ATOM   9430  H  HG23 . THR G  1 8  ? 69.187 48.415 4.747   1.00 43.04  ?  8    THR G HG23 1 
ATOM   9431  N  N    . VAL G  1 9  ? 71.263 48.976 2.859   1.00 32.34  ?  9    VAL G N    1 
ATOM   9432  C  CA   . VAL G  1 9  ? 71.198 48.321 1.558   1.00 34.61  ?  9    VAL G CA   1 
ATOM   9433  C  C    . VAL G  1 9  ? 70.226 47.150 1.586   1.00 38.71  ?  9    VAL G C    1 
ATOM   9434  O  O    . VAL G  1 9  ? 70.348 46.250 2.414   1.00 38.49  ?  9    VAL G O    1 
ATOM   9435  C  CB   . VAL G  1 9  ? 72.577 47.799 1.114   1.00 35.50  ?  9    VAL G CB   1 
ATOM   9436  C  CG1  . VAL G  1 9  ? 72.476 47.137 -0.251  1.00 36.77  ?  9    VAL G CG1  1 
ATOM   9437  C  CG2  . VAL G  1 9  ? 73.593 48.928 1.087   1.00 34.34  ?  9    VAL G CG2  1 
ATOM   9438  H  H    . VAL G  1 9  ? 71.837 48.630 3.399   1.00 38.81  ?  9    VAL G H    1 
ATOM   9439  H  HA   . VAL G  1 9  ? 70.884 48.964 0.889   1.00 41.54  ?  9    VAL G HA   1 
ATOM   9440  H  HB   . VAL G  1 9  ? 72.887 47.126 1.756   1.00 42.60  ?  9    VAL G HB   1 
ATOM   9441  H  HG11 . VAL G  1 9  ? 72.160 47.782 -0.888  1.00 44.12  ?  9    VAL G HG11 1 
ATOM   9442  H  HG12 . VAL G  1 9  ? 73.344 46.819 -0.509  1.00 44.12  ?  9    VAL G HG12 1 
ATOM   9443  H  HG13 . VAL G  1 9  ? 71.860 46.402 -0.196  1.00 44.12  ?  9    VAL G HG13 1 
ATOM   9444  H  HG21 . VAL G  1 9  ? 73.667 49.303 1.968   1.00 41.21  ?  9    VAL G HG21 1 
ATOM   9445  H  HG22 . VAL G  1 9  ? 74.442 48.578 0.808   1.00 41.21  ?  9    VAL G HG22 1 
ATOM   9446  H  HG23 . VAL G  1 9  ? 73.296 49.600 0.469   1.00 41.21  ?  9    VAL G HG23 1 
ATOM   9447  N  N    . ASN G  1 10 ? 69.262 47.171 0.672   1.00 41.82  ?  10   ASN G N    1 
ATOM   9448  C  CA   . ASN G  1 10 ? 68.302 46.085 0.541   1.00 45.52  ?  10   ASN G CA   1 
ATOM   9449  C  C    . ASN G  1 10 ? 68.395 45.454 -0.845  1.00 42.24  ?  10   ASN G C    1 
ATOM   9450  O  O    . ASN G  1 10 ? 67.687 45.854 -1.768  1.00 44.28  ?  10   ASN G O    1 
ATOM   9451  C  CB   . ASN G  1 10 ? 66.882 46.596 0.786   1.00 48.61  ?  10   ASN G CB   1 
ATOM   9452  C  CG   . ASN G  1 10 ? 66.803 47.565 1.954   1.00 49.05  ?  10   ASN G CG   1 
ATOM   9453  O  OD1  . ASN G  1 10 ? 66.843 47.159 3.117   1.00 49.81  ?  10   ASN G OD1  1 
ATOM   9454  N  ND2  . ASN G  1 10 ? 66.684 48.855 1.647   1.00 48.34  ?  10   ASN G ND2  1 
ATOM   9455  H  H    . ASN G  1 10 ? 69.142 47.812 0.111   1.00 50.18  ?  10   ASN G H    1 
ATOM   9456  H  HA   . ASN G  1 10 ? 68.500 45.394 1.208   1.00 54.62  ?  10   ASN G HA   1 
ATOM   9457  H  HB2  . ASN G  1 10 ? 66.570 47.058 -0.008  1.00 58.33  ?  10   ASN G HB2  1 
ATOM   9458  H  HB3  . ASN G  1 10 ? 66.303 45.843 0.982   1.00 58.33  ?  10   ASN G HB3  1 
ATOM   9459  H  HD21 . ASN G  1 10 ? 66.655 49.100 0.823   1.00 58.01  ?  10   ASN G HD21 1 
ATOM   9460  H  HD22 . ASN G  1 10 ? 66.635 49.443 2.272   1.00 58.01  ?  10   ASN G HD22 1 
ATOM   9461  N  N    . LEU G  1 11 ? 69.281 44.474 -0.988  1.00 39.24  ?  11   LEU G N    1 
ATOM   9462  C  CA   . LEU G  1 11 ? 69.463 43.799 -2.266  1.00 38.81  ?  11   LEU G CA   1 
ATOM   9463  C  C    . LEU G  1 11 ? 68.457 42.667 -2.424  1.00 43.58  ?  11   LEU G C    1 
ATOM   9464  O  O    . LEU G  1 11 ? 68.218 41.910 -1.483  1.00 48.24  ?  11   LEU G O    1 
ATOM   9465  C  CB   . LEU G  1 11 ? 70.883 43.241 -2.388  1.00 38.09  ?  11   LEU G CB   1 
ATOM   9466  C  CG   . LEU G  1 11 ? 72.018 44.268 -2.392  1.00 35.47  ?  11   LEU G CG   1 
ATOM   9467  C  CD1  . LEU G  1 11 ? 73.357 43.595 -2.665  1.00 37.82  ?  11   LEU G CD1  1 
ATOM   9468  C  CD2  . LEU G  1 11 ? 71.754 45.367 -3.411  1.00 33.63  ?  11   LEU G CD2  1 
ATOM   9469  H  H    . LEU G  1 11 ? 69.789 44.182 -0.360  1.00 47.09  ?  11   LEU G H    1 
ATOM   9470  H  HA   . LEU G  1 11 ? 69.321 44.439 -2.994  1.00 46.57  ?  11   LEU G HA   1 
ATOM   9471  H  HB2  . LEU G  1 11 ? 71.040 42.643 -1.640  1.00 45.70  ?  11   LEU G HB2  1 
ATOM   9472  H  HB3  . LEU G  1 11 ? 70.944 42.741 -3.217  1.00 45.70  ?  11   LEU G HB3  1 
ATOM   9473  H  HG   . LEU G  1 11 ? 72.068 44.682 -1.517  1.00 42.56  ?  11   LEU G HG   1 
ATOM   9474  H  HD11 . LEU G  1 11 ? 73.321 43.164 -3.522  1.00 45.38  ?  11   LEU G HD11 1 
ATOM   9475  H  HD12 . LEU G  1 11 ? 74.048 44.262 -2.662  1.00 45.38  ?  11   LEU G HD12 1 
ATOM   9476  H  HD13 . LEU G  1 11 ? 73.525 42.946 -1.979  1.00 45.38  ?  11   LEU G HD13 1 
ATOM   9477  H  HD21 . LEU G  1 11 ? 70.932 45.810 -3.185  1.00 40.36  ?  11   LEU G HD21 1 
ATOM   9478  H  HD22 . LEU G  1 11 ? 72.481 45.994 -3.390  1.00 40.36  ?  11   LEU G HD22 1 
ATOM   9479  H  HD23 . LEU G  1 11 ? 71.685 44.974 -4.284  1.00 40.36  ?  11   LEU G HD23 1 
ATOM   9480  N  N    . PRO G  1 12 ? 67.856 42.552 -3.617  1.00 41.31  ?  12   PRO G N    1 
ATOM   9481  C  CA   . PRO G  1 12 ? 66.962 41.423 -3.892  1.00 45.19  ?  12   PRO G CA   1 
ATOM   9482  C  C    . PRO G  1 12 ? 67.754 40.127 -4.017  1.00 54.95  ?  12   PRO G C    1 
ATOM   9483  O  O    . PRO G  1 12 ? 68.848 40.136 -4.578  1.00 47.19  ?  12   PRO G O    1 
ATOM   9484  C  CB   . PRO G  1 12 ? 66.319 41.803 -5.228  1.00 44.10  ?  12   PRO G CB   1 
ATOM   9485  C  CG   . PRO G  1 12 ? 67.305 42.705 -5.881  1.00 40.94  ?  12   PRO G CG   1 
ATOM   9486  C  CD   . PRO G  1 12 ? 67.979 43.459 -4.772  1.00 38.45  ?  12   PRO G CD   1 
ATOM   9487  H  HA   . PRO G  1 12 ? 66.275 41.337 -3.198  1.00 54.23  ?  12   PRO G HA   1 
ATOM   9488  H  HB2  . PRO G  1 12 ? 66.176 41.006 -5.762  1.00 52.91  ?  12   PRO G HB2  1 
ATOM   9489  H  HB3  . PRO G  1 12 ? 65.482 42.266 -5.069  1.00 52.91  ?  12   PRO G HB3  1 
ATOM   9490  H  HG2  . PRO G  1 12 ? 67.951 42.176 -6.374  1.00 49.13  ?  12   PRO G HG2  1 
ATOM   9491  H  HG3  . PRO G  1 12 ? 66.841 43.316 -6.474  1.00 49.13  ?  12   PRO G HG3  1 
ATOM   9492  H  HD2  . PRO G  1 12 ? 68.913 43.610 -4.985  1.00 46.14  ?  12   PRO G HD2  1 
ATOM   9493  H  HD3  . PRO G  1 12 ? 67.514 44.292 -4.598  1.00 46.14  ?  12   PRO G HD3  1 
ATOM   9494  N  N    . ARG G  1 13 ? 67.215 39.032 -3.492  1.00 67.63  ?  13   ARG G N    1 
ATOM   9495  C  CA   . ARG G  1 13 ? 67.912 37.751 -3.519  1.00 80.51  ?  13   ARG G CA   1 
ATOM   9496  C  C    . ARG G  1 13 ? 68.241 37.348 -4.951  1.00 79.43  ?  13   ARG G C    1 
ATOM   9497  O  O    . ARG G  1 13 ? 69.310 36.802 -5.226  1.00 83.38  ?  13   ARG G O    1 
ATOM   9498  C  CB   . ARG G  1 13 ? 67.049 36.665 -2.879  1.00 88.38  ?  13   ARG G CB   1 
ATOM   9499  C  CG   . ARG G  1 13 ? 67.757 35.323 -2.717  1.00 93.01  ?  13   ARG G CG   1 
ATOM   9500  C  CD   . ARG G  1 13 ? 66.859 34.145 -3.082  1.00 96.68  ?  13   ARG G CD   1 
ATOM   9501  N  NE   . ARG G  1 13 ? 65.448 34.421 -2.820  1.00 96.97  ?  13   ARG G NE   1 
ATOM   9502  C  CZ   . ARG G  1 13 ? 64.567 34.832 -3.730  1.00 97.32  ?  13   ARG G CZ   1 
ATOM   9503  N  NH1  . ARG G  1 13 ? 64.927 35.022 -4.994  1.00 98.94  ?  13   ARG G NH1  1 
ATOM   9504  N  NH2  . ARG G  1 13 ? 63.311 35.057 -3.370  1.00 96.10  ?  13   ARG G NH2  1 
ATOM   9505  H  H    . ARG G  1 13 ? 66.444 39.004 -3.113  1.00 81.15  ?  13   ARG G H    1 
ATOM   9506  H  HA   . ARG G  1 13 ? 68.749 37.822 -3.015  1.00 96.61  ?  13   ARG G HA   1 
ATOM   9507  H  HB2  . ARG G  1 13 ? 66.775 36.964 -1.998  1.00 106.06 ?  13   ARG G HB2  1 
ATOM   9508  H  HB3  . ARG G  1 13 ? 66.267 36.521 -3.435  1.00 106.06 ?  13   ARG G HB3  1 
ATOM   9509  H  HG2  . ARG G  1 13 ? 68.534 35.302 -3.297  1.00 111.61 ?  13   ARG G HG2  1 
ATOM   9510  H  HG3  . ARG G  1 13 ? 68.030 35.219 -1.792  1.00 111.61 ?  13   ARG G HG3  1 
ATOM   9511  H  HD2  . ARG G  1 13 ? 66.957 33.952 -4.028  1.00 116.02 ?  13   ARG G HD2  1 
ATOM   9512  H  HD3  . ARG G  1 13 ? 67.118 33.373 -2.556  1.00 116.02 ?  13   ARG G HD3  1 
ATOM   9513  H  HE   . ARG G  1 13 ? 65.165 34.310 -2.016  1.00 116.37 ?  13   ARG G HE   1 
ATOM   9514  H  HH11 . ARG G  1 13 ? 65.740 34.880 -5.235  1.00 118.73 ?  13   ARG G HH11 1 
ATOM   9515  H  HH12 . ARG G  1 13 ? 64.348 35.287 -5.571  1.00 118.73 ?  13   ARG G HH12 1 
ATOM   9516  H  HH21 . ARG G  1 13 ? 63.069 34.936 -2.554  1.00 115.33 ?  13   ARG G HH21 1 
ATOM   9517  H  HH22 . ARG G  1 13 ? 62.737 35.320 -3.954  1.00 115.33 ?  13   ARG G HH22 1 
ATOM   9518  N  N    . ASN G  1 14 ? 67.313 37.627 -5.859  1.00 72.07  ?  14   ASN G N    1 
ATOM   9519  C  CA   . ASN G  1 14 ? 67.452 37.226 -7.254  1.00 68.38  ?  14   ASN G CA   1 
ATOM   9520  C  C    . ASN G  1 14 ? 68.465 38.063 -8.030  1.00 61.02  ?  14   ASN G C    1 
ATOM   9521  O  O    . ASN G  1 14 ? 68.565 37.946 -9.250  1.00 62.67  ?  14   ASN G O    1 
ATOM   9522  C  CB   . ASN G  1 14 ? 66.094 37.295 -7.957  1.00 70.98  ?  14   ASN G CB   1 
ATOM   9523  C  CG   . ASN G  1 14 ? 65.467 38.675 -7.883  1.00 69.50  ?  14   ASN G CG   1 
ATOM   9524  O  OD1  . ASN G  1 14 ? 65.791 39.560 -8.675  1.00 67.62  ?  14   ASN G OD1  1 
ATOM   9525  N  ND2  . ASN G  1 14 ? 64.560 38.864 -6.930  1.00 70.25  ?  14   ASN G ND2  1 
ATOM   9526  H  H    . ASN G  1 14 ? 66.585 38.053 -5.691  1.00 86.49  ?  14   ASN G H    1 
ATOM   9527  H  HA   . ASN G  1 14 ? 67.754 36.294 -7.282  1.00 82.06  ?  14   ASN G HA   1 
ATOM   9528  H  HB2  . ASN G  1 14 ? 66.210 37.067 -8.893  1.00 85.17  ?  14   ASN G HB2  1 
ATOM   9529  H  HB3  . ASN G  1 14 ? 65.487 36.666 -7.536  1.00 85.17  ?  14   ASN G HB3  1 
ATOM   9530  H  HD21 . ASN G  1 14 ? 64.357 38.221 -6.396  1.00 84.30  ?  14   ASN G HD21 1 
ATOM   9531  H  HD22 . ASN G  1 14 ? 64.176 39.629 -6.847  1.00 84.30  ?  14   ASN G HD22 1 
ATOM   9532  N  N    . LEU G  1 15 ? 69.217 38.906 -7.329  1.00 55.93  ?  15   LEU G N    1 
ATOM   9533  C  CA   . LEU G  1 15 ? 70.193 39.762 -7.990  1.00 49.83  ?  15   LEU G CA   1 
ATOM   9534  C  C    . LEU G  1 15 ? 71.331 38.946 -8.591  1.00 52.12  ?  15   LEU G C    1 
ATOM   9535  O  O    . LEU G  1 15 ? 71.981 38.157 -7.903  1.00 54.76  ?  15   LEU G O    1 
ATOM   9536  C  CB   . LEU G  1 15 ? 70.763 40.790 -7.012  1.00 44.23  ?  15   LEU G CB   1 
ATOM   9537  C  CG   . LEU G  1 15 ? 71.604 41.892 -7.661  1.00 41.25  ?  15   LEU G CG   1 
ATOM   9538  C  CD1  . LEU G  1 15 ? 70.750 42.736 -8.596  1.00 40.69  ?  15   LEU G CD1  1 
ATOM   9539  C  CD2  . LEU G  1 15 ? 72.265 42.767 -6.607  1.00 38.70  ?  15   LEU G CD2  1 
ATOM   9540  H  H    . LEU G  1 15 ? 69.180 39.001 -6.475  1.00 67.12  ?  15   LEU G H    1 
ATOM   9541  H  HA   . LEU G  1 15 ? 69.752 40.248 -8.717  1.00 59.80  ?  15   LEU G HA   1 
ATOM   9542  H  HB2  . LEU G  1 15 ? 70.027 41.218 -6.548  1.00 53.07  ?  15   LEU G HB2  1 
ATOM   9543  H  HB3  . LEU G  1 15 ? 71.328 40.329 -6.372  1.00 53.07  ?  15   LEU G HB3  1 
ATOM   9544  H  HG   . LEU G  1 15 ? 72.306 41.481 -8.189  1.00 49.50  ?  15   LEU G HG   1 
ATOM   9545  H  HD11 . LEU G  1 15 ? 70.039 43.138 -8.091  1.00 48.83  ?  15   LEU G HD11 1 
ATOM   9546  H  HD12 . LEU G  1 15 ? 71.299 43.419 -8.989  1.00 48.83  ?  15   LEU G HD12 1 
ATOM   9547  H  HD13 . LEU G  1 15 ? 70.387 42.171 -9.282  1.00 48.83  ?  15   LEU G HD13 1 
ATOM   9548  H  HD21 . LEU G  1 15 ? 72.835 42.221 -6.061  1.00 46.44  ?  15   LEU G HD21 1 
ATOM   9549  H  HD22 . LEU G  1 15 ? 72.783 43.446 -7.046  1.00 46.44  ?  15   LEU G HD22 1 
ATOM   9550  H  HD23 . LEU G  1 15 ? 71.584 43.173 -6.066  1.00 46.44  ?  15   LEU G HD23 1 
ATOM   9551  N  N    . ASP G  1 16 ? 71.560 39.142 -9.884  1.00 48.63  ?  16   ASP G N    1 
ATOM   9552  C  CA   . ASP G  1 16 ? 72.702 38.555 -10.566 1.00 50.15  ?  16   ASP G CA   1 
ATOM   9553  C  C    . ASP G  1 16 ? 73.969 38.821 -9.757  1.00 52.66  ?  16   ASP G C    1 
ATOM   9554  O  O    . ASP G  1 16 ? 74.355 39.975 -9.573  1.00 50.21  ?  16   ASP G O    1 
ATOM   9555  C  CB   . ASP G  1 16 ? 72.831 39.169 -11.962 1.00 48.75  ?  16   ASP G CB   1 
ATOM   9556  C  CG   . ASP G  1 16 ? 74.022 38.637 -12.729 1.00 49.98  ?  16   ASP G CG   1 
ATOM   9557  O  OD1  . ASP G  1 16 ? 74.833 37.898 -12.137 1.00 50.97  ?  16   ASP G OD1  1 
ATOM   9558  O  OD2  . ASP G  1 16 ? 74.153 38.966 -13.927 1.00 50.69  ?  16   ASP G OD2  1 
ATOM   9559  H  H    . ASP G  1 16 ? 71.059 39.620 -10.395 1.00 58.36  ?  16   ASP G H    1 
ATOM   9560  H  HA   . ASP G  1 16 ? 72.577 37.586 -10.655 1.00 60.18  ?  16   ASP G HA   1 
ATOM   9561  H  HB2  . ASP G  1 16 ? 72.031 38.967 -12.472 1.00 58.49  ?  16   ASP G HB2  1 
ATOM   9562  H  HB3  . ASP G  1 16 ? 72.935 40.130 -11.876 1.00 58.49  ?  16   ASP G HB3  1 
ATOM   9563  N  N    . PRO G  1 17 ? 74.625 37.756 -9.270  1.00 53.70  ?  17   PRO G N    1 
ATOM   9564  C  CA   . PRO G  1 17 ? 75.820 37.946 -8.439  1.00 52.89  ?  17   PRO G CA   1 
ATOM   9565  C  C    . PRO G  1 17 ? 76.910 38.727 -9.165  1.00 52.71  ?  17   PRO G C    1 
ATOM   9566  O  O    . PRO G  1 17 ? 77.714 39.404 -8.525  1.00 53.84  ?  17   PRO G O    1 
ATOM   9567  C  CB   . PRO G  1 17 ? 76.283 36.514 -8.149  1.00 54.51  ?  17   PRO G CB   1 
ATOM   9568  C  CG   . PRO G  1 17 ? 75.679 35.686 -9.228  1.00 57.62  ?  17   PRO G CG   1 
ATOM   9569  C  CD   . PRO G  1 17 ? 74.370 36.333 -9.549  1.00 57.44  ?  17   PRO G CD   1 
ATOM   9570  H  HA   . PRO G  1 17 ? 75.592 38.396 -7.599  1.00 63.47  ?  17   PRO G HA   1 
ATOM   9571  H  HB2  . PRO G  1 17 ? 77.251 36.469 -8.184  1.00 65.41  ?  17   PRO G HB2  1 
ATOM   9572  H  HB3  . PRO G  1 17 ? 75.957 36.235 -7.279  1.00 65.41  ?  17   PRO G HB3  1 
ATOM   9573  H  HG2  . PRO G  1 17 ? 76.261 35.688 -10.004 1.00 69.14  ?  17   PRO G HG2  1 
ATOM   9574  H  HG3  . PRO G  1 17 ? 75.542 34.781 -8.906  1.00 69.14  ?  17   PRO G HG3  1 
ATOM   9575  H  HD2  . PRO G  1 17 ? 74.149 36.206 -10.485 1.00 68.92  ?  17   PRO G HD2  1 
ATOM   9576  H  HD3  . PRO G  1 17 ? 73.671 35.994 -8.968  1.00 68.92  ?  17   PRO G HD3  1 
ATOM   9577  N  N    . ARG G  1 18 ? 76.930 38.629 -10.489 1.00 48.05  ?  18   ARG G N    1 
ATOM   9578  C  CA   . ARG G  1 18 ? 77.869 39.394 -11.298 1.00 47.55  ?  18   ARG G CA   1 
ATOM   9579  C  C    . ARG G  1 18 ? 77.552 40.880 -11.185 1.00 45.61  ?  18   ARG G C    1 
ATOM   9580  O  O    . ARG G  1 18 ? 78.451 41.715 -11.083 1.00 44.62  ?  18   ARG G O    1 
ATOM   9581  C  CB   . ARG G  1 18 ? 77.791 38.953 -12.758 1.00 51.56  ?  18   ARG G CB   1 
ATOM   9582  C  CG   . ARG G  1 18 ? 78.596 39.821 -13.711 1.00 53.41  ?  18   ARG G CG   1 
ATOM   9583  C  CD   . ARG G  1 18 ? 78.422 39.364 -15.148 1.00 56.72  ?  18   ARG G CD   1 
ATOM   9584  N  NE   . ARG G  1 18 ? 79.096 38.095 -15.406 1.00 57.36  ?  18   ARG G NE   1 
ATOM   9585  C  CZ   . ARG G  1 18 ? 79.016 37.425 -16.551 1.00 60.05  ?  18   ARG G CZ   1 
ATOM   9586  N  NH1  . ARG G  1 18 ? 78.284 37.897 -17.551 1.00 62.56  ?  18   ARG G NH1  1 
ATOM   9587  N  NH2  . ARG G  1 18 ? 79.667 36.279 -16.695 1.00 61.36  ?  18   ARG G NH2  1 
ATOM   9588  H  H    . ARG G  1 18 ? 76.407 38.122 -10.946 1.00 57.66  ?  18   ARG G H    1 
ATOM   9589  H  HA   . ARG G  1 18 ? 78.781 39.243 -10.973 1.00 57.06  ?  18   ARG G HA   1 
ATOM   9590  H  HB2  . ARG G  1 18 ? 78.129 38.047 -12.829 1.00 61.88  ?  18   ARG G HB2  1 
ATOM   9591  H  HB3  . ARG G  1 18 ? 76.865 38.982 -13.044 1.00 61.88  ?  18   ARG G HB3  1 
ATOM   9592  H  HG2  . ARG G  1 18 ? 78.291 40.740 -13.644 1.00 64.09  ?  18   ARG G HG2  1 
ATOM   9593  H  HG3  . ARG G  1 18 ? 79.537 39.761 -13.483 1.00 64.09  ?  18   ARG G HG3  1 
ATOM   9594  H  HD2  . ARG G  1 18 ? 77.477 39.247 -15.332 1.00 68.07  ?  18   ARG G HD2  1 
ATOM   9595  H  HD3  . ARG G  1 18 ? 78.798 40.032 -15.742 1.00 68.07  ?  18   ARG G HD3  1 
ATOM   9596  H  HE   . ARG G  1 18 ? 79.575 37.759 -14.776 1.00 68.84  ?  18   ARG G HE   1 
ATOM   9597  H  HH11 . ARG G  1 18 ? 77.861 38.640 -17.461 1.00 75.07  ?  18   ARG G HH11 1 
ATOM   9598  H  HH12 . ARG G  1 18 ? 78.233 37.460 -18.291 1.00 75.07  ?  18   ARG G HH12 1 
ATOM   9599  H  HH21 . ARG G  1 18 ? 80.141 35.970 -16.048 1.00 73.63  ?  18   ARG G HH21 1 
ATOM   9600  H  HH22 . ARG G  1 18 ? 79.613 35.845 -17.435 1.00 73.63  ?  18   ARG G HH22 1 
ATOM   9601  N  N    . GLU G  1 19 ? 76.263 41.202 -11.208 1.00 46.99  ?  19   GLU G N    1 
ATOM   9602  C  CA   . GLU G  1 19 ? 75.813 42.578 -11.058 1.00 47.27  ?  19   GLU G CA   1 
ATOM   9603  C  C    . GLU G  1 19 ? 76.112 43.083 -9.650  1.00 44.69  ?  19   GLU G C    1 
ATOM   9604  O  O    . GLU G  1 19 ? 76.551 44.219 -9.470  1.00 42.19  ?  19   GLU G O    1 
ATOM   9605  C  CB   . GLU G  1 19 ? 74.314 42.680 -11.351 1.00 49.87  ?  19   GLU G CB   1 
ATOM   9606  C  CG   . GLU G  1 19 ? 73.705 44.042 -11.054 1.00 52.28  ?  19   GLU G CG   1 
ATOM   9607  C  CD   . GLU G  1 19 ? 74.349 45.159 -11.848 1.00 57.81  ?  19   GLU G CD   1 
ATOM   9608  O  OE1  . GLU G  1 19 ? 75.059 44.863 -12.832 1.00 63.62  ?  19   GLU G OE1  1 
ATOM   9609  O  OE2  . GLU G  1 19 ? 74.144 46.337 -11.486 1.00 56.80  ?  19   GLU G OE2  1 
ATOM   9610  H  H    . GLU G  1 19 ? 75.624 40.635 -11.311 1.00 56.39  ?  19   GLU G H    1 
ATOM   9611  H  HA   . GLU G  1 19 ? 76.291 43.147 -11.698 1.00 56.72  ?  19   GLU G HA   1 
ATOM   9612  H  HB2  . GLU G  1 19 ? 74.168 42.491 -12.291 1.00 59.85  ?  19   GLU G HB2  1 
ATOM   9613  H  HB3  . GLU G  1 19 ? 73.847 42.025 -10.810 1.00 59.85  ?  19   GLU G HB3  1 
ATOM   9614  H  HG2  . GLU G  1 19 ? 72.761 44.021 -11.277 1.00 62.73  ?  19   GLU G HG2  1 
ATOM   9615  H  HG3  . GLU G  1 19 ? 73.819 44.239 -10.112 1.00 62.73  ?  19   GLU G HG3  1 
ATOM   9616  N  N    . GLU G  1 20 ? 75.875 42.235 -8.655  1.00 53.44  ?  20   GLU G N    1 
ATOM   9617  C  CA   . GLU G  1 20 ? 76.139 42.602 -7.270  1.00 51.97  ?  20   GLU G CA   1 
ATOM   9618  C  C    . GLU G  1 20 ? 77.600 42.997 -7.085  1.00 51.42  ?  20   GLU G C    1 
ATOM   9619  O  O    . GLU G  1 20 ? 77.903 43.984 -6.417  1.00 50.53  ?  20   GLU G O    1 
ATOM   9620  C  CB   . GLU G  1 20 ? 75.784 41.454 -6.321  1.00 50.86  ?  20   GLU G CB   1 
ATOM   9621  C  CG   . GLU G  1 20 ? 76.179 41.718 -4.875  1.00 48.39  ?  20   GLU G CG   1 
ATOM   9622  C  CD   . GLU G  1 20 ? 75.480 40.798 -3.889  1.00 48.85  ?  20   GLU G CD   1 
ATOM   9623  O  OE1  . GLU G  1 20 ? 74.471 40.165 -4.267  1.00 51.23  ?  20   GLU G OE1  1 
ATOM   9624  O  OE2  . GLU G  1 20 ? 75.939 40.712 -2.730  1.00 47.86  ?  20   GLU G OE2  1 
ATOM   9625  H  H    . GLU G  1 20 ? 75.561 41.441 -8.755  1.00 64.13  ?  20   GLU G H    1 
ATOM   9626  H  HA   . GLU G  1 20 ? 75.584 43.375 -7.033  1.00 62.36  ?  20   GLU G HA   1 
ATOM   9627  H  HB2  . GLU G  1 20 ? 74.824 41.312 -6.347  1.00 61.03  ?  20   GLU G HB2  1 
ATOM   9628  H  HB3  . GLU G  1 20 ? 76.244 40.652 -6.614  1.00 61.03  ?  20   GLU G HB3  1 
ATOM   9629  H  HG2  . GLU G  1 20 ? 77.135 41.586 -4.781  1.00 58.06  ?  20   GLU G HG2  1 
ATOM   9630  H  HG3  . GLU G  1 20 ? 75.947 42.632 -4.646  1.00 58.06  ?  20   GLU G HG3  1 
ATOM   9631  N  N    . GLU G  1 21 ? 78.502 42.225 -7.683  1.00 48.57  ?  21   GLU G N    1 
ATOM   9632  C  CA   . GLU G  1 21 ? 79.929 42.503 -7.567  1.00 47.98  ?  21   GLU G CA   1 
ATOM   9633  C  C    . GLU G  1 21 ? 80.315 43.790 -8.288  1.00 45.82  ?  21   GLU G C    1 
ATOM   9634  O  O    . GLU G  1 21 ? 81.190 44.524 -7.828  1.00 45.26  ?  21   GLU G O    1 
ATOM   9635  C  CB   . GLU G  1 21 ? 80.755 41.329 -8.097  1.00 52.87  ?  21   GLU G CB   1 
ATOM   9636  C  CG   . GLU G  1 21 ? 80.931 40.210 -7.087  1.00 55.09  ?  21   GLU G CG   1 
ATOM   9637  C  CD   . GLU G  1 21 ? 81.539 40.700 -5.783  1.00 55.81  ?  21   GLU G CD   1 
ATOM   9638  O  OE1  . GLU G  1 21 ? 82.511 41.484 -5.837  1.00 57.19  ?  21   GLU G OE1  1 
ATOM   9639  O  OE2  . GLU G  1 21 ? 81.036 40.312 -4.706  1.00 54.80  ?  21   GLU G OE2  1 
ATOM   9640  H  H    . GLU G  1 21 ? 78.314 41.536 -8.162  1.00 58.28  ?  21   GLU G H    1 
ATOM   9641  H  HA   . GLU G  1 21 ? 80.149 42.617 -6.619  1.00 57.58  ?  21   GLU G HA   1 
ATOM   9642  H  HB2  . GLU G  1 21 ? 80.311 40.960 -8.876  1.00 63.44  ?  21   GLU G HB2  1 
ATOM   9643  H  HB3  . GLU G  1 21 ? 81.637 41.651 -8.342  1.00 63.44  ?  21   GLU G HB3  1 
ATOM   9644  H  HG2  . GLU G  1 21 ? 80.065 39.822 -6.888  1.00 66.11  ?  21   GLU G HG2  1 
ATOM   9645  H  HG3  . GLU G  1 21 ? 81.521 39.536 -7.459  1.00 66.11  ?  21   GLU G HG3  1 
ATOM   9646  N  N    . ARG G  1 22 ? 79.665 44.063 -9.414  1.00 42.41  ?  22   ARG G N    1 
ATOM   9647  C  CA   . ARG G  1 22 ? 79.913 45.302 -10.136 1.00 44.47  ?  22   ARG G CA   1 
ATOM   9648  C  C    . ARG G  1 22 ? 79.478 46.485 -9.283  1.00 41.89  ?  22   ARG G C    1 
ATOM   9649  O  O    . ARG G  1 22 ? 80.163 47.504 -9.227  1.00 42.21  ?  22   ARG G O    1 
ATOM   9650  C  CB   . ARG G  1 22 ? 79.168 45.326 -11.473 1.00 50.58  ?  22   ARG G CB   1 
ATOM   9651  C  CG   . ARG G  1 22 ? 79.522 46.534 -12.330 1.00 55.85  ?  22   ARG G CG   1 
ATOM   9652  C  CD   . ARG G  1 22 ? 78.623 46.668 -13.550 1.00 61.97  ?  22   ARG G CD   1 
ATOM   9653  N  NE   . ARG G  1 22 ? 77.242 46.987 -13.195 1.00 62.95  ?  22   ARG G NE   1 
ATOM   9654  C  CZ   . ARG G  1 22 ? 76.825 48.184 -12.790 1.00 62.83  ?  22   ARG G CZ   1 
ATOM   9655  N  NH1  . ARG G  1 22 ? 77.679 49.192 -12.670 1.00 62.03  ?  22   ARG G NH1  1 
ATOM   9656  N  NH2  . ARG G  1 22 ? 75.547 48.374 -12.493 1.00 63.28  ?  22   ARG G NH2  1 
ATOM   9657  H  H    . ARG G  1 22 ? 79.078 43.550 -9.778  1.00 50.90  ?  22   ARG G H    1 
ATOM   9658  H  HA   . ARG G  1 22 ? 80.873 45.386 -10.316 1.00 53.37  ?  22   ARG G HA   1 
ATOM   9659  H  HB2  . ARG G  1 22 ? 79.394 44.527 -11.974 1.00 60.69  ?  22   ARG G HB2  1 
ATOM   9660  H  HB3  . ARG G  1 22 ? 78.214 45.350 -11.301 1.00 60.69  ?  22   ARG G HB3  1 
ATOM   9661  H  HG2  . ARG G  1 22 ? 79.427 47.339 -11.797 1.00 67.02  ?  22   ARG G HG2  1 
ATOM   9662  H  HG3  . ARG G  1 22 ? 80.437 46.446 -12.639 1.00 67.02  ?  22   ARG G HG3  1 
ATOM   9663  H  HD2  . ARG G  1 22 ? 78.960 47.381 -14.116 1.00 74.37  ?  22   ARG G HD2  1 
ATOM   9664  H  HD3  . ARG G  1 22 ? 78.623 45.829 -14.037 1.00 74.37  ?  22   ARG G HD3  1 
ATOM   9665  H  HE   . ARG G  1 22 ? 76.659 46.357 -13.252 1.00 75.54  ?  22   ARG G HE   1 
ATOM   9666  H  HH11 . ARG G  1 22 ? 78.510 49.077 -12.861 1.00 74.44  ?  22   ARG G HH11 1 
ATOM   9667  H  HH12 . ARG G  1 22 ? 77.401 49.962 -12.406 1.00 74.44  ?  22   ARG G HH12 1 
ATOM   9668  H  HH21 . ARG G  1 22 ? 74.988 47.725 -12.566 1.00 75.93  ?  22   ARG G HH21 1 
ATOM   9669  H  HH22 . ARG G  1 22 ? 75.278 49.146 -12.228 1.00 75.93  ?  22   ARG G HH22 1 
ATOM   9670  N  N    . LEU G  1 23 ? 78.335 46.342 -8.619  1.00 44.12  ?  23   LEU G N    1 
ATOM   9671  C  CA   . LEU G  1 23 ? 77.812 47.398 -7.759  1.00 41.53  ?  23   LEU G CA   1 
ATOM   9672  C  C    . LEU G  1 23 ? 78.745 47.673 -6.584  1.00 37.86  ?  23   LEU G C    1 
ATOM   9673  O  O    . LEU G  1 23 ? 79.050 48.829 -6.293  1.00 35.42  ?  23   LEU G O    1 
ATOM   9674  C  CB   . LEU G  1 23 ? 76.415 47.038 -7.249  1.00 41.53  ?  23   LEU G CB   1 
ATOM   9675  C  CG   . LEU G  1 23 ? 75.263 47.262 -8.231  1.00 44.02  ?  23   LEU G CG   1 
ATOM   9676  C  CD1  . LEU G  1 23 ? 73.983 46.642 -7.697  1.00 44.53  ?  23   LEU G CD1  1 
ATOM   9677  C  CD2  . LEU G  1 23 ? 75.062 48.747 -8.502  1.00 44.08  ?  23   LEU G CD2  1 
ATOM   9678  H  H    . LEU G  1 23 ? 77.841 45.639 -8.649  1.00 52.94  ?  23   LEU G H    1 
ATOM   9679  H  HA   . LEU G  1 23 ? 77.737 48.224 -8.283  1.00 49.84  ?  23   LEU G HA   1 
ATOM   9680  H  HB2  . LEU G  1 23 ? 76.411 46.099 -7.008  1.00 49.84  ?  23   LEU G HB2  1 
ATOM   9681  H  HB3  . LEU G  1 23 ? 76.231 47.573 -6.461  1.00 49.84  ?  23   LEU G HB3  1 
ATOM   9682  H  HG   . LEU G  1 23 ? 75.477 46.830 -9.073  1.00 52.82  ?  23   LEU G HG   1 
ATOM   9683  H  HD11 . LEU G  1 23 ? 73.765 47.051 -6.856  1.00 53.44  ?  23   LEU G HD11 1 
ATOM   9684  H  HD12 . LEU G  1 23 ? 73.275 46.795 -8.328  1.00 53.44  ?  23   LEU G HD12 1 
ATOM   9685  H  HD13 . LEU G  1 23 ? 74.118 45.700 -7.578  1.00 53.44  ?  23   LEU G HD13 1 
ATOM   9686  H  HD21 . LEU G  1 23 ? 75.869 49.108 -8.877  1.00 52.90  ?  23   LEU G HD21 1 
ATOM   9687  H  HD22 . LEU G  1 23 ? 74.335 48.856 -9.120  1.00 52.90  ?  23   LEU G HD22 1 
ATOM   9688  H  HD23 . LEU G  1 23 ? 74.858 49.190 -7.675  1.00 52.90  ?  23   LEU G HD23 1 
ATOM   9689  N  N    . LYS G  1 24 ? 79.196 46.617 -5.911  1.00 40.35  ?  24   LYS G N    1 
ATOM   9690  C  CA   . LYS G  1 24 ? 80.137 46.775 -4.806  1.00 39.27  ?  24   LYS G CA   1 
ATOM   9691  C  C    . LYS G  1 24 ? 81.364 47.541 -5.279  1.00 36.54  ?  24   LYS G C    1 
ATOM   9692  O  O    . LYS G  1 24 ? 81.829 48.463 -4.610  1.00 35.10  ?  24   LYS G O    1 
ATOM   9693  C  CB   . LYS G  1 24 ? 80.581 45.420 -4.252  1.00 41.59  ?  24   LYS G CB   1 
ATOM   9694  C  CG   . LYS G  1 24 ? 79.508 44.630 -3.519  1.00 43.22  ?  24   LYS G CG   1 
ATOM   9695  C  CD   . LYS G  1 24 ? 80.139 43.485 -2.733  1.00 46.84  ?  24   LYS G CD   1 
ATOM   9696  C  CE   . LYS G  1 24 ? 79.165 42.338 -2.497  1.00 50.60  ?  24   LYS G CE   1 
ATOM   9697  N  NZ   . LYS G  1 24 ? 77.956 42.750 -1.729  1.00 51.62  ?  24   LYS G NZ   1 
ATOM   9698  H  H    . LYS G  1 24 ? 78.973 45.802 -6.073  1.00 48.42  ?  24   LYS G H    1 
ATOM   9699  H  HA   . LYS G  1 24 ? 79.712 47.283 -4.084  1.00 47.12  ?  24   LYS G HA   1 
ATOM   9700  H  HB2  . LYS G  1 24 ? 80.891 44.873 -4.991  1.00 49.90  ?  24   LYS G HB2  1 
ATOM   9701  H  HB3  . LYS G  1 24 ? 81.310 45.567 -3.629  1.00 49.90  ?  24   LYS G HB3  1 
ATOM   9702  H  HG2  . LYS G  1 24 ? 79.045 45.213 -2.897  1.00 51.86  ?  24   LYS G HG2  1 
ATOM   9703  H  HG3  . LYS G  1 24 ? 78.885 44.256 -4.162  1.00 51.86  ?  24   LYS G HG3  1 
ATOM   9704  H  HD2  . LYS G  1 24 ? 80.897 43.139 -3.229  1.00 56.21  ?  24   LYS G HD2  1 
ATOM   9705  H  HD3  . LYS G  1 24 ? 80.430 43.816 -1.869  1.00 56.21  ?  24   LYS G HD3  1 
ATOM   9706  H  HE2  . LYS G  1 24 ? 78.872 41.992 -3.354  1.00 60.72  ?  24   LYS G HE2  1 
ATOM   9707  H  HE3  . LYS G  1 24 ? 79.616 41.641 -1.994  1.00 60.72  ?  24   LYS G HE3  1 
ATOM   9708  H  HZ1  . LYS G  1 24 ? 77.517 43.385 -2.172  1.00 61.95  ?  24   LYS G HZ1  1 
ATOM   9709  H  HZ2  . LYS G  1 24 ? 77.417 42.051 -1.615  1.00 61.95  ?  24   LYS G HZ2  1 
ATOM   9710  H  HZ3  . LYS G  1 24 ? 78.195 43.065 -0.932  1.00 61.95  ?  24   LYS G HZ3  1 
ATOM   9711  N  N    . ALA G  1 25 ? 81.883 47.148 -6.438  1.00 33.15  ?  25   ALA G N    1 
ATOM   9712  C  CA   . ALA G  1 25 ? 83.092 47.748 -6.987  1.00 33.26  ?  25   ALA G CA   1 
ATOM   9713  C  C    . ALA G  1 25 ? 82.874 49.218 -7.325  1.00 32.67  ?  25   ALA G C    1 
ATOM   9714  O  O    . ALA G  1 25 ? 83.726 50.060 -7.038  1.00 30.10  ?  25   ALA G O    1 
ATOM   9715  C  CB   . ALA G  1 25 ? 83.541 46.984 -8.225  1.00 37.34  ?  25   ALA G CB   1 
ATOM   9716  H  H    . ALA G  1 25 ? 81.548 46.527 -6.931  1.00 39.78  ?  25   ALA G H    1 
ATOM   9717  H  HA   . ALA G  1 25 ? 83.808 47.693 -6.320  1.00 39.91  ?  25   ALA G HA   1 
ATOM   9718  H  HB1  . ALA G  1 25 ? 82.842 47.017 -8.882  1.00 44.80  ?  25   ALA G HB1  1 
ATOM   9719  H  HB2  . ALA G  1 25 ? 84.337 47.393 -8.572  1.00 44.80  ?  25   ALA G HB2  1 
ATOM   9720  H  HB3  . ALA G  1 25 ? 83.720 46.073 -7.981  1.00 44.80  ?  25   ALA G HB3  1 
ATOM   9721  N  N    . SER G  1 26 ? 81.734 49.520 -7.939  1.00 34.97  ?  26   SER G N    1 
ATOM   9722  C  CA   . SER G  1 26 ? 81.414 50.889 -8.331  1.00 37.75  ?  26   SER G CA   1 
ATOM   9723  C  C    . SER G  1 26 ? 81.238 51.761 -7.097  1.00 33.13  ?  26   SER G C    1 
ATOM   9724  O  O    . SER G  1 26 ? 81.748 52.877 -7.038  1.00 32.72  ?  26   SER G O    1 
ATOM   9725  C  CB   . SER G  1 26 ? 80.137 50.926 -9.172  1.00 42.74  ?  26   SER G CB   1 
ATOM   9726  O  OG   . SER G  1 26 ? 80.241 50.074 -10.299 1.00 48.68  ?  26   SER G OG   1 
ATOM   9727  H  H    . SER G  1 26 ? 81.125 48.947 -8.141  1.00 41.97  ?  26   SER G H    1 
ATOM   9728  H  HA   . SER G  1 26 ? 82.149 51.255 -8.866  1.00 45.30  ?  26   SER G HA   1 
ATOM   9729  H  HB2  . SER G  1 26 ? 79.391 50.634 -8.624  1.00 51.28  ?  26   SER G HB2  1 
ATOM   9730  H  HB3  . SER G  1 26 ? 79.987 51.835 -9.477  1.00 51.28  ?  26   SER G HB3  1 
ATOM   9731  H  HG   . SER G  1 26 ? 80.974 49.706 -10.306 1.00 58.42  ?  26   SER G HG   1 
ATOM   9732  N  N    . ALA G  1 27 ? 80.509 51.241 -6.115  1.00 33.16  ?  27   ALA G N    1 
ATOM   9733  C  CA   . ALA G  1 27 ? 80.270 51.961 -4.872  1.00 30.77  ?  27   ALA G CA   1 
ATOM   9734  C  C    . ALA G  1 27 ? 81.591 52.290 -4.185  1.00 33.40  ?  27   ALA G C    1 
ATOM   9735  O  O    . ALA G  1 27 ? 81.799 53.410 -3.720  1.00 31.11  ?  27   ALA G O    1 
ATOM   9736  C  CB   . ALA G  1 27 ? 79.386 51.139 -3.950  1.00 28.22  ?  27   ALA G CB   1 
ATOM   9737  H  H    . ALA G  1 27 ? 80.139 50.465 -6.145  1.00 39.80  ?  27   ALA G H    1 
ATOM   9738  H  HA   . ALA G  1 27 ? 79.809 52.803 -5.069  1.00 36.92  ?  27   ALA G HA   1 
ATOM   9739  H  HB1  . ALA G  1 27 ? 79.824 50.307 -3.756  1.00 33.86  ?  27   ALA G HB1  1 
ATOM   9740  H  HB2  . ALA G  1 27 ? 79.240 51.629 -3.138  1.00 33.86  ?  27   ALA G HB2  1 
ATOM   9741  H  HB3  . ALA G  1 27 ? 78.547 50.973 -4.387  1.00 33.86  ?  27   ALA G HB3  1 
ATOM   9742  N  N    . LYS G  1 28 ? 82.485 51.311 -4.126  1.00 41.63  ?  28   LYS G N    1 
ATOM   9743  C  CA   . LYS G  1 28 ? 83.777 51.507 -3.482  1.00 44.41  ?  28   LYS G CA   1 
ATOM   9744  C  C    . LYS G  1 28 ? 84.561 52.615 -4.178  1.00 43.94  ?  28   LYS G C    1 
ATOM   9745  O  O    . LYS G  1 28 ? 85.180 53.452 -3.522  1.00 46.63  ?  28   LYS G O    1 
ATOM   9746  C  CB   . LYS G  1 28 ? 84.584 50.207 -3.484  1.00 47.27  ?  28   LYS G CB   1 
ATOM   9747  C  CG   . LYS G  1 28 ? 85.900 50.308 -2.730  1.00 49.33  ?  28   LYS G CG   1 
ATOM   9748  C  CD   . LYS G  1 28 ? 86.524 48.942 -2.492  1.00 53.11  ?  28   LYS G CD   1 
ATOM   9749  C  CE   . LYS G  1 28 ? 87.831 49.063 -1.722  1.00 57.39  ?  28   LYS G CE   1 
ATOM   9750  N  NZ   . LYS G  1 28 ? 88.351 47.741 -1.276  1.00 60.97  ?  28   LYS G NZ   1 
ATOM   9751  H  H    . LYS G  1 28 ? 82.368 50.523 -4.451  1.00 49.95  ?  28   LYS G H    1 
ATOM   9752  H  HA   . LYS G  1 28 ? 83.633 51.775 -2.551  1.00 53.29  ?  28   LYS G HA   1 
ATOM   9753  H  HB2  . LYS G  1 28 ? 84.055 49.510 -3.066  1.00 56.73  ?  28   LYS G HB2  1 
ATOM   9754  H  HB3  . LYS G  1 28 ? 84.785 49.964 -4.401  1.00 56.73  ?  28   LYS G HB3  1 
ATOM   9755  H  HG2  . LYS G  1 28 ? 86.524 50.840 -3.248  1.00 59.20  ?  28   LYS G HG2  1 
ATOM   9756  H  HG3  . LYS G  1 28 ? 85.742 50.723 -1.867  1.00 59.20  ?  28   LYS G HG3  1 
ATOM   9757  H  HD2  . LYS G  1 28 ? 85.914 48.395 -1.973  1.00 63.73  ?  28   LYS G HD2  1 
ATOM   9758  H  HD3  . LYS G  1 28 ? 86.711 48.521 -3.346  1.00 63.73  ?  28   LYS G HD3  1 
ATOM   9759  H  HE2  . LYS G  1 28 ? 88.499 49.473 -2.293  1.00 68.87  ?  28   LYS G HE2  1 
ATOM   9760  H  HE3  . LYS G  1 28 ? 87.685 49.610 -0.934  1.00 68.87  ?  28   LYS G HE3  1 
ATOM   9761  H  HZ1  . LYS G  1 28 ? 88.500 47.219 -1.982  1.00 73.16  ?  28   LYS G HZ1  1 
ATOM   9762  H  HZ2  . LYS G  1 28 ? 89.114 47.849 -0.830  1.00 73.16  ?  28   LYS G HZ2  1 
ATOM   9763  H  HZ3  . LYS G  1 28 ? 87.758 47.345 -0.743  1.00 73.16  ?  28   LYS G HZ3  1 
ATOM   9764  N  N    . ALA G  1 29 ? 84.525 52.622 -5.506  1.00 35.79  ?  29   ALA G N    1 
ATOM   9765  C  CA   . ALA G  1 29 ? 85.247 53.623 -6.284  1.00 35.34  ?  29   ALA G CA   1 
ATOM   9766  C  C    . ALA G  1 29 ? 84.605 55.000 -6.137  1.00 34.12  ?  29   ALA G C    1 
ATOM   9767  O  O    . ALA G  1 29 ? 85.299 56.011 -6.021  1.00 33.51  ?  29   ALA G O    1 
ATOM   9768  C  CB   . ALA G  1 29 ? 85.295 53.219 -7.750  1.00 37.73  ?  29   ALA G CB   1 
ATOM   9769  H  H    . ALA G  1 29 ? 84.088 52.056 -5.983  1.00 42.95  ?  29   ALA G H    1 
ATOM   9770  H  HA   . ALA G  1 29 ? 86.168 53.681 -5.955  1.00 42.41  ?  29   ALA G HA   1 
ATOM   9771  H  HB1  . ALA G  1 29 ? 84.398 53.145 -8.083  1.00 45.27  ?  29   ALA G HB1  1 
ATOM   9772  H  HB2  . ALA G  1 29 ? 85.774 53.890 -8.243  1.00 45.27  ?  29   ALA G HB2  1 
ATOM   9773  H  HB3  . ALA G  1 29 ? 85.744 52.374 -7.826  1.00 45.27  ?  29   ALA G HB3  1 
ATOM   9774  N  N    . ARG G  1 30 ? 83.277 55.033 -6.146  1.00 34.40  ?  30   ARG G N    1 
ATOM   9775  C  CA   . ARG G  1 30 ? 82.550 56.291 -6.046  1.00 34.12  ?  30   ARG G CA   1 
ATOM   9776  C  C    . ARG G  1 30 ? 82.772 56.936 -4.682  1.00 30.48  ?  30   ARG G C    1 
ATOM   9777  O  O    . ARG G  1 30 ? 83.026 58.137 -4.592  1.00 29.21  ?  30   ARG G O    1 
ATOM   9778  C  CB   . ARG G  1 30 ? 81.055 56.069 -6.293  1.00 36.21  ?  30   ARG G CB   1 
ATOM   9779  C  CG   . ARG G  1 30 ? 80.206 57.327 -6.162  1.00 38.81  ?  30   ARG G CG   1 
ATOM   9780  C  CD   . ARG G  1 30 ? 80.708 58.443 -7.069  1.00 44.08  ?  30   ARG G CD   1 
ATOM   9781  N  NE   . ARG G  1 30 ? 79.835 59.614 -7.030  1.00 45.78  ?  30   ARG G NE   1 
ATOM   9782  C  CZ   . ARG G  1 30 ? 80.224 60.857 -7.301  1.00 47.13  ?  30   ARG G CZ   1 
ATOM   9783  N  NH1  . ARG G  1 30 ? 81.482 61.116 -7.630  1.00 49.25  ?  30   ARG G NH1  1 
ATOM   9784  N  NH2  . ARG G  1 30 ? 79.349 61.851 -7.236  1.00 45.58  ?  30   ARG G NH2  1 
ATOM   9785  H  H    . ARG G  1 30 ? 82.772 54.339 -6.210  1.00 41.28  ?  30   ARG G H    1 
ATOM   9786  H  HA   . ARG G  1 30 ? 82.882 56.908 -6.731  1.00 40.94  ?  30   ARG G HA   1 
ATOM   9787  H  HB2  . ARG G  1 30 ? 80.936 55.725 -7.192  1.00 43.46  ?  30   ARG G HB2  1 
ATOM   9788  H  HB3  . ARG G  1 30 ? 80.726 55.423 -5.649  1.00 43.46  ?  30   ARG G HB3  1 
ATOM   9789  H  HG2  . ARG G  1 30 ? 79.291 57.123 -6.411  1.00 46.57  ?  30   ARG G HG2  1 
ATOM   9790  H  HG3  . ARG G  1 30 ? 80.242 57.643 -5.245  1.00 46.57  ?  30   ARG G HG3  1 
ATOM   9791  H  HD2  . ARG G  1 30 ? 81.593 58.715 -6.779  1.00 52.90  ?  30   ARG G HD2  1 
ATOM   9792  H  HD3  . ARG G  1 30 ? 80.741 58.120 -7.983  1.00 52.90  ?  30   ARG G HD3  1 
ATOM   9793  H  HE   . ARG G  1 30 ? 79.011 59.491 -6.817  1.00 54.93  ?  30   ARG G HE   1 
ATOM   9794  H  HH11 . ARG G  1 30 ? 82.056 60.477 -7.674  1.00 59.10  ?  30   ARG G HH11 1 
ATOM   9795  H  HH12 . ARG G  1 30 ? 81.724 61.923 -7.802  1.00 59.10  ?  30   ARG G HH12 1 
ATOM   9796  H  HH21 . ARG G  1 30 ? 78.532 61.691 -7.022  1.00 54.69  ?  30   ARG G HH21 1 
ATOM   9797  H  HH22 . ARG G  1 30 ? 79.599 62.655 -7.409  1.00 54.69  ?  30   ARG G HH22 1 
ATOM   9798  N  N    . SER G  1 31 ? 82.685 56.140 -3.620  1.00 33.13  ?  31   SER G N    1 
ATOM   9799  C  CA   . SER G  1 31 ? 82.870 56.668 -2.273  1.00 32.54  ?  31   SER G CA   1 
ATOM   9800  C  C    . SER G  1 31 ? 84.324 57.074 -2.031  1.00 32.69  ?  31   SER G C    1 
ATOM   9801  O  O    . SER G  1 31 ? 84.591 58.026 -1.300  1.00 30.15  ?  31   SER G O    1 
ATOM   9802  C  CB   . SER G  1 31 ? 82.397 55.666 -1.211  1.00 34.30  ?  31   SER G CB   1 
ATOM   9803  O  OG   . SER G  1 31 ? 83.158 54.471 -1.228  1.00 37.67  ?  31   SER G OG   1 
ATOM   9804  H  H    . SER G  1 31 ? 82.520 55.297 -3.653  1.00 39.75  ?  31   SER G H    1 
ATOM   9805  H  HA   . SER G  1 31 ? 82.321 57.475 -2.179  1.00 39.05  ?  31   SER G HA   1 
ATOM   9806  H  HB2  . SER G  1 31 ? 82.481 56.076 -0.336  1.00 41.16  ?  31   SER G HB2  1 
ATOM   9807  H  HB3  . SER G  1 31 ? 81.468 55.446 -1.382  1.00 41.16  ?  31   SER G HB3  1 
ATOM   9808  H  HG   . SER G  1 31 ? 83.733 54.513 -1.811  1.00 45.20  ?  31   SER G HG   1 
ATOM   9809  N  N    . ARG G  1 32 ? 85.262 56.361 -2.648  1.00 33.79  ?  32   ARG G N    1 
ATOM   9810  C  CA   . ARG G  1 32 ? 86.669 56.730 -2.542  1.00 36.83  ?  32   ARG G CA   1 
ATOM   9811  C  C    . ARG G  1 32 ? 86.854 58.164 -3.016  1.00 35.50  ?  32   ARG G C    1 
ATOM   9812  O  O    . ARG G  1 32 ? 87.438 58.992 -2.318  1.00 36.40  ?  32   ARG G O    1 
ATOM   9813  C  CB   . ARG G  1 32 ? 87.551 55.795 -3.371  1.00 41.66  ?  32   ARG G CB   1 
ATOM   9814  C  CG   . ARG G  1 32 ? 88.891 56.410 -3.757  1.00 47.67  ?  32   ARG G CG   1 
ATOM   9815  C  CD   . ARG G  1 32 ? 89.876 55.364 -4.254  1.00 54.34  ?  32   ARG G CD   1 
ATOM   9816  N  NE   . ARG G  1 32 ? 90.333 54.491 -3.177  1.00 56.85  ?  32   ARG G NE   1 
ATOM   9817  C  CZ   . ARG G  1 32 ? 91.297 54.802 -2.313  1.00 58.99  ?  32   ARG G CZ   1 
ATOM   9818  N  NH1  . ARG G  1 32 ? 91.918 55.972 -2.388  1.00 60.87  ?  32   ARG G NH1  1 
ATOM   9819  N  NH2  . ARG G  1 32 ? 91.639 53.939 -1.366  1.00 58.40  ?  32   ARG G NH2  1 
ATOM   9820  H  H    . ARG G  1 32 ? 85.112 55.666 -3.131  1.00 40.54  ?  32   ARG G H    1 
ATOM   9821  H  HA   . ARG G  1 32 ? 86.952 56.674 -1.605  1.00 44.20  ?  32   ARG G HA   1 
ATOM   9822  H  HB2  . ARG G  1 32 ? 87.728 54.993 -2.856  1.00 50.00  ?  32   ARG G HB2  1 
ATOM   9823  H  HB3  . ARG G  1 32 ? 87.082 55.566 -4.189  1.00 50.00  ?  32   ARG G HB3  1 
ATOM   9824  H  HG2  . ARG G  1 32 ? 88.752 57.057 -4.466  1.00 57.21  ?  32   ARG G HG2  1 
ATOM   9825  H  HG3  . ARG G  1 32 ? 89.277 56.844 -2.980  1.00 57.21  ?  32   ARG G HG3  1 
ATOM   9826  H  HD2  . ARG G  1 32 ? 89.445 54.815 -4.927  1.00 65.21  ?  32   ARG G HD2  1 
ATOM   9827  H  HD3  . ARG G  1 32 ? 90.650 55.810 -4.632  1.00 65.21  ?  32   ARG G HD3  1 
ATOM   9828  H  HE   . ARG G  1 32 ? 89.953 53.724 -3.094  1.00 68.22  ?  32   ARG G HE   1 
ATOM   9829  H  HH11 . ARG G  1 32 ? 91.701 56.536 -2.999  1.00 73.04  ?  32   ARG G HH11 1 
ATOM   9830  H  HH12 . ARG G  1 32 ? 92.540 56.166 -1.826  1.00 73.04  ?  32   ARG G HH12 1 
ATOM   9831  H  HH21 . ARG G  1 32 ? 91.240 53.179 -1.312  1.00 70.08  ?  32   ARG G HH21 1 
ATOM   9832  H  HH22 . ARG G  1 32 ? 92.261 54.138 -0.807  1.00 70.08  ?  32   ARG G HH22 1 
ATOM   9833  N  N    . THR G  1 33 ? 86.339 58.449 -4.207  1.00 33.29  ?  33   THR G N    1 
ATOM   9834  C  CA   . THR G  1 33 ? 86.443 59.777 -4.797  1.00 35.89  ?  33   THR G CA   1 
ATOM   9835  C  C    . THR G  1 33 ? 85.826 60.832 -3.883  1.00 32.80  ?  33   THR G C    1 
ATOM   9836  O  O    . THR G  1 33 ? 86.450 61.850 -3.581  1.00 34.15  ?  33   THR G O    1 
ATOM   9837  C  CB   . THR G  1 33 ? 85.737 59.833 -6.165  1.00 41.01  ?  33   THR G CB   1 
ATOM   9838  O  OG1  . THR G  1 33 ? 86.378 58.934 -7.079  1.00 46.00  ?  33   THR G OG1  1 
ATOM   9839  C  CG2  . THR G  1 33 ? 85.780 61.241 -6.737  1.00 43.19  ?  33   THR G CG2  1 
ATOM   9840  H  H    . THR G  1 33 ? 85.919 57.882 -4.699  1.00 39.95  ?  33   THR G H    1 
ATOM   9841  H  HA   . THR G  1 33 ? 87.389 59.999 -4.929  1.00 43.06  ?  33   THR G HA   1 
ATOM   9842  H  HB   . THR G  1 33 ? 84.808 59.575 -6.058  1.00 49.21  ?  33   THR G HB   1 
ATOM   9843  H  HG1  . THR G  1 33 ? 86.341 58.167 -6.791  1.00 55.20  ?  33   THR G HG1  1 
ATOM   9844  H  HG21 . THR G  1 33 ? 86.691 61.521 -6.852  1.00 51.83  ?  33   THR G HG21 1 
ATOM   9845  H  HG22 . THR G  1 33 ? 85.337 61.264 -7.588  1.00 51.83  ?  33   THR G HG22 1 
ATOM   9846  H  HG23 . THR G  1 33 ? 85.340 61.851 -6.140  1.00 51.83  ?  33   THR G HG23 1 
ATOM   9847  N  N    . LEU G  1 34 ? 84.598 60.584 -3.444  1.00 31.82  ?  34   LEU G N    1 
ATOM   9848  C  CA   . LEU G  1 34 ? 83.876 61.546 -2.619  1.00 28.61  ?  34   LEU G CA   1 
ATOM   9849  C  C    . LEU G  1 34 ? 84.595 61.816 -1.299  1.00 26.99  ?  34   LEU G C    1 
ATOM   9850  O  O    . LEU G  1 34 ? 84.582 62.940 -0.799  1.00 24.37  ?  34   LEU G O    1 
ATOM   9851  C  CB   . LEU G  1 34 ? 82.447 61.059 -2.366  1.00 27.74  ?  34   LEU G CB   1 
ATOM   9852  C  CG   . LEU G  1 34 ? 81.575 61.009 -3.623  1.00 29.73  ?  34   LEU G CG   1 
ATOM   9853  C  CD1  . LEU G  1 34 ? 80.266 60.284 -3.354  1.00 30.05  ?  34   LEU G CD1  1 
ATOM   9854  C  CD2  . LEU G  1 34 ? 81.311 62.415 -4.143  1.00 30.69  ?  34   LEU G CD2  1 
ATOM   9855  H  H    . LEU G  1 34 ? 84.158 59.864 -3.610  1.00 38.18  ?  34   LEU G H    1 
ATOM   9856  H  HA   . LEU G  1 34 ? 83.818 62.395 -3.105  1.00 34.33  ?  34   LEU G HA   1 
ATOM   9857  H  HB2  . LEU G  1 34 ? 82.484 60.163 -1.995  1.00 33.29  ?  34   LEU G HB2  1 
ATOM   9858  H  HB3  . LEU G  1 34 ? 82.021 61.658 -1.733  1.00 33.29  ?  34   LEU G HB3  1 
ATOM   9859  H  HG   . LEU G  1 34 ? 82.049 60.521 -4.314  1.00 35.67  ?  34   LEU G HG   1 
ATOM   9860  H  HD11 . LEU G  1 34 ? 79.789 60.748 -2.663  1.00 36.06  ?  34   LEU G HD11 1 
ATOM   9861  H  HD12 . LEU G  1 34 ? 79.745 60.271 -4.160  1.00 36.06  ?  34   LEU G HD12 1 
ATOM   9862  H  HD13 . LEU G  1 34 ? 80.459 59.386 -3.074  1.00 36.06  ?  34   LEU G HD13 1 
ATOM   9863  H  HD21 . LEU G  1 34 ? 82.150 62.832 -4.356  1.00 36.83  ?  34   LEU G HD21 1 
ATOM   9864  H  HD22 . LEU G  1 34 ? 80.764 62.359 -4.930  1.00 36.83  ?  34   LEU G HD22 1 
ATOM   9865  H  HD23 . LEU G  1 34 ? 80.858 62.919 -3.463  1.00 36.83  ?  34   LEU G HD23 1 
ATOM   9866  N  N    . GLN G  1 35 ? 85.224 60.789 -0.737  1.00 32.29  ?  35   GLN G N    1 
ATOM   9867  C  CA   . GLN G  1 35 ? 86.003 60.962 0.484   1.00 34.51  ?  35   GLN G CA   1 
ATOM   9868  C  C    . GLN G  1 35 ? 87.270 61.770 0.209   1.00 37.44  ?  35   GLN G C    1 
ATOM   9869  O  O    . GLN G  1 35 ? 87.627 62.662 0.979   1.00 35.39  ?  35   GLN G O    1 
ATOM   9870  C  CB   . GLN G  1 35 ? 86.362 59.606 1.095   1.00 35.20  ?  35   GLN G CB   1 
ATOM   9871  C  CG   . GLN G  1 35 ? 85.166 58.835 1.635   1.00 33.38  ?  35   GLN G CG   1 
ATOM   9872  C  CD   . GLN G  1 35 ? 85.552 57.486 2.211   1.00 32.89  ?  35   GLN G CD   1 
ATOM   9873  O  OE1  . GLN G  1 35 ? 86.126 57.405 3.297   1.00 34.13  ?  35   GLN G OE1  1 
ATOM   9874  N  NE2  . GLN G  1 35 ? 85.243 56.418 1.482   1.00 31.54  ?  35   GLN G NE2  1 
ATOM   9875  H  H    . GLN G  1 35 ? 85.217 59.985 -1.042  1.00 38.74  ?  35   GLN G H    1 
ATOM   9876  H  HA   . GLN G  1 35 ? 85.465 61.456 1.138   1.00 41.41  ?  35   GLN G HA   1 
ATOM   9877  H  HB2  . GLN G  1 35 ? 86.785 59.059 0.415   1.00 42.23  ?  35   GLN G HB2  1 
ATOM   9878  H  HB3  . GLN G  1 35 ? 86.978 59.749 1.831   1.00 42.23  ?  35   GLN G HB3  1 
ATOM   9879  H  HG2  . GLN G  1 35 ? 84.747 59.354 2.340   1.00 40.05  ?  35   GLN G HG2  1 
ATOM   9880  H  HG3  . GLN G  1 35 ? 84.535 58.684 0.914   1.00 40.05  ?  35   GLN G HG3  1 
ATOM   9881  H  HE21 . GLN G  1 35 ? 84.844 56.514 0.726   1.00 37.85  ?  35   GLN G HE21 1 
ATOM   9882  H  HE22 . GLN G  1 35 ? 85.441 55.631 1.767   1.00 37.85  ?  35   GLN G HE22 1 
ATOM   9883  N  N    . GLU G  1 36 ? 87.942 61.459 -0.895  1.00 36.30  ?  36   GLU G N    1 
ATOM   9884  C  CA   . GLU G  1 36 ? 89.162 62.170 -1.272  1.00 40.68  ?  36   GLU G CA   1 
ATOM   9885  C  C    . GLU G  1 36 ? 88.895 63.656 -1.513  1.00 40.27  ?  36   GLU G C    1 
ATOM   9886  O  O    . GLU G  1 36 ? 89.776 64.493 -1.314  1.00 40.78  ?  36   GLU G O    1 
ATOM   9887  C  CB   . GLU G  1 36 ? 89.784 61.536 -2.518  1.00 44.94  ?  36   GLU G CB   1 
ATOM   9888  C  CG   . GLU G  1 36 ? 90.437 60.185 -2.257  1.00 47.38  ?  36   GLU G CG   1 
ATOM   9889  C  CD   . GLU G  1 36 ? 90.885 59.490 -3.531  1.00 51.96  ?  36   GLU G CD   1 
ATOM   9890  O  OE1  . GLU G  1 36 ? 90.477 59.928 -4.627  1.00 54.82  ?  36   GLU G OE1  1 
ATOM   9891  O  OE2  . GLU G  1 36 ? 91.645 58.504 -3.436  1.00 52.93  ?  36   GLU G OE2  1 
ATOM   9892  H  H    . GLU G  1 36 ? 87.713 60.839 -1.445  1.00 43.56  ?  36   GLU G H    1 
ATOM   9893  H  HA   . GLU G  1 36 ? 89.810 62.095 -0.541  1.00 48.82  ?  36   GLU G HA   1 
ATOM   9894  H  HB2  . GLU G  1 36 ? 89.090 61.407 -3.183  1.00 53.93  ?  36   GLU G HB2  1 
ATOM   9895  H  HB3  . GLU G  1 36 ? 90.466 62.133 -2.865  1.00 53.93  ?  36   GLU G HB3  1 
ATOM   9896  H  HG2  . GLU G  1 36 ? 91.218 60.314 -1.697  1.00 56.85  ?  36   GLU G HG2  1 
ATOM   9897  H  HG3  . GLU G  1 36 ? 89.799 59.607 -1.809  1.00 56.85  ?  36   GLU G HG3  1 
ATOM   9898  N  N    . GLN G  1 37 ? 87.677 63.980 -1.938  1.00 41.49  ?  37   GLN G N    1 
ATOM   9899  C  CA   . GLN G  1 37 ? 87.303 65.367 -2.190  1.00 42.80  ?  37   GLN G CA   1 
ATOM   9900  C  C    . GLN G  1 37 ? 86.798 66.054 -0.921  1.00 40.73  ?  37   GLN G C    1 
ATOM   9901  O  O    . GLN G  1 37 ? 86.636 67.274 -0.888  1.00 43.25  ?  37   GLN G O    1 
ATOM   9902  C  CB   . GLN G  1 37 ? 86.244 65.440 -3.290  1.00 44.92  ?  37   GLN G CB   1 
ATOM   9903  C  CG   . GLN G  1 37 ? 86.747 64.987 -4.649  1.00 52.04  ?  37   GLN G CG   1 
ATOM   9904  C  CD   . GLN G  1 37 ? 85.667 65.015 -5.709  1.00 59.23  ?  37   GLN G CD   1 
ATOM   9905  O  OE1  . GLN G  1 37 ? 84.484 65.170 -5.401  1.00 60.89  ?  37   GLN G OE1  1 
ATOM   9906  N  NE2  . GLN G  1 37 ? 86.069 64.868 -6.967  1.00 64.28  ?  37   GLN G NE2  1 
ATOM   9907  H  H    . GLN G  1 37 ? 87.048 63.413 -2.088  1.00 49.79  ?  37   GLN G H    1 
ATOM   9908  H  HA   . GLN G  1 37 ? 88.093 65.856 -2.501  1.00 51.36  ?  37   GLN G HA   1 
ATOM   9909  H  HB2  . GLN G  1 37 ? 85.498 64.871 -3.044  1.00 53.91  ?  37   GLN G HB2  1 
ATOM   9910  H  HB3  . GLN G  1 37 ? 85.944 66.359 -3.375  1.00 53.91  ?  37   GLN G HB3  1 
ATOM   9911  H  HG2  . GLN G  1 37 ? 87.463 65.577 -4.934  1.00 62.45  ?  37   GLN G HG2  1 
ATOM   9912  H  HG3  . GLN G  1 37 ? 87.075 64.077 -4.578  1.00 62.45  ?  37   GLN G HG3  1 
ATOM   9913  H  HE21 . GLN G  1 37 ? 86.904 64.764 -7.143  1.00 77.13  ?  37   GLN G HE21 1 
ATOM   9914  H  HE22 . GLN G  1 37 ? 85.493 64.877 -7.606  1.00 77.13  ?  37   GLN G HE22 1 
ATOM   9915  N  N    . GLY G  1 38 ? 86.548 65.267 0.119   1.00 41.73  ?  38   GLY G N    1 
ATOM   9916  C  CA   . GLY G  1 38 ? 86.173 65.812 1.410   1.00 40.26  ?  38   GLY G CA   1 
ATOM   9917  C  C    . GLY G  1 38 ? 84.678 66.000 1.592   1.00 37.57  ?  38   GLY G C    1 
ATOM   9918  O  O    . GLY G  1 38 ? 84.234 66.450 2.646   1.00 39.07  ?  38   GLY G O    1 
ATOM   9919  H  H    . GLY G  1 38 ? 86.590 64.408 0.099   1.00 50.07  ?  38   GLY G H    1 
ATOM   9920  H  HA2  . GLY G  1 38 ? 86.489 65.218 2.109   1.00 48.31  ?  38   GLY G HA2  1 
ATOM   9921  H  HA3  . GLY G  1 38 ? 86.602 66.674 1.528   1.00 48.31  ?  38   GLY G HA3  1 
ATOM   9922  N  N    . GLN G  1 39 ? 83.899 65.658 0.571   1.00 37.15  ?  39   GLN G N    1 
ATOM   9923  C  CA   . GLN G  1 39 ? 82.449 65.793 0.650   1.00 35.44  ?  39   GLN G CA   1 
ATOM   9924  C  C    . GLN G  1 39 ? 81.856 64.662 1.485   1.00 34.42  ?  39   GLN G C    1 
ATOM   9925  O  O    . GLN G  1 39 ? 80.924 64.876 2.257   1.00 32.16  ?  39   GLN G O    1 
ATOM   9926  C  CB   . GLN G  1 39 ? 81.838 65.820 -0.751  1.00 36.09  ?  39   GLN G CB   1 
ATOM   9927  C  CG   . GLN G  1 39 ? 82.356 66.969 -1.604  1.00 38.14  ?  39   GLN G CG   1 
ATOM   9928  C  CD   . GLN G  1 39 ? 81.744 67.000 -2.989  1.00 39.07  ?  39   GLN G CD   1 
ATOM   9929  O  OE1  . GLN G  1 39 ? 81.996 66.121 -3.813  1.00 39.44  ?  39   GLN G OE1  1 
ATOM   9930  N  NE2  . GLN G  1 39 ? 80.934 68.020 -3.254  1.00 39.79  ?  39   GLN G NE2  1 
ATOM   9931  H  H    . GLN G  1 39 ? 84.185 65.346 -0.177  1.00 44.57  ?  39   GLN G H    1 
ATOM   9932  H  HA   . GLN G  1 39 ? 82.231 66.641 1.091   1.00 42.53  ?  39   GLN G HA   1 
ATOM   9933  H  HB2  . GLN G  1 39 ? 82.053 64.990 -1.205  1.00 43.31  ?  39   GLN G HB2  1 
ATOM   9934  H  HB3  . GLN G  1 39 ? 80.876 65.916 -0.674  1.00 43.31  ?  39   GLN G HB3  1 
ATOM   9935  H  HG2  . GLN G  1 39 ? 82.146 67.808 -1.165  1.00 45.76  ?  39   GLN G HG2  1 
ATOM   9936  H  HG3  . GLN G  1 39 ? 83.317 66.879 -1.704  1.00 45.76  ?  39   GLN G HG3  1 
ATOM   9937  H  HE21 . GLN G  1 39 ? 80.782 68.616 -2.653  1.00 47.74  ?  39   GLN G HE21 1 
ATOM   9938  H  HE22 . GLN G  1 39 ? 80.561 68.083 -4.026  1.00 47.74  ?  39   GLN G HE22 1 
ATOM   9939  N  N    . TRP G  1 40 ? 82.404 63.461 1.320   1.00 34.72  ?  40   TRP G N    1 
ATOM   9940  C  CA   . TRP G  1 40 ? 82.074 62.335 2.184   1.00 32.02  ?  40   TRP G CA   1 
ATOM   9941  C  C    . TRP G  1 40 ? 83.108 62.302 3.307   1.00 34.87  ?  40   TRP G C    1 
ATOM   9942  O  O    . TRP G  1 40 ? 84.156 61.668 3.187   1.00 36.44  ?  40   TRP G O    1 
ATOM   9943  C  CB   . TRP G  1 40 ? 82.093 61.031 1.383   1.00 28.79  ?  40   TRP G CB   1 
ATOM   9944  C  CG   . TRP G  1 40 ? 81.329 59.899 2.012   1.00 26.83  ?  40   TRP G CG   1 
ATOM   9945  C  CD1  . TRP G  1 40 ? 81.183 59.641 3.345   1.00 26.12  ?  40   TRP G CD1  1 
ATOM   9946  C  CD2  . TRP G  1 40 ? 80.599 58.875 1.325   1.00 25.13  ?  40   TRP G CD2  1 
ATOM   9947  N  NE1  . TRP G  1 40 ? 80.414 58.516 3.528   1.00 25.31  ?  40   TRP G NE1  1 
ATOM   9948  C  CE2  . TRP G  1 40 ? 80.041 58.029 2.303   1.00 25.06  ?  40   TRP G CE2  1 
ATOM   9949  C  CE3  . TRP G  1 40 ? 80.365 58.592 -0.025  1.00 24.48  ?  40   TRP G CE3  1 
ATOM   9950  C  CZ2  . TRP G  1 40 ? 79.264 56.919 1.975   1.00 24.14  ?  40   TRP G CZ2  1 
ATOM   9951  C  CZ3  . TRP G  1 40 ? 79.595 57.490 -0.348  1.00 23.82  ?  40   TRP G CZ3  1 
ATOM   9952  C  CH2  . TRP G  1 40 ? 79.054 56.667 0.647   1.00 23.44  ?  40   TRP G CH2  1 
ATOM   9953  H  H    . TRP G  1 40 ? 82.976 63.273 0.707   1.00 41.66  ?  40   TRP G H    1 
ATOM   9954  H  HA   . TRP G  1 40 ? 81.184 62.459 2.573   1.00 38.43  ?  40   TRP G HA   1 
ATOM   9955  H  HB2  . TRP G  1 40 ? 81.704 61.198 0.510   1.00 34.54  ?  40   TRP G HB2  1 
ATOM   9956  H  HB3  . TRP G  1 40 ? 83.013 60.743 1.281   1.00 34.54  ?  40   TRP G HB3  1 
ATOM   9957  H  HD1  . TRP G  1 40 ? 81.555 60.149 4.029   1.00 31.34  ?  40   TRP G HD1  1 
ATOM   9958  H  HE1  . TRP G  1 40 ? 80.198 58.176 4.288   1.00 30.37  ?  40   TRP G HE1  1 
ATOM   9959  H  HE3  . TRP G  1 40 ? 80.722 59.133 -0.692  1.00 29.38  ?  40   TRP G HE3  1 
ATOM   9960  H  HZ2  . TRP G  1 40 ? 78.903 56.371 2.633   1.00 28.97  ?  40   TRP G HZ2  1 
ATOM   9961  H  HZ3  . TRP G  1 40 ? 79.433 57.292 -1.243  1.00 28.59  ?  40   TRP G HZ3  1 
ATOM   9962  H  HH2  . TRP G  1 40 ? 78.539 55.933 0.399   1.00 28.12  ?  40   TRP G HH2  1 
ATOM   9963  N  N    . ARG G  1 41 ? 82.808 63.000 4.397   1.00 35.44  ?  41   ARG G N    1 
ATOM   9964  C  CA   . ARG G  1 41 ? 83.786 63.241 5.451   1.00 37.96  ?  41   ARG G CA   1 
ATOM   9965  C  C    . ARG G  1 41 ? 84.060 62.006 6.306   1.00 36.90  ?  41   ARG G C    1 
ATOM   9966  O  O    . ARG G  1 41 ? 85.215 61.632 6.510   1.00 39.08  ?  41   ARG G O    1 
ATOM   9967  C  CB   . ARG G  1 41 ? 83.320 64.394 6.338   1.00 38.88  ?  41   ARG G CB   1 
ATOM   9968  C  CG   . ARG G  1 41 ? 84.318 64.798 7.402   1.00 42.34  ?  41   ARG G CG   1 
ATOM   9969  C  CD   . ARG G  1 41 ? 84.106 66.240 7.812   1.00 45.81  ?  41   ARG G CD   1 
ATOM   9970  N  NE   . ARG G  1 41 ? 85.039 66.660 8.851   1.00 52.47  ?  41   ARG G NE   1 
ATOM   9971  C  CZ   . ARG G  1 41 ? 85.226 67.923 9.221   1.00 57.65  ?  41   ARG G CZ   1 
ATOM   9972  N  NH1  . ARG G  1 41 ? 84.545 68.901 8.634   1.00 56.81  ?  41   ARG G NH1  1 
ATOM   9973  N  NH2  . ARG G  1 41 ? 86.097 68.210 10.179  1.00 62.83  ?  41   ARG G NH2  1 
ATOM   9974  H  H    . ARG G  1 41 ? 82.037 63.348 4.550   1.00 42.52  ?  41   ARG G H    1 
ATOM   9975  H  HA   . ARG G  1 41 ? 84.633 63.508 5.037   1.00 45.55  ?  41   ARG G HA   1 
ATOM   9976  H  HB2  . ARG G  1 41 ? 83.154 65.169 5.779   1.00 46.65  ?  41   ARG G HB2  1 
ATOM   9977  H  HB3  . ARG G  1 41 ? 82.501 64.132 6.785   1.00 46.65  ?  41   ARG G HB3  1 
ATOM   9978  H  HG2  . ARG G  1 41 ? 84.201 64.236 8.184   1.00 50.80  ?  41   ARG G HG2  1 
ATOM   9979  H  HG3  . ARG G  1 41 ? 85.218 64.708 7.051   1.00 50.80  ?  41   ARG G HG3  1 
ATOM   9980  H  HD2  . ARG G  1 41 ? 84.237 66.813 7.040   1.00 54.97  ?  41   ARG G HD2  1 
ATOM   9981  H  HD3  . ARG G  1 41 ? 83.205 66.344 8.155   1.00 54.97  ?  41   ARG G HD3  1 
ATOM   9982  H  HE   . ARG G  1 41 ? 85.488 66.050 9.259   1.00 62.96  ?  41   ARG G HE   1 
ATOM   9983  H  HH11 . ARG G  1 41 ? 83.979 68.719 8.013   1.00 68.17  ?  41   ARG G HH11 1 
ATOM   9984  H  HH12 . ARG G  1 41 ? 84.670 69.717 8.877   1.00 68.17  ?  41   ARG G HH12 1 
ATOM   9985  H  HH21 . ARG G  1 41 ? 86.540 67.580 10.561  1.00 75.39  ?  41   ARG G HH21 1 
ATOM   9986  H  HH22 . ARG G  1 41 ? 86.219 69.027 10.418  1.00 75.39  ?  41   ARG G HH22 1 
ATOM   9987  N  N    . TYR G  1 42 ? 83.002 61.382 6.812   1.00 33.22  ?  42   TYR G N    1 
ATOM   9988  C  CA   . TYR G  1 42 ? 83.152 60.196 7.647   1.00 31.49  ?  42   TYR G CA   1 
ATOM   9989  C  C    . TYR G  1 42 ? 82.308 59.039 7.126   1.00 28.16  ?  42   TYR G C    1 
ATOM   9990  O  O    . TYR G  1 42 ? 81.222 59.239 6.575   1.00 27.00  ?  42   TYR G O    1 
ATOM   9991  C  CB   . TYR G  1 42 ? 82.779 60.512 9.096   1.00 29.84  ?  42   TYR G CB   1 
ATOM   9992  C  CG   . TYR G  1 42 ? 83.649 61.579 9.721   1.00 31.82  ?  42   TYR G CG   1 
ATOM   9993  C  CD1  . TYR G  1 42 ? 85.032 61.528 9.610   1.00 33.82  ?  42   TYR G CD1  1 
ATOM   9994  C  CD2  . TYR G  1 42 ? 83.087 62.646 10.409  1.00 31.35  ?  42   TYR G CD2  1 
ATOM   9995  C  CE1  . TYR G  1 42 ? 85.830 62.501 10.174  1.00 35.88  ?  42   TYR G CE1  1 
ATOM   9996  C  CE2  . TYR G  1 42 ? 83.879 63.625 10.978  1.00 33.60  ?  42   TYR G CE2  1 
ATOM   9997  C  CZ   . TYR G  1 42 ? 85.249 63.548 10.857  1.00 36.41  ?  42   TYR G CZ   1 
ATOM   9998  O  OH   . TYR G  1 42 ? 86.043 64.522 11.419  1.00 41.18  ?  42   TYR G OH   1 
ATOM   9999  H  H    . TYR G  1 42 ? 82.187 61.625 6.687   1.00 39.86  ?  42   TYR G H    1 
ATOM   10000 H  HA   . TYR G  1 42 ? 84.090 59.914 7.632   1.00 37.79  ?  42   TYR G HA   1 
ATOM   10001 H  HB2  . TYR G  1 42 ? 81.861 60.822 9.123   1.00 35.81  ?  42   TYR G HB2  1 
ATOM   10002 H  HB3  . TYR G  1 42 ? 82.871 59.705 9.627   1.00 35.81  ?  42   TYR G HB3  1 
ATOM   10003 H  HD1  . TYR G  1 42 ? 85.427 60.822 9.150   1.00 40.59  ?  42   TYR G HD1  1 
ATOM   10004 H  HD2  . TYR G  1 42 ? 82.162 62.700 10.493  1.00 37.62  ?  42   TYR G HD2  1 
ATOM   10005 H  HE1  . TYR G  1 42 ? 86.756 62.452 10.093  1.00 43.06  ?  42   TYR G HE1  1 
ATOM   10006 H  HE2  . TYR G  1 42 ? 83.489 64.333 11.438  1.00 40.32  ?  42   TYR G HE2  1 
ATOM   10007 H  HH   . TYR G  1 42 ? 85.922 64.549 12.229  1.00 49.42  ?  42   TYR G HH   1 
ATOM   10008 N  N    . LEU G  1 43 ? 82.824 57.829 7.306   1.00 28.05  ?  43   LEU G N    1 
ATOM   10009 C  CA   . LEU G  1 43 ? 82.141 56.621 6.871   1.00 26.91  ?  43   LEU G CA   1 
ATOM   10010 C  C    . LEU G  1 43 ? 82.391 55.495 7.866   1.00 31.51  ?  43   LEU G C    1 
ATOM   10011 O  O    . LEU G  1 43 ? 83.535 55.111 8.107   1.00 34.01  ?  43   LEU G O    1 
ATOM   10012 C  CB   . LEU G  1 43 ? 82.634 56.203 5.485   1.00 26.74  ?  43   LEU G CB   1 
ATOM   10013 C  CG   . LEU G  1 43 ? 82.062 54.891 4.946   1.00 24.78  ?  43   LEU G CG   1 
ATOM   10014 C  CD1  . LEU G  1 43 ? 80.556 54.992 4.780   1.00 21.72  ?  43   LEU G CD1  1 
ATOM   10015 C  CD2  . LEU G  1 43 ? 82.726 54.516 3.629   1.00 25.73  ?  43   LEU G CD2  1 
ATOM   10016 H  H    . LEU G  1 43 ? 83.582 57.680 7.684   1.00 33.67  ?  43   LEU G H    1 
ATOM   10017 H  HA   . LEU G  1 43 ? 81.176 56.787 6.823   1.00 32.29  ?  43   LEU G HA   1 
ATOM   10018 H  HB2  . LEU G  1 43 ? 82.401 56.902 4.854   1.00 32.09  ?  43   LEU G HB2  1 
ATOM   10019 H  HB3  . LEU G  1 43 ? 83.598 56.107 5.519   1.00 32.09  ?  43   LEU G HB3  1 
ATOM   10020 H  HG   . LEU G  1 43 ? 82.245 54.184 5.583   1.00 29.74  ?  43   LEU G HG   1 
ATOM   10021 H  HD11 . LEU G  1 43 ? 80.356 55.700 4.163   1.00 26.07  ?  43   LEU G HD11 1 
ATOM   10022 H  HD12 . LEU G  1 43 ? 80.222 54.158 4.441   1.00 26.07  ?  43   LEU G HD12 1 
ATOM   10023 H  HD13 . LEU G  1 43 ? 80.160 55.181 5.634   1.00 26.07  ?  43   LEU G HD13 1 
ATOM   10024 H  HD21 . LEU G  1 43 ? 83.669 54.412 3.774   1.00 30.88  ?  43   LEU G HD21 1 
ATOM   10025 H  HD22 . LEU G  1 43 ? 82.350 53.691 3.314   1.00 30.88  ?  43   LEU G HD22 1 
ATOM   10026 H  HD23 . LEU G  1 43 ? 82.568 55.214 2.990   1.00 30.88  ?  43   LEU G HD23 1 
ATOM   10027 N  N    . TRP G  1 44 ? 81.316 54.974 8.447   1.00 31.56  ?  44   TRP G N    1 
ATOM   10028 C  CA   . TRP G  1 44 ? 81.415 53.857 9.377   1.00 32.46  ?  44   TRP G CA   1 
ATOM   10029 C  C    . TRP G  1 44 ? 80.418 52.773 9.007   1.00 31.61  ?  44   TRP G C    1 
ATOM   10030 O  O    . TRP G  1 44 ? 79.326 53.062 8.520   1.00 28.71  ?  44   TRP G O    1 
ATOM   10031 C  CB   . TRP G  1 44 ? 81.141 54.317 10.808  1.00 31.87  ?  44   TRP G CB   1 
ATOM   10032 C  CG   . TRP G  1 44 ? 82.086 55.355 11.309  1.00 33.47  ?  44   TRP G CG   1 
ATOM   10033 C  CD1  . TRP G  1 44 ? 83.398 55.179 11.642  1.00 35.95  ?  44   TRP G CD1  1 
ATOM   10034 C  CD2  . TRP G  1 44 ? 81.791 56.734 11.550  1.00 33.52  ?  44   TRP G CD2  1 
ATOM   10035 N  NE1  . TRP G  1 44 ? 83.940 56.366 12.071  1.00 37.81  ?  44   TRP G NE1  1 
ATOM   10036 C  CE2  . TRP G  1 44 ? 82.974 57.337 12.025  1.00 36.60  ?  44   TRP G CE2  1 
ATOM   10037 C  CE3  . TRP G  1 44 ? 80.643 57.520 11.410  1.00 30.53  ?  44   TRP G CE3  1 
ATOM   10038 C  CZ2  . TRP G  1 44 ? 83.042 58.688 12.357  1.00 38.16  ?  44   TRP G CZ2  1 
ATOM   10039 C  CZ3  . TRP G  1 44 ? 80.711 58.861 11.741  1.00 31.16  ?  44   TRP G CZ3  1 
ATOM   10040 C  CH2  . TRP G  1 44 ? 81.903 59.432 12.209  1.00 35.09  ?  44   TRP G CH2  1 
ATOM   10041 H  H    . TRP G  1 44 ? 80.512 55.252 8.318   1.00 37.87  ?  44   TRP G H    1 
ATOM   10042 H  HA   . TRP G  1 44 ? 82.318 53.477 9.338   1.00 38.96  ?  44   TRP G HA   1 
ATOM   10043 H  HB2  . TRP G  1 44 ? 80.246 54.688 10.849  1.00 38.24  ?  44   TRP G HB2  1 
ATOM   10044 H  HB3  . TRP G  1 44 ? 81.205 53.550 11.398  1.00 38.24  ?  44   TRP G HB3  1 
ATOM   10045 H  HD1  . TRP G  1 44 ? 83.859 54.373 11.585  1.00 43.14  ?  44   TRP G HD1  1 
ATOM   10046 H  HE1  . TRP G  1 44 ? 84.753 56.481 12.327  1.00 45.37  ?  44   TRP G HE1  1 
ATOM   10047 H  HE3  . TRP G  1 44 ? 79.849 57.148 11.099  1.00 36.64  ?  44   TRP G HE3  1 
ATOM   10048 H  HZ2  . TRP G  1 44 ? 83.831 59.070 12.669  1.00 45.80  ?  44   TRP G HZ2  1 
ATOM   10049 H  HZ3  . TRP G  1 44 ? 79.954 59.393 11.651  1.00 37.40  ?  44   TRP G HZ3  1 
ATOM   10050 H  HH2  . TRP G  1 44 ? 81.919 60.337 12.424  1.00 42.11  ?  44   TRP G HH2  1 
ATOM   10051 N  N    . ARG G  1 45 ? 80.797 51.523 9.243   1.00 33.48  ?  45   ARG G N    1 
ATOM   10052 C  CA   . ARG G  1 45 ? 79.889 50.405 9.042   1.00 32.94  ?  45   ARG G CA   1 
ATOM   10053 C  C    . ARG G  1 45 ? 78.938 50.286 10.224  1.00 30.99  ?  45   ARG G C    1 
ATOM   10054 O  O    . ARG G  1 45 ? 79.365 50.323 11.378  1.00 30.62  ?  45   ARG G O    1 
ATOM   10055 C  CB   . ARG G  1 45 ? 80.674 49.100 8.883   1.00 34.89  ?  45   ARG G CB   1 
ATOM   10056 C  CG   . ARG G  1 45 ? 79.796 47.856 8.822   1.00 34.21  ?  45   ARG G CG   1 
ATOM   10057 C  CD   . ARG G  1 45 ? 79.025 47.790 7.514   1.00 33.31  ?  45   ARG G CD   1 
ATOM   10058 N  NE   . ARG G  1 45 ? 79.840 47.254 6.429   1.00 35.82  ?  45   ARG G NE   1 
ATOM   10059 C  CZ   . ARG G  1 45 ? 79.600 47.447 5.135   1.00 37.12  ?  45   ARG G CZ   1 
ATOM   10060 N  NH1  . ARG G  1 45 ? 78.568 48.183 4.741   1.00 34.27  ?  45   ARG G NH1  1 
ATOM   10061 N  NH2  . ARG G  1 45 ? 80.403 46.908 4.229   1.00 41.23  ?  45   ARG G NH2  1 
ATOM   10062 H  H    . ARG G  1 45 ? 81.578 51.297 9.521   1.00 40.17  ?  45   ARG G H    1 
ATOM   10063 H  HA   . ARG G  1 45 ? 79.361 50.553 8.230   1.00 39.53  ?  45   ARG G HA   1 
ATOM   10064 H  HB2  . ARG G  1 45 ? 81.186 49.142 8.061   1.00 41.87  ?  45   ARG G HB2  1 
ATOM   10065 H  HB3  . ARG G  1 45 ? 81.273 49.003 9.639   1.00 41.87  ?  45   ARG G HB3  1 
ATOM   10066 H  HG2  . ARG G  1 45 ? 80.354 47.065 8.886   1.00 41.06  ?  45   ARG G HG2  1 
ATOM   10067 H  HG3  . ARG G  1 45 ? 79.157 47.877 9.551   1.00 41.06  ?  45   ARG G HG3  1 
ATOM   10068 H  HD2  . ARG G  1 45 ? 78.253 47.213 7.628   1.00 39.97  ?  45   ARG G HD2  1 
ATOM   10069 H  HD3  . ARG G  1 45 ? 78.740 48.684 7.267   1.00 39.97  ?  45   ARG G HD3  1 
ATOM   10070 H  HE   . ARG G  1 45 ? 80.525 46.778 6.641   1.00 42.98  ?  45   ARG G HE   1 
ATOM   10071 H  HH11 . ARG G  1 45 ? 78.042 48.535 5.324   1.00 41.13  ?  45   ARG G HH11 1 
ATOM   10072 H  HH12 . ARG G  1 45 ? 78.422 48.304 3.902   1.00 41.13  ?  45   ARG G HH12 1 
ATOM   10073 H  HH21 . ARG G  1 45 ? 81.075 46.433 4.479   1.00 49.48  ?  45   ARG G HH21 1 
ATOM   10074 H  HH22 . ARG G  1 45 ? 80.253 47.035 3.392   1.00 49.48  ?  45   ARG G HH22 1 
ATOM   10075 N  N    . THR G  1 46 ? 77.649 50.149 9.933   1.00 31.96  ?  46   THR G N    1 
ATOM   10076 C  CA   . THR G  1 46 ? 76.664 49.858 10.965  1.00 32.19  ?  46   THR G CA   1 
ATOM   10077 C  C    . THR G  1 46 ? 76.807 48.397 11.377  1.00 33.30  ?  46   THR G C    1 
ATOM   10078 O  O    . THR G  1 46 ? 76.513 47.491 10.599  1.00 34.94  ?  46   THR G O    1 
ATOM   10079 C  CB   . THR G  1 46 ? 75.230 50.128 10.475  1.00 32.09  ?  46   THR G CB   1 
ATOM   10080 O  OG1  . THR G  1 46 ? 75.057 49.588 9.159   1.00 32.85  ?  46   THR G OG1  1 
ATOM   10081 C  CG2  . THR G  1 46 ? 74.952 51.623 10.439  1.00 31.94  ?  46   THR G CG2  1 
ATOM   10082 H  H    . THR G  1 46 ? 77.318 50.221 9.142   1.00 38.36  ?  46   THR G H    1 
ATOM   10083 H  HA   . THR G  1 46 ? 76.836 50.420 11.749  1.00 38.62  ?  46   THR G HA   1 
ATOM   10084 H  HB   . THR G  1 46 ? 74.597 49.712 11.081  1.00 38.51  ?  46   THR G HB   1 
ATOM   10085 H  HG1  . THR G  1 46 ? 75.189 48.778 9.169   1.00 39.42  ?  46   THR G HG1  1 
ATOM   10086 H  HG21 . THR G  1 46 ? 75.568 52.056 9.844   1.00 38.33  ?  46   THR G HG21 1 
ATOM   10087 H  HG22 . THR G  1 46 ? 74.056 51.783 10.133  1.00 38.33  ?  46   THR G HG22 1 
ATOM   10088 H  HG23 . THR G  1 46 ? 75.053 51.996 11.318  1.00 38.33  ?  46   THR G HG23 1 
ATOM   10089 N  N    . THR G  1 47 ? 77.266 48.179 12.605  1.00 31.34  ?  47   THR G N    1 
ATOM   10090 C  CA   . THR G  1 47 ? 77.630 46.844 13.077  1.00 31.30  ?  47   THR G CA   1 
ATOM   10091 C  C    . THR G  1 47 ? 76.461 45.865 12.988  1.00 30.64  ?  47   THR G C    1 
ATOM   10092 O  O    . THR G  1 47 ? 75.356 46.158 13.442  1.00 29.93  ?  47   THR G O    1 
ATOM   10093 C  CB   . THR G  1 47 ? 78.144 46.890 14.532  1.00 32.04  ?  47   THR G CB   1 
ATOM   10094 O  OG1  . THR G  1 47 ? 79.277 47.765 14.620  1.00 32.66  ?  47   THR G OG1  1 
ATOM   10095 C  CG2  . THR G  1 47 ? 78.553 45.501 15.006  1.00 34.27  ?  47   THR G CG2  1 
ATOM   10096 H  H    . THR G  1 47 ? 77.378 48.796 13.193  1.00 37.61  ?  47   THR G H    1 
ATOM   10097 H  HA   . THR G  1 47 ? 78.353 46.497 12.514  1.00 37.56  ?  47   THR G HA   1 
ATOM   10098 H  HB   . THR G  1 47 ? 77.439 47.216 15.113  1.00 38.44  ?  47   THR G HB   1 
ATOM   10099 H  HG1  . THR G  1 47 ? 79.065 48.522 14.388  1.00 39.20  ?  47   THR G HG1  1 
ATOM   10100 H  HG21 . THR G  1 47 ? 79.252 45.156 14.445  1.00 41.12  ?  47   THR G HG21 1 
ATOM   10101 H  HG22 . THR G  1 47 ? 78.870 45.544 15.911  1.00 41.12  ?  47   THR G HG22 1 
ATOM   10102 H  HG23 . THR G  1 47 ? 77.800 44.907 14.967  1.00 41.12  ?  47   THR G HG23 1 
ATOM   10103 N  N    . GLY G  1 48 ? 76.720 44.695 12.413  1.00 31.98  ?  48   GLY G N    1 
ATOM   10104 C  CA   . GLY G  1 48 ? 75.692 43.691 12.193  1.00 33.35  ?  48   GLY G CA   1 
ATOM   10105 C  C    . GLY G  1 48 ? 74.745 43.933 11.026  1.00 33.38  ?  48   GLY G C    1 
ATOM   10106 O  O    . GLY G  1 48 ? 73.849 43.122 10.788  1.00 33.96  ?  48   GLY G O    1 
ATOM   10107 H  H    . GLY G  1 48 ? 77.499 44.457 12.138  1.00 38.38  ?  48   GLY G H    1 
ATOM   10108 H  HA2  . GLY G  1 48 ? 76.123 42.835 12.047  1.00 40.02  ?  48   GLY G HA2  1 
ATOM   10109 H  HA3  . GLY G  1 48 ? 75.154 43.618 12.997  1.00 40.02  ?  48   GLY G HA3  1 
ATOM   10110 N  N    . LYS G  1 49 ? 74.933 45.027 10.292  1.00 34.49  ?  49   LYS G N    1 
ATOM   10111 C  CA   . LYS G  1 49 ? 74.017 45.375 9.204   1.00 35.51  ?  49   LYS G CA   1 
ATOM   10112 C  C    . LYS G  1 49 ? 74.733 45.742 7.905   1.00 35.35  ?  49   LYS G C    1 
ATOM   10113 O  O    . LYS G  1 49 ? 75.884 46.181 7.914   1.00 37.73  ?  49   LYS G O    1 
ATOM   10114 C  CB   . LYS G  1 49 ? 73.109 46.534 9.625   1.00 34.38  ?  49   LYS G CB   1 
ATOM   10115 C  CG   . LYS G  1 49 ? 72.014 46.145 10.608  1.00 36.09  ?  49   LYS G CG   1 
ATOM   10116 C  CD   . LYS G  1 49 ? 71.215 47.360 11.060  1.00 36.20  ?  49   LYS G CD   1 
ATOM   10117 C  CE   . LYS G  1 49 ? 70.139 46.986 12.070  1.00 36.53  ?  49   LYS G CE   1 
ATOM   10118 N  NZ   . LYS G  1 49 ? 69.068 46.132 11.479  1.00 36.26  ?  49   LYS G NZ   1 
ATOM   10119 H  H    . LYS G  1 49 ? 75.579 45.584 10.401  1.00 41.38  ?  49   LYS G H    1 
ATOM   10120 H  HA   . LYS G  1 49 ? 73.445 44.601 9.019   1.00 42.61  ?  49   LYS G HA   1 
ATOM   10121 H  HB2  . LYS G  1 49 ? 73.653 47.219 10.045  1.00 41.25  ?  49   LYS G HB2  1 
ATOM   10122 H  HB3  . LYS G  1 49 ? 72.680 46.897 8.834   1.00 41.25  ?  49   LYS G HB3  1 
ATOM   10123 H  HG2  . LYS G  1 49 ? 71.406 45.522 10.181  1.00 43.31  ?  49   LYS G HG2  1 
ATOM   10124 H  HG3  . LYS G  1 49 ? 72.417 45.737 11.391  1.00 43.31  ?  49   LYS G HG3  1 
ATOM   10125 H  HD2  . LYS G  1 49 ? 71.814 47.998 11.478  1.00 43.44  ?  49   LYS G HD2  1 
ATOM   10126 H  HD3  . LYS G  1 49 ? 70.782 47.761 10.290  1.00 43.44  ?  49   LYS G HD3  1 
ATOM   10127 H  HE2  . LYS G  1 49 ? 70.547 46.493 12.800  1.00 43.83  ?  49   LYS G HE2  1 
ATOM   10128 H  HE3  . LYS G  1 49 ? 69.726 47.796 12.407  1.00 43.83  ?  49   LYS G HE3  1 
ATOM   10129 H  HZ1  . LYS G  1 49 ? 69.420 45.376 11.168  1.00 43.52  ?  49   LYS G HZ1  1 
ATOM   10130 H  HZ2  . LYS G  1 49 ? 68.460 45.935 12.098  1.00 43.52  ?  49   LYS G HZ2  1 
ATOM   10131 H  HZ3  . LYS G  1 49 ? 68.671 46.563 10.810  1.00 43.52  ?  49   LYS G HZ3  1 
ATOM   10132 N  N    . TYR G  1 50 ? 74.034 45.555 6.788   1.00 34.27  ?  50   TYR G N    1 
ATOM   10133 C  CA   . TYR G  1 50 ? 74.535 45.980 5.489   1.00 32.05  ?  50   TYR G CA   1 
ATOM   10134 C  C    . TYR G  1 50 ? 74.156 47.439 5.259   1.00 30.41  ?  50   TYR G C    1 
ATOM   10135 O  O    . TYR G  1 50 ? 73.114 47.737 4.676   1.00 30.56  ?  50   TYR G O    1 
ATOM   10136 C  CB   . TYR G  1 50 ? 73.954 45.110 4.375   1.00 31.58  ?  50   TYR G CB   1 
ATOM   10137 C  CG   . TYR G  1 50 ? 74.717 45.190 3.069   1.00 34.19  ?  50   TYR G CG   1 
ATOM   10138 C  CD1  . TYR G  1 50 ? 75.652 46.193 2.843   1.00 35.11  ?  50   TYR G CD1  1 
ATOM   10139 C  CD2  . TYR G  1 50 ? 74.503 44.258 2.062   1.00 37.83  ?  50   TYR G CD2  1 
ATOM   10140 C  CE1  . TYR G  1 50 ? 76.351 46.264 1.653   1.00 39.37  ?  50   TYR G CE1  1 
ATOM   10141 C  CE2  . TYR G  1 50 ? 75.197 44.323 0.867   1.00 42.21  ?  50   TYR G CE2  1 
ATOM   10142 C  CZ   . TYR G  1 50 ? 76.120 45.328 0.669   1.00 44.37  ?  50   TYR G CZ   1 
ATOM   10143 O  OH   . TYR G  1 50 ? 76.816 45.400 -0.516  1.00 49.96  ?  50   TYR G OH   1 
ATOM   10144 H  H    . TYR G  1 50 ? 73.260 45.181 6.759   1.00 41.12  ?  50   TYR G H    1 
ATOM   10145 H  HA   . TYR G  1 50 ? 75.512 45.903 5.470   1.00 38.46  ?  50   TYR G HA   1 
ATOM   10146 H  HB2  . TYR G  1 50 ? 73.961 44.185 4.666   1.00 37.89  ?  50   TYR G HB2  1 
ATOM   10147 H  HB3  . TYR G  1 50 ? 73.042 45.392 4.202   1.00 37.89  ?  50   TYR G HB3  1 
ATOM   10148 H  HD1  . TYR G  1 50 ? 75.811 46.826 3.505   1.00 42.13  ?  50   TYR G HD1  1 
ATOM   10149 H  HD2  . TYR G  1 50 ? 73.882 43.578 2.192   1.00 45.40  ?  50   TYR G HD2  1 
ATOM   10150 H  HE1  . TYR G  1 50 ? 76.974 46.942 1.516   1.00 47.24  ?  50   TYR G HE1  1 
ATOM   10151 H  HE2  . TYR G  1 50 ? 75.043 43.691 0.202   1.00 50.65  ?  50   TYR G HE2  1 
ATOM   10152 H  HH   . TYR G  1 50 ? 76.294 45.490 -1.143  1.00 59.95  ?  50   TYR G HH   1 
ATOM   10153 N  N    . GLY G  1 51 ? 75.008 48.344 5.724   1.00 31.45  ?  51   GLY G N    1 
ATOM   10154 C  CA   . GLY G  1 51 ? 74.748 49.766 5.605   1.00 31.14  ?  51   GLY G CA   1 
ATOM   10155 C  C    . GLY G  1 51 ? 75.835 50.576 6.280   1.00 31.16  ?  51   GLY G C    1 
ATOM   10156 O  O    . GLY G  1 51 ? 76.852 50.025 6.698   1.00 33.66  ?  51   GLY G O    1 
ATOM   10157 H  H    . GLY G  1 51 ? 75.750 48.155 6.115   1.00 37.75  ?  51   GLY G H    1 
ATOM   10158 H  HA2  . GLY G  1 51 ? 74.709 50.016 4.669   1.00 37.36  ?  51   GLY G HA2  1 
ATOM   10159 H  HA3  . GLY G  1 51 ? 73.897 49.979 6.020   1.00 37.36  ?  51   GLY G HA3  1 
ATOM   10160 N  N    . ASN G  1 52 ? 75.628 51.883 6.393   1.00 28.15  ?  52   ASN G N    1 
ATOM   10161 C  CA   . ASN G  1 52 ? 76.639 52.745 6.989   1.00 26.89  ?  52   ASN G CA   1 
ATOM   10162 C  C    . ASN G  1 52 ? 76.065 53.961 7.699   1.00 26.56  ?  52   ASN G C    1 
ATOM   10163 O  O    . ASN G  1 52 ? 74.909 54.333 7.495   1.00 23.76  ?  52   ASN G O    1 
ATOM   10164 C  CB   . ASN G  1 52 ? 77.628 53.218 5.920   1.00 27.72  ?  52   ASN G CB   1 
ATOM   10165 C  CG   . ASN G  1 52 ? 76.994 54.164 4.917   1.00 28.63  ?  52   ASN G CG   1 
ATOM   10166 O  OD1  . ASN G  1 52 ? 76.810 55.350 5.195   1.00 29.08  ?  52   ASN G OD1  1 
ATOM   10167 N  ND2  . ASN G  1 52 ? 76.664 53.645 3.738   1.00 29.71  ?  52   ASN G ND2  1 
ATOM   10168 H  H    . ASN G  1 52 ? 74.917 52.292 6.135   1.00 33.78  ?  52   ASN G H    1 
ATOM   10169 H  HA   . ASN G  1 52 ? 77.142 52.226 7.651   1.00 32.27  ?  52   ASN G HA   1 
ATOM   10170 H  HB2  . ASN G  1 52 ? 78.361 53.684 6.350   1.00 33.26  ?  52   ASN G HB2  1 
ATOM   10171 H  HB3  . ASN G  1 52 ? 77.962 52.447 5.435   1.00 33.26  ?  52   ASN G HB3  1 
ATOM   10172 H  HD21 . ASN G  1 52 ? 76.812 52.813 3.578   1.00 35.65  ?  52   ASN G HD21 1 
ATOM   10173 H  HD22 . ASN G  1 52 ? 76.302 54.141 3.137   1.00 35.65  ?  52   ASN G HD22 1 
ATOM   10174 N  N    . ILE G  1 53 ? 76.894 54.560 8.547   1.00 30.08  ?  53   ILE G N    1 
ATOM   10175 C  CA   . ILE G  1 53 ? 76.632 55.873 9.113   1.00 33.00  ?  53   ILE G CA   1 
ATOM   10176 C  C    . ILE G  1 53 ? 77.656 56.814 8.512   1.00 30.62  ?  53   ILE G C    1 
ATOM   10177 O  O    . ILE G  1 53 ? 78.855 56.539 8.559   1.00 33.79  ?  53   ILE G O    1 
ATOM   10178 C  CB   . ILE G  1 53 ? 76.809 55.891 10.636  1.00 38.62  ?  53   ILE G CB   1 
ATOM   10179 C  CG1  . ILE G  1 53 ? 75.869 54.885 11.299  1.00 41.22  ?  53   ILE G CG1  1 
ATOM   10180 C  CG2  . ILE G  1 53 ? 76.564 57.292 11.178  1.00 40.88  ?  53   ILE G CG2  1 
ATOM   10181 C  CD1  . ILE G  1 53 ? 74.404 55.188 11.089  1.00 42.58  ?  53   ILE G CD1  1 
ATOM   10182 H  H    . ILE G  1 53 ? 77.635 54.214 8.815   1.00 36.10  ?  53   ILE G H    1 
ATOM   10183 H  HA   . ILE G  1 53 ? 75.729 56.176 8.881   1.00 39.60  ?  53   ILE G HA   1 
ATOM   10184 H  HB   . ILE G  1 53 ? 77.723 55.639 10.842  1.00 46.35  ?  53   ILE G HB   1 
ATOM   10185 H  HG12 . ILE G  1 53 ? 76.045 54.005 10.932  1.00 49.47  ?  53   ILE G HG12 1 
ATOM   10186 H  HG13 . ILE G  1 53 ? 76.037 54.883 12.254  1.00 49.47  ?  53   ILE G HG13 1 
ATOM   10187 H  HG21 . ILE G  1 53 ? 75.668 57.558 10.958  1.00 49.06  ?  53   ILE G HG21 1 
ATOM   10188 H  HG22 . ILE G  1 53 ? 76.679 57.283 12.131  1.00 49.06  ?  53   ILE G HG22 1 
ATOM   10189 H  HG23 . ILE G  1 53 ? 77.193 57.896 10.777  1.00 49.06  ?  53   ILE G HG23 1 
ATOM   10190 H  HD11 . ILE G  1 53 ? 74.215 55.183 10.148  1.00 51.10  ?  53   ILE G HD11 1 
ATOM   10191 H  HD12 . ILE G  1 53 ? 73.880 54.517 11.532  1.00 51.10  ?  53   ILE G HD12 1 
ATOM   10192 H  HD13 . ILE G  1 53 ? 74.208 56.053 11.458  1.00 51.10  ?  53   ILE G HD13 1 
ATOM   10193 N  N    . SER G  1 54 ? 77.193 57.919 7.943   1.00 26.74  ?  54   SER G N    1 
ATOM   10194 C  CA   . SER G  1 54 ? 78.089 58.832 7.256   1.00 25.84  ?  54   SER G CA   1 
ATOM   10195 C  C    . SER G  1 54 ? 77.875 60.273 7.686   1.00 25.52  ?  54   SER G C    1 
ATOM   10196 O  O    . SER G  1 54 ? 76.791 60.651 8.134   1.00 26.15  ?  54   SER G O    1 
ATOM   10197 C  CB   . SER G  1 54 ? 77.894 58.723 5.741   1.00 26.45  ?  54   SER G CB   1 
ATOM   10198 O  OG   . SER G  1 54 ? 78.165 57.411 5.280   1.00 28.04  ?  54   SER G OG   1 
ATOM   10199 H  H    . SER G  1 54 ? 76.368 58.162 7.942   1.00 32.09  ?  54   SER G H    1 
ATOM   10200 H  HA   . SER G  1 54 ? 79.016 58.587 7.462   1.00 31.01  ?  54   SER G HA   1 
ATOM   10201 H  HB2  . SER G  1 54 ? 76.976 58.949 5.526   1.00 31.74  ?  54   SER G HB2  1 
ATOM   10202 H  HB3  . SER G  1 54 ? 78.498 59.342 5.302   1.00 31.74  ?  54   SER G HB3  1 
ATOM   10203 H  HG   . SER G  1 54 ? 78.381 56.932 5.909   1.00 33.65  ?  54   SER G HG   1 
ATOM   10204 N  N    . VAL G  1 55 ? 78.927 61.070 7.550   1.00 25.26  ?  55   VAL G N    1 
ATOM   10205 C  CA   . VAL G  1 55 ? 78.814 62.511 7.677   1.00 25.73  ?  55   VAL G CA   1 
ATOM   10206 C  C    . VAL G  1 55 ? 79.283 63.145 6.372   1.00 27.63  ?  55   VAL G C    1 
ATOM   10207 O  O    . VAL G  1 55 ? 80.388 62.872 5.899   1.00 28.46  ?  55   VAL G O    1 
ATOM   10208 C  CB   . VAL G  1 55 ? 79.649 63.056 8.846   1.00 26.80  ?  55   VAL G CB   1 
ATOM   10209 C  CG1  . VAL G  1 55 ? 79.435 64.553 8.988   1.00 25.17  ?  55   VAL G CG1  1 
ATOM   10210 C  CG2  . VAL G  1 55 ? 79.281 62.343 10.139  1.00 28.30  ?  55   VAL G CG2  1 
ATOM   10211 H  H    . VAL G  1 55 ? 79.724 60.795 7.383   1.00 30.32  ?  55   VAL G H    1 
ATOM   10212 H  HA   . VAL G  1 55 ? 77.876 62.755 7.823   1.00 30.87  ?  55   VAL G HA   1 
ATOM   10213 H  HB   . VAL G  1 55 ? 80.599 62.897 8.667   1.00 32.16  ?  55   VAL G HB   1 
ATOM   10214 H  HG11 . VAL G  1 55 ? 78.505 64.721 9.155   1.00 30.20  ?  55   VAL G HG11 1 
ATOM   10215 H  HG12 . VAL G  1 55 ? 79.963 64.875 9.722   1.00 30.20  ?  55   VAL G HG12 1 
ATOM   10216 H  HG13 . VAL G  1 55 ? 79.705 64.985 8.175   1.00 30.20  ?  55   VAL G HG13 1 
ATOM   10217 H  HG21 . VAL G  1 55 ? 79.453 61.404 10.037  1.00 33.96  ?  55   VAL G HG21 1 
ATOM   10218 H  HG22 . VAL G  1 55 ? 79.814 62.699 10.854  1.00 33.96  ?  55   VAL G HG22 1 
ATOM   10219 H  HG23 . VAL G  1 55 ? 78.349 62.488 10.321  1.00 33.96  ?  55   VAL G HG23 1 
ATOM   10220 N  N    . PHE G  1 56 ? 78.432 63.978 5.785   1.00 27.77  ?  56   PHE G N    1 
ATOM   10221 C  CA   . PHE G  1 56 ? 78.757 64.647 4.532   1.00 29.16  ?  56   PHE G CA   1 
ATOM   10222 C  C    . PHE G  1 56 ? 78.990 66.133 4.765   1.00 33.40  ?  56   PHE G C    1 
ATOM   10223 O  O    . PHE G  1 56 ? 78.290 66.761 5.557   1.00 32.58  ?  56   PHE G O    1 
ATOM   10224 C  CB   . PHE G  1 56 ? 77.634 64.452 3.511   1.00 26.26  ?  56   PHE G CB   1 
ATOM   10225 C  CG   . PHE G  1 56 ? 77.651 63.110 2.838   1.00 24.30  ?  56   PHE G CG   1 
ATOM   10226 C  CD1  . PHE G  1 56 ? 76.992 62.029 3.398   1.00 22.26  ?  56   PHE G CD1  1 
ATOM   10227 C  CD2  . PHE G  1 56 ? 78.325 62.931 1.640   1.00 26.01  ?  56   PHE G CD2  1 
ATOM   10228 C  CE1  . PHE G  1 56 ? 77.007 60.793 2.777   1.00 22.81  ?  56   PHE G CE1  1 
ATOM   10229 C  CE2  . PHE G  1 56 ? 78.345 61.696 1.014   1.00 26.18  ?  56   PHE G CE2  1 
ATOM   10230 C  CZ   . PHE G  1 56 ? 77.685 60.627 1.583   1.00 24.80  ?  56   PHE G CZ   1 
ATOM   10231 H  H    . PHE G  1 56 ? 77.653 64.174 6.095   1.00 33.32  ?  56   PHE G H    1 
ATOM   10232 H  HA   . PHE G  1 56 ? 79.578 64.261 4.163   1.00 34.99  ?  56   PHE G HA   1 
ATOM   10233 H  HB2  . PHE G  1 56 ? 76.781 64.546 3.963   1.00 31.51  ?  56   PHE G HB2  1 
ATOM   10234 H  HB3  . PHE G  1 56 ? 77.717 65.130 2.822   1.00 31.51  ?  56   PHE G HB3  1 
ATOM   10235 H  HD1  . PHE G  1 56 ? 76.535 62.135 4.201   1.00 26.71  ?  56   PHE G HD1  1 
ATOM   10236 H  HD2  . PHE G  1 56 ? 78.772 63.649 1.253   1.00 31.21  ?  56   PHE G HD2  1 
ATOM   10237 H  HE1  . PHE G  1 56 ? 76.561 60.074 3.163   1.00 27.37  ?  56   PHE G HE1  1 
ATOM   10238 H  HE2  . PHE G  1 56 ? 78.801 61.587 0.211   1.00 31.41  ?  56   PHE G HE2  1 
ATOM   10239 H  HZ   . PHE G  1 56 ? 77.695 59.796 1.165   1.00 29.76  ?  56   PHE G HZ   1 
ATOM   10240 N  N    . ASP G  1 57 ? 79.979 66.686 4.069   1.00 36.15  ?  57   ASP G N    1 
ATOM   10241 C  CA   . ASP G  1 57 ? 80.309 68.100 4.178   1.00 38.17  ?  57   ASP G CA   1 
ATOM   10242 C  C    . ASP G  1 57 ? 80.194 68.764 2.808   1.00 35.51  ?  57   ASP G C    1 
ATOM   10243 O  O    . ASP G  1 57 ? 81.135 68.739 2.014   1.00 37.75  ?  57   ASP G O    1 
ATOM   10244 C  CB   . ASP G  1 57 ? 81.725 68.274 4.729   1.00 40.99  ?  57   ASP G CB   1 
ATOM   10245 C  CG   . ASP G  1 57 ? 82.031 69.708 5.113   1.00 45.13  ?  57   ASP G CG   1 
ATOM   10246 O  OD1  . ASP G  1 57 ? 81.307 70.617 4.657   1.00 46.23  ?  57   ASP G OD1  1 
ATOM   10247 O  OD2  . ASP G  1 57 ? 82.999 69.926 5.872   1.00 46.87  ?  57   ASP G OD2  1 
ATOM   10248 H  H    . ASP G  1 57 ? 80.481 66.255 3.519   1.00 43.38  ?  57   ASP G H    1 
ATOM   10249 H  HA   . ASP G  1 57 ? 79.680 68.538 4.790   1.00 45.80  ?  57   ASP G HA   1 
ATOM   10250 H  HB2  . ASP G  1 57 ? 81.827 67.722 5.520   1.00 49.19  ?  57   ASP G HB2  1 
ATOM   10251 H  HB3  . ASP G  1 57 ? 82.364 68.002 4.051   1.00 49.19  ?  57   ASP G HB3  1 
ATOM   10252 N  N    . VAL G  1 58 ? 79.034 69.350 2.535   1.00 31.51  ?  58   VAL G N    1 
ATOM   10253 C  CA   . VAL G  1 58 ? 78.784 70.001 1.254   1.00 30.64  ?  58   VAL G CA   1 
ATOM   10254 C  C    . VAL G  1 58 ? 78.264 71.412 1.487   1.00 29.70  ?  58   VAL G C    1 
ATOM   10255 O  O    . VAL G  1 58 ? 78.069 71.822 2.628   1.00 31.19  ?  58   VAL G O    1 
ATOM   10256 C  CB   . VAL G  1 58 ? 77.771 69.206 0.409   1.00 29.97  ?  58   VAL G CB   1 
ATOM   10257 C  CG1  . VAL G  1 58 ? 78.348 67.846 0.036   1.00 31.76  ?  58   VAL G CG1  1 
ATOM   10258 C  CG2  . VAL G  1 58 ? 76.457 69.046 1.159   1.00 27.74  ?  58   VAL G CG2  1 
ATOM   10259 H  H    . VAL G  1 58 ? 78.369 69.385 3.079   1.00 37.81  ?  58   VAL G H    1 
ATOM   10260 H  HA   . VAL G  1 58 ? 79.624 70.061 0.752   1.00 36.76  ?  58   VAL G HA   1 
ATOM   10261 H  HB   . VAL G  1 58 ? 77.591 69.697 -0.420  1.00 35.97  ?  58   VAL G HB   1 
ATOM   10262 H  HG11 . VAL G  1 58 ? 78.543 67.359 0.840   1.00 38.11  ?  58   VAL G HG11 1 
ATOM   10263 H  HG12 . VAL G  1 58 ? 77.703 67.367 -0.489  1.00 38.11  ?  58   VAL G HG12 1 
ATOM   10264 H  HG13 . VAL G  1 58 ? 79.152 67.977 -0.472  1.00 38.11  ?  58   VAL G HG13 1 
ATOM   10265 H  HG21 . VAL G  1 58 ? 76.097 69.916 1.346   1.00 33.28  ?  58   VAL G HG21 1 
ATOM   10266 H  HG22 . VAL G  1 58 ? 75.844 68.549 0.612   1.00 33.28  ?  58   VAL G HG22 1 
ATOM   10267 H  HG23 . VAL G  1 58 ? 76.621 68.575 1.979   1.00 33.28  ?  58   VAL G HG23 1 
ATOM   10268 N  N    . ASN G  1 59 ? 78.034 72.154 0.410   1.00 28.44  ?  59   ASN G N    1 
ATOM   10269 C  CA   . ASN G  1 59 ? 77.643 73.555 0.531   1.00 30.73  ?  59   ASN G CA   1 
ATOM   10270 C  C    . ASN G  1 59 ? 76.139 73.813 0.399   1.00 29.60  ?  59   ASN G C    1 
ATOM   10271 O  O    . ASN G  1 59 ? 75.686 74.937 0.604   1.00 30.85  ?  59   ASN G O    1 
ATOM   10272 C  CB   . ASN G  1 59 ? 78.407 74.403 -0.488  1.00 37.83  ?  59   ASN G CB   1 
ATOM   10273 C  CG   . ASN G  1 59 ? 79.897 74.466 -0.192  1.00 44.55  ?  59   ASN G CG   1 
ATOM   10274 O  OD1  . ASN G  1 59 ? 80.436 73.632 0.538   1.00 45.51  ?  59   ASN G OD1  1 
ATOM   10275 N  ND2  . ASN G  1 59 ? 80.569 75.459 -0.759  1.00 49.11  ?  59   ASN G ND2  1 
ATOM   10276 H  H    . ASN G  1 59 ? 78.096 71.872 -0.400  1.00 34.12  ?  59   ASN G H    1 
ATOM   10277 H  HA   . ASN G  1 59 ? 77.909 73.866 1.422   1.00 36.87  ?  59   ASN G HA   1 
ATOM   10278 H  HB2  . ASN G  1 59 ? 78.292 74.017 -1.371  1.00 45.39  ?  59   ASN G HB2  1 
ATOM   10279 H  HB3  . ASN G  1 59 ? 78.059 75.308 -0.472  1.00 45.39  ?  59   ASN G HB3  1 
ATOM   10280 H  HD21 . ASN G  1 59 ? 80.160 76.024 -1.262  1.00 58.93  ?  59   ASN G HD21 1 
ATOM   10281 H  HD22 . ASN G  1 59 ? 81.415 75.539 -0.623  1.00 58.93  ?  59   ASN G HD22 1 
ATOM   10282 N  N    . SER G  1 60 ? 75.363 72.788 0.061   1.00 29.00  ?  60   SER G N    1 
ATOM   10283 C  CA   . SER G  1 60 ? 73.917 72.965 -0.066  1.00 28.09  ?  60   SER G CA   1 
ATOM   10284 C  C    . SER G  1 60 ? 73.168 71.640 -0.025  1.00 25.51  ?  60   SER G C    1 
ATOM   10285 O  O    . SER G  1 60 ? 73.766 70.579 -0.196  1.00 24.98  ?  60   SER G O    1 
ATOM   10286 C  CB   . SER G  1 60 ? 73.583 73.699 -1.367  1.00 29.69  ?  60   SER G CB   1 
ATOM   10287 O  OG   . SER G  1 60 ? 73.864 72.892 -2.497  1.00 29.06  ?  60   SER G OG   1 
ATOM   10288 H  H    . SER G  1 60 ? 75.643 71.991 -0.098  1.00 34.80  ?  60   SER G H    1 
ATOM   10289 H  HA   . SER G  1 60 ? 73.598 73.514 0.680   1.00 33.71  ?  60   SER G HA   1 
ATOM   10290 H  HB2  . SER G  1 60 ? 72.639 73.924 -1.369  1.00 35.63  ?  60   SER G HB2  1 
ATOM   10291 H  HB3  . SER G  1 60 ? 74.116 74.508 -1.418  1.00 35.63  ?  60   SER G HB3  1 
ATOM   10292 H  HG   . SER G  1 60 ? 73.681 73.298 -3.185  1.00 34.87  ?  60   SER G HG   1 
ATOM   10293 N  N    . HIS G  1 61 ? 71.857 71.712 0.205   1.00 23.69  ?  61   HIS G N    1 
ATOM   10294 C  CA   . HIS G  1 61 ? 71.006 70.526 0.176   1.00 22.34  ?  61   HIS G CA   1 
ATOM   10295 C  C    . HIS G  1 61 ? 71.086 69.882 -1.202  1.00 21.46  ?  61   HIS G C    1 
ATOM   10296 O  O    . HIS G  1 61 ? 71.124 68.656 -1.334  1.00 20.69  ?  61   HIS G O    1 
ATOM   10297 C  CB   . HIS G  1 61 ? 69.543 70.886 0.463   1.00 23.81  ?  61   HIS G CB   1 
ATOM   10298 C  CG   . HIS G  1 61 ? 69.328 71.612 1.755   1.00 24.86  ?  61   HIS G CG   1 
ATOM   10299 N  ND1  . HIS G  1 61 ? 70.234 71.581 2.793   1.00 24.67  ?  61   HIS G ND1  1 
ATOM   10300 C  CD2  . HIS G  1 61 ? 68.302 72.390 2.176   1.00 24.45  ?  61   HIS G CD2  1 
ATOM   10301 C  CE1  . HIS G  1 61 ? 69.776 72.309 3.797   1.00 24.19  ?  61   HIS G CE1  1 
ATOM   10302 N  NE2  . HIS G  1 61 ? 68.605 72.810 3.447   1.00 24.10  ?  61   HIS G NE2  1 
ATOM   10303 H  H    . HIS G  1 61 ? 71.435 72.440 0.381   1.00 28.43  ?  61   HIS G H    1 
ATOM   10304 H  HA   . HIS G  1 61 ? 71.311 69.880 0.846   1.00 26.81  ?  61   HIS G HA   1 
ATOM   10305 H  HB2  . HIS G  1 61 ? 69.217 71.454 -0.253  1.00 28.57  ?  61   HIS G HB2  1 
ATOM   10306 H  HB3  . HIS G  1 61 ? 69.022 70.068 0.494   1.00 28.57  ?  61   HIS G HB3  1 
ATOM   10307 H  HD1  . HIS G  1 61 ? 70.981 71.155 2.788   1.00 29.60  ?  61   HIS G HD1  1 
ATOM   10308 H  HD2  . HIS G  1 61 ? 67.535 72.600 1.693   1.00 29.34  ?  61   HIS G HD2  1 
ATOM   10309 H  HE1  . HIS G  1 61 ? 70.205 72.445 4.610   1.00 29.03  ?  61   HIS G HE1  1 
ATOM   10310 H  HE2  . HIS G  1 61 ? 68.113 73.318 3.937   1.00 28.92  ?  61   HIS G HE2  1 
ATOM   10311 N  N    . ASP G  1 62 ? 71.105 70.723 -2.231  1.00 22.97  ?  62   ASP G N    1 
ATOM   10312 C  CA   . ASP G  1 62 ? 71.105 70.248 -3.607  1.00 25.54  ?  62   ASP G CA   1 
ATOM   10313 C  C    . ASP G  1 62 ? 72.382 69.477 -3.925  1.00 25.49  ?  62   ASP G C    1 
ATOM   10314 O  O    . ASP G  1 62 ? 72.335 68.440 -4.586  1.00 23.66  ?  62   ASP G O    1 
ATOM   10315 C  CB   . ASP G  1 62 ? 70.924 71.420 -4.576  1.00 31.14  ?  62   ASP G CB   1 
ATOM   10316 C  CG   . ASP G  1 62 ? 69.531 72.022 -4.504  1.00 36.45  ?  62   ASP G CG   1 
ATOM   10317 O  OD1  . ASP G  1 62 ? 68.587 71.288 -4.142  1.00 37.11  ?  62   ASP G OD1  1 
ATOM   10318 O  OD2  . ASP G  1 62 ? 69.376 73.224 -4.807  1.00 40.84  ?  62   ASP G OD2  1 
ATOM   10319 H  H    . ASP G  1 62 ? 71.118 71.579 -2.156  1.00 27.56  ?  62   ASP G H    1 
ATOM   10320 H  HA   . ASP G  1 62 ? 70.348 69.638 -3.731  1.00 30.64  ?  62   ASP G HA   1 
ATOM   10321 H  HB2  . ASP G  1 62 ? 71.564 72.115 -4.357  1.00 37.37  ?  62   ASP G HB2  1 
ATOM   10322 H  HB3  . ASP G  1 62 ? 71.070 71.107 -5.483  1.00 37.37  ?  62   ASP G HB3  1 
ATOM   10323 N  N    . GLU G  1 63 ? 73.520 69.974 -3.453  1.00 26.35  ?  63   GLU G N    1 
ATOM   10324 C  CA   . GLU G  1 63 ? 74.769 69.240 -3.615  1.00 29.05  ?  63   GLU G CA   1 
ATOM   10325 C  C    . GLU G  1 63 ? 74.656 67.857 -2.978  1.00 27.27  ?  63   GLU G C    1 
ATOM   10326 O  O    . GLU G  1 63 ? 75.063 66.861 -3.576  1.00 29.60  ?  63   GLU G O    1 
ATOM   10327 C  CB   . GLU G  1 63 ? 75.947 70.012 -3.015  1.00 32.29  ?  63   GLU G CB   1 
ATOM   10328 C  CG   . GLU G  1 63 ? 76.378 71.215 -3.842  1.00 36.99  ?  63   GLU G CG   1 
ATOM   10329 C  CD   . GLU G  1 63 ? 77.626 71.887 -3.299  1.00 41.80  ?  63   GLU G CD   1 
ATOM   10330 O  OE1  . GLU G  1 63 ? 78.194 71.383 -2.307  1.00 42.77  ?  63   GLU G OE1  1 
ATOM   10331 O  OE2  . GLU G  1 63 ? 78.042 72.919 -3.870  1.00 45.16  ?  63   GLU G OE2  1 
ATOM   10332 H  H    . GLU G  1 63 ? 73.596 70.725 -3.041  1.00 31.62  ?  63   GLU G H    1 
ATOM   10333 H  HA   . GLU G  1 63 ? 74.945 69.119 -4.571  1.00 34.86  ?  63   GLU G HA   1 
ATOM   10334 H  HB2  . GLU G  1 63 ? 75.695 70.332 -2.135  1.00 38.75  ?  63   GLU G HB2  1 
ATOM   10335 H  HB3  . GLU G  1 63 ? 76.708 69.414 -2.942  1.00 38.75  ?  63   GLU G HB3  1 
ATOM   10336 H  HG2  . GLU G  1 63 ? 76.564 70.924 -4.749  1.00 44.39  ?  63   GLU G HG2  1 
ATOM   10337 H  HG3  . GLU G  1 63 ? 75.662 71.869 -3.845  1.00 44.39  ?  63   GLU G HG3  1 
ATOM   10338 N  N    . LEU G  1 64 ? 74.092 67.791 -1.774  1.00 23.81  ?  64   LEU G N    1 
ATOM   10339 C  CA   . LEU G  1 64 ? 73.928 66.509 -1.093  1.00 21.92  ?  64   LEU G CA   1 
ATOM   10340 C  C    . LEU G  1 64 ? 73.027 65.566 -1.889  1.00 21.20  ?  64   LEU G C    1 
ATOM   10341 O  O    . LEU G  1 64 ? 73.373 64.405 -2.097  1.00 20.92  ?  64   LEU G O    1 
ATOM   10342 C  CB   . LEU G  1 64 ? 73.361 66.695 0.318   1.00 22.50  ?  64   LEU G CB   1 
ATOM   10343 C  CG   . LEU G  1 64 ? 73.176 65.386 1.093   1.00 23.95  ?  64   LEU G CG   1 
ATOM   10344 C  CD1  . LEU G  1 64 ? 74.518 64.697 1.305   1.00 25.22  ?  64   LEU G CD1  1 
ATOM   10345 C  CD2  . LEU G  1 64 ? 72.479 65.616 2.425   1.00 24.10  ?  64   LEU G CD2  1 
ATOM   10346 H  H    . LEU G  1 64 ? 73.798 68.468 -1.334  1.00 28.57  ?  64   LEU G H    1 
ATOM   10347 H  HA   . LEU G  1 64 ? 74.807 66.083 -1.009  1.00 26.31  ?  64   LEU G HA   1 
ATOM   10348 H  HB2  . LEU G  1 64 ? 73.967 67.257 0.826   1.00 27.00  ?  64   LEU G HB2  1 
ATOM   10349 H  HB3  . LEU G  1 64 ? 72.494 67.125 0.251   1.00 27.00  ?  64   LEU G HB3  1 
ATOM   10350 H  HG   . LEU G  1 64 ? 72.619 64.790 0.568   1.00 28.74  ?  64   LEU G HG   1 
ATOM   10351 H  HD11 . LEU G  1 64 ? 75.093 65.281 1.805   1.00 30.26  ?  64   LEU G HD11 1 
ATOM   10352 H  HD12 . LEU G  1 64 ? 74.376 63.882 1.792   1.00 30.26  ?  64   LEU G HD12 1 
ATOM   10353 H  HD13 . LEU G  1 64 ? 74.908 64.505 0.450   1.00 30.26  ?  64   LEU G HD13 1 
ATOM   10354 H  HD21 . LEU G  1 64 ? 71.615 66.001 2.263   1.00 28.92  ?  64   LEU G HD21 1 
ATOM   10355 H  HD22 . LEU G  1 64 ? 72.384 64.774 2.877   1.00 28.92  ?  64   LEU G HD22 1 
ATOM   10356 H  HD23 . LEU G  1 64 ? 73.010 66.214 2.956   1.00 28.92  ?  64   LEU G HD23 1 
ATOM   10357 N  N    . HIS G  1 65 ? 71.873 66.062 -2.327  1.00 20.87  ?  65   HIS G N    1 
ATOM   10358 C  CA   . HIS G  1 65 ? 70.924 65.228 -3.062  1.00 21.76  ?  65   HIS G CA   1 
ATOM   10359 C  C    . HIS G  1 65 ? 71.561 64.643 -4.322  1.00 23.18  ?  65   HIS G C    1 
ATOM   10360 O  O    . HIS G  1 65 ? 71.444 63.446 -4.582  1.00 22.79  ?  65   HIS G O    1 
ATOM   10361 C  CB   . HIS G  1 65 ? 69.660 66.016 -3.429  1.00 22.59  ?  65   HIS G CB   1 
ATOM   10362 C  CG   . HIS G  1 65 ? 68.744 65.280 -4.360  1.00 24.41  ?  65   HIS G CG   1 
ATOM   10363 N  ND1  . HIS G  1 65 ? 67.685 64.514 -3.920  1.00 25.35  ?  65   HIS G ND1  1 
ATOM   10364 C  CD2  . HIS G  1 65 ? 68.739 65.184 -5.711  1.00 26.40  ?  65   HIS G CD2  1 
ATOM   10365 C  CE1  . HIS G  1 65 ? 67.065 63.984 -4.959  1.00 26.50  ?  65   HIS G CE1  1 
ATOM   10366 N  NE2  . HIS G  1 65 ? 67.685 64.373 -6.056  1.00 27.13  ?  65   HIS G NE2  1 
ATOM   10367 H  H    . HIS G  1 65 ? 71.615 66.874 -2.213  1.00 25.04  ?  65   HIS G H    1 
ATOM   10368 H  HA   . HIS G  1 65 ? 70.654 64.480 -2.489  1.00 26.11  ?  65   HIS G HA   1 
ATOM   10369 H  HB2  . HIS G  1 65 ? 69.165 66.211 -2.618  1.00 27.11  ?  65   HIS G HB2  1 
ATOM   10370 H  HB3  . HIS G  1 65 ? 69.922 66.843 -3.862  1.00 27.11  ?  65   HIS G HB3  1 
ATOM   10371 H  HD1  . HIS G  1 65 ? 67.461 64.401 -3.097  1.00 30.42  ?  65   HIS G HD1  1 
ATOM   10372 H  HD2  . HIS G  1 65 ? 69.336 65.591 -6.296  1.00 31.68  ?  65   HIS G HD2  1 
ATOM   10373 H  HE1  . HIS G  1 65 ? 66.319 63.430 -4.922  1.00 31.80  ?  65   HIS G HE1  1 
ATOM   10374 H  HE2  . HIS G  1 65 ? 67.463 64.157 -6.859  1.00 32.55  ?  65   HIS G HE2  1 
ATOM   10375 N  N    . GLU G  1 66 ? 72.235 65.484 -5.100  1.00 24.87  ?  66   GLU G N    1 
ATOM   10376 C  CA   . GLU G  1 66 ? 72.883 65.028 -6.328  1.00 30.05  ?  66   GLU G CA   1 
ATOM   10377 C  C    . GLU G  1 66 ? 73.864 63.896 -6.044  1.00 28.20  ?  66   GLU G C    1 
ATOM   10378 O  O    . GLU G  1 66 ? 73.928 62.915 -6.786  1.00 28.90  ?  66   GLU G O    1 
ATOM   10379 C  CB   . GLU G  1 66 ? 73.612 66.182 -7.021  1.00 37.64  ?  66   GLU G CB   1 
ATOM   10380 C  CG   . GLU G  1 66 ? 72.686 67.222 -7.630  1.00 46.10  ?  66   GLU G CG   1 
ATOM   10381 C  CD   . GLU G  1 66 ? 73.439 68.314 -8.366  1.00 56.80  ?  66   GLU G CD   1 
ATOM   10382 O  OE1  . GLU G  1 66 ? 74.463 68.001 -9.013  1.00 61.34  ?  66   GLU G OE1  1 
ATOM   10383 O  OE2  . GLU G  1 66 ? 73.009 69.487 -8.295  1.00 60.80  ?  66   GLU G OE2  1 
ATOM   10384 H  H    . GLU G  1 66 ? 72.333 66.323 -4.941  1.00 29.84  ?  66   GLU G H    1 
ATOM   10385 H  HA   . GLU G  1 66 ? 72.199 64.689 -6.943  1.00 36.05  ?  66   GLU G HA   1 
ATOM   10386 H  HB2  . GLU G  1 66 ? 74.174 66.631 -6.370  1.00 45.17  ?  66   GLU G HB2  1 
ATOM   10387 H  HB3  . GLU G  1 66 ? 74.161 65.821 -7.735  1.00 45.17  ?  66   GLU G HB3  1 
ATOM   10388 H  HG2  . GLU G  1 66 ? 72.093 66.787 -8.263  1.00 55.32  ?  66   GLU G HG2  1 
ATOM   10389 H  HG3  . GLU G  1 66 ? 72.168 67.638 -6.922  1.00 55.32  ?  66   GLU G HG3  1 
ATOM   10390 N  N    . ILE G  1 67 ? 74.628 64.036 -4.967  1.00 26.59  ?  67   ILE G N    1 
ATOM   10391 C  CA   . ILE G  1 67 ? 75.591 63.012 -4.589  1.00 27.34  ?  67   ILE G CA   1 
ATOM   10392 C  C    . ILE G  1 67 ? 74.885 61.700 -4.263  1.00 25.83  ?  67   ILE G C    1 
ATOM   10393 O  O    . ILE G  1 67 ? 75.220 60.654 -4.820  1.00 28.27  ?  67   ILE G O    1 
ATOM   10394 C  CB   . ILE G  1 67 ? 76.444 63.456 -3.386  1.00 28.01  ?  67   ILE G CB   1 
ATOM   10395 C  CG1  . ILE G  1 67 ? 77.445 64.528 -3.828  1.00 31.72  ?  67   ILE G CG1  1 
ATOM   10396 C  CG2  . ILE G  1 67 ? 77.179 62.267 -2.788  1.00 26.82  ?  67   ILE G CG2  1 
ATOM   10397 C  CD1  . ILE G  1 67 ? 78.162 65.213 -2.686  1.00 32.59  ?  67   ILE G CD1  1 
ATOM   10398 H  H    . ILE G  1 67 ? 74.608 64.714 -4.439  1.00 31.91  ?  67   ILE G H    1 
ATOM   10399 H  HA   . ILE G  1 67 ? 76.195 62.850 -5.343  1.00 32.80  ?  67   ILE G HA   1 
ATOM   10400 H  HB   . ILE G  1 67 ? 75.859 63.834 -2.711  1.00 33.62  ?  67   ILE G HB   1 
ATOM   10401 H  HG12 . ILE G  1 67 ? 78.117 64.113 -4.391  1.00 38.07  ?  67   ILE G HG12 1 
ATOM   10402 H  HG13 . ILE G  1 67 ? 76.971 65.209 -4.330  1.00 38.07  ?  67   ILE G HG13 1 
ATOM   10403 H  HG21 . ILE G  1 67 ? 77.751 61.885 -3.458  1.00 32.18  ?  67   ILE G HG21 1 
ATOM   10404 H  HG22 . ILE G  1 67 ? 77.703 62.567 -2.042  1.00 32.18  ?  67   ILE G HG22 1 
ATOM   10405 H  HG23 . ILE G  1 67 ? 76.535 61.617 -2.496  1.00 32.18  ?  67   ILE G HG23 1 
ATOM   10406 H  HD11 . ILE G  1 67 ? 78.649 64.556 -2.184  1.00 39.10  ?  67   ILE G HD11 1 
ATOM   10407 H  HD12 . ILE G  1 67 ? 78.768 65.866 -3.045  1.00 39.10  ?  67   ILE G HD12 1 
ATOM   10408 H  HD13 . ILE G  1 67 ? 77.514 65.642 -2.123  1.00 39.10  ?  67   ILE G HD13 1 
ATOM   10409 N  N    . LEU G  1 68 ? 73.904 61.757 -3.368  1.00 25.31  ?  68   LEU G N    1 
ATOM   10410 C  CA   . LEU G  1 68 ? 73.177 60.558 -2.963  1.00 23.16  ?  68   LEU G CA   1 
ATOM   10411 C  C    . LEU G  1 68 ? 72.479 59.921 -4.161  1.00 22.63  ?  68   LEU G C    1 
ATOM   10412 O  O    . LEU G  1 68 ? 72.466 58.699 -4.311  1.00 22.85  ?  68   LEU G O    1 
ATOM   10413 C  CB   . LEU G  1 68 ? 72.156 60.892 -1.875  1.00 22.34  ?  68   LEU G CB   1 
ATOM   10414 C  CG   . LEU G  1 68 ? 72.732 61.449 -0.571  1.00 22.35  ?  68   LEU G CG   1 
ATOM   10415 C  CD1  . LEU G  1 68 ? 71.615 61.778 0.411   1.00 20.99  ?  68   LEU G CD1  1 
ATOM   10416 C  CD2  . LEU G  1 68 ? 73.714 60.467 0.045   1.00 23.76  ?  68   LEU G CD2  1 
ATOM   10417 H  H    . LEU G  1 68 ? 73.639 62.477 -2.980  1.00 30.37  ?  68   LEU G H    1 
ATOM   10418 H  HA   . LEU G  1 68 ? 73.811 59.906 -2.597  1.00 27.80  ?  68   LEU G HA   1 
ATOM   10419 H  HB2  . LEU G  1 68 ? 71.540 61.554 -2.226  1.00 26.80  ?  68   LEU G HB2  1 
ATOM   10420 H  HB3  . LEU G  1 68 ? 71.668 60.083 -1.654  1.00 26.80  ?  68   LEU G HB3  1 
ATOM   10421 H  HG   . LEU G  1 68 ? 73.211 62.270 -0.764  1.00 26.82  ?  68   LEU G HG   1 
ATOM   10422 H  HD11 . LEU G  1 68 ? 71.122 60.977 0.602   1.00 25.19  ?  68   LEU G HD11 1 
ATOM   10423 H  HD12 . LEU G  1 68 ? 72.002 62.125 1.219   1.00 25.19  ?  68   LEU G HD12 1 
ATOM   10424 H  HD13 . LEU G  1 68 ? 71.036 62.434 0.017   1.00 25.19  ?  68   LEU G HD13 1 
ATOM   10425 H  HD21 . LEU G  1 68 ? 74.431 60.313 -0.575  1.00 28.51  ?  68   LEU G HD21 1 
ATOM   10426 H  HD22 . LEU G  1 68 ? 74.060 60.840 0.859   1.00 28.51  ?  68   LEU G HD22 1 
ATOM   10427 H  HD23 . LEU G  1 68 ? 73.257 59.643 0.229   1.00 28.51  ?  68   LEU G HD23 1 
ATOM   10428 N  N    . TRP G  1 69 ? 71.908 60.766 -5.012  1.00 20.30  ?  69   TRP G N    1 
ATOM   10429 C  CA   . TRP G  1 69 ? 71.185 60.321 -6.198  1.00 21.94  ?  69   TRP G CA   1 
ATOM   10430 C  C    . TRP G  1 69 ? 72.083 59.510 -7.134  1.00 23.54  ?  69   TRP G C    1 
ATOM   10431 O  O    . TRP G  1 69 ? 71.618 58.591 -7.809  1.00 24.32  ?  69   TRP G O    1 
ATOM   10432 C  CB   . TRP G  1 69 ? 70.634 61.545 -6.934  1.00 23.82  ?  69   TRP G CB   1 
ATOM   10433 C  CG   . TRP G  1 69 ? 69.605 61.249 -7.986  1.00 26.09  ?  69   TRP G CG   1 
ATOM   10434 C  CD1  . TRP G  1 69 ? 69.812 61.143 -9.332  1.00 29.57  ?  69   TRP G CD1  1 
ATOM   10435 C  CD2  . TRP G  1 69 ? 68.201 61.048 -7.779  1.00 26.78  ?  69   TRP G CD2  1 
ATOM   10436 N  NE1  . TRP G  1 69 ? 68.624 60.884 -9.974  1.00 30.93  ?  69   TRP G NE1  1 
ATOM   10437 C  CE2  . TRP G  1 69 ? 67.621 60.819 -9.043  1.00 29.44  ?  69   TRP G CE2  1 
ATOM   10438 C  CE3  . TRP G  1 69 ? 67.380 61.037 -6.648  1.00 25.67  ?  69   TRP G CE3  1 
ATOM   10439 C  CZ2  . TRP G  1 69 ? 66.256 60.580 -9.207  1.00 30.85  ?  69   TRP G CZ2  1 
ATOM   10440 C  CZ3  . TRP G  1 69 ? 66.025 60.799 -6.812  1.00 27.44  ?  69   TRP G CZ3  1 
ATOM   10441 C  CH2  . TRP G  1 69 ? 65.477 60.573 -8.082  1.00 29.80  ?  69   TRP G CH2  1 
ATOM   10442 H  H    . TRP G  1 69 ? 71.927 61.621 -4.922  1.00 24.36  ?  69   TRP G H    1 
ATOM   10443 H  HA   . TRP G  1 69 ? 70.431 59.757 -5.928  1.00 26.33  ?  69   TRP G HA   1 
ATOM   10444 H  HB2  . TRP G  1 69 ? 70.225 62.136 -6.284  1.00 28.59  ?  69   TRP G HB2  1 
ATOM   10445 H  HB3  . TRP G  1 69 ? 71.372 62.000 -7.369  1.00 28.59  ?  69   TRP G HB3  1 
ATOM   10446 H  HD1  . TRP G  1 69 ? 70.636 61.235 -9.753  1.00 35.49  ?  69   TRP G HD1  1 
ATOM   10447 H  HE1  . TRP G  1 69 ? 68.527 60.776 -10.822 1.00 37.12  ?  69   TRP G HE1  1 
ATOM   10448 H  HE3  . TRP G  1 69 ? 67.736 61.187 -5.802  1.00 30.81  ?  69   TRP G HE3  1 
ATOM   10449 H  HZ2  . TRP G  1 69 ? 65.890 60.428 -10.048 1.00 37.02  ?  69   TRP G HZ2  1 
ATOM   10450 H  HZ3  . TRP G  1 69 ? 65.469 60.789 -6.066  1.00 32.92  ?  69   TRP G HZ3  1 
ATOM   10451 H  HH2  . TRP G  1 69 ? 64.564 60.415 -8.162  1.00 35.76  ?  69   TRP G HH2  1 
ATOM   10452 N  N    . SER G  1 70 ? 73.369 59.848 -7.164  1.00 24.17  ?  70   SER G N    1 
ATOM   10453 C  CA   . SER G  1 70 ? 74.306 59.215 -8.087  1.00 28.29  ?  70   SER G CA   1 
ATOM   10454 C  C    . SER G  1 70 ? 74.971 57.965 -7.508  1.00 27.50  ?  70   SER G C    1 
ATOM   10455 O  O    . SER G  1 70 ? 75.670 57.246 -8.223  1.00 29.59  ?  70   SER G O    1 
ATOM   10456 C  CB   . SER G  1 70 ? 75.382 60.217 -8.517  1.00 32.58  ?  70   SER G CB   1 
ATOM   10457 O  OG   . SER G  1 70 ? 76.233 60.563 -7.436  1.00 34.05  ?  70   SER G OG   1 
ATOM   10458 H  H    . SER G  1 70 ? 73.726 60.444 -6.656  1.00 29.00  ?  70   SER G H    1 
ATOM   10459 H  HA   . SER G  1 70 ? 73.816 58.944 -8.891  1.00 33.95  ?  70   SER G HA   1 
ATOM   10460 H  HB2  . SER G  1 70 ? 75.917 59.819 -9.222  1.00 39.09  ?  70   SER G HB2  1 
ATOM   10461 H  HB3  . SER G  1 70 ? 74.950 61.020 -8.846  1.00 39.09  ?  70   SER G HB3  1 
ATOM   10462 H  HG   . SER G  1 70 ? 76.001 60.164 -6.758  1.00 40.86  ?  70   SER G HG   1 
ATOM   10463 N  N    . LEU G  1 71 ? 74.761 57.704 -6.221  1.00 24.75  ?  71   LEU G N    1 
ATOM   10464 C  CA   . LEU G  1 71 ? 75.351 56.528 -5.589  1.00 26.29  ?  71   LEU G CA   1 
ATOM   10465 C  C    . LEU G  1 71 ? 74.890 55.257 -6.295  1.00 28.09  ?  71   LEU G C    1 
ATOM   10466 O  O    . LEU G  1 71 ? 73.695 55.071 -6.525  1.00 28.87  ?  71   LEU G O    1 
ATOM   10467 C  CB   . LEU G  1 71 ? 74.974 56.462 -4.109  1.00 25.99  ?  71   LEU G CB   1 
ATOM   10468 C  CG   . LEU G  1 71 ? 75.512 57.585 -3.220  1.00 25.78  ?  71   LEU G CG   1 
ATOM   10469 C  CD1  . LEU G  1 71 ? 75.057 57.373 -1.785  1.00 24.87  ?  71   LEU G CD1  1 
ATOM   10470 C  CD2  . LEU G  1 71 ? 77.028 57.663 -3.293  1.00 25.91  ?  71   LEU G CD2  1 
ATOM   10471 H  H    . LEU G  1 71 ? 74.284 58.189 -5.695  1.00 29.70  ?  71   LEU G H    1 
ATOM   10472 H  HA   . LEU G  1 71 ? 76.327 56.581 -5.656  1.00 31.54  ?  71   LEU G HA   1 
ATOM   10473 H  HB2  . LEU G  1 71 ? 74.007 56.480 -4.041  1.00 31.19  ?  71   LEU G HB2  1 
ATOM   10474 H  HB3  . LEU G  1 71 ? 75.307 55.625 -3.748  1.00 31.19  ?  71   LEU G HB3  1 
ATOM   10475 H  HG   . LEU G  1 71 ? 75.153 58.432 -3.527  1.00 30.93  ?  71   LEU G HG   1 
ATOM   10476 H  HD11 . LEU G  1 71 ? 75.392 56.529 -1.473  1.00 29.84  ?  71   LEU G HD11 1 
ATOM   10477 H  HD12 . LEU G  1 71 ? 75.402 58.085 -1.240  1.00 29.84  ?  71   LEU G HD12 1 
ATOM   10478 H  HD13 . LEU G  1 71 ? 74.098 57.376 -1.758  1.00 29.84  ?  71   LEU G HD13 1 
ATOM   10479 H  HD21 . LEU G  1 71 ? 77.288 57.834 -4.202  1.00 31.09  ?  71   LEU G HD21 1 
ATOM   10480 H  HD22 . LEU G  1 71 ? 77.332 58.375 -2.726  1.00 31.09  ?  71   LEU G HD22 1 
ATOM   10481 H  HD23 . LEU G  1 71 ? 77.398 56.828 -2.998  1.00 31.09  ?  71   LEU G HD23 1 
ATOM   10482 N  N    . PRO G  1 72 ? 75.839 54.378 -6.650  1.00 29.21  ?  72   PRO G N    1 
ATOM   10483 C  CA   . PRO G  1 72 ? 75.507 53.124 -7.336  1.00 29.44  ?  72   PRO G CA   1 
ATOM   10484 C  C    . PRO G  1 72 ? 74.413 52.316 -6.640  1.00 30.08  ?  72   PRO G C    1 
ATOM   10485 O  O    . PRO G  1 72 ? 73.563 51.742 -7.317  1.00 31.87  ?  72   PRO G O    1 
ATOM   10486 C  CB   . PRO G  1 72 ? 76.832 52.360 -7.314  1.00 29.97  ?  72   PRO G CB   1 
ATOM   10487 C  CG   . PRO G  1 72 ? 77.863 53.427 -7.338  1.00 30.39  ?  72   PRO G CG   1 
ATOM   10488 C  CD   . PRO G  1 72 ? 77.297 54.557 -6.519  1.00 29.67  ?  72   PRO G CD   1 
ATOM   10489 H  HA   . PRO G  1 72 ? 75.245 53.299 -8.264  1.00 35.33  ?  72   PRO G HA   1 
ATOM   10490 H  HB2  . PRO G  1 72 ? 76.896 51.834 -6.501  1.00 35.97  ?  72   PRO G HB2  1 
ATOM   10491 H  HB3  . PRO G  1 72 ? 76.900 51.795 -8.099  1.00 35.97  ?  72   PRO G HB3  1 
ATOM   10492 H  HG2  . PRO G  1 72 ? 78.684 53.095 -6.941  1.00 36.46  ?  72   PRO G HG2  1 
ATOM   10493 H  HG3  . PRO G  1 72 ? 78.016 53.711 -8.252  1.00 36.46  ?  72   PRO G HG3  1 
ATOM   10494 H  HD2  . PRO G  1 72 ? 77.566 54.471 -5.591  1.00 35.60  ?  72   PRO G HD2  1 
ATOM   10495 H  HD3  . PRO G  1 72 ? 77.567 55.412 -6.889  1.00 35.60  ?  72   PRO G HD3  1 
ATOM   10496 N  N    . PHE G  1 73 ? 74.428 52.274 -5.311  1.00 28.19  ?  73   PHE G N    1 
ATOM   10497 C  CA   . PHE G  1 73 ? 73.454 51.473 -4.575  1.00 27.56  ?  73   PHE G CA   1 
ATOM   10498 C  C    . PHE G  1 73 ? 72.111 52.179 -4.395  1.00 24.83  ?  73   PHE G C    1 
ATOM   10499 O  O    . PHE G  1 73 ? 71.186 51.605 -3.822  1.00 22.45  ?  73   PHE G O    1 
ATOM   10500 C  CB   . PHE G  1 73 ? 74.003 51.080 -3.200  1.00 29.06  ?  73   PHE G CB   1 
ATOM   10501 C  CG   . PHE G  1 73 ? 74.858 49.843 -3.214  1.00 32.89  ?  73   PHE G CG   1 
ATOM   10502 C  CD1  . PHE G  1 73 ? 74.320 48.619 -3.572  1.00 34.45  ?  73   PHE G CD1  1 
ATOM   10503 C  CD2  . PHE G  1 73 ? 76.193 49.900 -2.852  1.00 34.62  ?  73   PHE G CD2  1 
ATOM   10504 C  CE1  . PHE G  1 73 ? 75.101 47.479 -3.581  1.00 35.25  ?  73   PHE G CE1  1 
ATOM   10505 C  CE2  . PHE G  1 73 ? 76.978 48.761 -2.858  1.00 35.51  ?  73   PHE G CE2  1 
ATOM   10506 C  CZ   . PHE G  1 73 ? 76.430 47.550 -3.223  1.00 35.64  ?  73   PHE G CZ   1 
ATOM   10507 H  H    . PHE G  1 73 ? 74.988 52.697 -4.815  1.00 33.82  ?  73   PHE G H    1 
ATOM   10508 H  HA   . PHE G  1 73 ? 73.288 50.646 -5.075  1.00 33.07  ?  73   PHE G HA   1 
ATOM   10509 H  HB2  . PHE G  1 73 ? 74.544 51.810 -2.859  1.00 34.87  ?  73   PHE G HB2  1 
ATOM   10510 H  HB3  . PHE G  1 73 ? 73.257 50.917 -2.601  1.00 34.87  ?  73   PHE G HB3  1 
ATOM   10511 H  HD1  . PHE G  1 73 ? 73.425 48.564 -3.815  1.00 41.34  ?  73   PHE G HD1  1 
ATOM   10512 H  HD2  . PHE G  1 73 ? 76.569 50.715 -2.606  1.00 41.54  ?  73   PHE G HD2  1 
ATOM   10513 H  HE1  . PHE G  1 73 ? 74.729 46.663 -3.827  1.00 42.30  ?  73   PHE G HE1  1 
ATOM   10514 H  HE2  . PHE G  1 73 ? 77.875 48.812 -2.617  1.00 42.61  ?  73   PHE G HE2  1 
ATOM   10515 H  HZ   . PHE G  1 73 ? 76.956 46.783 -3.228  1.00 42.77  ?  73   PHE G HZ   1 
ATOM   10516 N  N    . PHE G  1 74 ? 71.996 53.408 -4.892  1.00 27.67  ?  74   PHE G N    1 
ATOM   10517 C  CA   . PHE G  1 74 ? 70.827 54.234 -4.595  1.00 28.03  ?  74   PHE G CA   1 
ATOM   10518 C  C    . PHE G  1 74 ? 69.496 53.503 -4.763  1.00 29.03  ?  74   PHE G C    1 
ATOM   10519 O  O    . PHE G  1 74 ? 68.635 53.585 -3.889  1.00 27.28  ?  74   PHE G O    1 
ATOM   10520 C  CB   . PHE G  1 74 ? 70.808 55.513 -5.437  1.00 28.40  ?  74   PHE G CB   1 
ATOM   10521 C  CG   . PHE G  1 74 ? 69.674 56.432 -5.088  1.00 26.51  ?  74   PHE G CG   1 
ATOM   10522 C  CD1  . PHE G  1 74 ? 69.775 57.293 -4.008  1.00 24.52  ?  74   PHE G CD1  1 
ATOM   10523 C  CD2  . PHE G  1 74 ? 68.497 56.413 -5.814  1.00 26.83  ?  74   PHE G CD2  1 
ATOM   10524 C  CE1  . PHE G  1 74 ? 68.732 58.128 -3.669  1.00 24.35  ?  74   PHE G CE1  1 
ATOM   10525 C  CE2  . PHE G  1 74 ? 67.450 57.249 -5.481  1.00 27.05  ?  74   PHE G CE2  1 
ATOM   10526 C  CZ   . PHE G  1 74 ? 67.566 58.106 -4.404  1.00 25.88  ?  74   PHE G CZ   1 
ATOM   10527 H  H    . PHE G  1 74 ? 72.577 53.786 -5.401  1.00 33.20  ?  74   PHE G H    1 
ATOM   10528 H  HA   . PHE G  1 74 ? 70.884 54.510 -3.657  1.00 33.63  ?  74   PHE G HA   1 
ATOM   10529 H  HB2  . PHE G  1 74 ? 71.638 55.996 -5.296  1.00 34.08  ?  74   PHE G HB2  1 
ATOM   10530 H  HB3  . PHE G  1 74 ? 70.720 55.273 -6.373  1.00 34.08  ?  74   PHE G HB3  1 
ATOM   10531 H  HD1  . PHE G  1 74 ? 70.558 57.311 -3.507  1.00 29.42  ?  74   PHE G HD1  1 
ATOM   10532 H  HD2  . PHE G  1 74 ? 68.413 55.836 -6.539  1.00 32.19  ?  74   PHE G HD2  1 
ATOM   10533 H  HE1  . PHE G  1 74 ? 68.815 58.706 -2.945  1.00 29.22  ?  74   PHE G HE1  1 
ATOM   10534 H  HE2  . PHE G  1 74 ? 66.665 57.232 -5.979  1.00 32.46  ?  74   PHE G HE2  1 
ATOM   10535 H  HZ   . PHE G  1 74 ? 66.863 58.671 -4.180  1.00 31.05  ?  74   PHE G HZ   1 
ATOM   10536 N  N    . PRO G  1 75 ? 69.319 52.790 -5.886  1.00 30.51  ?  75   PRO G N    1 
ATOM   10537 C  CA   . PRO G  1 75 ? 68.043 52.105 -6.129  1.00 32.90  ?  75   PRO G CA   1 
ATOM   10538 C  C    . PRO G  1 75 ? 67.687 51.097 -5.036  1.00 31.23  ?  75   PRO G C    1 
ATOM   10539 O  O    . PRO G  1 75 ? 66.523 50.716 -4.905  1.00 33.03  ?  75   PRO G O    1 
ATOM   10540 C  CB   . PRO G  1 75 ? 68.282 51.377 -7.456  1.00 35.54  ?  75   PRO G CB   1 
ATOM   10541 C  CG   . PRO G  1 75 ? 69.413 52.099 -8.101  1.00 35.93  ?  75   PRO G CG   1 
ATOM   10542 C  CD   . PRO G  1 75 ? 70.279 52.573 -6.981  1.00 33.51  ?  75   PRO G CD   1 
ATOM   10543 H  HA   . PRO G  1 75 ? 67.315 52.753 -6.234  1.00 39.47  ?  75   PRO G HA   1 
ATOM   10544 H  HB2  . PRO G  1 75 ? 68.520 50.452 -7.283  1.00 42.64  ?  75   PRO G HB2  1 
ATOM   10545 H  HB3  . PRO G  1 75 ? 67.485 51.429 -8.006  1.00 42.64  ?  75   PRO G HB3  1 
ATOM   10546 H  HG2  . PRO G  1 75 ? 69.902 51.491 -8.677  1.00 43.11  ?  75   PRO G HG2  1 
ATOM   10547 H  HG3  . PRO G  1 75 ? 69.071 52.851 -8.610  1.00 43.11  ?  75   PRO G HG3  1 
ATOM   10548 H  HD2  . PRO G  1 75 ? 70.922 51.889 -6.738  1.00 40.21  ?  75   PRO G HD2  1 
ATOM   10549 H  HD3  . PRO G  1 75 ? 70.715 53.406 -7.220  1.00 40.21  ?  75   PRO G HD3  1 
ATOM   10550 N  N    . TYR G  1 76 ? 68.682 50.672 -4.264  1.00 28.77  ?  76   TYR G N    1 
ATOM   10551 C  CA   . TYR G  1 76 ? 68.474 49.664 -3.234  1.00 29.88  ?  76   TYR G CA   1 
ATOM   10552 C  C    . TYR G  1 76 ? 68.662 50.236 -1.834  1.00 27.96  ?  76   TYR G C    1 
ATOM   10553 O  O    . TYR G  1 76 ? 68.677 49.494 -0.855  1.00 30.26  ?  76   TYR G O    1 
ATOM   10554 C  CB   . TYR G  1 76 ? 69.447 48.503 -3.441  1.00 32.88  ?  76   TYR G CB   1 
ATOM   10555 C  CG   . TYR G  1 76 ? 69.477 47.988 -4.859  1.00 36.00  ?  76   TYR G CG   1 
ATOM   10556 C  CD1  . TYR G  1 76 ? 68.393 47.303 -5.391  1.00 37.81  ?  76   TYR G CD1  1 
ATOM   10557 C  CD2  . TYR G  1 76 ? 70.589 48.185 -5.668  1.00 37.85  ?  76   TYR G CD2  1 
ATOM   10558 C  CE1  . TYR G  1 76 ? 68.412 46.830 -6.689  1.00 41.36  ?  76   TYR G CE1  1 
ATOM   10559 C  CE2  . TYR G  1 76 ? 70.620 47.714 -6.967  1.00 41.53  ?  76   TYR G CE2  1 
ATOM   10560 C  CZ   . TYR G  1 76 ? 69.529 47.037 -7.472  1.00 44.40  ?  76   TYR G CZ   1 
ATOM   10561 O  OH   . TYR G  1 76 ? 69.552 46.566 -8.764  1.00 49.41  ?  76   TYR G OH   1 
ATOM   10562 H  H    . TYR G  1 76 ? 69.492 50.955 -4.319  1.00 34.52  ?  76   TYR G H    1 
ATOM   10563 H  HA   . TYR G  1 76 ? 67.561 49.316 -3.302  1.00 35.85  ?  76   TYR G HA   1 
ATOM   10564 H  HB2  . TYR G  1 76 ? 70.342 48.800 -3.213  1.00 39.45  ?  76   TYR G HB2  1 
ATOM   10565 H  HB3  . TYR G  1 76 ? 69.186 47.769 -2.863  1.00 39.45  ?  76   TYR G HB3  1 
ATOM   10566 H  HD1  . TYR G  1 76 ? 67.639 47.162 -4.865  1.00 45.37  ?  76   TYR G HD1  1 
ATOM   10567 H  HD2  . TYR G  1 76 ? 71.326 48.641 -5.329  1.00 45.42  ?  76   TYR G HD2  1 
ATOM   10568 H  HE1  . TYR G  1 76 ? 67.679 46.372 -7.031  1.00 49.63  ?  76   TYR G HE1  1 
ATOM   10569 H  HE2  . TYR G  1 76 ? 71.371 47.853 -7.498  1.00 49.83  ?  76   TYR G HE2  1 
ATOM   10570 H  HH   . TYR G  1 76 ? 70.170 46.035 -8.858  1.00 59.29  ?  76   TYR G HH   1 
ATOM   10571 N  N    . LEU G  1 77 ? 68.801 51.554 -1.736  1.00 27.56  ?  77   LEU G N    1 
ATOM   10572 C  CA   . LEU G  1 77 ? 69.092 52.181 -0.454  1.00 26.04  ?  77   LEU G CA   1 
ATOM   10573 C  C    . LEU G  1 77 ? 67.855 52.730 0.244   1.00 26.18  ?  77   LEU G C    1 
ATOM   10574 O  O    . LEU G  1 77 ? 66.951 53.273 -0.390  1.00 23.89  ?  77   LEU G O    1 
ATOM   10575 C  CB   . LEU G  1 77 ? 70.098 53.321 -0.625  1.00 25.73  ?  77   LEU G CB   1 
ATOM   10576 C  CG   . LEU G  1 77 ? 71.552 52.943 -0.912  1.00 26.32  ?  77   LEU G CG   1 
ATOM   10577 C  CD1  . LEU G  1 77 ? 72.409 54.196 -0.991  1.00 23.30  ?  77   LEU G CD1  1 
ATOM   10578 C  CD2  . LEU G  1 77 ? 72.094 51.992 0.143   1.00 28.71  ?  77   LEU G CD2  1 
ATOM   10579 H  H    . LEU G  1 77 ? 68.733 52.103 -2.394  1.00 33.07  ?  77   LEU G H    1 
ATOM   10580 H  HA   . LEU G  1 77 ? 69.495 51.512 0.138   1.00 31.25  ?  77   LEU G HA   1 
ATOM   10581 H  HB2  . LEU G  1 77 ? 69.799 53.877 -1.361  1.00 30.88  ?  77   LEU G HB2  1 
ATOM   10582 H  HB3  . LEU G  1 77 ? 70.098 53.846 0.191   1.00 30.88  ?  77   LEU G HB3  1 
ATOM   10583 H  HG   . LEU G  1 77 ? 71.597 52.494 -1.771  1.00 31.58  ?  77   LEU G HG   1 
ATOM   10584 H  HD11 . LEU G  1 77 ? 72.360 54.661 -0.153  1.00 27.96  ?  77   LEU G HD11 1 
ATOM   10585 H  HD12 . LEU G  1 77 ? 73.317 53.941 -1.172  1.00 27.96  ?  77   LEU G HD12 1 
ATOM   10586 H  HD13 . LEU G  1 77 ? 72.079 54.756 -1.697  1.00 27.96  ?  77   LEU G HD13 1 
ATOM   10587 H  HD21 . LEU G  1 77 ? 71.562 51.193 0.146   1.00 34.45  ?  77   LEU G HD21 1 
ATOM   10588 H  HD22 . LEU G  1 77 ? 73.005 51.777 -0.070  1.00 34.45  ?  77   LEU G HD22 1 
ATOM   10589 H  HD23 . LEU G  1 77 ? 72.050 52.420 1.001   1.00 34.45  ?  77   LEU G HD23 1 
ATOM   10590 N  N    . THR G  1 78 ? 67.836 52.568 1.561   1.00 29.50  ?  78   THR G N    1 
ATOM   10591 C  CA   . THR G  1 78 ? 66.963 53.339 2.426   1.00 32.47  ?  78   THR G CA   1 
ATOM   10592 C  C    . THR G  1 78 ? 67.842 54.403 3.064   1.00 30.59  ?  78   THR G C    1 
ATOM   10593 O  O    . THR G  1 78 ? 68.856 54.084 3.680   1.00 29.45  ?  78   THR G O    1 
ATOM   10594 C  CB   . THR G  1 78 ? 66.328 52.470 3.520   1.00 37.06  ?  78   THR G CB   1 
ATOM   10595 O  OG1  . THR G  1 78 ? 65.329 51.622 2.939   1.00 39.59  ?  78   THR G OG1  1 
ATOM   10596 C  CG2  . THR G  1 78 ? 65.687 53.342 4.594   1.00 37.30  ?  78   THR G CG2  1 
ATOM   10597 H  H    . THR G  1 78 ? 68.331 52.005 1.984   1.00 35.40  ?  78   THR G H    1 
ATOM   10598 H  HA   . THR G  1 78 ? 66.257 53.771 1.902   1.00 38.96  ?  78   THR G HA   1 
ATOM   10599 H  HB   . THR G  1 78 ? 67.013 51.923 3.937   1.00 44.48  ?  78   THR G HB   1 
ATOM   10600 H  HG1  . THR G  1 78 ? 64.986 51.154 3.519   1.00 47.51  ?  78   THR G HG1  1 
ATOM   10601 H  HG21 . THR G  1 78 ? 65.004 53.893 4.204   1.00 44.76  ?  78   THR G HG21 1 
ATOM   10602 H  HG22 . THR G  1 78 ? 65.293 52.789 5.273   1.00 44.76  ?  78   THR G HG22 1 
ATOM   10603 H  HG23 . THR G  1 78 ? 66.351 53.906 4.997   1.00 44.76  ?  78   THR G HG23 1 
ATOM   10604 N  N    . ILE G  1 79 ? 67.462 55.666 2.908   1.00 30.17  ?  79   ILE G N    1 
ATOM   10605 C  CA   . ILE G  1 79 ? 68.316 56.763 3.336   1.00 30.45  ?  79   ILE G CA   1 
ATOM   10606 C  C    . ILE G  1 79 ? 67.607 57.728 4.275   1.00 28.38  ?  79   ILE G C    1 
ATOM   10607 O  O    . ILE G  1 79 ? 66.479 58.150 4.020   1.00 29.07  ?  79   ILE G O    1 
ATOM   10608 C  CB   . ILE G  1 79 ? 68.829 57.572 2.130   1.00 31.87  ?  79   ILE G CB   1 
ATOM   10609 C  CG1  . ILE G  1 79 ? 69.630 56.672 1.186   1.00 32.63  ?  79   ILE G CG1  1 
ATOM   10610 C  CG2  . ILE G  1 79 ? 69.681 58.743 2.602   1.00 31.92  ?  79   ILE G CG2  1 
ATOM   10611 C  CD1  . ILE G  1 79 ? 70.205 57.397 -0.010  1.00 31.88  ?  79   ILE G CD1  1 
ATOM   10612 H  H    . ILE G  1 79 ? 66.716 55.912 2.559   1.00 36.21  ?  79   ILE G H    1 
ATOM   10613 H  HA   . ILE G  1 79 ? 69.093 56.397 3.808   1.00 36.54  ?  79   ILE G HA   1 
ATOM   10614 H  HB   . ILE G  1 79 ? 68.065 57.922 1.647   1.00 38.25  ?  79   ILE G HB   1 
ATOM   10615 H  HG12 . ILE G  1 79 ? 70.368 56.280 1.679   1.00 39.16  ?  79   ILE G HG12 1 
ATOM   10616 H  HG13 . ILE G  1 79 ? 69.047 55.970 0.855   1.00 39.16  ?  79   ILE G HG13 1 
ATOM   10617 H  HG21 . ILE G  1 79 ? 70.429 58.405 3.098   1.00 38.30  ?  79   ILE G HG21 1 
ATOM   10618 H  HG22 . ILE G  1 79 ? 69.989 59.232 1.836   1.00 38.30  ?  79   ILE G HG22 1 
ATOM   10619 H  HG23 . ILE G  1 79 ? 69.146 59.312 3.161   1.00 38.30  ?  79   ILE G HG23 1 
ATOM   10620 H  HD11 . ILE G  1 79 ? 70.795 58.089 0.299   1.00 38.26  ?  79   ILE G HD11 1 
ATOM   10621 H  HD12 . ILE G  1 79 ? 70.690 56.770 -0.552  1.00 38.26  ?  79   ILE G HD12 1 
ATOM   10622 H  HD13 . ILE G  1 79 ? 69.487 57.782 -0.518  1.00 38.26  ?  79   ILE G HD13 1 
ATOM   10623 N  N    . ASP G  1 80 ? 68.283 58.071 5.365   1.00 28.68  ?  80   ASP G N    1 
ATOM   10624 C  CA   A ASP G  1 80 ? 67.786 59.090 6.277   0.43 28.30  ?  80   ASP G CA   1 
ATOM   10625 C  CA   B ASP G  1 80 ? 67.791 59.082 6.290   0.57 28.36  ?  80   ASP G CA   1 
ATOM   10626 C  C    . ASP G  1 80 ? 68.802 60.218 6.374   1.00 25.87  ?  80   ASP G C    1 
ATOM   10627 O  O    . ASP G  1 80 ? 69.994 59.979 6.572   1.00 26.18  ?  80   ASP G O    1 
ATOM   10628 C  CB   A ASP G  1 80 ? 67.516 58.506 7.662   0.43 30.95  ?  80   ASP G CB   1 
ATOM   10629 C  CB   B ASP G  1 80 ? 67.563 58.477 7.675   0.57 31.08  ?  80   ASP G CB   1 
ATOM   10630 C  CG   A ASP G  1 80 ? 66.836 59.497 8.584   0.43 31.65  ?  80   ASP G CG   1 
ATOM   10631 C  CG   B ASP G  1 80 ? 66.526 57.371 7.663   0.57 34.92  ?  80   ASP G CG   1 
ATOM   10632 O  OD1  A ASP G  1 80 ? 65.590 59.584 8.547   0.43 34.02  ?  80   ASP G OD1  1 
ATOM   10633 O  OD1  B ASP G  1 80 ? 65.507 57.517 6.956   0.57 38.25  ?  80   ASP G OD1  1 
ATOM   10634 O  OD2  A ASP G  1 80 ? 67.546 60.192 9.341   0.43 31.51  ?  80   ASP G OD2  1 
ATOM   10635 O  OD2  B ASP G  1 80 ? 66.733 56.351 8.355   0.57 38.26  ?  80   ASP G OD2  1 
ATOM   10636 H  H    A ASP G  1 80 ? 69.035 57.726 5.599   0.43 34.41  ?  80   ASP G H    1 
ATOM   10637 H  H    B ASP G  1 80 ? 69.038 57.728 5.593   0.57 34.41  ?  80   ASP G H    1 
ATOM   10638 H  HA   A ASP G  1 80 ? 66.948 59.459 5.928   0.43 33.96  ?  80   ASP G HA   1 
ATOM   10639 H  HA   B ASP G  1 80 ? 66.941 59.443 5.962   0.57 34.03  ?  80   ASP G HA   1 
ATOM   10640 H  HB2  A ASP G  1 80 ? 66.938 57.732 7.572   0.43 37.14  ?  80   ASP G HB2  1 
ATOM   10641 H  HB2  B ASP G  1 80 ? 68.397 58.104 7.999   0.57 37.30  ?  80   ASP G HB2  1 
ATOM   10642 H  HB3  A ASP G  1 80 ? 68.359 58.247 8.067   0.43 37.14  ?  80   ASP G HB3  1 
ATOM   10643 H  HB3  B ASP G  1 80 ? 67.254 59.172 8.277   0.57 37.30  ?  80   ASP G HB3  1 
ATOM   10644 N  N    . VAL G  1 81 ? 68.323 61.447 6.220   1.00 24.10  ?  81   VAL G N    1 
ATOM   10645 C  CA   . VAL G  1 81 ? 69.190 62.614 6.238   1.00 24.40  ?  81   VAL G CA   1 
ATOM   10646 C  C    . VAL G  1 81 ? 68.813 63.554 7.375   1.00 25.36  ?  81   VAL G C    1 
ATOM   10647 O  O    . VAL G  1 81 ? 67.634 63.777 7.656   1.00 24.75  ?  81   VAL G O    1 
ATOM   10648 C  CB   . VAL G  1 81 ? 69.125 63.379 4.906   1.00 24.52  ?  81   VAL G CB   1 
ATOM   10649 C  CG1  . VAL G  1 81 ? 70.005 64.619 4.964   1.00 24.31  ?  81   VAL G CG1  1 
ATOM   10650 C  CG2  . VAL G  1 81 ? 69.543 62.470 3.757   1.00 25.28  ?  81   VAL G CG2  1 
ATOM   10651 H  H    . VAL G  1 81 ? 67.491 61.632 6.103   1.00 28.92  ?  81   VAL G H    1 
ATOM   10652 H  HA   . VAL G  1 81 ? 70.115 62.323 6.377   1.00 29.28  ?  81   VAL G HA   1 
ATOM   10653 H  HB   . VAL G  1 81 ? 68.202 63.668 4.746   1.00 29.42  ?  81   VAL G HB   1 
ATOM   10654 H  HG11 . VAL G  1 81 ? 70.912 64.350 5.131   1.00 29.17  ?  81   VAL G HG11 1 
ATOM   10655 H  HG12 . VAL G  1 81 ? 69.950 65.080 4.124   1.00 29.17  ?  81   VAL G HG12 1 
ATOM   10656 H  HG13 . VAL G  1 81 ? 69.696 65.188 5.672   1.00 29.17  ?  81   VAL G HG13 1 
ATOM   10657 H  HG21 . VAL G  1 81 ? 68.948 61.718 3.722   1.00 30.34  ?  81   VAL G HG21 1 
ATOM   10658 H  HG22 . VAL G  1 81 ? 69.497 62.964 2.935   1.00 30.34  ?  81   VAL G HG22 1 
ATOM   10659 H  HG23 . VAL G  1 81 ? 70.443 62.170 3.909   1.00 30.34  ?  81   VAL G HG23 1 
ATOM   10660 N  N    . GLU G  1 82 ? 69.833 64.111 8.016   1.00 26.77  ?  82   GLU G N    1 
ATOM   10661 C  CA   . GLU G  1 82 ? 69.648 64.943 9.190   1.00 29.64  ?  82   GLU G CA   1 
ATOM   10662 C  C    . GLU G  1 82 ? 70.770 65.975 9.267   1.00 29.59  ?  82   GLU G C    1 
ATOM   10663 O  O    . GLU G  1 82 ? 71.945 65.616 9.259   1.00 29.12  ?  82   GLU G O    1 
ATOM   10664 C  CB   . GLU G  1 82 ? 69.654 64.059 10.437  1.00 33.07  ?  82   GLU G CB   1 
ATOM   10665 C  CG   . GLU G  1 82 ? 69.674 64.807 11.752  1.00 38.12  ?  82   GLU G CG   1 
ATOM   10666 C  CD   . GLU G  1 82 ? 69.811 63.871 12.939  1.00 42.73  ?  82   GLU G CD   1 
ATOM   10667 O  OE1  . GLU G  1 82 ? 69.778 62.638 12.733  1.00 42.95  ?  82   GLU G OE1  1 
ATOM   10668 O  OE2  . GLU G  1 82 ? 69.956 64.367 14.076  1.00 45.89  ?  82   GLU G OE2  1 
ATOM   10669 H  H    . GLU G  1 82 ? 70.656 64.019 7.783   1.00 32.12  ?  82   GLU G H    1 
ATOM   10670 H  HA   . GLU G  1 82 ? 68.789 65.411 9.136   1.00 35.57  ?  82   GLU G HA   1 
ATOM   10671 H  HB2  . GLU G  1 82 ? 68.856 63.507 10.427  1.00 39.68  ?  82   GLU G HB2  1 
ATOM   10672 H  HB3  . GLU G  1 82 ? 70.441 63.493 10.410  1.00 39.68  ?  82   GLU G HB3  1 
ATOM   10673 H  HG2  . GLU G  1 82 ? 70.428 65.417 11.759  1.00 45.74  ?  82   GLU G HG2  1 
ATOM   10674 H  HG3  . GLU G  1 82 ? 68.845 65.300 11.850  1.00 45.74  ?  82   GLU G HG3  1 
ATOM   10675 N  N    . PRO G  1 83 ? 70.414 67.266 9.328   1.00 30.61  ?  83   PRO G N    1 
ATOM   10676 C  CA   . PRO G  1 83 ? 71.447 68.305 9.413   1.00 29.83  ?  83   PRO G CA   1 
ATOM   10677 C  C    . PRO G  1 83 ? 72.091 68.399 10.795  1.00 32.10  ?  83   PRO G C    1 
ATOM   10678 O  O    . PRO G  1 83 ? 71.418 68.208 11.808  1.00 33.16  ?  83   PRO G O    1 
ATOM   10679 C  CB   . PRO G  1 83 ? 70.678 69.590 9.093   1.00 29.82  ?  83   PRO G CB   1 
ATOM   10680 C  CG   . PRO G  1 83 ? 69.275 69.297 9.476   1.00 31.06  ?  83   PRO G CG   1 
ATOM   10681 C  CD   . PRO G  1 83 ? 69.062 67.837 9.202   1.00 31.30  ?  83   PRO G CD   1 
ATOM   10682 H  HA   . PRO G  1 83 ? 72.140 68.160 8.736   1.00 35.79  ?  83   PRO G HA   1 
ATOM   10683 H  HB2  . PRO G  1 83 ? 71.033 70.324 9.620   1.00 35.78  ?  83   PRO G HB2  1 
ATOM   10684 H  HB3  . PRO G  1 83 ? 70.743 69.784 8.145   1.00 35.78  ?  83   PRO G HB3  1 
ATOM   10685 H  HG2  . PRO G  1 83 ? 69.150 69.488 10.419  1.00 37.27  ?  83   PRO G HG2  1 
ATOM   10686 H  HG3  . PRO G  1 83 ? 68.673 69.835 8.938   1.00 37.27  ?  83   PRO G HG3  1 
ATOM   10687 H  HD2  . PRO G  1 83 ? 68.469 67.451 9.865   1.00 37.56  ?  83   PRO G HD2  1 
ATOM   10688 H  HD3  . PRO G  1 83 ? 68.723 67.708 8.302   1.00 37.56  ?  83   PRO G HD3  1 
ATOM   10689 N  N    . LEU G  1 84 ? 73.388 68.692 10.819  1.00 31.76  ?  84   LEU G N    1 
ATOM   10690 C  CA   . LEU G  1 84 ? 74.130 68.855 12.062  1.00 32.38  ?  84   LEU G CA   1 
ATOM   10691 C  C    . LEU G  1 84 ? 74.644 70.289 12.179  1.00 30.28  ?  84   LEU G C    1 
ATOM   10692 O  O    . LEU G  1 84 ? 75.112 70.866 11.198  1.00 31.32  ?  84   LEU G O    1 
ATOM   10693 C  CB   . LEU G  1 84 ? 75.314 67.888 12.102  1.00 33.67  ?  84   LEU G CB   1 
ATOM   10694 C  CG   . LEU G  1 84 ? 75.005 66.392 12.021  1.00 34.47  ?  84   LEU G CG   1 
ATOM   10695 C  CD1  . LEU G  1 84 ? 76.289 65.610 11.783  1.00 35.68  ?  84   LEU G CD1  1 
ATOM   10696 C  CD2  . LEU G  1 84 ? 74.315 65.912 13.285  1.00 34.96  ?  84   LEU G CD2  1 
ATOM   10697 H  H    . LEU G  1 84 ? 73.868 68.804 10.114  1.00 38.11  ?  84   LEU G H    1 
ATOM   10698 H  HA   . LEU G  1 84 ? 73.544 68.668 12.825  1.00 38.86  ?  84   LEU G HA   1 
ATOM   10699 H  HB2  . LEU G  1 84 ? 75.898 68.098 11.357  1.00 40.41  ?  84   LEU G HB2  1 
ATOM   10700 H  HB3  . LEU G  1 84 ? 75.793 68.034 12.933  1.00 40.41  ?  84   LEU G HB3  1 
ATOM   10701 H  HG   . LEU G  1 84 ? 74.410 66.231 11.272  1.00 41.36  ?  84   LEU G HG   1 
ATOM   10702 H  HD11 . LEU G  1 84 ? 76.893 65.773 12.511  1.00 42.82  ?  84   LEU G HD11 1 
ATOM   10703 H  HD12 . LEU G  1 84 ? 76.079 64.674 11.735  1.00 42.82  ?  84   LEU G HD12 1 
ATOM   10704 H  HD13 . LEU G  1 84 ? 76.684 65.901 10.958  1.00 42.82  ?  84   LEU G HD13 1 
ATOM   10705 H  HD21 . LEU G  1 84 ? 73.493 66.395 13.395  1.00 41.96  ?  84   LEU G HD21 1 
ATOM   10706 H  HD22 . LEU G  1 84 ? 74.134 64.972 13.204  1.00 41.96  ?  84   LEU G HD22 1 
ATOM   10707 H  HD23 . LEU G  1 84 ? 74.892 66.072 14.036  1.00 41.96  ?  84   LEU G HD23 1 
ATOM   10708 N  N    . SER G  1 85 ? 74.558 70.854 13.380  1.00 38.92  ?  85   SER G N    1 
ATOM   10709 C  CA   . SER G  1 85 ? 75.041 72.209 13.635  1.00 38.39  ?  85   SER G CA   1 
ATOM   10710 C  C    . SER G  1 85 ? 76.242 72.198 14.570  1.00 39.21  ?  85   SER G C    1 
ATOM   10711 O  O    . SER G  1 85 ? 76.557 71.178 15.183  1.00 35.47  ?  85   SER G O    1 
ATOM   10712 C  CB   . SER G  1 85 ? 73.933 73.068 14.249  1.00 36.78  ?  85   SER G CB   1 
ATOM   10713 O  OG   . SER G  1 85 ? 72.912 73.333 13.306  1.00 40.06  ?  85   SER G OG   1 
ATOM   10714 H  H    . SER G  1 85 ? 74.220 70.470 14.072  1.00 46.70  ?  85   SER G H    1 
ATOM   10715 H  HA   . SER G  1 85 ? 75.314 72.619 12.788  1.00 46.07  ?  85   SER G HA   1 
ATOM   10716 H  HB2  . SER G  1 85 ? 73.549 72.595 15.003  1.00 44.13  ?  85   SER G HB2  1 
ATOM   10717 H  HB3  . SER G  1 85 ? 74.314 73.909 14.545  1.00 44.13  ?  85   SER G HB3  1 
ATOM   10718 H  HG   . SER G  1 85 ? 73.093 72.978 12.590  1.00 48.08  ?  85   SER G HG   1 
ATOM   10719 N  N    . HIS G  1 86 ? 76.907 73.343 14.674  1.00 44.01  ?  86   HIS G N    1 
ATOM   10720 C  CA   . HIS G  1 86 ? 78.032 73.502 15.584  1.00 47.94  ?  86   HIS G CA   1 
ATOM   10721 C  C    . HIS G  1 86 ? 77.550 73.511 17.029  1.00 43.42  ?  86   HIS G C    1 
ATOM   10722 O  O    . HIS G  1 86 ? 76.676 74.297 17.395  1.00 42.51  ?  86   HIS G O    1 
ATOM   10723 C  CB   . HIS G  1 86 ? 78.774 74.805 15.283  1.00 54.55  ?  86   HIS G CB   1 
ATOM   10724 C  CG   . HIS G  1 86 ? 79.849 75.130 16.273  1.00 56.99  ?  86   HIS G CG   1 
ATOM   10725 N  ND1  . HIS G  1 86 ? 81.073 74.496 16.280  1.00 59.43  ?  86   HIS G ND1  1 
ATOM   10726 C  CD2  . HIS G  1 86 ? 79.881 76.020 17.293  1.00 57.09  ?  86   HIS G CD2  1 
ATOM   10727 C  CE1  . HIS G  1 86 ? 81.814 74.984 17.259  1.00 59.95  ?  86   HIS G CE1  1 
ATOM   10728 N  NE2  . HIS G  1 86 ? 81.113 75.910 17.889  1.00 58.63  ?  86   HIS G NE2  1 
ATOM   10729 H  H    . HIS G  1 86 ? 76.723 74.051 14.221  1.00 52.81  ?  86   HIS G H    1 
ATOM   10730 H  HA   . HIS G  1 86 ? 78.655 72.755 15.468  1.00 57.52  ?  86   HIS G HA   1 
ATOM   10731 H  HB2  . HIS G  1 86 ? 79.188 74.734 14.408  1.00 65.46  ?  86   HIS G HB2  1 
ATOM   10732 H  HB3  . HIS G  1 86 ? 78.137 75.536 15.286  1.00 65.46  ?  86   HIS G HB3  1 
ATOM   10733 H  HD1  . HIS G  1 86 ? 81.317 73.881 15.731  1.00 71.31  ?  86   HIS G HD1  1 
ATOM   10734 H  HD2  . HIS G  1 86 ? 79.197 76.599 17.542  1.00 68.51  ?  86   HIS G HD2  1 
ATOM   10735 H  HE1  . HIS G  1 86 ? 82.680 74.720 17.469  1.00 71.94  ?  86   HIS G HE1  1 
ATOM   10736 H  HE2  . HIS G  1 86 ? 81.385 76.369 18.564  1.00 70.35  ?  86   HIS G HE2  1 
ATOM   10737 N  N    . HIS G  1 87 ? 78.121 72.634 17.845  1.00 43.34  ?  87   HIS G N    1 
ATOM   10738 C  CA   . HIS G  1 87 ? 77.783 72.577 19.262  1.00 39.86  ?  87   HIS G CA   1 
ATOM   10739 C  C    . HIS G  1 87 ? 78.630 73.601 20.012  1.00 43.70  ?  87   HIS G C    1 
ATOM   10740 O  O    . HIS G  1 87 ? 79.840 73.681 19.799  1.00 42.12  ?  87   HIS G O    1 
ATOM   10741 C  CB   . HIS G  1 87 ? 78.043 71.174 19.810  1.00 38.16  ?  87   HIS G CB   1 
ATOM   10742 C  CG   . HIS G  1 87 ? 77.214 70.822 21.007  1.00 35.18  ?  87   HIS G CG   1 
ATOM   10743 N  ND1  . HIS G  1 87 ? 77.282 71.515 22.198  1.00 34.86  ?  87   HIS G ND1  1 
ATOM   10744 C  CD2  . HIS G  1 87 ? 76.309 69.833 21.200  1.00 33.57  ?  87   HIS G CD2  1 
ATOM   10745 C  CE1  . HIS G  1 87 ? 76.447 70.976 23.067  1.00 32.77  ?  87   HIS G CE1  1 
ATOM   10746 N  NE2  . HIS G  1 87 ? 75.846 69.953 22.488  1.00 31.90  ?  87   HIS G NE2  1 
ATOM   10747 H  H    . HIS G  1 87 ? 78.711 72.057 17.602  1.00 52.00  ?  87   HIS G H    1 
ATOM   10748 H  HA   . HIS G  1 87 ? 76.836 72.796 19.387  1.00 47.84  ?  87   HIS G HA   1 
ATOM   10749 H  HB2  . HIS G  1 87 ? 77.848 70.526 19.115  1.00 45.79  ?  87   HIS G HB2  1 
ATOM   10750 H  HB3  . HIS G  1 87 ? 78.976 71.108 20.067  1.00 45.79  ?  87   HIS G HB3  1 
ATOM   10751 H  HD1  . HIS G  1 87 ? 77.785 72.196 22.348  1.00 41.83  ?  87   HIS G HD1  1 
ATOM   10752 H  HD2  . HIS G  1 87 ? 76.047 69.195 20.577  1.00 40.29  ?  87   HIS G HD2  1 
ATOM   10753 H  HE1  . HIS G  1 87 ? 76.308 71.265 23.940  1.00 39.33  ?  87   HIS G HE1  1 
ATOM   10754 H  HE2  . HIS G  1 87 ? 75.258 69.445 22.857  1.00 38.27  ?  87   HIS G HE2  1 
ATOM   10755 N  N    . PRO G  1 88 ? 77.998 74.392 20.894  1.00 48.31  ?  88   PRO G N    1 
ATOM   10756 C  CA   . PRO G  1 88 ? 78.710 75.437 21.642  1.00 53.64  ?  88   PRO G CA   1 
ATOM   10757 C  C    . PRO G  1 88 ? 79.691 74.901 22.690  1.00 53.21  ?  88   PRO G C    1 
ATOM   10758 O  O    . PRO G  1 88 ? 80.243 75.687 23.461  1.00 60.23  ?  88   PRO G O    1 
ATOM   10759 C  CB   . PRO G  1 88 ? 77.576 76.213 22.323  1.00 51.87  ?  88   PRO G CB   1 
ATOM   10760 C  CG   . PRO G  1 88 ? 76.446 75.252 22.403  1.00 48.02  ?  88   PRO G CG   1 
ATOM   10761 C  CD   . PRO G  1 88 ? 76.553 74.395 21.181  1.00 48.06  ?  88   PRO G CD   1 
ATOM   10762 H  HA   . PRO G  1 88 ? 79.186 76.033 21.026  1.00 64.37  ?  88   PRO G HA   1 
ATOM   10763 H  HB2  . PRO G  1 88 ? 77.855 76.489 23.210  1.00 62.25  ?  88   PRO G HB2  1 
ATOM   10764 H  HB3  . PRO G  1 88 ? 77.336 76.982 21.783  1.00 62.25  ?  88   PRO G HB3  1 
ATOM   10765 H  HG2  . PRO G  1 88 ? 76.533 74.715 23.205  1.00 57.63  ?  88   PRO G HG2  1 
ATOM   10766 H  HG3  . PRO G  1 88 ? 75.606 75.738 22.406  1.00 57.63  ?  88   PRO G HG3  1 
ATOM   10767 H  HD2  . PRO G  1 88 ? 76.245 73.495 21.371  1.00 57.67  ?  88   PRO G HD2  1 
ATOM   10768 H  HD3  . PRO G  1 88 ? 76.063 74.792 20.445  1.00 57.67  ?  88   PRO G HD3  1 
ATOM   10769 N  N    . ALA G  1 89 ? 79.912 73.591 22.708  1.00 42.45  ?  89   ALA G N    1 
ATOM   10770 C  CA   . ALA G  1 89 ? 80.833 72.977 23.656  1.00 38.12  ?  89   ALA G CA   1 
ATOM   10771 C  C    . ALA G  1 89 ? 81.860 72.149 22.897  1.00 41.74  ?  89   ALA G C    1 
ATOM   10772 O  O    . ALA G  1 89 ? 82.663 71.437 23.498  1.00 45.19  ?  89   ALA G O    1 
ATOM   10773 C  CB   . ALA G  1 89 ? 80.076 72.105 24.650