data_3ZPL
# 
_entry.id   3ZPL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.302 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ZPL         
PDBE  EBI-56002    
WWPDB D_1290056002 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ZPL 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-02-28 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stevenson, C.E.M.' 1 
'Assaad, A.'        2 
'Lawson, D.M.'      3 
# 
_citation.id                        primary 
_citation.title                     
;Investigation of DNA Sequence Recognition by a Streptomycete Marr Family Transcriptional Regulator Through Surface Plasmon Resonance and X-Ray Crystallography.
;
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            41 
_citation.page_first                7009 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23748564 
_citation.pdbx_database_id_DOI      10.1093/NAR/GKT523 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Stevenson, C.E.M.' 1 ? 
primary 'Assaad, A.'        2 ? 
primary 'Chandra, G.'       3 ? 
primary 'Le, T.B.K.'        4 ? 
primary 'Greive, S.J.'      5 ? 
primary 'Bibb, M.J.'        6 ? 
primary 'Lawson, D.M.'      7 ? 
# 
_cell.entry_id           3ZPL 
_cell.length_a           70.800 
_cell.length_b           70.800 
_cell.length_c           557.480 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3ZPL 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSOR'                               20690.510 4  ? ? ? 
;SYNTHETIC GENE WITH OPTIMISED CODON USAGE FOR E.COLI EXPRESSION. INCLUDES N-TERMINAL HIS-TAG OF SEQUENCE MHHHHHHENLYFQG APPENDED TO WILD-TYPE SEQUENCE. SEQUENCE NUMBERING IS RELATIVE TO THE WILD-TYPE SEQUENCE.
;
2 polymer     syn 
;5'-D(*AP*AP*AP*GP*AP*TP*TP*GP*AP*GP*AP*TP*CP*TP *CP*AP*AP*TP*CP*TP*TP*DT)-3'
;
6749.401  4  ? ? ? ? 
3 non-polymer syn 'PHOSPHATE ION'                                                                94.971    4  ? ? ? ? 
4 water       nat water                                                                          18.015    14 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 SCO3205                        
2 'SYMMETRISED SCO3204 OPERATOR' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MHHHHHHENLYFQGMNDEPRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYYGLLVKLAESPRRRLRMTELAK
YAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAILTDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIV
AEGLQPSEAGADLPWLR
;
;MHHHHHHENLYFQGMNDEPRWLTAEEQLVWRSYIEAATLLEDHLDRQLQRDAGMPHVYYGLLVKLAESPRRRLRMTELAK
YAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAILTDEGYEVLRRTAPGHVDAVRQAVFDRLTPEQQKSLGEIMRIV
AEGLQPSEAGADLPWLR
;
A,B,E,F ? 
2 polydeoxyribonucleotide no no 
;(DA)(DA)(DA)(DG)(DA)(DT)(DT)(DG)(DA)(DG)(DA)(DT)(DC)(DT)(DC)(DA)(DA)(DT)(DC)(DT)
(DT)(DT)
;
AAAGATTGAGATCTCAATCTTT C,D,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   GLU n 
1 9   ASN n 
1 10  LEU n 
1 11  TYR n 
1 12  PHE n 
1 13  GLN n 
1 14  GLY n 
1 15  MET n 
1 16  ASN n 
1 17  ASP n 
1 18  GLU n 
1 19  PRO n 
1 20  ARG n 
1 21  TRP n 
1 22  LEU n 
1 23  THR n 
1 24  ALA n 
1 25  GLU n 
1 26  GLU n 
1 27  GLN n 
1 28  LEU n 
1 29  VAL n 
1 30  TRP n 
1 31  ARG n 
1 32  SER n 
1 33  TYR n 
1 34  ILE n 
1 35  GLU n 
1 36  ALA n 
1 37  ALA n 
1 38  THR n 
1 39  LEU n 
1 40  LEU n 
1 41  GLU n 
1 42  ASP n 
1 43  HIS n 
1 44  LEU n 
1 45  ASP n 
1 46  ARG n 
1 47  GLN n 
1 48  LEU n 
1 49  GLN n 
1 50  ARG n 
1 51  ASP n 
1 52  ALA n 
1 53  GLY n 
1 54  MET n 
1 55  PRO n 
1 56  HIS n 
1 57  VAL n 
1 58  TYR n 
1 59  TYR n 
1 60  GLY n 
1 61  LEU n 
1 62  LEU n 
1 63  VAL n 
1 64  LYS n 
1 65  LEU n 
1 66  ALA n 
1 67  GLU n 
1 68  SER n 
1 69  PRO n 
1 70  ARG n 
1 71  ARG n 
1 72  ARG n 
1 73  LEU n 
1 74  ARG n 
1 75  MET n 
1 76  THR n 
1 77  GLU n 
1 78  LEU n 
1 79  ALA n 
1 80  LYS n 
1 81  TYR n 
1 82  ALA n 
1 83  LYS n 
1 84  ILE n 
1 85  THR n 
1 86  ARG n 
1 87  SER n 
1 88  ARG n 
1 89  LEU n 
1 90  SER n 
1 91  HIS n 
1 92  ALA n 
1 93  VAL n 
1 94  ALA n 
1 95  ARG n 
1 96  LEU n 
1 97  GLU n 
1 98  LYS n 
1 99  ASN n 
1 100 GLY n 
1 101 TRP n 
1 102 VAL n 
1 103 ARG n 
1 104 ARG n 
1 105 GLU n 
1 106 ASP n 
1 107 CYS n 
1 108 PRO n 
1 109 SER n 
1 110 ASP n 
1 111 LYS n 
1 112 ARG n 
1 113 GLY n 
1 114 GLN n 
1 115 PHE n 
1 116 ALA n 
1 117 ILE n 
1 118 LEU n 
1 119 THR n 
1 120 ASP n 
1 121 GLU n 
1 122 GLY n 
1 123 TYR n 
1 124 GLU n 
1 125 VAL n 
1 126 LEU n 
1 127 ARG n 
1 128 ARG n 
1 129 THR n 
1 130 ALA n 
1 131 PRO n 
1 132 GLY n 
1 133 HIS n 
1 134 VAL n 
1 135 ASP n 
1 136 ALA n 
1 137 VAL n 
1 138 ARG n 
1 139 GLN n 
1 140 ALA n 
1 141 VAL n 
1 142 PHE n 
1 143 ASP n 
1 144 ARG n 
1 145 LEU n 
1 146 THR n 
1 147 PRO n 
1 148 GLU n 
1 149 GLN n 
1 150 GLN n 
1 151 LYS n 
1 152 SER n 
1 153 LEU n 
1 154 GLY n 
1 155 GLU n 
1 156 ILE n 
1 157 MET n 
1 158 ARG n 
1 159 ILE n 
1 160 VAL n 
1 161 ALA n 
1 162 GLU n 
1 163 GLY n 
1 164 LEU n 
1 165 GLN n 
1 166 PRO n 
1 167 SER n 
1 168 GLU n 
1 169 ALA n 
1 170 GLY n 
1 171 ALA n 
1 172 ASP n 
1 173 LEU n 
1 174 PRO n 
1 175 TRP n 
1 176 LEU n 
1 177 ARG n 
2 1   DA  n 
2 2   DA  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DT  n 
2 8   DG  n 
2 9   DA  n 
2 10  DG  n 
2 11  DA  n 
2 12  DT  n 
2 13  DC  n 
2 14  DT  n 
2 15  DC  n 
2 16  DA  n 
2 17  DA  n 
2 18  DT  n 
2 19  DC  n 
2 20  DT  n 
2 21  DT  n 
2 22  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    M145 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'STREPTOMYCES COELICOLOR' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1902 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 BAA-471 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              PLYSS 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PET21A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21A-SCO3205 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP Q9KYU1_STRCO 1 ? ? Q9KYU1 ? 
2 PDB 3ZPL         2 ? ? 3ZPL   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ZPL A 15 ? 177 ? Q9KYU1 1 ? 163 ? 1 163 
2 1 3ZPL B 15 ? 177 ? Q9KYU1 1 ? 163 ? 1 163 
3 1 3ZPL E 15 ? 177 ? Q9KYU1 1 ? 163 ? 1 163 
4 1 3ZPL F 15 ? 177 ? Q9KYU1 1 ? 163 ? 1 163 
5 2 3ZPL C 1  ? 22  ? 3ZPL   1 ? 22  ? 1 22  
6 2 3ZPL D 1  ? 22  ? 3ZPL   1 ? 22  ? 1 22  
7 2 3ZPL G 1  ? 22  ? 3ZPL   1 ? 22  ? 1 22  
8 2 3ZPL H 1  ? 22  ? 3ZPL   1 ? 22  ? 1 22  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ZPL MET A 1  ? UNP Q9KYU1 ? ? 'expression tag' -13 1  
1 3ZPL HIS A 2  ? UNP Q9KYU1 ? ? 'expression tag' -12 2  
1 3ZPL HIS A 3  ? UNP Q9KYU1 ? ? 'expression tag' -11 3  
1 3ZPL HIS A 4  ? UNP Q9KYU1 ? ? 'expression tag' -10 4  
1 3ZPL HIS A 5  ? UNP Q9KYU1 ? ? 'expression tag' -9  5  
1 3ZPL HIS A 6  ? UNP Q9KYU1 ? ? 'expression tag' -8  6  
1 3ZPL HIS A 7  ? UNP Q9KYU1 ? ? 'expression tag' -7  7  
1 3ZPL GLU A 8  ? UNP Q9KYU1 ? ? 'expression tag' -6  8  
1 3ZPL ASN A 9  ? UNP Q9KYU1 ? ? 'expression tag' -5  9  
1 3ZPL LEU A 10 ? UNP Q9KYU1 ? ? 'expression tag' -4  10 
1 3ZPL TYR A 11 ? UNP Q9KYU1 ? ? 'expression tag' -3  11 
1 3ZPL PHE A 12 ? UNP Q9KYU1 ? ? 'expression tag' -2  12 
1 3ZPL GLN A 13 ? UNP Q9KYU1 ? ? 'expression tag' -1  13 
1 3ZPL GLY A 14 ? UNP Q9KYU1 ? ? 'expression tag' 0   14 
2 3ZPL MET B 1  ? UNP Q9KYU1 ? ? 'expression tag' -13 15 
2 3ZPL HIS B 2  ? UNP Q9KYU1 ? ? 'expression tag' -12 16 
2 3ZPL HIS B 3  ? UNP Q9KYU1 ? ? 'expression tag' -11 17 
2 3ZPL HIS B 4  ? UNP Q9KYU1 ? ? 'expression tag' -10 18 
2 3ZPL HIS B 5  ? UNP Q9KYU1 ? ? 'expression tag' -9  19 
2 3ZPL HIS B 6  ? UNP Q9KYU1 ? ? 'expression tag' -8  20 
2 3ZPL HIS B 7  ? UNP Q9KYU1 ? ? 'expression tag' -7  21 
2 3ZPL GLU B 8  ? UNP Q9KYU1 ? ? 'expression tag' -6  22 
2 3ZPL ASN B 9  ? UNP Q9KYU1 ? ? 'expression tag' -5  23 
2 3ZPL LEU B 10 ? UNP Q9KYU1 ? ? 'expression tag' -4  24 
2 3ZPL TYR B 11 ? UNP Q9KYU1 ? ? 'expression tag' -3  25 
2 3ZPL PHE B 12 ? UNP Q9KYU1 ? ? 'expression tag' -2  26 
2 3ZPL GLN B 13 ? UNP Q9KYU1 ? ? 'expression tag' -1  27 
2 3ZPL GLY B 14 ? UNP Q9KYU1 ? ? 'expression tag' 0   28 
3 3ZPL MET E 1  ? UNP Q9KYU1 ? ? 'expression tag' -13 29 
3 3ZPL HIS E 2  ? UNP Q9KYU1 ? ? 'expression tag' -12 30 
3 3ZPL HIS E 3  ? UNP Q9KYU1 ? ? 'expression tag' -11 31 
3 3ZPL HIS E 4  ? UNP Q9KYU1 ? ? 'expression tag' -10 32 
3 3ZPL HIS E 5  ? UNP Q9KYU1 ? ? 'expression tag' -9  33 
3 3ZPL HIS E 6  ? UNP Q9KYU1 ? ? 'expression tag' -8  34 
3 3ZPL HIS E 7  ? UNP Q9KYU1 ? ? 'expression tag' -7  35 
3 3ZPL GLU E 8  ? UNP Q9KYU1 ? ? 'expression tag' -6  36 
3 3ZPL ASN E 9  ? UNP Q9KYU1 ? ? 'expression tag' -5  37 
3 3ZPL LEU E 10 ? UNP Q9KYU1 ? ? 'expression tag' -4  38 
3 3ZPL TYR E 11 ? UNP Q9KYU1 ? ? 'expression tag' -3  39 
3 3ZPL PHE E 12 ? UNP Q9KYU1 ? ? 'expression tag' -2  40 
3 3ZPL GLN E 13 ? UNP Q9KYU1 ? ? 'expression tag' -1  41 
3 3ZPL GLY E 14 ? UNP Q9KYU1 ? ? 'expression tag' 0   42 
4 3ZPL MET F 1  ? UNP Q9KYU1 ? ? 'expression tag' -13 43 
4 3ZPL HIS F 2  ? UNP Q9KYU1 ? ? 'expression tag' -12 44 
4 3ZPL HIS F 3  ? UNP Q9KYU1 ? ? 'expression tag' -11 45 
4 3ZPL HIS F 4  ? UNP Q9KYU1 ? ? 'expression tag' -10 46 
4 3ZPL HIS F 5  ? UNP Q9KYU1 ? ? 'expression tag' -9  47 
4 3ZPL HIS F 6  ? UNP Q9KYU1 ? ? 'expression tag' -8  48 
4 3ZPL HIS F 7  ? UNP Q9KYU1 ? ? 'expression tag' -7  49 
4 3ZPL GLU F 8  ? UNP Q9KYU1 ? ? 'expression tag' -6  50 
4 3ZPL ASN F 9  ? UNP Q9KYU1 ? ? 'expression tag' -5  51 
4 3ZPL LEU F 10 ? UNP Q9KYU1 ? ? 'expression tag' -4  52 
4 3ZPL TYR F 11 ? UNP Q9KYU1 ? ? 'expression tag' -3  53 
4 3ZPL PHE F 12 ? UNP Q9KYU1 ? ? 'expression tag' -2  54 
4 3ZPL GLN F 13 ? UNP Q9KYU1 ? ? 'expression tag' -1  55 
4 3ZPL GLY F 14 ? UNP Q9KYU1 ? ? 'expression tag' 0   56 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                      ? 'O4 P -3'         94.971  
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3ZPL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.93 
_exptl_crystal.density_percent_sol   72.1 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '20-40% (V/V) MPD, 80-100 MM SODIUM ACETATE AND 50 MM MES PH 5.6' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-07-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9780 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_wavelength             0.9780 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3ZPL 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             69.68 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   37192 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.0 
_reflns.pdbx_Rmerge_I_obs            0.10 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.70 
_reflns.B_iso_Wilson_estimate        80.9 
_reflns.pdbx_redundancy              8.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.87 
_reflns_shell.percent_possible_all   78.2 
_reflns_shell.Rmerge_I_obs           0.37 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.90 
_reflns_shell.pdbx_redundancy        3.0 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3ZPL 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     35209 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             59.88 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    95.97 
_refine.ls_R_factor_obs                          0.17668 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17565 
_refine.ls_R_factor_R_free                       0.19649 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1848 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.940 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.B_iso_mean                               60.9 
_refine.aniso_B[1][1]                            0.54 
_refine.aniso_B[2][2]                            0.54 
_refine.aniso_B[3][3]                            -1.09 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES WITH TLS ADDED.' 
_refine.pdbx_starting_model                      'PDB ENTRY 3ZMD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.098 
_refine.pdbx_overall_ESU_R_Free                  0.053 
_refine.overall_SU_ML                            0.183 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             18.712 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4933 
_refine_hist.pdbx_number_atoms_nucleic_acid   1792 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               6759 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        59.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.017  ? 7058  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.005  0.020  ? 5818  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.351  1.722  ? 9958  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.435  3.000  ? 13303 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.590  5.000  ? 626   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.533 21.391 ? 230   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       19.398 15.000 ? 812   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.479 15.000 ? 69    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.078  0.200  ? 1030  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 6742  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.006  0.020  ? 1611  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.311  2.852  ? 2522  'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.311  2.852  ? 2521  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.078  4.278  ? 3142  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.571  2.856  ? 4536  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 8492 0.08 0.05 'interatomic distance' 1  1  'X-RAY DIFFRACTION' ? ? ? 
2 B 8492 0.08 0.05 'interatomic distance' 1  2  'X-RAY DIFFRACTION' ? ? ? 
1 A 8517 0.07 0.05 'interatomic distance' 2  3  'X-RAY DIFFRACTION' ? ? ? 
2 E 8517 0.07 0.05 'interatomic distance' 2  4  'X-RAY DIFFRACTION' ? ? ? 
1 A 8242 0.09 0.05 'interatomic distance' 3  5  'X-RAY DIFFRACTION' ? ? ? 
2 F 8242 0.09 0.05 'interatomic distance' 3  6  'X-RAY DIFFRACTION' ? ? ? 
1 B 8302 0.09 0.05 'interatomic distance' 4  7  'X-RAY DIFFRACTION' ? ? ? 
2 E 8302 0.09 0.05 'interatomic distance' 4  8  'X-RAY DIFFRACTION' ? ? ? 
1 B 8432 0.09 0.05 'interatomic distance' 5  9  'X-RAY DIFFRACTION' ? ? ? 
2 F 8432 0.09 0.05 'interatomic distance' 5  10 'X-RAY DIFFRACTION' ? ? ? 
1 C 1789 0.01 0.05 'interatomic distance' 6  11 'X-RAY DIFFRACTION' ? ? ? 
2 D 1789 0.01 0.05 'interatomic distance' 6  12 'X-RAY DIFFRACTION' ? ? ? 
1 C 1785 0.04 0.05 'interatomic distance' 7  13 'X-RAY DIFFRACTION' ? ? ? 
2 G 1785 0.04 0.05 'interatomic distance' 7  14 'X-RAY DIFFRACTION' ? ? ? 
1 C 1779 0.05 0.05 'interatomic distance' 8  15 'X-RAY DIFFRACTION' ? ? ? 
2 H 1779 0.05 0.05 'interatomic distance' 8  16 'X-RAY DIFFRACTION' ? ? ? 
1 D 1782 0.04 0.05 'interatomic distance' 9  17 'X-RAY DIFFRACTION' ? ? ? 
2 G 1782 0.04 0.05 'interatomic distance' 9  18 'X-RAY DIFFRACTION' ? ? ? 
1 D 1779 0.05 0.05 'interatomic distance' 10 19 'X-RAY DIFFRACTION' ? ? ? 
2 H 1779 0.05 0.05 'interatomic distance' 10 20 'X-RAY DIFFRACTION' ? ? ? 
1 E 8123 0.10 0.05 'interatomic distance' 11 21 'X-RAY DIFFRACTION' ? ? ? 
2 F 8123 0.10 0.05 'interatomic distance' 11 22 'X-RAY DIFFRACTION' ? ? ? 
1 G 1787 0.03 0.05 'interatomic distance' 12 23 'X-RAY DIFFRACTION' ? ? ? 
2 H 1787 0.03 0.05 'interatomic distance' 12 24 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.873 
_refine_ls_shell.number_reflns_R_work             2094 
_refine_ls_shell.R_factor_R_work                  0.300 
_refine_ls_shell.percent_reflns_obs               77.99 
_refine_ls_shell.R_factor_R_free                  0.401 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             103 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1  
2 B 1  
1 A 2  
2 E 2  
1 A 3  
2 F 3  
1 B 4  
2 E 4  
1 B 5  
2 F 5  
1 C 6  
2 D 6  
1 C 7  
2 G 7  
1 C 8  
2 H 8  
1 D 9  
2 G 9  
1 D 10 
2 H 10 
1 E 11 
2 F 11 
1 G 12 
2 H 12 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 5 A 163 0 0 ? ? ? ? ? ? ? ? 1  ? 
2 B 5 B 163 0 0 ? ? ? ? ? ? ? ? 1  ? 
1 A 5 A 162 0 0 ? ? ? ? ? ? ? ? 2  ? 
2 E 5 E 162 0 0 ? ? ? ? ? ? ? ? 2  ? 
1 A 7 A 163 0 0 ? ? ? ? ? ? ? ? 3  ? 
2 F 7 F 163 0 0 ? ? ? ? ? ? ? ? 3  ? 
1 B 5 B 162 0 0 ? ? ? ? ? ? ? ? 4  ? 
2 E 5 E 162 0 0 ? ? ? ? ? ? ? ? 4  ? 
1 B 7 B 163 0 0 ? ? ? ? ? ? ? ? 5  ? 
2 F 7 F 163 0 0 ? ? ? ? ? ? ? ? 5  ? 
1 C 1 C 22  0 0 ? ? ? ? ? ? ? ? 6  ? 
2 D 1 D 22  0 0 ? ? ? ? ? ? ? ? 6  ? 
1 C 1 C 22  0 0 ? ? ? ? ? ? ? ? 7  ? 
2 G 1 G 22  0 0 ? ? ? ? ? ? ? ? 7  ? 
1 C 1 C 22  0 0 ? ? ? ? ? ? ? ? 8  ? 
2 H 1 H 22  0 0 ? ? ? ? ? ? ? ? 8  ? 
1 D 1 D 22  0 0 ? ? ? ? ? ? ? ? 9  ? 
2 G 1 G 22  0 0 ? ? ? ? ? ? ? ? 9  ? 
1 D 1 D 22  0 0 ? ? ? ? ? ? ? ? 10 ? 
2 H 1 H 22  0 0 ? ? ? ? ? ? ? ? 10 ? 
1 E 7 E 162 0 0 ? ? ? ? ? ? ? ? 11 ? 
2 F 7 F 162 0 0 ? ? ? ? ? ? ? ? 11 ? 
1 G 1 G 22  0 0 ? ? ? ? ? ? ? ? 12 ? 
2 H 1 H 22  0 0 ? ? ? ? ? ? ? ? 12 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
# 
_struct.entry_id                  3ZPL 
_struct.title                     
'Crystal structure of Sco3205, a MarR family transcriptional regulator from Streptomyces coelicolor, in complex with DNA' 
_struct.pdbx_descriptor           'PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ZPL 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'TRANSCRIPTION-DNA COMPLEX, TRANSCRIPTION, WINGED HELIX MOTIF, PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 23  ? GLY A 53  ? THR A 9   GLY A 39  1 ? 31 
HELX_P HELX_P2  2  PRO A 55  ? GLU A 67  ? PRO A 41  GLU A 53  1 ? 13 
HELX_P HELX_P3  3  SER A 68  ? ARG A 70  ? SER A 54  ARG A 56  5 ? 3  
HELX_P HELX_P4  4  MET A 75  ? LYS A 83  ? MET A 61  LYS A 69  1 ? 9  
HELX_P HELX_P5  5  THR A 85  ? ASN A 99  ? THR A 71  ASN A 85  1 ? 15 
HELX_P HELX_P6  6  THR A 119 ? VAL A 141 ? THR A 105 VAL A 127 1 ? 23 
HELX_P HELX_P7  7  PHE A 142 ? LEU A 145 ? PHE A 128 LEU A 131 5 ? 4  
HELX_P HELX_P8  8  THR A 146 ? GLN A 165 ? THR A 132 GLN A 151 1 ? 20 
HELX_P HELX_P9  9  LEU A 173 ? ARG A 177 ? LEU A 159 ARG A 163 5 ? 5  
HELX_P HELX_P10 10 THR B 23  ? ALA B 52  ? THR B 9   ALA B 38  1 ? 30 
HELX_P HELX_P11 11 PRO B 55  ? GLU B 67  ? PRO B 41  GLU B 53  1 ? 13 
HELX_P HELX_P12 12 SER B 68  ? ARG B 70  ? SER B 54  ARG B 56  5 ? 3  
HELX_P HELX_P13 13 MET B 75  ? LYS B 83  ? MET B 61  LYS B 69  1 ? 9  
HELX_P HELX_P14 14 THR B 85  ? ASN B 99  ? THR B 71  ASN B 85  1 ? 15 
HELX_P HELX_P15 15 THR B 119 ? VAL B 141 ? THR B 105 VAL B 127 1 ? 23 
HELX_P HELX_P16 16 PHE B 142 ? LEU B 145 ? PHE B 128 LEU B 131 5 ? 4  
HELX_P HELX_P17 17 THR B 146 ? GLN B 165 ? THR B 132 GLN B 151 1 ? 20 
HELX_P HELX_P18 18 LEU B 173 ? ARG B 177 ? LEU B 159 ARG B 163 5 ? 5  
HELX_P HELX_P19 19 THR E 23  ? ALA E 52  ? THR E 9   ALA E 38  1 ? 30 
HELX_P HELX_P20 20 PRO E 55  ? GLU E 67  ? PRO E 41  GLU E 53  1 ? 13 
HELX_P HELX_P21 21 SER E 68  ? ARG E 70  ? SER E 54  ARG E 56  5 ? 3  
HELX_P HELX_P22 22 MET E 75  ? LYS E 83  ? MET E 61  LYS E 69  1 ? 9  
HELX_P HELX_P23 23 THR E 85  ? ASN E 99  ? THR E 71  ASN E 85  1 ? 15 
HELX_P HELX_P24 24 THR E 119 ? VAL E 141 ? THR E 105 VAL E 127 1 ? 23 
HELX_P HELX_P25 25 PHE E 142 ? LEU E 145 ? PHE E 128 LEU E 131 5 ? 4  
HELX_P HELX_P26 26 THR E 146 ? GLN E 165 ? THR E 132 GLN E 151 1 ? 20 
HELX_P HELX_P27 27 LEU E 173 ? ARG E 177 ? LEU E 159 ARG E 163 5 ? 5  
HELX_P HELX_P28 28 THR F 23  ? GLY F 53  ? THR F 9   GLY F 39  1 ? 31 
HELX_P HELX_P29 29 PRO F 55  ? GLU F 67  ? PRO F 41  GLU F 53  1 ? 13 
HELX_P HELX_P30 30 SER F 68  ? ARG F 70  ? SER F 54  ARG F 56  5 ? 3  
HELX_P HELX_P31 31 MET F 75  ? LYS F 83  ? MET F 61  LYS F 69  1 ? 9  
HELX_P HELX_P32 32 THR F 85  ? ASN F 99  ? THR F 71  ASN F 85  1 ? 15 
HELX_P HELX_P33 33 THR F 119 ? VAL F 141 ? THR F 105 VAL F 127 1 ? 23 
HELX_P HELX_P34 34 PHE F 142 ? LEU F 145 ? PHE F 128 LEU F 131 5 ? 4  
HELX_P HELX_P35 35 THR F 146 ? GLN F 165 ? THR F 132 GLN F 151 1 ? 20 
HELX_P HELX_P36 36 LEU F 173 ? ARG F 177 ? LEU F 159 ARG F 163 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? C DA 1  N1 ? ? ? 1_555 D DT 22 N3 ? ? C DA 1  D DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2   hydrog ? ? C DA 1  N6 ? ? ? 1_555 D DT 22 O4 ? ? C DA 1  D DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3   hydrog ? ? C DA 2  N1 ? ? ? 1_555 D DT 21 N3 ? ? C DA 2  D DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4   hydrog ? ? C DA 2  N6 ? ? ? 1_555 D DT 21 O4 ? ? C DA 2  D DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5   hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT 20 N3 ? ? C DA 3  D DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6   hydrog ? ? C DA 3  N6 ? ? ? 1_555 D DT 20 O4 ? ? C DA 3  D DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7   hydrog ? ? C DG 4  N1 ? ? ? 1_555 D DC 19 N3 ? ? C DG 4  D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8   hydrog ? ? C DG 4  N2 ? ? ? 1_555 D DC 19 O2 ? ? C DG 4  D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9   hydrog ? ? C DG 4  O6 ? ? ? 1_555 D DC 19 N4 ? ? C DG 4  D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10  hydrog ? ? C DA 5  N1 ? ? ? 1_555 D DT 18 N3 ? ? C DA 5  D DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11  hydrog ? ? C DA 5  N6 ? ? ? 1_555 D DT 18 O4 ? ? C DA 5  D DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12  hydrog ? ? C DT 6  N3 ? ? ? 1_555 D DA 17 N1 ? ? C DT 6  D DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13  hydrog ? ? C DT 6  O4 ? ? ? 1_555 D DA 17 N6 ? ? C DT 6  D DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14  hydrog ? ? C DT 7  N3 ? ? ? 1_555 D DA 16 N1 ? ? C DT 7  D DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15  hydrog ? ? C DT 7  O4 ? ? ? 1_555 D DA 16 N6 ? ? C DT 7  D DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16  hydrog ? ? C DG 8  N1 ? ? ? 1_555 D DC 15 N3 ? ? C DG 8  D DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17  hydrog ? ? C DG 8  N2 ? ? ? 1_555 D DC 15 O2 ? ? C DG 8  D DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18  hydrog ? ? C DG 8  O6 ? ? ? 1_555 D DC 15 N4 ? ? C DG 8  D DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19  hydrog ? ? C DA 9  N1 ? ? ? 1_555 D DT 14 N3 ? ? C DA 9  D DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20  hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 14 O4 ? ? C DA 9  D DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21  hydrog ? ? C DG 10 N1 ? ? ? 1_555 D DC 13 N3 ? ? C DG 10 D DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22  hydrog ? ? C DG 10 N2 ? ? ? 1_555 D DC 13 O2 ? ? C DG 10 D DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23  hydrog ? ? C DG 10 O6 ? ? ? 1_555 D DC 13 N4 ? ? C DG 10 D DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24  hydrog ? ? C DA 11 N1 ? ? ? 1_555 D DT 12 N3 ? ? C DA 11 D DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25  hydrog ? ? C DA 11 N6 ? ? ? 1_555 D DT 12 O4 ? ? C DA 11 D DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26  hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA 11 N1 ? ? C DT 12 D DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27  hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA 11 N6 ? ? C DT 12 D DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28  hydrog ? ? C DC 13 N3 ? ? ? 1_555 D DG 10 N1 ? ? C DC 13 D DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29  hydrog ? ? C DC 13 N4 ? ? ? 1_555 D DG 10 O6 ? ? C DC 13 D DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30  hydrog ? ? C DC 13 O2 ? ? ? 1_555 D DG 10 N2 ? ? C DC 13 D DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31  hydrog ? ? C DT 14 N3 ? ? ? 1_555 D DA 9  N1 ? ? C DT 14 D DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32  hydrog ? ? C DT 14 O4 ? ? ? 1_555 D DA 9  N6 ? ? C DT 14 D DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33  hydrog ? ? C DC 15 N3 ? ? ? 1_555 D DG 8  N1 ? ? C DC 15 D DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34  hydrog ? ? C DC 15 N4 ? ? ? 1_555 D DG 8  O6 ? ? C DC 15 D DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35  hydrog ? ? C DC 15 O2 ? ? ? 1_555 D DG 8  N2 ? ? C DC 15 D DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36  hydrog ? ? C DA 16 N1 ? ? ? 1_555 D DT 7  N3 ? ? C DA 16 D DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37  hydrog ? ? C DA 16 N6 ? ? ? 1_555 D DT 7  O4 ? ? C DA 16 D DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38  hydrog ? ? C DA 17 N1 ? ? ? 1_555 D DT 6  N3 ? ? C DA 17 D DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39  hydrog ? ? C DA 17 N6 ? ? ? 1_555 D DT 6  O4 ? ? C DA 17 D DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40  hydrog ? ? C DT 18 N3 ? ? ? 1_555 D DA 5  N1 ? ? C DT 18 D DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41  hydrog ? ? C DT 18 O4 ? ? ? 1_555 D DA 5  N6 ? ? C DT 18 D DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42  hydrog ? ? C DC 19 N3 ? ? ? 1_555 D DG 4  N1 ? ? C DC 19 D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43  hydrog ? ? C DC 19 N4 ? ? ? 1_555 D DG 4  O6 ? ? C DC 19 D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44  hydrog ? ? C DC 19 O2 ? ? ? 1_555 D DG 4  N2 ? ? C DC 19 D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45  hydrog ? ? C DT 20 N3 ? ? ? 1_555 D DA 3  N1 ? ? C DT 20 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46  hydrog ? ? C DT 20 O4 ? ? ? 1_555 D DA 3  N6 ? ? C DT 20 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47  hydrog ? ? C DT 21 N3 ? ? ? 1_555 D DA 2  N1 ? ? C DT 21 D DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48  hydrog ? ? C DT 21 O4 ? ? ? 1_555 D DA 2  N6 ? ? C DT 21 D DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49  hydrog ? ? C DT 22 N3 ? ? ? 1_555 D DA 1  N1 ? ? C DT 22 D DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50  hydrog ? ? C DT 22 O4 ? ? ? 1_555 D DA 1  N6 ? ? C DT 22 D DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51  hydrog ? ? G DA 1  N1 ? ? ? 1_555 H DT 22 N3 ? ? G DA 1  H DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52  hydrog ? ? G DA 1  N6 ? ? ? 1_555 H DT 22 O4 ? ? G DA 1  H DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53  hydrog ? ? G DA 2  N1 ? ? ? 1_555 H DT 21 N3 ? ? G DA 2  H DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54  hydrog ? ? G DA 2  N6 ? ? ? 1_555 H DT 21 O4 ? ? G DA 2  H DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55  hydrog ? ? G DA 3  N1 ? ? ? 1_555 H DT 20 N3 ? ? G DA 3  H DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56  hydrog ? ? G DA 3  N6 ? ? ? 1_555 H DT 20 O4 ? ? G DA 3  H DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57  hydrog ? ? G DG 4  N1 ? ? ? 1_555 H DC 19 N3 ? ? G DG 4  H DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58  hydrog ? ? G DG 4  N2 ? ? ? 1_555 H DC 19 O2 ? ? G DG 4  H DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59  hydrog ? ? G DG 4  O6 ? ? ? 1_555 H DC 19 N4 ? ? G DG 4  H DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60  hydrog ? ? G DA 5  N1 ? ? ? 1_555 H DT 18 N3 ? ? G DA 5  H DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61  hydrog ? ? G DA 5  N6 ? ? ? 1_555 H DT 18 O4 ? ? G DA 5  H DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62  hydrog ? ? G DT 6  N3 ? ? ? 1_555 H DA 17 N1 ? ? G DT 6  H DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63  hydrog ? ? G DT 6  O4 ? ? ? 1_555 H DA 17 N6 ? ? G DT 6  H DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64  hydrog ? ? G DT 7  N3 ? ? ? 1_555 H DA 16 N1 ? ? G DT 7  H DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65  hydrog ? ? G DT 7  O4 ? ? ? 1_555 H DA 16 N6 ? ? G DT 7  H DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66  hydrog ? ? G DG 8  N1 ? ? ? 1_555 H DC 15 N3 ? ? G DG 8  H DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67  hydrog ? ? G DG 8  N2 ? ? ? 1_555 H DC 15 O2 ? ? G DG 8  H DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68  hydrog ? ? G DG 8  O6 ? ? ? 1_555 H DC 15 N4 ? ? G DG 8  H DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69  hydrog ? ? G DA 9  N1 ? ? ? 1_555 H DT 14 N3 ? ? G DA 9  H DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70  hydrog ? ? G DA 9  N6 ? ? ? 1_555 H DT 14 O4 ? ? G DA 9  H DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71  hydrog ? ? G DG 10 N1 ? ? ? 1_555 H DC 13 N3 ? ? G DG 10 H DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72  hydrog ? ? G DG 10 N2 ? ? ? 1_555 H DC 13 O2 ? ? G DG 10 H DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73  hydrog ? ? G DG 10 O6 ? ? ? 1_555 H DC 13 N4 ? ? G DG 10 H DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74  hydrog ? ? G DA 11 N1 ? ? ? 1_555 H DT 12 N3 ? ? G DA 11 H DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75  hydrog ? ? G DA 11 N6 ? ? ? 1_555 H DT 12 O4 ? ? G DA 11 H DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76  hydrog ? ? G DT 12 N3 ? ? ? 1_555 H DA 11 N1 ? ? G DT 12 H DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77  hydrog ? ? G DT 12 O4 ? ? ? 1_555 H DA 11 N6 ? ? G DT 12 H DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78  hydrog ? ? G DC 13 N3 ? ? ? 1_555 H DG 10 N1 ? ? G DC 13 H DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79  hydrog ? ? G DC 13 N4 ? ? ? 1_555 H DG 10 O6 ? ? G DC 13 H DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80  hydrog ? ? G DC 13 O2 ? ? ? 1_555 H DG 10 N2 ? ? G DC 13 H DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81  hydrog ? ? G DT 14 N3 ? ? ? 1_555 H DA 9  N1 ? ? G DT 14 H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82  hydrog ? ? G DT 14 O4 ? ? ? 1_555 H DA 9  N6 ? ? G DT 14 H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83  hydrog ? ? G DC 15 N3 ? ? ? 1_555 H DG 8  N1 ? ? G DC 15 H DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84  hydrog ? ? G DC 15 N4 ? ? ? 1_555 H DG 8  O6 ? ? G DC 15 H DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85  hydrog ? ? G DC 15 O2 ? ? ? 1_555 H DG 8  N2 ? ? G DC 15 H DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86  hydrog ? ? G DA 16 N1 ? ? ? 1_555 H DT 7  N3 ? ? G DA 16 H DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87  hydrog ? ? G DA 16 N6 ? ? ? 1_555 H DT 7  O4 ? ? G DA 16 H DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88  hydrog ? ? G DA 17 N1 ? ? ? 1_555 H DT 6  N3 ? ? G DA 17 H DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89  hydrog ? ? G DA 17 N6 ? ? ? 1_555 H DT 6  O4 ? ? G DA 17 H DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90  hydrog ? ? G DT 18 N3 ? ? ? 1_555 H DA 5  N1 ? ? G DT 18 H DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91  hydrog ? ? G DT 18 O4 ? ? ? 1_555 H DA 5  N6 ? ? G DT 18 H DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92  hydrog ? ? G DC 19 N3 ? ? ? 1_555 H DG 4  N1 ? ? G DC 19 H DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93  hydrog ? ? G DC 19 N4 ? ? ? 1_555 H DG 4  O6 ? ? G DC 19 H DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94  hydrog ? ? G DC 19 O2 ? ? ? 1_555 H DG 4  N2 ? ? G DC 19 H DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95  hydrog ? ? G DT 20 N3 ? ? ? 1_555 H DA 3  N1 ? ? G DT 20 H DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96  hydrog ? ? G DT 20 O4 ? ? ? 1_555 H DA 3  N6 ? ? G DT 20 H DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97  hydrog ? ? G DT 21 N3 ? ? ? 1_555 H DA 2  N1 ? ? G DT 21 H DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98  hydrog ? ? G DT 21 O4 ? ? ? 1_555 H DA 2  N6 ? ? G DT 21 H DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99  hydrog ? ? G DT 22 N3 ? ? ? 1_555 H DA 1  N1 ? ? G DT 22 H DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100 hydrog ? ? G DT 22 O4 ? ? ? 1_555 H DA 1  N6 ? ? G DT 22 H DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
BA ? 3 ? 
EA ? 3 ? 
FA ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
FA 1 2 ? anti-parallel 
FA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 72  ? ARG A 74  ? ARG A 58  ARG A 60  
AA 2 GLN A 114 ? LEU A 118 ? GLN A 100 LEU A 104 
AA 3 VAL A 102 ? ASP A 106 ? VAL A 88  ASP A 92  
BA 1 ARG B 72  ? ARG B 74  ? ARG B 58  ARG B 60  
BA 2 GLN B 114 ? LEU B 118 ? GLN B 100 LEU B 104 
BA 3 VAL B 102 ? ASP B 106 ? VAL B 88  ASP B 92  
EA 1 ARG E 72  ? ARG E 74  ? ARG E 58  ARG E 60  
EA 2 GLN E 114 ? LEU E 118 ? GLN E 100 LEU E 104 
EA 3 VAL E 102 ? ASP E 106 ? VAL E 88  ASP E 92  
FA 1 ARG F 72  ? ARG F 74  ? ARG F 58  ARG F 60  
FA 2 GLN F 114 ? LEU F 118 ? GLN F 100 LEU F 104 
FA 3 VAL F 102 ? ASP F 106 ? VAL F 88  ASP F 92  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 73  ? N LEU A 59  O ALA A 116 ? O ALA A 102 
AA 2 3 N ILE A 117 ? N ILE A 103 O ARG A 103 ? O ARG A 89  
BA 1 2 N LEU B 73  ? N LEU B 59  O ALA B 116 ? O ALA B 102 
BA 2 3 N ILE B 117 ? N ILE B 103 O ARG B 103 ? O ARG B 89  
EA 1 2 N LEU E 73  ? N LEU E 59  O ALA E 116 ? O ALA E 102 
EA 2 3 N ILE E 117 ? N ILE E 103 O ARG E 103 ? O ARG E 89  
FA 1 2 N LEU F 73  ? N LEU F 59  O ALA F 116 ? O ALA F 102 
FA 2 3 N ILE F 117 ? N ILE F 103 O ARG F 103 ? O ARG F 89  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PO4 A 1164' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PO4 A 1165' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PO4 D 1023' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PO4 C 1023' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 PO4 J .   ? PO4 A 1165 . ? 1_555 ? 
2  AC1 3 ASP E 106 ? ASP E 92   . ? 6_654 ? 
3  AC1 3 GLN E 114 ? GLN E 100  . ? 6_654 ? 
4  AC2 4 ASP A 106 ? ASP A 92   . ? 1_555 ? 
5  AC2 4 GLN A 114 ? GLN A 100  . ? 1_555 ? 
6  AC2 4 PO4 I .   ? PO4 A 1164 . ? 1_555 ? 
7  AC2 4 ASP E 106 ? ASP E 92   . ? 6_654 ? 
8  AC3 3 DT  C 18  ? DT  C 18   . ? 1_555 ? 
9  AC3 3 DA  D 3   ? DA  D 3    . ? 1_555 ? 
10 AC3 3 DG  D 4   ? DG  D 4    . ? 1_555 ? 
11 AC4 4 DT  C 18  ? DT  C 18   . ? 1_555 ? 
12 AC4 4 DC  C 19  ? DC  C 19   . ? 1_555 ? 
13 AC4 4 DT  D 6   ? DT  D 6    . ? 1_555 ? 
14 AC4 4 DT  D 7   ? DT  D 7    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3ZPL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ZPL 
_atom_sites.fract_transf_matrix[1][1]   0.014124 
_atom_sites.fract_transf_matrix[1][2]   0.008155 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016309 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001794 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . PRO A 1 19  ? 25.847  6.953   27.568  1.00 60.86  ? 5    PRO A N     1 
ATOM   2    C CA    . PRO A 1 19  ? 24.618  7.411   26.896  1.00 62.85  ? 5    PRO A CA    1 
ATOM   3    C C     . PRO A 1 19  ? 23.865  8.519   27.692  1.00 63.29  ? 5    PRO A C     1 
ATOM   4    O O     . PRO A 1 19  ? 22.709  8.387   28.135  1.00 70.80  ? 5    PRO A O     1 
ATOM   5    C CB    . PRO A 1 19  ? 23.825  6.101   26.676  1.00 63.74  ? 5    PRO A CB    1 
ATOM   6    C CG    . PRO A 1 19  ? 24.413  5.126   27.635  1.00 63.20  ? 5    PRO A CG    1 
ATOM   7    C CD    . PRO A 1 19  ? 25.870  5.491   27.732  1.00 62.30  ? 5    PRO A CD    1 
ATOM   8    N N     . ARG A 1 20  ? 24.562  9.637   27.828  1.00 61.71  ? 6    ARG A N     1 
ATOM   9    C CA    . ARG A 1 20  ? 24.102  10.819  28.560  1.00 59.27  ? 6    ARG A CA    1 
ATOM   10   C C     . ARG A 1 20  ? 23.265  11.772  27.688  1.00 60.47  ? 6    ARG A C     1 
ATOM   11   O O     . ARG A 1 20  ? 22.989  11.453  26.540  1.00 65.87  ? 6    ARG A O     1 
ATOM   12   C CB    . ARG A 1 20  ? 25.326  11.566  29.095  1.00 57.99  ? 6    ARG A CB    1 
ATOM   13   C CG    . ARG A 1 20  ? 26.350  11.905  28.026  1.00 58.59  ? 6    ARG A CG    1 
ATOM   14   C CD    . ARG A 1 20  ? 27.526  12.674  28.555  1.00 58.44  ? 6    ARG A CD    1 
ATOM   15   N NE    . ARG A 1 20  ? 27.272  14.118  28.603  1.00 58.00  ? 6    ARG A NE    1 
ATOM   16   C CZ    . ARG A 1 20  ? 27.369  14.939  27.552  1.00 58.61  ? 6    ARG A CZ    1 
ATOM   17   N NH1   . ARG A 1 20  ? 27.721  14.480  26.355  1.00 59.64  ? 6    ARG A NH1   1 
ATOM   18   N NH2   . ARG A 1 20  ? 27.111  16.233  27.693  1.00 58.64  ? 6    ARG A NH2   1 
ATOM   19   N N     . TRP A 1 21  ? 22.885  12.932  28.236  1.00 58.76  ? 7    TRP A N     1 
ATOM   20   C CA    . TRP A 1 21  ? 22.096  13.967  27.538  1.00 58.30  ? 7    TRP A CA    1 
ATOM   21   C C     . TRP A 1 21  ? 23.039  15.077  27.145  1.00 56.78  ? 7    TRP A C     1 
ATOM   22   O O     . TRP A 1 21  ? 24.151  15.131  27.649  1.00 56.96  ? 7    TRP A O     1 
ATOM   23   C CB    . TRP A 1 21  ? 21.062  14.618  28.474  1.00 58.88  ? 7    TRP A CB    1 
ATOM   24   C CG    . TRP A 1 21  ? 19.749  13.930  28.650  1.00 60.94  ? 7    TRP A CG    1 
ATOM   25   C CD1   . TRP A 1 21  ? 19.433  12.662  28.272  1.00 62.82  ? 7    TRP A CD1   1 
ATOM   26   C CD2   . TRP A 1 21  ? 18.590  14.444  29.333  1.00 62.88  ? 7    TRP A CD2   1 
ATOM   27   N NE1   . TRP A 1 21  ? 18.147  12.356  28.644  1.00 64.72  ? 7    TRP A NE1   1 
ATOM   28   C CE2   . TRP A 1 21  ? 17.604  13.433  29.296  1.00 65.75  ? 7    TRP A CE2   1 
ATOM   29   C CE3   . TRP A 1 21  ? 18.279  15.667  29.953  1.00 63.26  ? 7    TRP A CE3   1 
ATOM   30   C CZ2   . TRP A 1 21  ? 16.332  13.598  29.868  1.00 67.69  ? 7    TRP A CZ2   1 
ATOM   31   C CZ3   . TRP A 1 21  ? 17.017  15.833  30.509  1.00 65.94  ? 7    TRP A CZ3   1 
ATOM   32   C CH2   . TRP A 1 21  ? 16.061  14.798  30.467  1.00 68.39  ? 7    TRP A CH2   1 
ATOM   33   N N     . LEU A 1 22  ? 22.583  15.983  26.277  1.00 55.33  ? 8    LEU A N     1 
ATOM   34   C CA    . LEU A 1 22  ? 23.376  17.158  25.919  1.00 53.67  ? 8    LEU A CA    1 
ATOM   35   C C     . LEU A 1 22  ? 22.950  18.358  26.710  1.00 52.44  ? 8    LEU A C     1 
ATOM   36   O O     . LEU A 1 22  ? 21.772  18.687  26.737  1.00 53.46  ? 8    LEU A O     1 
ATOM   37   C CB    . LEU A 1 22  ? 23.237  17.492  24.430  1.00 53.12  ? 8    LEU A CB    1 
ATOM   38   C CG    . LEU A 1 22  ? 24.408  17.137  23.538  1.00 51.89  ? 8    LEU A CG    1 
ATOM   39   C CD1   . LEU A 1 22  ? 24.782  15.669  23.686  1.00 52.47  ? 8    LEU A CD1   1 
ATOM   40   C CD2   . LEU A 1 22  ? 24.048  17.490  22.102  1.00 52.39  ? 8    LEU A CD2   1 
ATOM   41   N N     . THR A 1 23  ? 23.905  19.051  27.321  1.00 52.40  ? 9    THR A N     1 
ATOM   42   C CA    . THR A 1 23  ? 23.558  20.274  28.052  1.00 52.92  ? 9    THR A CA    1 
ATOM   43   C C     . THR A 1 23  ? 23.002  21.264  27.052  1.00 52.24  ? 9    THR A C     1 
ATOM   44   O O     . THR A 1 23  ? 23.217  21.131  25.864  1.00 53.42  ? 9    THR A O     1 
ATOM   45   C CB    . THR A 1 23  ? 24.752  20.916  28.797  1.00 52.46  ? 9    THR A CB    1 
ATOM   46   O OG1   . THR A 1 23  ? 25.652  21.525  27.859  1.00 52.77  ? 9    THR A OG1   1 
ATOM   47   C CG2   . THR A 1 23  ? 25.493  19.884  29.651  1.00 52.91  ? 9    THR A CG2   1 
ATOM   48   N N     . ALA A 1 24  ? 22.300  22.272  27.534  1.00 53.23  ? 10   ALA A N     1 
ATOM   49   C CA    . ALA A 1 24  ? 21.794  23.313  26.652  1.00 52.94  ? 10   ALA A CA    1 
ATOM   50   C C     . ALA A 1 24  ? 22.938  24.075  26.021  1.00 53.01  ? 10   ALA A C     1 
ATOM   51   O O     . ALA A 1 24  ? 22.809  24.548  24.908  1.00 51.63  ? 10   ALA A O     1 
ATOM   52   C CB    . ALA A 1 24  ? 20.887  24.251  27.407  1.00 54.19  ? 10   ALA A CB    1 
ATOM   53   N N     . GLU A 1 25  ? 24.070  24.171  26.722  1.00 55.03  ? 11   GLU A N     1 
ATOM   54   C CA    . GLU A 1 25  ? 25.223  24.870  26.164  1.00 56.54  ? 11   GLU A CA    1 
ATOM   55   C C     . GLU A 1 25  ? 25.675  24.110  24.945  1.00 56.77  ? 11   GLU A C     1 
ATOM   56   O O     . GLU A 1 25  ? 25.821  24.689  23.875  1.00 56.74  ? 11   GLU A O     1 
ATOM   57   C CB    . GLU A 1 25  ? 26.389  24.995  27.145  1.00 57.86  ? 11   GLU A CB    1 
ATOM   58   C CG    . GLU A 1 25  ? 26.280  26.072  28.203  1.00 60.81  ? 11   GLU A CG    1 
ATOM   59   C CD    . GLU A 1 25  ? 25.359  25.696  29.369  1.00 61.82  ? 11   GLU A CD    1 
ATOM   60   O OE1   . GLU A 1 25  ? 25.145  24.484  29.622  1.00 60.87  ? 11   GLU A OE1   1 
ATOM   61   O OE2   . GLU A 1 25  ? 24.858  26.615  30.050  1.00 63.11  ? 11   GLU A OE2   1 
ATOM   62   N N     . GLU A 1 26  ? 25.915  22.811  25.132  1.00 57.16  ? 12   GLU A N     1 
ATOM   63   C CA    . GLU A 1 26  ? 26.371  21.919  24.055  1.00 57.03  ? 12   GLU A CA    1 
ATOM   64   C C     . GLU A 1 26  ? 25.435  21.936  22.866  1.00 55.24  ? 12   GLU A C     1 
ATOM   65   O O     . GLU A 1 26  ? 25.870  22.043  21.721  1.00 55.86  ? 12   GLU A O     1 
ATOM   66   C CB    . GLU A 1 26  ? 26.533  20.494  24.574  1.00 58.57  ? 12   GLU A CB    1 
ATOM   67   C CG    . GLU A 1 26  ? 27.723  20.292  25.516  1.00 59.38  ? 12   GLU A CG    1 
ATOM   68   C CD    . GLU A 1 26  ? 27.706  18.922  26.173  1.00 58.81  ? 12   GLU A CD    1 
ATOM   69   O OE1   . GLU A 1 26  ? 26.615  18.489  26.613  1.00 58.99  ? 12   GLU A OE1   1 
ATOM   70   O OE2   . GLU A 1 26  ? 28.762  18.255  26.242  1.00 58.42  ? 12   GLU A OE2   1 
ATOM   71   N N     . GLN A 1 27  ? 24.145  21.866  23.145  1.00 55.52  ? 13   GLN A N     1 
ATOM   72   C CA    . GLN A 1 27  ? 23.151  21.978  22.098  1.00 55.55  ? 13   GLN A CA    1 
ATOM   73   C C     . GLN A 1 27  ? 23.374  23.238  21.243  1.00 55.27  ? 13   GLN A C     1 
ATOM   74   O O     . GLN A 1 27  ? 23.279  23.175  20.021  1.00 55.45  ? 13   GLN A O     1 
ATOM   75   C CB    . GLN A 1 27  ? 21.745  22.002  22.706  1.00 55.82  ? 13   GLN A CB    1 
ATOM   76   C CG    . GLN A 1 27  ? 21.189  20.625  23.017  1.00 55.70  ? 13   GLN A CG    1 
ATOM   77   C CD    . GLN A 1 27  ? 19.853  20.695  23.731  1.00 57.46  ? 13   GLN A CD    1 
ATOM   78   O OE1   . GLN A 1 27  ? 18.843  21.098  23.135  1.00 59.03  ? 13   GLN A OE1   1 
ATOM   79   N NE2   . GLN A 1 27  ? 19.828  20.304  25.004  1.00 56.59  ? 13   GLN A NE2   1 
ATOM   80   N N     . LEU A 1 28  ? 23.653  24.373  21.894  1.00 53.66  ? 14   LEU A N     1 
ATOM   81   C CA    . LEU A 1 28  ? 23.883  25.646  21.200  1.00 52.54  ? 14   LEU A CA    1 
ATOM   82   C C     . LEU A 1 28  ? 25.162  25.689  20.380  1.00 52.50  ? 14   LEU A C     1 
ATOM   83   O O     . LEU A 1 28  ? 25.240  26.363  19.327  1.00 52.32  ? 14   LEU A O     1 
ATOM   84   C CB    . LEU A 1 28  ? 23.903  26.815  22.187  1.00 53.02  ? 14   LEU A CB    1 
ATOM   85   C CG    . LEU A 1 28  ? 22.490  27.382  22.421  1.00 52.74  ? 14   LEU A CG    1 
ATOM   86   C CD1   . LEU A 1 28  ? 22.329  28.151  23.718  1.00 52.81  ? 14   LEU A CD1   1 
ATOM   87   C CD2   . LEU A 1 28  ? 22.134  28.235  21.221  1.00 54.01  ? 14   LEU A CD2   1 
ATOM   88   N N     . VAL A 1 29  ? 26.189  25.031  20.894  1.00 54.18  ? 15   VAL A N     1 
ATOM   89   C CA    . VAL A 1 29  ? 27.449  24.906  20.158  1.00 56.77  ? 15   VAL A CA    1 
ATOM   90   C C     . VAL A 1 29  ? 27.160  24.155  18.868  1.00 55.66  ? 15   VAL A C     1 
ATOM   91   O O     . VAL A 1 29  ? 27.497  24.625  17.786  1.00 54.52  ? 15   VAL A O     1 
ATOM   92   C CB    . VAL A 1 29  ? 28.523  24.155  20.979  1.00 59.48  ? 15   VAL A CB    1 
ATOM   93   C CG1   . VAL A 1 29  ? 29.691  23.722  20.099  1.00 61.66  ? 15   VAL A CG1   1 
ATOM   94   C CG2   . VAL A 1 29  ? 29.016  25.039  22.122  1.00 60.54  ? 15   VAL A CG2   1 
ATOM   95   N N     . TRP A 1 30  ? 26.507  23.004  19.009  1.00 55.17  ? 16   TRP A N     1 
ATOM   96   C CA    . TRP A 1 30  ? 26.163  22.164  17.869  1.00 55.49  ? 16   TRP A CA    1 
ATOM   97   C C     . TRP A 1 30  ? 25.355  22.919  16.820  1.00 54.92  ? 16   TRP A C     1 
ATOM   98   O O     . TRP A 1 30  ? 25.665  22.874  15.640  1.00 54.74  ? 16   TRP A O     1 
ATOM   99   C CB    . TRP A 1 30  ? 25.399  20.932  18.350  1.00 55.43  ? 16   TRP A CB    1 
ATOM   100  C CG    . TRP A 1 30  ? 25.036  19.988  17.260  1.00 56.09  ? 16   TRP A CG    1 
ATOM   101  C CD1   . TRP A 1 30  ? 23.786  19.603  16.893  1.00 56.62  ? 16   TRP A CD1   1 
ATOM   102  C CD2   . TRP A 1 30  ? 25.937  19.318  16.377  1.00 57.84  ? 16   TRP A CD2   1 
ATOM   103  N NE1   . TRP A 1 30  ? 23.848  18.732  15.833  1.00 58.22  ? 16   TRP A NE1   1 
ATOM   104  C CE2   . TRP A 1 30  ? 25.162  18.532  15.506  1.00 58.44  ? 16   TRP A CE2   1 
ATOM   105  C CE3   . TRP A 1 30  ? 27.330  19.304  16.239  1.00 59.79  ? 16   TRP A CE3   1 
ATOM   106  C CZ2   . TRP A 1 30  ? 25.725  17.738  14.521  1.00 60.99  ? 16   TRP A CZ2   1 
ATOM   107  C CZ3   . TRP A 1 30  ? 27.893  18.505  15.253  1.00 62.03  ? 16   TRP A CZ3   1 
ATOM   108  C CH2   . TRP A 1 30  ? 27.088  17.738  14.404  1.00 62.72  ? 16   TRP A CH2   1 
ATOM   109  N N     . ARG A 1 31  ? 24.351  23.650  17.257  1.00 54.61  ? 17   ARG A N     1 
ATOM   110  C CA    . ARG A 1 31  ? 23.547  24.432  16.322  1.00 55.46  ? 17   ARG A CA    1 
ATOM   111  C C     . ARG A 1 31  ? 24.428  25.362  15.528  1.00 55.54  ? 17   ARG A C     1 
ATOM   112  O O     . ARG A 1 31  ? 24.366  25.395  14.303  1.00 55.13  ? 17   ARG A O     1 
ATOM   113  C CB    . ARG A 1 31  ? 22.522  25.296  17.053  1.00 54.64  ? 17   ARG A CB    1 
ATOM   114  C CG    . ARG A 1 31  ? 21.072  25.044  16.613  1.00 56.77  ? 17   ARG A CG    1 
ATOM   115  C CD    . ARG A 1 31  ? 20.130  25.459  17.719  1.00 56.63  ? 17   ARG A CD    1 
ATOM   116  N NE    . ARG A 1 31  ? 19.984  26.918  17.700  1.00 55.85  ? 17   ARG A NE    1 
ATOM   117  C CZ    . ARG A 1 31  ? 19.276  27.609  18.578  1.00 54.37  ? 17   ARG A CZ    1 
ATOM   118  N NH1   . ARG A 1 31  ? 18.631  26.980  19.558  1.00 54.71  ? 17   ARG A NH1   1 
ATOM   119  N NH2   . ARG A 1 31  ? 19.223  28.929  18.473  1.00 53.43  ? 17   ARG A NH2   1 
ATOM   120  N N     . SER A 1 32  ? 25.230  26.143  16.233  1.00 54.76  ? 18   SER A N     1 
ATOM   121  C CA    . SER A 1 32  ? 26.029  27.159  15.560  1.00 55.65  ? 18   SER A CA    1 
ATOM   122  C C     . SER A 1 32  ? 27.095  26.529  14.661  1.00 54.64  ? 18   SER A C     1 
ATOM   123  O O     . SER A 1 32  ? 27.453  27.104  13.633  1.00 53.80  ? 18   SER A O     1 
ATOM   124  C CB    . SER A 1 32  ? 26.611  28.150  16.566  1.00 57.18  ? 18   SER A CB    1 
ATOM   125  O OG    . SER A 1 32  ? 27.501  27.517  17.435  1.00 60.39  ? 18   SER A OG    1 
ATOM   126  N N     . TYR A 1 33  ? 27.551  25.326  14.999  1.00 54.47  ? 19   TYR A N     1 
ATOM   127  C CA    . TYR A 1 33  ? 28.373  24.559  14.058  1.00 55.56  ? 19   TYR A CA    1 
ATOM   128  C C     . TYR A 1 33  ? 27.599  24.273  12.769  1.00 56.15  ? 19   TYR A C     1 
ATOM   129  O O     . TYR A 1 33  ? 28.038  24.627  11.684  1.00 55.46  ? 19   TYR A O     1 
ATOM   130  C CB    . TYR A 1 33  ? 28.873  23.251  14.646  1.00 55.99  ? 19   TYR A CB    1 
ATOM   131  C CG    . TYR A 1 33  ? 29.568  22.407  13.609  1.00 59.88  ? 19   TYR A CG    1 
ATOM   132  C CD1   . TYR A 1 33  ? 30.874  22.684  13.217  1.00 61.73  ? 19   TYR A CD1   1 
ATOM   133  C CD2   . TYR A 1 33  ? 28.901  21.355  12.975  1.00 61.81  ? 19   TYR A CD2   1 
ATOM   134  C CE1   . TYR A 1 33  ? 31.511  21.931  12.244  1.00 64.85  ? 19   TYR A CE1   1 
ATOM   135  C CE2   . TYR A 1 33  ? 29.525  20.599  11.998  1.00 64.24  ? 19   TYR A CE2   1 
ATOM   136  C CZ    . TYR A 1 33  ? 30.831  20.891  11.633  1.00 66.51  ? 19   TYR A CZ    1 
ATOM   137  O OH    . TYR A 1 33  ? 31.476  20.143  10.664  1.00 70.74  ? 19   TYR A OH    1 
ATOM   138  N N     . ILE A 1 34  ? 26.433  23.647  12.903  1.00 51.55  ? 20   ILE A N     1 
ATOM   139  C CA    . ILE A 1 34  ? 25.598  23.287  11.732  1.00 50.92  ? 20   ILE A CA    1 
ATOM   140  C C     . ILE A 1 34  ? 25.361  24.475  10.813  1.00 49.49  ? 20   ILE A C     1 
ATOM   141  O O     . ILE A 1 34  ? 25.561  24.372  9.619   1.00 47.89  ? 20   ILE A O     1 
ATOM   142  C CB    . ILE A 1 34  ? 24.213  22.717  12.131  1.00 50.78  ? 20   ILE A CB    1 
ATOM   143  C CG1   . ILE A 1 34  ? 24.353  21.473  13.015  1.00 52.27  ? 20   ILE A CG1   1 
ATOM   144  C CG2   . ILE A 1 34  ? 23.417  22.350  10.893  1.00 50.00  ? 20   ILE A CG2   1 
ATOM   145  C CD1   . ILE A 1 34  ? 25.119  20.339  12.369  1.00 53.64  ? 20   ILE A CD1   1 
ATOM   146  N N     . GLU A 1 35  ? 24.967  25.605  11.385  1.00 50.78  ? 21   GLU A N     1 
ATOM   147  C CA    . GLU A 1 35  ? 24.678  26.805  10.601  1.00 51.83  ? 21   GLU A CA    1 
ATOM   148  C C     . GLU A 1 35  ? 25.933  27.237  9.841   1.00 51.89  ? 21   GLU A C     1 
ATOM   149  O O     . GLU A 1 35  ? 25.911  27.428  8.623   1.00 51.88  ? 21   GLU A O     1 
ATOM   150  C CB    . GLU A 1 35  ? 24.182  27.974  11.487  1.00 54.13  ? 21   GLU A CB    1 
ATOM   151  C CG    . GLU A 1 35  ? 22.978  27.673  12.384  1.00 56.32  ? 21   GLU A CG    1 
ATOM   152  C CD    . GLU A 1 35  ? 22.402  28.901  13.098  1.00 59.66  ? 21   GLU A CD    1 
ATOM   153  O OE1   . GLU A 1 35  ? 23.112  29.932  13.226  1.00 60.30  ? 21   GLU A OE1   1 
ATOM   154  O OE2   . GLU A 1 35  ? 21.213  28.840  13.524  1.00 62.53  ? 21   GLU A OE2   1 
ATOM   155  N N     . ALA A 1 36  ? 27.025  27.397  10.577  1.00 53.25  ? 22   ALA A N     1 
ATOM   156  C CA    . ALA A 1 36  ? 28.279  27.880  10.002  1.00 53.87  ? 22   ALA A CA    1 
ATOM   157  C C     . ALA A 1 36  ? 28.665  27.036  8.813   1.00 53.90  ? 22   ALA A C     1 
ATOM   158  O O     . ALA A 1 36  ? 28.860  27.539  7.696   1.00 56.78  ? 22   ALA A O     1 
ATOM   159  C CB    . ALA A 1 36  ? 29.374  27.862  11.043  1.00 54.49  ? 22   ALA A CB    1 
ATOM   160  N N     . ALA A 1 37  ? 28.733  25.736  9.043   1.00 53.02  ? 23   ALA A N     1 
ATOM   161  C CA    . ALA A 1 37  ? 29.114  24.801  7.994   1.00 50.81  ? 23   ALA A CA    1 
ATOM   162  C C     . ALA A 1 37  ? 28.189  24.898  6.795   1.00 49.89  ? 23   ALA A C     1 
ATOM   163  O O     . ALA A 1 37  ? 28.650  24.897  5.649   1.00 50.91  ? 23   ALA A O     1 
ATOM   164  C CB    . ALA A 1 37  ? 29.126  23.382  8.540   1.00 50.91  ? 23   ALA A CB    1 
ATOM   165  N N     . THR A 1 38  ? 26.883  24.946  7.049   1.00 48.25  ? 24   THR A N     1 
ATOM   166  C CA    . THR A 1 38  ? 25.913  24.970  5.963   1.00 46.38  ? 24   THR A CA    1 
ATOM   167  C C     . THR A 1 38  ? 26.027  26.277  5.197   1.00 47.95  ? 24   THR A C     1 
ATOM   168  O O     . THR A 1 38  ? 25.813  26.283  3.981   1.00 50.28  ? 24   THR A O     1 
ATOM   169  C CB    . THR A 1 38  ? 24.467  24.779  6.459   1.00 45.18  ? 24   THR A CB    1 
ATOM   170  O OG1   . THR A 1 38  ? 24.380  23.608  7.274   1.00 42.64  ? 24   THR A OG1   1 
ATOM   171  C CG2   . THR A 1 38  ? 23.489  24.638  5.282   1.00 44.53  ? 24   THR A CG2   1 
ATOM   172  N N     . LEU A 1 39  ? 26.383  27.370  5.888   1.00 48.23  ? 25   LEU A N     1 
ATOM   173  C CA    . LEU A 1 39  ? 26.538  28.687  5.250   1.00 49.27  ? 25   LEU A CA    1 
ATOM   174  C C     . LEU A 1 39  ? 27.849  28.783  4.484   1.00 50.49  ? 25   LEU A C     1 
ATOM   175  O O     . LEU A 1 39  ? 27.887  29.374  3.415   1.00 49.84  ? 25   LEU A O     1 
ATOM   176  C CB    . LEU A 1 39  ? 26.474  29.834  6.272   1.00 51.61  ? 25   LEU A CB    1 
ATOM   177  C CG    . LEU A 1 39  ? 25.116  30.176  6.897   1.00 52.78  ? 25   LEU A CG    1 
ATOM   178  C CD1   . LEU A 1 39  ? 25.334  31.029  8.117   1.00 56.02  ? 25   LEU A CD1   1 
ATOM   179  C CD2   . LEU A 1 39  ? 24.185  30.878  5.923   1.00 52.50  ? 25   LEU A CD2   1 
ATOM   180  N N     . LEU A 1 40  ? 28.928  28.239  5.048   1.00 51.80  ? 26   LEU A N     1 
ATOM   181  C CA    . LEU A 1 40  ? 30.199  28.185  4.332   1.00 52.59  ? 26   LEU A CA    1 
ATOM   182  C C     . LEU A 1 40  ? 30.098  27.380  3.021   1.00 51.45  ? 26   LEU A C     1 
ATOM   183  O O     . LEU A 1 40  ? 30.468  27.890  1.962   1.00 51.96  ? 26   LEU A O     1 
ATOM   184  C CB    . LEU A 1 40  ? 31.304  27.582  5.197   1.00 53.66  ? 26   LEU A CB    1 
ATOM   185  C CG    . LEU A 1 40  ? 32.349  28.543  5.731   1.00 57.08  ? 26   LEU A CG    1 
ATOM   186  C CD1   . LEU A 1 40  ? 33.362  27.774  6.569   1.00 57.18  ? 26   LEU A CD1   1 
ATOM   187  C CD2   . LEU A 1 40  ? 33.052  29.311  4.608   1.00 58.49  ? 26   LEU A CD2   1 
ATOM   188  N N     . GLU A 1 41  ? 29.617  26.137  3.089   1.00 49.67  ? 27   GLU A N     1 
ATOM   189  C CA    . GLU A 1 41  ? 29.488  25.318  1.864   1.00 50.33  ? 27   GLU A CA    1 
ATOM   190  C C     . GLU A 1 41  ? 28.659  26.089  0.849   1.00 51.68  ? 27   GLU A C     1 
ATOM   191  O O     . GLU A 1 41  ? 28.962  26.059  -0.322  1.00 49.75  ? 27   GLU A O     1 
ATOM   192  C CB    . GLU A 1 41  ? 28.893  23.921  2.074   1.00 48.66  ? 27   GLU A CB    1 
ATOM   193  N N     . ASP A 1 42  ? 27.637  26.807  1.312   1.00 53.04  ? 28   ASP A N     1 
ATOM   194  C CA    . ASP A 1 42  ? 26.799  27.578  0.410   1.00 55.48  ? 28   ASP A CA    1 
ATOM   195  C C     . ASP A 1 42  ? 27.573  28.738  -0.219  1.00 57.59  ? 28   ASP A C     1 
ATOM   196  O O     . ASP A 1 42  ? 27.509  28.972  -1.423  1.00 56.91  ? 28   ASP A O     1 
ATOM   197  C CB    . ASP A 1 42  ? 25.585  28.108  1.166   1.00 55.07  ? 28   ASP A CB    1 
ATOM   198  C CG    . ASP A 1 42  ? 24.661  28.906  0.291   1.00 55.97  ? 28   ASP A CG    1 
ATOM   199  O OD1   . ASP A 1 42  ? 24.865  30.122  0.151   1.00 59.33  ? 28   ASP A OD1   1 
ATOM   200  O OD2   . ASP A 1 42  ? 23.728  28.320  -0.279  1.00 56.05  ? 28   ASP A OD2   1 
ATOM   201  N N     . HIS A 1 43  ? 28.294  29.467  0.618   1.00 59.37  ? 29   HIS A N     1 
ATOM   202  C CA    . HIS A 1 43  ? 29.007  30.643  0.181   1.00 60.70  ? 29   HIS A CA    1 
ATOM   203  C C     . HIS A 1 43  ? 30.104  30.258  -0.808  1.00 62.57  ? 29   HIS A C     1 
ATOM   204  O O     . HIS A 1 43  ? 30.271  30.912  -1.855  1.00 64.86  ? 29   HIS A O     1 
ATOM   205  C CB    . HIS A 1 43  ? 29.581  31.383  1.385   1.00 60.76  ? 29   HIS A CB    1 
ATOM   206  C CG    . HIS A 1 43  ? 30.368  32.597  1.021   1.00 63.33  ? 29   HIS A CG    1 
ATOM   207  N ND1   . HIS A 1 43  ? 29.870  33.588  0.205   1.00 65.20  ? 29   HIS A ND1   1 
ATOM   208  C CD2   . HIS A 1 43  ? 31.629  32.970  1.344   1.00 64.14  ? 29   HIS A CD2   1 
ATOM   209  C CE1   . HIS A 1 43  ? 30.787  34.529  0.054   1.00 66.89  ? 29   HIS A CE1   1 
ATOM   210  N NE2   . HIS A 1 43  ? 31.866  34.174  0.731   1.00 64.61  ? 29   HIS A NE2   1 
ATOM   211  N N     . LEU A 1 44  ? 30.817  29.182  -0.496  1.00 59.34  ? 30   LEU A N     1 
ATOM   212  C CA    . LEU A 1 44  ? 31.953  28.764  -1.309  1.00 57.99  ? 30   LEU A CA    1 
ATOM   213  C C     . LEU A 1 44  ? 31.519  28.081  -2.598  1.00 58.22  ? 30   LEU A C     1 
ATOM   214  O O     . LEU A 1 44  ? 32.042  28.397  -3.665  1.00 62.32  ? 30   LEU A O     1 
ATOM   215  C CB    . LEU A 1 44  ? 32.889  27.866  -0.501  1.00 56.08  ? 30   LEU A CB    1 
ATOM   216  C CG    . LEU A 1 44  ? 33.472  28.554  0.740   1.00 54.67  ? 30   LEU A CG    1 
ATOM   217  C CD1   . LEU A 1 44  ? 34.556  27.695  1.378   1.00 52.93  ? 30   LEU A CD1   1 
ATOM   218  C CD2   . LEU A 1 44  ? 34.012  29.932  0.410   1.00 55.64  ? 30   LEU A CD2   1 
ATOM   219  N N     . ASP A 1 45  ? 30.558  27.165  -2.509  1.00 58.09  ? 31   ASP A N     1 
ATOM   220  C CA    . ASP A 1 45  ? 29.937  26.581  -3.702  1.00 58.58  ? 31   ASP A CA    1 
ATOM   221  C C     . ASP A 1 45  ? 29.515  27.664  -4.676  1.00 62.15  ? 31   ASP A C     1 
ATOM   222  O O     . ASP A 1 45  ? 29.739  27.534  -5.862  1.00 66.49  ? 31   ASP A O     1 
ATOM   223  C CB    . ASP A 1 45  ? 28.695  25.764  -3.364  1.00 56.98  ? 31   ASP A CB    1 
ATOM   224  C CG    . ASP A 1 45  ? 29.001  24.314  -2.989  1.00 55.78  ? 31   ASP A CG    1 
ATOM   225  O OD1   . ASP A 1 45  ? 30.169  23.872  -3.083  1.00 53.82  ? 31   ASP A OD1   1 
ATOM   226  O OD2   . ASP A 1 45  ? 28.025  23.615  -2.610  1.00 54.52  ? 31   ASP A OD2   1 
ATOM   227  N N     . ARG A 1 46  ? 28.877  28.715  -4.184  1.00 62.52  ? 32   ARG A N     1 
ATOM   228  C CA    . ARG A 1 46  ? 28.381  29.759  -5.075  1.00 63.78  ? 32   ARG A CA    1 
ATOM   229  C C     . ARG A 1 46  ? 29.509  30.570  -5.689  1.00 66.11  ? 32   ARG A C     1 
ATOM   230  O O     . ARG A 1 46  ? 29.480  30.905  -6.863  1.00 65.28  ? 32   ARG A O     1 
ATOM   231  C CB    . ARG A 1 46  ? 27.438  30.701  -4.326  1.00 62.88  ? 32   ARG A CB    1 
ATOM   232  C CG    . ARG A 1 46  ? 26.092  30.078  -4.024  1.00 61.60  ? 32   ARG A CG    1 
ATOM   233  C CD    . ARG A 1 46  ? 24.985  31.104  -4.056  1.00 61.98  ? 32   ARG A CD    1 
ATOM   234  N NE    . ARG A 1 46  ? 24.182  30.904  -5.255  1.00 62.69  ? 32   ARG A NE    1 
ATOM   235  C CZ    . ARG A 1 46  ? 23.344  31.798  -5.750  1.00 65.49  ? 32   ARG A CZ    1 
ATOM   236  N NH1   . ARG A 1 46  ? 23.191  32.976  -5.154  1.00 67.30  ? 32   ARG A NH1   1 
ATOM   237  N NH2   . ARG A 1 46  ? 22.657  31.519  -6.848  1.00 67.23  ? 32   ARG A NH2   1 
ATOM   238  N N     . GLN A 1 47  ? 30.466  30.949  -4.853  1.00 68.39  ? 33   GLN A N     1 
ATOM   239  C CA    . GLN A 1 47  ? 31.631  31.671  -5.305  1.00 70.14  ? 33   GLN A CA    1 
ATOM   240  C C     . GLN A 1 47  ? 32.328  30.874  -6.419  1.00 69.14  ? 33   GLN A C     1 
ATOM   241  O O     . GLN A 1 47  ? 32.693  31.429  -7.455  1.00 69.00  ? 33   GLN A O     1 
ATOM   242  C CB    . GLN A 1 47  ? 32.567  31.916  -4.117  1.00 72.16  ? 33   GLN A CB    1 
ATOM   243  C CG    . GLN A 1 47  ? 33.803  32.736  -4.439  1.00 75.59  ? 33   GLN A CG    1 
ATOM   244  C CD    . GLN A 1 47  ? 34.995  31.866  -4.765  1.00 77.38  ? 33   GLN A CD    1 
ATOM   245  O OE1   . GLN A 1 47  ? 35.280  30.904  -4.049  1.00 77.09  ? 33   GLN A OE1   1 
ATOM   246  N NE2   . GLN A 1 47  ? 35.691  32.185  -5.858  1.00 79.20  ? 33   GLN A NE2   1 
ATOM   247  N N     . LEU A 1 48  ? 32.477  29.569  -6.217  1.00 64.64  ? 34   LEU A N     1 
ATOM   248  C CA    . LEU A 1 48  ? 33.159  28.734  -7.203  1.00 62.45  ? 34   LEU A CA    1 
ATOM   249  C C     . LEU A 1 48  ? 32.291  28.383  -8.407  1.00 62.72  ? 34   LEU A C     1 
ATOM   250  O O     . LEU A 1 48  ? 32.802  28.214  -9.494  1.00 63.46  ? 34   LEU A O     1 
ATOM   251  C CB    . LEU A 1 48  ? 33.697  27.475  -6.557  1.00 59.53  ? 34   LEU A CB    1 
ATOM   252  C CG    . LEU A 1 48  ? 34.924  27.773  -5.712  1.00 61.22  ? 34   LEU A CG    1 
ATOM   253  C CD1   . LEU A 1 48  ? 35.166  26.676  -4.686  1.00 61.84  ? 34   LEU A CD1   1 
ATOM   254  C CD2   . LEU A 1 48  ? 36.146  27.958  -6.593  1.00 62.70  ? 34   LEU A CD2   1 
ATOM   255  N N     . GLN A 1 49  ? 30.981  28.304  -8.228  1.00 63.63  ? 35   GLN A N     1 
ATOM   256  C CA    . GLN A 1 49  ? 30.083  28.026  -9.347  1.00 65.18  ? 35   GLN A CA    1 
ATOM   257  C C     . GLN A 1 49  ? 30.046  29.199  -10.340 1.00 67.96  ? 35   GLN A C     1 
ATOM   258  O O     . GLN A 1 49  ? 29.979  28.975  -11.557 1.00 71.11  ? 35   GLN A O     1 
ATOM   259  C CB    . GLN A 1 49  ? 28.663  27.664  -8.860  1.00 62.97  ? 35   GLN A CB    1 
ATOM   260  N N     . ARG A 1 50  ? 30.094  30.438  -9.847  1.00 67.93  ? 36   ARG A N     1 
ATOM   261  C CA    . ARG A 1 50  ? 30.089  31.597  -10.747 1.00 71.55  ? 36   ARG A CA    1 
ATOM   262  C C     . ARG A 1 50  ? 31.468  31.884  -11.323 1.00 73.19  ? 36   ARG A C     1 
ATOM   263  O O     . ARG A 1 50  ? 31.602  32.034  -12.524 1.00 74.97  ? 36   ARG A O     1 
ATOM   264  C CB    . ARG A 1 50  ? 29.571  32.867  -10.053 1.00 72.58  ? 36   ARG A CB    1 
ATOM   265  N N     . ASP A 1 51  ? 32.480  31.969  -10.461 1.00 73.61  ? 37   ASP A N     1 
ATOM   266  C CA    . ASP A 1 51  ? 33.823  32.405  -10.861 1.00 74.84  ? 37   ASP A CA    1 
ATOM   267  C C     . ASP A 1 51  ? 34.654  31.322  -11.540 1.00 74.66  ? 37   ASP A C     1 
ATOM   268  O O     . ASP A 1 51  ? 35.650  31.627  -12.184 1.00 79.50  ? 37   ASP A O     1 
ATOM   269  C CB    . ASP A 1 51  ? 34.605  32.943  -9.652  1.00 75.27  ? 37   ASP A CB    1 
ATOM   270  C CG    . ASP A 1 51  ? 33.907  34.107  -8.957  1.00 77.08  ? 37   ASP A CG    1 
ATOM   271  O OD1   . ASP A 1 51  ? 32.902  34.629  -9.490  1.00 83.30  ? 37   ASP A OD1   1 
ATOM   272  O OD2   . ASP A 1 51  ? 34.354  34.505  -7.865  1.00 77.95  ? 37   ASP A OD2   1 
ATOM   273  N N     . ALA A 1 52  ? 34.245  30.067  -11.421 1.00 74.65  ? 38   ALA A N     1 
ATOM   274  C CA    . ALA A 1 52  ? 35.032  28.938  -11.961 1.00 73.93  ? 38   ALA A CA    1 
ATOM   275  C C     . ALA A 1 52  ? 34.213  27.794  -12.593 1.00 72.09  ? 38   ALA A C     1 
ATOM   276  O O     . ALA A 1 52  ? 34.778  26.846  -13.112 1.00 70.51  ? 38   ALA A O     1 
ATOM   277  C CB    . ALA A 1 52  ? 35.920  28.385  -10.858 1.00 72.64  ? 38   ALA A CB    1 
ATOM   278  N N     . GLY A 1 53  ? 32.890  27.864  -12.517 1.00 71.13  ? 39   GLY A N     1 
ATOM   279  C CA    . GLY A 1 53  ? 32.033  26.893  -13.184 1.00 68.32  ? 39   GLY A CA    1 
ATOM   280  C C     . GLY A 1 53  ? 31.988  25.509  -12.571 1.00 65.10  ? 39   GLY A C     1 
ATOM   281  O O     . GLY A 1 53  ? 31.647  24.565  -13.256 1.00 65.60  ? 39   GLY A O     1 
ATOM   282  N N     . MET A 1 54  ? 32.282  25.378  -11.277 1.00 63.92  ? 40   MET A N     1 
ATOM   283  C CA    . MET A 1 54  ? 32.194  24.076  -10.597 1.00 60.41  ? 40   MET A CA    1 
ATOM   284  C C     . MET A 1 54  ? 32.022  24.220  -9.096  1.00 56.92  ? 40   MET A C     1 
ATOM   285  O O     . MET A 1 54  ? 32.389  25.251  -8.532  1.00 56.92  ? 40   MET A O     1 
ATOM   286  C CB    . MET A 1 54  ? 33.439  23.269  -10.875 1.00 61.99  ? 40   MET A CB    1 
ATOM   287  C CG    . MET A 1 54  ? 34.649  23.700  -10.084 1.00 64.40  ? 40   MET A CG    1 
ATOM   288  S SD    . MET A 1 54  ? 36.072  22.821  -10.727 1.00 70.83  ? 40   MET A SD    1 
ATOM   289  C CE    . MET A 1 54  ? 37.319  24.107  -10.626 1.00 72.29  ? 40   MET A CE    1 
ATOM   290  N N     . PRO A 1 55  ? 31.480  23.178  -8.436  1.00 53.28  ? 41   PRO A N     1 
ATOM   291  C CA    . PRO A 1 55  ? 31.231  23.218  -7.001  1.00 50.74  ? 41   PRO A CA    1 
ATOM   292  C C     . PRO A 1 55  ? 32.483  23.025  -6.183  1.00 49.41  ? 41   PRO A C     1 
ATOM   293  O O     . PRO A 1 55  ? 33.519  22.712  -6.720  1.00 48.42  ? 41   PRO A O     1 
ATOM   294  C CB    . PRO A 1 55  ? 30.280  22.058  -6.786  1.00 51.33  ? 41   PRO A CB    1 
ATOM   295  C CG    . PRO A 1 55  ? 30.691  21.077  -7.822  1.00 52.16  ? 41   PRO A CG    1 
ATOM   296  C CD    . PRO A 1 55  ? 31.043  21.903  -9.020  1.00 53.11  ? 41   PRO A CD    1 
ATOM   297  N N     . HIS A 1 56  ? 32.394  23.243  -4.878  1.00 51.10  ? 42   HIS A N     1 
ATOM   298  C CA    . HIS A 1 56  ? 33.590  23.248  -4.028  1.00 51.58  ? 42   HIS A CA    1 
ATOM   299  C C     . HIS A 1 56  ? 34.315  21.918  -4.027  1.00 52.01  ? 42   HIS A C     1 
ATOM   300  O O     . HIS A 1 56  ? 35.535  21.887  -4.029  1.00 53.72  ? 42   HIS A O     1 
ATOM   301  C CB    . HIS A 1 56  ? 33.258  23.662  -2.596  1.00 50.45  ? 42   HIS A CB    1 
ATOM   302  C CG    . HIS A 1 56  ? 34.469  23.852  -1.730  1.00 52.50  ? 42   HIS A CG    1 
ATOM   303  N ND1   . HIS A 1 56  ? 34.484  23.532  -0.389  1.00 54.56  ? 42   HIS A ND1   1 
ATOM   304  C CD2   . HIS A 1 56  ? 35.701  24.346  -2.005  1.00 54.42  ? 42   HIS A CD2   1 
ATOM   305  C CE1   . HIS A 1 56  ? 35.664  23.832  0.128   1.00 54.47  ? 42   HIS A CE1   1 
ATOM   306  N NE2   . HIS A 1 56  ? 36.422  24.328  -0.831  1.00 55.65  ? 42   HIS A NE2   1 
ATOM   307  N N     . VAL A 1 57  ? 33.576  20.819  -4.022  1.00 52.93  ? 43   VAL A N     1 
ATOM   308  C CA    . VAL A 1 57  ? 34.209  19.511  -3.885  1.00 55.16  ? 43   VAL A CA    1 
ATOM   309  C C     . VAL A 1 57  ? 35.071  19.205  -5.103  1.00 55.23  ? 43   VAL A C     1 
ATOM   310  O O     . VAL A 1 57  ? 36.205  18.738  -4.961  1.00 56.83  ? 43   VAL A O     1 
ATOM   311  C CB    . VAL A 1 57  ? 33.183  18.377  -3.714  1.00 57.18  ? 43   VAL A CB    1 
ATOM   312  C CG1   . VAL A 1 57  ? 33.897  17.088  -3.335  1.00 55.96  ? 43   VAL A CG1   1 
ATOM   313  C CG2   . VAL A 1 57  ? 32.143  18.750  -2.664  1.00 57.16  ? 43   VAL A CG2   1 
ATOM   314  N N     . TYR A 1 58  ? 34.532  19.491  -6.286  1.00 54.41  ? 44   TYR A N     1 
ATOM   315  C CA    . TYR A 1 58  ? 35.263  19.335  -7.542  1.00 54.05  ? 44   TYR A CA    1 
ATOM   316  C C     . TYR A 1 58  ? 36.561  20.159  -7.543  1.00 54.53  ? 44   TYR A C     1 
ATOM   317  O O     . TYR A 1 58  ? 37.645  19.627  -7.745  1.00 55.63  ? 44   TYR A O     1 
ATOM   318  C CB    . TYR A 1 58  ? 34.374  19.751  -8.712  1.00 55.02  ? 44   TYR A CB    1 
ATOM   319  C CG    . TYR A 1 58  ? 33.249  18.769  -9.057  1.00 54.56  ? 44   TYR A CG    1 
ATOM   320  C CD1   . TYR A 1 58  ? 32.781  17.829  -8.144  1.00 54.93  ? 44   TYR A CD1   1 
ATOM   321  C CD2   . TYR A 1 58  ? 32.625  18.831  -10.274 1.00 55.67  ? 44   TYR A CD2   1 
ATOM   322  C CE1   . TYR A 1 58  ? 31.740  16.964  -8.454  1.00 53.51  ? 44   TYR A CE1   1 
ATOM   323  C CE2   . TYR A 1 58  ? 31.583  17.979  -10.583 1.00 56.86  ? 44   TYR A CE2   1 
ATOM   324  C CZ    . TYR A 1 58  ? 31.151  17.037  -9.671  1.00 54.97  ? 44   TYR A CZ    1 
ATOM   325  O OH    . TYR A 1 58  ? 30.125  16.189  -10.026 1.00 54.86  ? 44   TYR A OH    1 
ATOM   326  N N     . TYR A 1 59  ? 36.448  21.462  -7.327  1.00 54.50  ? 45   TYR A N     1 
ATOM   327  C CA    . TYR A 1 59  ? 37.621  22.333  -7.211  1.00 54.65  ? 45   TYR A CA    1 
ATOM   328  C C     . TYR A 1 59  ? 38.704  21.705  -6.337  1.00 54.79  ? 45   TYR A C     1 
ATOM   329  O O     . TYR A 1 59  ? 39.895  21.730  -6.697  1.00 59.21  ? 45   TYR A O     1 
ATOM   330  C CB    . TYR A 1 59  ? 37.213  23.685  -6.639  1.00 55.36  ? 45   TYR A CB    1 
ATOM   331  C CG    . TYR A 1 59  ? 38.308  24.712  -6.599  1.00 56.10  ? 45   TYR A CG    1 
ATOM   332  C CD1   . TYR A 1 59  ? 38.560  25.529  -7.692  1.00 59.16  ? 45   TYR A CD1   1 
ATOM   333  C CD2   . TYR A 1 59  ? 39.077  24.890  -5.458  1.00 57.23  ? 45   TYR A CD2   1 
ATOM   334  C CE1   . TYR A 1 59  ? 39.554  26.499  -7.660  1.00 61.23  ? 45   TYR A CE1   1 
ATOM   335  C CE2   . TYR A 1 59  ? 40.074  25.854  -5.407  1.00 59.85  ? 45   TYR A CE2   1 
ATOM   336  C CZ    . TYR A 1 59  ? 40.308  26.652  -6.519  1.00 61.67  ? 45   TYR A CZ    1 
ATOM   337  O OH    . TYR A 1 59  ? 41.290  27.601  -6.479  1.00 64.21  ? 45   TYR A OH    1 
ATOM   338  N N     . GLY A 1 60  ? 38.302  21.142  -5.197  1.00 51.85  ? 46   GLY A N     1 
ATOM   339  C CA    . GLY A 1 60  ? 39.231  20.434  -4.299  1.00 50.16  ? 46   GLY A CA    1 
ATOM   340  C C     . GLY A 1 60  ? 39.991  19.299  -4.984  1.00 50.03  ? 46   GLY A C     1 
ATOM   341  O O     . GLY A 1 60  ? 41.178  19.084  -4.720  1.00 48.23  ? 46   GLY A O     1 
ATOM   342  N N     . LEU A 1 61  ? 39.303  18.571  -5.868  1.00 48.92  ? 47   LEU A N     1 
ATOM   343  C CA    . LEU A 1 61  ? 39.926  17.468  -6.577  1.00 48.14  ? 47   LEU A CA    1 
ATOM   344  C C     . LEU A 1 61  ? 41.039  18.004  -7.471  1.00 50.32  ? 47   LEU A C     1 
ATOM   345  O O     . LEU A 1 61  ? 42.152  17.480  -7.470  1.00 51.54  ? 47   LEU A O     1 
ATOM   346  C CB    . LEU A 1 61  ? 38.899  16.701  -7.397  1.00 47.34  ? 47   LEU A CB    1 
ATOM   347  C CG    . LEU A 1 61  ? 37.695  16.129  -6.645  1.00 46.32  ? 47   LEU A CG    1 
ATOM   348  C CD1   . LEU A 1 61  ? 36.731  15.424  -7.597  1.00 46.80  ? 47   LEU A CD1   1 
ATOM   349  C CD2   . LEU A 1 61  ? 38.126  15.167  -5.547  1.00 46.10  ? 47   LEU A CD2   1 
ATOM   350  N N     . LEU A 1 62  ? 40.769  19.093  -8.185  1.00 50.93  ? 48   LEU A N     1 
ATOM   351  C CA    . LEU A 1 62  ? 41.793  19.719  -9.019  1.00 50.90  ? 48   LEU A CA    1 
ATOM   352  C C     . LEU A 1 62  ? 42.978  20.184  -8.205  1.00 52.01  ? 48   LEU A C     1 
ATOM   353  O O     . LEU A 1 62  ? 44.115  20.005  -8.600  1.00 54.59  ? 48   LEU A O     1 
ATOM   354  C CB    . LEU A 1 62  ? 41.224  20.904  -9.768  1.00 51.28  ? 48   LEU A CB    1 
ATOM   355  C CG    . LEU A 1 62  ? 40.015  20.636  -10.653 1.00 50.86  ? 48   LEU A CG    1 
ATOM   356  C CD1   . LEU A 1 62  ? 39.873  21.781  -11.635 1.00 51.86  ? 48   LEU A CD1   1 
ATOM   357  C CD2   . LEU A 1 62  ? 40.127  19.312  -11.390 1.00 50.87  ? 48   LEU A CD2   1 
ATOM   358  N N     . VAL A 1 63  ? 42.707  20.781  -7.057  1.00 54.20  ? 49   VAL A N     1 
ATOM   359  C CA    . VAL A 1 63  ? 43.764  21.264  -6.166  1.00 56.42  ? 49   VAL A CA    1 
ATOM   360  C C     . VAL A 1 63  ? 44.653  20.119  -5.698  1.00 58.31  ? 49   VAL A C     1 
ATOM   361  O O     . VAL A 1 63  ? 45.881  20.231  -5.696  1.00 61.26  ? 49   VAL A O     1 
ATOM   362  C CB    . VAL A 1 63  ? 43.164  21.983  -4.945  1.00 56.42  ? 49   VAL A CB    1 
ATOM   363  C CG1   . VAL A 1 63  ? 44.227  22.281  -3.897  1.00 57.11  ? 49   VAL A CG1   1 
ATOM   364  C CG2   . VAL A 1 63  ? 42.488  23.268  -5.390  1.00 56.07  ? 49   VAL A CG2   1 
ATOM   365  N N     . LYS A 1 64  ? 44.051  18.996  -5.336  1.00 57.45  ? 50   LYS A N     1 
ATOM   366  C CA    . LYS A 1 64  ? 44.865  17.890  -4.871  1.00 56.28  ? 50   LYS A CA    1 
ATOM   367  C C     . LYS A 1 64  ? 45.737  17.285  -5.979  1.00 53.90  ? 50   LYS A C     1 
ATOM   368  O O     . LYS A 1 64  ? 46.844  16.815  -5.701  1.00 54.29  ? 50   LYS A O     1 
ATOM   369  C CB    . LYS A 1 64  ? 44.030  16.811  -4.207  1.00 55.57  ? 50   LYS A CB    1 
ATOM   370  C CG    . LYS A 1 64  ? 44.895  15.782  -3.504  1.00 56.99  ? 50   LYS A CG    1 
ATOM   371  C CD    . LYS A 1 64  ? 45.965  16.402  -2.617  1.00 57.72  ? 50   LYS A CD    1 
ATOM   372  C CE    . LYS A 1 64  ? 46.906  15.339  -2.092  1.00 60.20  ? 50   LYS A CE    1 
ATOM   373  N NZ    . LYS A 1 64  ? 48.031  15.955  -1.336  1.00 62.46  ? 50   LYS A NZ    1 
ATOM   374  N N     . LEU A 1 65  ? 45.236  17.261  -7.214  1.00 51.73  ? 51   LEU A N     1 
ATOM   375  C CA    . LEU A 1 65  ? 46.019  16.727  -8.360  1.00 50.48  ? 51   LEU A CA    1 
ATOM   376  C C     . LEU A 1 65  ? 47.143  17.689  -8.708  1.00 52.30  ? 51   LEU A C     1 
ATOM   377  O O     . LEU A 1 65  ? 48.309  17.292  -8.797  1.00 51.96  ? 51   LEU A O     1 
ATOM   378  C CB    . LEU A 1 65  ? 45.136  16.533  -9.584  1.00 48.68  ? 51   LEU A CB    1 
ATOM   379  C CG    . LEU A 1 65  ? 43.986  15.538  -9.451  1.00 47.19  ? 51   LEU A CG    1 
ATOM   380  C CD1   . LEU A 1 65  ? 43.228  15.452  -10.761 1.00 47.73  ? 51   LEU A CD1   1 
ATOM   381  C CD2   . LEU A 1 65  ? 44.502  14.174  -9.029  1.00 46.87  ? 51   LEU A CD2   1 
ATOM   382  N N     . ALA A 1 66  ? 46.793  18.970  -8.831  1.00 53.27  ? 52   ALA A N     1 
ATOM   383  C CA    . ALA A 1 66  ? 47.780  20.046  -9.001  1.00 56.43  ? 52   ALA A CA    1 
ATOM   384  C C     . ALA A 1 66  ? 48.951  19.963  -8.004  1.00 57.05  ? 52   ALA A C     1 
ATOM   385  O O     . ALA A 1 66  ? 50.078  20.290  -8.336  1.00 57.96  ? 52   ALA A O     1 
ATOM   386  C CB    . ALA A 1 66  ? 47.092  21.401  -8.887  1.00 56.62  ? 52   ALA A CB    1 
ATOM   387  N N     . GLU A 1 67  ? 48.651  19.516  -6.792  1.00 58.44  ? 53   GLU A N     1 
ATOM   388  C CA    . GLU A 1 67  ? 49.656  19.303  -5.757  1.00 61.57  ? 53   GLU A CA    1 
ATOM   389  C C     . GLU A 1 67  ? 50.415  17.990  -5.869  1.00 61.21  ? 53   GLU A C     1 
ATOM   390  O O     . GLU A 1 67  ? 51.456  17.836  -5.244  1.00 62.80  ? 53   GLU A O     1 
ATOM   391  C CB    . GLU A 1 67  ? 48.991  19.304  -4.383  1.00 63.21  ? 53   GLU A CB    1 
ATOM   392  C CG    . GLU A 1 67  ? 48.647  20.663  -3.819  1.00 64.76  ? 53   GLU A CG    1 
ATOM   393  C CD    . GLU A 1 67  ? 48.188  20.549  -2.385  1.00 68.08  ? 53   GLU A CD    1 
ATOM   394  O OE1   . GLU A 1 67  ? 47.557  19.500  -2.044  1.00 65.56  ? 53   GLU A OE1   1 
ATOM   395  O OE2   . GLU A 1 67  ? 48.467  21.504  -1.601  1.00 71.99  ? 53   GLU A OE2   1 
ATOM   396  N N     . SER A 1 68  ? 49.884  17.034  -6.617  1.00 59.98  ? 54   SER A N     1 
ATOM   397  C CA    . SER A 1 68  ? 50.464  15.696  -6.652  1.00 61.44  ? 54   SER A CA    1 
ATOM   398  C C     . SER A 1 68  ? 51.664  15.585  -7.575  1.00 62.96  ? 54   SER A C     1 
ATOM   399  O O     . SER A 1 68  ? 51.851  16.406  -8.479  1.00 64.73  ? 54   SER A O     1 
ATOM   400  C CB    . SER A 1 68  ? 49.412  14.683  -7.100  1.00 61.29  ? 54   SER A CB    1 
ATOM   401  O OG    . SER A 1 68  ? 48.286  14.720  -6.246  1.00 61.83  ? 54   SER A OG    1 
ATOM   402  N N     . PRO A 1 69  ? 52.480  14.547  -7.370  1.00 65.51  ? 55   PRO A N     1 
ATOM   403  C CA    . PRO A 1 69  ? 53.552  14.292  -8.332  1.00 66.45  ? 55   PRO A CA    1 
ATOM   404  C C     . PRO A 1 69  ? 52.953  13.988  -9.686  1.00 66.64  ? 55   PRO A C     1 
ATOM   405  O O     . PRO A 1 69  ? 51.946  13.289  -9.780  1.00 69.55  ? 55   PRO A O     1 
ATOM   406  C CB    . PRO A 1 69  ? 54.274  13.063  -7.757  1.00 66.94  ? 55   PRO A CB    1 
ATOM   407  C CG    . PRO A 1 69  ? 53.947  13.070  -6.305  1.00 67.78  ? 55   PRO A CG    1 
ATOM   408  C CD    . PRO A 1 69  ? 52.553  13.640  -6.207  1.00 66.10  ? 55   PRO A CD    1 
ATOM   409  N N     . ARG A 1 70  ? 53.552  14.544  -10.729 1.00 69.09  ? 56   ARG A N     1 
ATOM   410  C CA    . ARG A 1 70  ? 53.074  14.388  -12.112 1.00 67.49  ? 56   ARG A CA    1 
ATOM   411  C C     . ARG A 1 70  ? 51.596  14.764  -12.304 1.00 65.83  ? 56   ARG A C     1 
ATOM   412  O O     . ARG A 1 70  ? 50.957  14.336  -13.269 1.00 66.83  ? 56   ARG A O     1 
ATOM   413  C CB    . ARG A 1 70  ? 53.368  12.972  -12.610 1.00 68.11  ? 56   ARG A CB    1 
ATOM   414  C CG    . ARG A 1 70  ? 54.854  12.633  -12.662 1.00 69.08  ? 56   ARG A CG    1 
ATOM   415  C CD    . ARG A 1 70  ? 55.063  11.234  -13.198 1.00 68.98  ? 56   ARG A CD    1 
ATOM   416  N NE    . ARG A 1 70  ? 54.583  11.129  -14.571 1.00 67.93  ? 56   ARG A NE    1 
ATOM   417  C CZ    . ARG A 1 70  ? 54.428  9.986   -15.235 1.00 68.72  ? 56   ARG A CZ    1 
ATOM   418  N NH1   . ARG A 1 70  ? 54.713  8.817   -14.661 1.00 69.01  ? 56   ARG A NH1   1 
ATOM   419  N NH2   . ARG A 1 70  ? 53.981  10.013  -16.490 1.00 69.18  ? 56   ARG A NH2   1 
ATOM   420  N N     . ARG A 1 71  ? 51.075  15.593  -11.395 1.00 64.70  ? 57   ARG A N     1 
ATOM   421  C CA    . ARG A 1 71  ? 49.696  16.100  -11.447 1.00 62.00  ? 57   ARG A CA    1 
ATOM   422  C C     . ARG A 1 71  ? 48.647  15.004  -11.574 1.00 59.40  ? 57   ARG A C     1 
ATOM   423  O O     . ARG A 1 71  ? 47.593  15.189  -12.181 1.00 58.71  ? 57   ARG A O     1 
ATOM   424  C CB    . ARG A 1 71  ? 49.567  17.137  -12.569 1.00 64.23  ? 57   ARG A CB    1 
ATOM   425  C CG    . ARG A 1 71  ? 49.935  18.539  -12.128 1.00 67.00  ? 57   ARG A CG    1 
ATOM   426  C CD    . ARG A 1 71  ? 50.203  19.385  -13.359 1.00 69.57  ? 57   ARG A CD    1 
ATOM   427  N NE    . ARG A 1 71  ? 50.693  20.758  -13.183 1.00 72.55  ? 57   ARG A NE    1 
ATOM   428  C CZ    . ARG A 1 71  ? 50.839  21.601  -14.202 1.00 74.31  ? 57   ARG A CZ    1 
ATOM   429  N NH1   . ARG A 1 71  ? 50.538  21.203  -15.436 1.00 74.76  ? 57   ARG A NH1   1 
ATOM   430  N NH2   . ARG A 1 71  ? 51.280  22.835  -13.995 1.00 76.35  ? 57   ARG A NH2   1 
ATOM   431  N N     . ARG A 1 72  ? 48.945  13.853  -10.985 1.00 60.41  ? 58   ARG A N     1 
ATOM   432  C CA    . ARG A 1 72  ? 48.088  12.688  -11.115 1.00 59.77  ? 58   ARG A CA    1 
ATOM   433  C C     . ARG A 1 72  ? 47.968  11.971  -9.798  1.00 58.43  ? 58   ARG A C     1 
ATOM   434  O O     . ARG A 1 72  ? 48.803  12.119  -8.916  1.00 57.56  ? 58   ARG A O     1 
ATOM   435  C CB    . ARG A 1 72  ? 48.629  11.740  -12.192 1.00 61.68  ? 58   ARG A CB    1 
ATOM   436  C CG    . ARG A 1 72  ? 49.869  10.949  -11.773 1.00 65.37  ? 58   ARG A CG    1 
ATOM   437  C CD    . ARG A 1 72  ? 50.515  10.280  -12.972 1.00 67.94  ? 58   ARG A CD    1 
ATOM   438  N NE    . ARG A 1 72  ? 50.743  11.267  -14.008 1.00 72.80  ? 58   ARG A NE    1 
ATOM   439  C CZ    . ARG A 1 72  ? 50.741  11.016  -15.321 1.00 76.51  ? 58   ARG A CZ    1 
ATOM   440  N NH1   . ARG A 1 72  ? 50.529  9.780   -15.782 1.00 78.90  ? 58   ARG A NH1   1 
ATOM   441  N NH2   . ARG A 1 72  ? 50.961  12.012  -16.181 1.00 74.59  ? 58   ARG A NH2   1 
ATOM   442  N N     . LEU A 1 73  ? 46.944  11.135  -9.706  1.00 58.98  ? 59   LEU A N     1 
ATOM   443  C CA    . LEU A 1 73  ? 46.643  10.390  -8.500  1.00 56.75  ? 59   LEU A CA    1 
ATOM   444  C C     . LEU A 1 73  ? 45.672  9.280   -8.896  1.00 55.52  ? 59   LEU A C     1 
ATOM   445  O O     . LEU A 1 73  ? 44.790  9.487   -9.728  1.00 53.41  ? 59   LEU A O     1 
ATOM   446  C CB    . LEU A 1 73  ? 45.977  11.339  -7.501  1.00 58.59  ? 59   LEU A CB    1 
ATOM   447  C CG    . LEU A 1 73  ? 46.444  11.378  -6.043  1.00 59.95  ? 59   LEU A CG    1 
ATOM   448  C CD1   . LEU A 1 73  ? 47.956  11.481  -5.903  1.00 60.51  ? 59   LEU A CD1   1 
ATOM   449  C CD2   . LEU A 1 73  ? 45.773  12.547  -5.344  1.00 59.20  ? 59   LEU A CD2   1 
ATOM   450  N N     . ARG A 1 74  ? 45.822  8.098   -8.318  1.00 56.82  ? 60   ARG A N     1 
ATOM   451  C CA    . ARG A 1 74  ? 44.883  7.012   -8.610  1.00 57.70  ? 60   ARG A CA    1 
ATOM   452  C C     . ARG A 1 74  ? 43.559  7.278   -7.942  1.00 57.19  ? 60   ARG A C     1 
ATOM   453  O O     . ARG A 1 74  ? 43.517  7.881   -6.882  1.00 56.12  ? 60   ARG A O     1 
ATOM   454  C CB    . ARG A 1 74  ? 45.455  5.658   -8.190  1.00 58.83  ? 60   ARG A CB    1 
ATOM   455  C CG    . ARG A 1 74  ? 46.413  5.159   -9.259  1.00 59.74  ? 60   ARG A CG    1 
ATOM   456  C CD    . ARG A 1 74  ? 47.121  3.897   -8.824  1.00 60.69  ? 60   ARG A CD    1 
ATOM   457  N NE    . ARG A 1 74  ? 46.194  2.811   -8.550  1.00 60.06  ? 60   ARG A NE    1 
ATOM   458  C CZ    . ARG A 1 74  ? 46.318  1.559   -8.981  1.00 63.71  ? 60   ARG A CZ    1 
ATOM   459  N NH1   . ARG A 1 74  ? 47.359  1.165   -9.747  1.00 66.20  ? 60   ARG A NH1   1 
ATOM   460  N NH2   . ARG A 1 74  ? 45.382  0.674   -8.636  1.00 63.83  ? 60   ARG A NH2   1 
ATOM   461  N N     . MET A 1 75  ? 42.488  6.786   -8.554  1.00 57.56  ? 61   MET A N     1 
ATOM   462  C CA    . MET A 1 75  ? 41.129  7.098   -8.113  1.00 56.05  ? 61   MET A CA    1 
ATOM   463  C C     . MET A 1 75  ? 40.904  6.963   -6.605  1.00 55.34  ? 61   MET A C     1 
ATOM   464  O O     . MET A 1 75  ? 40.474  7.917   -5.952  1.00 53.81  ? 61   MET A O     1 
ATOM   465  C CB    . MET A 1 75  ? 40.125  6.214   -8.841  1.00 58.61  ? 61   MET A CB    1 
ATOM   466  C CG    . MET A 1 75  ? 40.175  6.309   -10.362 1.00 61.06  ? 61   MET A CG    1 
ATOM   467  S SD    . MET A 1 75  ? 40.244  8.010   -10.996 1.00 62.69  ? 61   MET A SD    1 
ATOM   468  C CE    . MET A 1 75  ? 38.531  8.475   -10.820 1.00 61.96  ? 61   MET A CE    1 
ATOM   469  N N     . THR A 1 76  ? 41.177  5.787   -6.045  1.00 54.93  ? 62   THR A N     1 
ATOM   470  C CA    . THR A 1 76  ? 40.878  5.562   -4.635  1.00 54.99  ? 62   THR A CA    1 
ATOM   471  C C     . THR A 1 76  ? 41.676  6.534   -3.794  1.00 55.67  ? 62   THR A C     1 
ATOM   472  O O     . THR A 1 76  ? 41.152  7.058   -2.795  1.00 56.93  ? 62   THR A O     1 
ATOM   473  C CB    . THR A 1 76  ? 41.153  4.124   -4.179  1.00 56.60  ? 62   THR A CB    1 
ATOM   474  O OG1   . THR A 1 76  ? 40.377  3.229   -4.975  1.00 57.87  ? 62   THR A OG1   1 
ATOM   475  C CG2   . THR A 1 76  ? 40.773  3.925   -2.712  1.00 57.60  ? 62   THR A CG2   1 
ATOM   476  N N     . GLU A 1 77  ? 42.929  6.786   -4.173  1.00 53.83  ? 63   GLU A N     1 
ATOM   477  C CA    . GLU A 1 77  ? 43.746  7.738   -3.431  1.00 55.39  ? 63   GLU A CA    1 
ATOM   478  C C     . GLU A 1 77  ? 43.099  9.119   -3.438  1.00 53.31  ? 63   GLU A C     1 
ATOM   479  O O     . GLU A 1 77  ? 43.059  9.823   -2.427  1.00 54.48  ? 63   GLU A O     1 
ATOM   480  C CB    . GLU A 1 77  ? 45.139  7.836   -4.047  1.00 57.88  ? 63   GLU A CB    1 
ATOM   481  C CG    . GLU A 1 77  ? 46.079  6.687   -3.723  1.00 60.74  ? 63   GLU A CG    1 
ATOM   482  C CD    . GLU A 1 77  ? 47.243  6.597   -4.729  1.00 64.37  ? 63   GLU A CD    1 
ATOM   483  O OE1   . GLU A 1 77  ? 47.678  7.648   -5.281  1.00 64.30  ? 63   GLU A OE1   1 
ATOM   484  O OE2   . GLU A 1 77  ? 47.701  5.467   -5.024  1.00 67.52  ? 63   GLU A OE2   1 
ATOM   485  N N     . LEU A 1 78  ? 42.593  9.502   -4.592  1.00 52.34  ? 64   LEU A N     1 
ATOM   486  C CA    . LEU A 1 78  ? 41.950  10.791  -4.739  1.00 51.51  ? 64   LEU A CA    1 
ATOM   487  C C     . LEU A 1 78  ? 40.722  10.840  -3.837  1.00 51.85  ? 64   LEU A C     1 
ATOM   488  O O     . LEU A 1 78  ? 40.569  11.762  -3.049  1.00 51.26  ? 64   LEU A O     1 
ATOM   489  C CB    . LEU A 1 78  ? 41.599  11.032  -6.204  1.00 51.41  ? 64   LEU A CB    1 
ATOM   490  C CG    . LEU A 1 78  ? 41.065  12.405  -6.590  1.00 51.47  ? 64   LEU A CG    1 
ATOM   491  C CD1   . LEU A 1 78  ? 41.834  13.530  -5.899  1.00 51.28  ? 64   LEU A CD1   1 
ATOM   492  C CD2   . LEU A 1 78  ? 41.103  12.560  -8.103  1.00 51.80  ? 64   LEU A CD2   1 
ATOM   493  N N     . ALA A 1 79  ? 39.892  9.804   -3.888  1.00 53.26  ? 65   ALA A N     1 
ATOM   494  C CA    . ALA A 1 79  ? 38.739  9.705   -2.982  1.00 53.37  ? 65   ALA A CA    1 
ATOM   495  C C     . ALA A 1 79  ? 39.129  9.801   -1.507  1.00 54.26  ? 65   ALA A C     1 
ATOM   496  O O     . ALA A 1 79  ? 38.463  10.500  -0.746  1.00 52.69  ? 65   ALA A O     1 
ATOM   497  C CB    . ALA A 1 79  ? 37.992  8.417   -3.224  1.00 54.77  ? 65   ALA A CB    1 
ATOM   498  N N     . LYS A 1 80  ? 40.227  9.141   -1.118  1.00 56.57  ? 66   LYS A N     1 
ATOM   499  C CA    . LYS A 1 80  ? 40.667  9.119   0.296   1.00 58.47  ? 66   LYS A CA    1 
ATOM   500  C C     . LYS A 1 80  ? 41.058  10.514  0.787   1.00 59.80  ? 66   LYS A C     1 
ATOM   501  O O     . LYS A 1 80  ? 40.745  10.871  1.935   1.00 58.62  ? 66   LYS A O     1 
ATOM   502  C CB    . LYS A 1 80  ? 41.840  8.144   0.526   1.00 58.73  ? 66   LYS A CB    1 
ATOM   503  C CG    . LYS A 1 80  ? 42.337  8.080   1.977   1.00 59.66  ? 66   LYS A CG    1 
ATOM   504  C CD    . LYS A 1 80  ? 43.281  6.903   2.236   1.00 58.67  ? 66   LYS A CD    1 
ATOM   505  N N     . TYR A 1 81  ? 41.745  11.290  -0.065  1.00 57.99  ? 67   TYR A N     1 
ATOM   506  C CA    . TYR A 1 81  ? 42.113  12.657  0.304   1.00 59.50  ? 67   TYR A CA    1 
ATOM   507  C C     . TYR A 1 81  ? 40.864  13.517  0.418   1.00 56.00  ? 67   TYR A C     1 
ATOM   508  O O     . TYR A 1 81  ? 40.722  14.292  1.362   1.00 60.20  ? 67   TYR A O     1 
ATOM   509  C CB    . TYR A 1 81  ? 43.056  13.284  -0.721  1.00 63.00  ? 67   TYR A CB    1 
ATOM   510  C CG    . TYR A 1 81  ? 44.498  12.841  -0.624  1.00 69.94  ? 67   TYR A CG    1 
ATOM   511  C CD1   . TYR A 1 81  ? 45.259  13.099  0.523   1.00 73.63  ? 67   TYR A CD1   1 
ATOM   512  C CD2   . TYR A 1 81  ? 45.122  12.194  -1.696  1.00 73.04  ? 67   TYR A CD2   1 
ATOM   513  C CE1   . TYR A 1 81  ? 46.588  12.702  0.607   1.00 78.90  ? 67   TYR A CE1   1 
ATOM   514  C CE2   . TYR A 1 81  ? 46.456  11.802  -1.624  1.00 79.24  ? 67   TYR A CE2   1 
ATOM   515  C CZ    . TYR A 1 81  ? 47.182  12.055  -0.475  1.00 81.40  ? 67   TYR A CZ    1 
ATOM   516  O OH    . TYR A 1 81  ? 48.492  11.658  -0.418  1.00 85.08  ? 67   TYR A OH    1 
ATOM   517  N N     . ALA A 1 82  ? 39.971  13.383  -0.558  1.00 50.31  ? 68   ALA A N     1 
ATOM   518  C CA    . ALA A 1 82  ? 38.748  14.176  -0.644  1.00 45.95  ? 68   ALA A CA    1 
ATOM   519  C C     . ALA A 1 82  ? 37.700  13.779  0.404   1.00 45.01  ? 68   ALA A C     1 
ATOM   520  O O     . ALA A 1 82  ? 36.808  14.563  0.723   1.00 43.17  ? 68   ALA A O     1 
ATOM   521  C CB    . ALA A 1 82  ? 38.153  14.028  -2.033  1.00 43.73  ? 68   ALA A CB    1 
ATOM   522  N N     . LYS A 1 83  ? 37.808  12.555  0.910   1.00 45.74  ? 69   LYS A N     1 
ATOM   523  C CA    . LYS A 1 83  ? 36.891  11.995  1.922   1.00 45.90  ? 69   LYS A CA    1 
ATOM   524  C C     . LYS A 1 83  ? 35.523  11.722  1.334   1.00 45.69  ? 69   LYS A C     1 
ATOM   525  O O     . LYS A 1 83  ? 34.502  11.850  2.019   1.00 47.35  ? 69   LYS A O     1 
ATOM   526  C CB    . LYS A 1 83  ? 36.780  12.884  3.153   1.00 46.52  ? 69   LYS A CB    1 
ATOM   527  C CG    . LYS A 1 83  ? 38.112  13.375  3.695   1.00 48.03  ? 69   LYS A CG    1 
ATOM   528  C CD    . LYS A 1 83  ? 38.961  12.238  4.217   1.00 49.72  ? 69   LYS A CD    1 
ATOM   529  C CE    . LYS A 1 83  ? 40.414  12.659  4.354   1.00 52.32  ? 69   LYS A CE    1 
ATOM   530  N NZ    . LYS A 1 83  ? 41.268  11.536  4.821   1.00 54.62  ? 69   LYS A NZ    1 
ATOM   531  N N     . ILE A 1 84  ? 35.509  11.304  0.071   1.00 43.88  ? 70   ILE A N     1 
ATOM   532  C CA    . ILE A 1 84  ? 34.273  11.012  -0.623  1.00 44.21  ? 70   ILE A CA    1 
ATOM   533  C C     . ILE A 1 84  ? 34.282  9.566   -1.047  1.00 45.40  ? 70   ILE A C     1 
ATOM   534  O O     . ILE A 1 84  ? 35.276  8.883   -0.838  1.00 49.96  ? 70   ILE A O     1 
ATOM   535  C CB    . ILE A 1 84  ? 34.099  11.929  -1.851  1.00 44.35  ? 70   ILE A CB    1 
ATOM   536  C CG1   . ILE A 1 84  ? 35.063  11.541  -2.974  1.00 43.07  ? 70   ILE A CG1   1 
ATOM   537  C CG2   . ILE A 1 84  ? 34.236  13.392  -1.425  1.00 45.25  ? 70   ILE A CG2   1 
ATOM   538  C CD1   . ILE A 1 84  ? 35.159  12.560  -4.075  1.00 43.64  ? 70   ILE A CD1   1 
ATOM   539  N N     . THR A 1 85  ? 33.212  9.104   -1.688  1.00 43.18  ? 71   THR A N     1 
ATOM   540  C CA    . THR A 1 85  ? 33.191  7.742   -2.174  1.00 43.69  ? 71   THR A CA    1 
ATOM   541  C C     . THR A 1 85  ? 33.760  7.643   -3.569  1.00 42.47  ? 71   THR A C     1 
ATOM   542  O O     . THR A 1 85  ? 33.740  8.589   -4.334  1.00 42.88  ? 71   THR A O     1 
ATOM   543  C CB    . THR A 1 85  ? 31.764  7.140   -2.151  1.00 44.80  ? 71   THR A CB    1 
ATOM   544  O OG1   . THR A 1 85  ? 30.936  7.813   -3.098  1.00 45.33  ? 71   THR A OG1   1 
ATOM   545  C CG2   . THR A 1 85  ? 31.165  7.255   -0.754  1.00 46.43  ? 71   THR A CG2   1 
ATOM   546  N N     . ARG A 1 86  ? 34.212  6.451   -3.918  1.00 46.26  ? 72   ARG A N     1 
ATOM   547  C CA    . ARG A 1 86  ? 34.701  6.154   -5.265  1.00 46.63  ? 72   ARG A CA    1 
ATOM   548  C C     . ARG A 1 86  ? 33.652  6.429   -6.337  1.00 44.74  ? 72   ARG A C     1 
ATOM   549  O O     . ARG A 1 86  ? 33.978  6.816   -7.461  1.00 44.11  ? 72   ARG A O     1 
ATOM   550  C CB    . ARG A 1 86  ? 35.090  4.683   -5.360  1.00 50.67  ? 72   ARG A CB    1 
ATOM   551  C CG    . ARG A 1 86  ? 36.214  4.253   -4.431  1.00 52.84  ? 72   ARG A CG    1 
ATOM   552  C CD    . ARG A 1 86  ? 36.525  2.764   -4.642  1.00 59.09  ? 72   ARG A CD    1 
ATOM   553  N NE    . ARG A 1 86  ? 36.141  1.978   -3.471  1.00 63.24  ? 72   ARG A NE    1 
ATOM   554  C CZ    . ARG A 1 86  ? 35.757  0.703   -3.508  1.00 69.65  ? 72   ARG A CZ    1 
ATOM   555  N NH1   . ARG A 1 86  ? 35.677  0.023   -4.661  1.00 70.16  ? 72   ARG A NH1   1 
ATOM   556  N NH2   . ARG A 1 86  ? 35.439  0.094   -2.370  1.00 75.12  ? 72   ARG A NH2   1 
ATOM   557  N N     . SER A 1 87  ? 32.392  6.237   -5.959  1.00 45.75  ? 73   SER A N     1 
ATOM   558  C CA    . SER A 1 87  ? 31.252  6.361   -6.858  1.00 44.67  ? 73   SER A CA    1 
ATOM   559  C C     . SER A 1 87  ? 31.083  7.800   -7.217  1.00 47.58  ? 73   SER A C     1 
ATOM   560  O O     . SER A 1 87  ? 31.073  8.177   -8.399  1.00 51.47  ? 73   SER A O     1 
ATOM   561  C CB    . SER A 1 87  ? 30.007  5.902   -6.138  1.00 46.28  ? 73   SER A CB    1 
ATOM   562  O OG    . SER A 1 87  ? 29.362  4.932   -6.902  1.00 50.49  ? 73   SER A OG    1 
ATOM   563  N N     . ARG A 1 88  ? 30.998  8.621   -6.180  1.00 47.96  ? 74   ARG A N     1 
ATOM   564  C CA    . ARG A 1 88  ? 30.924  10.040  -6.354  1.00 47.94  ? 74   ARG A CA    1 
ATOM   565  C C     . ARG A 1 88  ? 32.125  10.526  -7.145  1.00 46.97  ? 74   ARG A C     1 
ATOM   566  O O     . ARG A 1 88  ? 31.986  11.385  -8.015  1.00 52.83  ? 74   ARG A O     1 
ATOM   567  C CB    . ARG A 1 88  ? 30.902  10.714  -4.997  1.00 48.49  ? 74   ARG A CB    1 
ATOM   568  C CG    . ARG A 1 88  ? 30.757  12.217  -5.069  1.00 49.30  ? 74   ARG A CG    1 
ATOM   569  C CD    . ARG A 1 88  ? 30.917  12.765  -3.674  1.00 50.20  ? 74   ARG A CD    1 
ATOM   570  N NE    . ARG A 1 88  ? 30.472  14.146  -3.565  1.00 50.92  ? 74   ARG A NE    1 
ATOM   571  C CZ    . ARG A 1 88  ? 30.316  14.757  -2.403  1.00 53.16  ? 74   ARG A CZ    1 
ATOM   572  N NH1   . ARG A 1 88  ? 30.565  14.104  -1.275  1.00 54.90  ? 74   ARG A NH1   1 
ATOM   573  N NH2   . ARG A 1 88  ? 29.920  16.020  -2.356  1.00 54.94  ? 74   ARG A NH2   1 
ATOM   574  N N     . LEU A 1 89  ? 33.303  9.986   -6.851  1.00 44.94  ? 75   LEU A N     1 
ATOM   575  C CA    . LEU A 1 89  ? 34.506  10.393  -7.568  1.00 45.84  ? 75   LEU A CA    1 
ATOM   576  C C     . LEU A 1 89  ? 34.454  10.063  -9.064  1.00 45.67  ? 75   LEU A C     1 
ATOM   577  O O     . LEU A 1 89  ? 34.850  10.897  -9.882  1.00 46.25  ? 75   LEU A O     1 
ATOM   578  C CB    . LEU A 1 89  ? 35.749  9.756   -6.960  1.00 45.39  ? 75   LEU A CB    1 
ATOM   579  C CG    . LEU A 1 89  ? 37.056  10.144  -7.656  1.00 45.41  ? 75   LEU A CG    1 
ATOM   580  C CD1   . LEU A 1 89  ? 37.258  11.646  -7.728  1.00 45.83  ? 75   LEU A CD1   1 
ATOM   581  C CD2   . LEU A 1 89  ? 38.202  9.519   -6.894  1.00 48.08  ? 75   LEU A CD2   1 
ATOM   582  N N     . SER A 1 90  ? 33.981  8.862   -9.412  1.00 43.36  ? 76   SER A N     1 
ATOM   583  C CA    . SER A 1 90  ? 33.880  8.471   -10.812 1.00 42.54  ? 76   SER A CA    1 
ATOM   584  C C     . SER A 1 90  ? 32.978  9.433   -11.534 1.00 41.50  ? 76   SER A C     1 
ATOM   585  O O     . SER A 1 90  ? 33.351  9.992   -12.562 1.00 43.94  ? 76   SER A O     1 
ATOM   586  C CB    . SER A 1 90  ? 33.324  7.070   -10.972 1.00 44.09  ? 76   SER A CB    1 
ATOM   587  O OG    . SER A 1 90  ? 34.167  6.140   -10.336 1.00 48.41  ? 76   SER A OG    1 
ATOM   588  N N     . HIS A 1 91  ? 31.803  9.674   -10.974 1.00 40.11  ? 77   HIS A N     1 
ATOM   589  C CA    . HIS A 1 91  ? 30.869  10.611  -11.586 1.00 39.76  ? 77   HIS A CA    1 
ATOM   590  C C     . HIS A 1 91  ? 31.512  12.003  -11.724 1.00 38.68  ? 77   HIS A C     1 
ATOM   591  O O     . HIS A 1 91  ? 31.414  12.612  -12.780 1.00 39.56  ? 77   HIS A O     1 
ATOM   592  C CB    . HIS A 1 91  ? 29.555  10.706  -10.791 1.00 41.01  ? 77   HIS A CB    1 
ATOM   593  C CG    . HIS A 1 91  ? 28.663  9.513   -10.956 1.00 42.74  ? 77   HIS A CG    1 
ATOM   594  N ND1   . HIS A 1 91  ? 28.307  9.017   -12.194 1.00 44.11  ? 77   HIS A ND1   1 
ATOM   595  C CD2   . HIS A 1 91  ? 28.050  8.728   -10.044 1.00 43.38  ? 77   HIS A CD2   1 
ATOM   596  C CE1   . HIS A 1 91  ? 27.510  7.978   -12.034 1.00 45.67  ? 77   HIS A CE1   1 
ATOM   597  N NE2   . HIS A 1 91  ? 27.340  7.781   -10.738 1.00 46.31  ? 77   HIS A NE2   1 
ATOM   598  N N     . ALA A 1 92  ? 32.189  12.470  -10.683 1.00 36.08  ? 78   ALA A N     1 
ATOM   599  C CA    . ALA A 1 92  ? 32.805  13.785  -10.710 1.00 37.89  ? 78   ALA A CA    1 
ATOM   600  C C     . ALA A 1 92  ? 33.878  13.895  -11.779 1.00 39.49  ? 78   ALA A C     1 
ATOM   601  O O     . ALA A 1 92  ? 33.949  14.909  -12.490 1.00 43.15  ? 78   ALA A O     1 
ATOM   602  C CB    . ALA A 1 92  ? 33.400  14.117  -9.355  1.00 37.97  ? 78   ALA A CB    1 
ATOM   603  N N     . VAL A 1 93  ? 34.704  12.861  -11.913 1.00 38.89  ? 79   VAL A N     1 
ATOM   604  C CA    . VAL A 1 93  ? 35.750  12.860  -12.940 1.00 41.14  ? 79   VAL A CA    1 
ATOM   605  C C     . VAL A 1 93  ? 35.198  12.675  -14.387 1.00 42.93  ? 79   VAL A C     1 
ATOM   606  O O     . VAL A 1 93  ? 35.807  13.164  -15.340 1.00 43.32  ? 79   VAL A O     1 
ATOM   607  C CB    . VAL A 1 93  ? 36.838  11.836  -12.612 1.00 41.47  ? 79   VAL A CB    1 
ATOM   608  C CG1   . VAL A 1 93  ? 37.866  11.756  -13.728 1.00 43.97  ? 79   VAL A CG1   1 
ATOM   609  C CG2   . VAL A 1 93  ? 37.510  12.218  -11.306 1.00 41.34  ? 79   VAL A CG2   1 
ATOM   610  N N     . ALA A 1 94  ? 34.046  12.010  -14.556 1.00 41.69  ? 80   ALA A N     1 
ATOM   611  C CA    . ALA A 1 94  ? 33.399  11.979  -15.870 1.00 41.72  ? 80   ALA A CA    1 
ATOM   612  C C     . ALA A 1 94  ? 33.034  13.386  -16.276 1.00 43.45  ? 80   ALA A C     1 
ATOM   613  O O     . ALA A 1 94  ? 33.204  13.784  -17.441 1.00 48.03  ? 80   ALA A O     1 
ATOM   614  C CB    . ALA A 1 94  ? 32.153  11.117  -15.849 1.00 40.46  ? 80   ALA A CB    1 
ATOM   615  N N     . ARG A 1 95  ? 32.568  14.157  -15.302 1.00 54.63  ? 81   ARG A N     1 
ATOM   616  C CA    . ARG A 1 95  ? 32.096  15.511  -15.542 1.00 53.83  ? 81   ARG A CA    1 
ATOM   617  C C     . ARG A 1 95  ? 33.287  16.455  -15.813 1.00 52.69  ? 81   ARG A C     1 
ATOM   618  O O     . ARG A 1 95  ? 33.203  17.311  -16.690 1.00 50.48  ? 81   ARG A O     1 
ATOM   619  C CB    . ARG A 1 95  ? 31.249  15.992  -14.348 1.00 54.99  ? 81   ARG A CB    1 
ATOM   620  C CG    . ARG A 1 95  ? 30.472  17.286  -14.553 1.00 56.23  ? 81   ARG A CG    1 
ATOM   621  C CD    . ARG A 1 95  ? 31.312  18.520  -14.196 1.00 58.74  ? 81   ARG A CD    1 
ATOM   622  N NE    . ARG A 1 95  ? 30.538  19.649  -13.648 1.00 60.54  ? 81   ARG A NE    1 
ATOM   623  C CZ    . ARG A 1 95  ? 31.018  20.886  -13.482 1.00 61.90  ? 81   ARG A CZ    1 
ATOM   624  N NH1   . ARG A 1 95  ? 32.265  21.192  -13.839 1.00 61.79  ? 81   ARG A NH1   1 
ATOM   625  N NH2   . ARG A 1 95  ? 30.241  21.844  -12.982 1.00 63.87  ? 81   ARG A NH2   1 
ATOM   626  N N     . LEU A 1 96  ? 34.376  16.281  -15.058 1.00 52.42  ? 82   LEU A N     1 
ATOM   627  C CA    . LEU A 1 96  ? 35.575  17.101  -15.228 1.00 51.77  ? 82   LEU A CA    1 
ATOM   628  C C     . LEU A 1 96  ? 36.325  16.767  -16.523 1.00 53.12  ? 82   LEU A C     1 
ATOM   629  O O     . LEU A 1 96  ? 36.905  17.651  -17.175 1.00 54.80  ? 82   LEU A O     1 
ATOM   630  C CB    . LEU A 1 96  ? 36.496  16.941  -14.025 1.00 51.26  ? 82   LEU A CB    1 
ATOM   631  C CG    . LEU A 1 96  ? 35.931  17.382  -12.664 1.00 52.50  ? 82   LEU A CG    1 
ATOM   632  C CD1   . LEU A 1 96  ? 36.841  16.929  -11.532 1.00 54.10  ? 82   LEU A CD1   1 
ATOM   633  C CD2   . LEU A 1 96  ? 35.744  18.883  -12.607 1.00 53.41  ? 82   LEU A CD2   1 
ATOM   634  N N     . GLU A 1 97  ? 36.329  15.484  -16.878 1.00 54.25  ? 83   GLU A N     1 
ATOM   635  C CA    . GLU A 1 97  ? 36.892  15.028  -18.130 1.00 54.41  ? 83   GLU A CA    1 
ATOM   636  C C     . GLU A 1 97  ? 36.126  15.634  -19.286 1.00 54.48  ? 83   GLU A C     1 
ATOM   637  O O     . GLU A 1 97  ? 36.736  16.110  -20.258 1.00 56.17  ? 83   GLU A O     1 
ATOM   638  C CB    . GLU A 1 97  ? 36.840  13.497  -18.194 1.00 56.80  ? 83   GLU A CB    1 
ATOM   639  C CG    . GLU A 1 97  ? 37.614  12.879  -19.346 1.00 59.23  ? 83   GLU A CG    1 
ATOM   640  C CD    . GLU A 1 97  ? 37.755  11.375  -19.200 1.00 62.21  ? 83   GLU A CD    1 
ATOM   641  O OE1   . GLU A 1 97  ? 36.736  10.712  -18.907 1.00 63.92  ? 83   GLU A OE1   1 
ATOM   642  O OE2   . GLU A 1 97  ? 38.883  10.852  -19.390 1.00 64.70  ? 83   GLU A OE2   1 
ATOM   643  N N     . LYS A 1 98  ? 34.795  15.623  -19.191 1.00 54.02  ? 84   LYS A N     1 
ATOM   644  C CA    . LYS A 1 98  ? 33.946  16.234  -20.226 1.00 55.61  ? 84   LYS A CA    1 
ATOM   645  C C     . LYS A 1 98  ? 34.327  17.677  -20.482 1.00 55.45  ? 84   LYS A C     1 
ATOM   646  O O     . LYS A 1 98  ? 34.594  18.035  -21.620 1.00 58.94  ? 84   LYS A O     1 
ATOM   647  C CB    . LYS A 1 98  ? 32.453  16.096  -19.903 1.00 56.83  ? 84   LYS A CB    1 
ATOM   648  C CG    . LYS A 1 98  ? 31.925  14.733  -20.327 1.00 59.44  ? 84   LYS A CG    1 
ATOM   649  C CD    . LYS A 1 98  ? 30.408  14.665  -20.247 1.00 61.91  ? 84   LYS A CD    1 
ATOM   650  C CE    . LYS A 1 98  ? 29.878  13.270  -20.599 1.00 65.91  ? 84   LYS A CE    1 
ATOM   651  N NZ    . LYS A 1 98  ? 30.567  12.190  -19.831 1.00 66.57  ? 84   LYS A NZ    1 
ATOM   652  N N     . ASN A 1 99  ? 34.423  18.502  -19.444 1.00 54.78  ? 85   ASN A N     1 
ATOM   653  C CA    . ASN A 1 99  ? 34.829  19.872  -19.691 1.00 58.20  ? 85   ASN A CA    1 
ATOM   654  C C     . ASN A 1 99  ? 36.342  20.086  -19.866 1.00 57.59  ? 85   ASN A C     1 
ATOM   655  O O     . ASN A 1 99  ? 36.791  21.208  -20.045 1.00 60.94  ? 85   ASN A O     1 
ATOM   656  C CB    . ASN A 1 99  ? 34.161  20.921  -18.750 1.00 60.65  ? 85   ASN A CB    1 
ATOM   657  C CG    . ASN A 1 99  ? 34.037  20.477  -17.326 1.00 60.41  ? 85   ASN A CG    1 
ATOM   658  O OD1   . ASN A 1 99  ? 32.935  20.420  -16.783 1.00 61.41  ? 85   ASN A OD1   1 
ATOM   659  N ND2   . ASN A 1 99  ? 35.153  20.158  -16.706 1.00 61.82  ? 85   ASN A ND2   1 
ATOM   660  N N     . GLY A 1 100 ? 37.121  19.020  -19.836 1.00 56.05  ? 86   GLY A N     1 
ATOM   661  C CA    . GLY A 1 100 ? 38.519  19.089  -20.254 1.00 56.53  ? 86   GLY A CA    1 
ATOM   662  C C     . GLY A 1 100 ? 39.541  19.435  -19.191 1.00 56.82  ? 86   GLY A C     1 
ATOM   663  O O     . GLY A 1 100 ? 40.718  19.602  -19.507 1.00 58.16  ? 86   GLY A O     1 
ATOM   664  N N     . TRP A 1 101 ? 39.126  19.526  -17.927 1.00 56.98  ? 87   TRP A N     1 
ATOM   665  C CA    . TRP A 1 101 ? 40.060  19.896  -16.873 1.00 57.37  ? 87   TRP A CA    1 
ATOM   666  C C     . TRP A 1 101 ? 40.827  18.658  -16.344 1.00 53.89  ? 87   TRP A C     1 
ATOM   667  O O     . TRP A 1 101 ? 41.819  18.791  -15.612 1.00 54.47  ? 87   TRP A O     1 
ATOM   668  C CB    . TRP A 1 101 ? 39.351  20.604  -15.706 1.00 60.75  ? 87   TRP A CB    1 
ATOM   669  C CG    . TRP A 1 101 ? 38.291  21.623  -15.882 1.00 65.52  ? 87   TRP A CG    1 
ATOM   670  C CD1   . TRP A 1 101 ? 37.074  21.563  -15.283 1.00 66.80  ? 87   TRP A CD1   1 
ATOM   671  C CD2   . TRP A 1 101 ? 38.329  22.867  -16.583 1.00 70.02  ? 87   TRP A CD2   1 
ATOM   672  N NE1   . TRP A 1 101 ? 36.321  22.654  -15.597 1.00 69.49  ? 87   TRP A NE1   1 
ATOM   673  C CE2   . TRP A 1 101 ? 37.066  23.482  -16.388 1.00 71.93  ? 87   TRP A CE2   1 
ATOM   674  C CE3   . TRP A 1 101 ? 39.285  23.517  -17.378 1.00 73.77  ? 87   TRP A CE3   1 
ATOM   675  C CZ2   . TRP A 1 101 ? 36.734  24.711  -16.949 1.00 78.19  ? 87   TRP A CZ2   1 
ATOM   676  C CZ3   . TRP A 1 101 ? 38.949  24.755  -17.942 1.00 79.95  ? 87   TRP A CZ3   1 
ATOM   677  C CH2   . TRP A 1 101 ? 37.682  25.338  -17.716 1.00 81.86  ? 87   TRP A CH2   1 
ATOM   678  N N     . VAL A 1 102 ? 40.373  17.466  -16.709 1.00 51.15  ? 88   VAL A N     1 
ATOM   679  C CA    . VAL A 1 102 ? 40.970  16.213  -16.238 1.00 51.06  ? 88   VAL A CA    1 
ATOM   680  C C     . VAL A 1 102 ? 40.980  15.170  -17.364 1.00 50.56  ? 88   VAL A C     1 
ATOM   681  O O     . VAL A 1 102 ? 40.153  15.218  -18.264 1.00 51.73  ? 88   VAL A O     1 
ATOM   682  C CB    . VAL A 1 102 ? 40.187  15.670  -15.018 1.00 52.30  ? 88   VAL A CB    1 
ATOM   683  C CG1   . VAL A 1 102 ? 40.501  14.213  -14.722 1.00 53.24  ? 88   VAL A CG1   1 
ATOM   684  C CG2   . VAL A 1 102 ? 40.503  16.492  -13.785 1.00 54.94  ? 88   VAL A CG2   1 
ATOM   685  N N     . ARG A 1 103 ? 41.929  14.242  -17.319 1.00 50.59  ? 89   ARG A N     1 
ATOM   686  C CA    . ARG A 1 103 ? 41.944  13.092  -18.242 1.00 51.40  ? 89   ARG A CA    1 
ATOM   687  C C     . ARG A 1 103 ? 42.377  11.862  -17.460 1.00 53.31  ? 89   ARG A C     1 
ATOM   688  O O     . ARG A 1 103 ? 42.930  11.982  -16.363 1.00 53.28  ? 89   ARG A O     1 
ATOM   689  C CB    . ARG A 1 103 ? 42.891  13.340  -19.425 1.00 50.80  ? 89   ARG A CB    1 
ATOM   690  C CG    . ARG A 1 103 ? 44.356  13.498  -19.029 1.00 49.90  ? 89   ARG A CG    1 
ATOM   691  C CD    . ARG A 1 103 ? 45.246  13.798  -20.217 1.00 50.03  ? 89   ARG A CD    1 
ATOM   692  N NE    . ARG A 1 103 ? 46.655  13.885  -19.817 1.00 48.85  ? 89   ARG A NE    1 
ATOM   693  C CZ    . ARG A 1 103 ? 47.519  12.867  -19.776 1.00 48.95  ? 89   ARG A CZ    1 
ATOM   694  N NH1   . ARG A 1 103 ? 47.158  11.633  -20.115 1.00 49.95  ? 89   ARG A NH1   1 
ATOM   695  N NH2   . ARG A 1 103 ? 48.769  13.082  -19.387 1.00 48.93  ? 89   ARG A NH2   1 
ATOM   696  N N     . ARG A 1 104 ? 42.103  10.691  -18.015 1.00 51.51  ? 90   ARG A N     1 
ATOM   697  C CA    . ARG A 1 104 ? 42.397  9.429   -17.361 1.00 53.64  ? 90   ARG A CA    1 
ATOM   698  C C     . ARG A 1 104 ? 43.422  8.608   -18.126 1.00 55.38  ? 90   ARG A C     1 
ATOM   699  O O     . ARG A 1 104 ? 43.462  8.640   -19.349 1.00 54.44  ? 90   ARG A O     1 
ATOM   700  C CB    . ARG A 1 104 ? 41.123  8.600   -17.241 1.00 55.59  ? 90   ARG A CB    1 
ATOM   701  C CG    . ARG A 1 104 ? 40.145  9.088   -16.173 1.00 58.25  ? 90   ARG A CG    1 
ATOM   702  C CD    . ARG A 1 104 ? 38.693  8.990   -16.668 1.00 59.29  ? 90   ARG A CD    1 
ATOM   703  N NE    . ARG A 1 104 ? 37.762  8.559   -15.634 1.00 58.70  ? 90   ARG A NE    1 
ATOM   704  C CZ    . ARG A 1 104 ? 36.467  8.337   -15.836 1.00 60.53  ? 90   ARG A CZ    1 
ATOM   705  N NH1   . ARG A 1 104 ? 35.938  8.516   -17.044 1.00 62.13  ? 90   ARG A NH1   1 
ATOM   706  N NH2   . ARG A 1 104 ? 35.688  7.953   -14.819 1.00 60.38  ? 90   ARG A NH2   1 
ATOM   707  N N     . GLU A 1 105 ? 44.218  7.842   -17.384 1.00 57.20  ? 91   GLU A N     1 
ATOM   708  C CA    . GLU A 1 105 ? 45.108  6.845   -17.957 1.00 60.38  ? 91   GLU A CA    1 
ATOM   709  C C     . GLU A 1 105 ? 45.008  5.551   -17.164 1.00 62.19  ? 91   GLU A C     1 
ATOM   710  O O     . GLU A 1 105 ? 44.611  5.551   -15.989 1.00 69.74  ? 91   GLU A O     1 
ATOM   711  C CB    . GLU A 1 105 ? 46.554  7.342   -17.933 1.00 61.06  ? 91   GLU A CB    1 
ATOM   712  C CG    . GLU A 1 105 ? 46.993  8.054   -19.184 1.00 62.93  ? 91   GLU A CG    1 
ATOM   713  C CD    . GLU A 1 105 ? 48.468  8.431   -19.167 1.00 66.40  ? 91   GLU A CD    1 
ATOM   714  O OE1   . GLU A 1 105 ? 49.174  8.127   -18.183 1.00 64.82  ? 91   GLU A OE1   1 
ATOM   715  O OE2   . GLU A 1 105 ? 48.931  9.044   -20.163 1.00 72.16  ? 91   GLU A OE2   1 
ATOM   716  N N     . ASP A 1 106 ? 45.432  4.459   -17.781 1.00 62.55  ? 92   ASP A N     1 
ATOM   717  C CA    . ASP A 1 106 ? 45.475  3.161   -17.114 1.00 63.39  ? 92   ASP A CA    1 
ATOM   718  C C     . ASP A 1 106 ? 46.766  3.053   -16.312 1.00 61.32  ? 92   ASP A C     1 
ATOM   719  O O     . ASP A 1 106 ? 47.769  3.660   -16.680 1.00 60.85  ? 92   ASP A O     1 
ATOM   720  C CB    . ASP A 1 106 ? 45.401  2.011   -18.128 1.00 65.76  ? 92   ASP A CB    1 
ATOM   721  C CG    . ASP A 1 106 ? 44.371  2.255   -19.220 1.00 66.08  ? 92   ASP A CG    1 
ATOM   722  O OD1   . ASP A 1 106 ? 44.018  3.417   -19.453 1.00 67.36  ? 92   ASP A OD1   1 
ATOM   723  O OD2   . ASP A 1 106 ? 43.926  1.289   -19.859 1.00 69.81  ? 92   ASP A OD2   1 
ATOM   724  N N     . CYS A 1 107 ? 46.733  2.299   -15.207 1.00 59.75  ? 93   CYS A N     1 
ATOM   725  C CA    . CYS A 1 107 ? 47.951  1.968   -14.482 1.00 59.54  ? 93   CYS A CA    1 
ATOM   726  C C     . CYS A 1 107 ? 48.613  0.858   -15.307 1.00 60.61  ? 93   CYS A C     1 
ATOM   727  O O     . CYS A 1 107 ? 47.940  -0.079  -15.737 1.00 59.74  ? 93   CYS A O     1 
ATOM   728  C CB    . CYS A 1 107 ? 47.662  1.514   -13.045 1.00 58.47  ? 93   CYS A CB    1 
ATOM   729  S SG    . CYS A 1 107 ? 49.137  1.154   -12.077 1.00 56.57  ? 93   CYS A SG    1 
ATOM   730  N N     . PRO A 1 108 ? 49.923  0.987   -15.576 1.00 61.24  ? 94   PRO A N     1 
ATOM   731  C CA    . PRO A 1 108 ? 50.550  0.000   -16.450 1.00 62.25  ? 94   PRO A CA    1 
ATOM   732  C C     . PRO A 1 108 ? 50.809  -1.373  -15.763 1.00 62.80  ? 94   PRO A C     1 
ATOM   733  O O     . PRO A 1 108 ? 50.656  -2.409  -16.414 1.00 61.94  ? 94   PRO A O     1 
ATOM   734  C CB    . PRO A 1 108 ? 51.850  0.689   -16.891 1.00 61.88  ? 94   PRO A CB    1 
ATOM   735  C CG    . PRO A 1 108 ? 52.145  1.714   -15.851 1.00 61.25  ? 94   PRO A CG    1 
ATOM   736  C CD    . PRO A 1 108 ? 50.895  1.962   -15.044 1.00 61.40  ? 94   PRO A CD    1 
ATOM   737  N N     . SER A 1 109 ? 51.178  -1.366  -14.477 1.00 61.96  ? 95   SER A N     1 
ATOM   738  C CA    . SER A 1 109 ? 51.437  -2.600  -13.725 1.00 62.00  ? 95   SER A CA    1 
ATOM   739  C C     . SER A 1 109 ? 50.162  -3.324  -13.346 1.00 62.02  ? 95   SER A C     1 
ATOM   740  O O     . SER A 1 109 ? 50.130  -4.555  -13.277 1.00 65.62  ? 95   SER A O     1 
ATOM   741  C CB    . SER A 1 109 ? 52.229  -2.297  -12.449 1.00 61.34  ? 95   SER A CB    1 
ATOM   742  N N     . ASP A 1 110 ? 49.113  -2.561  -13.081 1.00 61.65  ? 96   ASP A N     1 
ATOM   743  C CA    . ASP A 1 110 ? 47.840  -3.119  -12.652 1.00 61.72  ? 96   ASP A CA    1 
ATOM   744  C C     . ASP A 1 110 ? 46.740  -2.647  -13.605 1.00 62.09  ? 96   ASP A C     1 
ATOM   745  O O     . ASP A 1 110 ? 46.259  -1.521  -13.489 1.00 59.32  ? 96   ASP A O     1 
ATOM   746  C CB    . ASP A 1 110 ? 47.563  -2.661  -11.224 1.00 62.22  ? 96   ASP A CB    1 
ATOM   747  C CG    . ASP A 1 110 ? 46.471  -3.466  -10.551 1.00 64.52  ? 96   ASP A CG    1 
ATOM   748  O OD1   . ASP A 1 110 ? 45.583  -3.983  -11.272 1.00 66.21  ? 96   ASP A OD1   1 
ATOM   749  O OD2   . ASP A 1 110 ? 46.486  -3.565  -9.297  1.00 64.75  ? 96   ASP A OD2   1 
ATOM   750  N N     . LYS A 1 111 ? 46.346  -3.503  -14.552 1.00 64.74  ? 97   LYS A N     1 
ATOM   751  C CA    . LYS A 1 111 ? 45.422  -3.109  -15.636 1.00 65.35  ? 97   LYS A CA    1 
ATOM   752  C C     . LYS A 1 111 ? 43.996  -2.860  -15.108 1.00 65.68  ? 97   LYS A C     1 
ATOM   753  O O     . LYS A 1 111 ? 43.017  -2.892  -15.852 1.00 66.36  ? 97   LYS A O     1 
ATOM   754  C CB    . LYS A 1 111 ? 45.423  -4.178  -16.746 1.00 67.17  ? 97   LYS A CB    1 
ATOM   755  C CG    . LYS A 1 111 ? 46.778  -4.396  -17.423 1.00 67.94  ? 97   LYS A CG    1 
ATOM   756  C CD    . LYS A 1 111 ? 46.774  -5.626  -18.336 1.00 69.04  ? 97   LYS A CD    1 
ATOM   757  N N     . ARG A 1 112 ? 43.922  -2.546  -13.821 1.00 64.41  ? 98   ARG A N     1 
ATOM   758  C CA    . ARG A 1 112 ? 42.697  -2.446  -13.061 1.00 64.70  ? 98   ARG A CA    1 
ATOM   759  C C     . ARG A 1 112 ? 42.546  -1.010  -12.565 1.00 63.27  ? 98   ARG A C     1 
ATOM   760  O O     . ARG A 1 112 ? 41.445  -0.463  -12.492 1.00 61.99  ? 98   ARG A O     1 
ATOM   761  C CB    . ARG A 1 112 ? 42.862  -3.374  -11.866 1.00 66.67  ? 98   ARG A CB    1 
ATOM   762  C CG    . ARG A 1 112 ? 41.616  -3.748  -11.085 1.00 68.03  ? 98   ARG A CG    1 
ATOM   763  C CD    . ARG A 1 112 ? 41.698  -5.211  -10.668 1.00 69.93  ? 98   ARG A CD    1 
ATOM   764  N NE    . ARG A 1 112 ? 41.874  -5.509  -9.238  1.00 71.13  ? 98   ARG A NE    1 
ATOM   765  C CZ    . ARG A 1 112 ? 42.993  -5.352  -8.523  1.00 70.91  ? 98   ARG A CZ    1 
ATOM   766  N NH1   . ARG A 1 112 ? 44.079  -4.808  -9.048  1.00 70.39  ? 98   ARG A NH1   1 
ATOM   767  N NH2   . ARG A 1 112 ? 43.009  -5.722  -7.244  1.00 70.81  ? 98   ARG A NH2   1 
ATOM   768  N N     . GLY A 1 113 ? 43.678  -0.428  -12.180 1.00 62.14  ? 99   GLY A N     1 
ATOM   769  C CA    . GLY A 1 113 ? 43.737  0.924   -11.694 1.00 60.36  ? 99   GLY A CA    1 
ATOM   770  C C     . GLY A 1 113 ? 43.558  1.958   -12.780 1.00 59.03  ? 99   GLY A C     1 
ATOM   771  O O     . GLY A 1 113 ? 43.771  1.698   -13.965 1.00 57.11  ? 99   GLY A O     1 
ATOM   772  N N     . GLN A 1 114 ? 43.167  3.152   -12.354 1.00 58.40  ? 100  GLN A N     1 
ATOM   773  C CA    . GLN A 1 114 ? 43.036  4.277   -13.248 1.00 56.95  ? 100  GLN A CA    1 
ATOM   774  C C     . GLN A 1 114 ? 43.635  5.512   -12.597 1.00 56.38  ? 100  GLN A C     1 
ATOM   775  O O     . GLN A 1 114 ? 43.509  5.717   -11.380 1.00 56.13  ? 100  GLN A O     1 
ATOM   776  C CB    . GLN A 1 114 ? 41.568  4.462   -13.549 1.00 57.64  ? 100  GLN A CB    1 
ATOM   777  C CG    . GLN A 1 114 ? 41.262  5.164   -14.852 1.00 59.08  ? 100  GLN A CG    1 
ATOM   778  C CD    . GLN A 1 114 ? 40.612  4.315   -15.910 1.00 59.92  ? 100  GLN A CD    1 
ATOM   779  O OE1   . GLN A 1 114 ? 41.083  4.199   -17.040 1.00 62.22  ? 100  GLN A OE1   1 
ATOM   780  N NE2   . GLN A 1 114 ? 39.457  3.796   -15.564 1.00 60.55  ? 100  GLN A NE2   1 
ATOM   781  N N     . PHE A 1 115 ? 44.336  6.309   -13.393 1.00 56.16  ? 101  PHE A N     1 
ATOM   782  C CA    . PHE A 1 115 ? 44.884  7.570   -12.913 1.00 56.79  ? 101  PHE A CA    1 
ATOM   783  C C     . PHE A 1 115 ? 43.964  8.698   -13.333 1.00 54.87  ? 101  PHE A C     1 
ATOM   784  O O     . PHE A 1 115 ? 43.393  8.661   -14.417 1.00 52.43  ? 101  PHE A O     1 
ATOM   785  C CB    . PHE A 1 115 ? 46.286  7.823   -13.486 1.00 59.14  ? 101  PHE A CB    1 
ATOM   786  C CG    . PHE A 1 115 ? 47.392  7.159   -12.717 1.00 61.41  ? 101  PHE A CG    1 
ATOM   787  C CD1   . PHE A 1 115 ? 47.804  7.667   -11.485 1.00 63.51  ? 101  PHE A CD1   1 
ATOM   788  C CD2   . PHE A 1 115 ? 48.051  6.059   -13.237 1.00 62.59  ? 101  PHE A CD2   1 
ATOM   789  C CE1   . PHE A 1 115 ? 48.844  7.075   -10.784 1.00 66.50  ? 101  PHE A CE1   1 
ATOM   790  C CE2   . PHE A 1 115 ? 49.091  5.460   -12.543 1.00 65.46  ? 101  PHE A CE2   1 
ATOM   791  C CZ    . PHE A 1 115 ? 49.488  5.963   -11.313 1.00 67.18  ? 101  PHE A CZ    1 
ATOM   792  N N     . ALA A 1 116 ? 43.819  9.685   -12.452 1.00 54.80  ? 102  ALA A N     1 
ATOM   793  C CA    . ALA A 1 116 ? 43.186  10.960  -12.784 1.00 54.65  ? 102  ALA A CA    1 
ATOM   794  C C     . ALA A 1 116 ? 44.306  11.992  -12.907 1.00 53.38  ? 102  ALA A C     1 
ATOM   795  O O     . ALA A 1 116 ? 45.058  12.206  -11.972 1.00 52.29  ? 102  ALA A O     1 
ATOM   796  C CB    . ALA A 1 116 ? 42.210  11.364  -11.695 1.00 54.86  ? 102  ALA A CB    1 
ATOM   797  N N     . ILE A 1 117 ? 44.428  12.582  -14.083 1.00 53.96  ? 103  ILE A N     1 
ATOM   798  C CA    . ILE A 1 117 ? 45.502  13.504  -14.380 1.00 55.68  ? 103  ILE A CA    1 
ATOM   799  C C     . ILE A 1 117 ? 44.899  14.862  -14.703 1.00 56.16  ? 103  ILE A C     1 
ATOM   800  O O     . ILE A 1 117 ? 43.927  14.951  -15.471 1.00 55.96  ? 103  ILE A O     1 
ATOM   801  C CB    . ILE A 1 117 ? 46.310  13.041  -15.605 1.00 57.88  ? 103  ILE A CB    1 
ATOM   802  C CG1   . ILE A 1 117 ? 46.828  11.610  -15.396 1.00 56.91  ? 103  ILE A CG1   1 
ATOM   803  C CG2   . ILE A 1 117 ? 47.454  14.015  -15.870 1.00 59.57  ? 103  ILE A CG2   1 
ATOM   804  C CD1   . ILE A 1 117 ? 47.305  10.927  -16.652 1.00 56.09  ? 103  ILE A CD1   1 
ATOM   805  N N     . LEU A 1 118 ? 45.459  15.906  -14.099 1.00 55.88  ? 104  LEU A N     1 
ATOM   806  C CA    . LEU A 1 118 ? 45.035  17.276  -14.356 1.00 56.41  ? 104  LEU A CA    1 
ATOM   807  C C     . LEU A 1 118 ? 45.601  17.770  -15.678 1.00 56.29  ? 104  LEU A C     1 
ATOM   808  O O     . LEU A 1 118 ? 46.811  17.764  -15.858 1.00 58.85  ? 104  LEU A O     1 
ATOM   809  C CB    . LEU A 1 118 ? 45.535  18.172  -13.222 1.00 58.12  ? 104  LEU A CB    1 
ATOM   810  C CG    . LEU A 1 118 ? 45.300  19.693  -13.294 1.00 58.52  ? 104  LEU A CG    1 
ATOM   811  C CD1   . LEU A 1 118 ? 43.814  20.004  -13.343 1.00 57.39  ? 104  LEU A CD1   1 
ATOM   812  C CD2   . LEU A 1 118 ? 45.951  20.363  -12.091 1.00 59.43  ? 104  LEU A CD2   1 
ATOM   813  N N     . THR A 1 119 ? 44.738  18.192  -16.598 1.00 54.40  ? 105  THR A N     1 
ATOM   814  C CA    . THR A 1 119 ? 45.184  18.736  -17.880 1.00 55.04  ? 105  THR A CA    1 
ATOM   815  C C     . THR A 1 119 ? 45.833  20.100  -17.716 1.00 57.69  ? 105  THR A C     1 
ATOM   816  O O     . THR A 1 119 ? 45.704  20.720  -16.679 1.00 59.04  ? 105  THR A O     1 
ATOM   817  C CB    . THR A 1 119 ? 44.002  18.943  -18.837 1.00 53.28  ? 105  THR A CB    1 
ATOM   818  O OG1   . THR A 1 119 ? 43.082  19.864  -18.249 1.00 50.47  ? 105  THR A OG1   1 
ATOM   819  C CG2   . THR A 1 119 ? 43.309  17.618  -19.130 1.00 52.17  ? 105  THR A CG2   1 
ATOM   820  N N     . ASP A 1 120 ? 46.516  20.573  -18.752 1.00 61.84  ? 106  ASP A N     1 
ATOM   821  C CA    . ASP A 1 120 ? 47.012  21.957  -18.766 1.00 64.04  ? 106  ASP A CA    1 
ATOM   822  C C     . ASP A 1 120 ? 45.884  22.964  -18.528 1.00 63.58  ? 106  ASP A C     1 
ATOM   823  O O     . ASP A 1 120 ? 45.978  23.814  -17.647 1.00 67.94  ? 106  ASP A O     1 
ATOM   824  C CB    . ASP A 1 120 ? 47.693  22.292  -20.097 1.00 65.91  ? 106  ASP A CB    1 
ATOM   825  C CG    . ASP A 1 120 ? 49.066  21.634  -20.251 1.00 67.66  ? 106  ASP A CG    1 
ATOM   826  O OD1   . ASP A 1 120 ? 49.720  21.343  -19.209 1.00 66.85  ? 106  ASP A OD1   1 
ATOM   827  O OD2   . ASP A 1 120 ? 49.496  21.440  -21.424 1.00 67.95  ? 106  ASP A OD2   1 
ATOM   828  N N     . GLU A 1 121 ? 44.809  22.852  -19.293 1.00 61.76  ? 107  GLU A N     1 
ATOM   829  C CA    . GLU A 1 121 ? 43.688  23.782  -19.172 1.00 60.00  ? 107  GLU A CA    1 
ATOM   830  C C     . GLU A 1 121 ? 43.097  23.783  -17.771 1.00 59.91  ? 107  GLU A C     1 
ATOM   831  O O     . GLU A 1 121 ? 42.655  24.827  -17.276 1.00 61.87  ? 107  GLU A O     1 
ATOM   832  C CB    . GLU A 1 121 ? 42.610  23.418  -20.180 1.00 60.86  ? 107  GLU A CB    1 
ATOM   833  C CG    . GLU A 1 121 ? 41.812  24.585  -20.741 1.00 63.30  ? 107  GLU A CG    1 
ATOM   834  C CD    . GLU A 1 121 ? 42.657  25.713  -21.297 1.00 66.91  ? 107  GLU A CD    1 
ATOM   835  O OE1   . GLU A 1 121 ? 43.335  26.359  -20.495 1.00 69.78  ? 107  GLU A OE1   1 
ATOM   836  O OE2   . GLU A 1 121 ? 42.642  25.974  -22.519 1.00 70.73  ? 107  GLU A OE2   1 
ATOM   837  N N     . GLY A 1 122 ? 43.098  22.614  -17.120 1.00 58.89  ? 108  GLY A N     1 
ATOM   838  C CA    . GLY A 1 122 ? 42.629  22.485  -15.749 1.00 56.68  ? 108  GLY A CA    1 
ATOM   839  C C     . GLY A 1 122 ? 43.512  23.300  -14.831 1.00 57.40  ? 108  GLY A C     1 
ATOM   840  O O     . GLY A 1 122 ? 43.017  24.057  -13.994 1.00 58.70  ? 108  GLY A O     1 
ATOM   841  N N     . TYR A 1 123 ? 44.818  23.140  -14.985 1.00 56.94  ? 109  TYR A N     1 
ATOM   842  C CA    . TYR A 1 123 ? 45.769  23.958  -14.254 1.00 59.84  ? 109  TYR A CA    1 
ATOM   843  C C     . TYR A 1 123 ? 45.546  25.446  -14.487 1.00 60.92  ? 109  TYR A C     1 
ATOM   844  O O     . TYR A 1 123 ? 45.768  26.254  -13.584 1.00 63.18  ? 109  TYR A O     1 
ATOM   845  C CB    . TYR A 1 123 ? 47.195  23.602  -14.656 1.00 62.54  ? 109  TYR A CB    1 
ATOM   846  C CG    . TYR A 1 123 ? 48.244  24.117  -13.703 1.00 67.05  ? 109  TYR A CG    1 
ATOM   847  C CD1   . TYR A 1 123 ? 48.501  23.453  -12.503 1.00 68.82  ? 109  TYR A CD1   1 
ATOM   848  C CD2   . TYR A 1 123 ? 48.991  25.254  -13.998 1.00 71.08  ? 109  TYR A CD2   1 
ATOM   849  C CE1   . TYR A 1 123 ? 49.465  23.920  -11.616 1.00 72.43  ? 109  TYR A CE1   1 
ATOM   850  C CE2   . TYR A 1 123 ? 49.968  25.722  -13.127 1.00 75.25  ? 109  TYR A CE2   1 
ATOM   851  C CZ    . TYR A 1 123 ? 50.196  25.054  -11.934 1.00 76.30  ? 109  TYR A CZ    1 
ATOM   852  O OH    . TYR A 1 123 ? 51.165  25.517  -11.072 1.00 82.04  ? 109  TYR A OH    1 
ATOM   853  N N     . GLU A 1 124 ? 45.139  25.821  -15.699 1.00 59.65  ? 110  GLU A N     1 
ATOM   854  C CA    . GLU A 1 124 ? 44.895  27.228  -16.001 1.00 59.89  ? 110  GLU A CA    1 
ATOM   855  C C     . GLU A 1 124 ? 43.657  27.769  -15.298 1.00 58.42  ? 110  GLU A C     1 
ATOM   856  O O     . GLU A 1 124 ? 43.599  28.958  -14.993 1.00 57.86  ? 110  GLU A O     1 
ATOM   857  C CB    . GLU A 1 124 ? 44.829  27.488  -17.512 1.00 60.70  ? 110  GLU A CB    1 
ATOM   858  C CG    . GLU A 1 124 ? 46.132  28.042  -18.076 1.00 62.31  ? 110  GLU A CG    1 
ATOM   859  N N     . VAL A 1 125 ? 42.683  26.902  -15.024 1.00 57.22  ? 111  VAL A N     1 
ATOM   860  C CA    . VAL A 1 125 ? 41.501  27.303  -14.244 1.00 56.27  ? 111  VAL A CA    1 
ATOM   861  C C     . VAL A 1 125 ? 41.841  27.532  -12.768 1.00 57.69  ? 111  VAL A C     1 
ATOM   862  O O     . VAL A 1 125 ? 41.260  28.402  -12.117 1.00 57.78  ? 111  VAL A O     1 
ATOM   863  C CB    . VAL A 1 125 ? 40.371  26.281  -14.350 1.00 54.14  ? 111  VAL A CB    1 
ATOM   864  C CG1   . VAL A 1 125 ? 39.215  26.665  -13.472 1.00 53.99  ? 111  VAL A CG1   1 
ATOM   865  C CG2   . VAL A 1 125 ? 39.873  26.200  -15.772 1.00 55.43  ? 111  VAL A CG2   1 
ATOM   866  N N     . LEU A 1 126 ? 42.789  26.771  -12.241 1.00 58.98  ? 112  LEU A N     1 
ATOM   867  C CA    . LEU A 1 126 ? 43.225  26.996  -10.867 1.00 60.83  ? 112  LEU A CA    1 
ATOM   868  C C     . LEU A 1 126 ? 43.943  28.327  -10.772 1.00 63.66  ? 112  LEU A C     1 
ATOM   869  O O     . LEU A 1 126 ? 43.631  29.141  -9.907  1.00 65.25  ? 112  LEU A O     1 
ATOM   870  C CB    . LEU A 1 126 ? 44.150  25.891  -10.378 1.00 61.13  ? 112  LEU A CB    1 
ATOM   871  C CG    . LEU A 1 126 ? 43.425  24.687  -9.802  1.00 60.40  ? 112  LEU A CG    1 
ATOM   872  C CD1   . LEU A 1 126 ? 42.671  23.980  -10.906 1.00 60.13  ? 112  LEU A CD1   1 
ATOM   873  C CD2   . LEU A 1 126 ? 44.406  23.733  -9.161  1.00 60.70  ? 112  LEU A CD2   1 
ATOM   874  N N     . ARG A 1 127 ? 44.897  28.546  -11.680 1.00 65.65  ? 113  ARG A N     1 
ATOM   875  C CA    . ARG A 1 127 ? 45.682  29.793  -11.698 1.00 68.07  ? 113  ARG A CA    1 
ATOM   876  C C     . ARG A 1 127 ? 44.743  31.003  -11.795 1.00 67.37  ? 113  ARG A C     1 
ATOM   877  O O     . ARG A 1 127 ? 44.900  31.972  -11.063 1.00 68.48  ? 113  ARG A O     1 
ATOM   878  C CB    . ARG A 1 127 ? 46.704  29.789  -12.851 1.00 68.70  ? 113  ARG A CB    1 
ATOM   879  C CG    . ARG A 1 127 ? 47.876  30.759  -12.664 1.00 71.36  ? 113  ARG A CG    1 
ATOM   880  C CD    . ARG A 1 127 ? 48.806  30.880  -13.875 1.00 71.46  ? 113  ARG A CD    1 
ATOM   881  N N     . ARG A 1 128 ? 43.742  30.899  -12.668 1.00 65.62  ? 114  ARG A N     1 
ATOM   882  C CA    . ARG A 1 128 ? 42.765  31.960  -12.853 1.00 64.77  ? 114  ARG A CA    1 
ATOM   883  C C     . ARG A 1 128 ? 41.909  32.203  -11.597 1.00 64.50  ? 114  ARG A C     1 
ATOM   884  O O     . ARG A 1 128 ? 41.696  33.357  -11.219 1.00 65.54  ? 114  ARG A O     1 
ATOM   885  C CB    . ARG A 1 128 ? 41.882  31.674  -14.077 1.00 63.43  ? 114  ARG A CB    1 
ATOM   886  N N     . THR A 1 129 ? 41.459  31.140  -10.923 1.00 62.82  ? 115  THR A N     1 
ATOM   887  C CA    . THR A 1 129 ? 40.419  31.282  -9.894  1.00 61.39  ? 115  THR A CA    1 
ATOM   888  C C     . THR A 1 129 ? 40.888  31.272  -8.437  1.00 62.72  ? 115  THR A C     1 
ATOM   889  O O     . THR A 1 129 ? 40.276  31.928  -7.582  1.00 61.87  ? 115  THR A O     1 
ATOM   890  C CB    . THR A 1 129 ? 39.375  30.187  -10.050 1.00 59.51  ? 115  THR A CB    1 
ATOM   891  O OG1   . THR A 1 129 ? 39.995  28.918  -9.844  1.00 59.81  ? 115  THR A OG1   1 
ATOM   892  C CG2   . THR A 1 129 ? 38.762  30.242  -11.443 1.00 60.20  ? 115  THR A CG2   1 
ATOM   893  N N     . ALA A 1 130 ? 41.948  30.524  -8.138  1.00 63.68  ? 116  ALA A N     1 
ATOM   894  C CA    . ALA A 1 130 ? 42.439  30.398  -6.757  1.00 65.14  ? 116  ALA A CA    1 
ATOM   895  C C     . ALA A 1 130 ? 42.436  31.687  -5.936  1.00 69.28  ? 116  ALA A C     1 
ATOM   896  O O     . ALA A 1 130 ? 41.859  31.709  -4.848  1.00 74.28  ? 116  ALA A O     1 
ATOM   897  C CB    . ALA A 1 130 ? 43.813  29.753  -6.725  1.00 65.36  ? 116  ALA A CB    1 
ATOM   898  N N     . PRO A 1 131 ? 43.075  32.762  -6.429  1.00 72.29  ? 117  PRO A N     1 
ATOM   899  C CA    . PRO A 1 131 ? 43.034  34.040  -5.702  1.00 74.80  ? 117  PRO A CA    1 
ATOM   900  C C     . PRO A 1 131 ? 41.633  34.446  -5.235  1.00 74.57  ? 117  PRO A C     1 
ATOM   901  O O     . PRO A 1 131 ? 41.469  34.850  -4.091  1.00 77.54  ? 117  PRO A O     1 
ATOM   902  C CB    . PRO A 1 131 ? 43.565  35.064  -6.726  1.00 75.94  ? 117  PRO A CB    1 
ATOM   903  C CG    . PRO A 1 131 ? 44.102  34.282  -7.881  1.00 74.71  ? 117  PRO A CG    1 
ATOM   904  C CD    . PRO A 1 131 ? 43.993  32.816  -7.577  1.00 73.33  ? 117  PRO A CD    1 
ATOM   905  N N     . GLY A 1 132 ? 40.639  34.352  -6.118  1.00 72.50  ? 118  GLY A N     1 
ATOM   906  C CA    . GLY A 1 132 ? 39.248  34.578  -5.732  1.00 69.80  ? 118  GLY A CA    1 
ATOM   907  C C     . GLY A 1 132 ? 38.848  33.653  -4.594  1.00 68.76  ? 118  GLY A C     1 
ATOM   908  O O     . GLY A 1 132 ? 38.427  34.107  -3.535  1.00 68.96  ? 118  GLY A O     1 
ATOM   909  N N     . HIS A 1 133 ? 39.017  32.349  -4.798  1.00 66.72  ? 119  HIS A N     1 
ATOM   910  C CA    . HIS A 1 133 ? 38.627  31.377  -3.788  1.00 64.35  ? 119  HIS A CA    1 
ATOM   911  C C     . HIS A 1 133 ? 39.360  31.577  -2.464  1.00 65.76  ? 119  HIS A C     1 
ATOM   912  O O     . HIS A 1 133 ? 38.780  31.370  -1.392  1.00 65.58  ? 119  HIS A O     1 
ATOM   913  C CB    . HIS A 1 133 ? 38.854  29.941  -4.272  1.00 63.39  ? 119  HIS A CB    1 
ATOM   914  C CG    . HIS A 1 133 ? 38.534  28.910  -3.229  1.00 61.48  ? 119  HIS A CG    1 
ATOM   915  N ND1   . HIS A 1 133 ? 37.244  28.661  -2.807  1.00 59.59  ? 119  HIS A ND1   1 
ATOM   916  C CD2   . HIS A 1 133 ? 39.334  28.106  -2.493  1.00 60.82  ? 119  HIS A CD2   1 
ATOM   917  C CE1   . HIS A 1 133 ? 37.264  27.733  -1.871  1.00 59.00  ? 119  HIS A CE1   1 
ATOM   918  N NE2   . HIS A 1 133 ? 38.518  27.380  -1.660  1.00 60.00  ? 119  HIS A NE2   1 
ATOM   919  N N     . VAL A 1 134 ? 40.629  31.963  -2.533  1.00 66.75  ? 120  VAL A N     1 
ATOM   920  C CA    . VAL A 1 134 ? 41.400  32.228  -1.318  1.00 68.85  ? 120  VAL A CA    1 
ATOM   921  C C     . VAL A 1 134 ? 40.817  33.423  -0.565  1.00 71.08  ? 120  VAL A C     1 
ATOM   922  O O     . VAL A 1 134 ? 40.559  33.316  0.625   1.00 71.31  ? 120  VAL A O     1 
ATOM   923  C CB    . VAL A 1 134 ? 42.900  32.396  -1.617  1.00 70.37  ? 120  VAL A CB    1 
ATOM   924  C CG1   . VAL A 1 134 ? 43.648  32.919  -0.410  1.00 73.45  ? 120  VAL A CG1   1 
ATOM   925  C CG2   . VAL A 1 134 ? 43.486  31.055  -2.043  1.00 70.23  ? 120  VAL A CG2   1 
ATOM   926  N N     . ASP A 1 135 ? 40.571  34.534  -1.259  1.00 72.29  ? 121  ASP A N     1 
ATOM   927  C CA    . ASP A 1 135 ? 39.898  35.689  -0.647  1.00 74.41  ? 121  ASP A CA    1 
ATOM   928  C C     . ASP A 1 135 ? 38.646  35.251  0.098   1.00 72.36  ? 121  ASP A C     1 
ATOM   929  O O     . ASP A 1 135 ? 38.507  35.496  1.290   1.00 71.22  ? 121  ASP A O     1 
ATOM   930  C CB    . ASP A 1 135 ? 39.466  36.727  -1.703  1.00 76.70  ? 121  ASP A CB    1 
ATOM   931  C CG    . ASP A 1 135 ? 40.503  37.843  -1.941  1.00 81.06  ? 121  ASP A CG    1 
ATOM   932  O OD1   . ASP A 1 135 ? 41.482  38.056  -1.158  1.00 83.92  ? 121  ASP A OD1   1 
ATOM   933  O OD2   . ASP A 1 135 ? 40.285  38.547  -2.951  1.00 82.93  ? 121  ASP A OD2   1 
ATOM   934  N N     . ALA A 1 136 ? 37.734  34.604  -0.631  1.00 70.22  ? 122  ALA A N     1 
ATOM   935  C CA    . ALA A 1 136 ? 36.454  34.166  -0.067  1.00 69.01  ? 122  ALA A CA    1 
ATOM   936  C C     . ALA A 1 136 ? 36.633  33.330  1.209   1.00 68.30  ? 122  ALA A C     1 
ATOM   937  O O     . ALA A 1 136 ? 35.883  33.490  2.169   1.00 66.85  ? 122  ALA A O     1 
ATOM   938  C CB    . ALA A 1 136 ? 35.652  33.386  -1.104  1.00 66.40  ? 122  ALA A CB    1 
ATOM   939  N N     . VAL A 1 137 ? 37.639  32.459  1.212   1.00 67.20  ? 123  VAL A N     1 
ATOM   940  C CA    . VAL A 1 137 ? 37.967  31.658  2.394   1.00 67.40  ? 123  VAL A CA    1 
ATOM   941  C C     . VAL A 1 137 ? 38.610  32.502  3.501   1.00 69.14  ? 123  VAL A C     1 
ATOM   942  O O     . VAL A 1 137 ? 38.416  32.223  4.685   1.00 70.95  ? 123  VAL A O     1 
ATOM   943  C CB    . VAL A 1 137 ? 38.874  30.468  2.024   1.00 66.67  ? 123  VAL A CB    1 
ATOM   944  C CG1   . VAL A 1 137 ? 39.400  29.771  3.273   1.00 68.54  ? 123  VAL A CG1   1 
ATOM   945  C CG2   . VAL A 1 137 ? 38.101  29.485  1.155   1.00 63.86  ? 123  VAL A CG2   1 
ATOM   946  N N     . ARG A 1 138 ? 39.386  33.514  3.124   1.00 63.87  ? 124  ARG A N     1 
ATOM   947  C CA    . ARG A 1 138 ? 39.918  34.464  4.104   1.00 64.84  ? 124  ARG A CA    1 
ATOM   948  C C     . ARG A 1 138 ? 38.781  35.229  4.769   1.00 65.10  ? 124  ARG A C     1 
ATOM   949  O O     . ARG A 1 138 ? 38.647  35.205  5.987   1.00 63.91  ? 124  ARG A O     1 
ATOM   950  C CB    . ARG A 1 138 ? 40.879  35.468  3.450   1.00 67.03  ? 124  ARG A CB    1 
ATOM   951  C CG    . ARG A 1 138 ? 42.319  34.964  3.314   1.00 67.45  ? 124  ARG A CG    1 
ATOM   952  C CD    . ARG A 1 138 ? 43.452  35.993  3.276   1.00 69.65  ? 124  ARG A CD    1 
ATOM   953  N NE    . ARG A 1 138 ? 44.744  35.291  3.344   1.00 68.91  ? 124  ARG A NE    1 
ATOM   954  C CZ    . ARG A 1 138 ? 45.259  34.733  4.450   1.00 68.06  ? 124  ARG A CZ    1 
ATOM   955  N NH1   . ARG A 1 138 ? 44.609  34.770  5.610   1.00 67.06  ? 124  ARG A NH1   1 
ATOM   956  N NH2   . ARG A 1 138 ? 46.442  34.119  4.400   1.00 68.11  ? 124  ARG A NH2   1 
ATOM   957  N N     . GLN A 1 139 ? 37.977  35.898  3.945   1.00 66.08  ? 125  GLN A N     1 
ATOM   958  C CA    . GLN A 1 139 ? 36.959  36.841  4.417   1.00 67.58  ? 125  GLN A CA    1 
ATOM   959  C C     . GLN A 1 139 ? 35.937  36.147  5.296   1.00 67.64  ? 125  GLN A C     1 
ATOM   960  O O     . GLN A 1 139 ? 35.508  36.697  6.293   1.00 71.82  ? 125  GLN A O     1 
ATOM   961  C CB    . GLN A 1 139 ? 36.248  37.557  3.264   1.00 67.51  ? 125  GLN A CB    1 
ATOM   962  N N     . ALA A 1 140 ? 35.562  34.930  4.940   1.00 66.91  ? 126  ALA A N     1 
ATOM   963  C CA    . ALA A 1 140 ? 34.591  34.166  5.711   1.00 65.51  ? 126  ALA A CA    1 
ATOM   964  C C     . ALA A 1 140 ? 35.149  33.631  7.023   1.00 65.78  ? 126  ALA A C     1 
ATOM   965  O O     . ALA A 1 140 ? 34.417  33.494  7.998   1.00 65.42  ? 126  ALA A O     1 
ATOM   966  C CB    . ALA A 1 140 ? 34.078  33.018  4.881   1.00 62.93  ? 126  ALA A CB    1 
ATOM   967  N N     . VAL A 1 141 ? 36.441  33.326  7.048   1.00 67.42  ? 127  VAL A N     1 
ATOM   968  C CA    . VAL A 1 141 ? 37.039  32.632  8.190   1.00 67.07  ? 127  VAL A CA    1 
ATOM   969  C C     . VAL A 1 141 ? 38.240  33.364  8.808   1.00 69.88  ? 127  VAL A C     1 
ATOM   970  O O     . VAL A 1 141 ? 38.103  33.973  9.866   1.00 72.36  ? 127  VAL A O     1 
ATOM   971  C CB    . VAL A 1 141 ? 37.459  31.210  7.797   1.00 64.68  ? 127  VAL A CB    1 
ATOM   972  C CG1   . VAL A 1 141 ? 38.113  30.498  8.973   1.00 64.58  ? 127  VAL A CG1   1 
ATOM   973  C CG2   . VAL A 1 141 ? 36.246  30.436  7.310   1.00 63.89  ? 127  VAL A CG2   1 
ATOM   974  N N     . PHE A 1 142 ? 39.399  33.318  8.155   1.00 69.10  ? 128  PHE A N     1 
ATOM   975  C CA    . PHE A 1 142 ? 40.653  33.658  8.830   1.00 70.67  ? 128  PHE A CA    1 
ATOM   976  C C     . PHE A 1 142 ? 40.770  35.122  9.240   1.00 72.44  ? 128  PHE A C     1 
ATOM   977  O O     . PHE A 1 142 ? 41.299  35.428  10.315  1.00 73.71  ? 128  PHE A O     1 
ATOM   978  C CB    . PHE A 1 142 ? 41.855  33.214  7.985   1.00 71.34  ? 128  PHE A CB    1 
ATOM   979  C CG    . PHE A 1 142 ? 41.973  31.728  7.848   1.00 70.81  ? 128  PHE A CG    1 
ATOM   980  C CD1   . PHE A 1 142 ? 42.541  30.970  8.864   1.00 72.28  ? 128  PHE A CD1   1 
ATOM   981  C CD2   . PHE A 1 142 ? 41.486  31.073  6.725   1.00 70.12  ? 128  PHE A CD2   1 
ATOM   982  C CE1   . PHE A 1 142 ? 42.629  29.589  8.761   1.00 70.31  ? 128  PHE A CE1   1 
ATOM   983  C CE2   . PHE A 1 142 ? 41.583  29.693  6.606   1.00 68.62  ? 128  PHE A CE2   1 
ATOM   984  C CZ    . PHE A 1 142 ? 42.153  28.951  7.627   1.00 68.87  ? 128  PHE A CZ    1 
ATOM   985  N N     . ASP A 1 143 ? 40.274  36.027  8.402   1.00 72.69  ? 129  ASP A N     1 
ATOM   986  C CA    . ASP A 1 143 ? 40.226  37.446  8.760   1.00 74.51  ? 129  ASP A CA    1 
ATOM   987  C C     . ASP A 1 143 ? 39.404  37.734  10.021  1.00 75.42  ? 129  ASP A C     1 
ATOM   988  O O     . ASP A 1 143 ? 39.502  38.832  10.568  1.00 78.43  ? 129  ASP A O     1 
ATOM   989  C CB    . ASP A 1 143 ? 39.659  38.282  7.602   1.00 74.90  ? 129  ASP A CB    1 
ATOM   990  C CG    . ASP A 1 143 ? 40.668  38.520  6.493   1.00 75.51  ? 129  ASP A CG    1 
ATOM   991  O OD1   . ASP A 1 143 ? 41.892  38.311  6.710   1.00 76.73  ? 129  ASP A OD1   1 
ATOM   992  O OD2   . ASP A 1 143 ? 40.244  38.956  5.404   1.00 75.04  ? 129  ASP A OD2   1 
ATOM   993  N N     . ARG A 1 144 ? 38.598  36.768  10.473  1.00 73.41  ? 130  ARG A N     1 
ATOM   994  C CA    . ARG A 1 144 ? 37.670  36.978  11.594  1.00 74.07  ? 130  ARG A CA    1 
ATOM   995  C C     . ARG A 1 144 ? 38.104  36.333  12.907  1.00 73.73  ? 130  ARG A C     1 
ATOM   996  O O     . ARG A 1 144 ? 37.439  36.516  13.928  1.00 74.26  ? 130  ARG A O     1 
ATOM   997  C CB    . ARG A 1 144 ? 36.288  36.446  11.229  1.00 72.80  ? 130  ARG A CB    1 
ATOM   998  C CG    . ARG A 1 144 ? 35.770  36.968  9.900   1.00 73.63  ? 130  ARG A CG    1 
ATOM   999  C CD    . ARG A 1 144 ? 34.288  36.697  9.712   1.00 72.53  ? 130  ARG A CD    1 
ATOM   1000 N NE    . ARG A 1 144 ? 33.607  37.942  9.383   1.00 76.33  ? 130  ARG A NE    1 
ATOM   1001 C CZ    . ARG A 1 144 ? 32.891  38.187  8.286   1.00 78.46  ? 130  ARG A CZ    1 
ATOM   1002 N NH1   . ARG A 1 144 ? 32.682  37.250  7.359   1.00 77.73  ? 130  ARG A NH1   1 
ATOM   1003 N NH2   . ARG A 1 144 ? 32.337  39.392  8.136   1.00 81.16  ? 130  ARG A NH2   1 
ATOM   1004 N N     . LEU A 1 145 ? 39.219  35.601  12.890  1.00 72.76  ? 131  LEU A N     1 
ATOM   1005 C CA    . LEU A 1 145 ? 39.675  34.865  14.070  1.00 71.88  ? 131  LEU A CA    1 
ATOM   1006 C C     . LEU A 1 145 ? 41.091  35.261  14.480  1.00 73.24  ? 131  LEU A C     1 
ATOM   1007 O O     . LEU A 1 145 ? 41.969  35.417  13.637  1.00 73.03  ? 131  LEU A O     1 
ATOM   1008 C CB    . LEU A 1 145 ? 39.650  33.371  13.783  1.00 69.22  ? 131  LEU A CB    1 
ATOM   1009 C CG    . LEU A 1 145 ? 38.364  32.850  13.157  1.00 67.57  ? 131  LEU A CG    1 
ATOM   1010 C CD1   . LEU A 1 145 ? 38.571  31.417  12.705  1.00 66.60  ? 131  LEU A CD1   1 
ATOM   1011 C CD2   . LEU A 1 145 ? 37.209  32.942  14.129  1.00 67.73  ? 131  LEU A CD2   1 
ATOM   1012 N N     . THR A 1 146 ? 41.309  35.406  15.780  1.00 74.82  ? 132  THR A N     1 
ATOM   1013 C CA    . THR A 1 146 ? 42.642  35.667  16.307  1.00 77.08  ? 132  THR A CA    1 
ATOM   1014 C C     . THR A 1 146 ? 43.514  34.425  16.093  1.00 77.29  ? 132  THR A C     1 
ATOM   1015 O O     . THR A 1 146 ? 42.976  33.327  15.902  1.00 78.51  ? 132  THR A O     1 
ATOM   1016 C CB    . THR A 1 146 ? 42.612  36.002  17.819  1.00 78.53  ? 132  THR A CB    1 
ATOM   1017 O OG1   . THR A 1 146 ? 42.356  34.818  18.580  1.00 76.98  ? 132  THR A OG1   1 
ATOM   1018 C CG2   . THR A 1 146 ? 41.551  37.062  18.157  1.00 80.09  ? 132  THR A CG2   1 
ATOM   1019 N N     . PRO A 1 147 ? 44.856  34.591  16.098  1.00 78.26  ? 133  PRO A N     1 
ATOM   1020 C CA    . PRO A 1 147 ? 45.754  33.435  16.067  1.00 76.27  ? 133  PRO A CA    1 
ATOM   1021 C C     . PRO A 1 147 ? 45.371  32.314  17.052  1.00 74.61  ? 133  PRO A C     1 
ATOM   1022 O O     . PRO A 1 147 ? 45.340  31.137  16.671  1.00 74.15  ? 133  PRO A O     1 
ATOM   1023 C CB    . PRO A 1 147 ? 47.125  34.041  16.427  1.00 78.02  ? 133  PRO A CB    1 
ATOM   1024 C CG    . PRO A 1 147 ? 46.984  35.533  16.291  1.00 80.60  ? 133  PRO A CG    1 
ATOM   1025 C CD    . PRO A 1 147 ? 45.590  35.842  15.824  1.00 80.68  ? 133  PRO A CD    1 
ATOM   1026 N N     . GLU A 1 148 ? 45.061  32.669  18.295  1.00 74.03  ? 134  GLU A N     1 
ATOM   1027 C CA    . GLU A 1 148 ? 44.664  31.671  19.299  1.00 72.00  ? 134  GLU A CA    1 
ATOM   1028 C C     . GLU A 1 148 ? 43.524  30.771  18.797  1.00 68.75  ? 134  GLU A C     1 
ATOM   1029 O O     . GLU A 1 148 ? 43.571  29.558  18.994  1.00 66.67  ? 134  GLU A O     1 
ATOM   1030 C CB    . GLU A 1 148 ? 44.290  32.340  20.640  1.00 73.93  ? 134  GLU A CB    1 
ATOM   1031 N N     . GLN A 1 149 ? 42.531  31.361  18.124  1.00 68.17  ? 135  GLN A N     1 
ATOM   1032 C CA    . GLN A 1 149 ? 41.331  30.621  17.685  1.00 66.46  ? 135  GLN A CA    1 
ATOM   1033 C C     . GLN A 1 149 ? 41.580  29.821  16.433  1.00 64.70  ? 135  GLN A C     1 
ATOM   1034 O O     . GLN A 1 149 ? 41.023  28.740  16.258  1.00 62.23  ? 135  GLN A O     1 
ATOM   1035 C CB    . GLN A 1 149 ? 40.152  31.537  17.392  1.00 68.61  ? 135  GLN A CB    1 
ATOM   1036 C CG    . GLN A 1 149 ? 40.205  32.906  18.025  1.00 70.97  ? 135  GLN A CG    1 
ATOM   1037 C CD    . GLN A 1 149 ? 38.845  33.548  18.097  1.00 73.02  ? 135  GLN A CD    1 
ATOM   1038 O OE1   . GLN A 1 149 ? 38.557  34.514  17.394  1.00 76.47  ? 135  GLN A OE1   1 
ATOM   1039 N NE2   . GLN A 1 149 ? 37.995  33.015  18.959  1.00 73.61  ? 135  GLN A NE2   1 
ATOM   1040 N N     . GLN A 1 150 ? 42.406  30.361  15.539  1.00 65.78  ? 136  GLN A N     1 
ATOM   1041 C CA    . GLN A 1 150 ? 42.873  29.593  14.386  1.00 63.91  ? 136  GLN A CA    1 
ATOM   1042 C C     . GLN A 1 150 ? 43.597  28.348  14.886  1.00 63.73  ? 136  GLN A C     1 
ATOM   1043 O O     . GLN A 1 150 ? 43.351  27.255  14.390  1.00 65.40  ? 136  GLN A O     1 
ATOM   1044 C CB    . GLN A 1 150 ? 43.793  30.432  13.499  1.00 63.69  ? 136  GLN A CB    1 
ATOM   1045 C CG    . GLN A 1 150 ? 43.084  31.582  12.814  1.00 63.84  ? 136  GLN A CG    1 
ATOM   1046 C CD    . GLN A 1 150 ? 44.006  32.408  11.960  1.00 64.19  ? 136  GLN A CD    1 
ATOM   1047 O OE1   . GLN A 1 150 ? 45.130  31.998  11.680  1.00 64.57  ? 136  GLN A OE1   1 
ATOM   1048 N NE2   . GLN A 1 150 ? 43.538  33.580  11.531  1.00 65.47  ? 136  GLN A NE2   1 
ATOM   1049 N N     . LYS A 1 151 ? 44.496  28.519  15.855  1.00 64.33  ? 137  LYS A N     1 
ATOM   1050 C CA    . LYS A 1 151 ? 45.173  27.381  16.471  1.00 63.87  ? 137  LYS A CA    1 
ATOM   1051 C C     . LYS A 1 151 ? 44.116  26.443  16.988  1.00 63.49  ? 137  LYS A C     1 
ATOM   1052 O O     . LYS A 1 151 ? 44.090  25.275  16.625  1.00 63.90  ? 137  LYS A O     1 
ATOM   1053 C CB    . LYS A 1 151 ? 46.087  27.826  17.618  1.00 64.36  ? 137  LYS A CB    1 
ATOM   1054 N N     . SER A 1 152 ? 43.201  26.987  17.782  1.00 65.22  ? 138  SER A N     1 
ATOM   1055 C CA    . SER A 1 152 ? 42.171  26.200  18.463  1.00 64.87  ? 138  SER A CA    1 
ATOM   1056 C C     . SER A 1 152 ? 41.264  25.411  17.498  1.00 63.16  ? 138  SER A C     1 
ATOM   1057 O O     . SER A 1 152 ? 40.962  24.243  17.731  1.00 61.57  ? 138  SER A O     1 
ATOM   1058 C CB    . SER A 1 152 ? 41.333  27.121  19.351  1.00 67.09  ? 138  SER A CB    1 
ATOM   1059 O OG    . SER A 1 152 ? 40.525  26.372  20.240  1.00 69.70  ? 138  SER A OG    1 
ATOM   1060 N N     . LEU A 1 153 ? 40.828  26.068  16.423  1.00 64.05  ? 139  LEU A N     1 
ATOM   1061 C CA    . LEU A 1 153 ? 40.003  25.442  15.380  1.00 63.51  ? 139  LEU A CA    1 
ATOM   1062 C C     . LEU A 1 153 ? 40.642  24.179  14.808  1.00 63.18  ? 139  LEU A C     1 
ATOM   1063 O O     . LEU A 1 153 ? 39.992  23.138  14.707  1.00 62.20  ? 139  LEU A O     1 
ATOM   1064 C CB    . LEU A 1 153 ? 39.786  26.427  14.232  1.00 63.70  ? 139  LEU A CB    1 
ATOM   1065 C CG    . LEU A 1 153 ? 38.985  25.995  13.000  1.00 62.92  ? 139  LEU A CG    1 
ATOM   1066 C CD1   . LEU A 1 153 ? 37.659  25.392  13.393  1.00 61.72  ? 139  LEU A CD1   1 
ATOM   1067 C CD2   . LEU A 1 153 ? 38.759  27.160  12.048  1.00 63.41  ? 139  LEU A CD2   1 
ATOM   1068 N N     . GLY A 1 154 ? 41.916  24.285  14.428  1.00 63.32  ? 140  GLY A N     1 
ATOM   1069 C CA    . GLY A 1 154 ? 42.637  23.177  13.808  1.00 62.20  ? 140  GLY A CA    1 
ATOM   1070 C C     . GLY A 1 154 ? 42.833  22.007  14.747  1.00 62.68  ? 140  GLY A C     1 
ATOM   1071 O O     . GLY A 1 154 ? 42.690  20.857  14.343  1.00 62.00  ? 140  GLY A O     1 
ATOM   1072 N N     . GLU A 1 155 ? 43.154  22.300  16.007  1.00 62.77  ? 141  GLU A N     1 
ATOM   1073 C CA    . GLU A 1 155 ? 43.275  21.265  17.009  1.00 62.44  ? 141  GLU A CA    1 
ATOM   1074 C C     . GLU A 1 155 ? 41.948  20.530  17.132  1.00 62.48  ? 141  GLU A C     1 
ATOM   1075 O O     . GLU A 1 155 ? 41.904  19.293  17.185  1.00 63.76  ? 141  GLU A O     1 
ATOM   1076 C CB    . GLU A 1 155 ? 43.697  21.876  18.330  1.00 63.03  ? 141  GLU A CB    1 
ATOM   1077 N N     . ILE A 1 156 ? 40.863  21.293  17.113  1.00 61.52  ? 142  ILE A N     1 
ATOM   1078 C CA    . ILE A 1 156 ? 39.525  20.742  17.309  1.00 60.99  ? 142  ILE A CA    1 
ATOM   1079 C C     . ILE A 1 156 ? 39.066  19.872  16.136  1.00 59.13  ? 142  ILE A C     1 
ATOM   1080 O O     . ILE A 1 156 ? 38.606  18.756  16.330  1.00 60.16  ? 142  ILE A O     1 
ATOM   1081 C CB    . ILE A 1 156 ? 38.495  21.868  17.579  1.00 61.04  ? 142  ILE A CB    1 
ATOM   1082 C CG1   . ILE A 1 156 ? 38.730  22.452  18.966  1.00 61.29  ? 142  ILE A CG1   1 
ATOM   1083 C CG2   . ILE A 1 156 ? 37.074  21.329  17.480  1.00 61.70  ? 142  ILE A CG2   1 
ATOM   1084 C CD1   . ILE A 1 156 ? 38.052  23.775  19.211  1.00 61.83  ? 142  ILE A CD1   1 
ATOM   1085 N N     . MET A 1 157 ? 39.173  20.387  14.921  1.00 58.10  ? 143  MET A N     1 
ATOM   1086 C CA    . MET A 1 157 ? 38.679  19.651  13.773  1.00 56.43  ? 143  MET A CA    1 
ATOM   1087 C C     . MET A 1 157 ? 39.516  18.396  13.557  1.00 57.48  ? 143  MET A C     1 
ATOM   1088 O O     . MET A 1 157 ? 38.976  17.355  13.225  1.00 55.68  ? 143  MET A O     1 
ATOM   1089 C CB    . MET A 1 157 ? 38.641  20.537  12.534  1.00 56.67  ? 143  MET A CB    1 
ATOM   1090 C CG    . MET A 1 157 ? 37.697  21.735  12.647  1.00 56.91  ? 143  MET A CG    1 
ATOM   1091 S SD    . MET A 1 157 ? 36.008  21.351  13.148  1.00 59.64  ? 143  MET A SD    1 
ATOM   1092 C CE    . MET A 1 157 ? 35.197  20.828  11.645  1.00 59.10  ? 143  MET A CE    1 
ATOM   1093 N N     . ARG A 1 158 ? 40.834  18.495  13.764  1.00 59.34  ? 144  ARG A N     1 
ATOM   1094 C CA    . ARG A 1 158 ? 41.740  17.369  13.608  1.00 59.97  ? 144  ARG A CA    1 
ATOM   1095 C C     . ARG A 1 158 ? 41.352  16.180  14.482  1.00 59.33  ? 144  ARG A C     1 
ATOM   1096 O O     . ARG A 1 158 ? 41.380  15.030  14.028  1.00 59.41  ? 144  ARG A O     1 
ATOM   1097 C CB    . ARG A 1 158 ? 43.167  17.842  13.876  1.00 64.57  ? 144  ARG A CB    1 
ATOM   1098 C CG    . ARG A 1 158 ? 44.251  16.830  13.539  1.00 70.02  ? 144  ARG A CG    1 
ATOM   1099 C CD    . ARG A 1 158 ? 45.434  17.549  12.858  1.00 74.82  ? 144  ARG A CD    1 
ATOM   1100 N NE    . ARG A 1 158 ? 45.749  18.858  13.487  1.00 78.15  ? 144  ARG A NE    1 
ATOM   1101 C CZ    . ARG A 1 158 ? 45.745  20.068  12.889  1.00 80.04  ? 144  ARG A CZ    1 
ATOM   1102 N NH1   . ARG A 1 158 ? 45.385  20.266  11.608  1.00 77.81  ? 144  ARG A NH1   1 
ATOM   1103 N NH2   . ARG A 1 158 ? 46.085  21.130  13.623  1.00 79.76  ? 144  ARG A NH2   1 
ATOM   1104 N N     . ILE A 1 159 ? 40.911  16.452  15.706  1.00 59.21  ? 145  ILE A N     1 
ATOM   1105 C CA    . ILE A 1 159 ? 40.398  15.394  16.592  1.00 60.16  ? 145  ILE A CA    1 
ATOM   1106 C C     . ILE A 1 159 ? 39.125  14.751  16.032  1.00 60.60  ? 145  ILE A C     1 
ATOM   1107 O O     . ILE A 1 159 ? 38.988  13.515  15.994  1.00 61.58  ? 145  ILE A O     1 
ATOM   1108 C CB    . ILE A 1 159 ? 40.032  15.938  17.984  1.00 61.60  ? 145  ILE A CB    1 
ATOM   1109 C CG1   . ILE A 1 159 ? 41.262  16.506  18.703  1.00 61.65  ? 145  ILE A CG1   1 
ATOM   1110 C CG2   . ILE A 1 159 ? 39.397  14.833  18.829  1.00 63.64  ? 145  ILE A CG2   1 
ATOM   1111 C CD1   . ILE A 1 159 ? 40.921  17.529  19.771  1.00 60.95  ? 145  ILE A CD1   1 
ATOM   1112 N N     . VAL A 1 160 ? 38.182  15.607  15.630  1.00 59.24  ? 146  VAL A N     1 
ATOM   1113 C CA    . VAL A 1 160 ? 36.918  15.169  15.042  1.00 58.73  ? 146  VAL A CA    1 
ATOM   1114 C C     . VAL A 1 160 ? 37.183  14.298  13.814  1.00 58.76  ? 146  VAL A C     1 
ATOM   1115 O O     . VAL A 1 160 ? 36.577  13.241  13.659  1.00 60.79  ? 146  VAL A O     1 
ATOM   1116 C CB    . VAL A 1 160 ? 36.025  16.375  14.662  1.00 57.08  ? 146  VAL A CB    1 
ATOM   1117 C CG1   . VAL A 1 160 ? 34.853  15.948  13.795  1.00 56.31  ? 146  VAL A CG1   1 
ATOM   1118 C CG2   . VAL A 1 160 ? 35.526  17.076  15.917  1.00 58.06  ? 146  VAL A CG2   1 
ATOM   1119 N N     . ALA A 1 161 ? 38.090  14.741  12.956  1.00 57.26  ? 147  ALA A N     1 
ATOM   1120 C CA    . ALA A 1 161 ? 38.434  13.983  11.761  1.00 58.15  ? 147  ALA A CA    1 
ATOM   1121 C C     . ALA A 1 161 ? 39.101  12.664  12.134  1.00 60.59  ? 147  ALA A C     1 
ATOM   1122 O O     . ALA A 1 161 ? 38.647  11.593  11.715  1.00 60.04  ? 147  ALA A O     1 
ATOM   1123 C CB    . ALA A 1 161 ? 39.339  14.795  10.846  1.00 56.40  ? 147  ALA A CB    1 
ATOM   1124 N N     . GLU A 1 162 ? 40.189  12.744  12.906  1.00 62.37  ? 148  GLU A N     1 
ATOM   1125 C CA    . GLU A 1 162 ? 40.886  11.545  13.354  1.00 62.95  ? 148  GLU A CA    1 
ATOM   1126 C C     . GLU A 1 162 ? 39.878  10.551  13.900  1.00 64.23  ? 148  GLU A C     1 
ATOM   1127 O O     . GLU A 1 162 ? 39.932  9.379   13.566  1.00 65.12  ? 148  GLU A O     1 
ATOM   1128 C CB    . GLU A 1 162 ? 41.887  11.896  14.451  1.00 62.69  ? 148  GLU A CB    1 
ATOM   1129 N N     . GLY A 1 163 ? 38.925  11.047  14.694  1.00 65.30  ? 149  GLY A N     1 
ATOM   1130 C CA    . GLY A 1 163 ? 37.907  10.209  15.329  1.00 65.72  ? 149  GLY A CA    1 
ATOM   1131 C C     . GLY A 1 163 ? 37.015  9.462   14.355  1.00 66.39  ? 149  GLY A C     1 
ATOM   1132 O O     . GLY A 1 163 ? 36.571  8.346   14.631  1.00 66.79  ? 149  GLY A O     1 
ATOM   1133 N N     . LEU A 1 164 ? 36.760  10.070  13.199  1.00 65.07  ? 150  LEU A N     1 
ATOM   1134 C CA    . LEU A 1 164 ? 35.826  9.508   12.225  1.00 65.25  ? 150  LEU A CA    1 
ATOM   1135 C C     . LEU A 1 164 ? 36.503  8.630   11.186  1.00 66.64  ? 150  LEU A C     1 
ATOM   1136 O O     . LEU A 1 164 ? 35.832  8.029   10.355  1.00 67.03  ? 150  LEU A O     1 
ATOM   1137 C CB    . LEU A 1 164 ? 35.061  10.637  11.537  1.00 63.58  ? 150  LEU A CB    1 
ATOM   1138 C CG    . LEU A 1 164 ? 33.921  11.211  12.375  1.00 63.02  ? 150  LEU A CG    1 
ATOM   1139 C CD1   . LEU A 1 164 ? 33.641  12.658  12.002  1.00 60.54  ? 150  LEU A CD1   1 
ATOM   1140 C CD2   . LEU A 1 164 ? 32.690  10.347  12.195  1.00 64.45  ? 150  LEU A CD2   1 
ATOM   1141 N N     . GLN A 1 165 ? 37.828  8.594   11.183  1.00 67.83  ? 151  GLN A N     1 
ATOM   1142 C CA    . GLN A 1 165 ? 38.542  7.710   10.270  1.00 70.35  ? 151  GLN A CA    1 
ATOM   1143 C C     . GLN A 1 165 ? 39.610  6.964   11.050  1.00 74.17  ? 151  GLN A C     1 
ATOM   1144 O O     . GLN A 1 165 ? 40.800  7.162   10.828  1.00 73.65  ? 151  GLN A O     1 
ATOM   1145 C CB    . GLN A 1 165 ? 39.131  8.465   9.052   1.00 67.59  ? 151  GLN A CB    1 
ATOM   1146 C CG    . GLN A 1 165 ? 39.844  9.758   9.392   1.00 65.71  ? 151  GLN A CG    1 
ATOM   1147 C CD    . GLN A 1 165 ? 40.494  10.415  8.192   1.00 64.73  ? 151  GLN A CD    1 
ATOM   1148 O OE1   . GLN A 1 165 ? 40.213  10.080  7.037   1.00 65.62  ? 151  GLN A OE1   1 
ATOM   1149 N NE2   . GLN A 1 165 ? 41.353  11.378  8.457   1.00 64.00  ? 151  GLN A NE2   1 
ATOM   1150 N N     . PRO A 1 166 ? 39.180  6.100   11.981  1.00 79.77  ? 152  PRO A N     1 
ATOM   1151 C CA    . PRO A 1 166 ? 40.173  5.266   12.645  1.00 84.80  ? 152  PRO A CA    1 
ATOM   1152 C C     . PRO A 1 166 ? 40.769  4.210   11.687  1.00 89.82  ? 152  PRO A C     1 
ATOM   1153 O O     . PRO A 1 166 ? 40.141  3.857   10.664  1.00 93.48  ? 152  PRO A O     1 
ATOM   1154 C CB    . PRO A 1 166 ? 39.373  4.618   13.780  1.00 85.03  ? 152  PRO A CB    1 
ATOM   1155 C CG    . PRO A 1 166 ? 37.978  4.544   13.262  1.00 83.60  ? 152  PRO A CG    1 
ATOM   1156 C CD    . PRO A 1 166 ? 37.801  5.733   12.356  1.00 80.41  ? 152  PRO A CD    1 
ATOM   1157 N N     . SER A 1 167 ? 41.966  3.719   12.019  1.00 92.63  ? 153  SER A N     1 
ATOM   1158 C CA    . SER A 1 167 ? 42.641  2.696   11.213  1.00 95.01  ? 153  SER A CA    1 
ATOM   1159 C C     . SER A 1 167 ? 42.057  1.291   11.438  1.00 98.90  ? 153  SER A C     1 
ATOM   1160 O O     . SER A 1 167 ? 42.310  0.390   10.624  1.00 101.06 ? 153  SER A O     1 
ATOM   1161 C CB    . SER A 1 167 ? 44.143  2.679   11.527  1.00 94.76  ? 153  SER A CB    1 
ATOM   1162 N N     . GLU A 1 168 ? 41.241  1.143   12.498  1.00 100.82 ? 154  GLU A N     1 
ATOM   1163 C CA    . GLU A 1 168 ? 40.902  -0.138  13.148  1.00 103.98 ? 154  GLU A CA    1 
ATOM   1164 C C     . GLU A 1 168 ? 39.920  -1.059  12.390  1.00 106.34 ? 154  GLU A C     1 
ATOM   1165 O O     . GLU A 1 168 ? 39.014  -1.672  12.992  1.00 107.05 ? 154  GLU A O     1 
ATOM   1166 C CB    . GLU A 1 168 ? 40.357  0.125   14.557  1.00 102.97 ? 154  GLU A CB    1 
ATOM   1167 N N     . ALA A 1 169 ? 40.113  -1.126  11.072  1.00 105.03 ? 155  ALA A N     1 
ATOM   1168 C CA    . ALA A 1 169 ? 39.609  -2.208  10.210  1.00 107.80 ? 155  ALA A CA    1 
ATOM   1169 C C     . ALA A 1 169 ? 38.092  -2.218  9.965   1.00 107.97 ? 155  ALA A C     1 
ATOM   1170 O O     . ALA A 1 169 ? 37.638  -1.833  8.886   1.00 105.97 ? 155  ALA A O     1 
ATOM   1171 C CB    . ALA A 1 169 ? 40.099  -3.570  10.708  1.00 111.64 ? 155  ALA A CB    1 
ATOM   1172 N N     . GLY A 1 170 ? 37.303  -2.682  10.931  1.00 108.80 ? 156  GLY A N     1 
ATOM   1173 C CA    . GLY A 1 170 ? 35.850  -2.730  10.736  1.00 107.82 ? 156  GLY A CA    1 
ATOM   1174 C C     . GLY A 1 170 ? 35.163  -1.383  10.844  1.00 103.11 ? 156  GLY A C     1 
ATOM   1175 O O     . GLY A 1 170 ? 34.372  -1.153  11.757  1.00 102.96 ? 156  GLY A O     1 
ATOM   1176 N N     . ALA A 1 171 ? 35.468  -0.499  9.897   1.00 98.60  ? 157  ALA A N     1 
ATOM   1177 C CA    . ALA A 1 171 ? 34.884  0.825   9.835   1.00 94.52  ? 157  ALA A CA    1 
ATOM   1178 C C     . ALA A 1 171 ? 34.261  1.115   8.463   1.00 92.89  ? 157  ALA A C     1 
ATOM   1179 O O     . ALA A 1 171 ? 34.463  0.368   7.504   1.00 95.30  ? 157  ALA A O     1 
ATOM   1180 C CB    . ALA A 1 171 ? 35.951  1.851   10.174  1.00 91.12  ? 157  ALA A CB    1 
ATOM   1181 N N     . ASP A 1 172 ? 33.508  2.214   8.400   1.00 88.32  ? 158  ASP A N     1 
ATOM   1182 C CA    . ASP A 1 172 ? 32.677  2.609   7.260   1.00 83.84  ? 158  ASP A CA    1 
ATOM   1183 C C     . ASP A 1 172 ? 33.222  3.871   6.547   1.00 78.01  ? 158  ASP A C     1 
ATOM   1184 O O     . ASP A 1 172 ? 32.544  4.895   6.455   1.00 74.67  ? 158  ASP A O     1 
ATOM   1185 C CB    . ASP A 1 172 ? 31.254  2.842   7.782   1.00 83.83  ? 158  ASP A CB    1 
ATOM   1186 C CG    . ASP A 1 172 ? 30.260  3.143   6.677   1.00 83.80  ? 158  ASP A CG    1 
ATOM   1187 O OD1   . ASP A 1 172 ? 30.537  2.777   5.518   1.00 83.98  ? 158  ASP A OD1   1 
ATOM   1188 O OD2   . ASP A 1 172 ? 29.207  3.761   6.966   1.00 84.27  ? 158  ASP A OD2   1 
ATOM   1189 N N     . LEU A 1 173 ? 34.449  3.786   6.039   1.00 74.76  ? 159  LEU A N     1 
ATOM   1190 C CA    . LEU A 1 173 ? 35.090  4.925   5.401   1.00 70.36  ? 159  LEU A CA    1 
ATOM   1191 C C     . LEU A 1 173 ? 34.570  5.033   3.959   1.00 68.40  ? 159  LEU A C     1 
ATOM   1192 O O     . LEU A 1 173 ? 34.551  4.041   3.238   1.00 69.62  ? 159  LEU A O     1 
ATOM   1193 C CB    . LEU A 1 173 ? 36.622  4.775   5.444   1.00 70.65  ? 159  LEU A CB    1 
ATOM   1194 C CG    . LEU A 1 173 ? 37.244  4.497   6.828   1.00 71.08  ? 159  LEU A CG    1 
ATOM   1195 C CD1   . LEU A 1 173 ? 38.745  4.239   6.756   1.00 71.66  ? 159  LEU A CD1   1 
ATOM   1196 C CD2   . LEU A 1 173 ? 36.972  5.630   7.796   1.00 68.66  ? 159  LEU A CD2   1 
ATOM   1197 N N     . PRO A 1 174 ? 34.156  6.246   3.537   1.00 64.98  ? 160  PRO A N     1 
ATOM   1198 C CA    . PRO A 1 174 ? 33.591  6.497   2.202   1.00 63.42  ? 160  PRO A CA    1 
ATOM   1199 C C     . PRO A 1 174 ? 34.329  5.820   1.031   1.00 64.48  ? 160  PRO A C     1 
ATOM   1200 O O     . PRO A 1 174 ? 33.710  5.188   0.173   1.00 67.47  ? 160  PRO A O     1 
ATOM   1201 C CB    . PRO A 1 174 ? 33.719  8.008   2.056   1.00 61.53  ? 160  PRO A CB    1 
ATOM   1202 C CG    . PRO A 1 174 ? 33.739  8.539   3.455   1.00 60.57  ? 160  PRO A CG    1 
ATOM   1203 C CD    . PRO A 1 174 ? 34.327  7.490   4.322   1.00 61.83  ? 160  PRO A CD    1 
ATOM   1204 N N     . TRP A 1 175 ? 35.650  5.944   1.007   1.00 62.57  ? 161  TRP A N     1 
ATOM   1205 C CA    . TRP A 1 175 ? 36.444  5.460   -0.118  1.00 62.30  ? 161  TRP A CA    1 
ATOM   1206 C C     . TRP A 1 175 ? 36.580  3.939   -0.122  1.00 65.59  ? 161  TRP A C     1 
ATOM   1207 O O     . TRP A 1 175 ? 37.106  3.367   -1.086  1.00 67.06  ? 161  TRP A O     1 
ATOM   1208 C CB    . TRP A 1 175 ? 37.817  6.137   -0.131  1.00 60.41  ? 161  TRP A CB    1 
ATOM   1209 C CG    . TRP A 1 175 ? 38.573  6.031   1.164   1.00 60.03  ? 161  TRP A CG    1 
ATOM   1210 C CD1   . TRP A 1 175 ? 39.505  5.108   1.477   1.00 61.88  ? 161  TRP A CD1   1 
ATOM   1211 C CD2   . TRP A 1 175 ? 38.457  6.890   2.308   1.00 58.57  ? 161  TRP A CD2   1 
ATOM   1212 N NE1   . TRP A 1 175 ? 39.989  5.340   2.744   1.00 61.69  ? 161  TRP A NE1   1 
ATOM   1213 C CE2   . TRP A 1 175 ? 39.365  6.431   3.273   1.00 59.38  ? 161  TRP A CE2   1 
ATOM   1214 C CE3   . TRP A 1 175 ? 37.683  8.013   2.601   1.00 57.00  ? 161  TRP A CE3   1 
ATOM   1215 C CZ2   . TRP A 1 175 ? 39.522  7.054   4.525   1.00 58.85  ? 161  TRP A CZ2   1 
ATOM   1216 C CZ3   . TRP A 1 175 ? 37.838  8.634   3.841   1.00 56.18  ? 161  TRP A CZ3   1 
ATOM   1217 C CH2   . TRP A 1 175 ? 38.746  8.154   4.788   1.00 56.95  ? 161  TRP A CH2   1 
ATOM   1218 N N     . LEU A 1 176 ? 36.152  3.301   0.970   1.00 67.35  ? 162  LEU A N     1 
ATOM   1219 C CA    . LEU A 1 176 ? 36.096  1.844   1.064   1.00 71.35  ? 162  LEU A CA    1 
ATOM   1220 C C     . LEU A 1 176 ? 34.685  1.335   0.944   1.00 72.62  ? 162  LEU A C     1 
ATOM   1221 O O     . LEU A 1 176 ? 34.412  0.165   1.200   1.00 76.19  ? 162  LEU A O     1 
ATOM   1222 C CB    . LEU A 1 176 ? 36.698  1.355   2.384   1.00 72.87  ? 162  LEU A CB    1 
ATOM   1223 C CG    . LEU A 1 176 ? 38.126  1.801   2.672   1.00 73.06  ? 162  LEU A CG    1 
ATOM   1224 C CD1   . LEU A 1 176 ? 38.569  1.183   3.993   1.00 74.88  ? 162  LEU A CD1   1 
ATOM   1225 C CD2   . LEU A 1 176 ? 39.075  1.411   1.534   1.00 74.09  ? 162  LEU A CD2   1 
ATOM   1226 N N     . ARG A 1 177 ? 33.788  2.193   0.499   1.00 71.19  ? 163  ARG A N     1 
ATOM   1227 C CA    . ARG A 1 177 ? 32.412  1.773   0.314   1.00 72.90  ? 163  ARG A CA    1 
ATOM   1228 C C     . ARG A 1 177 ? 32.350  1.013   -0.991  1.00 74.30  ? 163  ARG A C     1 
ATOM   1229 O O     . ARG A 1 177 ? 33.368  0.823   -1.643  1.00 74.18  ? 163  ARG A O     1 
ATOM   1230 C CB    . ARG A 1 177 ? 31.468  2.979   0.269   1.00 70.77  ? 163  ARG A CB    1 
ATOM   1231 C CG    . ARG A 1 177 ? 30.254  2.824   1.169   1.00 71.54  ? 163  ARG A CG    1 
ATOM   1232 C CD    . ARG A 1 177 ? 30.468  3.528   2.491   1.00 69.77  ? 163  ARG A CD    1 
ATOM   1233 N NE    . ARG A 1 177 ? 30.017  4.911   2.427   1.00 66.34  ? 163  ARG A NE    1 
ATOM   1234 C CZ    . ARG A 1 177 ? 30.210  5.813   3.383   1.00 64.37  ? 163  ARG A CZ    1 
ATOM   1235 N NH1   . ARG A 1 177 ? 30.853  5.505   4.507   1.00 64.67  ? 163  ARG A NH1   1 
ATOM   1236 N NH2   . ARG A 1 177 ? 29.763  7.042   3.205   1.00 62.23  ? 163  ARG A NH2   1 
ATOM   1237 O OXT   . ARG A 1 177 ? 31.297  0.579   -1.431  1.00 76.66  ? 163  ARG A OXT   1 
ATOM   1238 N N     . PRO B 1 19  ? 47.348  40.121  -4.573  1.00 103.56 ? 5    PRO B N     1 
ATOM   1239 C CA    . PRO B 1 19  ? 47.516  38.674  -4.358  1.00 96.30  ? 5    PRO B CA    1 
ATOM   1240 C C     . PRO B 1 19  ? 47.906  38.269  -2.929  1.00 91.15  ? 5    PRO B C     1 
ATOM   1241 O O     . PRO B 1 19  ? 49.009  38.586  -2.503  1.00 90.21  ? 5    PRO B O     1 
ATOM   1242 C CB    . PRO B 1 19  ? 48.661  38.306  -5.312  1.00 96.59  ? 5    PRO B CB    1 
ATOM   1243 C CG    . PRO B 1 19  ? 49.365  39.595  -5.591  1.00 102.69 ? 5    PRO B CG    1 
ATOM   1244 C CD    . PRO B 1 19  ? 48.285  40.638  -5.586  1.00 108.00 ? 5    PRO B CD    1 
ATOM   1245 N N     . ARG B 1 20  ? 47.009  37.579  -2.215  1.00 88.18  ? 6    ARG B N     1 
ATOM   1246 C CA    . ARG B 1 20  ? 47.313  36.955  -0.913  1.00 82.97  ? 6    ARG B CA    1 
ATOM   1247 C C     . ARG B 1 20  ? 47.851  35.537  -1.160  1.00 78.93  ? 6    ARG B C     1 
ATOM   1248 O O     . ARG B 1 20  ? 48.272  35.213  -2.276  1.00 79.28  ? 6    ARG B O     1 
ATOM   1249 C CB    . ARG B 1 20  ? 46.058  36.903  -0.032  1.00 80.83  ? 6    ARG B CB    1 
ATOM   1250 N N     . TRP B 1 21  ? 47.886  34.728  -0.102  1.00 75.11  ? 7    TRP B N     1 
ATOM   1251 C CA    . TRP B 1 21  ? 47.962  33.258  -0.184  1.00 71.78  ? 7    TRP B CA    1 
ATOM   1252 C C     . TRP B 1 21  ? 47.739  32.773  1.239   1.00 69.47  ? 7    TRP B C     1 
ATOM   1253 O O     . TRP B 1 21  ? 47.724  33.576  2.176   1.00 70.33  ? 7    TRP B O     1 
ATOM   1254 C CB    . TRP B 1 21  ? 49.343  32.785  -0.648  1.00 72.46  ? 7    TRP B CB    1 
ATOM   1255 C CG    . TRP B 1 21  ? 49.573  32.499  -2.164  1.00 75.40  ? 7    TRP B CG    1 
ATOM   1256 C CD1   . TRP B 1 21  ? 50.803  32.445  -2.774  1.00 77.24  ? 7    TRP B CD1   1 
ATOM   1257 C CD2   . TRP B 1 21  ? 48.598  32.298  -3.233  1.00 77.78  ? 7    TRP B CD2   1 
ATOM   1258 N NE1   . TRP B 1 21  ? 50.667  32.210  -4.123  1.00 79.92  ? 7    TRP B NE1   1 
ATOM   1259 C CE2   . TRP B 1 21  ? 49.333  32.120  -4.433  1.00 80.65  ? 7    TRP B CE2   1 
ATOM   1260 C CE3   . TRP B 1 21  ? 47.190  32.251  -3.297  1.00 78.38  ? 7    TRP B CE3   1 
ATOM   1261 C CZ2   . TRP B 1 21  ? 48.709  31.895  -5.676  1.00 83.32  ? 7    TRP B CZ2   1 
ATOM   1262 C CZ3   . TRP B 1 21  ? 46.576  32.026  -4.548  1.00 80.92  ? 7    TRP B CZ3   1 
ATOM   1263 C CH2   . TRP B 1 21  ? 47.336  31.855  -5.708  1.00 82.97  ? 7    TRP B CH2   1 
ATOM   1264 N N     . LEU B 1 22  ? 47.615  31.463  1.415   1.00 66.52  ? 8    LEU B N     1 
ATOM   1265 C CA    . LEU B 1 22  ? 47.503  30.874  2.760   1.00 64.12  ? 8    LEU B CA    1 
ATOM   1266 C C     . LEU B 1 22  ? 48.839  30.327  3.258   1.00 62.27  ? 8    LEU B C     1 
ATOM   1267 O O     . LEU B 1 22  ? 49.486  29.585  2.551   1.00 60.77  ? 8    LEU B O     1 
ATOM   1268 C CB    . LEU B 1 22  ? 46.484  29.734  2.750   1.00 62.84  ? 8    LEU B CB    1 
ATOM   1269 C CG    . LEU B 1 22  ? 45.117  30.009  3.359   1.00 63.32  ? 8    LEU B CG    1 
ATOM   1270 C CD1   . LEU B 1 22  ? 44.479  31.254  2.751   1.00 67.73  ? 8    LEU B CD1   1 
ATOM   1271 C CD2   . LEU B 1 22  ? 44.241  28.793  3.161   1.00 61.10  ? 8    LEU B CD2   1 
ATOM   1272 N N     . THR B 1 23  ? 49.231  30.665  4.483   1.00 62.59  ? 9    THR B N     1 
ATOM   1273 C CA    . THR B 1 23  ? 50.457  30.098  5.072   1.00 62.58  ? 9    THR B CA    1 
ATOM   1274 C C     . THR B 1 23  ? 50.252  28.607  5.209   1.00 61.36  ? 9    THR B C     1 
ATOM   1275 O O     . THR B 1 23  ? 49.126  28.127  5.144   1.00 61.19  ? 9    THR B O     1 
ATOM   1276 C CB    . THR B 1 23  ? 50.806  30.676  6.465   1.00 63.17  ? 9    THR B CB    1 
ATOM   1277 O OG1   . THR B 1 23  ? 49.892  30.170  7.451   1.00 64.29  ? 9    THR B OG1   1 
ATOM   1278 C CG2   . THR B 1 23  ? 50.787  32.203  6.453   1.00 64.47  ? 9    THR B CG2   1 
ATOM   1279 N N     . ALA B 1 24  ? 51.330  27.867  5.375   1.00 62.83  ? 10   ALA B N     1 
ATOM   1280 C CA    . ALA B 1 24  ? 51.212  26.429  5.553   1.00 65.62  ? 10   ALA B CA    1 
ATOM   1281 C C     . ALA B 1 24  ? 50.476  26.105  6.850   1.00 67.67  ? 10   ALA B C     1 
ATOM   1282 O O     . ALA B 1 24  ? 49.792  25.087  6.923   1.00 69.71  ? 10   ALA B O     1 
ATOM   1283 C CB    . ALA B 1 24  ? 52.581  25.767  5.542   1.00 66.74  ? 10   ALA B CB    1 
ATOM   1284 N N     . GLU B 1 25  ? 50.606  26.970  7.860   1.00 70.30  ? 11   GLU B N     1 
ATOM   1285 C CA    . GLU B 1 25  ? 49.940  26.739  9.152   1.00 71.78  ? 11   GLU B CA    1 
ATOM   1286 C C     . GLU B 1 25  ? 48.435  26.809  8.906   1.00 70.15  ? 11   GLU B C     1 
ATOM   1287 O O     . GLU B 1 25  ? 47.684  25.866  9.227   1.00 70.13  ? 11   GLU B O     1 
ATOM   1288 C CB    . GLU B 1 25  ? 50.400  27.741  10.244  1.00 73.08  ? 11   GLU B CB    1 
ATOM   1289 N N     . GLU B 1 26  ? 48.013  27.900  8.266   1.00 69.24  ? 12   GLU B N     1 
ATOM   1290 C CA    . GLU B 1 26  ? 46.599  28.117  7.926   1.00 67.71  ? 12   GLU B CA    1 
ATOM   1291 C C     . GLU B 1 26  ? 46.042  26.984  7.071   1.00 66.73  ? 12   GLU B C     1 
ATOM   1292 O O     . GLU B 1 26  ? 44.945  26.505  7.327   1.00 68.39  ? 12   GLU B O     1 
ATOM   1293 C CB    . GLU B 1 26  ? 46.435  29.442  7.184   1.00 68.02  ? 12   GLU B CB    1 
ATOM   1294 C CG    . GLU B 1 26  ? 46.662  30.677  8.051   1.00 72.30  ? 12   GLU B CG    1 
ATOM   1295 C CD    . GLU B 1 26  ? 46.726  31.980  7.251   1.00 73.38  ? 12   GLU B CD    1 
ATOM   1296 O OE1   . GLU B 1 26  ? 47.289  31.968  6.142   1.00 73.67  ? 12   GLU B OE1   1 
ATOM   1297 O OE2   . GLU B 1 26  ? 46.183  33.008  7.719   1.00 74.16  ? 12   GLU B OE2   1 
ATOM   1298 N N     . GLN B 1 27  ? 46.792  26.553  6.059   1.00 65.85  ? 13   GLN B N     1 
ATOM   1299 C CA    . GLN B 1 27  ? 46.395  25.410  5.237   1.00 66.77  ? 13   GLN B CA    1 
ATOM   1300 C C     . GLN B 1 27  ? 46.066  24.187  6.081   1.00 66.69  ? 13   GLN B C     1 
ATOM   1301 O O     . GLN B 1 27  ? 45.051  23.538  5.851   1.00 63.87  ? 13   GLN B O     1 
ATOM   1302 C CB    . GLN B 1 27  ? 47.489  25.045  4.237   1.00 69.52  ? 13   GLN B CB    1 
ATOM   1303 C CG    . GLN B 1 27  ? 47.444  25.874  2.969   1.00 70.53  ? 13   GLN B CG    1 
ATOM   1304 C CD    . GLN B 1 27  ? 48.635  25.596  2.064   1.00 73.99  ? 13   GLN B CD    1 
ATOM   1305 O OE1   . GLN B 1 27  ? 48.740  24.521  1.473   1.00 71.02  ? 13   GLN B OE1   1 
ATOM   1306 N NE2   . GLN B 1 27  ? 49.545  26.570  1.950   1.00 75.63  ? 13   GLN B NE2   1 
ATOM   1307 N N     . LEU B 1 28  ? 46.908  23.898  7.070   1.00 68.20  ? 14   LEU B N     1 
ATOM   1308 C CA    . LEU B 1 28  ? 46.671  22.755  7.938   1.00 70.84  ? 14   LEU B CA    1 
ATOM   1309 C C     . LEU B 1 28  ? 45.367  22.903  8.701   1.00 70.74  ? 14   LEU B C     1 
ATOM   1310 O O     . LEU B 1 28  ? 44.638  21.947  8.835   1.00 73.58  ? 14   LEU B O     1 
ATOM   1311 C CB    . LEU B 1 28  ? 47.815  22.522  8.925   1.00 73.94  ? 14   LEU B CB    1 
ATOM   1312 C CG    . LEU B 1 28  ? 48.719  21.337  8.595   1.00 77.84  ? 14   LEU B CG    1 
ATOM   1313 C CD1   . LEU B 1 28  ? 49.433  21.565  7.273   1.00 75.42  ? 14   LEU B CD1   1 
ATOM   1314 C CD2   . LEU B 1 28  ? 49.700  21.053  9.731   1.00 81.72  ? 14   LEU B CD2   1 
ATOM   1315 N N     . VAL B 1 29  ? 45.081  24.100  9.196   1.00 70.30  ? 15   VAL B N     1 
ATOM   1316 C CA    . VAL B 1 29  ? 43.834  24.354  9.914   1.00 70.33  ? 15   VAL B CA    1 
ATOM   1317 C C     . VAL B 1 29  ? 42.642  24.140  8.977   1.00 69.71  ? 15   VAL B C     1 
ATOM   1318 O O     . VAL B 1 29  ? 41.739  23.351  9.266   1.00 71.35  ? 15   VAL B O     1 
ATOM   1319 C CB    . VAL B 1 29  ? 43.801  25.794  10.481  1.00 70.04  ? 15   VAL B CB    1 
ATOM   1320 C CG1   . VAL B 1 29  ? 42.410  26.153  10.980  1.00 71.01  ? 15   VAL B CG1   1 
ATOM   1321 C CG2   . VAL B 1 29  ? 44.818  25.947  11.598  1.00 71.51  ? 15   VAL B CG2   1 
ATOM   1322 N N     . TRP B 1 30  ? 42.662  24.843  7.850   1.00 66.48  ? 16   TRP B N     1 
ATOM   1323 C CA    . TRP B 1 30  ? 41.591  24.764  6.863   1.00 64.97  ? 16   TRP B CA    1 
ATOM   1324 C C     . TRP B 1 30  ? 41.376  23.348  6.367   1.00 65.05  ? 16   TRP B C     1 
ATOM   1325 O O     . TRP B 1 30  ? 40.251  22.874  6.301   1.00 67.55  ? 16   TRP B O     1 
ATOM   1326 C CB    . TRP B 1 30  ? 41.922  25.676  5.690   1.00 63.98  ? 16   TRP B CB    1 
ATOM   1327 C CG    . TRP B 1 30  ? 40.891  25.723  4.628   1.00 64.51  ? 16   TRP B CG    1 
ATOM   1328 C CD1   . TRP B 1 30  ? 41.061  25.416  3.299   1.00 64.85  ? 16   TRP B CD1   1 
ATOM   1329 C CD2   . TRP B 1 30  ? 39.527  26.118  4.779   1.00 64.89  ? 16   TRP B CD2   1 
ATOM   1330 N NE1   . TRP B 1 30  ? 39.877  25.597  2.622   1.00 66.14  ? 16   TRP B NE1   1 
ATOM   1331 C CE2   . TRP B 1 30  ? 38.920  26.030  3.506   1.00 65.61  ? 16   TRP B CE2   1 
ATOM   1332 C CE3   . TRP B 1 30  ? 38.760  26.550  5.860   1.00 65.71  ? 16   TRP B CE3   1 
ATOM   1333 C CZ2   . TRP B 1 30  ? 37.574  26.351  3.292   1.00 65.60  ? 16   TRP B CZ2   1 
ATOM   1334 C CZ3   . TRP B 1 30  ? 37.423  26.873  5.641   1.00 67.26  ? 16   TRP B CZ3   1 
ATOM   1335 C CH2   . TRP B 1 30  ? 36.847  26.764  4.365   1.00 66.69  ? 16   TRP B CH2   1 
ATOM   1336 N N     . ARG B 1 31  ? 42.458  22.667  6.020   1.00 66.23  ? 17   ARG B N     1 
ATOM   1337 C CA    . ARG B 1 31  ? 42.356  21.315  5.487   1.00 68.29  ? 17   ARG B CA    1 
ATOM   1338 C C     . ARG B 1 31  ? 41.647  20.444  6.543   1.00 68.68  ? 17   ARG B C     1 
ATOM   1339 O O     . ARG B 1 31  ? 40.655  19.773  6.224   1.00 68.47  ? 17   ARG B O     1 
ATOM   1340 C CB    . ARG B 1 31  ? 43.715  20.786  4.928   1.00 71.13  ? 17   ARG B CB    1 
ATOM   1341 C CG    . ARG B 1 31  ? 43.962  19.320  5.118   1.00 74.74  ? 17   ARG B CG    1 
ATOM   1342 C CD    . ARG B 1 31  ? 42.919  18.358  4.528   1.00 76.46  ? 17   ARG B CD    1 
ATOM   1343 N NE    . ARG B 1 31  ? 43.494  17.030  4.266   1.00 81.07  ? 17   ARG B NE    1 
ATOM   1344 C CZ    . ARG B 1 31  ? 42.803  15.975  3.829   1.00 83.90  ? 17   ARG B CZ    1 
ATOM   1345 N NH1   . ARG B 1 31  ? 41.499  16.076  3.577   1.00 83.01  ? 17   ARG B NH1   1 
ATOM   1346 N NH2   . ARG B 1 31  ? 43.426  14.814  3.633   1.00 87.58  ? 17   ARG B NH2   1 
ATOM   1347 N N     . SER B 1 32  ? 42.076  20.515  7.805   1.00 68.97  ? 18   SER B N     1 
ATOM   1348 C CA    . SER B 1 32  ? 41.482  19.658  8.829   1.00 72.96  ? 18   SER B CA    1 
ATOM   1349 C C     . SER B 1 32  ? 40.023  20.026  9.115   1.00 71.03  ? 18   SER B C     1 
ATOM   1350 O O     . SER B 1 32  ? 39.215  19.150  9.441   1.00 74.12  ? 18   SER B O     1 
ATOM   1351 C CB    . SER B 1 32  ? 42.328  19.635  10.104  1.00 76.21  ? 18   SER B CB    1 
ATOM   1352 O OG    . SER B 1 32  ? 42.364  20.908  10.722  1.00 78.37  ? 18   SER B OG    1 
ATOM   1353 N N     . TYR B 1 33  ? 39.670  21.294  8.953   1.00 64.50  ? 19   TYR B N     1 
ATOM   1354 C CA    . TYR B 1 33  ? 38.262  21.663  8.970   1.00 64.24  ? 19   TYR B CA    1 
ATOM   1355 C C     . TYR B 1 33  ? 37.505  20.934  7.863   1.00 62.37  ? 19   TYR B C     1 
ATOM   1356 O O     . TYR B 1 33  ? 36.519  20.246  8.136   1.00 62.26  ? 19   TYR B O     1 
ATOM   1357 C CB    . TYR B 1 33  ? 38.044  23.170  8.824   1.00 67.52  ? 19   TYR B CB    1 
ATOM   1358 C CG    . TYR B 1 33  ? 36.574  23.498  8.666   1.00 68.83  ? 19   TYR B CG    1 
ATOM   1359 C CD1   . TYR B 1 33  ? 35.720  23.526  9.767   1.00 69.76  ? 19   TYR B CD1   1 
ATOM   1360 C CD2   . TYR B 1 33  ? 36.029  23.748  7.411   1.00 70.35  ? 19   TYR B CD2   1 
ATOM   1361 C CE1   . TYR B 1 33  ? 34.360  23.809  9.626   1.00 70.38  ? 19   TYR B CE1   1 
ATOM   1362 C CE2   . TYR B 1 33  ? 34.676  24.031  7.253   1.00 71.30  ? 19   TYR B CE2   1 
ATOM   1363 C CZ    . TYR B 1 33  ? 33.842  24.063  8.362   1.00 71.18  ? 19   TYR B CZ    1 
ATOM   1364 O OH    . TYR B 1 33  ? 32.503  24.343  8.206   1.00 68.75  ? 19   TYR B OH    1 
ATOM   1365 N N     . ILE B 1 34  ? 37.955  21.096  6.618   1.00 60.95  ? 20   ILE B N     1 
ATOM   1366 C CA    . ILE B 1 34  ? 37.268  20.502  5.473   1.00 59.49  ? 20   ILE B CA    1 
ATOM   1367 C C     . ILE B 1 34  ? 37.021  19.011  5.691   1.00 55.73  ? 20   ILE B C     1 
ATOM   1368 O O     . ILE B 1 34  ? 35.916  18.532  5.470   1.00 52.27  ? 20   ILE B O     1 
ATOM   1369 C CB    . ILE B 1 34  ? 38.045  20.687  4.148   1.00 62.84  ? 20   ILE B CB    1 
ATOM   1370 C CG1   . ILE B 1 34  ? 38.272  22.163  3.820   1.00 66.72  ? 20   ILE B CG1   1 
ATOM   1371 C CG2   . ILE B 1 34  ? 37.289  20.049  2.985   1.00 63.10  ? 20   ILE B CG2   1 
ATOM   1372 C CD1   . ILE B 1 34  ? 36.998  22.967  3.672   1.00 68.23  ? 20   ILE B CD1   1 
ATOM   1373 N N     . GLU B 1 35  ? 38.051  18.283  6.112   1.00 55.54  ? 21   GLU B N     1 
ATOM   1374 C CA    . GLU B 1 35  ? 37.937  16.839  6.298   1.00 54.81  ? 21   GLU B CA    1 
ATOM   1375 C C     . GLU B 1 35  ? 36.898  16.510  7.313   1.00 55.69  ? 21   GLU B C     1 
ATOM   1376 O O     . GLU B 1 35  ? 35.972  15.726  7.072   1.00 57.63  ? 21   GLU B O     1 
ATOM   1377 C CB    . GLU B 1 35  ? 39.243  16.261  6.795   1.00 55.16  ? 21   GLU B CB    1 
ATOM   1378 N N     . ALA B 1 36  ? 37.055  17.120  8.474   1.00 57.48  ? 22   ALA B N     1 
ATOM   1379 C CA    . ALA B 1 36  ? 36.158  16.867  9.585   1.00 54.65  ? 22   ALA B CA    1 
ATOM   1380 C C     . ALA B 1 36  ? 34.732  17.055  9.138   1.00 51.94  ? 22   ALA B C     1 
ATOM   1381 O O     . ALA B 1 36  ? 33.893  16.156  9.301   1.00 51.39  ? 22   ALA B O     1 
ATOM   1382 C CB    . ALA B 1 36  ? 36.488  17.809  10.729  1.00 56.80  ? 22   ALA B CB    1 
ATOM   1383 N N     . ALA B 1 37  ? 34.452  18.232  8.584   1.00 51.39  ? 23   ALA B N     1 
ATOM   1384 C CA    . ALA B 1 37  ? 33.090  18.563  8.160   1.00 51.24  ? 23   ALA B CA    1 
ATOM   1385 C C     . ALA B 1 37  ? 32.561  17.557  7.152   1.00 50.40  ? 23   ALA B C     1 
ATOM   1386 O O     . ALA B 1 37  ? 31.411  17.102  7.261   1.00 51.76  ? 23   ALA B O     1 
ATOM   1387 C CB    . ALA B 1 37  ? 33.030  19.951  7.575   1.00 52.70  ? 23   ALA B CB    1 
ATOM   1388 N N     . THR B 1 38  ? 33.388  17.197  6.176   1.00 49.49  ? 24   THR B N     1 
ATOM   1389 C CA    . THR B 1 38  ? 32.954  16.273  5.141   1.00 48.92  ? 24   THR B CA    1 
ATOM   1390 C C     . THR B 1 38  ? 32.701  14.892  5.727   1.00 48.59  ? 24   THR B C     1 
ATOM   1391 O O     . THR B 1 38  ? 31.808  14.183  5.258   1.00 50.22  ? 24   THR B O     1 
ATOM   1392 C CB    . THR B 1 38  ? 33.979  16.179  3.982   1.00 50.05  ? 24   THR B CB    1 
ATOM   1393 O OG1   . THR B 1 38  ? 34.299  17.495  3.508   1.00 50.95  ? 24   THR B OG1   1 
ATOM   1394 C CG2   . THR B 1 38  ? 33.429  15.341  2.825   1.00 49.24  ? 24   THR B CG2   1 
ATOM   1395 N N     . LEU B 1 39  ? 33.479  14.511  6.747   1.00 48.88  ? 25   LEU B N     1 
ATOM   1396 C CA    . LEU B 1 39  ? 33.325  13.205  7.395   1.00 48.66  ? 25   LEU B CA    1 
ATOM   1397 C C     . LEU B 1 39  ? 32.136  13.194  8.340   1.00 49.67  ? 25   LEU B C     1 
ATOM   1398 O O     . LEU B 1 39  ? 31.428  12.181  8.430   1.00 52.74  ? 25   LEU B O     1 
ATOM   1399 C CB    . LEU B 1 39  ? 34.588  12.805  8.157   1.00 49.20  ? 25   LEU B CB    1 
ATOM   1400 C CG    . LEU B 1 39  ? 35.837  12.409  7.348   1.00 49.31  ? 25   LEU B CG    1 
ATOM   1401 C CD1   . LEU B 1 39  ? 37.048  12.416  8.253   1.00 49.78  ? 25   LEU B CD1   1 
ATOM   1402 C CD2   . LEU B 1 39  ? 35.686  11.045  6.678   1.00 48.94  ? 25   LEU B CD2   1 
ATOM   1403 N N     . LEU B 1 40  ? 31.911  14.291  9.062   1.00 50.30  ? 26   LEU B N     1 
ATOM   1404 C CA    . LEU B 1 40  ? 30.714  14.393  9.924   1.00 51.96  ? 26   LEU B CA    1 
ATOM   1405 C C     . LEU B 1 40  ? 29.398  14.322  9.141   1.00 51.03  ? 26   LEU B C     1 
ATOM   1406 O O     . LEU B 1 40  ? 28.547  13.508  9.432   1.00 52.21  ? 26   LEU B O     1 
ATOM   1407 C CB    . LEU B 1 40  ? 30.734  15.688  10.733  1.00 53.47  ? 26   LEU B CB    1 
ATOM   1408 C CG    . LEU B 1 40  ? 31.030  15.570  12.232  1.00 54.07  ? 26   LEU B CG    1 
ATOM   1409 C CD1   . LEU B 1 40  ? 31.009  16.963  12.849  1.00 55.54  ? 26   LEU B CD1   1 
ATOM   1410 C CD2   . LEU B 1 40  ? 30.039  14.658  12.931  1.00 53.80  ? 26   LEU B CD2   1 
ATOM   1411 N N     . GLU B 1 41  ? 29.255  15.165  8.131   1.00 51.05  ? 27   GLU B N     1 
ATOM   1412 C CA    . GLU B 1 41  ? 28.082  15.146  7.295   1.00 50.58  ? 27   GLU B CA    1 
ATOM   1413 C C     . GLU B 1 41  ? 27.841  13.737  6.762   1.00 50.49  ? 27   GLU B C     1 
ATOM   1414 O O     . GLU B 1 41  ? 26.700  13.273  6.700   1.00 50.10  ? 27   GLU B O     1 
ATOM   1415 C CB    . GLU B 1 41  ? 28.275  16.116  6.120   1.00 51.55  ? 27   GLU B CB    1 
ATOM   1416 N N     . ASP B 1 42  ? 28.916  13.051  6.385   1.00 50.32  ? 28   ASP B N     1 
ATOM   1417 C CA    . ASP B 1 42  ? 28.796  11.698  5.886   1.00 50.69  ? 28   ASP B CA    1 
ATOM   1418 C C     . ASP B 1 42  ? 28.325  10.733  6.985   1.00 51.96  ? 28   ASP B C     1 
ATOM   1419 O O     . ASP B 1 42  ? 27.430  9.911   6.772   1.00 54.46  ? 28   ASP B O     1 
ATOM   1420 C CB    . ASP B 1 42  ? 30.139  11.239  5.335   1.00 50.68  ? 28   ASP B CB    1 
ATOM   1421 C CG    . ASP B 1 42  ? 30.075  9.840   4.771   1.00 51.60  ? 28   ASP B CG    1 
ATOM   1422 O OD1   . ASP B 1 42  ? 30.287  8.875   5.537   1.00 51.15  ? 28   ASP B OD1   1 
ATOM   1423 O OD2   . ASP B 1 42  ? 29.802  9.699   3.561   1.00 51.27  ? 28   ASP B OD2   1 
ATOM   1424 N N     . HIS B 1 43  ? 28.955  10.820  8.151   1.00 51.43  ? 29   HIS B N     1 
ATOM   1425 C CA    . HIS B 1 43  ? 28.665  9.922   9.240   1.00 52.66  ? 29   HIS B CA    1 
ATOM   1426 C C     . HIS B 1 43  ? 27.218  10.116  9.702   1.00 52.82  ? 29   HIS B C     1 
ATOM   1427 O O     . HIS B 1 43  ? 26.488  9.136   9.953   1.00 54.41  ? 29   HIS B O     1 
ATOM   1428 C CB    . HIS B 1 43  ? 29.660  10.162  10.389  1.00 54.35  ? 29   HIS B CB    1 
ATOM   1429 C CG    . HIS B 1 43  ? 29.416  9.310   11.598  1.00 56.34  ? 29   HIS B CG    1 
ATOM   1430 N ND1   . HIS B 1 43  ? 29.334  7.938   11.536  1.00 57.82  ? 29   HIS B ND1   1 
ATOM   1431 C CD2   . HIS B 1 43  ? 29.232  9.640   12.899  1.00 59.33  ? 29   HIS B CD2   1 
ATOM   1432 C CE1   . HIS B 1 43  ? 29.094  7.458   12.744  1.00 61.47  ? 29   HIS B CE1   1 
ATOM   1433 N NE2   . HIS B 1 43  ? 29.031  8.469   13.593  1.00 62.10  ? 29   HIS B NE2   1 
ATOM   1434 N N     . LEU B 1 44  ? 26.790  11.374  9.788   1.00 50.92  ? 30   LEU B N     1 
ATOM   1435 C CA    . LEU B 1 44  ? 25.457  11.688  10.311  1.00 51.82  ? 30   LEU B CA    1 
ATOM   1436 C C     . LEU B 1 44  ? 24.339  11.407  9.308   1.00 50.58  ? 30   LEU B C     1 
ATOM   1437 O O     . LEU B 1 44  ? 23.327  10.809  9.663   1.00 51.09  ? 30   LEU B O     1 
ATOM   1438 C CB    . LEU B 1 44  ? 25.409  13.142  10.794  1.00 52.46  ? 30   LEU B CB    1 
ATOM   1439 C CG    . LEU B 1 44  ? 26.403  13.452  11.935  1.00 53.27  ? 30   LEU B CG    1 
ATOM   1440 C CD1   . LEU B 1 44  ? 26.150  14.836  12.508  1.00 53.84  ? 30   LEU B CD1   1 
ATOM   1441 C CD2   . LEU B 1 44  ? 26.332  12.404  13.040  1.00 53.96  ? 30   LEU B CD2   1 
ATOM   1442 N N     . ASP B 1 45  ? 24.533  11.828  8.062   1.00 49.76  ? 31   ASP B N     1 
ATOM   1443 C CA    . ASP B 1 45  ? 23.632  11.454  6.970   1.00 49.19  ? 31   ASP B CA    1 
ATOM   1444 C C     . ASP B 1 45  ? 23.386  9.986   6.954   1.00 48.07  ? 31   ASP B C     1 
ATOM   1445 O O     . ASP B 1 45  ? 22.254  9.553   6.806   1.00 48.89  ? 31   ASP B O     1 
ATOM   1446 C CB    . ASP B 1 45  ? 24.210  11.836  5.605   1.00 49.40  ? 31   ASP B CB    1 
ATOM   1447 C CG    . ASP B 1 45  ? 23.877  13.261  5.185   1.00 49.36  ? 31   ASP B CG    1 
ATOM   1448 O OD1   . ASP B 1 45  ? 23.097  13.962  5.880   1.00 48.04  ? 31   ASP B OD1   1 
ATOM   1449 O OD2   . ASP B 1 45  ? 24.395  13.657  4.108   1.00 50.37  ? 31   ASP B OD2   1 
ATOM   1450 N N     . ARG B 1 46  ? 24.436  9.198   7.114   1.00 49.45  ? 32   ARG B N     1 
ATOM   1451 C CA    . ARG B 1 46  ? 24.268  7.725   7.080   1.00 52.00  ? 32   ARG B CA    1 
ATOM   1452 C C     . ARG B 1 46  ? 23.528  7.169   8.292   1.00 52.67  ? 32   ARG B C     1 
ATOM   1453 O O     . ARG B 1 46  ? 22.653  6.321   8.163   1.00 53.94  ? 32   ARG B O     1 
ATOM   1454 C CB    . ARG B 1 46  ? 25.607  7.033   6.959   1.00 52.14  ? 32   ARG B CB    1 
ATOM   1455 C CG    . ARG B 1 46  ? 26.253  7.215   5.588   1.00 52.23  ? 32   ARG B CG    1 
ATOM   1456 C CD    . ARG B 1 46  ? 27.063  5.996   5.210   1.00 53.29  ? 32   ARG B CD    1 
ATOM   1457 N NE    . ARG B 1 46  ? 26.303  5.229   4.224   1.00 54.05  ? 32   ARG B NE    1 
ATOM   1458 C CZ    . ARG B 1 46  ? 26.574  3.977   3.901   1.00 56.36  ? 32   ARG B CZ    1 
ATOM   1459 N NH1   . ARG B 1 46  ? 27.571  3.329   4.495   1.00 57.50  ? 32   ARG B NH1   1 
ATOM   1460 N NH2   . ARG B 1 46  ? 25.843  3.370   2.990   1.00 58.16  ? 32   ARG B NH2   1 
ATOM   1461 N N     . GLN B 1 47  ? 23.908  7.642   9.465   1.00 53.05  ? 33   GLN B N     1 
ATOM   1462 C CA    . GLN B 1 47  ? 23.242  7.266   10.685  1.00 55.02  ? 33   GLN B CA    1 
ATOM   1463 C C     . GLN B 1 47  ? 21.744  7.568   10.573  1.00 55.84  ? 33   GLN B C     1 
ATOM   1464 O O     . GLN B 1 47  ? 20.895  6.736   10.920  1.00 58.23  ? 33   GLN B O     1 
ATOM   1465 C CB    . GLN B 1 47  ? 23.886  8.010   11.846  1.00 55.49  ? 33   GLN B CB    1 
ATOM   1466 C CG    . GLN B 1 47  ? 23.329  7.662   13.213  1.00 58.04  ? 33   GLN B CG    1 
ATOM   1467 C CD    . GLN B 1 47  ? 22.228  8.604   13.652  1.00 57.40  ? 33   GLN B CD    1 
ATOM   1468 O OE1   . GLN B 1 47  ? 22.368  9.822   13.538  1.00 56.49  ? 33   GLN B OE1   1 
ATOM   1469 N NE2   . GLN B 1 47  ? 21.123  8.049   14.142  1.00 59.01  ? 33   GLN B NE2   1 
ATOM   1470 N N     . LEU B 1 48  ? 21.408  8.737   10.048  1.00 53.83  ? 34   LEU B N     1 
ATOM   1471 C CA    . LEU B 1 48  ? 20.007  9.113   9.943   1.00 54.78  ? 34   LEU B CA    1 
ATOM   1472 C C     . LEU B 1 48  ? 19.283  8.440   8.789   1.00 55.53  ? 34   LEU B C     1 
ATOM   1473 O O     . LEU B 1 48  ? 18.073  8.242   8.854   1.00 57.94  ? 34   LEU B O     1 
ATOM   1474 C CB    . LEU B 1 48  ? 19.865  10.630  9.854   1.00 54.00  ? 34   LEU B CB    1 
ATOM   1475 C CG    . LEU B 1 48  ? 20.103  11.288  11.209  1.00 55.81  ? 34   LEU B CG    1 
ATOM   1476 C CD1   . LEU B 1 48  ? 20.482  12.753  11.049  1.00 55.20  ? 34   LEU B CD1   1 
ATOM   1477 C CD2   . LEU B 1 48  ? 18.881  11.136  12.104  1.00 57.49  ? 34   LEU B CD2   1 
ATOM   1478 N N     . GLN B 1 49  ? 19.992  8.132   7.715   1.00 55.79  ? 35   GLN B N     1 
ATOM   1479 C CA    . GLN B 1 49  ? 19.352  7.482   6.574   1.00 57.42  ? 35   GLN B CA    1 
ATOM   1480 C C     . GLN B 1 49  ? 18.936  6.051   6.930   1.00 59.40  ? 35   GLN B C     1 
ATOM   1481 O O     . GLN B 1 49  ? 17.892  5.588   6.476   1.00 60.69  ? 35   GLN B O     1 
ATOM   1482 C CB    . GLN B 1 49  ? 20.238  7.519   5.316   1.00 57.47  ? 35   GLN B CB    1 
ATOM   1483 C CG    . GLN B 1 49  ? 19.437  7.536   4.011   1.00 59.17  ? 35   GLN B CG    1 
ATOM   1484 C CD    . GLN B 1 49  ? 18.692  8.851   3.758   1.00 60.01  ? 35   GLN B CD    1 
ATOM   1485 O OE1   . GLN B 1 49  ? 19.288  9.860   3.418   1.00 59.23  ? 35   GLN B OE1   1 
ATOM   1486 N NE2   . GLN B 1 49  ? 17.363  8.824   3.902   1.00 62.56  ? 35   GLN B NE2   1 
ATOM   1487 N N     . ARG B 1 50  ? 19.731  5.353   7.736   1.00 61.68  ? 36   ARG B N     1 
ATOM   1488 C CA    . ARG B 1 50  ? 19.362  3.975   8.123   1.00 66.07  ? 36   ARG B CA    1 
ATOM   1489 C C     . ARG B 1 50  ? 18.381  3.940   9.286   1.00 65.65  ? 36   ARG B C     1 
ATOM   1490 O O     . ARG B 1 50  ? 17.358  3.292   9.193   1.00 67.97  ? 36   ARG B O     1 
ATOM   1491 C CB    . ARG B 1 50  ? 20.579  3.032   8.362   1.00 68.79  ? 36   ARG B CB    1 
ATOM   1492 C CG    . ARG B 1 50  ? 21.755  3.561   9.163   1.00 68.57  ? 36   ARG B CG    1 
ATOM   1493 C CD    . ARG B 1 50  ? 22.699  2.444   9.585   1.00 73.23  ? 36   ARG B CD    1 
ATOM   1494 N NE    . ARG B 1 50  ? 23.926  2.930   10.257  1.00 73.77  ? 36   ARG B NE    1 
ATOM   1495 C CZ    . ARG B 1 50  ? 24.037  3.241   11.557  1.00 74.04  ? 36   ARG B CZ    1 
ATOM   1496 N NH1   . ARG B 1 50  ? 23.001  3.153   12.386  1.00 74.35  ? 36   ARG B NH1   1 
ATOM   1497 N NH2   . ARG B 1 50  ? 25.204  3.661   12.034  1.00 74.72  ? 36   ARG B NH2   1 
ATOM   1498 N N     . ASP B 1 51  ? 18.670  4.681   10.349  1.00 65.61  ? 37   ASP B N     1 
ATOM   1499 C CA    . ASP B 1 51  ? 17.863  4.628   11.584  1.00 66.41  ? 37   ASP B CA    1 
ATOM   1500 C C     . ASP B 1 51  ? 16.553  5.416   11.525  1.00 65.38  ? 37   ASP B C     1 
ATOM   1501 O O     . ASP B 1 51  ? 15.697  5.247   12.375  1.00 68.14  ? 37   ASP B O     1 
ATOM   1502 C CB    . ASP B 1 51  ? 18.700  5.130   12.776  1.00 66.71  ? 37   ASP B CB    1 
ATOM   1503 C CG    . ASP B 1 51  ? 19.985  4.323   12.977  1.00 68.52  ? 37   ASP B CG    1 
ATOM   1504 O OD1   . ASP B 1 51  ? 20.148  3.264   12.323  1.00 69.51  ? 37   ASP B OD1   1 
ATOM   1505 O OD2   . ASP B 1 51  ? 20.835  4.738   13.795  1.00 68.16  ? 37   ASP B OD2   1 
ATOM   1506 N N     . ALA B 1 52  ? 16.417  6.315   10.553  1.00 65.17  ? 38   ALA B N     1 
ATOM   1507 C CA    . ALA B 1 52  ? 15.263  7.224   10.477  1.00 64.04  ? 38   ALA B CA    1 
ATOM   1508 C C     . ALA B 1 52  ? 14.744  7.510   9.064   1.00 62.79  ? 38   ALA B C     1 
ATOM   1509 O O     . ALA B 1 52  ? 13.720  8.183   8.913   1.00 63.38  ? 38   ALA B O     1 
ATOM   1510 C CB    . ALA B 1 52  ? 15.592  8.541   11.174  1.00 63.20  ? 38   ALA B CB    1 
ATOM   1511 N N     . GLY B 1 53  ? 15.432  7.017   8.042   1.00 62.16  ? 39   GLY B N     1 
ATOM   1512 C CA    . GLY B 1 53  ? 14.932  7.112   6.679   1.00 62.81  ? 39   GLY B CA    1 
ATOM   1513 C C     . GLY B 1 53  ? 14.987  8.487   6.047   1.00 62.05  ? 39   GLY B C     1 
ATOM   1514 O O     . GLY B 1 53  ? 14.213  8.764   5.133   1.00 64.02  ? 39   GLY B O     1 
ATOM   1515 N N     . MET B 1 54  ? 15.879  9.356   6.519   1.00 60.80  ? 40   MET B N     1 
ATOM   1516 C CA    . MET B 1 54  ? 16.014  10.692  5.932   1.00 59.53  ? 40   MET B CA    1 
ATOM   1517 C C     . MET B 1 54  ? 17.388  11.279  6.191   1.00 58.44  ? 40   MET B C     1 
ATOM   1518 O O     . MET B 1 54  ? 18.041  10.905  7.162   1.00 59.51  ? 40   MET B O     1 
ATOM   1519 C CB    . MET B 1 54  ? 14.947  11.631  6.483   1.00 60.30  ? 40   MET B CB    1 
ATOM   1520 C CG    . MET B 1 54  ? 15.201  12.143  7.882   1.00 60.91  ? 40   MET B CG    1 
ATOM   1521 S SD    . MET B 1 54  ? 13.724  13.024  8.453   1.00 61.30  ? 40   MET B SD    1 
ATOM   1522 C CE    . MET B 1 54  ? 13.707  12.523  10.153  1.00 61.28  ? 40   MET B CE    1 
ATOM   1523 N N     . PRO B 1 55  ? 17.823  12.217  5.335   1.00 55.39  ? 41   PRO B N     1 
ATOM   1524 C CA    . PRO B 1 55  ? 19.137  12.834  5.483   1.00 53.83  ? 41   PRO B CA    1 
ATOM   1525 C C     . PRO B 1 55  ? 19.198  13.852  6.617   1.00 53.55  ? 41   PRO B C     1 
ATOM   1526 O O     . PRO B 1 55  ? 18.177  14.213  7.166   1.00 54.90  ? 41   PRO B O     1 
ATOM   1527 C CB    . PRO B 1 55  ? 19.332  13.526  4.144   1.00 54.28  ? 41   PRO B CB    1 
ATOM   1528 C CG    . PRO B 1 55  ? 17.950  13.905  3.749   1.00 55.57  ? 41   PRO B CG    1 
ATOM   1529 C CD    . PRO B 1 55  ? 17.079  12.779  4.198   1.00 54.92  ? 41   PRO B CD    1 
ATOM   1530 N N     . HIS B 1 56  ? 20.396  14.312  6.962   1.00 53.52  ? 42   HIS B N     1 
ATOM   1531 C CA    . HIS B 1 56  ? 20.563  15.176  8.117   1.00 53.07  ? 42   HIS B CA    1 
ATOM   1532 C C     . HIS B 1 56  ? 19.785  16.487  8.006   1.00 54.55  ? 42   HIS B C     1 
ATOM   1533 O O     . HIS B 1 56  ? 19.236  16.959  8.984   1.00 55.92  ? 42   HIS B O     1 
ATOM   1534 C CB    . HIS B 1 56  ? 22.042  15.460  8.377   1.00 53.35  ? 42   HIS B CB    1 
ATOM   1535 C CG    . HIS B 1 56  ? 22.299  16.177  9.659   1.00 54.91  ? 42   HIS B CG    1 
ATOM   1536 N ND1   . HIS B 1 56  ? 23.313  17.092  9.805   1.00 57.50  ? 42   HIS B ND1   1 
ATOM   1537 C CD2   . HIS B 1 56  ? 21.669  16.122  10.857  1.00 58.62  ? 42   HIS B CD2   1 
ATOM   1538 C CE1   . HIS B 1 56  ? 23.288  17.586  11.034  1.00 60.56  ? 42   HIS B CE1   1 
ATOM   1539 N NE2   . HIS B 1 56  ? 22.297  17.014  11.694  1.00 60.95  ? 42   HIS B NE2   1 
ATOM   1540 N N     . VAL B 1 57  ? 19.744  17.089  6.828   1.00 56.65  ? 43   VAL B N     1 
ATOM   1541 C CA    . VAL B 1 57  ? 19.137  18.417  6.691   1.00 58.64  ? 43   VAL B CA    1 
ATOM   1542 C C     . VAL B 1 57  ? 17.634  18.342  6.973   1.00 59.64  ? 43   VAL B C     1 
ATOM   1543 O O     . VAL B 1 57  ? 17.098  19.195  7.690   1.00 61.65  ? 43   VAL B O     1 
ATOM   1544 C CB    . VAL B 1 57  ? 19.341  19.028  5.296   1.00 59.58  ? 43   VAL B CB    1 
ATOM   1545 C CG1   . VAL B 1 57  ? 18.907  20.491  5.304   1.00 62.77  ? 43   VAL B CG1   1 
ATOM   1546 C CG2   . VAL B 1 57  ? 20.789  18.901  4.868   1.00 59.80  ? 43   VAL B CG2   1 
ATOM   1547 N N     . TYR B 1 58  ? 16.983  17.322  6.414   1.00 45.88  ? 44   TYR B N     1 
ATOM   1548 C CA    . TYR B 1 58  ? 15.569  17.064  6.657   1.00 47.72  ? 44   TYR B CA    1 
ATOM   1549 C C     . TYR B 1 58  ? 15.265  16.884  8.152   1.00 48.70  ? 44   TYR B C     1 
ATOM   1550 O O     . TYR B 1 58  ? 14.458  17.610  8.721   1.00 50.04  ? 44   TYR B O     1 
ATOM   1551 C CB    . TYR B 1 58  ? 15.127  15.810  5.891   1.00 49.20  ? 44   TYR B CB    1 
ATOM   1552 C CG    . TYR B 1 58  ? 15.006  15.983  4.388   1.00 48.68  ? 44   TYR B CG    1 
ATOM   1553 C CD1   . TYR B 1 58  ? 15.637  17.022  3.722   1.00 50.32  ? 44   TYR B CD1   1 
ATOM   1554 C CD2   . TYR B 1 58  ? 14.256  15.107  3.646   1.00 49.99  ? 44   TYR B CD2   1 
ATOM   1555 C CE1   . TYR B 1 58  ? 15.520  17.178  2.351   1.00 51.20  ? 44   TYR B CE1   1 
ATOM   1556 C CE2   . TYR B 1 58  ? 14.152  15.236  2.281   1.00 51.49  ? 44   TYR B CE2   1 
ATOM   1557 C CZ    . TYR B 1 58  ? 14.779  16.268  1.638   1.00 51.46  ? 44   TYR B CZ    1 
ATOM   1558 O OH    . TYR B 1 58  ? 14.653  16.401  0.272   1.00 52.97  ? 44   TYR B OH    1 
ATOM   1559 N N     . TYR B 1 59  ? 15.933  15.930  8.786   1.00 50.28  ? 45   TYR B N     1 
ATOM   1560 C CA    . TYR B 1 59  ? 15.831  15.749  10.230  1.00 52.60  ? 45   TYR B CA    1 
ATOM   1561 C C     . TYR B 1 59  ? 15.867  17.092  10.990  1.00 51.16  ? 45   TYR B C     1 
ATOM   1562 O O     . TYR B 1 59  ? 15.060  17.317  11.908  1.00 47.67  ? 45   TYR B O     1 
ATOM   1563 C CB    . TYR B 1 59  ? 16.948  14.831  10.720  1.00 55.81  ? 45   TYR B CB    1 
ATOM   1564 C CG    . TYR B 1 59  ? 16.849  14.439  12.170  1.00 59.74  ? 45   TYR B CG    1 
ATOM   1565 C CD1   . TYR B 1 59  ? 16.105  13.338  12.558  1.00 64.39  ? 45   TYR B CD1   1 
ATOM   1566 C CD2   . TYR B 1 59  ? 17.510  15.162  13.155  1.00 61.31  ? 45   TYR B CD2   1 
ATOM   1567 C CE1   . TYR B 1 59  ? 15.997  12.973  13.887  1.00 66.83  ? 45   TYR B CE1   1 
ATOM   1568 C CE2   . TYR B 1 59  ? 17.419  14.805  14.487  1.00 64.37  ? 45   TYR B CE2   1 
ATOM   1569 C CZ    . TYR B 1 59  ? 16.651  13.718  14.842  1.00 67.60  ? 45   TYR B CZ    1 
ATOM   1570 O OH    . TYR B 1 59  ? 16.553  13.354  16.148  1.00 74.32  ? 45   TYR B OH    1 
ATOM   1571 N N     . GLY B 1 60  ? 16.804  17.967  10.605  1.00 50.13  ? 46   GLY B N     1 
ATOM   1572 C CA    . GLY B 1 60  ? 16.935  19.306  11.195  1.00 49.28  ? 46   GLY B CA    1 
ATOM   1573 C C     . GLY B 1 60  ? 15.673  20.145  11.058  1.00 50.17  ? 46   GLY B C     1 
ATOM   1574 O O     . GLY B 1 60  ? 15.287  20.864  11.990  1.00 54.67  ? 46   GLY B O     1 
ATOM   1575 N N     . LEU B 1 61  ? 14.994  20.024  9.924   1.00 47.31  ? 47   LEU B N     1 
ATOM   1576 C CA    . LEU B 1 61  ? 13.739  20.729  9.730   1.00 45.86  ? 47   LEU B CA    1 
ATOM   1577 C C     . LEU B 1 61  ? 12.694  20.263  10.747  1.00 46.76  ? 47   LEU B C     1 
ATOM   1578 O O     . LEU B 1 61  ? 12.010  21.082  11.375  1.00 48.35  ? 47   LEU B O     1 
ATOM   1579 C CB    . LEU B 1 61  ? 13.206  20.532  8.307   1.00 44.24  ? 47   LEU B CB    1 
ATOM   1580 C CG    . LEU B 1 61  ? 14.169  20.949  7.179   1.00 43.99  ? 47   LEU B CG    1 
ATOM   1581 C CD1   . LEU B 1 61  ? 13.562  20.679  5.815   1.00 44.04  ? 47   LEU B CD1   1 
ATOM   1582 C CD2   . LEU B 1 61  ? 14.576  22.403  7.288   1.00 43.28  ? 47   LEU B CD2   1 
ATOM   1583 N N     . LEU B 1 62  ? 12.575  18.956  10.919  1.00 46.33  ? 48   LEU B N     1 
ATOM   1584 C CA    . LEU B 1 62  ? 11.629  18.427  11.898  1.00 48.76  ? 48   LEU B CA    1 
ATOM   1585 C C     . LEU B 1 62  ? 11.943  18.908  13.305  1.00 48.83  ? 48   LEU B C     1 
ATOM   1586 O O     . LEU B 1 62  ? 11.055  19.264  14.055  1.00 50.25  ? 48   LEU B O     1 
ATOM   1587 C CB    . LEU B 1 62  ? 11.633  16.907  11.883  1.00 49.51  ? 48   LEU B CB    1 
ATOM   1588 C CG    . LEU B 1 62  ? 11.345  16.227  10.559  1.00 48.32  ? 48   LEU B CG    1 
ATOM   1589 C CD1   . LEU B 1 62  ? 10.967  14.780  10.831  1.00 49.75  ? 48   LEU B CD1   1 
ATOM   1590 C CD2   . LEU B 1 62  ? 10.234  16.942  9.799   1.00 47.98  ? 48   LEU B CD2   1 
ATOM   1591 N N     . VAL B 1 63  ? 13.221  18.932  13.643  1.00 49.60  ? 49   VAL B N     1 
ATOM   1592 C CA    . VAL B 1 63  ? 13.660  19.399  14.942  1.00 49.66  ? 49   VAL B CA    1 
ATOM   1593 C C     . VAL B 1 63  ? 13.256  20.851  15.161  1.00 50.15  ? 49   VAL B C     1 
ATOM   1594 O O     . VAL B 1 63  ? 12.799  21.214  16.246  1.00 54.62  ? 49   VAL B O     1 
ATOM   1595 C CB    . VAL B 1 63  ? 15.184  19.230  15.085  1.00 49.98  ? 49   VAL B CB    1 
ATOM   1596 C CG1   . VAL B 1 63  ? 15.710  19.921  16.330  1.00 51.63  ? 49   VAL B CG1   1 
ATOM   1597 C CG2   . VAL B 1 63  ? 15.532  17.743  15.135  1.00 52.07  ? 49   VAL B CG2   1 
ATOM   1598 N N     . LYS B 1 64  ? 13.424  21.687  14.152  1.00 48.51  ? 50   LYS B N     1 
ATOM   1599 C CA    . LYS B 1 64  ? 13.135  23.099  14.319  1.00 49.21  ? 50   LYS B CA    1 
ATOM   1600 C C     . LYS B 1 64  ? 11.624  23.349  14.490  1.00 49.71  ? 50   LYS B C     1 
ATOM   1601 O O     . LYS B 1 64  ? 11.219  24.238  15.262  1.00 51.29  ? 50   LYS B O     1 
ATOM   1602 C CB    . LYS B 1 64  ? 13.707  23.906  13.136  1.00 48.41  ? 50   LYS B CB    1 
ATOM   1603 N N     . LEU B 1 65  ? 10.793  22.557  13.808  1.00 47.24  ? 51   LEU B N     1 
ATOM   1604 C CA    . LEU B 1 65  ? 9.344   22.658  13.967  1.00 46.19  ? 51   LEU B CA    1 
ATOM   1605 C C     . LEU B 1 65  ? 8.911   22.145  15.340  1.00 48.90  ? 51   LEU B C     1 
ATOM   1606 O O     . LEU B 1 65  ? 8.158   22.819  16.066  1.00 49.36  ? 51   LEU B O     1 
ATOM   1607 C CB    . LEU B 1 65  ? 8.631   21.863  12.901  1.00 45.05  ? 51   LEU B CB    1 
ATOM   1608 C CG    . LEU B 1 65  ? 8.889   22.296  11.472  1.00 44.04  ? 51   LEU B CG    1 
ATOM   1609 C CD1   . LEU B 1 65  ? 8.088   21.433  10.510  1.00 44.47  ? 51   LEU B CD1   1 
ATOM   1610 C CD2   . LEU B 1 65  ? 8.543   23.761  11.293  1.00 43.74  ? 51   LEU B CD2   1 
ATOM   1611 N N     . ALA B 1 66  ? 9.391   20.951  15.690  1.00 49.08  ? 52   ALA B N     1 
ATOM   1612 C CA    . ALA B 1 66  ? 9.157   20.375  17.002  1.00 49.99  ? 52   ALA B CA    1 
ATOM   1613 C C     . ALA B 1 66  ? 9.438   21.384  18.127  1.00 51.58  ? 52   ALA B C     1 
ATOM   1614 O O     . ALA B 1 66  ? 8.788   21.359  19.181  1.00 51.32  ? 52   ALA B O     1 
ATOM   1615 C CB    . ALA B 1 66  ? 10.006  19.131  17.169  1.00 50.65  ? 52   ALA B CB    1 
ATOM   1616 N N     . GLU B 1 67  ? 10.441  22.234  17.907  1.00 51.32  ? 53   GLU B N     1 
ATOM   1617 C CA    . GLU B 1 67  ? 10.825  23.271  18.867  1.00 52.76  ? 53   GLU B CA    1 
ATOM   1618 C C     . GLU B 1 67  ? 9.956   24.509  18.793  1.00 52.53  ? 53   GLU B C     1 
ATOM   1619 O O     . GLU B 1 67  ? 9.987   25.326  19.704  1.00 54.11  ? 53   GLU B O     1 
ATOM   1620 C CB    . GLU B 1 67  ? 12.256  23.728  18.610  1.00 53.60  ? 53   GLU B CB    1 
ATOM   1621 C CG    . GLU B 1 67  ? 13.359  22.840  19.154  1.00 56.27  ? 53   GLU B CG    1 
ATOM   1622 C CD    . GLU B 1 67  ? 14.731  23.493  18.991  1.00 56.40  ? 53   GLU B CD    1 
ATOM   1623 O OE1   . GLU B 1 67  ? 14.912  24.245  18.014  1.00 55.34  ? 53   GLU B OE1   1 
ATOM   1624 O OE2   . GLU B 1 67  ? 15.616  23.260  19.832  1.00 58.08  ? 53   GLU B OE2   1 
ATOM   1625 N N     . SER B 1 68  ? 9.208   24.677  17.709  1.00 52.05  ? 54   SER B N     1 
ATOM   1626 C CA    . SER B 1 68  ? 8.450   25.913  17.498  1.00 53.02  ? 54   SER B CA    1 
ATOM   1627 C C     . SER B 1 68  ? 7.111   25.953  18.247  1.00 54.08  ? 54   SER B C     1 
ATOM   1628 O O     . SER B 1 68  ? 6.572   24.921  18.614  1.00 51.86  ? 54   SER B O     1 
ATOM   1629 C CB    . SER B 1 68  ? 8.185   26.109  16.015  1.00 52.80  ? 54   SER B CB    1 
ATOM   1630 O OG    . SER B 1 68  ? 9.403   26.103  15.300  1.00 53.75  ? 54   SER B OG    1 
ATOM   1631 N N     . PRO B 1 69  ? 6.580   27.166  18.487  1.00 56.90  ? 55   PRO B N     1 
ATOM   1632 C CA    . PRO B 1 69  ? 5.223   27.258  19.005  1.00 58.84  ? 55   PRO B CA    1 
ATOM   1633 C C     . PRO B 1 69  ? 4.236   26.602  18.033  1.00 59.84  ? 55   PRO B C     1 
ATOM   1634 O O     . PRO B 1 69  ? 4.372   26.753  16.812  1.00 63.10  ? 55   PRO B O     1 
ATOM   1635 C CB    . PRO B 1 69  ? 4.977   28.763  19.099  1.00 59.52  ? 55   PRO B CB    1 
ATOM   1636 C CG    . PRO B 1 69  ? 6.329   29.374  19.145  1.00 58.99  ? 55   PRO B CG    1 
ATOM   1637 C CD    . PRO B 1 69  ? 7.190   28.496  18.302  1.00 57.47  ? 55   PRO B CD    1 
ATOM   1638 N N     . ARG B 1 70  ? 3.292   25.846  18.575  1.00 60.44  ? 56   ARG B N     1 
ATOM   1639 C CA    . ARG B 1 70  ? 2.302   25.108  17.782  1.00 61.18  ? 56   ARG B CA    1 
ATOM   1640 C C     . ARG B 1 70  ? 2.918   24.202  16.705  1.00 59.25  ? 56   ARG B C     1 
ATOM   1641 O O     . ARG B 1 70  ? 2.252   23.822  15.741  1.00 57.69  ? 56   ARG B O     1 
ATOM   1642 C CB    . ARG B 1 70  ? 1.277   26.072  17.181  1.00 63.50  ? 56   ARG B CB    1 
ATOM   1643 C CG    . ARG B 1 70  ? 0.460   26.825  18.229  1.00 67.59  ? 56   ARG B CG    1 
ATOM   1644 C CD    . ARG B 1 70  ? -0.555  27.720  17.564  1.00 69.66  ? 56   ARG B CD    1 
ATOM   1645 N NE    . ARG B 1 70  ? -1.521  26.932  16.802  1.00 71.94  ? 56   ARG B NE    1 
ATOM   1646 C CZ    . ARG B 1 70  ? -2.395  27.438  15.934  1.00 75.61  ? 56   ARG B CZ    1 
ATOM   1647 N NH1   . ARG B 1 70  ? -2.437  28.753  15.691  1.00 78.08  ? 56   ARG B NH1   1 
ATOM   1648 N NH2   . ARG B 1 70  ? -3.241  26.627  15.304  1.00 75.69  ? 56   ARG B NH2   1 
ATOM   1649 N N     . ARG B 1 71  ? 4.183   23.827  16.912  1.00 58.86  ? 57   ARG B N     1 
ATOM   1650 C CA    . ARG B 1 71  ? 4.903   22.908  16.027  1.00 57.59  ? 57   ARG B CA    1 
ATOM   1651 C C     . ARG B 1 71  ? 4.857   23.340  14.564  1.00 57.46  ? 57   ARG B C     1 
ATOM   1652 O O     . ARG B 1 71  ? 4.904   22.507  13.646  1.00 58.92  ? 57   ARG B O     1 
ATOM   1653 C CB    . ARG B 1 71  ? 4.390   21.474  16.212  1.00 56.89  ? 57   ARG B CB    1 
ATOM   1654 C CG    . ARG B 1 71  ? 5.104   20.738  17.345  1.00 56.80  ? 57   ARG B CG    1 
ATOM   1655 C CD    . ARG B 1 71  ? 4.362   19.544  17.946  1.00 58.40  ? 57   ARG B CD    1 
ATOM   1656 N NE    . ARG B 1 71  ? 3.630   18.769  16.956  1.00 57.71  ? 57   ARG B NE    1 
ATOM   1657 C CZ    . ARG B 1 71  ? 2.958   17.669  17.254  1.00 58.66  ? 57   ARG B CZ    1 
ATOM   1658 N NH1   . ARG B 1 71  ? 2.958   17.210  18.503  1.00 59.35  ? 57   ARG B NH1   1 
ATOM   1659 N NH2   . ARG B 1 71  ? 2.295   17.031  16.303  1.00 59.17  ? 57   ARG B NH2   1 
ATOM   1660 N N     . ARG B 1 72  ? 4.839   24.652  14.354  1.00 56.84  ? 58   ARG B N     1 
ATOM   1661 C CA    . ARG B 1 72  ? 4.726   25.203  13.018  1.00 56.75  ? 58   ARG B CA    1 
ATOM   1662 C C     . ARG B 1 72  ? 5.621   26.412  12.833  1.00 54.55  ? 58   ARG B C     1 
ATOM   1663 O O     . ARG B 1 72  ? 6.075   27.012  13.791  1.00 54.79  ? 58   ARG B O     1 
ATOM   1664 C CB    . ARG B 1 72  ? 3.278   25.593  12.735  1.00 58.01  ? 58   ARG B CB    1 
ATOM   1665 C CG    . ARG B 1 72  ? 2.835   26.870  13.444  1.00 57.98  ? 58   ARG B CG    1 
ATOM   1666 C CD    . ARG B 1 72  ? 1.344   27.014  13.347  1.00 59.75  ? 58   ARG B CD    1 
ATOM   1667 N NE    . ARG B 1 72  ? 0.717   25.782  13.795  1.00 62.11  ? 58   ARG B NE    1 
ATOM   1668 C CZ    . ARG B 1 72  ? -0.466  25.328  13.369  1.00 63.50  ? 58   ARG B CZ    1 
ATOM   1669 N NH1   . ARG B 1 72  ? -1.177  26.008  12.465  1.00 63.20  ? 58   ARG B NH1   1 
ATOM   1670 N NH2   . ARG B 1 72  ? -0.936  24.178  13.854  1.00 62.88  ? 58   ARG B NH2   1 
ATOM   1671 N N     . LEU B 1 73  ? 5.865   26.739  11.576  1.00 54.31  ? 59   LEU B N     1 
ATOM   1672 C CA    . LEU B 1 73  ? 6.791   27.799  11.198  1.00 55.12  ? 59   LEU B CA    1 
ATOM   1673 C C     . LEU B 1 73  ? 6.527   28.126  9.731   1.00 54.06  ? 59   LEU B C     1 
ATOM   1674 O O     . LEU B 1 73  ? 6.289   27.220  8.932   1.00 55.00  ? 59   LEU B O     1 
ATOM   1675 C CB    . LEU B 1 73  ? 8.234   27.306  11.362  1.00 52.93  ? 59   LEU B CB    1 
ATOM   1676 C CG    . LEU B 1 73  ? 9.257   28.167  12.090  1.00 54.32  ? 59   LEU B CG    1 
ATOM   1677 C CD1   . LEU B 1 73  ? 8.748   28.705  13.426  1.00 56.28  ? 59   LEU B CD1   1 
ATOM   1678 C CD2   . LEU B 1 73  ? 10.530  27.357  12.310  1.00 52.91  ? 59   LEU B CD2   1 
ATOM   1679 N N     . ARG B 1 74  ? 6.535   29.402  9.383   1.00 52.30  ? 60   ARG B N     1 
ATOM   1680 C CA    . ARG B 1 74  ? 6.339   29.780  8.001   1.00 52.24  ? 60   ARG B CA    1 
ATOM   1681 C C     . ARG B 1 74  ? 7.544   29.436  7.186   1.00 50.67  ? 60   ARG B C     1 
ATOM   1682 O O     . ARG B 1 74  ? 8.661   29.443  7.703   1.00 51.79  ? 60   ARG B O     1 
ATOM   1683 C CB    . ARG B 1 74  ? 6.010   31.261  7.888   1.00 55.17  ? 60   ARG B CB    1 
ATOM   1684 C CG    . ARG B 1 74  ? 4.545   31.482  8.183   1.00 56.26  ? 60   ARG B CG    1 
ATOM   1685 C CD    . ARG B 1 74  ? 4.223   32.944  8.254   1.00 58.29  ? 60   ARG B CD    1 
ATOM   1686 N NE    . ARG B 1 74  ? 4.519   33.604  6.999   1.00 61.61  ? 60   ARG B NE    1 
ATOM   1687 C CZ    . ARG B 1 74  ? 3.709   34.450  6.365   1.00 64.87  ? 60   ARG B CZ    1 
ATOM   1688 N NH1   . ARG B 1 74  ? 2.499   34.776  6.851   1.00 67.17  ? 60   ARG B NH1   1 
ATOM   1689 N NH2   . ARG B 1 74  ? 4.128   34.974  5.224   1.00 65.47  ? 60   ARG B NH2   1 
ATOM   1690 N N     . MET B 1 75  ? 7.324   29.103  5.915   1.00 51.06  ? 61   MET B N     1 
ATOM   1691 C CA    . MET B 1 75  ? 8.380   28.534  5.054   1.00 49.93  ? 61   MET B CA    1 
ATOM   1692 C C     . MET B 1 75  ? 9.686   29.311  5.129   1.00 49.07  ? 61   MET B C     1 
ATOM   1693 O O     . MET B 1 75  ? 10.734  28.744  5.417   1.00 48.04  ? 61   MET B O     1 
ATOM   1694 C CB    . MET B 1 75  ? 7.926   28.498  3.601   1.00 52.32  ? 61   MET B CB    1 
ATOM   1695 C CG    . MET B 1 75  ? 6.662   27.686  3.356   1.00 54.37  ? 61   MET B CG    1 
ATOM   1696 S SD    . MET B 1 75  ? 6.675   26.069  4.138   1.00 54.49  ? 61   MET B SD    1 
ATOM   1697 C CE    . MET B 1 75  ? 7.729   25.166  3.011   1.00 53.38  ? 61   MET B CE    1 
ATOM   1698 N N     . THR B 1 76  ? 9.624   30.616  4.895   1.00 50.04  ? 62   THR B N     1 
ATOM   1699 C CA    . THR B 1 76  ? 10.837  31.405  4.870   1.00 50.04  ? 62   THR B CA    1 
ATOM   1700 C C     . THR B 1 76  ? 11.541  31.353  6.228   1.00 49.30  ? 62   THR B C     1 
ATOM   1701 O O     . THR B 1 76  ? 12.765  31.256  6.273   1.00 51.69  ? 62   THR B O     1 
ATOM   1702 C CB    . THR B 1 76  ? 10.578  32.865  4.447   1.00 52.38  ? 62   THR B CB    1 
ATOM   1703 O OG1   . THR B 1 76  ? 9.951   32.901  3.156   1.00 53.34  ? 62   THR B OG1   1 
ATOM   1704 C CG2   . THR B 1 76  ? 11.882  33.622  4.367   1.00 52.48  ? 62   THR B CG2   1 
ATOM   1705 N N     . GLU B 1 77  ? 10.781  31.423  7.320   1.00 48.43  ? 63   GLU B N     1 
ATOM   1706 C CA    . GLU B 1 77  ? 11.352  31.356  8.677   1.00 47.91  ? 63   GLU B CA    1 
ATOM   1707 C C     . GLU B 1 77  ? 12.063  30.011  8.866   1.00 45.99  ? 63   GLU B C     1 
ATOM   1708 O O     . GLU B 1 77  ? 13.199  29.927  9.336   1.00 45.03  ? 63   GLU B O     1 
ATOM   1709 C CB    . GLU B 1 77  ? 10.297  31.637  9.761   1.00 47.70  ? 63   GLU B CB    1 
ATOM   1710 N N     . LEU B 1 78  ? 11.446  28.958  8.377   1.00 47.80  ? 64   LEU B N     1 
ATOM   1711 C CA    . LEU B 1 78  ? 12.074  27.646  8.426   1.00 47.84  ? 64   LEU B CA    1 
ATOM   1712 C C     . LEU B 1 78  ? 13.390  27.641  7.641   1.00 47.35  ? 64   LEU B C     1 
ATOM   1713 O O     . LEU B 1 78  ? 14.430  27.222  8.160   1.00 48.97  ? 64   LEU B O     1 
ATOM   1714 C CB    . LEU B 1 78  ? 11.108  26.586  7.913   1.00 46.33  ? 64   LEU B CB    1 
ATOM   1715 C CG    . LEU B 1 78  ? 11.485  25.113  8.095   1.00 47.44  ? 64   LEU B CG    1 
ATOM   1716 C CD1   . LEU B 1 78  ? 12.100  24.855  9.462   1.00 48.07  ? 64   LEU B CD1   1 
ATOM   1717 C CD2   . LEU B 1 78  ? 10.255  24.232  7.874   1.00 46.68  ? 64   LEU B CD2   1 
ATOM   1718 N N     . ALA B 1 79  ? 13.353  28.126  6.406   1.00 47.22  ? 65   ALA B N     1 
ATOM   1719 C CA    . ALA B 1 79  ? 14.565  28.221  5.604   1.00 47.06  ? 65   ALA B CA    1 
ATOM   1720 C C     . ALA B 1 79  ? 15.655  29.014  6.320   1.00 48.53  ? 65   ALA B C     1 
ATOM   1721 O O     . ALA B 1 79  ? 16.813  28.625  6.277   1.00 47.78  ? 65   ALA B O     1 
ATOM   1722 C CB    . ALA B 1 79  ? 14.245  28.850  4.266   1.00 48.26  ? 65   ALA B CB    1 
ATOM   1723 N N     . LYS B 1 80  ? 15.278  30.113  6.981   1.00 49.04  ? 66   LYS B N     1 
ATOM   1724 C CA    . LYS B 1 80  ? 16.247  30.997  7.638   1.00 49.34  ? 66   LYS B CA    1 
ATOM   1725 C C     . LYS B 1 80  ? 16.966  30.295  8.779   1.00 49.29  ? 66   LYS B C     1 
ATOM   1726 O O     . LYS B 1 80  ? 18.156  30.493  8.962   1.00 48.61  ? 66   LYS B O     1 
ATOM   1727 C CB    . LYS B 1 80  ? 15.576  32.293  8.165   1.00 52.27  ? 66   LYS B CB    1 
ATOM   1728 C CG    . LYS B 1 80  ? 16.501  33.264  8.902   1.00 52.79  ? 66   LYS B CG    1 
ATOM   1729 C CD    . LYS B 1 80  ? 15.815  34.609  9.146   1.00 55.35  ? 66   LYS B CD    1 
ATOM   1730 N N     . TYR B 1 81  ? 16.234  29.511  9.569   1.00 50.18  ? 67   TYR B N     1 
ATOM   1731 C CA    . TYR B 1 81  ? 16.843  28.754  10.662  1.00 49.76  ? 67   TYR B CA    1 
ATOM   1732 C C     . TYR B 1 81  ? 17.775  27.672  10.109  1.00 48.92  ? 67   TYR B C     1 
ATOM   1733 O O     . TYR B 1 81  ? 18.898  27.508  10.583  1.00 48.89  ? 67   TYR B O     1 
ATOM   1734 C CB    . TYR B 1 81  ? 15.789  28.098  11.535  1.00 50.34  ? 67   TYR B CB    1 
ATOM   1735 C CG    . TYR B 1 81  ? 15.102  29.031  12.494  1.00 54.20  ? 67   TYR B CG    1 
ATOM   1736 C CD1   . TYR B 1 81  ? 15.819  29.697  13.510  1.00 57.58  ? 67   TYR B CD1   1 
ATOM   1737 C CD2   . TYR B 1 81  ? 13.730  29.234  12.429  1.00 55.10  ? 67   TYR B CD2   1 
ATOM   1738 C CE1   . TYR B 1 81  ? 15.178  30.538  14.399  1.00 56.74  ? 67   TYR B CE1   1 
ATOM   1739 C CE2   . TYR B 1 81  ? 13.086  30.083  13.312  1.00 55.65  ? 67   TYR B CE2   1 
ATOM   1740 C CZ    . TYR B 1 81  ? 13.807  30.722  14.294  1.00 56.93  ? 67   TYR B CZ    1 
ATOM   1741 O OH    . TYR B 1 81  ? 13.135  31.563  15.168  1.00 59.59  ? 67   TYR B OH    1 
ATOM   1742 N N     . ALA B 1 82  ? 17.302  26.968  9.086   1.00 46.97  ? 68   ALA B N     1 
ATOM   1743 C CA    . ALA B 1 82  ? 18.052  25.893  8.432   1.00 48.24  ? 68   ALA B CA    1 
ATOM   1744 C C     . ALA B 1 82  ? 19.242  26.383  7.594   1.00 48.29  ? 68   ALA B C     1 
ATOM   1745 O O     . ALA B 1 82  ? 20.162  25.620  7.323   1.00 48.16  ? 68   ALA B O     1 
ATOM   1746 C CB    . ALA B 1 82  ? 17.102  25.085  7.542   1.00 48.28  ? 68   ALA B CB    1 
ATOM   1747 N N     . LYS B 1 83  ? 19.191  27.647  7.172   1.00 49.50  ? 69   LYS B N     1 
ATOM   1748 C CA    . LYS B 1 83  ? 20.218  28.279  6.340   1.00 50.84  ? 69   LYS B CA    1 
ATOM   1749 C C     . LYS B 1 83  ? 20.236  27.709  4.918   1.00 49.36  ? 69   LYS B C     1 
ATOM   1750 O O     . LYS B 1 83  ? 21.287  27.615  4.290   1.00 49.92  ? 69   LYS B O     1 
ATOM   1751 C CB    . LYS B 1 83  ? 21.604  28.172  6.974   1.00 54.11  ? 69   LYS B CB    1 
ATOM   1752 C CG    . LYS B 1 83  ? 21.647  28.532  8.454   1.00 55.92  ? 69   LYS B CG    1 
ATOM   1753 C CD    . LYS B 1 83  ? 21.304  29.985  8.691   1.00 57.99  ? 69   LYS B CD    1 
ATOM   1754 C CE    . LYS B 1 83  ? 20.926  30.219  10.137  1.00 59.25  ? 69   LYS B CE    1 
ATOM   1755 N NZ    . LYS B 1 83  ? 20.506  31.625  10.378  1.00 62.69  ? 69   LYS B NZ    1 
ATOM   1756 N N     . ILE B 1 84  ? 19.055  27.378  4.411   1.00 46.68  ? 70   ILE B N     1 
ATOM   1757 C CA    . ILE B 1 84  ? 18.912  26.809  3.097   1.00 45.89  ? 70   ILE B CA    1 
ATOM   1758 C C     . ILE B 1 84  ? 18.014  27.715  2.281   1.00 48.03  ? 70   ILE B C     1 
ATOM   1759 O O     . ILE B 1 84  ? 17.557  28.731  2.786   1.00 50.16  ? 70   ILE B O     1 
ATOM   1760 C CB    . ILE B 1 84  ? 18.303  25.407  3.150   1.00 44.89  ? 70   ILE B CB    1 
ATOM   1761 C CG1   . ILE B 1 84  ? 16.817  25.475  3.493   1.00 45.98  ? 70   ILE B CG1   1 
ATOM   1762 C CG2   . ILE B 1 84  ? 19.089  24.530  4.113   1.00 45.22  ? 70   ILE B CG2   1 
ATOM   1763 C CD1   . ILE B 1 84  ? 16.194  24.144  3.859   1.00 45.14  ? 70   ILE B CD1   1 
ATOM   1764 N N     . THR B 1 85  ? 17.804  27.382  1.008   1.00 47.22  ? 71   THR B N     1 
ATOM   1765 C CA    . THR B 1 85  ? 16.967  28.214  0.172   1.00 46.20  ? 71   THR B CA    1 
ATOM   1766 C C     . THR B 1 85  ? 15.533  27.759  0.259   1.00 46.47  ? 71   THR B C     1 
ATOM   1767 O O     . THR B 1 85  ? 15.243  26.623  0.582   1.00 46.37  ? 71   THR B O     1 
ATOM   1768 C CB    . THR B 1 85  ? 17.407  28.198  -1.297  1.00 46.32  ? 71   THR B CB    1 
ATOM   1769 O OG1   . THR B 1 85  ? 17.225  26.886  -1.846  1.00 47.22  ? 71   THR B OG1   1 
ATOM   1770 C CG2   . THR B 1 85  ? 18.862  28.639  -1.421  1.00 45.46  ? 71   THR B CG2   1 
ATOM   1771 N N     . ARG B 1 86  ? 14.631  28.677  -0.033  1.00 50.07  ? 72   ARG B N     1 
ATOM   1772 C CA    . ARG B 1 86  ? 13.209  28.381  -0.082  1.00 50.68  ? 72   ARG B CA    1 
ATOM   1773 C C     . ARG B 1 86  ? 12.911  27.228  -1.034  1.00 49.33  ? 72   ARG B C     1 
ATOM   1774 O O     . ARG B 1 86  ? 11.945  26.486  -0.833  1.00 48.83  ? 72   ARG B O     1 
ATOM   1775 C CB    . ARG B 1 86  ? 12.449  29.612  -0.554  1.00 52.76  ? 72   ARG B CB    1 
ATOM   1776 C CG    . ARG B 1 86  ? 12.593  30.797  0.369   1.00 54.92  ? 72   ARG B CG    1 
ATOM   1777 C CD    . ARG B 1 86  ? 11.824  31.950  -0.190  1.00 57.81  ? 72   ARG B CD    1 
ATOM   1778 N NE    . ARG B 1 86  ? 11.799  33.091  0.710   1.00 60.48  ? 72   ARG B NE    1 
ATOM   1779 C CZ    . ARG B 1 86  ? 11.689  34.355  0.319   1.00 64.47  ? 72   ARG B CZ    1 
ATOM   1780 N NH1   . ARG B 1 86  ? 11.630  34.654  -0.972  1.00 69.52  ? 72   ARG B NH1   1 
ATOM   1781 N NH2   . ARG B 1 86  ? 11.639  35.322  1.222   1.00 64.91  ? 72   ARG B NH2   1 
ATOM   1782 N N     . SER B 1 87  ? 13.711  27.137  -2.097  1.00 47.37  ? 73   SER B N     1 
ATOM   1783 C CA    . SER B 1 87  ? 13.485  26.198  -3.182  1.00 47.04  ? 73   SER B CA    1 
ATOM   1784 C C     . SER B 1 87  ? 13.737  24.827  -2.657  1.00 48.55  ? 73   SER B C     1 
ATOM   1785 O O     . SER B 1 87  ? 12.901  23.918  -2.746  1.00 49.76  ? 73   SER B O     1 
ATOM   1786 C CB    . SER B 1 87  ? 14.471  26.476  -4.294  1.00 47.89  ? 73   SER B CB    1 
ATOM   1787 O OG    . SER B 1 87  ? 13.797  26.605  -5.510  1.00 50.65  ? 73   SER B OG    1 
ATOM   1788 N N     . ARG B 1 88  ? 14.922  24.682  -2.072  1.00 50.14  ? 74   ARG B N     1 
ATOM   1789 C CA    . ARG B 1 88  ? 15.301  23.453  -1.436  1.00 47.79  ? 74   ARG B CA    1 
ATOM   1790 C C     . ARG B 1 88  ? 14.274  23.082  -0.376  1.00 47.86  ? 74   ARG B C     1 
ATOM   1791 O O     . ARG B 1 88  ? 13.911  21.920  -0.253  1.00 50.68  ? 74   ARG B O     1 
ATOM   1792 C CB    . ARG B 1 88  ? 16.662  23.616  -0.806  1.00 46.05  ? 74   ARG B CB    1 
ATOM   1793 C CG    . ARG B 1 88  ? 17.190  22.338  -0.165  1.00 46.31  ? 74   ARG B CG    1 
ATOM   1794 C CD    . ARG B 1 88  ? 18.461  22.679  0.568   1.00 45.70  ? 74   ARG B CD    1 
ATOM   1795 N NE    . ARG B 1 88  ? 19.210  21.513  0.959   1.00 46.68  ? 74   ARG B NE    1 
ATOM   1796 C CZ    . ARG B 1 88  ? 20.465  21.573  1.393   1.00 48.08  ? 74   ARG B CZ    1 
ATOM   1797 N NH1   . ARG B 1 88  ? 21.083  22.744  1.488   1.00 48.25  ? 74   ARG B NH1   1 
ATOM   1798 N NH2   . ARG B 1 88  ? 21.102  20.466  1.733   1.00 48.13  ? 74   ARG B NH2   1 
ATOM   1799 N N     . LEU B 1 89  ? 13.821  24.067  0.387   1.00 46.89  ? 75   LEU B N     1 
ATOM   1800 C CA    . LEU B 1 89  ? 12.844  23.815  1.433   1.00 46.85  ? 75   LEU B CA    1 
ATOM   1801 C C     . LEU B 1 89  ? 11.536  23.303  0.883   1.00 47.61  ? 75   LEU B C     1 
ATOM   1802 O O     . LEU B 1 89  ? 10.954  22.381  1.447   1.00 48.20  ? 75   LEU B O     1 
ATOM   1803 C CB    . LEU B 1 89  ? 12.591  25.077  2.258   1.00 48.49  ? 75   LEU B CB    1 
ATOM   1804 C CG    . LEU B 1 89  ? 11.582  24.910  3.393   1.00 49.37  ? 75   LEU B CG    1 
ATOM   1805 C CD1   . LEU B 1 89  ? 11.938  23.759  4.314   1.00 50.01  ? 75   LEU B CD1   1 
ATOM   1806 C CD2   . LEU B 1 89  ? 11.504  26.191  4.179   1.00 48.58  ? 75   LEU B CD2   1 
ATOM   1807 N N     . SER B 1 90  ? 11.056  23.900  -0.209  1.00 48.32  ? 76   SER B N     1 
ATOM   1808 C CA    . SER B 1 90  ? 9.799   23.452  -0.812  1.00 47.59  ? 76   SER B CA    1 
ATOM   1809 C C     . SER B 1 90  ? 9.920   21.995  -1.197  1.00 45.42  ? 76   SER B C     1 
ATOM   1810 O O     . SER B 1 90  ? 9.067   21.189  -0.859  1.00 45.42  ? 76   SER B O     1 
ATOM   1811 C CB    . SER B 1 90  ? 9.438   24.276  -2.044  1.00 49.61  ? 76   SER B CB    1 
ATOM   1812 O OG    . SER B 1 90  ? 9.261   25.636  -1.700  1.00 51.35  ? 76   SER B OG    1 
ATOM   1813 N N     . HIS B 1 91  ? 10.992  21.659  -1.909  1.00 44.05  ? 77   HIS B N     1 
ATOM   1814 C CA    . HIS B 1 91  ? 11.187  20.271  -2.376  1.00 41.21  ? 77   HIS B CA    1 
ATOM   1815 C C     . HIS B 1 91  ? 11.226  19.363  -1.172  1.00 41.29  ? 77   HIS B C     1 
ATOM   1816 O O     . HIS B 1 91  ? 10.595  18.327  -1.165  1.00 41.20  ? 77   HIS B O     1 
ATOM   1817 C CB    . HIS B 1 91  ? 12.457  20.142  -3.220  1.00 39.24  ? 77   HIS B CB    1 
ATOM   1818 C CG    . HIS B 1 91  ? 12.313  20.645  -4.622  1.00 38.46  ? 77   HIS B CG    1 
ATOM   1819 N ND1   . HIS B 1 91  ? 11.314  20.219  -5.465  1.00 38.77  ? 77   HIS B ND1   1 
ATOM   1820 C CD2   . HIS B 1 91  ? 13.049  21.539  -5.337  1.00 37.77  ? 77   HIS B CD2   1 
ATOM   1821 C CE1   . HIS B 1 91  ? 11.435  20.828  -6.636  1.00 37.84  ? 77   HIS B CE1   1 
ATOM   1822 N NE2   . HIS B 1 91  ? 12.492  21.618  -6.590  1.00 36.95  ? 77   HIS B NE2   1 
ATOM   1823 N N     . ALA B 1 92  ? 11.953  19.774  -0.137  1.00 42.18  ? 78   ALA B N     1 
ATOM   1824 C CA    . ALA B 1 92  ? 12.113  18.950  1.057   1.00 44.01  ? 78   ALA B CA    1 
ATOM   1825 C C     . ALA B 1 92  ? 10.776  18.699  1.760   1.00 45.55  ? 78   ALA B C     1 
ATOM   1826 O O     . ALA B 1 92  ? 10.503  17.588  2.197   1.00 46.04  ? 78   ALA B O     1 
ATOM   1827 C CB    . ALA B 1 92  ? 13.098  19.598  2.014   1.00 44.69  ? 78   ALA B CB    1 
ATOM   1828 N N     . VAL B 1 93  ? 9.948   19.735  1.853   1.00 46.84  ? 79   VAL B N     1 
ATOM   1829 C CA    . VAL B 1 93  ? 8.650   19.608  2.501   1.00 48.25  ? 79   VAL B CA    1 
ATOM   1830 C C     . VAL B 1 93  ? 7.637   18.836  1.649   1.00 49.37  ? 79   VAL B C     1 
ATOM   1831 O O     . VAL B 1 93  ? 6.731   18.205  2.194   1.00 50.39  ? 79   VAL B O     1 
ATOM   1832 C CB    . VAL B 1 93  ? 8.113   20.990  2.931   1.00 49.34  ? 79   VAL B CB    1 
ATOM   1833 C CG1   . VAL B 1 93  ? 6.702   20.876  3.489   1.00 51.52  ? 79   VAL B CG1   1 
ATOM   1834 C CG2   . VAL B 1 93  ? 9.034   21.600  3.983   1.00 48.99  ? 79   VAL B CG2   1 
ATOM   1835 N N     . ALA B 1 94  ? 7.770   18.867  0.321   1.00 49.05  ? 80   ALA B N     1 
ATOM   1836 C CA    . ALA B 1 94  ? 6.935   17.995  -0.510  1.00 48.04  ? 80   ALA B CA    1 
ATOM   1837 C C     . ALA B 1 94  ? 7.223   16.546  -0.128  1.00 50.31  ? 80   ALA B C     1 
ATOM   1838 O O     . ALA B 1 94  ? 6.309   15.707  -0.074  1.00 50.84  ? 80   ALA B O     1 
ATOM   1839 C CB    . ALA B 1 94  ? 7.210   18.211  -1.981  1.00 45.90  ? 80   ALA B CB    1 
ATOM   1840 N N     . ARG B 1 95  ? 8.502   16.263  0.115   1.00 49.73  ? 81   ARG B N     1 
ATOM   1841 C CA    . ARG B 1 95  ? 8.954   14.902  0.349   1.00 52.88  ? 81   ARG B CA    1 
ATOM   1842 C C     . ARG B 1 95  ? 8.538   14.455  1.748   1.00 53.46  ? 81   ARG B C     1 
ATOM   1843 O O     . ARG B 1 95  ? 8.114   13.322  1.928   1.00 53.44  ? 81   ARG B O     1 
ATOM   1844 C CB    . ARG B 1 95  ? 10.479  14.809  0.141   1.00 53.18  ? 81   ARG B CB    1 
ATOM   1845 C CG    . ARG B 1 95  ? 11.065  13.400  0.138   1.00 54.71  ? 81   ARG B CG    1 
ATOM   1846 C CD    . ARG B 1 95  ? 11.394  12.905  1.541   1.00 55.31  ? 81   ARG B CD    1 
ATOM   1847 N NE    . ARG B 1 95  ? 12.568  12.005  1.607   1.00 57.60  ? 81   ARG B NE    1 
ATOM   1848 C CZ    . ARG B 1 95  ? 12.943  11.299  2.689   1.00 57.62  ? 81   ARG B CZ    1 
ATOM   1849 N NH1   . ARG B 1 95  ? 12.215  11.327  3.805   1.00 57.37  ? 81   ARG B NH1   1 
ATOM   1850 N NH2   . ARG B 1 95  ? 14.035  10.535  2.648   1.00 57.11  ? 81   ARG B NH2   1 
ATOM   1851 N N     . LEU B 1 96  ? 8.627   15.372  2.711   1.00 54.01  ? 82   LEU B N     1 
ATOM   1852 C CA    . LEU B 1 96  ? 8.234   15.097  4.088   1.00 55.71  ? 82   LEU B CA    1 
ATOM   1853 C C     . LEU B 1 96  ? 6.702   15.006  4.259   1.00 57.14  ? 82   LEU B C     1 
ATOM   1854 O O     . LEU B 1 96  ? 6.193   14.187  5.042   1.00 58.39  ? 82   LEU B O     1 
ATOM   1855 C CB    . LEU B 1 96  ? 8.795   16.161  5.020   1.00 56.39  ? 82   LEU B CB    1 
ATOM   1856 C CG    . LEU B 1 96  ? 10.320  16.282  5.071   1.00 57.62  ? 82   LEU B CG    1 
ATOM   1857 C CD1   . LEU B 1 96  ? 10.725  17.537  5.827   1.00 57.10  ? 82   LEU B CD1   1 
ATOM   1858 C CD2   . LEU B 1 96  ? 10.956  15.056  5.720   1.00 59.80  ? 82   LEU B CD2   1 
ATOM   1859 N N     . GLU B 1 97  ? 5.979   15.836  3.511   1.00 56.96  ? 83   GLU B N     1 
ATOM   1860 C CA    . GLU B 1 97  ? 4.522   15.757  3.437   1.00 57.69  ? 83   GLU B CA    1 
ATOM   1861 C C     . GLU B 1 97  ? 4.081   14.407  2.863   1.00 58.58  ? 83   GLU B C     1 
ATOM   1862 O O     . GLU B 1 97  ? 3.162   13.783  3.410   1.00 59.73  ? 83   GLU B O     1 
ATOM   1863 C CB    . GLU B 1 97  ? 3.974   16.896  2.581   1.00 58.43  ? 83   GLU B CB    1 
ATOM   1864 C CG    . GLU B 1 97  ? 2.466   17.090  2.638   1.00 60.60  ? 83   GLU B CG    1 
ATOM   1865 C CD    . GLU B 1 97  ? 2.046   18.416  2.021   1.00 62.36  ? 83   GLU B CD    1 
ATOM   1866 O OE1   . GLU B 1 97  ? 2.528   18.731  0.911   1.00 60.40  ? 83   GLU B OE1   1 
ATOM   1867 O OE2   . GLU B 1 97  ? 1.243   19.164  2.636   1.00 67.36  ? 83   GLU B OE2   1 
ATOM   1868 N N     . LYS B 1 98  ? 4.756   13.951  1.794   1.00 56.91  ? 84   LYS B N     1 
ATOM   1869 C CA    . LYS B 1 98  ? 4.462   12.647  1.177   1.00 56.56  ? 84   LYS B CA    1 
ATOM   1870 C C     . LYS B 1 98  ? 4.544   11.558  2.220   1.00 59.05  ? 84   LYS B C     1 
ATOM   1871 O O     . LYS B 1 98  ? 3.597   10.802  2.388   1.00 62.50  ? 84   LYS B O     1 
ATOM   1872 C CB    . LYS B 1 98  ? 5.358   12.325  -0.045  1.00 54.99  ? 84   LYS B CB    1 
ATOM   1873 C CG    . LYS B 1 98  ? 4.780   12.694  -1.408  1.00 54.54  ? 84   LYS B CG    1 
ATOM   1874 N N     . ASN B 1 99  ? 5.639   11.473  2.965   1.00 60.59  ? 85   ASN B N     1 
ATOM   1875 C CA    . ASN B 1 99  ? 5.697   10.409  3.971   1.00 62.74  ? 85   ASN B CA    1 
ATOM   1876 C C     . ASN B 1 99  ? 4.973   10.717  5.285   1.00 60.58  ? 85   ASN B C     1 
ATOM   1877 O O     . ASN B 1 99  ? 5.026   9.939   6.226   1.00 60.93  ? 85   ASN B O     1 
ATOM   1878 C CB    . ASN B 1 99  ? 7.127   9.816   4.170   1.00 65.96  ? 85   ASN B CB    1 
ATOM   1879 C CG    . ASN B 1 99  ? 8.237   10.845  4.113   1.00 64.26  ? 85   ASN B CG    1 
ATOM   1880 O OD1   . ASN B 1 99  ? 9.166   10.731  3.321   1.00 62.12  ? 85   ASN B OD1   1 
ATOM   1881 N ND2   . ASN B 1 99  ? 8.178   11.816  4.997   1.00 66.70  ? 85   ASN B ND2   1 
ATOM   1882 N N     . GLY B 1 100 ? 4.296   11.855  5.348   1.00 59.45  ? 86   GLY B N     1 
ATOM   1883 C CA    . GLY B 1 100 ? 3.365   12.117  6.442   1.00 60.65  ? 86   GLY B CA    1 
ATOM   1884 C C     . GLY B 1 100 ? 3.936   12.747  7.707   1.00 60.79  ? 86   GLY B C     1 
ATOM   1885 O O     . GLY B 1 100 ? 3.220   12.895  8.689   1.00 60.82  ? 86   GLY B O     1 
ATOM   1886 N N     . TRP B 1 101 ? 5.196   13.174  7.683   1.00 58.54  ? 87   TRP B N     1 
ATOM   1887 C CA    . TRP B 1 101 ? 5.790   13.768  8.871   1.00 57.56  ? 87   TRP B CA    1 
ATOM   1888 C C     . TRP B 1 101 ? 5.499   15.272  8.972   1.00 55.61  ? 87   TRP B C     1 
ATOM   1889 O O     . TRP B 1 101 ? 5.754   15.887  10.002  1.00 55.17  ? 87   TRP B O     1 
ATOM   1890 C CB    . TRP B 1 101 ? 7.302   13.470  8.905   1.00 57.40  ? 87   TRP B CB    1 
ATOM   1891 C CG    . TRP B 1 101 ? 7.580   11.957  8.853   1.00 58.54  ? 87   TRP B CG    1 
ATOM   1892 C CD1   . TRP B 1 101 ? 6.790   10.960  9.370   1.00 60.21  ? 87   TRP B CD1   1 
ATOM   1893 C CD2   . TRP B 1 101 ? 8.725   11.301  8.292   1.00 58.62  ? 87   TRP B CD2   1 
ATOM   1894 N NE1   . TRP B 1 101 ? 7.370   9.737   9.146   1.00 62.13  ? 87   TRP B NE1   1 
ATOM   1895 C CE2   . TRP B 1 101 ? 8.554   9.918   8.481   1.00 62.08  ? 87   TRP B CE2   1 
ATOM   1896 C CE3   . TRP B 1 101 ? 9.880   11.752  7.667   1.00 58.80  ? 87   TRP B CE3   1 
ATOM   1897 C CZ2   . TRP B 1 101 ? 9.507   8.976   8.058   1.00 64.20  ? 87   TRP B CZ2   1 
ATOM   1898 C CZ3   . TRP B 1 101 ? 10.818  10.826  7.237   1.00 60.53  ? 87   TRP B CZ3   1 
ATOM   1899 C CH2   . TRP B 1 101 ? 10.628  9.454   7.430   1.00 63.00  ? 87   TRP B CH2   1 
ATOM   1900 N N     . VAL B 1 102 ? 4.996   15.854  7.890   1.00 53.70  ? 88   VAL B N     1 
ATOM   1901 C CA    . VAL B 1 102 ? 4.741   17.292  7.812   1.00 52.32  ? 88   VAL B CA    1 
ATOM   1902 C C     . VAL B 1 102 ? 3.453   17.556  7.024   1.00 52.53  ? 88   VAL B C     1 
ATOM   1903 O O     . VAL B 1 102 ? 3.063   16.757  6.188   1.00 50.95  ? 88   VAL B O     1 
ATOM   1904 C CB    . VAL B 1 102 ? 5.928   18.030  7.162   1.00 49.80  ? 88   VAL B CB    1 
ATOM   1905 C CG1   . VAL B 1 102 ? 5.550   19.430  6.736   1.00 49.33  ? 88   VAL B CG1   1 
ATOM   1906 C CG2   . VAL B 1 102 ? 7.099   18.111  8.120   1.00 50.60  ? 88   VAL B CG2   1 
ATOM   1907 N N     . ARG B 1 103 ? 2.775   18.659  7.341   1.00 54.70  ? 89   ARG B N     1 
ATOM   1908 C CA    . ARG B 1 103 ? 1.625   19.120  6.556   1.00 57.01  ? 89   ARG B CA    1 
ATOM   1909 C C     . ARG B 1 103 ? 1.696   20.642  6.432   1.00 57.13  ? 89   ARG B C     1 
ATOM   1910 O O     . ARG B 1 103 ? 2.399   21.280  7.193   1.00 55.95  ? 89   ARG B O     1 
ATOM   1911 C CB    . ARG B 1 103 ? 0.298   18.682  7.189   1.00 58.08  ? 89   ARG B CB    1 
ATOM   1912 C CG    . ARG B 1 103 ? 0.036   19.281  8.555   1.00 59.26  ? 89   ARG B CG    1 
ATOM   1913 C CD    . ARG B 1 103 ? -1.267  18.770  9.160   1.00 61.55  ? 89   ARG B CD    1 
ATOM   1914 N NE    . ARG B 1 103 ? -1.524  19.390  10.457  1.00 62.55  ? 89   ARG B NE    1 
ATOM   1915 C CZ    . ARG B 1 103 ? -2.182  20.533  10.650  1.00 64.40  ? 89   ARG B CZ    1 
ATOM   1916 N NH1   . ARG B 1 103 ? -2.693  21.221  9.631   1.00 65.27  ? 89   ARG B NH1   1 
ATOM   1917 N NH2   . ARG B 1 103 ? -2.339  20.996  11.886  1.00 65.50  ? 89   ARG B NH2   1 
ATOM   1918 N N     . ARG B 1 104 ? 0.956   21.192  5.471   1.00 58.81  ? 90   ARG B N     1 
ATOM   1919 C CA    . ARG B 1 104 ? 0.952   22.628  5.197   1.00 60.19  ? 90   ARG B CA    1 
ATOM   1920 C C     . ARG B 1 104 ? -0.410  23.285  5.436   1.00 63.09  ? 90   ARG B C     1 
ATOM   1921 O O     . ARG B 1 104 ? -1.448  22.664  5.218   1.00 64.67  ? 90   ARG B O     1 
ATOM   1922 C CB    . ARG B 1 104 ? 1.340   22.868  3.748   1.00 59.24  ? 90   ARG B CB    1 
ATOM   1923 C CG    . ARG B 1 104 ? 2.811   22.642  3.441   1.00 57.66  ? 90   ARG B CG    1 
ATOM   1924 C CD    . ARG B 1 104 ? 2.977   21.927  2.108   1.00 57.41  ? 90   ARG B CD    1 
ATOM   1925 N NE    . ARG B 1 104 ? 4.108   22.423  1.338   1.00 57.21  ? 90   ARG B NE    1 
ATOM   1926 C CZ    . ARG B 1 104 ? 4.425   22.014  0.110   1.00 57.67  ? 90   ARG B CZ    1 
ATOM   1927 N NH1   . ARG B 1 104 ? 3.707   21.076  -0.504  1.00 58.74  ? 90   ARG B NH1   1 
ATOM   1928 N NH2   . ARG B 1 104 ? 5.471   22.546  -0.512  1.00 57.68  ? 90   ARG B NH2   1 
ATOM   1929 N N     . GLU B 1 105 ? -0.385  24.542  5.875   1.00 64.76  ? 91   GLU B N     1 
ATOM   1930 C CA    . GLU B 1 105 ? -1.585  25.389  5.992   1.00 69.19  ? 91   GLU B CA    1 
ATOM   1931 C C     . GLU B 1 105 ? -1.313  26.807  5.455   1.00 70.75  ? 91   GLU B C     1 
ATOM   1932 O O     . GLU B 1 105 ? -0.153  27.219  5.347   1.00 69.02  ? 91   GLU B O     1 
ATOM   1933 C CB    . GLU B 1 105 ? -2.030  25.501  7.452   1.00 70.88  ? 91   GLU B CB    1 
ATOM   1934 C CG    . GLU B 1 105 ? -3.041  24.457  7.888   1.00 74.21  ? 91   GLU B CG    1 
ATOM   1935 C CD    . GLU B 1 105 ? -3.554  24.680  9.305   1.00 76.94  ? 91   GLU B CD    1 
ATOM   1936 O OE1   . GLU B 1 105 ? -3.135  25.663  9.953   1.00 77.45  ? 91   GLU B OE1   1 
ATOM   1937 O OE2   . GLU B 1 105 ? -4.382  23.867  9.765   1.00 77.54  ? 91   GLU B OE2   1 
ATOM   1938 N N     . ASP B 1 106 ? -2.383  27.550  5.161   1.00 72.10  ? 92   ASP B N     1 
ATOM   1939 C CA    . ASP B 1 106 ? -2.273  28.930  4.674   1.00 73.54  ? 92   ASP B CA    1 
ATOM   1940 C C     . ASP B 1 106 ? -2.159  29.871  5.863   1.00 74.31  ? 92   ASP B C     1 
ATOM   1941 O O     . ASP B 1 106 ? -2.673  29.549  6.934   1.00 77.19  ? 92   ASP B O     1 
ATOM   1942 C CB    . ASP B 1 106 ? -3.502  29.343  3.842   1.00 75.74  ? 92   ASP B CB    1 
ATOM   1943 C CG    . ASP B 1 106 ? -3.980  28.258  2.886   1.00 75.86  ? 92   ASP B CG    1 
ATOM   1944 O OD1   . ASP B 1 106 ? -3.695  27.069  3.128   1.00 80.61  ? 92   ASP B OD1   1 
ATOM   1945 O OD2   . ASP B 1 106 ? -4.651  28.589  1.891   1.00 74.56  ? 92   ASP B OD2   1 
ATOM   1946 N N     . CYS B 1 107 ? -1.479  31.007  5.686   1.00 72.00  ? 93   CYS B N     1 
ATOM   1947 C CA    . CYS B 1 107 ? -1.501  32.064  6.684   1.00 73.35  ? 93   CYS B CA    1 
ATOM   1948 C C     . CYS B 1 107 ? -2.832  32.787  6.478   1.00 78.74  ? 93   CYS B C     1 
ATOM   1949 O O     . CYS B 1 107 ? -3.200  33.091  5.337   1.00 81.29  ? 93   CYS B O     1 
ATOM   1950 C CB    . CYS B 1 107 ? -0.318  33.031  6.531   1.00 71.09  ? 93   CYS B CB    1 
ATOM   1951 S SG    . CYS B 1 107 ? -0.235  34.325  7.801   1.00 70.06  ? 93   CYS B SG    1 
ATOM   1952 N N     . PRO B 1 108 ? -3.572  33.051  7.569   1.00 80.52  ? 94   PRO B N     1 
ATOM   1953 C CA    . PRO B 1 108 ? -4.894  33.643  7.381   1.00 83.37  ? 94   PRO B CA    1 
ATOM   1954 C C     . PRO B 1 108 ? -4.862  35.146  7.037   1.00 85.27  ? 94   PRO B C     1 
ATOM   1955 O O     . PRO B 1 108 ? -5.667  35.602  6.228   1.00 88.79  ? 94   PRO B O     1 
ATOM   1956 C CB    . PRO B 1 108 ? -5.597  33.374  8.722   1.00 86.03  ? 94   PRO B CB    1 
ATOM   1957 C CG    . PRO B 1 108 ? -4.512  33.157  9.724   1.00 84.29  ? 94   PRO B CG    1 
ATOM   1958 C CD    . PRO B 1 108 ? -3.223  32.881  8.992   1.00 80.43  ? 94   PRO B CD    1 
ATOM   1959 N N     . SER B 1 109 ? -3.943  35.901  7.637   1.00 84.04  ? 95   SER B N     1 
ATOM   1960 C CA    . SER B 1 109 ? -3.827  37.337  7.392   1.00 84.80  ? 95   SER B CA    1 
ATOM   1961 C C     . SER B 1 109 ? -3.166  37.654  6.050   1.00 83.33  ? 95   SER B C     1 
ATOM   1962 O O     . SER B 1 109 ? -3.466  38.669  5.421   1.00 86.71  ? 95   SER B O     1 
ATOM   1963 C CB    . SER B 1 109 ? -3.024  37.990  8.520   1.00 84.08  ? 95   SER B CB    1 
ATOM   1964 N N     . ASP B 1 110 ? -2.244  36.799  5.626   1.00 79.97  ? 96   ASP B N     1 
ATOM   1965 C CA    . ASP B 1 110 ? -1.478  37.020  4.400   1.00 76.81  ? 96   ASP B CA    1 
ATOM   1966 C C     . ASP B 1 110 ? -1.667  35.808  3.483   1.00 75.17  ? 96   ASP B C     1 
ATOM   1967 O O     . ASP B 1 110 ? -1.026  34.753  3.692   1.00 73.84  ? 96   ASP B O     1 
ATOM   1968 C CB    . ASP B 1 110 ? -0.001  37.211  4.760   1.00 74.91  ? 96   ASP B CB    1 
ATOM   1969 C CG    . ASP B 1 110 ? 0.829   37.788  3.619   1.00 74.28  ? 96   ASP B CG    1 
ATOM   1970 O OD1   . ASP B 1 110 ? 0.500   37.544  2.444   1.00 73.24  ? 96   ASP B OD1   1 
ATOM   1971 O OD2   . ASP B 1 110 ? 1.830   38.485  3.895   1.00 72.96  ? 96   ASP B OD2   1 
ATOM   1972 N N     . LYS B 1 111 ? -2.519  35.965  2.464   1.00 74.76  ? 97   LYS B N     1 
ATOM   1973 C CA    . LYS B 1 111 ? -2.929  34.864  1.589   1.00 73.96  ? 97   LYS B CA    1 
ATOM   1974 C C     . LYS B 1 111 ? -1.793  34.401  0.671   1.00 71.37  ? 97   LYS B C     1 
ATOM   1975 O O     . LYS B 1 111 ? -2.021  33.792  -0.375  1.00 73.21  ? 97   LYS B O     1 
ATOM   1976 C CB    . LYS B 1 111 ? -4.144  35.298  0.752   1.00 77.03  ? 97   LYS B CB    1 
ATOM   1977 N N     . ARG B 1 112 ? -0.567  34.638  1.128   1.00 69.24  ? 98   ARG B N     1 
ATOM   1978 C CA    . ARG B 1 112 ? 0.664   34.452  0.376   1.00 64.73  ? 98   ARG B CA    1 
ATOM   1979 C C     . ARG B 1 112 ? 1.548   33.457  1.111   1.00 61.99  ? 98   ARG B C     1 
ATOM   1980 O O     . ARG B 1 112 ? 2.212   32.625  0.508   1.00 61.35  ? 98   ARG B O     1 
ATOM   1981 C CB    . ARG B 1 112 ? 1.367   35.801  0.353   1.00 64.13  ? 98   ARG B CB    1 
ATOM   1982 C CG    . ARG B 1 112 ? 2.518   35.981  -0.622  1.00 60.46  ? 98   ARG B CG    1 
ATOM   1983 C CD    . ARG B 1 112 ? 2.502   37.404  -1.170  1.00 61.49  ? 98   ARG B CD    1 
ATOM   1984 N NE    . ARG B 1 112 ? 3.635   38.256  -0.753  1.00 59.47  ? 98   ARG B NE    1 
ATOM   1985 C CZ    . ARG B 1 112 ? 3.794   38.824  0.442   1.00 60.01  ? 98   ARG B CZ    1 
ATOM   1986 N NH1   . ARG B 1 112 ? 2.905   38.660  1.410   1.00 62.20  ? 98   ARG B NH1   1 
ATOM   1987 N NH2   . ARG B 1 112 ? 4.866   39.565  0.671   1.00 59.73  ? 98   ARG B NH2   1 
ATOM   1988 N N     . GLY B 1 113 ? 1.547   33.561  2.435   1.00 62.66  ? 99   GLY B N     1 
ATOM   1989 C CA    . GLY B 1 113 ? 2.344   32.708  3.297   1.00 60.72  ? 99   GLY B CA    1 
ATOM   1990 C C     . GLY B 1 113 ? 1.826   31.289  3.427   1.00 59.64  ? 99   GLY B C     1 
ATOM   1991 O O     . GLY B 1 113 ? 0.639   31.018  3.217   1.00 59.71  ? 99   GLY B O     1 
ATOM   1992 N N     . GLN B 1 114 ? 2.742   30.387  3.775   1.00 58.11  ? 100  GLN B N     1 
ATOM   1993 C CA    . GLN B 1 114 ? 2.413   29.002  4.069   1.00 57.13  ? 100  GLN B CA    1 
ATOM   1994 C C     . GLN B 1 114 ? 3.098   28.578  5.337   1.00 57.20  ? 100  GLN B C     1 
ATOM   1995 O O     . GLN B 1 114 ? 4.225   28.938  5.577   1.00 55.61  ? 100  GLN B O     1 
ATOM   1996 C CB    . GLN B 1 114 ? 2.838   28.070  2.944   1.00 55.15  ? 100  GLN B CB    1 
ATOM   1997 C CG    . GLN B 1 114 ? 2.000   28.277  1.683   1.00 56.94  ? 100  GLN B CG    1 
ATOM   1998 C CD    . GLN B 1 114 ? 0.588   27.714  1.849   1.00 59.26  ? 100  GLN B CD    1 
ATOM   1999 O OE1   . GLN B 1 114 ? -0.399  28.404  1.594   1.00 60.28  ? 100  GLN B OE1   1 
ATOM   2000 N NE2   . GLN B 1 114 ? 0.483   26.467  2.334   1.00 59.82  ? 100  GLN B NE2   1 
ATOM   2001 N N     . PHE B 1 115 ? 2.396   27.797  6.144   1.00 54.87  ? 101  PHE B N     1 
ATOM   2002 C CA    . PHE B 1 115 ? 2.979   27.209  7.335   1.00 53.92  ? 101  PHE B CA    1 
ATOM   2003 C C     . PHE B 1 115 ? 3.400   25.768  7.032   1.00 53.85  ? 101  PHE B C     1 
ATOM   2004 O O     . PHE B 1 115 ? 2.722   25.056  6.285   1.00 54.42  ? 101  PHE B O     1 
ATOM   2005 C CB    . PHE B 1 115 ? 1.968   27.223  8.481   1.00 55.60  ? 101  PHE B CB    1 
ATOM   2006 C CG    . PHE B 1 115 ? 1.908   28.525  9.229   1.00 56.54  ? 101  PHE B CG    1 
ATOM   2007 C CD1   . PHE B 1 115 ? 2.913   28.868  10.122  1.00 56.39  ? 101  PHE B CD1   1 
ATOM   2008 C CD2   . PHE B 1 115 ? 0.840   29.393  9.069   1.00 57.70  ? 101  PHE B CD2   1 
ATOM   2009 C CE1   . PHE B 1 115 ? 2.858   30.055  10.837  1.00 57.35  ? 101  PHE B CE1   1 
ATOM   2010 C CE2   . PHE B 1 115 ? 0.781   30.585  9.777   1.00 60.57  ? 101  PHE B CE2   1 
ATOM   2011 C CZ    . PHE B 1 115 ? 1.795   30.916  10.665  1.00 59.57  ? 101  PHE B CZ    1 
ATOM   2012 N N     . ALA B 1 116 ? 4.517   25.359  7.613   1.00 52.85  ? 102  ALA B N     1 
ATOM   2013 C CA    . ALA B 1 116 ? 4.921   23.962  7.675   1.00 53.19  ? 102  ALA B CA    1 
ATOM   2014 C C     . ALA B 1 116 ? 4.672   23.490  9.102   1.00 55.19  ? 102  ALA B C     1 
ATOM   2015 O O     . ALA B 1 116 ? 5.201   24.064  10.061  1.00 55.21  ? 102  ALA B O     1 
ATOM   2016 C CB    . ALA B 1 116 ? 6.386   23.821  7.340   1.00 52.98  ? 102  ALA B CB    1 
ATOM   2017 N N     . ILE B 1 117 ? 3.840   22.466  9.245   1.00 55.53  ? 103  ILE B N     1 
ATOM   2018 C CA    . ILE B 1 117 ? 3.433   21.989  10.550  1.00 54.99  ? 103  ILE B CA    1 
ATOM   2019 C C     . ILE B 1 117 ? 3.903   20.551  10.670  1.00 54.89  ? 103  ILE B C     1 
ATOM   2020 O O     . ILE B 1 117 ? 3.695   19.747  9.757   1.00 53.67  ? 103  ILE B O     1 
ATOM   2021 C CB    . ILE B 1 117 ? 1.908   22.038  10.705  1.00 56.75  ? 103  ILE B CB    1 
ATOM   2022 C CG1   . ILE B 1 117 ? 1.392   23.457  10.434  1.00 58.08  ? 103  ILE B CG1   1 
ATOM   2023 C CG2   . ILE B 1 117 ? 1.504   21.543  12.087  1.00 57.01  ? 103  ILE B CG2   1 
ATOM   2024 C CD1   . ILE B 1 117 ? -0.098  23.547  10.192  1.00 61.22  ? 103  ILE B CD1   1 
ATOM   2025 N N     . LEU B 1 118 ? 4.515   20.234  11.807  1.00 54.03  ? 104  LEU B N     1 
ATOM   2026 C CA    . LEU B 1 118 ? 4.931   18.875  12.120  1.00 53.36  ? 104  LEU B CA    1 
ATOM   2027 C C     . LEU B 1 118 ? 3.723   18.043  12.561  1.00 55.10  ? 104  LEU B C     1 
ATOM   2028 O O     . LEU B 1 118 ? 3.064   18.387  13.522  1.00 55.66  ? 104  LEU B O     1 
ATOM   2029 C CB    . LEU B 1 118 ? 5.969   18.917  13.252  1.00 52.13  ? 104  LEU B CB    1 
ATOM   2030 C CG    . LEU B 1 118 ? 6.523   17.618  13.827  1.00 50.92  ? 104  LEU B CG    1 
ATOM   2031 C CD1   . LEU B 1 118 ? 7.217   16.793  12.758  1.00 49.30  ? 104  LEU B CD1   1 
ATOM   2032 C CD2   . LEU B 1 118 ? 7.470   17.927  14.978  1.00 49.72  ? 104  LEU B CD2   1 
ATOM   2033 N N     . THR B 1 119 ? 3.450   16.938  11.870  1.00 56.62  ? 105  THR B N     1 
ATOM   2034 C CA    . THR B 1 119 ? 2.356   16.035  12.251  1.00 58.11  ? 105  THR B CA    1 
ATOM   2035 C C     . THR B 1 119 ? 2.676   15.286  13.533  1.00 59.78  ? 105  THR B C     1 
ATOM   2036 O O     . THR B 1 119 ? 3.827   15.267  13.969  1.00 58.72  ? 105  THR B O     1 
ATOM   2037 C CB    . THR B 1 119 ? 2.139   14.973  11.185  1.00 59.07  ? 105  THR B CB    1 
ATOM   2038 O OG1   . THR B 1 119 ? 3.348   14.214  11.030  1.00 58.03  ? 105  THR B OG1   1 
ATOM   2039 C CG2   . THR B 1 119 ? 1.750   15.611  9.848   1.00 59.45  ? 105  THR B CG2   1 
ATOM   2040 N N     . ASP B 1 120 ? 1.676   14.635  14.129  1.00 63.18  ? 106  ASP B N     1 
ATOM   2041 C CA    . ASP B 1 120 ? 1.935   13.704  15.243  1.00 64.54  ? 106  ASP B CA    1 
ATOM   2042 C C     . ASP B 1 120 ? 2.972   12.641  14.856  1.00 64.62  ? 106  ASP B C     1 
ATOM   2043 O O     . ASP B 1 120 ? 3.953   12.441  15.575  1.00 63.64  ? 106  ASP B O     1 
ATOM   2044 C CB    . ASP B 1 120 ? 0.662   12.991  15.707  1.00 67.77  ? 106  ASP B CB    1 
ATOM   2045 C CG    . ASP B 1 120 ? -0.267  13.889  16.511  1.00 70.32  ? 106  ASP B CG    1 
ATOM   2046 O OD1   . ASP B 1 120 ? 0.207   14.865  17.129  1.00 68.24  ? 106  ASP B OD1   1 
ATOM   2047 O OD2   . ASP B 1 120 ? -1.493  13.606  16.528  1.00 75.26  ? 106  ASP B OD2   1 
ATOM   2048 N N     . GLU B 1 121 ? 2.750   11.962  13.731  1.00 66.04  ? 107  GLU B N     1 
ATOM   2049 C CA    . GLU B 1 121 ? 3.641   10.862  13.302  1.00 67.63  ? 107  GLU B CA    1 
ATOM   2050 C C     . GLU B 1 121 ? 5.075   11.350  13.120  1.00 63.41  ? 107  GLU B C     1 
ATOM   2051 O O     . GLU B 1 121 ? 6.025   10.620  13.434  1.00 64.41  ? 107  GLU B O     1 
ATOM   2052 C CB    . GLU B 1 121 ? 3.134   10.122  12.052  1.00 69.21  ? 107  GLU B CB    1 
ATOM   2053 C CG    . GLU B 1 121 ? 2.617   10.994  10.957  1.00 71.30  ? 107  GLU B CG    1 
ATOM   2054 C CD    . GLU B 1 121 ? 1.226   11.581  11.168  1.00 75.31  ? 107  GLU B CD    1 
ATOM   2055 O OE1   . GLU B 1 121 ? 0.676   11.486  12.296  1.00 78.99  ? 107  GLU B OE1   1 
ATOM   2056 O OE2   . GLU B 1 121 ? 0.692   12.155  10.184  1.00 75.39  ? 107  GLU B OE2   1 
ATOM   2057 N N     . GLY B 1 122 ? 5.219   12.599  12.681  1.00 59.56  ? 108  GLY B N     1 
ATOM   2058 C CA    . GLY B 1 122 ? 6.522   13.221  12.539  1.00 56.79  ? 108  GLY B CA    1 
ATOM   2059 C C     . GLY B 1 122 ? 7.196   13.371  13.887  1.00 57.42  ? 108  GLY B C     1 
ATOM   2060 O O     . GLY B 1 122 ? 8.356   12.990  14.059  1.00 58.38  ? 108  GLY B O     1 
ATOM   2061 N N     . TYR B 1 123 ? 6.456   13.902  14.857  1.00 58.57  ? 109  TYR B N     1 
ATOM   2062 C CA    . TYR B 1 123 ? 6.921   13.958  16.242  1.00 58.71  ? 109  TYR B CA    1 
ATOM   2063 C C     . TYR B 1 123 ? 7.302   12.587  16.785  1.00 57.60  ? 109  TYR B C     1 
ATOM   2064 O O     . TYR B 1 123 ? 8.222   12.474  17.565  1.00 54.58  ? 109  TYR B O     1 
ATOM   2065 C CB    . TYR B 1 123 ? 5.851   14.560  17.133  1.00 62.35  ? 109  TYR B CB    1 
ATOM   2066 C CG    . TYR B 1 123 ? 6.348   15.015  18.474  1.00 64.06  ? 109  TYR B CG    1 
ATOM   2067 C CD1   . TYR B 1 123 ? 7.024   16.218  18.604  1.00 63.68  ? 109  TYR B CD1   1 
ATOM   2068 C CD2   . TYR B 1 123 ? 6.111   14.258  19.617  1.00 67.21  ? 109  TYR B CD2   1 
ATOM   2069 C CE1   . TYR B 1 123 ? 7.472   16.662  19.840  1.00 66.71  ? 109  TYR B CE1   1 
ATOM   2070 C CE2   . TYR B 1 123 ? 6.555   14.684  20.858  1.00 70.49  ? 109  TYR B CE2   1 
ATOM   2071 C CZ    . TYR B 1 123 ? 7.229   15.891  20.968  1.00 70.09  ? 109  TYR B CZ    1 
ATOM   2072 O OH    . TYR B 1 123 ? 7.655   16.318  22.205  1.00 72.31  ? 109  TYR B OH    1 
ATOM   2073 N N     . GLU B 1 124 ? 6.587   11.546  16.374  1.00 60.27  ? 110  GLU B N     1 
ATOM   2074 C CA    . GLU B 1 124 ? 6.908   10.190  16.824  1.00 61.90  ? 110  GLU B CA    1 
ATOM   2075 C C     . GLU B 1 124 ? 8.211   9.648   16.222  1.00 59.44  ? 110  GLU B C     1 
ATOM   2076 O O     . GLU B 1 124 ? 8.882   8.849   16.858  1.00 59.93  ? 110  GLU B O     1 
ATOM   2077 C CB    . GLU B 1 124 ? 5.751   9.222   16.568  1.00 64.50  ? 110  GLU B CB    1 
ATOM   2078 C CG    . GLU B 1 124 ? 4.888   9.020   17.798  1.00 67.26  ? 110  GLU B CG    1 
ATOM   2079 C CD    . GLU B 1 124 ? 5.659   8.376   18.931  1.00 68.23  ? 110  GLU B CD    1 
ATOM   2080 O OE1   . GLU B 1 124 ? 6.404   7.389   18.676  1.00 66.58  ? 110  GLU B OE1   1 
ATOM   2081 O OE2   . GLU B 1 124 ? 5.528   8.877   20.072  1.00 68.41  ? 110  GLU B OE2   1 
ATOM   2082 N N     . VAL B 1 125 ? 8.570   10.095  15.022  1.00 56.96  ? 111  VAL B N     1 
ATOM   2083 C CA    . VAL B 1 125 ? 9.867   9.737   14.424  1.00 54.47  ? 111  VAL B CA    1 
ATOM   2084 C C     . VAL B 1 125 ? 11.026  10.429  15.145  1.00 52.03  ? 111  VAL B C     1 
ATOM   2085 O O     . VAL B 1 125 ? 12.127  9.861   15.261  1.00 51.47  ? 111  VAL B O     1 
ATOM   2086 C CB    . VAL B 1 125 ? 9.937   10.086  12.926  1.00 53.79  ? 111  VAL B CB    1 
ATOM   2087 C CG1   . VAL B 1 125 ? 11.328  9.798   12.368  1.00 54.29  ? 111  VAL B CG1   1 
ATOM   2088 C CG2   . VAL B 1 125 ? 8.923   9.288   12.155  1.00 54.62  ? 111  VAL B CG2   1 
ATOM   2089 N N     . LEU B 1 126 ? 10.796  11.640  15.640  1.00 50.80  ? 112  LEU B N     1 
ATOM   2090 C CA    . LEU B 1 126 ? 11.828  12.305  16.427  1.00 50.72  ? 112  LEU B CA    1 
ATOM   2091 C C     . LEU B 1 126 ? 12.032  11.561  17.724  1.00 52.74  ? 112  LEU B C     1 
ATOM   2092 O O     . LEU B 1 126 ? 13.166  11.252  18.087  1.00 53.94  ? 112  LEU B O     1 
ATOM   2093 C CB    . LEU B 1 126 ? 11.476  13.747  16.734  1.00 49.74  ? 112  LEU B CB    1 
ATOM   2094 C CG    . LEU B 1 126 ? 11.887  14.715  15.645  1.00 48.71  ? 112  LEU B CG    1 
ATOM   2095 C CD1   . LEU B 1 126 ? 11.057  14.447  14.426  1.00 49.80  ? 112  LEU B CD1   1 
ATOM   2096 C CD2   . LEU B 1 126 ? 11.690  16.153  16.098  1.00 50.66  ? 112  LEU B CD2   1 
ATOM   2097 N N     . ARG B 1 127 ? 10.934  11.283  18.422  1.00 54.92  ? 113  ARG B N     1 
ATOM   2098 C CA    . ARG B 1 127 ? 11.001  10.604  19.699  1.00 58.46  ? 113  ARG B CA    1 
ATOM   2099 C C     . ARG B 1 127 ? 11.729  9.263   19.525  1.00 56.54  ? 113  ARG B C     1 
ATOM   2100 O O     . ARG B 1 127 ? 12.577  8.900   20.348  1.00 55.02  ? 113  ARG B O     1 
ATOM   2101 C CB    . ARG B 1 127 ? 9.596   10.405  20.296  1.00 64.58  ? 113  ARG B CB    1 
ATOM   2102 C CG    . ARG B 1 127 ? 9.582   10.178  21.810  1.00 70.55  ? 113  ARG B CG    1 
ATOM   2103 C CD    . ARG B 1 127 ? 8.192   9.862   22.373  1.00 77.30  ? 113  ARG B CD    1 
ATOM   2104 N NE    . ARG B 1 127 ? 7.590   8.632   21.853  1.00 82.42  ? 113  ARG B NE    1 
ATOM   2105 C CZ    . ARG B 1 127 ? 7.993   7.388   22.133  1.00 85.98  ? 113  ARG B CZ    1 
ATOM   2106 N NH1   . ARG B 1 127 ? 9.040   7.159   22.920  1.00 87.13  ? 113  ARG B NH1   1 
ATOM   2107 N NH2   . ARG B 1 127 ? 7.348   6.355   21.603  1.00 89.08  ? 113  ARG B NH2   1 
ATOM   2108 N N     . ARG B 1 128 ? 11.393  8.546   18.454  1.00 53.98  ? 114  ARG B N     1 
ATOM   2109 C CA    . ARG B 1 128 ? 12.011  7.257   18.173  1.00 54.36  ? 114  ARG B CA    1 
ATOM   2110 C C     . ARG B 1 128 ? 13.528  7.381   17.887  1.00 53.24  ? 114  ARG B C     1 
ATOM   2111 O O     . ARG B 1 128 ? 14.322  6.596   18.412  1.00 53.36  ? 114  ARG B O     1 
ATOM   2112 C CB    . ARG B 1 128 ? 11.276  6.543   17.027  1.00 53.98  ? 114  ARG B CB    1 
ATOM   2113 N N     . THR B 1 129 ? 13.934  8.390   17.121  1.00 52.45  ? 115  THR B N     1 
ATOM   2114 C CA    . THR B 1 129 ? 15.300  8.432   16.588  1.00 54.61  ? 115  THR B CA    1 
ATOM   2115 C C     . THR B 1 129 ? 16.309  9.368   17.289  1.00 52.78  ? 115  THR B C     1 
ATOM   2116 O O     . THR B 1 129 ? 17.499  9.060   17.339  1.00 53.82  ? 115  THR B O     1 
ATOM   2117 C CB    . THR B 1 129 ? 15.267  8.820   15.107  1.00 55.38  ? 115  THR B CB    1 
ATOM   2118 O OG1   . THR B 1 129 ? 14.745  10.149  14.995  1.00 58.44  ? 115  THR B OG1   1 
ATOM   2119 C CG2   . THR B 1 129 ? 14.402  7.846   14.320  1.00 56.38  ? 115  THR B CG2   1 
ATOM   2120 N N     . ALA B 1 130 ? 15.844  10.493  17.811  1.00 51.94  ? 116  ALA B N     1 
ATOM   2121 C CA    . ALA B 1 130 ? 16.723  11.457  18.464  1.00 53.28  ? 116  ALA B CA    1 
ATOM   2122 C C     . ALA B 1 130 ? 17.828  10.854  19.342  1.00 55.36  ? 116  ALA B C     1 
ATOM   2123 O O     . ALA B 1 130 ? 18.992  11.180  19.138  1.00 57.64  ? 116  ALA B O     1 
ATOM   2124 C CB    . ALA B 1 130 ? 15.922  12.466  19.272  1.00 54.80  ? 116  ALA B CB    1 
ATOM   2125 N N     . PRO B 1 131 ? 17.479  9.993   20.324  1.00 56.36  ? 117  PRO B N     1 
ATOM   2126 C CA    . PRO B 1 131 ? 18.531  9.346   21.133  1.00 56.35  ? 117  PRO B CA    1 
ATOM   2127 C C     . PRO B 1 131 ? 19.676  8.759   20.310  1.00 56.27  ? 117  PRO B C     1 
ATOM   2128 O O     . PRO B 1 131 ? 20.837  8.969   20.650  1.00 58.18  ? 117  PRO B O     1 
ATOM   2129 C CB    . PRO B 1 131 ? 17.790  8.222   21.871  1.00 58.79  ? 117  PRO B CB    1 
ATOM   2130 C CG    . PRO B 1 131 ? 16.320  8.443   21.639  1.00 59.34  ? 117  PRO B CG    1 
ATOM   2131 C CD    . PRO B 1 131 ? 16.133  9.708   20.849  1.00 56.71  ? 117  PRO B CD    1 
ATOM   2132 N N     . GLY B 1 132 ? 19.352  8.029   19.245  1.00 54.87  ? 118  GLY B N     1 
ATOM   2133 C CA    . GLY B 1 132 ? 20.364  7.552   18.320  1.00 53.43  ? 118  GLY B CA    1 
ATOM   2134 C C     . GLY B 1 132 ? 21.183  8.714   17.781  1.00 52.13  ? 118  GLY B C     1 
ATOM   2135 O O     . GLY B 1 132 ? 22.416  8.745   17.920  1.00 51.23  ? 118  GLY B O     1 
ATOM   2136 N N     . HIS B 1 133 ? 20.505  9.679   17.170  1.00 49.56  ? 119  HIS B N     1 
ATOM   2137 C CA    . HIS B 1 133 ? 21.198  10.806  16.575  1.00 49.03  ? 119  HIS B CA    1 
ATOM   2138 C C     . HIS B 1 133 ? 22.027  11.602  17.581  1.00 50.02  ? 119  HIS B C     1 
ATOM   2139 O O     . HIS B 1 133 ? 23.127  12.088  17.248  1.00 51.64  ? 119  HIS B O     1 
ATOM   2140 C CB    . HIS B 1 133 ? 20.232  11.750  15.877  1.00 47.73  ? 119  HIS B CB    1 
ATOM   2141 C CG    . HIS B 1 133 ? 20.905  12.957  15.301  1.00 46.52  ? 119  HIS B CG    1 
ATOM   2142 N ND1   . HIS B 1 133 ? 21.741  12.893  14.210  1.00 46.73  ? 119  HIS B ND1   1 
ATOM   2143 C CD2   . HIS B 1 133 ? 20.878  14.256  15.682  1.00 45.95  ? 119  HIS B CD2   1 
ATOM   2144 C CE1   . HIS B 1 133 ? 22.204  14.104  13.947  1.00 47.88  ? 119  HIS B CE1   1 
ATOM   2145 N NE2   . HIS B 1 133 ? 21.686  14.951  14.817  1.00 45.62  ? 119  HIS B NE2   1 
ATOM   2146 N N     . VAL B 1 134 ? 21.519  11.737  18.802  1.00 49.00  ? 120  VAL B N     1 
ATOM   2147 C CA    . VAL B 1 134 ? 22.267  12.417  19.847  1.00 48.83  ? 120  VAL B CA    1 
ATOM   2148 C C     . VAL B 1 134 ? 23.550  11.658  20.170  1.00 49.41  ? 120  VAL B C     1 
ATOM   2149 O O     . VAL B 1 134 ? 24.613  12.251  20.199  1.00 50.20  ? 120  VAL B O     1 
ATOM   2150 C CB    . VAL B 1 134 ? 21.392  12.673  21.097  1.00 49.65  ? 120  VAL B CB    1 
ATOM   2151 C CG1   . VAL B 1 134 ? 22.227  13.155  22.279  1.00 50.35  ? 120  VAL B CG1   1 
ATOM   2152 C CG2   . VAL B 1 134 ? 20.337  13.713  20.765  1.00 49.04  ? 120  VAL B CG2   1 
ATOM   2153 N N     . ASP B 1 135 ? 23.457  10.352  20.408  1.00 52.44  ? 121  ASP B N     1 
ATOM   2154 C CA    . ASP B 1 135 ? 24.647  9.509   20.611  1.00 54.59  ? 121  ASP B CA    1 
ATOM   2155 C C     . ASP B 1 135 ? 25.690  9.792   19.543  1.00 54.23  ? 121  ASP B C     1 
ATOM   2156 O O     . ASP B 1 135 ? 26.823  10.153  19.854  1.00 54.01  ? 121  ASP B O     1 
ATOM   2157 C CB    . ASP B 1 135 ? 24.306  8.002   20.530  1.00 56.84  ? 121  ASP B CB    1 
ATOM   2158 C CG    . ASP B 1 135 ? 23.724  7.452   21.794  1.00 59.27  ? 121  ASP B CG    1 
ATOM   2159 O OD1   . ASP B 1 135 ? 23.408  8.243   22.684  1.00 58.36  ? 121  ASP B OD1   1 
ATOM   2160 O OD2   . ASP B 1 135 ? 23.530  6.218   21.864  1.00 63.68  ? 121  ASP B OD2   1 
ATOM   2161 N N     . ALA B 1 136 ? 25.297  9.600   18.288  1.00 53.86  ? 122  ALA B N     1 
ATOM   2162 C CA    . ALA B 1 136 ? 26.212  9.765   17.151  1.00 56.73  ? 122  ALA B CA    1 
ATOM   2163 C C     . ALA B 1 136 ? 26.909  11.130  17.162  1.00 56.67  ? 122  ALA B C     1 
ATOM   2164 O O     . ALA B 1 136 ? 28.091  11.218  16.872  1.00 60.65  ? 122  ALA B O     1 
ATOM   2165 C CB    . ALA B 1 136 ? 25.470  9.549   15.835  1.00 56.50  ? 122  ALA B CB    1 
ATOM   2166 N N     . VAL B 1 137 ? 26.173  12.173  17.523  1.00 55.71  ? 123  VAL B N     1 
ATOM   2167 C CA    . VAL B 1 137 ? 26.725  13.514  17.637  1.00 55.41  ? 123  VAL B CA    1 
ATOM   2168 C C     . VAL B 1 137 ? 27.601  13.673  18.885  1.00 56.74  ? 123  VAL B C     1 
ATOM   2169 O O     . VAL B 1 137 ? 28.571  14.417  18.863  1.00 57.32  ? 123  VAL B O     1 
ATOM   2170 C CB    . VAL B 1 137 ? 25.600  14.573  17.644  1.00 56.40  ? 123  VAL B CB    1 
ATOM   2171 C CG1   . VAL B 1 137 ? 26.144  15.956  17.986  1.00 57.61  ? 123  VAL B CG1   1 
ATOM   2172 C CG2   . VAL B 1 137 ? 24.917  14.604  16.283  1.00 56.69  ? 123  VAL B CG2   1 
ATOM   2173 N N     . ARG B 1 138 ? 27.252  12.995  19.975  1.00 55.32  ? 124  ARG B N     1 
ATOM   2174 C CA    . ARG B 1 138 ? 28.122  12.945  21.129  1.00 56.65  ? 124  ARG B CA    1 
ATOM   2175 C C     . ARG B 1 138 ? 29.446  12.283  20.802  1.00 57.63  ? 124  ARG B C     1 
ATOM   2176 O O     . ARG B 1 138 ? 30.505  12.869  20.995  1.00 57.29  ? 124  ARG B O     1 
ATOM   2177 C CB    . ARG B 1 138 ? 27.486  12.140  22.250  1.00 58.41  ? 124  ARG B CB    1 
ATOM   2178 C CG    . ARG B 1 138 ? 26.558  12.914  23.142  1.00 59.29  ? 124  ARG B CG    1 
ATOM   2179 C CD    . ARG B 1 138 ? 26.312  12.062  24.390  1.00 60.10  ? 124  ARG B CD    1 
ATOM   2180 N NE    . ARG B 1 138 ? 27.322  11.003  24.600  1.00 60.83  ? 124  ARG B NE    1 
ATOM   2181 C CZ    . ARG B 1 138 ? 27.196  9.692   24.315  1.00 61.39  ? 124  ARG B CZ    1 
ATOM   2182 N NH1   . ARG B 1 138 ? 26.071  9.166   23.817  1.00 59.51  ? 124  ARG B NH1   1 
ATOM   2183 N NH2   . ARG B 1 138 ? 28.227  8.875   24.543  1.00 62.59  ? 124  ARG B NH2   1 
ATOM   2184 N N     . GLN B 1 139 ? 29.362  11.044  20.305  1.00 57.96  ? 125  GLN B N     1 
ATOM   2185 C CA    . GLN B 1 139 ? 30.525  10.173  20.138  1.00 57.82  ? 125  GLN B CA    1 
ATOM   2186 C C     . GLN B 1 139 ? 31.511  10.755  19.145  1.00 58.34  ? 125  GLN B C     1 
ATOM   2187 O O     . GLN B 1 139 ? 32.723  10.724  19.377  1.00 60.72  ? 125  GLN B O     1 
ATOM   2188 C CB    . GLN B 1 139 ? 30.067  8.762   19.779  1.00 57.97  ? 125  GLN B CB    1 
ATOM   2189 C CG    . GLN B 1 139 ? 29.510  8.050   21.008  1.00 58.92  ? 125  GLN B CG    1 
ATOM   2190 C CD    . GLN B 1 139 ? 28.905  6.694   20.721  1.00 60.57  ? 125  GLN B CD    1 
ATOM   2191 O OE1   . GLN B 1 139 ? 28.457  6.413   19.609  1.00 61.90  ? 125  GLN B OE1   1 
ATOM   2192 N NE2   . GLN B 1 139 ? 28.840  5.857   21.751  1.00 62.29  ? 125  GLN B NE2   1 
ATOM   2193 N N     . ALA B 1 140 ? 30.992  11.375  18.091  1.00 56.91  ? 126  ALA B N     1 
ATOM   2194 C CA    . ALA B 1 140 ? 31.830  12.019  17.092  1.00 57.65  ? 126  ALA B CA    1 
ATOM   2195 C C     . ALA B 1 140 ? 32.471  13.315  17.589  1.00 58.80  ? 126  ALA B C     1 
ATOM   2196 O O     . ALA B 1 140 ? 33.563  13.666  17.147  1.00 62.03  ? 126  ALA B O     1 
ATOM   2197 C CB    . ALA B 1 140 ? 31.012  12.298  15.839  1.00 56.59  ? 126  ALA B CB    1 
ATOM   2198 N N     . VAL B 1 141 ? 31.792  14.038  18.475  1.00 57.91  ? 127  VAL B N     1 
ATOM   2199 C CA    . VAL B 1 141 ? 32.215  15.394  18.832  1.00 59.51  ? 127  VAL B CA    1 
ATOM   2200 C C     . VAL B 1 141 ? 32.406  15.606  20.327  1.00 61.87  ? 127  VAL B C     1 
ATOM   2201 O O     . VAL B 1 141 ? 33.531  15.640  20.804  1.00 65.12  ? 127  VAL B O     1 
ATOM   2202 C CB    . VAL B 1 141 ? 31.221  16.445  18.289  1.00 56.72  ? 127  VAL B CB    1 
ATOM   2203 C CG1   . VAL B 1 141 ? 31.633  17.850  18.702  1.00 56.91  ? 127  VAL B CG1   1 
ATOM   2204 C CG2   . VAL B 1 141 ? 31.129  16.342  16.779  1.00 56.09  ? 127  VAL B CG2   1 
ATOM   2205 N N     . PHE B 1 142 ? 31.313  15.726  21.075  1.00 63.19  ? 128  PHE B N     1 
ATOM   2206 C CA    . PHE B 1 142 ? 31.382  16.262  22.451  1.00 64.78  ? 128  PHE B CA    1 
ATOM   2207 C C     . PHE B 1 142 ? 32.138  15.397  23.451  1.00 65.76  ? 128  PHE B C     1 
ATOM   2208 O O     . PHE B 1 142 ? 32.878  15.918  24.277  1.00 68.41  ? 128  PHE B O     1 
ATOM   2209 C CB    . PHE B 1 142 ? 29.987  16.620  22.947  1.00 63.69  ? 128  PHE B CB    1 
ATOM   2210 C CG    . PHE B 1 142 ? 29.367  17.744  22.163  1.00 63.37  ? 128  PHE B CG    1 
ATOM   2211 C CD1   . PHE B 1 142 ? 29.726  19.060  22.417  1.00 64.55  ? 128  PHE B CD1   1 
ATOM   2212 C CD2   . PHE B 1 142 ? 28.461  17.486  21.161  1.00 62.09  ? 128  PHE B CD2   1 
ATOM   2213 C CE1   . PHE B 1 142 ? 29.169  20.098  21.707  1.00 64.64  ? 128  PHE B CE1   1 
ATOM   2214 C CE2   . PHE B 1 142 ? 27.896  18.524  20.442  1.00 62.33  ? 128  PHE B CE2   1 
ATOM   2215 C CZ    . PHE B 1 142 ? 28.255  19.830  20.712  1.00 63.60  ? 128  PHE B CZ    1 
ATOM   2216 N N     . ASP B 1 143 ? 31.986  14.083  23.353  1.00 64.82  ? 129  ASP B N     1 
ATOM   2217 C CA    . ASP B 1 143 ? 32.774  13.171  24.171  1.00 67.21  ? 129  ASP B CA    1 
ATOM   2218 C C     . ASP B 1 143 ? 34.287  13.298  23.950  1.00 70.09  ? 129  ASP B C     1 
ATOM   2219 O O     . ASP B 1 143 ? 35.061  12.781  24.748  1.00 72.36  ? 129  ASP B O     1 
ATOM   2220 C CB    . ASP B 1 143 ? 32.363  11.721  23.909  1.00 67.42  ? 129  ASP B CB    1 
ATOM   2221 C CG    . ASP B 1 143 ? 31.067  11.342  24.598  1.00 68.22  ? 129  ASP B CG    1 
ATOM   2222 O OD1   . ASP B 1 143 ? 30.601  12.087  25.504  1.00 66.36  ? 129  ASP B OD1   1 
ATOM   2223 O OD2   . ASP B 1 143 ? 30.508  10.280  24.210  1.00 69.02  ? 129  ASP B OD2   1 
ATOM   2224 N N     . ARG B 1 144 ? 34.711  13.981  22.887  1.00 70.71  ? 130  ARG B N     1 
ATOM   2225 C CA    . ARG B 1 144 ? 36.139  14.083  22.524  1.00 70.49  ? 130  ARG B CA    1 
ATOM   2226 C C     . ARG B 1 144 ? 36.787  15.437  22.828  1.00 67.11  ? 130  ARG B C     1 
ATOM   2227 O O     . ARG B 1 144 ? 37.996  15.598  22.628  1.00 69.49  ? 130  ARG B O     1 
ATOM   2228 C CB    . ARG B 1 144 ? 36.317  13.787  21.032  1.00 70.40  ? 130  ARG B CB    1 
ATOM   2229 C CG    . ARG B 1 144 ? 35.649  12.493  20.593  1.00 72.16  ? 130  ARG B CG    1 
ATOM   2230 C CD    . ARG B 1 144 ? 36.109  12.054  19.209  1.00 72.91  ? 130  ARG B CD    1 
ATOM   2231 N NE    . ARG B 1 144 ? 36.627  10.687  19.218  1.00 74.46  ? 130  ARG B NE    1 
ATOM   2232 C CZ    . ARG B 1 144 ? 36.161  9.669   18.495  1.00 78.72  ? 130  ARG B CZ    1 
ATOM   2233 N NH1   . ARG B 1 144 ? 35.132  9.814   17.649  1.00 78.18  ? 130  ARG B NH1   1 
ATOM   2234 N NH2   . ARG B 1 144 ? 36.750  8.479   18.609  1.00 82.01  ? 130  ARG B NH2   1 
ATOM   2235 N N     . LEU B 1 145 ? 36.009  16.390  23.325  1.00 63.79  ? 131  LEU B N     1 
ATOM   2236 C CA    . LEU B 1 145 ? 36.515  17.736  23.572  1.00 63.72  ? 131  LEU B CA    1 
ATOM   2237 C C     . LEU B 1 145 ? 36.334  18.143  25.020  1.00 63.69  ? 131  LEU B C     1 
ATOM   2238 O O     . LEU B 1 145 ? 35.289  17.892  25.602  1.00 64.74  ? 131  LEU B O     1 
ATOM   2239 C CB    . LEU B 1 145 ? 35.784  18.735  22.681  1.00 62.27  ? 131  LEU B CB    1 
ATOM   2240 C CG    . LEU B 1 145 ? 35.693  18.341  21.208  1.00 61.68  ? 131  LEU B CG    1 
ATOM   2241 C CD1   . LEU B 1 145 ? 34.736  19.273  20.492  1.00 60.92  ? 131  LEU B CD1   1 
ATOM   2242 C CD2   . LEU B 1 145 ? 37.058  18.360  20.554  1.00 62.09  ? 131  LEU B CD2   1 
ATOM   2243 N N     . THR B 1 146 ? 37.351  18.786  25.590  1.00 65.62  ? 132  THR B N     1 
ATOM   2244 C CA    . THR B 1 146 ? 37.254  19.334  26.948  1.00 68.38  ? 132  THR B CA    1 
ATOM   2245 C C     . THR B 1 146 ? 36.253  20.504  26.924  1.00 67.06  ? 132  THR B C     1 
ATOM   2246 O O     . THR B 1 146 ? 35.962  21.054  25.850  1.00 67.02  ? 132  THR B O     1 
ATOM   2247 C CB    . THR B 1 146 ? 38.633  19.726  27.596  1.00 71.42  ? 132  THR B CB    1 
ATOM   2248 O OG1   . THR B 1 146 ? 38.412  20.360  28.874  1.00 74.53  ? 132  THR B OG1   1 
ATOM   2249 C CG2   . THR B 1 146 ? 39.459  20.672  26.706  1.00 69.22  ? 132  THR B CG2   1 
ATOM   2250 N N     . PRO B 1 147 ? 35.653  20.831  28.085  1.00 67.69  ? 133  PRO B N     1 
ATOM   2251 C CA    . PRO B 1 147 ? 34.812  22.027  28.197  1.00 67.67  ? 133  PRO B CA    1 
ATOM   2252 C C     . PRO B 1 147 ? 35.406  23.283  27.537  1.00 66.13  ? 133  PRO B C     1 
ATOM   2253 O O     . PRO B 1 147 ? 34.709  23.976  26.796  1.00 65.08  ? 133  PRO B O     1 
ATOM   2254 C CB    . PRO B 1 147 ? 34.677  22.223  29.722  1.00 70.83  ? 133  PRO B CB    1 
ATOM   2255 C CG    . PRO B 1 147 ? 35.140  20.945  30.363  1.00 71.92  ? 133  PRO B CG    1 
ATOM   2256 C CD    . PRO B 1 147 ? 35.505  19.970  29.270  1.00 70.04  ? 133  PRO B CD    1 
ATOM   2257 N N     . GLU B 1 148 ? 36.685  23.556  27.779  1.00 66.89  ? 134  GLU B N     1 
ATOM   2258 C CA    . GLU B 1 148 ? 37.350  24.710  27.163  1.00 67.64  ? 134  GLU B CA    1 
ATOM   2259 C C     . GLU B 1 148 ? 37.161  24.747  25.632  1.00 66.45  ? 134  GLU B C     1 
ATOM   2260 O O     . GLU B 1 148 ? 36.870  25.812  25.068  1.00 68.25  ? 134  GLU B O     1 
ATOM   2261 C CB    . GLU B 1 148 ? 38.845  24.748  27.530  1.00 68.51  ? 134  GLU B CB    1 
ATOM   2262 N N     . GLN B 1 149 ? 37.274  23.590  24.973  1.00 64.60  ? 135  GLN B N     1 
ATOM   2263 C CA    . GLN B 1 149 ? 37.210  23.518  23.499  1.00 61.90  ? 135  GLN B CA    1 
ATOM   2264 C C     . GLN B 1 149 ? 35.790  23.581  22.995  1.00 61.20  ? 135  GLN B C     1 
ATOM   2265 O O     . GLN B 1 149 ? 35.534  24.100  21.912  1.00 62.50  ? 135  GLN B O     1 
ATOM   2266 C CB    . GLN B 1 149 ? 37.844  22.240  22.935  1.00 60.53  ? 135  GLN B CB    1 
ATOM   2267 C CG    . GLN B 1 149 ? 38.811  21.538  23.841  1.00 61.37  ? 135  GLN B CG    1 
ATOM   2268 C CD    . GLN B 1 149 ? 39.718  20.616  23.084  1.00 60.27  ? 135  GLN B CD    1 
ATOM   2269 O OE1   . GLN B 1 149 ? 39.641  19.387  23.222  1.00 60.92  ? 135  GLN B OE1   1 
ATOM   2270 N NE2   . GLN B 1 149 ? 40.619  21.194  22.314  1.00 59.74  ? 135  GLN B NE2   1 
ATOM   2271 N N     . GLN B 1 150 ? 34.874  22.981  23.737  1.00 61.67  ? 136  GLN B N     1 
ATOM   2272 C CA    . GLN B 1 150 ? 33.459  23.106  23.417  1.00 61.79  ? 136  GLN B CA    1 
ATOM   2273 C C     . GLN B 1 150 ? 33.070  24.575  23.460  1.00 63.45  ? 136  GLN B C     1 
ATOM   2274 O O     . GLN B 1 150 ? 32.417  25.064  22.544  1.00 62.42  ? 136  GLN B O     1 
ATOM   2275 C CB    . GLN B 1 150 ? 32.612  22.319  24.401  1.00 61.43  ? 136  GLN B CB    1 
ATOM   2276 C CG    . GLN B 1 150 ? 32.794  20.823  24.283  1.00 62.08  ? 136  GLN B CG    1 
ATOM   2277 C CD    . GLN B 1 150 ? 31.933  20.057  25.271  1.00 62.44  ? 136  GLN B CD    1 
ATOM   2278 O OE1   . GLN B 1 150 ? 31.023  20.616  25.874  1.00 61.28  ? 136  GLN B OE1   1 
ATOM   2279 N NE2   . GLN B 1 150 ? 32.199  18.759  25.409  1.00 63.09  ? 136  GLN B NE2   1 
ATOM   2280 N N     . LYS B 1 151 ? 33.488  25.273  24.519  1.00 65.49  ? 137  LYS B N     1 
ATOM   2281 C CA    . LYS B 1 151 ? 33.282  26.719  24.605  1.00 66.15  ? 137  LYS B CA    1 
ATOM   2282 C C     . LYS B 1 151 ? 33.880  27.335  23.352  1.00 64.41  ? 137  LYS B C     1 
ATOM   2283 O O     . LYS B 1 151 ? 33.194  28.030  22.614  1.00 63.84  ? 137  LYS B O     1 
ATOM   2284 C CB    . LYS B 1 151 ? 33.931  27.301  25.881  1.00 68.78  ? 137  LYS B CB    1 
ATOM   2285 C CG    . LYS B 1 151 ? 33.448  28.685  26.335  1.00 69.45  ? 137  LYS B CG    1 
ATOM   2286 C CD    . LYS B 1 151 ? 34.066  29.039  27.685  1.00 71.02  ? 137  LYS B CD    1 
ATOM   2287 C CE    . LYS B 1 151 ? 34.487  30.500  27.771  1.00 72.72  ? 137  LYS B CE    1 
ATOM   2288 N NZ    . LYS B 1 151 ? 35.768  30.654  28.525  1.00 73.28  ? 137  LYS B NZ    1 
ATOM   2289 N N     . SER B 1 152 ? 35.147  27.012  23.095  1.00 64.71  ? 138  SER B N     1 
ATOM   2290 C CA    . SER B 1 152 ? 35.924  27.621  22.003  1.00 64.25  ? 138  SER B CA    1 
ATOM   2291 C C     . SER B 1 152 ? 35.313  27.393  20.604  1.00 61.39  ? 138  SER B C     1 
ATOM   2292 O O     . SER B 1 152 ? 35.219  28.323  19.807  1.00 59.33  ? 138  SER B O     1 
ATOM   2293 C CB    . SER B 1 152 ? 37.357  27.100  22.040  1.00 65.01  ? 138  SER B CB    1 
ATOM   2294 O OG    . SER B 1 152 ? 38.194  27.878  21.207  1.00 66.72  ? 138  SER B OG    1 
ATOM   2295 N N     . LEU B 1 153 ? 34.875  26.163  20.337  1.00 59.62  ? 139  LEU B N     1 
ATOM   2296 C CA    . LEU B 1 153 ? 34.185  25.804  19.089  1.00 57.35  ? 139  LEU B CA    1 
ATOM   2297 C C     . LEU B 1 153 ? 32.978  26.699  18.804  1.00 56.64  ? 139  LEU B C     1 
ATOM   2298 O O     . LEU B 1 153 ? 32.829  27.222  17.701  1.00 56.64  ? 139  LEU B O     1 
ATOM   2299 C CB    . LEU B 1 153 ? 33.694  24.364  19.168  1.00 57.51  ? 139  LEU B CB    1 
ATOM   2300 C CG    . LEU B 1 153 ? 32.932  23.764  17.990  1.00 57.88  ? 139  LEU B CG    1 
ATOM   2301 C CD1   . LEU B 1 153 ? 33.659  23.980  16.694  1.00 57.80  ? 139  LEU B CD1   1 
ATOM   2302 C CD2   . LEU B 1 153 ? 32.683  22.274  18.187  1.00 59.44  ? 139  LEU B CD2   1 
ATOM   2303 N N     . GLY B 1 154 ? 32.114  26.869  19.805  1.00 55.21  ? 140  GLY B N     1 
ATOM   2304 C CA    . GLY B 1 154 ? 30.892  27.647  19.642  1.00 54.39  ? 140  GLY B CA    1 
ATOM   2305 C C     . GLY B 1 154 ? 31.142  29.116  19.408  1.00 54.50  ? 140  GLY B C     1 
ATOM   2306 O O     . GLY B 1 154 ? 30.470  29.738  18.589  1.00 52.80  ? 140  GLY B O     1 
ATOM   2307 N N     . GLU B 1 155 ? 32.117  29.674  20.124  1.00 56.82  ? 141  GLU B N     1 
ATOM   2308 C CA    . GLU B 1 155 ? 32.519  31.059  19.898  1.00 58.44  ? 141  GLU B CA    1 
ATOM   2309 C C     . GLU B 1 155 ? 32.980  31.200  18.468  1.00 59.48  ? 141  GLU B C     1 
ATOM   2310 O O     . GLU B 1 155 ? 32.634  32.164  17.794  1.00 61.01  ? 141  GLU B O     1 
ATOM   2311 C CB    . GLU B 1 155 ? 33.640  31.504  20.842  1.00 62.07  ? 141  GLU B CB    1 
ATOM   2312 C CG    . GLU B 1 155 ? 33.425  31.087  22.283  1.00 64.17  ? 141  GLU B CG    1 
ATOM   2313 C CD    . GLU B 1 155 ? 34.223  31.907  23.272  1.00 67.93  ? 141  GLU B CD    1 
ATOM   2314 O OE1   . GLU B 1 155 ? 35.469  31.755  23.335  1.00 68.75  ? 141  GLU B OE1   1 
ATOM   2315 O OE2   . GLU B 1 155 ? 33.567  32.697  24.008  1.00 71.13  ? 141  GLU B OE2   1 
ATOM   2316 N N     . ILE B 1 156 ? 33.744  30.211  17.999  1.00 59.87  ? 142  ILE B N     1 
ATOM   2317 C CA    . ILE B 1 156 ? 34.343  30.256  16.672  1.00 59.88  ? 142  ILE B CA    1 
ATOM   2318 C C     . ILE B 1 156 ? 33.305  30.153  15.565  1.00 59.89  ? 142  ILE B C     1 
ATOM   2319 O O     . ILE B 1 156 ? 33.313  30.963  14.633  1.00 62.34  ? 142  ILE B O     1 
ATOM   2320 C CB    . ILE B 1 156 ? 35.426  29.171  16.503  1.00 58.84  ? 142  ILE B CB    1 
ATOM   2321 C CG1   . ILE B 1 156 ? 36.660  29.551  17.333  1.00 60.20  ? 142  ILE B CG1   1 
ATOM   2322 C CG2   . ILE B 1 156 ? 35.832  29.028  15.043  1.00 58.78  ? 142  ILE B CG2   1 
ATOM   2323 C CD1   . ILE B 1 156 ? 37.635  28.424  17.563  1.00 60.41  ? 142  ILE B CD1   1 
ATOM   2324 N N     . MET B 1 157 ? 32.426  29.160  15.648  1.00 57.64  ? 143  MET B N     1 
ATOM   2325 C CA    . MET B 1 157 ? 31.464  28.948  14.575  1.00 57.24  ? 143  MET B CA    1 
ATOM   2326 C C     . MET B 1 157 ? 30.456  30.093  14.516  1.00 58.07  ? 143  MET B C     1 
ATOM   2327 O O     . MET B 1 157 ? 30.114  30.548  13.438  1.00 61.70  ? 143  MET B O     1 
ATOM   2328 C CB    . MET B 1 157 ? 30.779  27.592  14.706  1.00 56.87  ? 143  MET B CB    1 
ATOM   2329 C CG    . MET B 1 157 ? 31.734  26.406  14.601  1.00 56.48  ? 143  MET B CG    1 
ATOM   2330 S SD    . MET B 1 157 ? 32.768  26.377  13.112  1.00 57.21  ? 143  MET B SD    1 
ATOM   2331 C CE    . MET B 1 157 ? 33.807  24.991  13.542  1.00 58.67  ? 143  MET B CE    1 
ATOM   2332 N N     . ARG B 1 158 ? 30.057  30.608  15.671  1.00 58.64  ? 144  ARG B N     1 
ATOM   2333 C CA    . ARG B 1 158 ? 29.141  31.762  15.761  1.00 59.02  ? 144  ARG B CA    1 
ATOM   2334 C C     . ARG B 1 158 ? 29.674  32.984  14.987  1.00 58.65  ? 144  ARG B C     1 
ATOM   2335 O O     . ARG B 1 158 ? 28.926  33.658  14.298  1.00 57.40  ? 144  ARG B O     1 
ATOM   2336 C CB    . ARG B 1 158 ? 28.851  32.051  17.265  1.00 59.64  ? 144  ARG B CB    1 
ATOM   2337 C CG    . ARG B 1 158 ? 27.797  33.082  17.709  1.00 61.89  ? 144  ARG B CG    1 
ATOM   2338 C CD    . ARG B 1 158 ? 27.374  32.876  19.180  1.00 61.06  ? 144  ARG B CD    1 
ATOM   2339 N N     . ILE B 1 159 ? 30.972  33.240  15.077  1.00 60.38  ? 145  ILE B N     1 
ATOM   2340 C CA    . ILE B 1 159 ? 31.597  34.344  14.330  1.00 62.31  ? 145  ILE B CA    1 
ATOM   2341 C C     . ILE B 1 159 ? 31.533  34.096  12.821  1.00 61.81  ? 145  ILE B C     1 
ATOM   2342 O O     . ILE B 1 159 ? 31.165  34.991  12.044  1.00 60.29  ? 145  ILE B O     1 
ATOM   2343 C CB    . ILE B 1 159 ? 33.083  34.514  14.689  1.00 64.35  ? 145  ILE B CB    1 
ATOM   2344 C CG1   . ILE B 1 159 ? 33.254  34.894  16.167  1.00 65.52  ? 145  ILE B CG1   1 
ATOM   2345 C CG2   . ILE B 1 159 ? 33.716  35.574  13.798  1.00 67.73  ? 145  ILE B CG2   1 
ATOM   2346 C CD1   . ILE B 1 159 ? 34.617  34.537  16.723  1.00 66.12  ? 145  ILE B CD1   1 
ATOM   2347 N N     . VAL B 1 160 ? 31.917  32.878  12.424  1.00 59.40  ? 146  VAL B N     1 
ATOM   2348 C CA    . VAL B 1 160 ? 31.879  32.459  11.028  1.00 58.03  ? 146  VAL B CA    1 
ATOM   2349 C C     . VAL B 1 160 ? 30.465  32.597  10.474  1.00 56.70  ? 146  VAL B C     1 
ATOM   2350 O O     . VAL B 1 160 ? 30.277  33.136  9.390   1.00 59.00  ? 146  VAL B O     1 
ATOM   2351 C CB    . VAL B 1 160 ? 32.376  31.014  10.869  1.00 57.40  ? 146  VAL B CB    1 
ATOM   2352 C CG1   . VAL B 1 160 ? 32.068  30.477  9.474   1.00 57.31  ? 146  VAL B CG1   1 
ATOM   2353 C CG2   . VAL B 1 160 ? 33.869  30.938  11.148  1.00 58.16  ? 146  VAL B CG2   1 
ATOM   2354 N N     . ALA B 1 161 ? 29.476  32.138  11.233  1.00 55.17  ? 147  ALA B N     1 
ATOM   2355 C CA    . ALA B 1 161 ? 28.073  32.256  10.827  1.00 55.79  ? 147  ALA B CA    1 
ATOM   2356 C C     . ALA B 1 161 ? 27.617  33.715  10.781  1.00 58.29  ? 147  ALA B C     1 
ATOM   2357 O O     . ALA B 1 161 ? 27.188  34.193  9.732   1.00 61.83  ? 147  ALA B O     1 
ATOM   2358 C CB    . ALA B 1 161 ? 27.186  31.467  11.756  1.00 55.18  ? 147  ALA B CB    1 
ATOM   2359 N N     . GLU B 1 162 ? 27.777  34.439  11.889  1.00 57.46  ? 148  GLU B N     1 
ATOM   2360 C CA    . GLU B 1 162 ? 27.504  35.876  11.904  1.00 59.61  ? 148  GLU B CA    1 
ATOM   2361 C C     . GLU B 1 162 ? 28.110  36.551  10.666  1.00 61.93  ? 148  GLU B C     1 
ATOM   2362 O O     . GLU B 1 162 ? 27.459  37.359  10.012  1.00 61.09  ? 148  GLU B O     1 
ATOM   2363 C CB    . GLU B 1 162 ? 28.010  36.545  13.197  1.00 60.82  ? 148  GLU B CB    1 
ATOM   2364 N N     . GLY B 1 163 ? 29.356  36.201  10.345  1.00 64.00  ? 149  GLY B N     1 
ATOM   2365 C CA    . GLY B 1 163 ? 30.077  36.812  9.224   1.00 66.87  ? 149  GLY B CA    1 
ATOM   2366 C C     . GLY B 1 163 ? 29.425  36.586  7.874   1.00 67.58  ? 149  GLY B C     1 
ATOM   2367 O O     . GLY B 1 163 ? 29.525  37.429  6.979   1.00 71.05  ? 149  GLY B O     1 
ATOM   2368 N N     . LEU B 1 164 ? 28.761  35.445  7.731   1.00 65.19  ? 150  LEU B N     1 
ATOM   2369 C CA    . LEU B 1 164 ? 28.201  35.032  6.450   1.00 65.13  ? 150  LEU B CA    1 
ATOM   2370 C C     . LEU B 1 164 ? 26.742  35.405  6.308   1.00 64.51  ? 150  LEU B C     1 
ATOM   2371 O O     . LEU B 1 164 ? 26.152  35.226  5.244   1.00 63.99  ? 150  LEU B O     1 
ATOM   2372 C CB    . LEU B 1 164 ? 28.368  33.521  6.271   1.00 63.98  ? 150  LEU B CB    1 
ATOM   2373 C CG    . LEU B 1 164 ? 29.768  33.097  5.846   1.00 64.36  ? 150  LEU B CG    1 
ATOM   2374 C CD1   . LEU B 1 164 ? 30.067  31.680  6.306   1.00 63.09  ? 150  LEU B CD1   1 
ATOM   2375 C CD2   . LEU B 1 164 ? 29.906  33.235  4.335   1.00 65.95  ? 150  LEU B CD2   1 
ATOM   2376 N N     . GLN B 1 165 ? 26.154  35.937  7.365   1.00 65.22  ? 151  GLN B N     1 
ATOM   2377 C CA    . GLN B 1 165 ? 24.801  36.468  7.264   1.00 67.11  ? 151  GLN B CA    1 
ATOM   2378 C C     . GLN B 1 165 ? 24.729  37.870  7.865   1.00 70.54  ? 151  GLN B C     1 
ATOM   2379 O O     . GLN B 1 165 ? 24.093  38.075  8.899   1.00 74.07  ? 151  GLN B O     1 
ATOM   2380 C CB    . GLN B 1 165 ? 23.780  35.508  7.894   1.00 64.85  ? 151  GLN B CB    1 
ATOM   2381 C CG    . GLN B 1 165 ? 24.185  34.947  9.247   1.00 64.57  ? 151  GLN B CG    1 
ATOM   2382 C CD    . GLN B 1 165 ? 23.149  34.021  9.866   1.00 62.42  ? 151  GLN B CD    1 
ATOM   2383 O OE1   . GLN B 1 165 ? 22.219  33.575  9.202   1.00 60.31  ? 151  GLN B OE1   1 
ATOM   2384 N NE2   . GLN B 1 165 ? 23.295  33.755  11.153  1.00 60.50  ? 151  GLN B NE2   1 
ATOM   2385 N N     . PRO B 1 166 ? 25.386  38.849  7.214   1.00 71.67  ? 152  PRO B N     1 
ATOM   2386 C CA    . PRO B 1 166 ? 25.281  40.207  7.740   1.00 75.18  ? 152  PRO B CA    1 
ATOM   2387 C C     . PRO B 1 166 ? 23.897  40.813  7.439   1.00 76.10  ? 152  PRO B C     1 
ATOM   2388 O O     . PRO B 1 166 ? 23.212  40.346  6.527   1.00 71.86  ? 152  PRO B O     1 
ATOM   2389 C CB    . PRO B 1 166 ? 26.412  40.957  6.996   1.00 76.55  ? 152  PRO B CB    1 
ATOM   2390 C CG    . PRO B 1 166 ? 26.571  40.220  5.712   1.00 74.92  ? 152  PRO B CG    1 
ATOM   2391 C CD    . PRO B 1 166 ? 26.241  38.782  6.012   1.00 71.80  ? 152  PRO B CD    1 
ATOM   2392 N N     . SER B 1 167 ? 23.517  41.853  8.186   1.00 79.66  ? 153  SER B N     1 
ATOM   2393 C CA    . SER B 1 167 ? 22.248  42.563  7.962   1.00 82.35  ? 153  SER B CA    1 
ATOM   2394 C C     . SER B 1 167 ? 22.252  43.454  6.697   1.00 85.36  ? 153  SER B C     1 
ATOM   2395 O O     . SER B 1 167 ? 21.194  43.886  6.244   1.00 85.13  ? 153  SER B O     1 
ATOM   2396 C CB    . SER B 1 167 ? 21.900  43.411  9.196   1.00 82.03  ? 153  SER B CB    1 
ATOM   2397 N N     . GLU B 1 168 ? 23.437  43.701  6.135   1.00 87.21  ? 154  GLU B N     1 
ATOM   2398 C CA    . GLU B 1 168 ? 23.655  44.724  5.083   1.00 91.91  ? 154  GLU B CA    1 
ATOM   2399 C C     . GLU B 1 168 ? 22.851  44.685  3.753   1.00 94.84  ? 154  GLU B C     1 
ATOM   2400 O O     . GLU B 1 168 ? 23.440  44.480  2.701   1.00 97.93  ? 154  GLU B O     1 
ATOM   2401 C CB    . GLU B 1 168 ? 25.163  44.812  4.759   1.00 91.84  ? 154  GLU B CB    1 
ATOM   2402 N N     . ALA B 1 169 ? 21.530  44.909  3.807   1.00 97.04  ? 155  ALA B N     1 
ATOM   2403 C CA    . ALA B 1 169 ? 20.708  45.410  2.660   1.00 100.26 ? 155  ALA B CA    1 
ATOM   2404 C C     . ALA B 1 169 ? 20.399  44.441  1.494   1.00 100.93 ? 155  ALA B C     1 
ATOM   2405 O O     . ALA B 1 169 ? 19.291  43.897  1.424   1.00 101.35 ? 155  ALA B O     1 
ATOM   2406 C CB    . ALA B 1 169 ? 21.276  46.726  2.120   1.00 103.12 ? 155  ALA B CB    1 
ATOM   2407 N N     . GLY B 1 170 ? 21.358  44.255  0.582   1.00 101.47 ? 156  GLY B N     1 
ATOM   2408 C CA    . GLY B 1 170 ? 21.166  43.467  -0.638  1.00 98.88  ? 156  GLY B CA    1 
ATOM   2409 C C     . GLY B 1 170 ? 21.951  42.161  -0.619  1.00 95.44  ? 156  GLY B C     1 
ATOM   2410 O O     . GLY B 1 170 ? 22.329  41.670  -1.685  1.00 93.28  ? 156  GLY B O     1 
ATOM   2411 N N     . ALA B 1 171 ? 22.209  41.610  0.578   1.00 90.46  ? 157  ALA B N     1 
ATOM   2412 C CA    . ALA B 1 171 ? 23.133  40.438  0.723   1.00 87.89  ? 157  ALA B CA    1 
ATOM   2413 C C     . ALA B 1 171 ? 22.515  39.134  0.208   1.00 83.97  ? 157  ALA B C     1 
ATOM   2414 O O     . ALA B 1 171 ? 21.288  39.008  0.064   1.00 84.13  ? 157  ALA B O     1 
ATOM   2415 C CB    . ALA B 1 171 ? 23.651  40.262  2.168   1.00 87.30  ? 157  ALA B CB    1 
ATOM   2416 N N     . ASP B 1 172 ? 23.381  38.157  -0.038  1.00 81.31  ? 158  ASP B N     1 
ATOM   2417 C CA    . ASP B 1 172 ? 23.039  36.970  -0.806  1.00 79.00  ? 158  ASP B CA    1 
ATOM   2418 C C     . ASP B 1 172 ? 22.691  35.812  0.133   1.00 74.72  ? 158  ASP B C     1 
ATOM   2419 O O     . ASP B 1 172 ? 23.301  34.744  0.080   1.00 75.64  ? 158  ASP B O     1 
ATOM   2420 C CB    . ASP B 1 172 ? 24.207  36.607  -1.736  1.00 78.76  ? 158  ASP B CB    1 
ATOM   2421 C CG    . ASP B 1 172 ? 23.879  35.449  -2.650  1.00 78.19  ? 158  ASP B CG    1 
ATOM   2422 O OD1   . ASP B 1 172 ? 22.673  35.198  -2.871  1.00 78.26  ? 158  ASP B OD1   1 
ATOM   2423 O OD2   . ASP B 1 172 ? 24.812  34.772  -3.132  1.00 76.91  ? 158  ASP B OD2   1 
ATOM   2424 N N     . LEU B 1 173 ? 21.713  36.037  1.005   1.00 70.83  ? 159  LEU B N     1 
ATOM   2425 C CA    . LEU B 1 173 ? 21.320  35.031  1.981   1.00 66.78  ? 159  LEU B CA    1 
ATOM   2426 C C     . LEU B 1 173 ? 20.405  34.019  1.311   1.00 64.74  ? 159  LEU B C     1 
ATOM   2427 O O     . LEU B 1 173 ? 19.470  34.411  0.606   1.00 67.38  ? 159  LEU B O     1 
ATOM   2428 C CB    . LEU B 1 173 ? 20.620  35.693  3.177   1.00 66.60  ? 159  LEU B CB    1 
ATOM   2429 C CG    . LEU B 1 173 ? 21.400  36.836  3.852   1.00 66.86  ? 159  LEU B CG    1 
ATOM   2430 C CD1   . LEU B 1 173 ? 20.601  37.518  4.949   1.00 65.99  ? 159  LEU B CD1   1 
ATOM   2431 C CD2   . LEU B 1 173 ? 22.727  36.348  4.408   1.00 65.08  ? 159  LEU B CD2   1 
ATOM   2432 N N     . PRO B 1 174 ? 20.671  32.715  1.514   1.00 60.89  ? 160  PRO B N     1 
ATOM   2433 C CA    . PRO B 1 174 ? 19.929  31.619  0.855   1.00 59.96  ? 160  PRO B CA    1 
ATOM   2434 C C     . PRO B 1 174 ? 18.410  31.803  0.847   1.00 59.42  ? 160  PRO B C     1 
ATOM   2435 O O     . PRO B 1 174 ? 17.758  31.620  -0.176  1.00 60.71  ? 160  PRO B O     1 
ATOM   2436 C CB    . PRO B 1 174 ? 20.298  30.389  1.698   1.00 57.27  ? 160  PRO B CB    1 
ATOM   2437 C CG    . PRO B 1 174 ? 21.620  30.711  2.288   1.00 57.01  ? 160  PRO B CG    1 
ATOM   2438 C CD    . PRO B 1 174 ? 21.703  32.201  2.431   1.00 58.45  ? 160  PRO B CD    1 
ATOM   2439 N N     . TRP B 1 175 ? 17.862  32.160  1.996   1.00 58.11  ? 161  TRP B N     1 
ATOM   2440 C CA    . TRP B 1 175 ? 16.416  32.226  2.164   1.00 58.23  ? 161  TRP B CA    1 
ATOM   2441 C C     . TRP B 1 175 ? 15.797  33.474  1.525   1.00 60.15  ? 161  TRP B C     1 
ATOM   2442 O O     . TRP B 1 175 ? 14.578  33.580  1.418   1.00 58.83  ? 161  TRP B O     1 
ATOM   2443 C CB    . TRP B 1 175 ? 16.054  32.148  3.635   1.00 56.53  ? 161  TRP B CB    1 
ATOM   2444 C CG    . TRP B 1 175 ? 16.741  33.155  4.486   1.00 56.24  ? 161  TRP B CG    1 
ATOM   2445 C CD1   . TRP B 1 175 ? 16.261  34.371  4.861   1.00 56.65  ? 161  TRP B CD1   1 
ATOM   2446 C CD2   . TRP B 1 175 ? 18.024  33.026  5.093   1.00 54.51  ? 161  TRP B CD2   1 
ATOM   2447 N NE1   . TRP B 1 175 ? 17.166  35.012  5.663   1.00 56.71  ? 161  TRP B NE1   1 
ATOM   2448 C CE2   . TRP B 1 175 ? 18.257  34.204  5.825   1.00 54.92  ? 161  TRP B CE2   1 
ATOM   2449 C CE3   . TRP B 1 175 ? 19.000  32.035  5.087   1.00 53.42  ? 161  TRP B CE3   1 
ATOM   2450 C CZ2   . TRP B 1 175 ? 19.420  34.420  6.533   1.00 54.28  ? 161  TRP B CZ2   1 
ATOM   2451 C CZ3   . TRP B 1 175 ? 20.162  32.248  5.809   1.00 53.71  ? 161  TRP B CZ3   1 
ATOM   2452 C CH2   . TRP B 1 175 ? 20.361  33.430  6.519   1.00 53.49  ? 161  TRP B CH2   1 
ATOM   2453 N N     . LEU B 1 176 ? 16.649  34.401  1.085   1.00 61.39  ? 162  LEU B N     1 
ATOM   2454 C CA    . LEU B 1 176 ? 16.213  35.548  0.285   1.00 62.39  ? 162  LEU B CA    1 
ATOM   2455 C C     . LEU B 1 176 ? 16.518  35.367  -1.196  1.00 64.23  ? 162  LEU B C     1 
ATOM   2456 O O     . LEU B 1 176 ? 16.398  36.305  -1.976  1.00 66.62  ? 162  LEU B O     1 
ATOM   2457 C CB    . LEU B 1 176 ? 16.859  36.829  0.809   1.00 61.89  ? 162  LEU B CB    1 
ATOM   2458 C CG    . LEU B 1 176 ? 16.635  37.123  2.286   1.00 59.83  ? 162  LEU B CG    1 
ATOM   2459 C CD1   . LEU B 1 176 ? 17.313  38.439  2.626   1.00 60.83  ? 162  LEU B CD1   1 
ATOM   2460 C CD2   . LEU B 1 176 ? 15.155  37.158  2.624   1.00 60.00  ? 162  LEU B CD2   1 
ATOM   2461 N N     . ARG B 1 177 ? 16.883  34.157  -1.592  1.00 64.63  ? 163  ARG B N     1 
ATOM   2462 C CA    . ARG B 1 177 ? 17.184  33.888  -2.985  1.00 67.27  ? 163  ARG B CA    1 
ATOM   2463 C C     . ARG B 1 177 ? 15.848  33.724  -3.688  1.00 68.81  ? 163  ARG B C     1 
ATOM   2464 O O     . ARG B 1 177 ? 14.791  33.885  -3.056  1.00 69.45  ? 163  ARG B O     1 
ATOM   2465 C CB    . ARG B 1 177 ? 18.017  32.611  -3.147  1.00 67.93  ? 163  ARG B CB    1 
ATOM   2466 C CG    . ARG B 1 177 ? 19.233  32.786  -4.030  1.00 70.34  ? 163  ARG B CG    1 
ATOM   2467 C CD    . ARG B 1 177 ? 20.471  33.016  -3.195  1.00 69.89  ? 163  ARG B CD    1 
ATOM   2468 N NE    . ARG B 1 177 ? 21.108  31.754  -2.853  1.00 70.43  ? 163  ARG B NE    1 
ATOM   2469 C CZ    . ARG B 1 177 ? 22.145  31.616  -2.025  1.00 70.50  ? 163  ARG B CZ    1 
ATOM   2470 N NH1   . ARG B 1 177 ? 22.687  32.661  -1.423  1.00 70.46  ? 163  ARG B NH1   1 
ATOM   2471 N NH2   . ARG B 1 177 ? 22.634  30.407  -1.790  1.00 70.64  ? 163  ARG B NH2   1 
ATOM   2472 O OXT   . ARG B 1 177 ? 15.795  33.444  -4.881  1.00 70.46  ? 163  ARG B OXT   1 
ATOM   2473 O "O5'" . DA  C 2 1   ? 32.960  -15.734 -4.151  1.00 76.04  ? 1    DA  C "O5'" 1 
ATOM   2474 C "C5'" . DA  C 2 1   ? 33.349  -15.784 -2.761  1.00 78.23  ? 1    DA  C "C5'" 1 
ATOM   2475 C "C4'" . DA  C 2 1   ? 34.737  -15.213 -2.547  1.00 77.35  ? 1    DA  C "C4'" 1 
ATOM   2476 O "O4'" . DA  C 2 1   ? 35.596  -15.515 -3.672  1.00 77.44  ? 1    DA  C "O4'" 1 
ATOM   2477 C "C3'" . DA  C 2 1   ? 34.820  -13.707 -2.312  1.00 72.39  ? 1    DA  C "C3'" 1 
ATOM   2478 O "O3'" . DA  C 2 1   ? 35.291  -13.465 -0.984  1.00 77.13  ? 1    DA  C "O3'" 1 
ATOM   2479 C "C2'" . DA  C 2 1   ? 35.826  -13.198 -3.329  1.00 70.57  ? 1    DA  C "C2'" 1 
ATOM   2480 C "C1'" . DA  C 2 1   ? 36.422  -14.420 -4.006  1.00 72.26  ? 1    DA  C "C1'" 1 
ATOM   2481 N N9    . DA  C 2 1   ? 36.476  -14.346 -5.465  1.00 68.21  ? 1    DA  C N9    1 
ATOM   2482 C C8    . DA  C 2 1   ? 35.516  -14.752 -6.361  1.00 66.79  ? 1    DA  C C8    1 
ATOM   2483 N N7    . DA  C 2 1   ? 35.854  -14.578 -7.614  1.00 65.44  ? 1    DA  C N7    1 
ATOM   2484 C C5    . DA  C 2 1   ? 37.122  -14.020 -7.542  1.00 65.15  ? 1    DA  C C5    1 
ATOM   2485 C C6    . DA  C 2 1   ? 38.022  -13.592 -8.532  1.00 63.79  ? 1    DA  C C6    1 
ATOM   2486 N N6    . DA  C 2 1   ? 37.773  -13.670 -9.842  1.00 61.16  ? 1    DA  C N6    1 
ATOM   2487 N N1    . DA  C 2 1   ? 39.200  -13.067 -8.125  1.00 64.82  ? 1    DA  C N1    1 
ATOM   2488 C C2    . DA  C 2 1   ? 39.448  -12.993 -6.808  1.00 66.47  ? 1    DA  C C2    1 
ATOM   2489 N N3    . DA  C 2 1   ? 38.685  -13.373 -5.783  1.00 67.27  ? 1    DA  C N3    1 
ATOM   2490 C C4    . DA  C 2 1   ? 37.520  -13.878 -6.224  1.00 66.66  ? 1    DA  C C4    1 
ATOM   2491 P P     . DA  C 2 2   ? 34.948  -12.073 -0.236  1.00 77.96  ? 2    DA  C P     1 
ATOM   2492 O OP1   . DA  C 2 2   ? 35.179  -12.274 1.223   1.00 84.12  ? 2    DA  C OP1   1 
ATOM   2493 O OP2   . DA  C 2 2   ? 33.627  -11.600 -0.712  1.00 71.50  ? 2    DA  C OP2   1 
ATOM   2494 O "O5'" . DA  C 2 2   ? 36.087  -11.101 -0.776  1.00 74.50  ? 2    DA  C "O5'" 1 
ATOM   2495 C "C5'" . DA  C 2 2   ? 37.474  -11.367 -0.457  1.00 77.92  ? 2    DA  C "C5'" 1 
ATOM   2496 C "C4'" . DA  C 2 2   ? 38.376  -10.348 -1.112  1.00 75.22  ? 2    DA  C "C4'" 1 
ATOM   2497 O "O4'" . DA  C 2 2   ? 38.404  -10.552 -2.547  1.00 72.05  ? 2    DA  C "O4'" 1 
ATOM   2498 C "C3'" . DA  C 2 2   ? 37.965  -8.891  -0.901  1.00 72.32  ? 2    DA  C "C3'" 1 
ATOM   2499 O "O3'" . DA  C 2 2   ? 39.169  -8.168  -0.610  1.00 73.32  ? 2    DA  C "O3'" 1 
ATOM   2500 C "C2'" . DA  C 2 2   ? 37.279  -8.531  -2.210  1.00 67.54  ? 2    DA  C "C2'" 1 
ATOM   2501 C "C1'" . DA  C 2 2   ? 38.054  -9.359  -3.223  1.00 67.42  ? 2    DA  C "C1'" 1 
ATOM   2502 N N9    . DA  C 2 2   ? 37.332  -9.749  -4.434  1.00 64.34  ? 2    DA  C N9    1 
ATOM   2503 C C8    . DA  C 2 2   ? 36.059  -10.253 -4.542  1.00 62.09  ? 2    DA  C C8    1 
ATOM   2504 N N7    . DA  C 2 2   ? 35.705  -10.538 -5.770  1.00 59.97  ? 2    DA  C N7    1 
ATOM   2505 C C5    . DA  C 2 2   ? 36.830  -10.230 -6.520  1.00 62.20  ? 2    DA  C C5    1 
ATOM   2506 C C6    . DA  C 2 2   ? 37.099  -10.311 -7.896  1.00 61.79  ? 2    DA  C C6    1 
ATOM   2507 N N6    . DA  C 2 2   ? 36.215  -10.744 -8.796  1.00 61.54  ? 2    DA  C N6    1 
ATOM   2508 N N1    . DA  C 2 2   ? 38.318  -9.911  -8.324  1.00 63.96  ? 2    DA  C N1    1 
ATOM   2509 C C2    . DA  C 2 2   ? 39.202  -9.467  -7.418  1.00 64.46  ? 2    DA  C C2    1 
ATOM   2510 N N3    . DA  C 2 2   ? 39.067  -9.349  -6.098  1.00 63.99  ? 2    DA  C N3    1 
ATOM   2511 C C4    . DA  C 2 2   ? 37.844  -9.751  -5.709  1.00 63.88  ? 2    DA  C C4    1 
ATOM   2512 P P     . DA  C 2 3   ? 39.181  -6.576  -0.550  1.00 70.42  ? 3    DA  C P     1 
ATOM   2513 O OP1   . DA  C 2 3   ? 40.122  -6.173  0.529   1.00 71.86  ? 3    DA  C OP1   1 
ATOM   2514 O OP2   . DA  C 2 3   ? 37.767  -6.099  -0.541  1.00 68.74  ? 3    DA  C OP2   1 
ATOM   2515 O "O5'" . DA  C 2 3   ? 39.819  -6.175  -1.953  1.00 68.04  ? 3    DA  C "O5'" 1 
ATOM   2516 C "C5'" . DA  C 2 3   ? 41.224  -6.343  -2.205  1.00 69.55  ? 3    DA  C "C5'" 1 
ATOM   2517 C "C4'" . DA  C 2 3   ? 41.602  -5.568  -3.444  1.00 67.15  ? 3    DA  C "C4'" 1 
ATOM   2518 O "O4'" . DA  C 2 3   ? 40.851  -6.076  -4.575  1.00 64.96  ? 3    DA  C "O4'" 1 
ATOM   2519 C "C3'" . DA  C 2 3   ? 41.282  -4.075  -3.374  1.00 65.69  ? 3    DA  C "C3'" 1 
ATOM   2520 O "O3'" . DA  C 2 3   ? 42.303  -3.317  -4.043  1.00 65.15  ? 3    DA  C "O3'" 1 
ATOM   2521 C "C2'" . DA  C 2 3   ? 39.939  -3.976  -4.074  1.00 62.08  ? 3    DA  C "C2'" 1 
ATOM   2522 C "C1'" . DA  C 2 3   ? 40.057  -5.046  -5.142  1.00 59.76  ? 3    DA  C "C1'" 1 
ATOM   2523 N N9    . DA  C 2 3   ? 38.795  -5.639  -5.576  1.00 57.75  ? 3    DA  C N9    1 
ATOM   2524 C C8    . DA  C 2 3   ? 37.694  -5.966  -4.825  1.00 57.84  ? 3    DA  C C8    1 
ATOM   2525 N N7    . DA  C 2 3   ? 36.717  -6.498  -5.523  1.00 55.91  ? 3    DA  C N7    1 
ATOM   2526 C C5    . DA  C 2 3   ? 37.210  -6.521  -6.820  1.00 55.32  ? 3    DA  C C5    1 
ATOM   2527 C C6    . DA  C 2 3   ? 36.660  -6.970  -8.036  1.00 55.14  ? 3    DA  C C6    1 
ATOM   2528 N N6    . DA  C 2 3   ? 35.437  -7.491  -8.153  1.00 54.37  ? 3    DA  C N6    1 
ATOM   2529 N N1    . DA  C 2 3   ? 37.418  -6.853  -9.147  1.00 55.54  ? 3    DA  C N1    1 
ATOM   2530 C C2    . DA  C 2 3   ? 38.643  -6.328  -9.035  1.00 55.38  ? 3    DA  C C2    1 
ATOM   2531 N N3    . DA  C 2 3   ? 39.273  -5.883  -7.950  1.00 54.75  ? 3    DA  C N3    1 
ATOM   2532 C C4    . DA  C 2 3   ? 38.494  -6.010  -6.864  1.00 55.69  ? 3    DA  C C4    1 
ATOM   2533 P P     . DG  C 2 4   ? 42.283  -1.723  -3.967  1.00 65.25  ? 4    DG  C P     1 
ATOM   2534 O OP1   . DG  C 2 4   ? 43.683  -1.241  -3.796  1.00 64.26  ? 4    DG  C OP1   1 
ATOM   2535 O OP2   . DG  C 2 4   ? 41.220  -1.317  -2.998  1.00 65.21  ? 4    DG  C OP2   1 
ATOM   2536 O "O5'" . DG  C 2 4   ? 41.797  -1.320  -5.426  1.00 57.26  ? 4    DG  C "O5'" 1 
ATOM   2537 C "C5'" . DG  C 2 4   ? 42.627  -1.567  -6.565  1.00 52.80  ? 4    DG  C "C5'" 1 
ATOM   2538 C "C4'" . DG  C 2 4   ? 41.925  -1.042  -7.793  1.00 49.00  ? 4    DG  C "C4'" 1 
ATOM   2539 O "O4'" . DG  C 2 4   ? 40.771  -1.864  -8.060  1.00 48.05  ? 4    DG  C "O4'" 1 
ATOM   2540 C "C3'" . DG  C 2 4   ? 41.420  0.396   -7.662  1.00 47.70  ? 4    DG  C "C3'" 1 
ATOM   2541 O "O3'" . DG  C 2 4   ? 41.994  1.136   -8.739  1.00 47.23  ? 4    DG  C "O3'" 1 
ATOM   2542 C "C2'" . DG  C 2 4   ? 39.906  0.270   -7.683  1.00 47.72  ? 4    DG  C "C2'" 1 
ATOM   2543 C "C1'" . DG  C 2 4   ? 39.669  -1.056  -8.394  1.00 47.69  ? 4    DG  C "C1'" 1 
ATOM   2544 N N9    . DG  C 2 4   ? 38.460  -1.768  -7.985  1.00 47.72  ? 4    DG  C N9    1 
ATOM   2545 C C8    . DG  C 2 4   ? 38.018  -1.962  -6.700  1.00 47.60  ? 4    DG  C C8    1 
ATOM   2546 N N7    . DG  C 2 4   ? 36.914  -2.654  -6.638  1.00 48.34  ? 4    DG  C N7    1 
ATOM   2547 C C5    . DG  C 2 4   ? 36.610  -2.939  -7.961  1.00 46.81  ? 4    DG  C C5    1 
ATOM   2548 C C6    . DG  C 2 4   ? 35.521  -3.657  -8.518  1.00 47.52  ? 4    DG  C C6    1 
ATOM   2549 O O6    . DG  C 2 4   ? 34.577  -4.205  -7.934  1.00 49.94  ? 4    DG  C O6    1 
ATOM   2550 N N1    . DG  C 2 4   ? 35.605  -3.717  -9.905  1.00 47.25  ? 4    DG  C N1    1 
ATOM   2551 C C2    . DG  C 2 4   ? 36.606  -3.159  -10.659 1.00 46.53  ? 4    DG  C C2    1 
ATOM   2552 N N2    . DG  C 2 4   ? 36.500  -3.314  -11.981 1.00 45.67  ? 4    DG  C N2    1 
ATOM   2553 N N3    . DG  C 2 4   ? 37.632  -2.491  -10.151 1.00 45.90  ? 4    DG  C N3    1 
ATOM   2554 C C4    . DG  C 2 4   ? 37.571  -2.425  -8.804  1.00 46.90  ? 4    DG  C C4    1 
ATOM   2555 P P     . DA  C 2 5   ? 41.741  2.688   -8.879  1.00 46.02  ? 5    DA  C P     1 
ATOM   2556 O OP1   . DA  C 2 5   ? 42.688  3.200   -9.896  1.00 44.92  ? 5    DA  C OP1   1 
ATOM   2557 O OP2   . DA  C 2 5   ? 41.729  3.269   -7.513  1.00 47.03  ? 5    DA  C OP2   1 
ATOM   2558 O "O5'" . DA  C 2 5   ? 40.294  2.717   -9.538  1.00 46.20  ? 5    DA  C "O5'" 1 
ATOM   2559 C "C5'" . DA  C 2 5   ? 40.122  2.115   -10.823 1.00 44.83  ? 5    DA  C "C5'" 1 
ATOM   2560 C "C4'" . DA  C 2 5   ? 38.657  1.972   -11.162 1.00 45.85  ? 5    DA  C "C4'" 1 
ATOM   2561 O "O4'" . DA  C 2 5   ? 37.978  1.107   -10.234 1.00 45.37  ? 5    DA  C "O4'" 1 
ATOM   2562 C "C3'" . DA  C 2 5   ? 37.813  3.247   -11.168 1.00 48.45  ? 5    DA  C "C3'" 1 
ATOM   2563 O "O3'" . DA  C 2 5   ? 37.825  3.844   -12.466 1.00 51.90  ? 5    DA  C "O3'" 1 
ATOM   2564 C "C2'" . DA  C 2 5   ? 36.431  2.753   -10.740 1.00 47.77  ? 5    DA  C "C2'" 1 
ATOM   2565 C "C1'" . DA  C 2 5   ? 36.624  1.247   -10.584 1.00 45.75  ? 5    DA  C "C1'" 1 
ATOM   2566 N N9    . DA  C 2 5   ? 35.808  0.597   -9.564  1.00 45.15  ? 5    DA  C N9    1 
ATOM   2567 C C8    . DA  C 2 5   ? 35.925  0.667   -8.199  1.00 46.68  ? 5    DA  C C8    1 
ATOM   2568 N N7    . DA  C 2 5   ? 34.999  0.000   -7.555  1.00 47.82  ? 5    DA  C N7    1 
ATOM   2569 C C5    . DA  C 2 5   ? 34.220  -0.548  -8.564  1.00 46.91  ? 5    DA  C C5    1 
ATOM   2570 C C6    . DA  C 2 5   ? 33.065  -1.349  -8.538  1.00 47.36  ? 5    DA  C C6    1 
ATOM   2571 N N6    . DA  C 2 5   ? 32.483  -1.771  -7.414  1.00 47.18  ? 5    DA  C N6    1 
ATOM   2572 N N1    . DA  C 2 5   ? 32.524  -1.713  -9.722  1.00 46.66  ? 5    DA  C N1    1 
ATOM   2573 C C2    . DA  C 2 5   ? 33.102  -1.280  -10.848 1.00 47.30  ? 5    DA  C C2    1 
ATOM   2574 N N3    . DA  C 2 5   ? 34.185  -0.517  -11.001 1.00 47.45  ? 5    DA  C N3    1 
ATOM   2575 C C4    . DA  C 2 5   ? 34.703  -0.183  -9.806  1.00 45.93  ? 5    DA  C C4    1 
ATOM   2576 P P     . DT  C 2 6   ? 36.828  5.075   -12.821 1.00 57.68  ? 6    DT  C P     1 
ATOM   2577 O OP1   . DT  C 2 6   ? 37.400  5.825   -13.967 1.00 62.65  ? 6    DT  C OP1   1 
ATOM   2578 O OP2   . DT  C 2 6   ? 36.516  5.807   -11.574 1.00 59.58  ? 6    DT  C OP2   1 
ATOM   2579 O "O5'" . DT  C 2 6   ? 35.509  4.326   -13.302 1.00 54.53  ? 6    DT  C "O5'" 1 
ATOM   2580 C "C5'" . DT  C 2 6   ? 35.557  3.401   -14.387 1.00 53.62  ? 6    DT  C "C5'" 1 
ATOM   2581 C "C4'" . DT  C 2 6   ? 34.187  2.806   -14.610 1.00 55.28  ? 6    DT  C "C4'" 1 
ATOM   2582 O "O4'" . DT  C 2 6   ? 33.735  2.098   -13.434 1.00 52.31  ? 6    DT  C "O4'" 1 
ATOM   2583 C "C3'" . DT  C 2 6   ? 33.101  3.831   -14.940 1.00 58.47  ? 6    DT  C "C3'" 1 
ATOM   2584 O "O3'" . DT  C 2 6   ? 32.602  3.505   -16.239 1.00 63.17  ? 6    DT  C "O3'" 1 
ATOM   2585 C "C2'" . DT  C 2 6   ? 32.094  3.691   -13.810 1.00 57.15  ? 6    DT  C "C2'" 1 
ATOM   2586 C "C1'" . DT  C 2 6   ? 32.346  2.285   -13.292 1.00 53.13  ? 6    DT  C "C1'" 1 
ATOM   2587 N N1    . DT  C 2 6   ? 32.012  2.072   -11.869 1.00 51.22  ? 6    DT  C N1    1 
ATOM   2588 C C2    . DT  C 2 6   ? 30.959  1.246   -11.541 1.00 52.70  ? 6    DT  C C2    1 
ATOM   2589 O O2    . DT  C 2 6   ? 30.286  0.658   -12.373 1.00 54.98  ? 6    DT  C O2    1 
ATOM   2590 N N3    . DT  C 2 6   ? 30.727  1.122   -10.192 1.00 51.54  ? 6    DT  C N3    1 
ATOM   2591 C C4    . DT  C 2 6   ? 31.423  1.737   -9.167  1.00 50.80  ? 6    DT  C C4    1 
ATOM   2592 O O4    . DT  C 2 6   ? 31.089  1.548   -8.003  1.00 51.60  ? 6    DT  C O4    1 
ATOM   2593 C C5    . DT  C 2 6   ? 32.502  2.602   -9.586  1.00 49.64  ? 6    DT  C C5    1 
ATOM   2594 C C7    . DT  C 2 6   ? 33.311  3.312   -8.547  1.00 49.66  ? 6    DT  C C7    1 
ATOM   2595 C C6    . DT  C 2 6   ? 32.741  2.719   -10.897 1.00 50.24  ? 6    DT  C C6    1 
ATOM   2596 P P     . DT  C 2 7   ? 31.437  4.351   -16.878 1.00 64.32  ? 7    DT  C P     1 
ATOM   2597 O OP1   . DT  C 2 7   ? 31.508  4.148   -18.358 1.00 69.19  ? 7    DT  C OP1   1 
ATOM   2598 O OP2   . DT  C 2 7   ? 31.497  5.715   -16.287 1.00 61.04  ? 7    DT  C OP2   1 
ATOM   2599 O "O5'" . DT  C 2 7   ? 30.135  3.625   -16.314 1.00 64.00  ? 7    DT  C "O5'" 1 
ATOM   2600 C "C5'" . DT  C 2 7   ? 29.749  2.311   -16.764 1.00 65.47  ? 7    DT  C "C5'" 1 
ATOM   2601 C "C4'" . DT  C 2 7   ? 28.371  1.981   -16.236 1.00 63.93  ? 7    DT  C "C4'" 1 
ATOM   2602 O "O4'" . DT  C 2 7   ? 28.428  1.830   -14.808 1.00 60.17  ? 7    DT  C "O4'" 1 
ATOM   2603 C "C3'" . DT  C 2 7   ? 27.314  3.050   -16.516 1.00 62.85  ? 7    DT  C "C3'" 1 
ATOM   2604 O "O3'" . DT  C 2 7   ? 26.372  2.513   -17.444 1.00 66.32  ? 7    DT  C "O3'" 1 
ATOM   2605 C "C2'" . DT  C 2 7   ? 26.728  3.399   -15.153 1.00 59.20  ? 7    DT  C "C2'" 1 
ATOM   2606 C "C1'" . DT  C 2 7   ? 27.241  2.317   -14.220 1.00 58.43  ? 7    DT  C "C1'" 1 
ATOM   2607 N N1    . DT  C 2 7   ? 27.595  2.780   -12.866 1.00 56.23  ? 7    DT  C N1    1 
ATOM   2608 C C2    . DT  C 2 7   ? 27.026  2.163   -11.773 1.00 54.56  ? 7    DT  C C2    1 
ATOM   2609 O O2    . DT  C 2 7   ? 26.200  1.273   -11.864 1.00 57.60  ? 7    DT  C O2    1 
ATOM   2610 N N3    . DT  C 2 7   ? 27.453  2.641   -10.560 1.00 51.58  ? 7    DT  C N3    1 
ATOM   2611 C C4    . DT  C 2 7   ? 28.390  3.633   -10.336 1.00 49.46  ? 7    DT  C C4    1 
ATOM   2612 O O4    . DT  C 2 7   ? 28.684  3.947   -9.189  1.00 43.41  ? 7    DT  C O4    1 
ATOM   2613 C C5    . DT  C 2 7   ? 28.974  4.209   -11.527 1.00 51.76  ? 7    DT  C C5    1 
ATOM   2614 C C7    . DT  C 2 7   ? 29.997  5.290   -11.383 1.00 51.31  ? 7    DT  C C7    1 
ATOM   2615 C C6    . DT  C 2 7   ? 28.557  3.756   -12.716 1.00 54.38  ? 7    DT  C C6    1 
ATOM   2616 P P     . DG  C 2 8   ? 25.301  3.468   -18.121 1.00 71.96  ? 8    DG  C P     1 
ATOM   2617 O OP1   . DG  C 2 8   ? 24.956  2.897   -19.456 1.00 74.97  ? 8    DG  C OP1   1 
ATOM   2618 O OP2   . DG  C 2 8   ? 25.780  4.880   -18.002 1.00 68.05  ? 8    DG  C OP2   1 
ATOM   2619 O "O5'" . DG  C 2 8   ? 24.042  3.314   -17.153 1.00 71.29  ? 8    DG  C "O5'" 1 
ATOM   2620 C "C5'" . DG  C 2 8   ? 23.642  2.012   -16.674 1.00 70.69  ? 8    DG  C "C5'" 1 
ATOM   2621 C "C4'" . DG  C 2 8   ? 22.418  2.130   -15.797 1.00 67.89  ? 8    DG  C "C4'" 1 
ATOM   2622 O "O4'" . DG  C 2 8   ? 22.824  2.380   -14.431 1.00 63.38  ? 8    DG  C "O4'" 1 
ATOM   2623 C "C3'" . DG  C 2 8   ? 21.447  3.253   -16.165 1.00 67.00  ? 8    DG  C "C3'" 1 
ATOM   2624 O "O3'" . DG  C 2 8   ? 20.128  2.718   -16.035 1.00 68.25  ? 8    DG  C "O3'" 1 
ATOM   2625 C "C2'" . DG  C 2 8   ? 21.816  4.365   -15.198 1.00 63.19  ? 8    DG  C "C2'" 1 
ATOM   2626 C "C1'" . DG  C 2 8   ? 22.276  3.602   -13.966 1.00 61.73  ? 8    DG  C "C1'" 1 
ATOM   2627 N N9    . DG  C 2 8   ? 23.297  4.269   -13.164 1.00 57.02  ? 8    DG  C N9    1 
ATOM   2628 C C8    . DG  C 2 8   ? 24.255  5.155   -13.592 1.00 54.58  ? 8    DG  C C8    1 
ATOM   2629 N N7    . DG  C 2 8   ? 25.042  5.559   -12.634 1.00 53.65  ? 8    DG  C N7    1 
ATOM   2630 C C5    . DG  C 2 8   ? 24.580  4.892   -11.506 1.00 52.36  ? 8    DG  C C5    1 
ATOM   2631 C C6    . DG  C 2 8   ? 25.023  4.947   -10.159 1.00 48.67  ? 8    DG  C C6    1 
ATOM   2632 O O6    . DG  C 2 8   ? 25.952  5.607   -9.679  1.00 47.82  ? 8    DG  C O6    1 
ATOM   2633 N N1    . DG  C 2 8   ? 24.262  4.125   -9.337  1.00 48.02  ? 8    DG  C N1    1 
ATOM   2634 C C2    . DG  C 2 8   ? 23.206  3.355   -9.751  1.00 49.88  ? 8    DG  C C2    1 
ATOM   2635 N N2    . DG  C 2 8   ? 22.599  2.626   -8.803  1.00 48.92  ? 8    DG  C N2    1 
ATOM   2636 N N3    . DG  C 2 8   ? 22.779  3.299   -11.003 1.00 53.24  ? 8    DG  C N3    1 
ATOM   2637 C C4    . DG  C 2 8   ? 23.504  4.091   -11.819 1.00 53.47  ? 8    DG  C C4    1 
ATOM   2638 P P     . DA  C 2 9   ? 18.809  3.634   -16.228 1.00 68.69  ? 9    DA  C P     1 
ATOM   2639 O OP1   . DA  C 2 9   ? 17.852  2.879   -17.082 1.00 69.65  ? 9    DA  C OP1   1 
ATOM   2640 O OP2   . DA  C 2 9   ? 19.217  5.006   -16.617 1.00 65.22  ? 9    DA  C OP2   1 
ATOM   2641 O "O5'" . DA  C 2 9   ? 18.218  3.664   -14.753 1.00 64.84  ? 9    DA  C "O5'" 1 
ATOM   2642 C "C5'" . DA  C 2 9   ? 18.274  2.472   -13.946 1.00 65.91  ? 9    DA  C "C5'" 1 
ATOM   2643 C "C4'" . DA  C 2 9   ? 17.701  2.755   -12.580 1.00 63.84  ? 9    DA  C "C4'" 1 
ATOM   2644 O "O4'" . DA  C 2 9   ? 18.728  3.344   -11.750 1.00 61.15  ? 9    DA  C "O4'" 1 
ATOM   2645 C "C3'" . DA  C 2 9   ? 16.548  3.751   -12.577 1.00 62.46  ? 9    DA  C "C3'" 1 
ATOM   2646 O "O3'" . DA  C 2 9   ? 15.642  3.368   -11.544 1.00 64.05  ? 9    DA  C "O3'" 1 
ATOM   2647 C "C2'" . DA  C 2 9   ? 17.244  5.071   -12.293 1.00 59.30  ? 9    DA  C "C2'" 1 
ATOM   2648 C "C1'" . DA  C 2 9   ? 18.338  4.642   -11.331 1.00 55.56  ? 9    DA  C "C1'" 1 
ATOM   2649 N N9    . DA  C 2 9   ? 19.538  5.473   -11.325 1.00 52.23  ? 9    DA  C N9    1 
ATOM   2650 C C8    . DA  C 2 9   ? 20.143  6.103   -12.386 1.00 52.37  ? 9    DA  C C8    1 
ATOM   2651 N N7    . DA  C 2 9   ? 21.230  6.758   -12.060 1.00 50.48  ? 9    DA  C N7    1 
ATOM   2652 C C5    . DA  C 2 9   ? 21.361  6.529   -10.698 1.00 47.23  ? 9    DA  C C5    1 
ATOM   2653 C C6    . DA  C 2 9   ? 22.314  6.954   -9.757  1.00 46.38  ? 9    DA  C C6    1 
ATOM   2654 N N6    . DA  C 2 9   ? 23.364  7.718   -10.063 1.00 46.31  ? 9    DA  C N6    1 
ATOM   2655 N N1    . DA  C 2 9   ? 22.147  6.567   -8.475  1.00 45.55  ? 9    DA  C N1    1 
ATOM   2656 C C2    . DA  C 2 9   ? 21.104  5.781   -8.174  1.00 47.37  ? 9    DA  C C2    1 
ATOM   2657 N N3    . DA  C 2 9   ? 20.147  5.308   -8.973  1.00 47.42  ? 9    DA  C N3    1 
ATOM   2658 C C4    . DA  C 2 9   ? 20.336  5.726   -10.236 1.00 48.18  ? 9    DA  C C4    1 
ATOM   2659 P P     . DG  C 2 10  ? 14.187  4.053   -11.439 1.00 68.64  ? 10   DG  C P     1 
ATOM   2660 O OP1   . DG  C 2 10  ? 13.197  2.950   -11.272 1.00 66.75  ? 10   DG  C OP1   1 
ATOM   2661 O OP2   . DG  C 2 10  ? 14.038  5.054   -12.537 1.00 66.26  ? 10   DG  C OP2   1 
ATOM   2662 O "O5'" . DG  C 2 10  ? 14.290  4.924   -10.109 1.00 59.04  ? 10   DG  C "O5'" 1 
ATOM   2663 C "C5'" . DG  C 2 10  ? 14.560  4.266   -8.863  1.00 57.49  ? 10   DG  C "C5'" 1 
ATOM   2664 C "C4'" . DG  C 2 10  ? 15.058  5.275   -7.860  1.00 54.34  ? 10   DG  C "C4'" 1 
ATOM   2665 O "O4'" . DG  C 2 10  ? 16.305  5.841   -8.322  1.00 52.07  ? 10   DG  C "O4'" 1 
ATOM   2666 C "C3'" . DG  C 2 10  ? 14.124  6.465   -7.626  1.00 52.67  ? 10   DG  C "C3'" 1 
ATOM   2667 O "O3'" . DG  C 2 10  ? 14.109  6.685   -6.219  1.00 52.85  ? 10   DG  C "O3'" 1 
ATOM   2668 C "C2'" . DG  C 2 10  ? 14.815  7.595   -8.366  1.00 49.41  ? 10   DG  C "C2'" 1 
ATOM   2669 C "C1'" . DG  C 2 10  ? 16.254  7.229   -8.101  1.00 46.15  ? 10   DG  C "C1'" 1 
ATOM   2670 N N9    . DG  C 2 10  ? 17.254  7.854   -8.953  1.00 41.66  ? 10   DG  C N9    1 
ATOM   2671 C C8    . DG  C 2 10  ? 17.244  7.990   -10.320 1.00 41.84  ? 10   DG  C C8    1 
ATOM   2672 N N7    . DG  C 2 10  ? 18.297  8.607   -10.781 1.00 40.51  ? 10   DG  C N7    1 
ATOM   2673 C C5    . DG  C 2 10  ? 19.045  8.897   -9.648  1.00 38.78  ? 10   DG  C C5    1 
ATOM   2674 C C6    . DG  C 2 10  ? 20.302  9.544   -9.515  1.00 37.56  ? 10   DG  C C6    1 
ATOM   2675 O O6    . DG  C 2 10  ? 21.036  9.994   -10.400 1.00 36.33  ? 10   DG  C O6    1 
ATOM   2676 N N1    . DG  C 2 10  ? 20.702  9.613   -8.185  1.00 37.49  ? 10   DG  C N1    1 
ATOM   2677 C C2    . DG  C 2 10  ? 19.994  9.110   -7.122  1.00 38.39  ? 10   DG  C C2    1 
ATOM   2678 N N2    . DG  C 2 10  ? 20.539  9.281   -5.913  1.00 38.14  ? 10   DG  C N2    1 
ATOM   2679 N N3    . DG  C 2 10  ? 18.828  8.494   -7.234  1.00 39.02  ? 10   DG  C N3    1 
ATOM   2680 C C4    . DG  C 2 10  ? 18.424  8.412   -8.517  1.00 39.15  ? 10   DG  C C4    1 
ATOM   2681 P P     . DA  C 2 11  ? 13.100  7.739   -5.564  1.00 59.59  ? 11   DA  C P     1 
ATOM   2682 O OP1   . DA  C 2 11  ? 12.245  6.985   -4.597  1.00 58.00  ? 11   DA  C OP1   1 
ATOM   2683 O OP2   . DA  C 2 11  ? 12.475  8.568   -6.644  1.00 57.83  ? 11   DA  C OP2   1 
ATOM   2684 O "O5'" . DA  C 2 11  ? 14.079  8.699   -4.760  1.00 53.72  ? 11   DA  C "O5'" 1 
ATOM   2685 C "C5'" . DA  C 2 11  ? 15.027  8.102   -3.854  1.00 54.35  ? 11   DA  C "C5'" 1 
ATOM   2686 C "C4'" . DA  C 2 11  ? 15.898  9.173   -3.244  1.00 51.24  ? 11   DA  C "C4'" 1 
ATOM   2687 O "O4'" . DA  C 2 11  ? 16.869  9.591   -4.230  1.00 49.57  ? 11   DA  C "O4'" 1 
ATOM   2688 C "C3'" . DA  C 2 11  ? 15.140  10.434  -2.841  1.00 49.74  ? 11   DA  C "C3'" 1 
ATOM   2689 O "O3'" . DA  C 2 11  ? 15.677  11.002  -1.655  1.00 52.52  ? 11   DA  C "O3'" 1 
ATOM   2690 C "C2'" . DA  C 2 11  ? 15.359  11.363  -4.009  1.00 46.46  ? 11   DA  C "C2'" 1 
ATOM   2691 C "C1'" . DA  C 2 11  ? 16.740  10.974  -4.475  1.00 45.34  ? 11   DA  C "C1'" 1 
ATOM   2692 N N9    . DA  C 2 11  ? 16.961  11.190  -5.901  1.00 44.55  ? 11   DA  C N9    1 
ATOM   2693 C C8    . DA  C 2 11  ? 16.154  10.853  -6.959  1.00 43.02  ? 11   DA  C C8    1 
ATOM   2694 N N7    . DA  C 2 11  ? 16.638  11.207  -8.124  1.00 43.14  ? 11   DA  C N7    1 
ATOM   2695 C C5    . DA  C 2 11  ? 17.852  11.805  -7.813  1.00 42.92  ? 11   DA  C C5    1 
ATOM   2696 C C6    . DA  C 2 11  ? 18.848  12.398  -8.609  1.00 42.66  ? 11   DA  C C6    1 
ATOM   2697 N N6    . DA  C 2 11  ? 18.779  12.491  -9.936  1.00 42.97  ? 11   DA  C N6    1 
ATOM   2698 N N1    . DA  C 2 11  ? 19.922  12.925  -7.982  1.00 43.63  ? 11   DA  C N1    1 
ATOM   2699 C C2    . DA  C 2 11  ? 19.988  12.845  -6.646  1.00 44.76  ? 11   DA  C C2    1 
ATOM   2700 N N3    . DA  C 2 11  ? 19.118  12.312  -5.791  1.00 42.99  ? 11   DA  C N3    1 
ATOM   2701 C C4    . DA  C 2 11  ? 18.058  11.810  -6.447  1.00 43.07  ? 11   DA  C C4    1 
ATOM   2702 P P     . DT  C 2 12  ? 14.953  12.264  -0.974  1.00 54.50  ? 12   DT  C P     1 
ATOM   2703 O OP1   . DT  C 2 12  ? 14.963  12.035  0.502   1.00 53.62  ? 12   DT  C OP1   1 
ATOM   2704 O OP2   . DT  C 2 12  ? 13.685  12.566  -1.719  1.00 49.70  ? 12   DT  C OP2   1 
ATOM   2705 O "O5'" . DT  C 2 12  ? 15.947  13.458  -1.301  1.00 48.75  ? 12   DT  C "O5'" 1 
ATOM   2706 C "C5'" . DT  C 2 12  ? 17.301  13.392  -0.846  1.00 47.60  ? 12   DT  C "C5'" 1 
ATOM   2707 C "C4'" . DT  C 2 12  ? 18.097  14.472  -1.529  1.00 45.06  ? 12   DT  C "C4'" 1 
ATOM   2708 O "O4'" . DT  C 2 12  ? 18.026  14.291  -2.956  1.00 43.69  ? 12   DT  C "O4'" 1 
ATOM   2709 C "C3'" . DT  C 2 12  ? 17.595  15.892  -1.244  1.00 44.10  ? 12   DT  C "C3'" 1 
ATOM   2710 O "O3'" . DT  C 2 12  ? 18.656  16.512  -0.521  1.00 43.40  ? 12   DT  C "O3'" 1 
ATOM   2711 C "C2'" . DT  C 2 12  ? 17.288  16.470  -2.616  1.00 43.01  ? 12   DT  C "C2'" 1 
ATOM   2712 C "C1'" . DT  C 2 12  ? 18.068  15.574  -3.555  1.00 42.16  ? 12   DT  C "C1'" 1 
ATOM   2713 N N1    . DT  C 2 12  ? 17.537  15.449  -4.934  1.00 41.56  ? 12   DT  C N1    1 
ATOM   2714 C C2    . DT  C 2 12  ? 18.360  15.823  -5.978  1.00 41.40  ? 12   DT  C C2    1 
ATOM   2715 O O2    . DT  C 2 12  ? 19.475  16.293  -5.811  1.00 40.65  ? 12   DT  C O2    1 
ATOM   2716 N N3    . DT  C 2 12  ? 17.824  15.631  -7.231  1.00 40.19  ? 12   DT  C N3    1 
ATOM   2717 C C4    . DT  C 2 12  ? 16.587  15.095  -7.535  1.00 40.37  ? 12   DT  C C4    1 
ATOM   2718 O O4    . DT  C 2 12  ? 16.237  14.996  -8.713  1.00 39.55  ? 12   DT  C O4    1 
ATOM   2719 C C5    . DT  C 2 12  ? 15.791  14.687  -6.389  1.00 39.33  ? 12   DT  C C5    1 
ATOM   2720 C C7    . DT  C 2 12  ? 14.439  14.089  -6.619  1.00 39.60  ? 12   DT  C C7    1 
ATOM   2721 C C6    . DT  C 2 12  ? 16.297  14.890  -5.165  1.00 39.05  ? 12   DT  C C6    1 
ATOM   2722 P P     . DC  C 2 13  ? 18.627  18.040  -0.174  1.00 44.46  ? 13   DC  C P     1 
ATOM   2723 O OP1   . DC  C 2 13  ? 19.596  18.254  0.927   1.00 44.47  ? 13   DC  C OP1   1 
ATOM   2724 O OP2   . DC  C 2 13  ? 17.207  18.446  -0.013  1.00 47.12  ? 13   DC  C OP2   1 
ATOM   2725 O "O5'" . DC  C 2 13  ? 19.312  18.696  -1.447  1.00 42.88  ? 13   DC  C "O5'" 1 
ATOM   2726 C "C5'" . DC  C 2 13  ? 20.745  18.634  -1.583  1.00 41.07  ? 13   DC  C "C5'" 1 
ATOM   2727 C "C4'" . DC  C 2 13  ? 21.187  19.531  -2.710  1.00 41.11  ? 13   DC  C "C4'" 1 
ATOM   2728 O "O4'" . DC  C 2 13  ? 20.499  19.113  -3.908  1.00 38.80  ? 13   DC  C "O4'" 1 
ATOM   2729 C "C3'" . DC  C 2 13  ? 20.836  21.008  -2.500  1.00 44.67  ? 13   DC  C "C3'" 1 
ATOM   2730 O "O3'" . DC  C 2 13  ? 21.967  21.861  -2.748  1.00 46.16  ? 13   DC  C "O3'" 1 
ATOM   2731 C "C2'" . DC  C 2 13  ? 19.652  21.226  -3.427  1.00 44.52  ? 13   DC  C "C2'" 1 
ATOM   2732 C "C1'" . DC  C 2 13  ? 19.926  20.229  -4.540  1.00 42.44  ? 13   DC  C "C1'" 1 
ATOM   2733 N N1    . DC  C 2 13  ? 18.749  19.763  -5.310  1.00 44.00  ? 13   DC  C N1    1 
ATOM   2734 C C2    . DC  C 2 13  ? 18.857  19.684  -6.703  1.00 42.71  ? 13   DC  C C2    1 
ATOM   2735 O O2    . DC  C 2 13  ? 19.928  20.008  -7.242  1.00 44.13  ? 13   DC  C O2    1 
ATOM   2736 N N3    . DC  C 2 13  ? 17.800  19.246  -7.424  1.00 43.07  ? 13   DC  C N3    1 
ATOM   2737 C C4    . DC  C 2 13  ? 16.669  18.893  -6.806  1.00 45.56  ? 13   DC  C C4    1 
ATOM   2738 N N4    . DC  C 2 13  ? 15.649  18.472  -7.560  1.00 47.10  ? 13   DC  C N4    1 
ATOM   2739 C C5    . DC  C 2 13  ? 16.525  18.982  -5.390  1.00 43.35  ? 13   DC  C C5    1 
ATOM   2740 C C6    . DC  C 2 13  ? 17.581  19.415  -4.687  1.00 43.56  ? 13   DC  C C6    1 
ATOM   2741 P P     . DT  C 2 14  ? 21.829  23.469  -2.606  1.00 51.67  ? 14   DT  C P     1 
ATOM   2742 O OP1   . DT  C 2 14  ? 23.045  23.975  -1.915  1.00 50.14  ? 14   DT  C OP1   1 
ATOM   2743 O OP2   . DT  C 2 14  ? 20.485  23.796  -2.056  1.00 50.22  ? 14   DT  C OP2   1 
ATOM   2744 O "O5'" . DT  C 2 14  ? 21.826  23.950  -4.125  1.00 48.00  ? 14   DT  C "O5'" 1 
ATOM   2745 C "C5'" . DT  C 2 14  ? 22.851  23.486  -5.007  1.00 46.37  ? 14   DT  C "C5'" 1 
ATOM   2746 C "C4'" . DT  C 2 14  ? 22.626  24.028  -6.395  1.00 47.13  ? 14   DT  C "C4'" 1 
ATOM   2747 O "O4'" . DT  C 2 14  ? 21.505  23.350  -6.993  1.00 45.88  ? 14   DT  C "O4'" 1 
ATOM   2748 C "C3'" . DT  C 2 14  ? 22.324  25.522  -6.476  1.00 48.61  ? 14   DT  C "C3'" 1 
ATOM   2749 O "O3'" . DT  C 2 14  ? 23.205  26.092  -7.444  1.00 51.79  ? 14   DT  C "O3'" 1 
ATOM   2750 C "C2'" . DT  C 2 14  ? 20.863  25.581  -6.886  1.00 48.09  ? 14   DT  C "C2'" 1 
ATOM   2751 C "C1'" . DT  C 2 14  ? 20.640  24.266  -7.607  1.00 46.24  ? 14   DT  C "C1'" 1 
ATOM   2752 N N1    . DT  C 2 14  ? 19.288  23.690  -7.523  1.00 46.96  ? 14   DT  C N1    1 
ATOM   2753 C C2    . DT  C 2 14  ? 18.700  23.229  -8.678  1.00 48.08  ? 14   DT  C C2    1 
ATOM   2754 O O2    . DT  C 2 14  ? 19.210  23.346  -9.778  1.00 50.35  ? 14   DT  C O2    1 
ATOM   2755 N N3    . DT  C 2 14  ? 17.456  22.676  -8.504  1.00 48.05  ? 14   DT  C N3    1 
ATOM   2756 C C4    . DT  C 2 14  ? 16.776  22.507  -7.315  1.00 48.27  ? 14   DT  C C4    1 
ATOM   2757 O O4    . DT  C 2 14  ? 15.660  21.990  -7.316  1.00 48.91  ? 14   DT  C O4    1 
ATOM   2758 C C5    . DT  C 2 14  ? 17.468  22.983  -6.138  1.00 47.87  ? 14   DT  C C5    1 
ATOM   2759 C C7    . DT  C 2 14  ? 16.814  22.833  -4.801  1.00 48.53  ? 14   DT  C C7    1 
ATOM   2760 C C6    . DT  C 2 14  ? 18.679  23.529  -6.298  1.00 46.63  ? 14   DT  C C6    1 
ATOM   2761 P P     . DC  C 2 15  ? 23.383  27.668  -7.532  1.00 59.22  ? 15   DC  C P     1 
ATOM   2762 O OP1   . DC  C 2 15  ? 24.820  27.946  -7.805  1.00 59.90  ? 15   DC  C OP1   1 
ATOM   2763 O OP2   . DC  C 2 15  ? 22.727  28.280  -6.349  1.00 57.30  ? 15   DC  C OP2   1 
ATOM   2764 O "O5'" . DC  C 2 15  ? 22.484  28.044  -8.794  1.00 59.05  ? 15   DC  C "O5'" 1 
ATOM   2765 C "C5'" . DC  C 2 15  ? 22.682  27.388  -10.061 1.00 57.31  ? 15   DC  C "C5'" 1 
ATOM   2766 C "C4'" . DC  C 2 15  ? 21.487  27.638  -10.949 1.00 57.96  ? 15   DC  C "C4'" 1 
ATOM   2767 O "O4'" . DC  C 2 15  ? 20.378  26.830  -10.503 1.00 54.27  ? 15   DC  C "O4'" 1 
ATOM   2768 C "C3'" . DC  C 2 15  ? 20.986  29.083  -10.940 1.00 59.84  ? 15   DC  C "C3'" 1 
ATOM   2769 O "O3'" . DC  C 2 15  ? 21.235  29.679  -12.213 1.00 64.82  ? 15   DC  C "O3'" 1 
ATOM   2770 C "C2'" . DC  C 2 15  ? 19.499  28.973  -10.647 1.00 58.13  ? 15   DC  C "C2'" 1 
ATOM   2771 C "C1'" . DC  C 2 15  ? 19.189  27.503  -10.817 1.00 54.67  ? 15   DC  C "C1'" 1 
ATOM   2772 N N1    . DC  C 2 15  ? 18.154  26.997  -9.920  1.00 53.80  ? 15   DC  C N1    1 
ATOM   2773 C C2    . DC  C 2 15  ? 17.080  26.282  -10.458 1.00 53.18  ? 15   DC  C C2    1 
ATOM   2774 O O2    . DC  C 2 15  ? 17.024  26.115  -11.685 1.00 53.63  ? 15   DC  C O2    1 
ATOM   2775 N N3    . DC  C 2 15  ? 16.118  25.817  -9.631  1.00 51.56  ? 15   DC  C N3    1 
ATOM   2776 C C4    . DC  C 2 15  ? 16.217  26.014  -8.315  1.00 50.50  ? 15   DC  C C4    1 
ATOM   2777 N N4    . DC  C 2 15  ? 15.257  25.517  -7.536  1.00 50.24  ? 15   DC  C N4    1 
ATOM   2778 C C5    . DC  C 2 15  ? 17.307  26.728  -7.739  1.00 50.92  ? 15   DC  C C5    1 
ATOM   2779 C C6    . DC  C 2 15  ? 18.245  27.196  -8.570  1.00 53.02  ? 15   DC  C C6    1 
ATOM   2780 P P     . DA  C 2 16  ? 20.859  31.194  -12.461 1.00 70.34  ? 16   DA  C P     1 
ATOM   2781 O OP1   . DA  C 2 16  ? 21.901  31.801  -13.332 1.00 75.72  ? 16   DA  C OP1   1 
ATOM   2782 O OP2   . DA  C 2 16  ? 20.523  31.810  -11.150 1.00 68.89  ? 16   DA  C OP2   1 
ATOM   2783 O "O5'" . DA  C 2 16  ? 19.522  31.097  -13.309 1.00 69.61  ? 16   DA  C "O5'" 1 
ATOM   2784 C "C5'" . DA  C 2 16  ? 19.415  30.233  -14.446 1.00 69.46  ? 16   DA  C "C5'" 1 
ATOM   2785 C "C4'" . DA  C 2 16  ? 17.952  30.107  -14.793 1.00 69.55  ? 16   DA  C "C4'" 1 
ATOM   2786 O "O4'" . DA  C 2 16  ? 17.268  29.462  -13.691 1.00 64.71  ? 16   DA  C "O4'" 1 
ATOM   2787 C "C3'" . DA  C 2 16  ? 17.255  31.454  -15.003 1.00 72.26  ? 16   DA  C "C3'" 1 
ATOM   2788 O "O3'" . DA  C 2 16  ? 16.511  31.405  -16.220 1.00 74.97  ? 16   DA  C "O3'" 1 
ATOM   2789 C "C2'" . DA  C 2 16  ? 16.391  31.617  -13.763 1.00 70.90  ? 16   DA  C "C2'" 1 
ATOM   2790 C "C1'" . DA  C 2 16  ? 16.081  30.181  -13.397 1.00 66.60  ? 16   DA  C "C1'" 1 
ATOM   2791 N N9    . DA  C 2 16  ? 15.748  29.933  -11.994 1.00 63.83  ? 16   DA  C N9    1 
ATOM   2792 C C8    . DA  C 2 16  ? 16.394  30.374  -10.864 1.00 63.77  ? 16   DA  C C8    1 
ATOM   2793 N N7    . DA  C 2 16  ? 15.871  29.924  -9.748  1.00 62.70  ? 16   DA  C N7    1 
ATOM   2794 C C5    . DA  C 2 16  ? 14.802  29.145  -10.171 1.00 59.61  ? 16   DA  C C5    1 
ATOM   2795 C C6    . DA  C 2 16  ? 13.835  28.400  -9.471  1.00 57.85  ? 16   DA  C C6    1 
ATOM   2796 N N6    . DA  C 2 16  ? 13.785  28.311  -8.140  1.00 56.14  ? 16   DA  C N6    1 
ATOM   2797 N N1    . DA  C 2 16  ? 12.921  27.720  -10.197 1.00 57.80  ? 16   DA  C N1    1 
ATOM   2798 C C2    . DA  C 2 16  ? 12.966  27.811  -11.532 1.00 59.19  ? 16   DA  C C2    1 
ATOM   2799 N N3    . DA  C 2 16  ? 13.817  28.485  -12.302 1.00 59.07  ? 16   DA  C N3    1 
ATOM   2800 C C4    . DA  C 2 16  ? 14.723  29.134  -11.552 1.00 60.09  ? 16   DA  C C4    1 
ATOM   2801 P P     . DA  C 2 17  ? 15.697  32.684  -16.732 1.00 63.48  ? 17   DA  C P     1 
ATOM   2802 O OP1   . DA  C 2 17  ? 15.984  32.846  -18.183 1.00 64.94  ? 17   DA  C OP1   1 
ATOM   2803 O OP2   . DA  C 2 17  ? 15.947  33.811  -15.795 1.00 62.11  ? 17   DA  C OP2   1 
ATOM   2804 O "O5'" . DA  C 2 17  ? 14.198  32.178  -16.584 1.00 62.03  ? 17   DA  C "O5'" 1 
ATOM   2805 C "C5'" . DA  C 2 17  ? 13.890  30.813  -16.930 1.00 63.40  ? 17   DA  C "C5'" 1 
ATOM   2806 C "C4'" . DA  C 2 17  ? 12.470  30.491  -16.535 1.00 63.57  ? 17   DA  C "C4'" 1 
ATOM   2807 O "O4'" . DA  C 2 17  ? 12.408  30.179  -15.125 1.00 61.09  ? 17   DA  C "O4'" 1 
ATOM   2808 C "C3'" . DA  C 2 17  ? 11.490  31.642  -16.755 1.00 64.52  ? 17   DA  C "C3'" 1 
ATOM   2809 O "O3'" . DA  C 2 17  ? 10.329  31.083  -17.359 1.00 68.22  ? 17   DA  C "O3'" 1 
ATOM   2810 C "C2'" . DA  C 2 17  ? 11.262  32.189  -15.358 1.00 60.12  ? 17   DA  C "C2'" 1 
ATOM   2811 C "C1'" . DA  C 2 17  ? 11.367  30.934  -14.525 1.00 57.48  ? 17   DA  C "C1'" 1 
ATOM   2812 N N9    . DA  C 2 17  ? 11.724  31.146  -13.125 1.00 52.67  ? 17   DA  C N9    1 
ATOM   2813 C C8    . DA  C 2 17  ? 12.721  31.942  -12.613 1.00 52.21  ? 17   DA  C C8    1 
ATOM   2814 N N7    . DA  C 2 17  ? 12.800  31.912  -11.304 1.00 49.16  ? 17   DA  C N7    1 
ATOM   2815 C C5    . DA  C 2 17  ? 11.802  31.023  -10.931 1.00 50.25  ? 17   DA  C C5    1 
ATOM   2816 C C6    . DA  C 2 17  ? 11.391  30.532  -9.678  1.00 50.68  ? 17   DA  C C6    1 
ATOM   2817 N N6    . DA  C 2 17  ? 11.944  30.907  -8.526  1.00 51.78  ? 17   DA  C N6    1 
ATOM   2818 N N1    . DA  C 2 17  ? 10.378  29.636  -9.653  1.00 51.18  ? 17   DA  C N1    1 
ATOM   2819 C C2    . DA  C 2 17  ? 9.815   29.275  -10.815 1.00 52.96  ? 17   DA  C C2    1 
ATOM   2820 N N3    . DA  C 2 17  ? 10.126  29.652  -12.056 1.00 52.91  ? 17   DA  C N3    1 
ATOM   2821 C C4    . DA  C 2 17  ? 11.140  30.535  -12.044 1.00 51.57  ? 17   DA  C C4    1 
ATOM   2822 P P     . DT  C 2 18  ? 9.083   32.004  -17.675 1.00 74.38  ? 18   DT  C P     1 
ATOM   2823 O OP1   . DT  C 2 18  ? 8.392   31.451  -18.878 1.00 80.17  ? 18   DT  C OP1   1 
ATOM   2824 O OP2   . DT  C 2 18  ? 9.520   33.436  -17.637 1.00 72.71  ? 18   DT  C OP2   1 
ATOM   2825 O "O5'" . DT  C 2 18  ? 8.174   31.766  -16.394 1.00 70.00  ? 18   DT  C "O5'" 1 
ATOM   2826 C "C5'" . DT  C 2 18  ? 7.548   30.497  -16.185 1.00 70.46  ? 18   DT  C "C5'" 1 
ATOM   2827 C "C4'" . DT  C 2 18  ? 6.735   30.587  -14.921 1.00 68.77  ? 18   DT  C "C4'" 1 
ATOM   2828 O "O4'" . DT  C 2 18  ? 7.611   30.934  -13.831 1.00 64.11  ? 18   DT  C "O4'" 1 
ATOM   2829 C "C3'" . DT  C 2 18  ? 5.663   31.681  -14.948 1.00 69.48  ? 18   DT  C "C3'" 1 
ATOM   2830 O "O3'" . DT  C 2 18  ? 4.384   31.057  -15.078 1.00 75.27  ? 18   DT  C "O3'" 1 
ATOM   2831 C "C2'" . DT  C 2 18  ? 5.844   32.426  -13.633 1.00 64.39  ? 18   DT  C "C2'" 1 
ATOM   2832 C "C1'" . DT  C 2 18  ? 6.805   31.543  -12.856 1.00 61.29  ? 18   DT  C "C1'" 1 
ATOM   2833 N N1    . DT  C 2 18  ? 7.690   32.224  -11.898 1.00 55.98  ? 18   DT  C N1    1 
ATOM   2834 C C2    . DT  C 2 18  ? 7.557   31.908  -10.562 1.00 53.81  ? 18   DT  C C2    1 
ATOM   2835 O O2    . DT  C 2 18  ? 6.723   31.120  -10.143 1.00 54.01  ? 18   DT  C O2    1 
ATOM   2836 N N3    . DT  C 2 18  ? 8.423   32.572  -9.729  1.00 50.06  ? 18   DT  C N3    1 
ATOM   2837 C C4    . DT  C 2 18  ? 9.387   33.490  -10.092 1.00 50.39  ? 18   DT  C C4    1 
ATOM   2838 O O4    . DT  C 2 18  ? 10.086  34.013  -9.230  1.00 53.45  ? 18   DT  C O4    1 
ATOM   2839 C C5    . DT  C 2 18  ? 9.479   33.766  -11.508 1.00 51.00  ? 18   DT  C C5    1 
ATOM   2840 C C7    . DT  C 2 18  ? 10.510  34.734  -11.994 1.00 50.53  ? 18   DT  C C7    1 
ATOM   2841 C C6    . DT  C 2 18  ? 8.639   33.125  -12.330 1.00 53.41  ? 18   DT  C C6    1 
ATOM   2842 P P     . DC  C 2 19  ? 3.077   31.940  -15.378 1.00 79.07  ? 19   DC  C P     1 
ATOM   2843 O OP1   . DC  C 2 19  ? 2.258   31.230  -16.391 1.00 81.49  ? 19   DC  C OP1   1 
ATOM   2844 O OP2   . DC  C 2 19  ? 3.504   33.345  -15.593 1.00 77.45  ? 19   DC  C OP2   1 
ATOM   2845 O "O5'" . DC  C 2 19  ? 2.314   31.939  -13.980 1.00 73.96  ? 19   DC  C "O5'" 1 
ATOM   2846 C "C5'" . DC  C 2 19  ? 2.229   30.764  -13.152 1.00 72.00  ? 19   DC  C "C5'" 1 
ATOM   2847 C "C4'" . DC  C 2 19  ? 1.839   31.170  -11.751 1.00 68.62  ? 19   DC  C "C4'" 1 
ATOM   2848 O "O4'" . DC  C 2 19  ? 3.005   31.615  -11.022 1.00 65.56  ? 19   DC  C "O4'" 1 
ATOM   2849 C "C3'" . DC  C 2 19  ? 0.838   32.328  -11.692 1.00 67.14  ? 19   DC  C "C3'" 1 
ATOM   2850 O "O3'" . DC  C 2 19  ? -0.388  31.876  -11.118 1.00 69.63  ? 19   DC  C "O3'" 1 
ATOM   2851 C "C2'" . DC  C 2 19  ? 1.535   33.397  -10.868 1.00 61.29  ? 19   DC  C "C2'" 1 
ATOM   2852 C "C1'" . DC  C 2 19  ? 2.604   32.630  -10.128 1.00 59.04  ? 19   DC  C "C1'" 1 
ATOM   2853 N N1    . DC  C 2 19  ? 3.798   33.413  -9.767  1.00 55.06  ? 19   DC  C N1    1 
ATOM   2854 C C2    . DC  C 2 19  ? 4.216   33.443  -8.428  1.00 53.89  ? 19   DC  C C2    1 
ATOM   2855 O O2    . DC  C 2 19  ? 3.559   32.821  -7.579  1.00 54.38  ? 19   DC  C O2    1 
ATOM   2856 N N3    . DC  C 2 19  ? 5.328   34.140  -8.098  1.00 50.91  ? 19   DC  C N3    1 
ATOM   2857 C C4    . DC  C 2 19  ? 6.001   34.805  -9.040  1.00 49.36  ? 19   DC  C C4    1 
ATOM   2858 N N4    . DC  C 2 19  ? 7.086   35.482  -8.671  1.00 48.46  ? 19   DC  C N4    1 
ATOM   2859 C C5    . DC  C 2 19  ? 5.605   34.781  -10.409 1.00 51.57  ? 19   DC  C C5    1 
ATOM   2860 C C6    . DC  C 2 19  ? 4.511   34.076  -10.726 1.00 53.80  ? 19   DC  C C6    1 
ATOM   2861 P P     . DT  C 2 20  ? -1.653  32.849  -11.060 1.00 71.51  ? 20   DT  C P     1 
ATOM   2862 O OP1   . DT  C 2 20  ? -2.872  31.989  -11.121 1.00 75.47  ? 20   DT  C OP1   1 
ATOM   2863 O OP2   . DT  C 2 20  ? -1.447  33.935  -12.053 1.00 70.13  ? 20   DT  C OP2   1 
ATOM   2864 O "O5'" . DT  C 2 20  ? -1.549  33.446  -9.587  1.00 65.61  ? 20   DT  C "O5'" 1 
ATOM   2865 C "C5'" . DT  C 2 20  ? -1.592  32.532  -8.472  1.00 67.21  ? 20   DT  C "C5'" 1 
ATOM   2866 C "C4'" . DT  C 2 20  ? -1.278  33.266  -7.193  1.00 63.79  ? 20   DT  C "C4'" 1 
ATOM   2867 O "O4'" . DT  C 2 20  ? 0.057   33.812  -7.264  1.00 60.92  ? 20   DT  C "O4'" 1 
ATOM   2868 C "C3'" . DT  C 2 20  ? -2.208  34.446  -6.916  1.00 63.23  ? 20   DT  C "C3'" 1 
ATOM   2869 O "O3'" . DT  C 2 20  ? -2.787  34.228  -5.635  1.00 65.45  ? 20   DT  C "O3'" 1 
ATOM   2870 C "C2'" . DT  C 2 20  ? -1.296  35.662  -6.946  1.00 60.29  ? 20   DT  C "C2'" 1 
ATOM   2871 C "C1'" . DT  C 2 20  ? 0.068   35.078  -6.643  1.00 56.56  ? 20   DT  C "C1'" 1 
ATOM   2872 N N1    . DT  C 2 20  ? 1.233   35.822  -7.162  1.00 51.89  ? 20   DT  C N1    1 
ATOM   2873 C C2    . DT  C 2 20  ? 2.197   36.235  -6.268  1.00 50.45  ? 20   DT  C C2    1 
ATOM   2874 O O2    . DT  C 2 20  ? 2.124   36.032  -5.069  1.00 49.83  ? 20   DT  C O2    1 
ATOM   2875 N N3    . DT  C 2 20  ? 3.253   36.904  -6.833  1.00 50.42  ? 20   DT  C N3    1 
ATOM   2876 C C4    . DT  C 2 20  ? 3.442   37.184  -8.171  1.00 51.67  ? 20   DT  C C4    1 
ATOM   2877 O O4    . DT  C 2 20  ? 4.449   37.788  -8.533  1.00 52.38  ? 20   DT  C O4    1 
ATOM   2878 C C5    . DT  C 2 20  ? 2.397   36.715  -9.053  1.00 52.43  ? 20   DT  C C5    1 
ATOM   2879 C C7    . DT  C 2 20  ? 2.512   36.983  -10.520 1.00 54.26  ? 20   DT  C C7    1 
ATOM   2880 C C6    . DT  C 2 20  ? 1.361   36.062  -8.512  1.00 52.31  ? 20   DT  C C6    1 
ATOM   2881 P P     . DT  C 2 21  ? -3.925  35.173  -5.107  1.00 66.45  ? 21   DT  C P     1 
ATOM   2882 O OP1   . DT  C 2 21  ? -4.859  34.325  -4.304  1.00 65.81  ? 21   DT  C OP1   1 
ATOM   2883 O OP2   . DT  C 2 21  ? -4.423  35.976  -6.263  1.00 69.17  ? 21   DT  C OP2   1 
ATOM   2884 O "O5'" . DT  C 2 21  ? -3.138  36.158  -4.136  1.00 60.50  ? 21   DT  C "O5'" 1 
ATOM   2885 C "C5'" . DT  C 2 21  ? -2.389  35.627  -3.044  1.00 59.92  ? 21   DT  C "C5'" 1 
ATOM   2886 C "C4'" . DT  C 2 21  ? -1.481  36.691  -2.478  1.00 58.66  ? 21   DT  C "C4'" 1 
ATOM   2887 O "O4'" . DT  C 2 21  ? -0.513  37.096  -3.471  1.00 57.00  ? 21   DT  C "O4'" 1 
ATOM   2888 C "C3'" . DT  C 2 21  ? -2.195  37.969  -2.023  1.00 57.79  ? 21   DT  C "C3'" 1 
ATOM   2889 O "O3'" . DT  C 2 21  ? -1.981  38.124  -0.614  1.00 59.09  ? 21   DT  C "O3'" 1 
ATOM   2890 C "C2'" . DT  C 2 21  ? -1.584  39.064  -2.889  1.00 56.40  ? 21   DT  C "C2'" 1 
ATOM   2891 C "C1'" . DT  C 2 21  ? -0.250  38.470  -3.302  1.00 54.36  ? 21   DT  C "C1'" 1 
ATOM   2892 N N1    . DT  C 2 21  ? 0.364   38.968  -4.554  1.00 52.04  ? 21   DT  C N1    1 
ATOM   2893 C C2    . DT  C 2 21  ? 1.585   39.604  -4.472  1.00 54.22  ? 21   DT  C C2    1 
ATOM   2894 O O2    . DT  C 2 21  ? 2.172   39.797  -3.416  1.00 55.79  ? 21   DT  C O2    1 
ATOM   2895 N N3    . DT  C 2 21  ? 2.093   40.027  -5.677  1.00 54.22  ? 21   DT  C N3    1 
ATOM   2896 C C4    . DT  C 2 21  ? 1.524   39.864  -6.925  1.00 53.79  ? 21   DT  C C4    1 
ATOM   2897 O O4    . DT  C 2 21  ? 2.109   40.279  -7.921  1.00 53.65  ? 21   DT  C O4    1 
ATOM   2898 C C5    . DT  C 2 21  ? 0.253   39.173  -6.939  1.00 53.60  ? 21   DT  C C5    1 
ATOM   2899 C C7    . DT  C 2 21  ? -0.454  38.985  -8.244  1.00 55.08  ? 21   DT  C C7    1 
ATOM   2900 C C6    . DT  C 2 21  ? -0.255  38.764  -5.767  1.00 51.49  ? 21   DT  C C6    1 
ATOM   2901 P P     . DT  C 2 22  ? -2.677  39.306  0.183   1.00 61.26  ? 22   DT  C P     1 
ATOM   2902 O OP1   . DT  C 2 22  ? -2.799  38.905  1.606   1.00 65.04  ? 22   DT  C OP1   1 
ATOM   2903 O OP2   . DT  C 2 22  ? -3.891  39.707  -0.578  1.00 61.68  ? 22   DT  C OP2   1 
ATOM   2904 O "O5'" . DT  C 2 22  ? -1.569  40.451  0.152   1.00 63.03  ? 22   DT  C "O5'" 1 
ATOM   2905 C "C5'" . DT  C 2 22  ? -0.611  40.563  1.225   1.00 65.35  ? 22   DT  C "C5'" 1 
ATOM   2906 C "C4'" . DT  C 2 22  ? 0.553   41.434  0.814   1.00 65.79  ? 22   DT  C "C4'" 1 
ATOM   2907 O "O4'" . DT  C 2 22  ? 0.782   41.309  -0.602  1.00 64.06  ? 22   DT  C "O4'" 1 
ATOM   2908 C "C3'" . DT  C 2 22  ? 0.346   42.926  1.060   1.00 68.63  ? 22   DT  C "C3'" 1 
ATOM   2909 O "O3'" . DT  C 2 22  ? 0.952   43.304  2.301   1.00 72.66  ? 22   DT  C "O3'" 1 
ATOM   2910 C "C2'" . DT  C 2 22  ? 1.022   43.605  -0.124  1.00 68.61  ? 22   DT  C "C2'" 1 
ATOM   2911 C "C1'" . DT  C 2 22  ? 1.453   42.475  -1.046  1.00 66.22  ? 22   DT  C "C1'" 1 
ATOM   2912 N N1    . DT  C 2 22  ? 1.143   42.658  -2.481  1.00 66.36  ? 22   DT  C N1    1 
ATOM   2913 C C2    . DT  C 2 22  ? 2.138   43.171  -3.282  1.00 69.79  ? 22   DT  C C2    1 
ATOM   2914 O O2    . DT  C 2 22  ? 3.235   43.495  -2.857  1.00 73.09  ? 22   DT  C O2    1 
ATOM   2915 N N3    . DT  C 2 22  ? 1.804   43.286  -4.608  1.00 69.67  ? 22   DT  C N3    1 
ATOM   2916 C C4    . DT  C 2 22  ? 0.606   42.938  -5.201  1.00 68.00  ? 22   DT  C C4    1 
ATOM   2917 O O4    . DT  C 2 22  ? 0.456   43.094  -6.411  1.00 70.32  ? 22   DT  C O4    1 
ATOM   2918 C C5    . DT  C 2 22  ? -0.394  42.402  -4.302  1.00 64.11  ? 22   DT  C C5    1 
ATOM   2919 C C7    . DT  C 2 22  ? -1.731  42.013  -4.852  1.00 62.67  ? 22   DT  C C7    1 
ATOM   2920 C C6    . DT  C 2 22  ? -0.080  42.292  -3.005  1.00 63.38  ? 22   DT  C C6    1 
ATOM   2921 O "O5'" . DA  D 2 1   ? 8.436   46.197  -12.051 1.00 80.16  ? 1    DA  D "O5'" 1 
ATOM   2922 C "C5'" . DA  D 2 1   ? 9.506   46.996  -11.490 1.00 82.53  ? 1    DA  D "C5'" 1 
ATOM   2923 C "C4'" . DA  D 2 1   ? 9.342   47.165  -9.994  1.00 81.54  ? 1    DA  D "C4'" 1 
ATOM   2924 O "O4'" . DA  D 2 1   ? 7.944   47.275  -9.632  1.00 79.46  ? 1    DA  D "O4'" 1 
ATOM   2925 C "C3'" . DA  D 2 1   ? 9.943   46.059  -9.131  1.00 79.75  ? 1    DA  D "C3'" 1 
ATOM   2926 O "O3'" . DA  D 2 1   ? 10.988  46.599  -8.323  1.00 84.20  ? 1    DA  D "O3'" 1 
ATOM   2927 C "C2'" . DA  D 2 1   ? 8.805   45.574  -8.248  1.00 76.43  ? 1    DA  D "C2'" 1 
ATOM   2928 C "C1'" . DA  D 2 1   ? 7.660   46.549  -8.451  1.00 74.24  ? 1    DA  D "C1'" 1 
ATOM   2929 N N9    . DA  D 2 1   ? 6.380   45.870  -8.635  1.00 67.70  ? 1    DA  D N9    1 
ATOM   2930 C C8    . DA  D 2 1   ? 5.763   45.507  -9.808  1.00 65.77  ? 1    DA  D C8    1 
ATOM   2931 N N7    . DA  D 2 1   ? 4.630   44.874  -9.634  1.00 61.99  ? 1    DA  D N7    1 
ATOM   2932 C C5    . DA  D 2 1   ? 4.504   44.792  -8.255  1.00 62.77  ? 1    DA  D C5    1 
ATOM   2933 C C6    . DA  D 2 1   ? 3.520   44.222  -7.429  1.00 61.68  ? 1    DA  D C6    1 
ATOM   2934 N N6    . DA  D 2 1   ? 2.427   43.615  -7.893  1.00 60.83  ? 1    DA  D N6    1 
ATOM   2935 N N1    . DA  D 2 1   ? 3.704   44.294  -6.092  1.00 61.01  ? 1    DA  D N1    1 
ATOM   2936 C C2    . DA  D 2 1   ? 4.797   44.917  -5.627  1.00 61.99  ? 1    DA  D C2    1 
ATOM   2937 N N3    . DA  D 2 1   ? 5.788   45.495  -6.303  1.00 62.60  ? 1    DA  D N3    1 
ATOM   2938 C C4    . DA  D 2 1   ? 5.580   45.392  -7.627  1.00 63.84  ? 1    DA  D C4    1 
ATOM   2939 P P     . DA  D 2 2   ? 12.154  45.645  -7.772  1.00 88.48  ? 2    DA  D P     1 
ATOM   2940 O OP1   . DA  D 2 2   ? 13.278  46.524  -7.346  1.00 91.35  ? 2    DA  D OP1   1 
ATOM   2941 O OP2   . DA  D 2 2   ? 12.387  44.570  -8.776  1.00 81.63  ? 2    DA  D OP2   1 
ATOM   2942 O "O5'" . DA  D 2 2   ? 11.512  44.999  -6.461  1.00 80.21  ? 2    DA  D "O5'" 1 
ATOM   2943 C "C5'" . DA  D 2 2   ? 11.165  45.838  -5.338  1.00 80.09  ? 2    DA  D "C5'" 1 
ATOM   2944 C "C4'" . DA  D 2 2   ? 10.527  45.022  -4.237  1.00 75.04  ? 2    DA  D "C4'" 1 
ATOM   2945 O "O4'" . DA  D 2 2   ? 9.211   44.563  -4.633  1.00 70.57  ? 2    DA  D "O4'" 1 
ATOM   2946 C "C3'" . DA  D 2 2   ? 11.304  43.771  -3.833  1.00 69.49  ? 2    DA  D "C3'" 1 
ATOM   2947 O "O3'" . DA  D 2 2   ? 11.284  43.728  -2.399  1.00 70.75  ? 2    DA  D "O3'" 1 
ATOM   2948 C "C2'" . DA  D 2 2   ? 10.555  42.655  -4.539  1.00 64.35  ? 2    DA  D "C2'" 1 
ATOM   2949 C "C1'" . DA  D 2 2   ? 9.127   43.147  -4.489  1.00 61.44  ? 2    DA  D "C1'" 1 
ATOM   2950 N N9    . DA  D 2 2   ? 8.248   42.643  -5.543  1.00 57.12  ? 2    DA  D N9    1 
ATOM   2951 C C8    . DA  D 2 2   ? 8.503   42.583  -6.890  1.00 57.40  ? 2    DA  D C8    1 
ATOM   2952 N N7    . DA  D 2 2   ? 7.506   42.113  -7.597  1.00 56.16  ? 2    DA  D N7    1 
ATOM   2953 C C5    . DA  D 2 2   ? 6.525   41.848  -6.654  1.00 52.94  ? 2    DA  D C5    1 
ATOM   2954 C C6    . DA  D 2 2   ? 5.220   41.341  -6.767  1.00 51.29  ? 2    DA  D C6    1 
ATOM   2955 N N6    . DA  D 2 2   ? 4.664   40.989  -7.925  1.00 50.51  ? 2    DA  D N6    1 
ATOM   2956 N N1    . DA  D 2 2   ? 4.504   41.189  -5.631  1.00 51.14  ? 2    DA  D N1    1 
ATOM   2957 C C2    . DA  D 2 2   ? 5.055   41.568  -4.470  1.00 52.03  ? 2    DA  D C2    1 
ATOM   2958 N N3    . DA  D 2 2   ? 6.269   42.071  -4.239  1.00 53.41  ? 2    DA  D N3    1 
ATOM   2959 C C4    . DA  D 2 2   ? 6.966   42.173  -5.384  1.00 54.52  ? 2    DA  D C4    1 
ATOM   2960 P P     . DA  D 2 3   ? 11.810  42.442  -1.607  1.00 73.04  ? 3    DA  D P     1 
ATOM   2961 O OP1   . DA  D 2 3   ? 12.487  42.912  -0.371  1.00 72.66  ? 3    DA  D OP1   1 
ATOM   2962 O OP2   . DA  D 2 3   ? 12.532  41.554  -2.579  1.00 71.36  ? 3    DA  D OP2   1 
ATOM   2963 O "O5'" . DA  D 2 3   ? 10.453  41.718  -1.185  1.00 67.65  ? 3    DA  D "O5'" 1 
ATOM   2964 C "C5'" . DA  D 2 3   ? 9.610   42.237  -0.139  1.00 63.39  ? 3    DA  D "C5'" 1 
ATOM   2965 C "C4'" . DA  D 2 3   ? 8.625   41.173  0.285   1.00 59.66  ? 3    DA  D "C4'" 1 
ATOM   2966 O "O4'" . DA  D 2 3   ? 7.804   40.800  -0.851  1.00 56.00  ? 3    DA  D "O4'" 1 
ATOM   2967 C "C3'" . DA  D 2 3   ? 9.281   39.878  0.767   1.00 59.41  ? 3    DA  D "C3'" 1 
ATOM   2968 O "O3'" . DA  D 2 3   ? 8.527   39.306  1.840   1.00 60.53  ? 3    DA  D "O3'" 1 
ATOM   2969 C "C2'" . DA  D 2 3   ? 9.272   38.996  -0.471  1.00 55.15  ? 3    DA  D "C2'" 1 
ATOM   2970 C "C1'" . DA  D 2 3   ? 7.974   39.409  -1.140  1.00 53.23  ? 3    DA  D "C1'" 1 
ATOM   2971 N N9    . DA  D 2 3   ? 7.932   39.233  -2.591  1.00 49.68  ? 3    DA  D N9    1 
ATOM   2972 C C8    . DA  D 2 3   ? 8.908   39.503  -3.517  1.00 49.48  ? 3    DA  D C8    1 
ATOM   2973 N N7    . DA  D 2 3   ? 8.544   39.261  -4.755  1.00 47.94  ? 3    DA  D N7    1 
ATOM   2974 C C5    . DA  D 2 3   ? 7.245   38.790  -4.634  1.00 46.82  ? 3    DA  D C5    1 
ATOM   2975 C C6    . DA  D 2 3   ? 6.300   38.355  -5.585  1.00 45.89  ? 3    DA  D C6    1 
ATOM   2976 N N6    . DA  D 2 3   ? 6.530   38.318  -6.894  1.00 44.76  ? 3    DA  D N6    1 
ATOM   2977 N N1    . DA  D 2 3   ? 5.088   37.963  -5.133  1.00 47.32  ? 3    DA  D N1    1 
ATOM   2978 C C2    . DA  D 2 3   ? 4.851   38.005  -3.813  1.00 46.55  ? 3    DA  D C2    1 
ATOM   2979 N N3    . DA  D 2 3   ? 5.658   38.387  -2.823  1.00 46.61  ? 3    DA  D N3    1 
ATOM   2980 C C4    . DA  D 2 3   ? 6.858   38.758  -3.305  1.00 47.79  ? 3    DA  D C4    1 
ATOM   2981 P P     . DG  D 2 4   ? 9.090   38.018  2.613   1.00 60.64  ? 4    DG  D P     1 
ATOM   2982 O OP1   . DG  D 2 4   ? 8.813   38.175  4.065   1.00 60.08  ? 4    DG  D OP1   1 
ATOM   2983 O OP2   . DG  D 2 4   ? 10.475  37.767  2.137   1.00 60.18  ? 4    DG  D OP2   1 
ATOM   2984 O "O5'" . DG  D 2 4   ? 8.163   36.845  2.067   1.00 56.81  ? 4    DG  D "O5'" 1 
ATOM   2985 C "C5'" . DG  D 2 4   ? 6.765   36.819  2.380   1.00 55.38  ? 4    DG  D "C5'" 1 
ATOM   2986 C "C4'" . DG  D 2 4   ? 6.146   35.597  1.749   1.00 52.85  ? 4    DG  D "C4'" 1 
ATOM   2987 O "O4'" . DG  D 2 4   ? 6.159   35.737  0.310   1.00 48.43  ? 4    DG  D "O4'" 1 
ATOM   2988 C "C3'" . DG  D 2 4   ? 6.891   34.297  2.066   1.00 53.27  ? 4    DG  D "C3'" 1 
ATOM   2989 O "O3'" . DG  D 2 4   ? 5.955   33.412  2.673   1.00 55.12  ? 4    DG  D "O3'" 1 
ATOM   2990 C "C2'" . DG  D 2 4   ? 7.454   33.844  0.726   1.00 50.85  ? 4    DG  D "C2'" 1 
ATOM   2991 C "C1'" . DG  D 2 4   ? 6.551   34.513  -0.290  1.00 48.54  ? 4    DG  D "C1'" 1 
ATOM   2992 N N9    . DG  D 2 4   ? 7.193   34.828  -1.562  1.00 48.13  ? 4    DG  D N9    1 
ATOM   2993 C C8    . DG  D 2 4   ? 8.424   35.418  -1.734  1.00 50.05  ? 4    DG  D C8    1 
ATOM   2994 N N7    . DG  D 2 4   ? 8.721   35.630  -2.989  1.00 47.83  ? 4    DG  D N7    1 
ATOM   2995 C C5    . DG  D 2 4   ? 7.635   35.123  -3.690  1.00 45.83  ? 4    DG  D C5    1 
ATOM   2996 C C6    . DG  D 2 4   ? 7.395   35.057  -5.086  1.00 44.65  ? 4    DG  D C6    1 
ATOM   2997 O O6    . DG  D 2 4   ? 8.115   35.454  -6.012  1.00 47.31  ? 4    DG  D O6    1 
ATOM   2998 N N1    . DG  D 2 4   ? 6.157   34.486  -5.368  1.00 42.91  ? 4    DG  D N1    1 
ATOM   2999 C C2    . DG  D 2 4   ? 5.266   34.031  -4.429  1.00 42.01  ? 4    DG  D C2    1 
ATOM   3000 N N2    . DG  D 2 4   ? 4.132   33.501  -4.906  1.00 40.16  ? 4    DG  D N2    1 
ATOM   3001 N N3    . DG  D 2 4   ? 5.484   34.069  -3.121  1.00 42.83  ? 4    DG  D N3    1 
ATOM   3002 C C4    . DG  D 2 4   ? 6.677   34.632  -2.825  1.00 46.14  ? 4    DG  D C4    1 
ATOM   3003 P P     . DA  D 2 5   ? 6.412   31.991  3.200   1.00 57.01  ? 5    DA  D P     1 
ATOM   3004 O OP1   . DA  D 2 5   ? 5.312   31.444  4.043   1.00 57.40  ? 5    DA  D OP1   1 
ATOM   3005 O OP2   . DA  D 2 5   ? 7.792   32.105  3.762   1.00 55.46  ? 5    DA  D OP2   1 
ATOM   3006 O "O5'" . DA  D 2 5   ? 6.425   31.158  1.856   1.00 51.96  ? 5    DA  D "O5'" 1 
ATOM   3007 C "C5'" . DA  D 2 5   ? 5.206   31.006  1.129   1.00 50.85  ? 5    DA  D "C5'" 1 
ATOM   3008 C "C4'" . DA  D 2 5   ? 5.465   30.417  -0.236  1.00 49.55  ? 5    DA  D "C4'" 1 
ATOM   3009 O "O4'" . DA  D 2 5   ? 6.285   31.284  -1.041  1.00 49.67  ? 5    DA  D "O4'" 1 
ATOM   3010 C "C3'" . DA  D 2 5   ? 6.193   29.077  -0.274  1.00 51.41  ? 5    DA  D "C3'" 1 
ATOM   3011 O "O3'" . DA  D 2 5   ? 5.252   28.001  -0.238  1.00 53.28  ? 5    DA  D "O3'" 1 
ATOM   3012 C "C2'" . DA  D 2 5   ? 6.985   29.144  -1.578  1.00 50.21  ? 5    DA  D "C2'" 1 
ATOM   3013 C "C1'" . DA  D 2 5   ? 6.601   30.500  -2.161  1.00 47.99  ? 5    DA  D "C1'" 1 
ATOM   3014 N N9    . DA  D 2 5   ? 7.622   31.197  -2.947  1.00 46.58  ? 5    DA  D N9    1 
ATOM   3015 C C8    . DA  D 2 5   ? 8.764   31.837  -2.529  1.00 47.77  ? 5    DA  D C8    1 
ATOM   3016 N N7    . DA  D 2 5   ? 9.482   32.336  -3.509  1.00 45.18  ? 5    DA  D N7    1 
ATOM   3017 C C5    . DA  D 2 5   ? 8.755   32.016  -4.649  1.00 44.00  ? 5    DA  D C5    1 
ATOM   3018 C C6    . DA  D 2 5   ? 8.979   32.260  -6.015  1.00 42.08  ? 5    DA  D C6    1 
ATOM   3019 N N6    . DA  D 2 5   ? 10.038  32.923  -6.488  1.00 42.79  ? 5    DA  D N6    1 
ATOM   3020 N N1    . DA  D 2 5   ? 8.074   31.781  -6.894  1.00 42.35  ? 5    DA  D N1    1 
ATOM   3021 C C2    . DA  D 2 5   ? 7.019   31.103  -6.425  1.00 44.11  ? 5    DA  D C2    1 
ATOM   3022 N N3    . DA  D 2 5   ? 6.695   30.814  -5.166  1.00 43.72  ? 5    DA  D N3    1 
ATOM   3023 C C4    . DA  D 2 5   ? 7.615   31.302  -4.318  1.00 45.04  ? 5    DA  D C4    1 
ATOM   3024 P P     . DT  D 2 6   ? 5.755   26.475  -0.460  1.00 58.93  ? 6    DT  D P     1 
ATOM   3025 O OP1   . DT  D 2 6   ? 4.768   25.563  0.192   1.00 58.51  ? 6    DT  D OP1   1 
ATOM   3026 O OP2   . DT  D 2 6   ? 7.199   26.373  -0.098  1.00 53.39  ? 6    DT  D OP2   1 
ATOM   3027 O "O5'" . DT  D 2 6   ? 5.669   26.325  -2.041  1.00 51.12  ? 6    DT  D "O5'" 1 
ATOM   3028 C "C5'" . DT  D 2 6   ? 4.425   26.520  -2.718  1.00 50.05  ? 6    DT  D "C5'" 1 
ATOM   3029 C "C4'" . DT  D 2 6   ? 4.610   26.307  -4.201  1.00 48.71  ? 6    DT  D "C4'" 1 
ATOM   3030 O "O4'" . DT  D 2 6   ? 5.571   27.257  -4.703  1.00 45.67  ? 6    DT  D "O4'" 1 
ATOM   3031 C "C3'" . DT  D 2 6   ? 5.142   24.923  -4.585  1.00 51.27  ? 6    DT  D "C3'" 1 
ATOM   3032 O "O3'" . DT  D 2 6   ? 4.158   24.295  -5.407  1.00 55.37  ? 6    DT  D "O3'" 1 
ATOM   3033 C "C2'" . DT  D 2 6   ? 6.477   25.205  -5.266  1.00 47.79  ? 6    DT  D "C2'" 1 
ATOM   3034 C "C1'" . DT  D 2 6   ? 6.331   26.647  -5.718  1.00 44.03  ? 6    DT  D "C1'" 1 
ATOM   3035 N N1    . DT  D 2 6   ? 7.590   27.398  -5.825  1.00 42.55  ? 6    DT  D N1    1 
ATOM   3036 C C2    . DT  D 2 6   ? 8.006   27.826  -7.064  1.00 43.10  ? 6    DT  D C2    1 
ATOM   3037 O O2    . DT  D 2 6   ? 7.389   27.590  -8.090  1.00 47.13  ? 6    DT  D O2    1 
ATOM   3038 N N3    . DT  D 2 6   ? 9.204   28.505  -7.063  1.00 40.96  ? 6    DT  D N3    1 
ATOM   3039 C C4    . DT  D 2 6   ? 9.995   28.802  -5.967  1.00 39.41  ? 6    DT  D C4    1 
ATOM   3040 O O4    . DT  D 2 6   ? 11.040  29.425  -6.117  1.00 37.53  ? 6    DT  D O4    1 
ATOM   3041 C C5    . DT  D 2 6   ? 9.490   28.330  -4.698  1.00 40.47  ? 6    DT  D C5    1 
ATOM   3042 C C7    . DT  D 2 6   ? 10.283  28.595  -3.457  1.00 40.19  ? 6    DT  D C7    1 
ATOM   3043 C C6    . DT  D 2 6   ? 8.323   27.674  -4.690  1.00 42.51  ? 6    DT  D C6    1 
ATOM   3044 P P     . DT  D 2 7   ? 4.436   22.851  -6.024  1.00 61.25  ? 7    DT  D P     1 
ATOM   3045 O OP1   . DT  D 2 7   ? 3.116   22.230  -6.353  1.00 63.76  ? 7    DT  D OP1   1 
ATOM   3046 O OP2   . DT  D 2 7   ? 5.384   22.145  -5.133  1.00 56.54  ? 7    DT  D OP2   1 
ATOM   3047 O "O5'" . DT  D 2 7   ? 5.202   23.193  -7.379  1.00 56.10  ? 7    DT  D "O5'" 1 
ATOM   3048 C "C5'" . DT  D 2 7   ? 4.521   23.808  -8.482  1.00 54.75  ? 7    DT  D "C5'" 1 
ATOM   3049 C "C4'" . DT  D 2 7   ? 5.427   23.826  -9.690  1.00 53.78  ? 7    DT  D "C4'" 1 
ATOM   3050 O "O4'" . DT  D 2 7   ? 6.542   24.700  -9.437  1.00 50.59  ? 7    DT  D "O4'" 1 
ATOM   3051 C "C3'" . DT  D 2 7   ? 6.019   22.466  -10.061 1.00 54.49  ? 7    DT  D "C3'" 1 
ATOM   3052 O "O3'" . DT  D 2 7   ? 5.462   22.073  -11.315 1.00 57.32  ? 7    DT  D "O3'" 1 
ATOM   3053 C "C2'" . DT  D 2 7   ? 7.525   22.682  -10.091 1.00 51.38  ? 7    DT  D "C2'" 1 
ATOM   3054 C "C1'" . DT  D 2 7   ? 7.700   24.185  -10.052 1.00 50.35  ? 7    DT  D "C1'" 1 
ATOM   3055 N N1    . DT  D 2 7   ? 8.842   24.647  -9.265  1.00 48.13  ? 7    DT  D N1    1 
ATOM   3056 C C2    . DT  D 2 7   ? 9.762   25.485  -9.850  1.00 48.04  ? 7    DT  D C2    1 
ATOM   3057 O O2    . DT  D 2 7   ? 9.721   25.805  -11.026 1.00 47.10  ? 7    DT  D O2    1 
ATOM   3058 N N3    . DT  D 2 7   ? 10.769  25.897  -9.013  1.00 47.35  ? 7    DT  D N3    1 
ATOM   3059 C C4    . DT  D 2 7   ? 10.915  25.592  -7.675  1.00 46.55  ? 7    DT  D C4    1 
ATOM   3060 O O4    . DT  D 2 7   ? 11.869  26.039  -7.048  1.00 48.30  ? 7    DT  D O4    1 
ATOM   3061 C C5    . DT  D 2 7   ? 9.884   24.752  -7.117  1.00 46.95  ? 7    DT  D C5    1 
ATOM   3062 C C7    . DT  D 2 7   ? 9.955   24.376  -5.671  1.00 48.18  ? 7    DT  D C7    1 
ATOM   3063 C C6    . DT  D 2 7   ? 8.912   24.329  -7.929  1.00 47.21  ? 7    DT  D C6    1 
ATOM   3064 P P     . DG  D 2 8   ? 5.694   20.606  -11.854 1.00 62.74  ? 8    DG  D P     1 
ATOM   3065 O OP1   . DG  D 2 8   ? 4.530   20.258  -12.713 1.00 64.28  ? 8    DG  D OP1   1 
ATOM   3066 O OP2   . DG  D 2 8   ? 6.062   19.740  -10.693 1.00 59.67  ? 8    DG  D OP2   1 
ATOM   3067 O "O5'" . DG  D 2 8   ? 6.988   20.780  -12.778 1.00 60.35  ? 8    DG  D "O5'" 1 
ATOM   3068 C "C5'" . DG  D 2 8   ? 7.107   21.907  -13.671 1.00 57.04  ? 8    DG  D "C5'" 1 
ATOM   3069 C "C4'" . DG  D 2 8   ? 8.405   21.841  -14.438 1.00 55.22  ? 8    DG  D "C4'" 1 
ATOM   3070 O "O4'" . DG  D 2 8   ? 9.453   22.488  -13.681 1.00 51.85  ? 8    DG  D "O4'" 1 
ATOM   3071 C "C3'" . DG  D 2 8   ? 8.916   20.436  -14.755 1.00 56.11  ? 8    DG  D "C3'" 1 
ATOM   3072 O "O3'" . DG  D 2 8   ? 9.423   20.482  -16.091 1.00 58.07  ? 8    DG  D "O3'" 1 
ATOM   3073 C "C2'" . DG  D 2 8   ? 9.950   20.190  -13.668 1.00 54.23  ? 8    DG  D "C2'" 1 
ATOM   3074 C "C1'" . DG  D 2 8   ? 10.510  21.581  -13.413 1.00 51.27  ? 8    DG  D "C1'" 1 
ATOM   3075 N N9    . DG  D 2 8   ? 10.985  21.834  -12.054 1.00 48.65  ? 8    DG  D N9    1 
ATOM   3076 C C8    . DG  D 2 8   ? 10.539  21.254  -10.890 1.00 48.79  ? 8    DG  D C8    1 
ATOM   3077 N N7    . DG  D 2 8   ? 11.162  21.692  -9.830  1.00 47.28  ? 8    DG  D N7    1 
ATOM   3078 C C5    . DG  D 2 8   ? 12.073  22.614  -10.323 1.00 45.49  ? 8    DG  D C5    1 
ATOM   3079 C C6    . DG  D 2 8   ? 13.015  23.425  -9.643  1.00 45.48  ? 8    DG  D C6    1 
ATOM   3080 O O6    . DG  D 2 8   ? 13.243  23.489  -8.432  1.00 46.28  ? 8    DG  D O6    1 
ATOM   3081 N N1    . DG  D 2 8   ? 13.728  24.230  -10.524 1.00 46.41  ? 8    DG  D N1    1 
ATOM   3082 C C2    . DG  D 2 8   ? 13.557  24.254  -11.885 1.00 46.68  ? 8    DG  D C2    1 
ATOM   3083 N N2    . DG  D 2 8   ? 14.359  25.087  -12.563 1.00 46.69  ? 8    DG  D N2    1 
ATOM   3084 N N3    . DG  D 2 8   ? 12.677  23.507  -12.533 1.00 46.85  ? 8    DG  D N3    1 
ATOM   3085 C C4    . DG  D 2 8   ? 11.966  22.724  -11.693 1.00 46.36  ? 8    DG  D C4    1 
ATOM   3086 P P     . DA  D 2 9   ? 10.144  19.230  -16.773 1.00 61.30  ? 9    DA  D P     1 
ATOM   3087 O OP1   . DA  D 2 9   ? 9.584   19.070  -18.149 1.00 65.14  ? 9    DA  D OP1   1 
ATOM   3088 O OP2   . DA  D 2 9   ? 10.109  18.079  -15.830 1.00 61.73  ? 9    DA  D OP2   1 
ATOM   3089 O "O5'" . DA  D 2 9   ? 11.636  19.751  -16.913 1.00 57.90  ? 9    DA  D "O5'" 1 
ATOM   3090 C "C5'" . DA  D 2 9   ? 11.884  21.112  -17.289 1.00 58.33  ? 9    DA  D "C5'" 1 
ATOM   3091 C "C4'" . DA  D 2 9   ? 13.369  21.376  -17.302 1.00 58.46  ? 9    DA  D "C4'" 1 
ATOM   3092 O "O4'" . DA  D 2 9   ? 13.808  21.681  -15.958 1.00 57.99  ? 9    DA  D "O4'" 1 
ATOM   3093 C "C3'" . DA  D 2 9   ? 14.214  20.186  -17.744 1.00 59.77  ? 9    DA  D "C3'" 1 
ATOM   3094 O "O3'" . DA  D 2 9   ? 15.346  20.701  -18.437 1.00 61.32  ? 9    DA  D "O3'" 1 
ATOM   3095 C "C2'" . DA  D 2 9   ? 14.589  19.519  -16.434 1.00 56.36  ? 9    DA  D "C2'" 1 
ATOM   3096 C "C1'" . DA  D 2 9   ? 14.763  20.716  -15.527 1.00 55.08  ? 9    DA  D "C1'" 1 
ATOM   3097 N N9    . DA  D 2 9   ? 14.540  20.480  -14.102 1.00 53.56  ? 9    DA  D N9    1 
ATOM   3098 C C8    . DA  D 2 9   ? 13.622  19.652  -13.502 1.00 53.57  ? 9    DA  D C8    1 
ATOM   3099 N N7    . DA  D 2 9   ? 13.663  19.682  -12.192 1.00 50.53  ? 9    DA  D N7    1 
ATOM   3100 C C5    . DA  D 2 9   ? 14.661  20.603  -11.911 1.00 48.86  ? 9    DA  D C5    1 
ATOM   3101 C C6    . DA  D 2 9   ? 15.180  21.092  -10.702 1.00 49.10  ? 9    DA  D C6    1 
ATOM   3102 N N6    . DA  D 2 9   ? 14.748  20.700  -9.503  1.00 50.57  ? 9    DA  D N6    1 
ATOM   3103 N N1    . DA  D 2 9   ? 16.189  21.990  -10.768 1.00 47.55  ? 9    DA  D N1    1 
ATOM   3104 C C2    . DA  D 2 9   ? 16.627  22.373  -11.973 1.00 47.06  ? 9    DA  D C2    1 
ATOM   3105 N N3    . DA  D 2 9   ? 16.206  21.999  -13.178 1.00 48.83  ? 9    DA  D N3    1 
ATOM   3106 C C4    . DA  D 2 9   ? 15.208  21.104  -13.076 1.00 49.55  ? 9    DA  D C4    1 
ATOM   3107 P P     . DG  D 2 10  ? 16.312  19.722  -19.258 1.00 64.20  ? 10   DG  D P     1 
ATOM   3108 O OP1   . DG  D 2 10  ? 16.518  20.325  -20.604 1.00 65.62  ? 10   DG  D OP1   1 
ATOM   3109 O OP2   . DG  D 2 10  ? 15.799  18.328  -19.124 1.00 63.75  ? 10   DG  D OP2   1 
ATOM   3110 O "O5'" . DG  D 2 10  ? 17.660  19.765  -18.407 1.00 60.04  ? 10   DG  D "O5'" 1 
ATOM   3111 C "C5'" . DG  D 2 10  ? 18.338  21.011  -18.222 1.00 58.83  ? 10   DG  D "C5'" 1 
ATOM   3112 C "C4'" . DG  D 2 10  ? 19.273  20.907  -17.046 1.00 57.05  ? 10   DG  D "C4'" 1 
ATOM   3113 O "O4'" . DG  D 2 10  ? 18.522  20.654  -15.837 1.00 55.44  ? 10   DG  D "O4'" 1 
ATOM   3114 C "C3'" . DG  D 2 10  ? 20.297  19.773  -17.142 1.00 58.84  ? 10   DG  D "C3'" 1 
ATOM   3115 O "O3'" . DG  D 2 10  ? 21.536  20.329  -16.707 1.00 58.32  ? 10   DG  D "O3'" 1 
ATOM   3116 C "C2'" . DG  D 2 10  ? 19.773  18.740  -16.159 1.00 57.61  ? 10   DG  D "C2'" 1 
ATOM   3117 C "C1'" . DG  D 2 10  ? 19.217  19.661  -15.105 1.00 56.23  ? 10   DG  D "C1'" 1 
ATOM   3118 N N9    . DG  D 2 10  ? 18.299  19.065  -14.141 1.00 56.72  ? 10   DG  D N9    1 
ATOM   3119 C C8    . DG  D 2 10  ? 17.235  18.231  -14.388 1.00 56.60  ? 10   DG  D C8    1 
ATOM   3120 N N7    . DG  D 2 10  ? 16.612  17.863  -13.301 1.00 55.47  ? 10   DG  D N7    1 
ATOM   3121 C C5    . DG  D 2 10  ? 17.323  18.471  -12.274 1.00 55.94  ? 10   DG  D C5    1 
ATOM   3122 C C6    . DG  D 2 10  ? 17.117  18.450  -10.864 1.00 56.47  ? 10   DG  D C6    1 
ATOM   3123 O O6    . DG  D 2 10  ? 16.235  17.868  -10.218 1.00 61.02  ? 10   DG  D O6    1 
ATOM   3124 N N1    . DG  D 2 10  ? 18.063  19.220  -10.199 1.00 52.88  ? 10   DG  D N1    1 
ATOM   3125 C C2    . DG  D 2 10  ? 19.089  19.903  -10.800 1.00 53.12  ? 10   DG  D C2    1 
ATOM   3126 N N2    . DG  D 2 10  ? 19.909  20.578  -9.983  1.00 53.15  ? 10   DG  D N2    1 
ATOM   3127 N N3    . DG  D 2 10  ? 19.277  19.952  -12.107 1.00 56.07  ? 10   DG  D N3    1 
ATOM   3128 C C4    . DG  D 2 10  ? 18.365  19.218  -12.778 1.00 55.69  ? 10   DG  D C4    1 
ATOM   3129 P P     . DA  D 2 11  ? 22.898  19.512  -16.817 1.00 63.09  ? 11   DA  D P     1 
ATOM   3130 O OP1   . DA  D 2 11  ? 23.834  20.309  -17.662 1.00 65.71  ? 11   DA  D OP1   1 
ATOM   3131 O OP2   . DA  D 2 11  ? 22.579  18.093  -17.167 1.00 59.75  ? 11   DA  D OP2   1 
ATOM   3132 O "O5'" . DA  D 2 11  ? 23.440  19.562  -15.325 1.00 57.39  ? 11   DA  D "O5'" 1 
ATOM   3133 C "C5'" . DA  D 2 11  ? 23.507  20.821  -14.626 1.00 57.86  ? 11   DA  D "C5'" 1 
ATOM   3134 C "C4'" . DA  D 2 11  ? 23.981  20.609  -13.209 1.00 54.70  ? 11   DA  D "C4'" 1 
ATOM   3135 O "O4'" . DA  D 2 11  ? 22.896  20.041  -12.434 1.00 53.14  ? 11   DA  D "O4'" 1 
ATOM   3136 C "C3'" . DA  D 2 11  ? 25.139  19.619  -13.087 1.00 53.24  ? 11   DA  D "C3'" 1 
ATOM   3137 O "O3'" . DA  D 2 11  ? 26.020  19.997  -12.036 1.00 53.60  ? 11   DA  D "O3'" 1 
ATOM   3138 C "C2'" . DA  D 2 11  ? 24.453  18.310  -12.744 1.00 49.70  ? 11   DA  D "C2'" 1 
ATOM   3139 C "C1'" . DA  D 2 11  ? 23.287  18.773  -11.901 1.00 48.97  ? 11   DA  D "C1'" 1 
ATOM   3140 N N9    . DA  D 2 11  ? 22.120  17.895  -11.935 1.00 47.16  ? 11   DA  D N9    1 
ATOM   3141 C C8    . DA  D 2 11  ? 21.490  17.356  -13.030 1.00 46.83  ? 11   DA  D C8    1 
ATOM   3142 N N7    . DA  D 2 11  ? 20.457  16.607  -12.730 1.00 44.45  ? 11   DA  D N7    1 
ATOM   3143 C C5    . DA  D 2 11  ? 20.388  16.674  -11.346 1.00 43.73  ? 11   DA  D C5    1 
ATOM   3144 C C6    . DA  D 2 11  ? 19.489  16.128  -10.418 1.00 41.26  ? 11   DA  D C6    1 
ATOM   3145 N N6    . DA  D 2 11  ? 18.453  15.368  -10.756 1.00 41.79  ? 11   DA  D N6    1 
ATOM   3146 N N1    . DA  D 2 11  ? 19.702  16.384  -9.111  1.00 40.75  ? 11   DA  D N1    1 
ATOM   3147 C C2    . DA  D 2 11  ? 20.729  17.171  -8.770  1.00 42.88  ? 11   DA  D C2    1 
ATOM   3148 N N3    . DA  D 2 11  ? 21.631  17.760  -9.550  1.00 45.75  ? 11   DA  D N3    1 
ATOM   3149 C C4    . DA  D 2 11  ? 21.407  17.461  -10.842 1.00 46.27  ? 11   DA  D C4    1 
ATOM   3150 P P     . DT  D 2 12  ? 27.378  19.222  -11.842 1.00 55.71  ? 12   DT  D P     1 
ATOM   3151 O OP1   . DT  D 2 12  ? 28.430  20.242  -11.546 1.00 56.68  ? 12   DT  D OP1   1 
ATOM   3152 O OP2   . DT  D 2 12  ? 27.527  18.223  -12.938 1.00 54.23  ? 12   DT  D OP2   1 
ATOM   3153 O "O5'" . DT  D 2 12  ? 27.095  18.339  -10.548 1.00 52.76  ? 12   DT  D "O5'" 1 
ATOM   3154 C "C5'" . DT  D 2 12  ? 26.819  18.981  -9.309  1.00 51.53  ? 12   DT  D "C5'" 1 
ATOM   3155 C "C4'" . DT  D 2 12  ? 26.322  17.951  -8.331  1.00 50.12  ? 12   DT  D "C4'" 1 
ATOM   3156 O "O4'" . DT  D 2 12  ? 25.109  17.346  -8.826  1.00 51.35  ? 12   DT  D "O4'" 1 
ATOM   3157 C "C3'" . DT  D 2 12  ? 27.298  16.799  -8.076  1.00 47.88  ? 12   DT  D "C3'" 1 
ATOM   3158 O "O3'" . DT  D 2 12  ? 27.702  16.948  -6.716  1.00 47.28  ? 12   DT  D "O3'" 1 
ATOM   3159 C "C2'" . DT  D 2 12  ? 26.494  15.547  -8.394  1.00 47.63  ? 12   DT  D "C2'" 1 
ATOM   3160 C "C1'" . DT  D 2 12  ? 25.060  16.027  -8.334  1.00 47.94  ? 12   DT  D "C1'" 1 
ATOM   3161 N N1    . DT  D 2 12  ? 24.098  15.269  -9.162  1.00 48.68  ? 12   DT  D N1    1 
ATOM   3162 C C2    . DT  D 2 12  ? 23.044  14.634  -8.538  1.00 48.27  ? 12   DT  D C2    1 
ATOM   3163 O O2    . DT  D 2 12  ? 22.860  14.675  -7.333  1.00 49.35  ? 12   DT  D O2    1 
ATOM   3164 N N3    . DT  D 2 12  ? 22.206  13.949  -9.384  1.00 45.85  ? 12   DT  D N3    1 
ATOM   3165 C C4    . DT  D 2 12  ? 22.315  13.842  -10.757 1.00 46.13  ? 12   DT  D C4    1 
ATOM   3166 O O4    . DT  D 2 12  ? 21.468  13.219  -11.390 1.00 47.22  ? 12   DT  D O4    1 
ATOM   3167 C C5    . DT  D 2 12  ? 23.445  14.531  -11.343 1.00 45.56  ? 12   DT  D C5    1 
ATOM   3168 C C7    . DT  D 2 12  ? 23.651  14.464  -12.822 1.00 46.33  ? 12   DT  D C7    1 
ATOM   3169 C C6    . DT  D 2 12  ? 24.273  15.193  -10.526 1.00 47.08  ? 12   DT  D C6    1 
ATOM   3170 P P     . DC  D 2 13  ? 28.566  15.852  -5.988  1.00 46.22  ? 13   DC  D P     1 
ATOM   3171 O OP1   . DC  D 2 13  ? 29.201  16.500  -4.811  1.00 50.24  ? 13   DC  D OP1   1 
ATOM   3172 O OP2   . DC  D 2 13  ? 29.409  15.180  -6.999  1.00 47.30  ? 13   DC  D OP2   1 
ATOM   3173 O "O5'" . DC  D 2 13  ? 27.449  14.897  -5.369  1.00 46.23  ? 13   DC  D "O5'" 1 
ATOM   3174 C "C5'" . DC  D 2 13  ? 26.702  15.337  -4.205  1.00 44.99  ? 13   DC  D "C5'" 1 
ATOM   3175 C "C4'" . DC  D 2 13  ? 25.873  14.200  -3.662  1.00 43.24  ? 13   DC  D "C4'" 1 
ATOM   3176 O "O4'" . DC  D 2 13  ? 25.010  13.719  -4.724  1.00 41.33  ? 13   DC  D "O4'" 1 
ATOM   3177 C "C3'" . DC  D 2 13  ? 26.712  13.001  -3.212  1.00 42.71  ? 13   DC  D "C3'" 1 
ATOM   3178 O "O3'" . DC  D 2 13  ? 26.335  12.563  -1.897  1.00 43.20  ? 13   DC  D "O3'" 1 
ATOM   3179 C "C2'" . DC  D 2 13  ? 26.503  11.982  -4.325  1.00 41.08  ? 13   DC  D "C2'" 1 
ATOM   3180 C "C1'" . DC  D 2 13  ? 25.106  12.309  -4.814  1.00 39.87  ? 13   DC  D "C1'" 1 
ATOM   3181 N N1    . DC  D 2 13  ? 24.791  11.915  -6.202  1.00 39.23  ? 13   DC  D N1    1 
ATOM   3182 C C2    . DC  D 2 13  ? 23.571  11.285  -6.460  1.00 37.89  ? 13   DC  D C2    1 
ATOM   3183 O O2    . DC  D 2 13  ? 22.800  11.073  -5.521  1.00 38.64  ? 13   DC  D O2    1 
ATOM   3184 N N3    . DC  D 2 13  ? 23.273  10.905  -7.723  1.00 37.86  ? 13   DC  D N3    1 
ATOM   3185 C C4    . DC  D 2 13  ? 24.128  11.163  -8.715  1.00 38.87  ? 13   DC  D C4    1 
ATOM   3186 N N4    . DC  D 2 13  ? 23.783  10.792  -9.953  1.00 38.58  ? 13   DC  D N4    1 
ATOM   3187 C C5    . DC  D 2 13  ? 25.368  11.831  -8.486  1.00 38.98  ? 13   DC  D C5    1 
ATOM   3188 C C6    . DC  D 2 13  ? 25.665  12.169  -7.223  1.00 40.07  ? 13   DC  D C6    1 
ATOM   3189 P P     . DT  D 2 14  ? 27.090  11.286  -1.216  1.00 47.17  ? 14   DT  D P     1 
ATOM   3190 O OP1   . DT  D 2 14  ? 27.333  11.595  0.217   1.00 49.26  ? 14   DT  D OP1   1 
ATOM   3191 O OP2   . DT  D 2 14  ? 28.236  10.860  -2.076  1.00 44.48  ? 14   DT  D OP2   1 
ATOM   3192 O "O5'" . DT  D 2 14  ? 25.991  10.139  -1.329  1.00 46.94  ? 14   DT  D "O5'" 1 
ATOM   3193 C "C5'" . DT  D 2 14  ? 24.650  10.384  -0.872  1.00 46.59  ? 14   DT  D "C5'" 1 
ATOM   3194 C "C4'" . DT  D 2 14  ? 23.792  9.167   -1.113  1.00 46.98  ? 14   DT  D "C4'" 1 
ATOM   3195 O "O4'" . DT  D 2 14  ? 23.533  9.035   -2.525  1.00 46.22  ? 14   DT  D "O4'" 1 
ATOM   3196 C "C3'" . DT  D 2 14  ? 24.412  7.842   -0.662  1.00 49.07  ? 14   DT  D "C3'" 1 
ATOM   3197 O "O3'" . DT  D 2 14  ? 23.457  7.161   0.154   1.00 52.12  ? 14   DT  D "O3'" 1 
ATOM   3198 C "C2'" . DT  D 2 14  ? 24.728  7.105   -1.954  1.00 46.99  ? 14   DT  D "C2'" 1 
ATOM   3199 C "C1'" . DT  D 2 14  ? 23.740  7.690   -2.939  1.00 46.76  ? 14   DT  D "C1'" 1 
ATOM   3200 N N1    . DT  D 2 14  ? 24.176  7.736   -4.344  1.00 44.70  ? 14   DT  D N1    1 
ATOM   3201 C C2    . DT  D 2 14  ? 23.303  7.298   -5.311  1.00 45.24  ? 14   DT  D C2    1 
ATOM   3202 O O2    . DT  D 2 14  ? 22.211  6.817   -5.054  1.00 47.66  ? 14   DT  D O2    1 
ATOM   3203 N N3    . DT  D 2 14  ? 23.762  7.432   -6.597  1.00 44.09  ? 14   DT  D N3    1 
ATOM   3204 C C4    . DT  D 2 14  ? 24.948  8.014   -7.004  1.00 43.65  ? 14   DT  D C4    1 
ATOM   3205 O O4    . DT  D 2 14  ? 25.202  8.116   -8.201  1.00 44.03  ? 14   DT  D O4    1 
ATOM   3206 C C5    . DT  D 2 14  ? 25.804  8.478   -5.938  1.00 43.22  ? 14   DT  D C5    1 
ATOM   3207 C C7    . DT  D 2 14  ? 27.114  9.117   -6.281  1.00 42.15  ? 14   DT  D C7    1 
ATOM   3208 C C6    . DT  D 2 14  ? 25.374  8.329   -4.678  1.00 44.06  ? 14   DT  D C6    1 
ATOM   3209 P P     . DC  D 2 15  ? 23.908  5.921   1.043   1.00 56.60  ? 15   DC  D P     1 
ATOM   3210 O OP1   . DC  D 2 15  ? 23.190  6.008   2.342   1.00 57.15  ? 15   DC  D OP1   1 
ATOM   3211 O OP2   . DC  D 2 15  ? 25.397  5.835   1.031   1.00 55.91  ? 15   DC  D OP2   1 
ATOM   3212 O "O5'" . DC  D 2 15  ? 23.405  4.688   0.173   1.00 53.67  ? 15   DC  D "O5'" 1 
ATOM   3213 C "C5'" . DC  D 2 15  ? 22.033  4.609   -0.238  1.00 54.12  ? 15   DC  D "C5'" 1 
ATOM   3214 C "C4'" . DC  D 2 15  ? 21.891  3.556   -1.308  1.00 53.87  ? 15   DC  D "C4'" 1 
ATOM   3215 O "O4'" . DC  D 2 15  ? 22.407  4.076   -2.544  1.00 50.68  ? 15   DC  D "O4'" 1 
ATOM   3216 C "C3'" . DC  D 2 15  ? 22.669  2.272   -1.032  1.00 56.75  ? 15   DC  D "C3'" 1 
ATOM   3217 O "O3'" . DC  D 2 15  ? 21.760  1.196   -0.787  1.00 62.42  ? 15   DC  D "O3'" 1 
ATOM   3218 C "C2'" . DC  D 2 15  ? 23.492  2.046   -2.287  1.00 54.94  ? 15   DC  D "C2'" 1 
ATOM   3219 C "C1'" . DC  D 2 15  ? 22.911  3.009   -3.298  1.00 50.46  ? 15   DC  D "C1'" 1 
ATOM   3220 N N1    . DC  D 2 15  ? 23.892  3.558   -4.235  1.00 46.99  ? 15   DC  D N1    1 
ATOM   3221 C C2    . DC  D 2 15  ? 23.620  3.503   -5.601  1.00 47.61  ? 15   DC  D C2    1 
ATOM   3222 O O2    . DC  D 2 15  ? 22.570  2.954   -5.981  1.00 47.39  ? 15   DC  D O2    1 
ATOM   3223 N N3    . DC  D 2 15  ? 24.525  4.011   -6.475  1.00 47.20  ? 15   DC  D N3    1 
ATOM   3224 C C4    . DC  D 2 15  ? 25.651  4.570   -6.020  1.00 46.64  ? 15   DC  D C4    1 
ATOM   3225 N N4    . DC  D 2 15  ? 26.515  5.067   -6.910  1.00 45.97  ? 15   DC  D N4    1 
ATOM   3226 C C5    . DC  D 2 15  ? 25.945  4.643   -4.629  1.00 46.26  ? 15   DC  D C5    1 
ATOM   3227 C C6    . DC  D 2 15  ? 25.047  4.131   -3.781  1.00 46.77  ? 15   DC  D C6    1 
ATOM   3228 P P     . DA  D 2 16  ? 22.329  -0.251  -0.432  1.00 69.07  ? 16   DA  D P     1 
ATOM   3229 O OP1   . DA  D 2 16  ? 21.439  -0.875  0.581   1.00 71.14  ? 16   DA  D OP1   1 
ATOM   3230 O OP2   . DA  D 2 16  ? 23.789  -0.119  -0.168  1.00 66.38  ? 16   DA  D OP2   1 
ATOM   3231 O "O5'" . DA  D 2 16  ? 22.140  -1.040  -1.804  1.00 68.27  ? 16   DA  D "O5'" 1 
ATOM   3232 C "C5'" . DA  D 2 16  ? 20.904  -1.002  -2.532  1.00 65.74  ? 16   DA  D "C5'" 1 
ATOM   3233 C "C4'" . DA  D 2 16  ? 21.159  -1.534  -3.918  1.00 64.13  ? 16   DA  D "C4'" 1 
ATOM   3234 O "O4'" . DA  D 2 16  ? 22.077  -0.636  -4.569  1.00 58.88  ? 16   DA  D "O4'" 1 
ATOM   3235 C "C3'" . DA  D 2 16  ? 21.826  -2.914  -3.940  1.00 68.78  ? 16   DA  D "C3'" 1 
ATOM   3236 O "O3'" . DA  D 2 16  ? 21.125  -3.762  -4.851  1.00 72.60  ? 16   DA  D "O3'" 1 
ATOM   3237 C "C2'" . DA  D 2 16  ? 23.260  -2.618  -4.350  1.00 66.30  ? 16   DA  D "C2'" 1 
ATOM   3238 C "C1'" . DA  D 2 16  ? 23.085  -1.377  -5.203  1.00 61.18  ? 16   DA  D "C1'" 1 
ATOM   3239 N N9    . DA  D 2 16  ? 24.258  -0.518  -5.324  1.00 57.22  ? 16   DA  D N9    1 
ATOM   3240 C C8    . DA  D 2 16  ? 25.124  -0.104  -4.342  1.00 56.58  ? 16   DA  D C8    1 
ATOM   3241 N N7    . DA  D 2 16  ? 26.099  0.650   -4.783  1.00 53.37  ? 16   DA  D N7    1 
ATOM   3242 C C5    . DA  D 2 16  ? 25.862  0.736   -6.146  1.00 52.86  ? 16   DA  D C5    1 
ATOM   3243 C C6    . DA  D 2 16  ? 26.531  1.411   -7.177  1.00 51.78  ? 16   DA  D C6    1 
ATOM   3244 N N6    . DA  D 2 16  ? 27.638  2.129   -6.988  1.00 50.57  ? 16   DA  D N6    1 
ATOM   3245 N N1    . DA  D 2 16  ? 26.040  1.290   -8.431  1.00 52.74  ? 16   DA  D N1    1 
ATOM   3246 C C2    . DA  D 2 16  ? 24.941  0.549   -8.622  1.00 54.09  ? 16   DA  D C2    1 
ATOM   3247 N N3    . DA  D 2 16  ? 24.216  -0.125  -7.728  1.00 55.31  ? 16   DA  D N3    1 
ATOM   3248 C C4    . DA  D 2 16  ? 24.733  0.020   -6.494  1.00 54.48  ? 16   DA  D C4    1 
ATOM   3249 P P     . DA  D 2 17  ? 21.596  -5.280  -5.082  1.00 82.08  ? 17   DA  D P     1 
ATOM   3250 O OP1   . DA  D 2 17  ? 20.388  -6.141  -5.069  1.00 88.22  ? 17   DA  D OP1   1 
ATOM   3251 O OP2   . DA  D 2 17  ? 22.714  -5.584  -4.151  1.00 81.03  ? 17   DA  D OP2   1 
ATOM   3252 O "O5'" . DA  D 2 17  ? 22.120  -5.235  -6.584  1.00 80.03  ? 17   DA  D "O5'" 1 
ATOM   3253 C "C5'" . DA  D 2 17  ? 21.410  -4.428  -7.545  1.00 75.16  ? 17   DA  D "C5'" 1 
ATOM   3254 C "C4'" . DA  D 2 17  ? 22.190  -4.357  -8.833  1.00 72.34  ? 17   DA  D "C4'" 1 
ATOM   3255 O "O4'" . DA  D 2 17  ? 23.228  -3.360  -8.714  1.00 69.87  ? 17   DA  D "O4'" 1 
ATOM   3256 C "C3'" . DA  D 2 17  ? 22.893  -5.655  -9.220  1.00 76.47  ? 17   DA  D "C3'" 1 
ATOM   3257 O "O3'" . DA  D 2 17  ? 22.665  -5.840  -10.615 1.00 78.53  ? 17   DA  D "O3'" 1 
ATOM   3258 C "C2'" . DA  D 2 17  ? 24.343  -5.392  -8.860  1.00 75.25  ? 17   DA  D "C2'" 1 
ATOM   3259 C "C1'" . DA  D 2 17  ? 24.452  -3.903  -9.143  1.00 69.41  ? 17   DA  D "C1'" 1 
ATOM   3260 N N9    . DA  D 2 17  ? 25.518  -3.216  -8.421  1.00 65.13  ? 17   DA  D N9    1 
ATOM   3261 C C8    . DA  D 2 17  ? 25.855  -3.338  -7.097  1.00 65.05  ? 17   DA  D C8    1 
ATOM   3262 N N7    . DA  D 2 17  ? 26.895  -2.620  -6.749  1.00 63.28  ? 17   DA  D N7    1 
ATOM   3263 C C5    . DA  D 2 17  ? 27.268  -1.982  -7.924  1.00 60.16  ? 17   DA  D C5    1 
ATOM   3264 C C6    . DA  D 2 17  ? 28.316  -1.098  -8.227  1.00 56.91  ? 17   DA  D C6    1 
ATOM   3265 N N6    . DA  D 2 17  ? 29.198  -0.667  -7.329  1.00 56.77  ? 17   DA  D N6    1 
ATOM   3266 N N1    . DA  D 2 17  ? 28.419  -0.658  -9.499  1.00 56.43  ? 17   DA  D N1    1 
ATOM   3267 C C2    . DA  D 2 17  ? 27.539  -1.104  -10.405 1.00 58.61  ? 17   DA  D C2    1 
ATOM   3268 N N3    . DA  D 2 17  ? 26.516  -1.942  -10.243 1.00 61.08  ? 17   DA  D N3    1 
ATOM   3269 C C4    . DA  D 2 17  ? 26.431  -2.344  -8.963  1.00 61.94  ? 17   DA  D C4    1 
ATOM   3270 P P     . DT  D 2 18  ? 23.299  -7.077  -11.367 1.00 65.59  ? 18   DT  D P     1 
ATOM   3271 O OP1   . DT  D 2 18  ? 22.379  -7.446  -12.480 1.00 66.55  ? 18   DT  D OP1   1 
ATOM   3272 O OP2   . DT  D 2 18  ? 23.728  -8.075  -10.352 1.00 62.35  ? 18   DT  D OP2   1 
ATOM   3273 O "O5'" . DT  D 2 18  ? 24.623  -6.454  -11.979 1.00 63.63  ? 18   DT  D "O5'" 1 
ATOM   3274 C "C5'" . DT  D 2 18  ? 24.555  -5.495  -13.036 1.00 64.85  ? 18   DT  D "C5'" 1 
ATOM   3275 C "C4'" . DT  D 2 18  ? 25.966  -5.129  -13.417 1.00 64.72  ? 18   DT  D "C4'" 1 
ATOM   3276 O "O4'" . DT  D 2 18  ? 26.632  -4.607  -12.252 1.00 63.81  ? 18   DT  D "O4'" 1 
ATOM   3277 C "C3'" . DT  D 2 18  ? 26.819  -6.311  -13.884 1.00 64.07  ? 18   DT  D "C3'" 1 
ATOM   3278 O "O3'" . DT  D 2 18  ? 27.017  -6.206  -15.296 1.00 68.24  ? 18   DT  D "O3'" 1 
ATOM   3279 C "C2'" . DT  D 2 18  ? 28.113  -6.189  -13.089 1.00 60.94  ? 18   DT  D "C2'" 1 
ATOM   3280 C "C1'" . DT  D 2 18  ? 28.011  -4.811  -12.457 1.00 59.99  ? 18   DT  D "C1'" 1 
ATOM   3281 N N1    . DT  D 2 18  ? 28.690  -4.639  -11.159 1.00 57.73  ? 18   DT  D N1    1 
ATOM   3282 C C2    . DT  D 2 18  ? 29.734  -3.744  -11.102 1.00 56.59  ? 18   DT  D C2    1 
ATOM   3283 O O2    . DT  D 2 18  ? 30.123  -3.114  -12.068 1.00 55.69  ? 18   DT  D O2    1 
ATOM   3284 N N3    . DT  D 2 18  ? 30.311  -3.617  -9.862  1.00 56.46  ? 18   DT  D N3    1 
ATOM   3285 C C4    . DT  D 2 18  ? 29.962  -4.289  -8.707  1.00 54.81  ? 18   DT  D C4    1 
ATOM   3286 O O4    . DT  D 2 18  ? 30.583  -4.082  -7.673  1.00 56.49  ? 18   DT  D O4    1 
ATOM   3287 C C5    . DT  D 2 18  ? 28.847  -5.202  -8.835  1.00 55.30  ? 18   DT  D C5    1 
ATOM   3288 C C7    . DT  D 2 18  ? 28.381  -5.953  -7.628  1.00 56.72  ? 18   DT  D C7    1 
ATOM   3289 C C6    . DT  D 2 18  ? 28.271  -5.326  -10.038 1.00 55.67  ? 18   DT  D C6    1 
ATOM   3290 P P     . DC  D 2 19  ? 27.668  -7.430  -16.117 1.00 70.98  ? 19   DC  D P     1 
ATOM   3291 O OP1   . DC  D 2 19  ? 26.926  -7.591  -17.392 1.00 73.14  ? 19   DC  D OP1   1 
ATOM   3292 O OP2   . DC  D 2 19  ? 27.832  -8.579  -15.189 1.00 67.07  ? 19   DC  D OP2   1 
ATOM   3293 O "O5'" . DC  D 2 19  ? 29.131  -6.908  -16.453 1.00 67.48  ? 19   DC  D "O5'" 1 
ATOM   3294 C "C5'" . DC  D 2 19  ? 29.406  -5.553  -16.841 1.00 66.99  ? 19   DC  D "C5'" 1 
ATOM   3295 C "C4'" . DC  D 2 19  ? 30.881  -5.280  -16.665 1.00 64.49  ? 19   DC  D "C4'" 1 
ATOM   3296 O "O4'" . DC  D 2 19  ? 31.147  -4.950  -15.282 1.00 59.38  ? 19   DC  D "O4'" 1 
ATOM   3297 C "C3'" . DC  D 2 19  ? 31.783  -6.470  -17.002 1.00 64.03  ? 19   DC  D "C3'" 1 
ATOM   3298 O "O3'" . DC  D 2 19  ? 32.625  -6.143  -18.107 1.00 68.21  ? 19   DC  D "O3'" 1 
ATOM   3299 C "C2'" . DC  D 2 19  ? 32.558  -6.739  -15.718 1.00 59.46  ? 19   DC  D "C2'" 1 
ATOM   3300 C "C1'" . DC  D 2 19  ? 32.423  -5.434  -14.951 1.00 56.63  ? 19   DC  D "C1'" 1 
ATOM   3301 N N1    . DC  D 2 19  ? 32.491  -5.559  -13.488 1.00 51.85  ? 19   DC  D N1    1 
ATOM   3302 C C2    . DC  D 2 19  ? 33.420  -4.783  -12.790 1.00 50.75  ? 19   DC  D C2    1 
ATOM   3303 O O2    . DC  D 2 19  ? 34.163  -4.023  -13.426 1.00 53.11  ? 19   DC  D O2    1 
ATOM   3304 N N3    . DC  D 2 19  ? 33.500  -4.895  -11.445 1.00 49.40  ? 19   DC  D N3    1 
ATOM   3305 C C4    . DC  D 2 19  ? 32.693  -5.738  -10.798 1.00 47.79  ? 19   DC  D C4    1 
ATOM   3306 N N4    . DC  D 2 19  ? 32.818  -5.825  -9.474  1.00 47.41  ? 19   DC  D N4    1 
ATOM   3307 C C5    . DC  D 2 19  ? 31.733  -6.539  -11.484 1.00 48.28  ? 19   DC  D C5    1 
ATOM   3308 C C6    . DC  D 2 19  ? 31.668  -6.421  -12.816 1.00 50.39  ? 19   DC  D C6    1 
ATOM   3309 P P     . DT  D 2 20  ? 33.577  -7.267  -18.751 1.00 71.04  ? 20   DT  D P     1 
ATOM   3310 O OP1   . DT  D 2 20  ? 33.749  -6.943  -20.191 1.00 74.99  ? 20   DT  D OP1   1 
ATOM   3311 O OP2   . DT  D 2 20  ? 33.059  -8.604  -18.353 1.00 67.42  ? 20   DT  D OP2   1 
ATOM   3312 O "O5'" . DT  D 2 20  ? 34.964  -6.987  -18.021 1.00 64.46  ? 20   DT  D "O5'" 1 
ATOM   3313 C "C5'" . DT  D 2 20  ? 35.591  -5.704  -18.164 1.00 64.79  ? 20   DT  D "C5'" 1 
ATOM   3314 C "C4'" . DT  D 2 20  ? 36.781  -5.617  -17.241 1.00 62.96  ? 20   DT  D "C4'" 1 
ATOM   3315 O "O4'" . DT  D 2 20  ? 36.349  -5.736  -15.866 1.00 60.69  ? 20   DT  D "O4'" 1 
ATOM   3316 C "C3'" . DT  D 2 20  ? 37.820  -6.720  -17.463 1.00 63.75  ? 20   DT  D "C3'" 1 
ATOM   3317 O "O3'" . DT  D 2 20  ? 39.071  -6.097  -17.729 1.00 64.97  ? 20   DT  D "O3'" 1 
ATOM   3318 C "C2'" . DT  D 2 20  ? 37.832  -7.506  -16.160 1.00 61.43  ? 20   DT  D "C2'" 1 
ATOM   3319 C "C1'" . DT  D 2 20  ? 37.315  -6.496  -15.157 1.00 59.87  ? 20   DT  D "C1'" 1 
ATOM   3320 N N1    . DT  D 2 20  ? 36.662  -7.057  -13.958 1.00 58.69  ? 20   DT  D N1    1 
ATOM   3321 C C2    . DT  D 2 20  ? 37.153  -6.710  -12.719 1.00 58.52  ? 20   DT  D C2    1 
ATOM   3322 O O2    . DT  D 2 20  ? 38.107  -5.966  -12.563 1.00 59.87  ? 20   DT  D O2    1 
ATOM   3323 N N3    . DT  D 2 20  ? 36.476  -7.259  -11.661 1.00 56.21  ? 20   DT  D N3    1 
ATOM   3324 C C4    . DT  D 2 20  ? 35.367  -8.079  -11.716 1.00 56.35  ? 20   DT  D C4    1 
ATOM   3325 O O4    . DT  D 2 20  ? 34.847  -8.470  -10.675 1.00 57.21  ? 20   DT  D O4    1 
ATOM   3326 C C5    . DT  D 2 20  ? 34.899  -8.396  -13.047 1.00 57.44  ? 20   DT  D C5    1 
ATOM   3327 C C7    . DT  D 2 20  ? 33.716  -9.298  -13.207 1.00 60.10  ? 20   DT  D C7    1 
ATOM   3328 C C6    . DT  D 2 20  ? 35.558  -7.872  -14.087 1.00 57.94  ? 20   DT  D C6    1 
ATOM   3329 P P     . DT  D 2 21  ? 40.324  -6.972  -18.157 1.00 68.96  ? 21   DT  D P     1 
ATOM   3330 O OP1   . DT  D 2 21  ? 41.140  -6.172  -19.125 1.00 72.00  ? 21   DT  D OP1   1 
ATOM   3331 O OP2   . DT  D 2 21  ? 39.831  -8.328  -18.535 1.00 68.63  ? 21   DT  D OP2   1 
ATOM   3332 O "O5'" . DT  D 2 21  ? 41.152  -7.080  -16.803 1.00 60.24  ? 21   DT  D "O5'" 1 
ATOM   3333 C "C5'" . DT  D 2 21  ? 41.569  -5.900  -16.107 1.00 57.35  ? 21   DT  D "C5'" 1 
ATOM   3334 C "C4'" . DT  D 2 21  ? 42.020  -6.258  -14.710 1.00 55.54  ? 21   DT  D "C4'" 1 
ATOM   3335 O "O4'" . DT  D 2 21  ? 40.926  -6.821  -13.954 1.00 53.12  ? 21   DT  D "O4'" 1 
ATOM   3336 C "C3'" . DT  D 2 21  ? 43.151  -7.288  -14.653 1.00 56.38  ? 21   DT  D "C3'" 1 
ATOM   3337 O "O3'" . DT  D 2 21  ? 44.285  -6.669  -14.033 1.00 58.44  ? 21   DT  D "O3'" 1 
ATOM   3338 C "C2'" . DT  D 2 21  ? 42.556  -8.467  -13.891 1.00 53.99  ? 21   DT  D "C2'" 1 
ATOM   3339 C "C1'" . DT  D 2 21  ? 41.444  -7.821  -13.096 1.00 52.27  ? 21   DT  D "C1'" 1 
ATOM   3340 N N1    . DT  D 2 21  ? 40.316  -8.690  -12.670 1.00 49.97  ? 21   DT  D N1    1 
ATOM   3341 C C2    . DT  D 2 21  ? 40.069  -8.818  -11.319 1.00 50.81  ? 21   DT  D C2    1 
ATOM   3342 O O2    . DT  D 2 21  ? 40.766  -8.302  -10.460 1.00 52.38  ? 21   DT  D O2    1 
ATOM   3343 N N3    . DT  D 2 21  ? 38.983  -9.601  -11.007 1.00 50.01  ? 21   DT  D N3    1 
ATOM   3344 C C4    . DT  D 2 21  ? 38.133  -10.240 -11.890 1.00 50.78  ? 21   DT  D C4    1 
ATOM   3345 O O4    . DT  D 2 21  ? 37.189  -10.903 -11.460 1.00 50.33  ? 21   DT  D O4    1 
ATOM   3346 C C5    . DT  D 2 21  ? 38.439  -10.043 -13.293 1.00 49.48  ? 21   DT  D C5    1 
ATOM   3347 C C7    . DT  D 2 21  ? 37.571  -10.693 -14.323 1.00 49.19  ? 21   DT  D C7    1 
ATOM   3348 C C6    . DT  D 2 21  ? 39.489  -9.271  -13.607 1.00 48.79  ? 21   DT  D C6    1 
ATOM   3349 P P     . DT  D 2 22  ? 45.663  -7.453  -13.932 1.00 57.84  ? 22   DT  D P     1 
ATOM   3350 O OP1   . DT  D 2 22  ? 46.754  -6.457  -13.841 1.00 62.12  ? 22   DT  D OP1   1 
ATOM   3351 O OP2   . DT  D 2 22  ? 45.681  -8.468  -15.014 1.00 59.93  ? 22   DT  D OP2   1 
ATOM   3352 O "O5'" . DT  D 2 22  ? 45.573  -8.141  -12.500 1.00 59.71  ? 22   DT  D "O5'" 1 
ATOM   3353 C "C5'" . DT  D 2 22  ? 46.092  -7.455  -11.339 1.00 62.80  ? 22   DT  D "C5'" 1 
ATOM   3354 C "C4'" . DT  D 2 22  ? 45.563  -8.077  -10.068 1.00 63.13  ? 22   DT  D "C4'" 1 
ATOM   3355 O "O4'" . DT  D 2 22  ? 44.239  -8.595  -10.297 1.00 62.68  ? 22   DT  D "O4'" 1 
ATOM   3356 C "C3'" . DT  D 2 22  ? 46.378  -9.264  -9.558  1.00 65.28  ? 22   DT  D "C3'" 1 
ATOM   3357 O "O3'" . DT  D 2 22  ? 47.297  -8.831  -8.552  1.00 69.21  ? 22   DT  D "O3'" 1 
ATOM   3358 C "C2'" . DT  D 2 22  ? 45.340  -10.227 -8.998  1.00 65.33  ? 22   DT  D "C2'" 1 
ATOM   3359 C "C1'" . DT  D 2 22  ? 43.993  -9.608  -9.338  1.00 64.18  ? 22   DT  D "C1'" 1 
ATOM   3360 N N1    . DT  D 2 22  ? 42.985  -10.532 -9.897  1.00 61.06  ? 22   DT  D N1    1 
ATOM   3361 C C2    . DT  D 2 22  ? 42.051  -11.050 -9.029  1.00 61.59  ? 22   DT  D C2    1 
ATOM   3362 O O2    . DT  D 2 22  ? 42.059  -10.824 -7.829  1.00 62.08  ? 22   DT  D O2    1 
ATOM   3363 N N3    . DT  D 2 22  ? 41.125  -11.877 -9.612  1.00 60.73  ? 22   DT  D N3    1 
ATOM   3364 C C4    . DT  D 2 22  ? 41.029  -12.212 -10.948 1.00 60.04  ? 22   DT  D C4    1 
ATOM   3365 O O4    . DT  D 2 22  ? 40.121  -12.944 -11.329 1.00 62.98  ? 22   DT  D O4    1 
ATOM   3366 C C5    . DT  D 2 22  ? 42.029  -11.617 -11.806 1.00 59.63  ? 22   DT  D C5    1 
ATOM   3367 C C7    . DT  D 2 22  ? 42.007  -11.926 -13.271 1.00 58.59  ? 22   DT  D C7    1 
ATOM   3368 C C6    . DT  D 2 22  ? 42.939  -10.809 -11.246 1.00 58.93  ? 22   DT  D C6    1 
ATOM   3369 N N     . ASN E 1 16  ? -1.954  25.567  21.785  1.00 97.92  ? 2    ASN E N     1 
ATOM   3370 C CA    . ASN E 1 16  ? -0.901  25.539  22.836  1.00 91.84  ? 2    ASN E CA    1 
ATOM   3371 C C     . ASN E 1 16  ? -1.230  24.563  23.978  1.00 91.32  ? 2    ASN E C     1 
ATOM   3372 O O     . ASN E 1 16  ? -1.034  24.887  25.161  1.00 91.07  ? 2    ASN E O     1 
ATOM   3373 C CB    . ASN E 1 16  ? -0.663  26.950  23.383  1.00 91.48  ? 2    ASN E CB    1 
ATOM   3374 N N     . ASP E 1 17  ? -1.754  23.387  23.613  1.00 91.27  ? 3    ASP E N     1 
ATOM   3375 C CA    . ASP E 1 17  ? -1.843  22.223  24.524  1.00 88.16  ? 3    ASP E CA    1 
ATOM   3376 C C     . ASP E 1 17  ? -1.121  20.965  23.962  1.00 84.75  ? 3    ASP E C     1 
ATOM   3377 O O     . ASP E 1 17  ? -1.025  19.942  24.658  1.00 81.94  ? 3    ASP E O     1 
ATOM   3378 C CB    . ASP E 1 17  ? -3.311  21.905  24.884  1.00 92.25  ? 3    ASP E CB    1 
ATOM   3379 C CG    . ASP E 1 17  ? -4.116  21.355  23.702  1.00 96.45  ? 3    ASP E CG    1 
ATOM   3380 O OD1   . ASP E 1 17  ? -3.791  21.661  22.529  1.00 95.66  ? 3    ASP E OD1   1 
ATOM   3381 O OD2   . ASP E 1 17  ? -5.088  20.615  23.955  1.00 98.73  ? 3    ASP E OD2   1 
ATOM   3382 N N     . GLU E 1 18  ? -0.611  21.066  22.721  1.00 83.61  ? 4    GLU E N     1 
ATOM   3383 C CA    . GLU E 1 18  ? 0.067   19.966  22.014  1.00 79.80  ? 4    GLU E CA    1 
ATOM   3384 C C     . GLU E 1 18  ? 1.580   20.026  22.216  1.00 73.66  ? 4    GLU E C     1 
ATOM   3385 O O     . GLU E 1 18  ? 2.178   21.094  22.100  1.00 72.60  ? 4    GLU E O     1 
ATOM   3386 C CB    . GLU E 1 18  ? -0.235  20.021  20.512  1.00 83.07  ? 4    GLU E CB    1 
ATOM   3387 C CG    . GLU E 1 18  ? 0.574   21.055  19.730  1.00 81.40  ? 4    GLU E CG    1 
ATOM   3388 C CD    . GLU E 1 18  ? 0.054   21.270  18.322  1.00 85.72  ? 4    GLU E CD    1 
ATOM   3389 O OE1   . GLU E 1 18  ? -0.694  20.407  17.808  1.00 87.32  ? 4    GLU E OE1   1 
ATOM   3390 O OE2   . GLU E 1 18  ? 0.400   22.313  17.731  1.00 86.62  ? 4    GLU E OE2   1 
ATOM   3391 N N     . PRO E 1 19  ? 2.207   18.871  22.466  1.00 70.29  ? 5    PRO E N     1 
ATOM   3392 C CA    . PRO E 1 19  ? 3.595   18.793  22.943  1.00 66.70  ? 5    PRO E CA    1 
ATOM   3393 C C     . PRO E 1 19  ? 4.683   19.337  21.989  1.00 65.24  ? 5    PRO E C     1 
ATOM   3394 O O     . PRO E 1 19  ? 4.911   18.744  20.948  1.00 66.06  ? 5    PRO E O     1 
ATOM   3395 C CB    . PRO E 1 19  ? 3.814   17.276  23.134  1.00 67.70  ? 5    PRO E CB    1 
ATOM   3396 C CG    . PRO E 1 19  ? 2.786   16.625  22.254  1.00 70.98  ? 5    PRO E CG    1 
ATOM   3397 C CD    . PRO E 1 19  ? 1.598   17.539  22.313  1.00 72.64  ? 5    PRO E CD    1 
ATOM   3398 N N     . ARG E 1 20  ? 5.362   20.420  22.383  1.00 62.80  ? 6    ARG E N     1 
ATOM   3399 C CA    . ARG E 1 20  ? 6.552   20.933  21.698  1.00 58.38  ? 6    ARG E CA    1 
ATOM   3400 C C     . ARG E 1 20  ? 7.814   20.227  22.254  1.00 55.84  ? 6    ARG E C     1 
ATOM   3401 O O     . ARG E 1 20  ? 7.712   19.210  22.951  1.00 55.50  ? 6    ARG E O     1 
ATOM   3402 C CB    . ARG E 1 20  ? 6.670   22.457  21.891  1.00 57.73  ? 6    ARG E CB    1 
ATOM   3403 C CG    . ARG E 1 20  ? 5.573   23.298  21.246  1.00 61.39  ? 6    ARG E CG    1 
ATOM   3404 C CD    . ARG E 1 20  ? 5.611   24.763  21.742  1.00 61.66  ? 6    ARG E CD    1 
ATOM   3405 N NE    . ARG E 1 20  ? 6.983   25.195  21.965  1.00 60.01  ? 6    ARG E NE    1 
ATOM   3406 C CZ    . ARG E 1 20  ? 7.379   26.116  22.849  1.00 61.47  ? 6    ARG E CZ    1 
ATOM   3407 N NH1   . ARG E 1 20  ? 6.513   26.770  23.635  1.00 63.53  ? 6    ARG E NH1   1 
ATOM   3408 N NH2   . ARG E 1 20  ? 8.675   26.397  22.947  1.00 59.55  ? 6    ARG E NH2   1 
ATOM   3409 N N     . TRP E 1 21  ? 8.992   20.708  21.848  1.00 54.70  ? 7    TRP E N     1 
ATOM   3410 C CA    . TRP E 1 21  ? 10.255  20.538  22.587  1.00 52.37  ? 7    TRP E CA    1 
ATOM   3411 C C     . TRP E 1 21  ? 10.615  21.921  23.112  1.00 50.41  ? 7    TRP E C     1 
ATOM   3412 O O     . TRP E 1 21  ? 10.060  22.913  22.643  1.00 50.88  ? 7    TRP E O     1 
ATOM   3413 C CB    . TRP E 1 21  ? 11.395  20.125  21.646  1.00 53.08  ? 7    TRP E CB    1 
ATOM   3414 C CG    . TRP E 1 21  ? 11.508  18.680  21.251  1.00 53.64  ? 7    TRP E CG    1 
ATOM   3415 C CD1   . TRP E 1 21  ? 10.599  17.695  21.482  1.00 55.33  ? 7    TRP E CD1   1 
ATOM   3416 C CD2   . TRP E 1 21  ? 12.566  18.076  20.481  1.00 54.04  ? 7    TRP E CD2   1 
ATOM   3417 N NE1   . TRP E 1 21  ? 11.025  16.509  20.926  1.00 55.78  ? 7    TRP E NE1   1 
ATOM   3418 C CE2   . TRP E 1 21  ? 12.223  16.717  20.298  1.00 54.98  ? 7    TRP E CE2   1 
ATOM   3419 C CE3   . TRP E 1 21  ? 13.770  18.551  19.933  1.00 54.35  ? 7    TRP E CE3   1 
ATOM   3420 C CZ2   . TRP E 1 21  ? 13.034  15.830  19.601  1.00 56.41  ? 7    TRP E CZ2   1 
ATOM   3421 C CZ3   . TRP E 1 21  ? 14.581  17.664  19.249  1.00 55.44  ? 7    TRP E CZ3   1 
ATOM   3422 C CH2   . TRP E 1 21  ? 14.208  16.317  19.087  1.00 56.89  ? 7    TRP E CH2   1 
ATOM   3423 N N     . LEU E 1 22  ? 11.578  21.997  24.022  1.00 47.61  ? 8    LEU E N     1 
ATOM   3424 C CA    . LEU E 1 22  ? 12.111  23.290  24.440  1.00 48.01  ? 8    LEU E CA    1 
ATOM   3425 C C     . LEU E 1 22  ? 13.385  23.644  23.696  1.00 47.09  ? 8    LEU E C     1 
ATOM   3426 O O     . LEU E 1 22  ? 14.315  22.861  23.683  1.00 48.00  ? 8    LEU E O     1 
ATOM   3427 C CB    . LEU E 1 22  ? 12.411  23.302  25.938  1.00 49.43  ? 8    LEU E CB    1 
ATOM   3428 C CG    . LEU E 1 22  ? 11.419  24.038  26.839  1.00 49.41  ? 8    LEU E CG    1 
ATOM   3429 C CD1   . LEU E 1 22  ? 10.001  23.545  26.619  1.00 48.00  ? 8    LEU E CD1   1 
ATOM   3430 C CD2   . LEU E 1 22  ? 11.865  23.854  28.289  1.00 50.53  ? 8    LEU E CD2   1 
ATOM   3431 N N     . THR E 1 23  ? 13.457  24.849  23.138  1.00 46.59  ? 9    THR E N     1 
ATOM   3432 C CA    . THR E 1 23  ? 14.684  25.294  22.494  1.00 46.99  ? 9    THR E CA    1 
ATOM   3433 C C     . THR E 1 23  ? 15.777  25.350  23.543  1.00 47.71  ? 9    THR E C     1 
ATOM   3434 O O     . THR E 1 23  ? 15.510  25.377  24.726  1.00 50.45  ? 9    THR E O     1 
ATOM   3435 C CB    . THR E 1 23  ? 14.564  26.685  21.821  1.00 48.30  ? 9    THR E CB    1 
ATOM   3436 O OG1   . THR E 1 23  ? 14.539  27.724  22.814  1.00 49.10  ? 9    THR E OG1   1 
ATOM   3437 C CG2   . THR E 1 23  ? 13.313  26.773  20.929  1.00 48.22  ? 9    THR E CG2   1 
ATOM   3438 N N     . ALA E 1 24  ? 17.017  25.368  23.116  1.00 49.65  ? 10   ALA E N     1 
ATOM   3439 C CA    . ALA E 1 24  ? 18.114  25.461  24.060  1.00 50.83  ? 10   ALA E CA    1 
ATOM   3440 C C     . ALA E 1 24  ? 18.066  26.789  24.762  1.00 53.64  ? 10   ALA E C     1 
ATOM   3441 O O     . ALA E 1 24  ? 18.517  26.881  25.911  1.00 55.48  ? 10   ALA E O     1 
ATOM   3442 C CB    . ALA E 1 24  ? 19.454  25.290  23.347  1.00 52.73  ? 10   ALA E CB    1 
ATOM   3443 N N     . GLU E 1 25  ? 17.559  27.831  24.078  1.00 55.26  ? 11   GLU E N     1 
ATOM   3444 C CA    . GLU E 1 25  ? 17.510  29.157  24.696  1.00 56.94  ? 11   GLU E CA    1 
ATOM   3445 C C     . GLU E 1 25  ? 16.575  29.033  25.872  1.00 56.14  ? 11   GLU E C     1 
ATOM   3446 O O     . GLU E 1 25  ? 16.935  29.407  26.985  1.00 57.74  ? 11   GLU E O     1 
ATOM   3447 C CB    . GLU E 1 25  ? 17.003  30.334  23.821  1.00 58.27  ? 11   GLU E CB    1 
ATOM   3448 C CG    . GLU E 1 25  ? 16.882  30.223  22.281  1.00 58.52  ? 11   GLU E CG    1 
ATOM   3449 C CD    . GLU E 1 25  ? 18.027  29.560  21.563  1.00 56.93  ? 11   GLU E CD    1 
ATOM   3450 O OE1   . GLU E 1 25  ? 18.199  28.341  21.763  1.00 53.24  ? 11   GLU E OE1   1 
ATOM   3451 O OE2   . GLU E 1 25  ? 18.696  30.246  20.754  1.00 58.77  ? 11   GLU E OE2   1 
ATOM   3452 N N     . GLU E 1 26  ? 15.370  28.527  25.605  1.00 55.35  ? 12   GLU E N     1 
ATOM   3453 C CA    . GLU E 1 26  ? 14.333  28.353  26.633  1.00 55.19  ? 12   GLU E CA    1 
ATOM   3454 C C     . GLU E 1 26  ? 14.840  27.527  27.807  1.00 53.90  ? 12   GLU E C     1 
ATOM   3455 O O     . GLU E 1 26  ? 14.623  27.888  28.959  1.00 55.25  ? 12   GLU E O     1 
ATOM   3456 C CB    . GLU E 1 26  ? 13.080  27.718  26.035  1.00 55.72  ? 12   GLU E CB    1 
ATOM   3457 C CG    . GLU E 1 26  ? 12.285  28.638  25.113  1.00 58.55  ? 12   GLU E CG    1 
ATOM   3458 C CD    . GLU E 1 26  ? 11.181  27.905  24.356  1.00 59.62  ? 12   GLU E CD    1 
ATOM   3459 O OE1   . GLU E 1 26  ? 11.429  26.761  23.899  1.00 58.76  ? 12   GLU E OE1   1 
ATOM   3460 O OE2   . GLU E 1 26  ? 10.054  28.453  24.237  1.00 61.67  ? 12   GLU E OE2   1 
ATOM   3461 N N     . GLN E 1 27  ? 15.521  26.427  27.510  1.00 51.74  ? 13   GLN E N     1 
ATOM   3462 C CA    . GLN E 1 27  ? 16.112  25.600  28.555  1.00 51.55  ? 13   GLN E CA    1 
ATOM   3463 C C     . GLN E 1 27  ? 16.984  26.430  29.489  1.00 54.80  ? 13   GLN E C     1 
ATOM   3464 O O     . GLN E 1 27  ? 16.916  26.267  30.689  1.00 55.64  ? 13   GLN E O     1 
ATOM   3465 C CB    . GLN E 1 27  ? 16.924  24.473  27.936  1.00 51.28  ? 13   GLN E CB    1 
ATOM   3466 C CG    . GLN E 1 27  ? 16.099  23.265  27.522  1.00 49.70  ? 13   GLN E CG    1 
ATOM   3467 C CD    . GLN E 1 27  ? 16.924  22.224  26.772  1.00 50.47  ? 13   GLN E CD    1 
ATOM   3468 O OE1   . GLN E 1 27  ? 17.777  21.570  27.359  1.00 53.86  ? 13   GLN E OE1   1 
ATOM   3469 N NE2   . GLN E 1 27  ? 16.659  22.054  25.476  1.00 49.63  ? 13   GLN E NE2   1 
ATOM   3470 N N     . LEU E 1 28  ? 17.795  27.332  28.928  1.00 58.08  ? 14   LEU E N     1 
ATOM   3471 C CA    . LEU E 1 28  ? 18.688  28.218  29.717  1.00 60.89  ? 14   LEU E CA    1 
ATOM   3472 C C     . LEU E 1 28  ? 17.962  29.257  30.556  1.00 61.92  ? 14   LEU E C     1 
ATOM   3473 O O     . LEU E 1 28  ? 18.414  29.625  31.653  1.00 65.10  ? 14   LEU E O     1 
ATOM   3474 C CB    . LEU E 1 28  ? 19.690  28.970  28.831  1.00 63.02  ? 14   LEU E CB    1 
ATOM   3475 C CG    . LEU E 1 28  ? 21.128  28.454  28.845  1.00 66.39  ? 14   LEU E CG    1 
ATOM   3476 C CD1   . LEU E 1 28  ? 21.163  27.059  28.292  1.00 65.25  ? 14   LEU E CD1   1 
ATOM   3477 C CD2   . LEU E 1 28  ? 22.085  29.378  28.093  1.00 69.77  ? 14   LEU E CD2   1 
ATOM   3478 N N     . VAL E 1 29  ? 16.873  29.778  30.006  1.00 60.24  ? 15   VAL E N     1 
ATOM   3479 C CA    . VAL E 1 29  ? 16.038  30.704  30.736  1.00 61.59  ? 15   VAL E CA    1 
ATOM   3480 C C     . VAL E 1 29  ? 15.500  29.977  31.956  1.00 59.64  ? 15   VAL E C     1 
ATOM   3481 O O     . VAL E 1 29  ? 15.633  30.448  33.087  1.00 60.58  ? 15   VAL E O     1 
ATOM   3482 C CB    . VAL E 1 29  ? 14.864  31.217  29.874  1.00 61.51  ? 15   VAL E CB    1 
ATOM   3483 C CG1   . VAL E 1 29  ? 13.807  31.910  30.739  1.00 63.02  ? 15   VAL E CG1   1 
ATOM   3484 C CG2   . VAL E 1 29  ? 15.381  32.167  28.811  1.00 61.96  ? 15   VAL E CG2   1 
ATOM   3485 N N     . TRP E 1 30  ? 14.903  28.816  31.707  1.00 56.88  ? 16   TRP E N     1 
ATOM   3486 C CA    . TRP E 1 30  ? 14.318  27.993  32.774  1.00 56.53  ? 16   TRP E CA    1 
ATOM   3487 C C     . TRP E 1 30  ? 15.332  27.679  33.869  1.00 58.23  ? 16   TRP E C     1 
ATOM   3488 O O     . TRP E 1 30  ? 15.039  27.818  35.046  1.00 59.70  ? 16   TRP E O     1 
ATOM   3489 C CB    . TRP E 1 30  ? 13.732  26.709  32.185  1.00 53.58  ? 16   TRP E CB    1 
ATOM   3490 C CG    . TRP E 1 30  ? 13.055  25.821  33.195  1.00 54.39  ? 16   TRP E CG    1 
ATOM   3491 C CD1   . TRP E 1 30  ? 13.380  24.527  33.497  1.00 54.11  ? 16   TRP E CD1   1 
ATOM   3492 C CD2   . TRP E 1 30  ? 11.943  26.156  34.029  1.00 54.78  ? 16   TRP E CD2   1 
ATOM   3493 N NE1   . TRP E 1 30  ? 12.543  24.044  34.471  1.00 54.46  ? 16   TRP E NE1   1 
ATOM   3494 C CE2   . TRP E 1 30  ? 11.647  25.021  34.806  1.00 54.63  ? 16   TRP E CE2   1 
ATOM   3495 C CE3   . TRP E 1 30  ? 11.159  27.304  34.184  1.00 55.75  ? 16   TRP E CE3   1 
ATOM   3496 C CZ2   . TRP E 1 30  ? 10.611  25.002  35.723  1.00 56.14  ? 16   TRP E CZ2   1 
ATOM   3497 C CZ3   . TRP E 1 30  ? 10.126  27.281  35.095  1.00 56.11  ? 16   TRP E CZ3   1 
ATOM   3498 C CH2   . TRP E 1 30  ? 9.861   26.136  35.853  1.00 56.53  ? 16   TRP E CH2   1 
ATOM   3499 N N     . ARG E 1 31  ? 16.524  27.265  33.477  1.00 50.56  ? 17   ARG E N     1 
ATOM   3500 C CA    . ARG E 1 31  ? 17.552  26.929  34.460  1.00 50.45  ? 17   ARG E CA    1 
ATOM   3501 C C     . ARG E 1 31  ? 17.780  28.122  35.349  1.00 49.88  ? 17   ARG E C     1 
ATOM   3502 O O     . ARG E 1 31  ? 17.773  28.001  36.565  1.00 49.83  ? 17   ARG E O     1 
ATOM   3503 C CB    . ARG E 1 31  ? 18.891  26.602  33.788  1.00 50.99  ? 17   ARG E CB    1 
ATOM   3504 C CG    . ARG E 1 31  ? 19.482  25.241  34.172  1.00 51.52  ? 17   ARG E CG    1 
ATOM   3505 C CD    . ARG E 1 31  ? 20.422  24.763  33.077  1.00 52.13  ? 17   ARG E CD    1 
ATOM   3506 N NE    . ARG E 1 31  ? 21.690  25.473  33.207  1.00 52.25  ? 17   ARG E NE    1 
ATOM   3507 C CZ    . ARG E 1 31  ? 22.725  25.346  32.381  1.00 52.72  ? 17   ARG E CZ    1 
ATOM   3508 N NH1   . ARG E 1 31  ? 22.654  24.510  31.352  1.00 55.33  ? 17   ARG E NH1   1 
ATOM   3509 N NH2   . ARG E 1 31  ? 23.824  26.057  32.588  1.00 51.88  ? 17   ARG E NH2   1 
ATOM   3510 N N     . SER E 1 32  ? 18.037  29.265  34.733  1.00 49.88  ? 18   SER E N     1 
ATOM   3511 C CA    . SER E 1 32  ? 18.411  30.438  35.494  1.00 50.15  ? 18   SER E CA    1 
ATOM   3512 C C     . SER E 1 32  ? 17.246  30.911  36.373  1.00 50.49  ? 18   SER E C     1 
ATOM   3513 O O     . SER E 1 32  ? 17.470  31.463  37.445  1.00 51.11  ? 18   SER E O     1 
ATOM   3514 C CB    . SER E 1 32  ? 18.962  31.541  34.580  1.00 50.60  ? 18   SER E CB    1 
ATOM   3515 O OG    . SER E 1 32  ? 17.992  32.010  33.695  1.00 50.22  ? 18   SER E OG    1 
ATOM   3516 N N     . TYR E 1 33  ? 16.011  30.667  35.947  1.00 51.65  ? 19   TYR E N     1 
ATOM   3517 C CA    . TYR E 1 33  ? 14.869  30.889  36.825  1.00 51.65  ? 19   TYR E CA    1 
ATOM   3518 C C     . TYR E 1 33  ? 14.976  30.009  38.055  1.00 51.58  ? 19   TYR E C     1 
ATOM   3519 O O     . TYR E 1 33  ? 14.951  30.500  39.177  1.00 53.27  ? 19   TYR E O     1 
ATOM   3520 C CB    . TYR E 1 33  ? 13.533  30.624  36.132  1.00 53.21  ? 19   TYR E CB    1 
ATOM   3521 C CG    . TYR E 1 33  ? 12.374  30.673  37.113  1.00 53.87  ? 19   TYR E CG    1 
ATOM   3522 C CD1   . TYR E 1 33  ? 11.846  31.880  37.525  1.00 53.96  ? 19   TYR E CD1   1 
ATOM   3523 C CD2   . TYR E 1 33  ? 11.828  29.509  37.630  1.00 55.79  ? 19   TYR E CD2   1 
ATOM   3524 C CE1   . TYR E 1 33  ? 10.805  31.933  38.437  1.00 55.90  ? 19   TYR E CE1   1 
ATOM   3525 C CE2   . TYR E 1 33  ? 10.791  29.545  38.543  1.00 57.13  ? 19   TYR E CE2   1 
ATOM   3526 C CZ    . TYR E 1 33  ? 10.285  30.763  38.947  1.00 56.75  ? 19   TYR E CZ    1 
ATOM   3527 O OH    . TYR E 1 33  ? 9.268   30.812  39.864  1.00 56.62  ? 19   TYR E OH    1 
ATOM   3528 N N     . ILE E 1 34  ? 15.100  28.708  37.842  1.00 51.95  ? 20   ILE E N     1 
ATOM   3529 C CA    . ILE E 1 34  ? 15.165  27.764  38.951  1.00 51.71  ? 20   ILE E CA    1 
ATOM   3530 C C     . ILE E 1 34  ? 16.232  28.184  39.964  1.00 50.22  ? 20   ILE E C     1 
ATOM   3531 O O     . ILE E 1 34  ? 15.978  28.177  41.156  1.00 49.26  ? 20   ILE E O     1 
ATOM   3532 C CB    . ILE E 1 34  ? 15.461  26.307  38.485  1.00 53.30  ? 20   ILE E CB    1 
ATOM   3533 C CG1   . ILE E 1 34  ? 14.409  25.799  37.499  1.00 54.66  ? 20   ILE E CG1   1 
ATOM   3534 C CG2   . ILE E 1 34  ? 15.509  25.360  39.687  1.00 52.72  ? 20   ILE E CG2   1 
ATOM   3535 C CD1   . ILE E 1 34  ? 13.000  25.776  38.070  1.00 55.73  ? 20   ILE E CD1   1 
ATOM   3536 N N     . GLU E 1 35  ? 17.431  28.499  39.485  1.00 51.51  ? 21   GLU E N     1 
ATOM   3537 C CA    . GLU E 1 35  ? 18.564  28.832  40.363  1.00 53.69  ? 21   GLU E CA    1 
ATOM   3538 C C     . GLU E 1 35  ? 18.207  30.064  41.185  1.00 55.91  ? 21   GLU E C     1 
ATOM   3539 O O     . GLU E 1 35  ? 18.281  30.057  42.423  1.00 57.86  ? 21   GLU E O     1 
ATOM   3540 C CB    . GLU E 1 35  ? 19.873  29.087  39.579  1.00 54.98  ? 21   GLU E CB    1 
ATOM   3541 C CG    . GLU E 1 35  ? 20.340  27.958  38.641  1.00 56.02  ? 21   GLU E CG    1 
ATOM   3542 C CD    . GLU E 1 35  ? 21.728  28.185  38.034  1.00 58.02  ? 21   GLU E CD    1 
ATOM   3543 O OE1   . GLU E 1 35  ? 22.192  29.348  37.973  1.00 57.34  ? 21   GLU E OE1   1 
ATOM   3544 O OE2   . GLU E 1 35  ? 22.368  27.190  37.601  1.00 61.03  ? 21   GLU E OE2   1 
ATOM   3545 N N     . ALA E 1 36  ? 17.788  31.110  40.488  1.00 54.87  ? 22   ALA E N     1 
ATOM   3546 C CA    . ALA E 1 36  ? 17.456  32.359  41.132  1.00 53.88  ? 22   ALA E CA    1 
ATOM   3547 C C     . ALA E 1 36  ? 16.462  32.130  42.251  1.00 53.26  ? 22   ALA E C     1 
ATOM   3548 O O     . ALA E 1 36  ? 16.705  32.507  43.410  1.00 55.43  ? 22   ALA E O     1 
ATOM   3549 C CB    . ALA E 1 36  ? 16.893  33.328  40.115  1.00 54.30  ? 22   ALA E CB    1 
ATOM   3550 N N     . ALA E 1 37  ? 15.349  31.497  41.911  1.00 52.20  ? 23   ALA E N     1 
ATOM   3551 C CA    . ALA E 1 37  ? 14.290  31.235  42.887  1.00 51.30  ? 23   ALA E CA    1 
ATOM   3552 C C     . ALA E 1 37  ? 14.796  30.416  44.072  1.00 50.49  ? 23   ALA E C     1 
ATOM   3553 O O     . ALA E 1 37  ? 14.506  30.727  45.214  1.00 49.88  ? 23   ALA E O     1 
ATOM   3554 C CB    . ALA E 1 37  ? 13.132  30.530  42.218  1.00 52.41  ? 23   ALA E CB    1 
ATOM   3555 N N     . THR E 1 38  ? 15.588  29.387  43.795  1.00 50.51  ? 24   THR E N     1 
ATOM   3556 C CA    . THR E 1 38  ? 16.112  28.533  44.858  1.00 49.69  ? 24   THR E CA    1 
ATOM   3557 C C     . THR E 1 38  ? 17.100  29.291  45.745  1.00 50.87  ? 24   THR E C     1 
ATOM   3558 O O     . THR E 1 38  ? 17.152  29.039  46.946  1.00 48.58  ? 24   THR E O     1 
ATOM   3559 C CB    . THR E 1 38  ? 16.783  27.266  44.300  1.00 48.22  ? 24   THR E CB    1 
ATOM   3560 O OG1   . THR E 1 38  ? 15.880  26.597  43.406  1.00 47.72  ? 24   THR E OG1   1 
ATOM   3561 C CG2   . THR E 1 38  ? 17.164  26.302  45.424  1.00 48.43  ? 24   THR E CG2   1 
ATOM   3562 N N     . LEU E 1 39  ? 17.837  30.233  45.157  1.00 51.00  ? 25   LEU E N     1 
ATOM   3563 C CA    . LEU E 1 39  ? 18.793  31.051  45.910  1.00 52.56  ? 25   LEU E CA    1 
ATOM   3564 C C     . LEU E 1 39  ? 18.110  32.159  46.690  1.00 52.85  ? 25   LEU E C     1 
ATOM   3565 O O     . LEU E 1 39  ? 18.511  32.446  47.818  1.00 54.54  ? 25   LEU E O     1 
ATOM   3566 C CB    . LEU E 1 39  ? 19.848  31.680  44.990  1.00 54.02  ? 25   LEU E CB    1 
ATOM   3567 C CG    . LEU E 1 39  ? 20.897  30.744  44.381  1.00 55.53  ? 25   LEU E CG    1 
ATOM   3568 C CD1   . LEU E 1 39  ? 21.591  31.448  43.225  1.00 57.63  ? 25   LEU E CD1   1 
ATOM   3569 C CD2   . LEU E 1 39  ? 21.921  30.281  45.410  1.00 55.97  ? 25   LEU E CD2   1 
ATOM   3570 N N     . LEU E 1 40  ? 17.088  32.789  46.101  1.00 51.92  ? 26   LEU E N     1 
ATOM   3571 C CA    . LEU E 1 40  ? 16.285  33.776  46.842  1.00 51.22  ? 26   LEU E CA    1 
ATOM   3572 C C     . LEU E 1 40  ? 15.595  33.153  48.068  1.00 52.06  ? 26   LEU E C     1 
ATOM   3573 O O     . LEU E 1 40  ? 15.743  33.659  49.181  1.00 52.85  ? 26   LEU E O     1 
ATOM   3574 C CB    . LEU E 1 40  ? 15.222  34.403  45.957  1.00 50.45  ? 26   LEU E CB    1 
ATOM   3575 C CG    . LEU E 1 40  ? 15.468  35.836  45.523  1.00 52.12  ? 26   LEU E CG    1 
ATOM   3576 C CD1   . LEU E 1 40  ? 14.317  36.296  44.636  1.00 51.55  ? 26   LEU E CD1   1 
ATOM   3577 C CD2   . LEU E 1 40  ? 15.634  36.772  46.713  1.00 53.21  ? 26   LEU E CD2   1 
ATOM   3578 N N     . GLU E 1 41  ? 14.842  32.066  47.868  1.00 51.28  ? 27   GLU E N     1 
ATOM   3579 C CA    . GLU E 1 41  ? 14.162  31.398  48.978  1.00 53.74  ? 27   GLU E CA    1 
ATOM   3580 C C     . GLU E 1 41  ? 15.172  31.085  50.076  1.00 55.91  ? 27   GLU E C     1 
ATOM   3581 O O     . GLU E 1 41  ? 14.886  31.257  51.258  1.00 56.56  ? 27   GLU E O     1 
ATOM   3582 C CB    . GLU E 1 41  ? 13.459  30.109  48.527  1.00 51.85  ? 27   GLU E CB    1 
ATOM   3583 N N     . ASP E 1 42  ? 16.372  30.674  49.681  1.00 56.50  ? 28   ASP E N     1 
ATOM   3584 C CA    . ASP E 1 42  ? 17.409  30.354  50.646  1.00 58.64  ? 28   ASP E CA    1 
ATOM   3585 C C     . ASP E 1 42  ? 17.898  31.602  51.382  1.00 61.20  ? 28   ASP E C     1 
ATOM   3586 O O     . ASP E 1 42  ? 18.037  31.606  52.603  1.00 60.56  ? 28   ASP E O     1 
ATOM   3587 C CB    . ASP E 1 42  ? 18.565  29.683  49.939  1.00 60.05  ? 28   ASP E CB    1 
ATOM   3588 C CG    . ASP E 1 42  ? 19.663  29.295  50.874  1.00 63.35  ? 28   ASP E CG    1 
ATOM   3589 O OD1   . ASP E 1 42  ? 20.567  30.133  51.088  1.00 68.48  ? 28   ASP E OD1   1 
ATOM   3590 O OD2   . ASP E 1 42  ? 19.638  28.151  51.385  1.00 65.56  ? 28   ASP E OD2   1 
ATOM   3591 N N     . HIS E 1 43  ? 18.154  32.659  50.624  1.00 61.30  ? 29   HIS E N     1 
ATOM   3592 C CA    . HIS E 1 43  ? 18.698  33.870  51.182  1.00 61.69  ? 29   HIS E CA    1 
ATOM   3593 C C     . HIS E 1 43  ? 17.691  34.481  52.153  1.00 62.61  ? 29   HIS E C     1 
ATOM   3594 O O     . HIS E 1 43  ? 18.066  34.937  53.248  1.00 66.53  ? 29   HIS E O     1 
ATOM   3595 C CB    . HIS E 1 43  ? 19.079  34.841  50.057  1.00 61.76  ? 29   HIS E CB    1 
ATOM   3596 C CG    . HIS E 1 43  ? 19.614  36.149  50.540  1.00 65.32  ? 29   HIS E CG    1 
ATOM   3597 N ND1   . HIS E 1 43  ? 20.666  36.243  51.426  1.00 69.35  ? 29   HIS E ND1   1 
ATOM   3598 C CD2   . HIS E 1 43  ? 19.240  37.421  50.265  1.00 68.29  ? 29   HIS E CD2   1 
ATOM   3599 C CE1   . HIS E 1 43  ? 20.913  37.518  51.680  1.00 71.99  ? 29   HIS E CE1   1 
ATOM   3600 N NE2   . HIS E 1 43  ? 20.062  38.255  50.988  1.00 69.93  ? 29   HIS E NE2   1 
ATOM   3601 N N     . LEU E 1 44  ? 16.421  34.483  51.760  1.00 57.91  ? 30   LEU E N     1 
ATOM   3602 C CA    . LEU E 1 44  ? 15.396  35.156  52.543  1.00 55.91  ? 30   LEU E CA    1 
ATOM   3603 C C     . LEU E 1 44  ? 14.980  34.352  53.765  1.00 56.48  ? 30   LEU E C     1 
ATOM   3604 O O     . LEU E 1 44  ? 14.879  34.897  54.851  1.00 59.64  ? 30   LEU E O     1 
ATOM   3605 C CB    . LEU E 1 44  ? 14.196  35.490  51.658  1.00 53.68  ? 30   LEU E CB    1 
ATOM   3606 C CG    . LEU E 1 44  ? 14.516  36.432  50.490  1.00 51.45  ? 30   LEU E CG    1 
ATOM   3607 C CD1   . LEU E 1 44  ? 13.251  36.895  49.795  1.00 50.03  ? 30   LEU E CD1   1 
ATOM   3608 C CD2   . LEU E 1 44  ? 15.321  37.629  50.956  1.00 53.46  ? 30   LEU E CD2   1 
ATOM   3609 N N     . ASP E 1 45  ? 14.749  33.058  53.585  1.00 55.69  ? 31   ASP E N     1 
ATOM   3610 C CA    . ASP E 1 45  ? 14.542  32.148  54.704  1.00 55.61  ? 31   ASP E CA    1 
ATOM   3611 C C     . ASP E 1 45  ? 15.623  32.326  55.752  1.00 57.99  ? 31   ASP E C     1 
ATOM   3612 O O     . ASP E 1 45  ? 15.313  32.366  56.917  1.00 62.16  ? 31   ASP E O     1 
ATOM   3613 C CB    . ASP E 1 45  ? 14.589  30.678  54.266  1.00 55.99  ? 31   ASP E CB    1 
ATOM   3614 C CG    . ASP E 1 45  ? 13.249  30.143  53.764  1.00 55.49  ? 31   ASP E CG    1 
ATOM   3615 O OD1   . ASP E 1 45  ? 12.214  30.859  53.830  1.00 56.56  ? 31   ASP E OD1   1 
ATOM   3616 O OD2   . ASP E 1 45  ? 13.253  28.971  53.308  1.00 54.04  ? 31   ASP E OD2   1 
ATOM   3617 N N     . ARG E 1 46  ? 16.889  32.409  55.349  1.00 58.32  ? 32   ARG E N     1 
ATOM   3618 C CA    . ARG E 1 46  ? 17.984  32.530  56.312  1.00 61.02  ? 32   ARG E CA    1 
ATOM   3619 C C     . ARG E 1 46  ? 17.990  33.877  57.009  1.00 63.94  ? 32   ARG E C     1 
ATOM   3620 O O     . ARG E 1 46  ? 18.172  33.966  58.221  1.00 64.24  ? 32   ARG E O     1 
ATOM   3621 C CB    . ARG E 1 46  ? 19.332  32.337  55.642  1.00 62.11  ? 32   ARG E CB    1 
ATOM   3622 C CG    . ARG E 1 46  ? 19.614  30.897  55.249  1.00 62.27  ? 32   ARG E CG    1 
ATOM   3623 C CD    . ARG E 1 46  ? 21.097  30.593  55.302  1.00 63.80  ? 32   ARG E CD    1 
ATOM   3624 N NE    . ARG E 1 46  ? 21.407  29.708  56.414  1.00 66.09  ? 32   ARG E NE    1 
ATOM   3625 C CZ    . ARG E 1 46  ? 22.628  29.494  56.890  1.00 68.46  ? 32   ARG E CZ    1 
ATOM   3626 N NH1   . ARG E 1 46  ? 23.669  30.123  56.374  1.00 69.57  ? 32   ARG E NH1   1 
ATOM   3627 N NH2   . ARG E 1 46  ? 22.800  28.655  57.904  1.00 70.77  ? 32   ARG E NH2   1 
ATOM   3628 N N     . GLN E 1 47  ? 17.817  34.933  56.229  1.00 63.96  ? 33   GLN E N     1 
ATOM   3629 C CA    . GLN E 1 47  ? 17.725  36.269  56.773  1.00 65.40  ? 33   GLN E CA    1 
ATOM   3630 C C     . GLN E 1 47  ? 16.602  36.324  57.823  1.00 67.16  ? 33   GLN E C     1 
ATOM   3631 O O     . GLN E 1 47  ? 16.784  36.883  58.912  1.00 69.65  ? 33   GLN E O     1 
ATOM   3632 C CB    . GLN E 1 47  ? 17.478  37.254  55.627  1.00 65.14  ? 33   GLN E CB    1 
ATOM   3633 C CG    . GLN E 1 47  ? 17.432  38.708  56.033  1.00 67.79  ? 33   GLN E CG    1 
ATOM   3634 C CD    . GLN E 1 47  ? 16.019  39.180  56.312  1.00 67.42  ? 33   GLN E CD    1 
ATOM   3635 O OE1   . GLN E 1 47  ? 15.118  38.945  55.507  1.00 68.50  ? 33   GLN E OE1   1 
ATOM   3636 N NE2   . GLN E 1 47  ? 15.823  39.864  57.445  1.00 68.00  ? 33   GLN E NE2   1 
ATOM   3637 N N     . LEU E 1 48  ? 15.454  35.735  57.507  1.00 64.25  ? 34   LEU E N     1 
ATOM   3638 C CA    . LEU E 1 48  ? 14.320  35.791  58.424  1.00 65.59  ? 34   LEU E CA    1 
ATOM   3639 C C     . LEU E 1 48  ? 14.434  34.808  59.575  1.00 66.64  ? 34   LEU E C     1 
ATOM   3640 O O     . LEU E 1 48  ? 13.925  35.063  60.640  1.00 66.43  ? 34   LEU E O     1 
ATOM   3641 C CB    . LEU E 1 48  ? 13.012  35.573  57.663  1.00 64.61  ? 34   LEU E CB    1 
ATOM   3642 C CG    . LEU E 1 48  ? 12.611  36.813  56.859  1.00 63.66  ? 34   LEU E CG    1 
ATOM   3643 C CD1   . LEU E 1 48  ? 11.640  36.470  55.753  1.00 60.98  ? 34   LEU E CD1   1 
ATOM   3644 C CD2   . LEU E 1 48  ? 12.031  37.871  57.785  1.00 64.74  ? 34   LEU E CD2   1 
ATOM   3645 N N     . GLN E 1 49  ? 15.111  33.687  59.367  1.00 67.68  ? 35   GLN E N     1 
ATOM   3646 C CA    . GLN E 1 49  ? 15.298  32.718  60.444  1.00 68.30  ? 35   GLN E CA    1 
ATOM   3647 C C     . GLN E 1 49  ? 16.226  33.258  61.537  1.00 71.10  ? 35   GLN E C     1 
ATOM   3648 O O     . GLN E 1 49  ? 15.992  33.002  62.717  1.00 70.93  ? 35   GLN E O     1 
ATOM   3649 C CB    . GLN E 1 49  ? 15.808  31.360  59.923  1.00 68.72  ? 35   GLN E CB    1 
ATOM   3650 C CG    . GLN E 1 49  ? 15.336  30.179  60.768  1.00 67.81  ? 35   GLN E CG    1 
ATOM   3651 C CD    . GLN E 1 49  ? 13.827  29.908  60.642  1.00 65.40  ? 35   GLN E CD    1 
ATOM   3652 O OE1   . GLN E 1 49  ? 13.349  29.390  59.630  1.00 63.94  ? 35   GLN E OE1   1 
ATOM   3653 N NE2   . GLN E 1 49  ? 13.085  30.223  61.694  1.00 63.62  ? 35   GLN E NE2   1 
ATOM   3654 N N     . ARG E 1 50  ? 17.261  34.015  61.167  1.00 74.17  ? 36   ARG E N     1 
ATOM   3655 C CA    . ARG E 1 50  ? 18.145  34.590  62.195  1.00 77.62  ? 36   ARG E CA    1 
ATOM   3656 C C     . ARG E 1 50  ? 17.574  35.873  62.798  1.00 75.63  ? 36   ARG E C     1 
ATOM   3657 O O     . ARG E 1 50  ? 17.507  35.987  64.018  1.00 74.99  ? 36   ARG E O     1 
ATOM   3658 C CB    . ARG E 1 50  ? 19.615  34.755  61.744  1.00 83.36  ? 36   ARG E CB    1 
ATOM   3659 C CG    . ARG E 1 50  ? 19.904  35.304  60.361  1.00 85.85  ? 36   ARG E CG    1 
ATOM   3660 C CD    . ARG E 1 50  ? 21.437  35.418  60.250  1.00 92.39  ? 36   ARG E CD    1 
ATOM   3661 N NE    . ARG E 1 50  ? 21.956  36.664  60.796  1.00 96.71  ? 36   ARG E NE    1 
ATOM   3662 C CZ    . ARG E 1 50  ? 21.958  37.817  60.137  1.00 98.19  ? 36   ARG E CZ    1 
ATOM   3663 N NH1   . ARG E 1 50  ? 21.446  37.881  58.918  1.00 95.12  ? 36   ARG E NH1   1 
ATOM   3664 N NH2   . ARG E 1 50  ? 22.467  38.906  60.701  1.00 102.81 ? 36   ARG E NH2   1 
ATOM   3665 N N     . ASP E 1 51  ? 17.151  36.813  61.953  1.00 74.01  ? 37   ASP E N     1 
ATOM   3666 C CA    . ASP E 1 51  ? 16.730  38.147  62.409  1.00 74.66  ? 37   ASP E CA    1 
ATOM   3667 C C     . ASP E 1 51  ? 15.320  38.197  62.995  1.00 71.05  ? 37   ASP E C     1 
ATOM   3668 O O     . ASP E 1 51  ? 14.970  39.162  63.670  1.00 73.56  ? 37   ASP E O     1 
ATOM   3669 C CB    . ASP E 1 51  ? 16.819  39.169  61.267  1.00 76.30  ? 37   ASP E CB    1 
ATOM   3670 C CG    . ASP E 1 51  ? 18.227  39.288  60.683  1.00 80.45  ? 37   ASP E CG    1 
ATOM   3671 O OD1   . ASP E 1 51  ? 19.175  38.714  61.258  1.00 82.60  ? 37   ASP E OD1   1 
ATOM   3672 O OD2   . ASP E 1 51  ? 18.377  39.933  59.622  1.00 81.83  ? 37   ASP E OD2   1 
ATOM   3673 N N     . ALA E 1 52  ? 14.519  37.167  62.760  1.00 67.59  ? 38   ALA E N     1 
ATOM   3674 C CA    . ALA E 1 52  ? 13.109  37.159  63.194  1.00 64.29  ? 38   ALA E CA    1 
ATOM   3675 C C     . ALA E 1 52  ? 12.574  35.801  63.681  1.00 61.10  ? 38   ALA E C     1 
ATOM   3676 O O     . ALA E 1 52  ? 11.447  35.716  64.140  1.00 57.34  ? 38   ALA E O     1 
ATOM   3677 C CB    . ALA E 1 52  ? 12.234  37.672  62.065  1.00 63.09  ? 38   ALA E CB    1 
ATOM   3678 N N     . GLY E 1 53  ? 13.379  34.748  63.590  1.00 63.20  ? 39   GLY E N     1 
ATOM   3679 C CA    . GLY E 1 53  ? 13.031  33.454  64.164  1.00 62.09  ? 39   GLY E CA    1 
ATOM   3680 C C     . GLY E 1 53  ? 11.952  32.690  63.438  1.00 60.77  ? 39   GLY E C     1 
ATOM   3681 O O     . GLY E 1 53  ? 11.317  31.842  64.038  1.00 66.48  ? 39   GLY E O     1 
ATOM   3682 N N     . MET E 1 54  ? 11.746  32.952  62.148  1.00 59.93  ? 40   MET E N     1 
ATOM   3683 C CA    . MET E 1 54  ? 10.743  32.214  61.366  1.00 57.30  ? 40   MET E CA    1 
ATOM   3684 C C     . MET E 1 54  ? 11.029  32.252  59.874  1.00 57.55  ? 40   MET E C     1 
ATOM   3685 O O     . MET E 1 54  ? 11.759  33.139  59.410  1.00 62.34  ? 40   MET E O     1 
ATOM   3686 C CB    . MET E 1 54  ? 9.371   32.784  61.595  1.00 55.07  ? 40   MET E CB    1 
ATOM   3687 C CG    . MET E 1 54  ? 9.105   34.062  60.856  1.00 55.85  ? 40   MET E CG    1 
ATOM   3688 S SD    . MET E 1 54  ? 7.540   34.721  61.439  1.00 57.09  ? 40   MET E SD    1 
ATOM   3689 C CE    . MET E 1 54  ? 7.915   36.471  61.471  1.00 62.55  ? 40   MET E CE    1 
ATOM   3690 N N     . PRO E 1 55  ? 10.476  31.284  59.120  1.00 53.23  ? 41   PRO E N     1 
ATOM   3691 C CA    . PRO E 1 55  ? 10.813  31.151  57.702  1.00 54.57  ? 41   PRO E CA    1 
ATOM   3692 C C     . PRO E 1 55  ? 10.029  32.149  56.871  1.00 54.07  ? 41   PRO E C     1 
ATOM   3693 O O     . PRO E 1 55  ? 9.142   32.786  57.401  1.00 52.66  ? 41   PRO E O     1 
ATOM   3694 C CB    . PRO E 1 55  ? 10.394  29.715  57.381  1.00 52.57  ? 41   PRO E CB    1 
ATOM   3695 C CG    . PRO E 1 55  ? 9.292   29.454  58.325  1.00 49.68  ? 41   PRO E CG    1 
ATOM   3696 C CD    . PRO E 1 55  ? 9.689   30.139  59.589  1.00 51.00  ? 41   PRO E CD    1 
ATOM   3697 N N     . HIS E 1 56  ? 10.351  32.275  55.588  1.00 55.12  ? 42   HIS E N     1 
ATOM   3698 C CA    . HIS E 1 56  ? 9.738   33.310  54.758  1.00 58.07  ? 42   HIS E CA    1 
ATOM   3699 C C     . HIS E 1 56  ? 8.216   33.176  54.620  1.00 54.77  ? 42   HIS E C     1 
ATOM   3700 O O     . HIS E 1 56  ? 7.514   34.164  54.660  1.00 53.04  ? 42   HIS E O     1 
ATOM   3701 C CB    . HIS E 1 56  ? 10.366  33.345  53.369  1.00 63.53  ? 42   HIS E CB    1 
ATOM   3702 C CG    . HIS E 1 56  ? 9.913   34.508  52.532  1.00 68.69  ? 42   HIS E CG    1 
ATOM   3703 N ND1   . HIS E 1 56  ? 9.730   34.420  51.168  1.00 70.39  ? 42   HIS E ND1   1 
ATOM   3704 C CD2   . HIS E 1 56  ? 9.593   35.782  52.870  1.00 71.21  ? 42   HIS E CD2   1 
ATOM   3705 C CE1   . HIS E 1 56  ? 9.334   35.591  50.699  1.00 70.72  ? 42   HIS E CE1   1 
ATOM   3706 N NE2   . HIS E 1 56  ? 9.244   36.436  51.709  1.00 71.85  ? 42   HIS E NE2   1 
ATOM   3707 N N     . VAL E 1 57  ? 7.716   31.956  54.517  1.00 53.21  ? 43   VAL E N     1 
ATOM   3708 C CA    . VAL E 1 57  ? 6.297   31.758  54.298  1.00 53.02  ? 43   VAL E CA    1 
ATOM   3709 C C     . VAL E 1 57  ? 5.492   32.237  55.503  1.00 52.81  ? 43   VAL E C     1 
ATOM   3710 O O     . VAL E 1 57  ? 4.468   32.918  55.335  1.00 51.15  ? 43   VAL E O     1 
ATOM   3711 C CB    . VAL E 1 57  ? 5.939   30.286  54.033  1.00 53.94  ? 43   VAL E CB    1 
ATOM   3712 C CG1   . VAL E 1 57  ? 4.499   30.184  53.542  1.00 52.63  ? 43   VAL E CG1   1 
ATOM   3713 C CG2   . VAL E 1 57  ? 6.888   29.682  53.012  1.00 57.53  ? 43   VAL E CG2   1 
ATOM   3714 N N     . TYR E 1 58  ? 5.958   31.879  56.708  1.00 51.72  ? 44   TYR E N     1 
ATOM   3715 C CA    . TYR E 1 58  ? 5.334   32.313  57.972  1.00 49.68  ? 44   TYR E CA    1 
ATOM   3716 C C     . TYR E 1 58  ? 5.285   33.852  58.058  1.00 51.69  ? 44   TYR E C     1 
ATOM   3717 O O     . TYR E 1 58  ? 4.219   34.440  58.210  1.00 49.26  ? 44   TYR E O     1 
ATOM   3718 C CB    . TYR E 1 58  ? 6.096   31.746  59.162  1.00 47.88  ? 44   TYR E CB    1 
ATOM   3719 C CG    . TYR E 1 58  ? 5.909   30.250  59.400  1.00 46.05  ? 44   TYR E CG    1 
ATOM   3720 C CD1   . TYR E 1 58  ? 5.439   29.401  58.414  1.00 44.04  ? 44   TYR E CD1   1 
ATOM   3721 C CD2   . TYR E 1 58  ? 6.224   29.695  60.621  1.00 45.41  ? 44   TYR E CD2   1 
ATOM   3722 C CE1   . TYR E 1 58  ? 5.277   28.052  58.651  1.00 42.71  ? 44   TYR E CE1   1 
ATOM   3723 C CE2   . TYR E 1 58  ? 6.051   28.352  60.859  1.00 44.67  ? 44   TYR E CE2   1 
ATOM   3724 C CZ    . TYR E 1 58  ? 5.590   27.534  59.868  1.00 42.81  ? 44   TYR E CZ    1 
ATOM   3725 O OH    . TYR E 1 58  ? 5.455   26.184  60.140  1.00 42.42  ? 44   TYR E OH    1 
ATOM   3726 N N     . TYR E 1 59  ? 6.442   34.492  57.936  1.00 54.19  ? 45   TYR E N     1 
ATOM   3727 C CA    . TYR E 1 59  ? 6.515   35.953  57.914  1.00 57.34  ? 45   TYR E CA    1 
ATOM   3728 C C     . TYR E 1 59  ? 5.449   36.571  57.003  1.00 57.52  ? 45   TYR E C     1 
ATOM   3729 O O     . TYR E 1 59  ? 4.783   37.543  57.382  1.00 56.77  ? 45   TYR E O     1 
ATOM   3730 C CB    . TYR E 1 59  ? 7.901   36.391  57.457  1.00 59.83  ? 45   TYR E CB    1 
ATOM   3731 C CG    . TYR E 1 59  ? 8.143   37.880  57.533  1.00 61.72  ? 45   TYR E CG    1 
ATOM   3732 C CD1   . TYR E 1 59  ? 8.608   38.471  58.695  1.00 62.30  ? 45   TYR E CD1   1 
ATOM   3733 C CD2   . TYR E 1 59  ? 7.933   38.690  56.425  1.00 63.24  ? 45   TYR E CD2   1 
ATOM   3734 C CE1   . TYR E 1 59  ? 8.861   39.825  58.758  1.00 64.00  ? 45   TYR E CE1   1 
ATOM   3735 C CE2   . TYR E 1 59  ? 8.182   40.048  56.476  1.00 63.89  ? 45   TYR E CE2   1 
ATOM   3736 C CZ    . TYR E 1 59  ? 8.638   40.604  57.651  1.00 65.10  ? 45   TYR E CZ    1 
ATOM   3737 O OH    . TYR E 1 59  ? 8.867   41.953  57.711  1.00 68.63  ? 45   TYR E OH    1 
ATOM   3738 N N     . GLY E 1 60  ? 5.281   35.990  55.812  1.00 55.95  ? 46   GLY E N     1 
ATOM   3739 C CA    . GLY E 1 60  ? 4.248   36.425  54.861  1.00 54.09  ? 46   GLY E CA    1 
ATOM   3740 C C     . GLY E 1 60  ? 2.845   36.368  55.435  1.00 53.78  ? 46   GLY E C     1 
ATOM   3741 O O     . GLY E 1 60  ? 2.021   37.243  55.164  1.00 57.13  ? 46   GLY E O     1 
ATOM   3742 N N     . LEU E 1 61  ? 2.558   35.336  56.234  1.00 51.80  ? 47   LEU E N     1 
ATOM   3743 C CA    . LEU E 1 61  ? 1.242   35.203  56.855  1.00 50.30  ? 47   LEU E CA    1 
ATOM   3744 C C     . LEU E 1 61  ? 1.014   36.402  57.791  1.00 52.21  ? 47   LEU E C     1 
ATOM   3745 O O     . LEU E 1 61  ? -0.052  37.003  57.787  1.00 51.84  ? 47   LEU E O     1 
ATOM   3746 C CB    . LEU E 1 61  ? 1.113   33.872  57.625  1.00 48.83  ? 47   LEU E CB    1 
ATOM   3747 C CG    . LEU E 1 61  ? 1.358   32.590  56.816  1.00 48.43  ? 47   LEU E CG    1 
ATOM   3748 C CD1   . LEU E 1 61  ? 1.261   31.349  57.694  1.00 47.74  ? 47   LEU E CD1   1 
ATOM   3749 C CD2   . LEU E 1 61  ? 0.405   32.473  55.634  1.00 48.37  ? 47   LEU E CD2   1 
ATOM   3750 N N     . LEU E 1 62  ? 2.020   36.735  58.597  1.00 52.70  ? 48   LEU E N     1 
ATOM   3751 C CA    . LEU E 1 62  ? 1.905   37.860  59.515  1.00 53.46  ? 48   LEU E CA    1 
ATOM   3752 C C     . LEU E 1 62  ? 1.680   39.158  58.772  1.00 53.75  ? 48   LEU E C     1 
ATOM   3753 O O     . LEU E 1 62  ? 0.853   39.966  59.169  1.00 52.75  ? 48   LEU E O     1 
ATOM   3754 C CB    . LEU E 1 62  ? 3.154   37.997  60.372  1.00 53.89  ? 48   LEU E CB    1 
ATOM   3755 C CG    . LEU E 1 62  ? 3.546   36.783  61.214  1.00 54.12  ? 48   LEU E CG    1 
ATOM   3756 C CD1   . LEU E 1 62  ? 4.505   37.241  62.293  1.00 55.08  ? 48   LEU E CD1   1 
ATOM   3757 C CD2   . LEU E 1 62  ? 2.337   36.092  61.830  1.00 52.73  ? 48   LEU E CD2   1 
ATOM   3758 N N     . VAL E 1 63  ? 2.411   39.336  57.683  1.00 53.22  ? 49   VAL E N     1 
ATOM   3759 C CA    . VAL E 1 63  ? 2.259   40.516  56.854  1.00 53.45  ? 49   VAL E CA    1 
ATOM   3760 C C     . VAL E 1 63  ? 0.835   40.631  56.315  1.00 52.46  ? 49   VAL E C     1 
ATOM   3761 O O     . VAL E 1 63  ? 0.249   41.712  56.325  1.00 54.10  ? 49   VAL E O     1 
ATOM   3762 C CB    . VAL E 1 63  ? 3.257   40.490  55.705  1.00 54.95  ? 49   VAL E CB    1 
ATOM   3763 C CG1   . VAL E 1 63  ? 2.975   41.594  54.701  1.00 57.12  ? 49   VAL E CG1   1 
ATOM   3764 C CG2   . VAL E 1 63  ? 4.670   40.631  56.255  1.00 57.47  ? 49   VAL E CG2   1 
ATOM   3765 N N     . LYS E 1 64  ? 0.256   39.522  55.872  1.00 49.79  ? 50   LYS E N     1 
ATOM   3766 C CA    . LYS E 1 64  ? -1.069  39.601  55.306  1.00 49.97  ? 50   LYS E CA    1 
ATOM   3767 C C     . LYS E 1 64  ? -2.150  39.917  56.357  1.00 49.54  ? 50   LYS E C     1 
ATOM   3768 O O     . LYS E 1 64  ? -3.121  40.605  56.047  1.00 51.09  ? 50   LYS E O     1 
ATOM   3769 C CB    . LYS E 1 64  ? -1.431  38.353  54.523  1.00 49.96  ? 50   LYS E CB    1 
ATOM   3770 C CG    . LYS E 1 64  ? -2.728  38.533  53.750  1.00 53.07  ? 50   LYS E CG    1 
ATOM   3771 C CD    . LYS E 1 64  ? -2.767  39.827  52.941  1.00 56.01  ? 50   LYS E CD    1 
ATOM   3772 C CE    . LYS E 1 64  ? -4.135  40.046  52.320  1.00 59.12  ? 50   LYS E CE    1 
ATOM   3773 N NZ    . LYS E 1 64  ? -4.197  41.367  51.625  1.00 62.72  ? 50   LYS E NZ    1 
ATOM   3774 N N     . LEU E 1 65  ? -1.987  39.412  57.574  1.00 47.03  ? 51   LEU E N     1 
ATOM   3775 C CA    . LEU E 1 65  ? -2.915  39.712  58.651  1.00 46.94  ? 51   LEU E CA    1 
ATOM   3776 C C     . LEU E 1 65  ? -2.768  41.166  59.102  1.00 50.22  ? 51   LEU E C     1 
ATOM   3777 O O     . LEU E 1 65  ? -3.748  41.906  59.186  1.00 51.98  ? 51   LEU E O     1 
ATOM   3778 C CB    . LEU E 1 65  ? -2.649  38.811  59.845  1.00 45.50  ? 51   LEU E CB    1 
ATOM   3779 C CG    . LEU E 1 65  ? -2.829  37.319  59.628  1.00 43.30  ? 51   LEU E CG    1 
ATOM   3780 C CD1   . LEU E 1 65  ? -2.570  36.569  60.920  1.00 42.27  ? 51   LEU E CD1   1 
ATOM   3781 C CD2   . LEU E 1 65  ? -4.210  37.011  59.095  1.00 43.86  ? 51   LEU E CD2   1 
ATOM   3782 N N     . ALA E 1 66  ? -1.526  41.583  59.344  1.00 51.76  ? 52   ALA E N     1 
ATOM   3783 C CA    . ALA E 1 66  ? -1.203  42.985  59.633  1.00 54.09  ? 52   ALA E CA    1 
ATOM   3784 C C     . ALA E 1 66  ? -1.868  43.956  58.651  1.00 54.82  ? 52   ALA E C     1 
ATOM   3785 O O     . ALA E 1 66  ? -2.238  45.074  59.025  1.00 54.63  ? 52   ALA E O     1 
ATOM   3786 C CB    . ALA E 1 66  ? 0.314   43.179  59.619  1.00 55.30  ? 52   ALA E CB    1 
ATOM   3787 N N     . GLU E 1 67  ? -1.973  43.530  57.393  1.00 55.13  ? 53   GLU E N     1 
ATOM   3788 C CA    . GLU E 1 67  ? -2.629  44.311  56.349  1.00 58.87  ? 53   GLU E CA    1 
ATOM   3789 C C     . GLU E 1 67  ? -4.156  44.212  56.360  1.00 60.51  ? 53   GLU E C     1 
ATOM   3790 O O     . GLU E 1 67  ? -4.823  45.032  55.740  1.00 60.64  ? 53   GLU E O     1 
ATOM   3791 C CB    . GLU E 1 67  ? -2.166  43.841  54.974  1.00 59.77  ? 53   GLU E CB    1 
ATOM   3792 C CG    . GLU E 1 67  ? -0.805  44.343  54.528  1.00 61.43  ? 53   GLU E CG    1 
ATOM   3793 C CD    . GLU E 1 67  ? -0.528  43.970  53.088  1.00 62.79  ? 53   GLU E CD    1 
ATOM   3794 O OE1   . GLU E 1 67  ? -1.038  42.900  52.640  1.00 60.96  ? 53   GLU E OE1   1 
ATOM   3795 O OE2   . GLU E 1 67  ? 0.169   44.762  52.404  1.00 64.47  ? 53   GLU E OE2   1 
ATOM   3796 N N     . SER E 1 68  ? -4.701  43.195  57.020  1.00 60.61  ? 54   SER E N     1 
ATOM   3797 C CA    . SER E 1 68  ? -6.133  42.924  56.949  1.00 62.85  ? 54   SER E CA    1 
ATOM   3798 C C     . SER E 1 68  ? -6.965  43.801  57.879  1.00 65.45  ? 54   SER E C     1 
ATOM   3799 O O     . SER E 1 68  ? -6.448  44.368  58.843  1.00 65.97  ? 54   SER E O     1 
ATOM   3800 C CB    . SER E 1 68  ? -6.407  41.464  57.283  1.00 62.09  ? 54   SER E CB    1 
ATOM   3801 O OG    . SER E 1 68  ? -5.691  40.610  56.407  1.00 60.75  ? 54   SER E OG    1 
ATOM   3802 N N     . PRO E 1 69  ? -8.269  43.926  57.580  1.00 66.98  ? 55   PRO E N     1 
ATOM   3803 C CA    . PRO E 1 69  ? -9.140  44.612  58.531  1.00 68.74  ? 55   PRO E CA    1 
ATOM   3804 C C     . PRO E 1 69  ? -9.140  43.865  59.851  1.00 67.83  ? 55   PRO E C     1 
ATOM   3805 O O     . PRO E 1 69  ? -9.163  42.633  59.862  1.00 67.38  ? 55   PRO E O     1 
ATOM   3806 C CB    . PRO E 1 69  ? -10.519 44.558  57.861  1.00 70.35  ? 55   PRO E CB    1 
ATOM   3807 C CG    . PRO E 1 69  ? -10.227 44.376  56.403  1.00 69.97  ? 55   PRO E CG    1 
ATOM   3808 C CD    . PRO E 1 69  ? -8.978  43.553  56.342  1.00 66.52  ? 55   PRO E CD    1 
ATOM   3809 N N     . ARG E 1 70  ? -9.077  44.613  60.950  1.00 69.77  ? 56   ARG E N     1 
ATOM   3810 C CA    . ARG E 1 70  ? -9.038  44.047  62.307  1.00 69.83  ? 56   ARG E CA    1 
ATOM   3811 C C     . ARG E 1 70  ? -7.914  43.017  62.508  1.00 66.80  ? 56   ARG E C     1 
ATOM   3812 O O     . ARG E 1 70  ? -7.972  42.186  63.416  1.00 64.57  ? 56   ARG E O     1 
ATOM   3813 C CB    . ARG E 1 70  ? -10.408 43.466  62.680  1.00 71.54  ? 56   ARG E CB    1 
ATOM   3814 C CG    . ARG E 1 70  ? -11.514 44.516  62.727  1.00 75.02  ? 56   ARG E CG    1 
ATOM   3815 C CD    . ARG E 1 70  ? -12.832 43.891  63.146  1.00 78.25  ? 56   ARG E CD    1 
ATOM   3816 N NE    . ARG E 1 70  ? -12.747 43.330  64.494  1.00 78.41  ? 56   ARG E NE    1 
ATOM   3817 C CZ    . ARG E 1 70  ? -13.672 42.554  65.056  1.00 80.56  ? 56   ARG E CZ    1 
ATOM   3818 N NH1   . ARG E 1 70  ? -14.787 42.232  64.401  1.00 81.13  ? 56   ARG E NH1   1 
ATOM   3819 N NH2   . ARG E 1 70  ? -13.476 42.096  66.290  1.00 81.39  ? 56   ARG E NH2   1 
ATOM   3820 N N     . ARG E 1 71  ? -6.885  43.102  61.658  1.00 64.71  ? 57   ARG E N     1 
ATOM   3821 C CA    . ARG E 1 71  ? -5.706  42.241  61.735  1.00 61.60  ? 57   ARG E CA    1 
ATOM   3822 C C     . ARG E 1 71  ? -6.037  40.745  61.753  1.00 58.93  ? 57   ARG E C     1 
ATOM   3823 O O     . ARG E 1 71  ? -5.314  39.942  62.354  1.00 54.60  ? 57   ARG E O     1 
ATOM   3824 C CB    . ARG E 1 71  ? -4.846  42.639  62.934  1.00 61.45  ? 57   ARG E CB    1 
ATOM   3825 C CG    . ARG E 1 71  ? -3.907  43.774  62.615  1.00 62.10  ? 57   ARG E CG    1 
ATOM   3826 C CD    . ARG E 1 71  ? -4.004  44.748  63.756  1.00 65.83  ? 57   ARG E CD    1 
ATOM   3827 N NE    . ARG E 1 71  ? -2.918  44.861  64.706  1.00 67.69  ? 57   ARG E NE    1 
ATOM   3828 C CZ    . ARG E 1 71  ? -2.036  45.865  64.782  1.00 70.26  ? 57   ARG E CZ    1 
ATOM   3829 N NH1   . ARG E 1 71  ? -1.998  46.877  63.901  1.00 72.59  ? 57   ARG E NH1   1 
ATOM   3830 N NH2   . ARG E 1 71  ? -1.138  45.823  65.757  1.00 70.29  ? 57   ARG E NH2   1 
ATOM   3831 N N     . ARG E 1 72  ? -7.118  40.390  61.064  1.00 59.16  ? 58   ARG E N     1 
ATOM   3832 C CA    . ARG E 1 72  ? -7.617  39.026  61.078  1.00 59.08  ? 58   ARG E CA    1 
ATOM   3833 C C     . ARG E 1 72  ? -8.071  38.597  59.708  1.00 59.72  ? 58   ARG E C     1 
ATOM   3834 O O     . ARG E 1 72  ? -8.322  39.427  58.838  1.00 64.58  ? 58   ARG E O     1 
ATOM   3835 C CB    . ARG E 1 72  ? -8.762  38.885  62.094  1.00 60.01  ? 58   ARG E CB    1 
ATOM   3836 C CG    . ARG E 1 72  ? -10.093 39.495  61.724  1.00 61.11  ? 58   ARG E CG    1 
ATOM   3837 N N     . LEU E 1 73  ? -8.179  37.291  59.532  1.00 58.63  ? 59   LEU E N     1 
ATOM   3838 C CA    . LEU E 1 73  ? -8.521  36.694  58.248  1.00 58.55  ? 59   LEU E CA    1 
ATOM   3839 C C     . LEU E 1 73  ? -8.929  35.257  58.530  1.00 57.37  ? 59   LEU E C     1 
ATOM   3840 O O     . LEU E 1 73  ? -8.302  34.587  59.353  1.00 55.37  ? 59   LEU E O     1 
ATOM   3841 C CB    . LEU E 1 73  ? -7.287  36.726  57.327  1.00 57.62  ? 59   LEU E CB    1 
ATOM   3842 C CG    . LEU E 1 73  ? -7.417  37.224  55.891  1.00 59.89  ? 59   LEU E CG    1 
ATOM   3843 C CD1   . LEU E 1 73  ? -8.156  38.549  55.773  1.00 61.73  ? 59   LEU E CD1   1 
ATOM   3844 C CD2   . LEU E 1 73  ? -6.024  37.366  55.292  1.00 60.97  ? 59   LEU E CD2   1 
ATOM   3845 N N     . ARG E 1 74  ? -9.962  34.768  57.854  1.00 58.37  ? 60   ARG E N     1 
ATOM   3846 C CA    . ARG E 1 74  ? -10.350 33.365  58.022  1.00 57.77  ? 60   ARG E CA    1 
ATOM   3847 C C     . ARG E 1 74  ? -9.343  32.449  57.364  1.00 56.02  ? 60   ARG E C     1 
ATOM   3848 O O     . ARG E 1 74  ? -8.734  32.812  56.364  1.00 55.23  ? 60   ARG E O     1 
ATOM   3849 C CB    . ARG E 1 74  ? -11.749 33.114  57.482  1.00 60.34  ? 60   ARG E CB    1 
ATOM   3850 C CG    . ARG E 1 74  ? -12.775 33.581  58.493  1.00 63.50  ? 60   ARG E CG    1 
ATOM   3851 C CD    . ARG E 1 74  ? -14.181 33.511  57.940  1.00 67.27  ? 60   ARG E CD    1 
ATOM   3852 N NE    . ARG E 1 74  ? -14.542 32.145  57.573  1.00 68.37  ? 60   ARG E NE    1 
ATOM   3853 C CZ    . ARG E 1 74  ? -15.673 31.524  57.890  1.00 70.81  ? 60   ARG E CZ    1 
ATOM   3854 N NH1   . ARG E 1 74  ? -16.639 32.131  58.589  1.00 75.25  ? 60   ARG E NH1   1 
ATOM   3855 N NH2   . ARG E 1 74  ? -15.846 30.273  57.479  1.00 71.41  ? 60   ARG E NH2   1 
ATOM   3856 N N     . MET E 1 75  ? -9.189  31.258  57.923  1.00 56.01  ? 61   MET E N     1 
ATOM   3857 C CA    . MET E 1 75  ? -8.131  30.332  57.516  1.00 54.93  ? 61   MET E CA    1 
ATOM   3858 C C     . MET E 1 75  ? -8.013  30.147  56.012  1.00 54.40  ? 61   MET E C     1 
ATOM   3859 O O     . MET E 1 75  ? -6.938  30.362  55.443  1.00 50.89  ? 61   MET E O     1 
ATOM   3860 C CB    . MET E 1 75  ? -8.335  28.969  58.162  1.00 56.35  ? 61   MET E CB    1 
ATOM   3861 C CG    . MET E 1 75  ? -8.389  28.994  59.687  1.00 57.48  ? 61   MET E CG    1 
ATOM   3862 S SD    . MET E 1 75  ? -7.078  29.960  60.454  1.00 59.69  ? 61   MET E SD    1 
ATOM   3863 C CE    . MET E 1 75  ? -5.705  28.799  60.321  1.00 57.57  ? 61   MET E CE    1 
ATOM   3864 N N     . THR E 1 76  ? -9.107  29.762  55.360  1.00 56.58  ? 62   THR E N     1 
ATOM   3865 C CA    . THR E 1 76  ? -9.044  29.475  53.926  1.00 58.30  ? 62   THR E CA    1 
ATOM   3866 C C     . THR E 1 76  ? -8.636  30.719  53.147  1.00 58.97  ? 62   THR E C     1 
ATOM   3867 O O     . THR E 1 76  ? -7.826  30.634  52.222  1.00 57.94  ? 62   THR E O     1 
ATOM   3868 C CB    . THR E 1 76  ? -10.364 28.921  53.361  1.00 62.44  ? 62   THR E CB    1 
ATOM   3869 O OG1   . THR E 1 76  ? -10.730 27.731  54.068  1.00 63.71  ? 62   THR E OG1   1 
ATOM   3870 C CG2   . THR E 1 76  ? -10.218 28.578  51.882  1.00 63.17  ? 62   THR E CG2   1 
ATOM   3871 N N     . GLU E 1 77  ? -9.151  31.879  53.539  1.00 59.91  ? 63   GLU E N     1 
ATOM   3872 C CA    . GLU E 1 77  ? -8.738  33.123  52.892  1.00 59.65  ? 63   GLU E CA    1 
ATOM   3873 C C     . GLU E 1 77  ? -7.244  33.340  53.029  1.00 56.43  ? 63   GLU E C     1 
ATOM   3874 O O     . GLU E 1 77  ? -6.569  33.766  52.099  1.00 58.53  ? 63   GLU E O     1 
ATOM   3875 C CB    . GLU E 1 77  ? -9.450  34.302  53.511  1.00 62.08  ? 63   GLU E CB    1 
ATOM   3876 C CG    . GLU E 1 77  ? -10.762 34.651  52.884  1.00 66.18  ? 63   GLU E CG    1 
ATOM   3877 C CD    . GLU E 1 77  ? -11.109 36.059  53.285  1.00 69.16  ? 63   GLU E CD    1 
ATOM   3878 O OE1   . GLU E 1 77  ? -11.645 36.221  54.388  1.00 67.64  ? 63   GLU E OE1   1 
ATOM   3879 O OE2   . GLU E 1 77  ? -10.773 36.995  52.522  1.00 71.93  ? 63   GLU E OE2   1 
ATOM   3880 N N     . LEU E 1 78  ? -6.731  33.087  54.220  1.00 54.49  ? 64   LEU E N     1 
ATOM   3881 C CA    . LEU E 1 78  ? -5.309  33.266  54.478  1.00 52.95  ? 64   LEU E CA    1 
ATOM   3882 C C     . LEU E 1 78  ? -4.525  32.322  53.557  1.00 52.14  ? 64   LEU E C     1 
ATOM   3883 O O     . LEU E 1 78  ? -3.621  32.750  52.869  1.00 50.84  ? 64   LEU E O     1 
ATOM   3884 C CB    . LEU E 1 78  ? -5.001  33.019  55.957  1.00 51.90  ? 64   LEU E CB    1 
ATOM   3885 C CG    . LEU E 1 78  ? -3.594  33.312  56.455  1.00 52.39  ? 64   LEU E CG    1 
ATOM   3886 C CD1   . LEU E 1 78  ? -3.042  34.609  55.880  1.00 54.23  ? 64   LEU E CD1   1 
ATOM   3887 C CD2   . LEU E 1 78  ? -3.581  33.356  57.988  1.00 52.13  ? 64   LEU E CD2   1 
ATOM   3888 N N     . ALA E 1 79  ? -4.911  31.051  53.524  1.00 51.77  ? 65   ALA E N     1 
ATOM   3889 C CA    . ALA E 1 79  ? -4.292  30.092  52.631  1.00 51.36  ? 65   ALA E CA    1 
ATOM   3890 C C     . ALA E 1 79  ? -4.334  30.559  51.167  1.00 54.10  ? 65   ALA E C     1 
ATOM   3891 O O     . ALA E 1 79  ? -3.340  30.423  50.460  1.00 55.32  ? 65   ALA E O     1 
ATOM   3892 C CB    . ALA E 1 79  ? -4.960  28.743  52.760  1.00 51.06  ? 65   ALA E CB    1 
ATOM   3893 N N     . LYS E 1 80  ? -5.459  31.126  50.730  1.00 56.14  ? 66   LYS E N     1 
ATOM   3894 C CA    . LYS E 1 80  ? -5.636  31.546  49.320  1.00 58.16  ? 66   LYS E CA    1 
ATOM   3895 C C     . LYS E 1 80  ? -4.679  32.666  48.958  1.00 58.55  ? 66   LYS E C     1 
ATOM   3896 O O     . LYS E 1 80  ? -4.133  32.674  47.850  1.00 58.97  ? 66   LYS E O     1 
ATOM   3897 C CB    . LYS E 1 80  ? -7.093  31.987  49.008  1.00 59.57  ? 66   LYS E CB    1 
ATOM   3898 C CG    . LYS E 1 80  ? -7.315  32.430  47.558  1.00 60.72  ? 66   LYS E CG    1 
ATOM   3899 C CD    . LYS E 1 80  ? -8.774  32.501  47.122  1.00 62.86  ? 66   LYS E CD    1 
ATOM   3900 N N     . TYR E 1 81  ? -4.479  33.617  49.878  1.00 61.97  ? 67   TYR E N     1 
ATOM   3901 C CA    . TYR E 1 81  ? -3.518  34.707  49.636  1.00 63.21  ? 67   TYR E CA    1 
ATOM   3902 C C     . TYR E 1 81  ? -2.095  34.163  49.576  1.00 58.71  ? 67   TYR E C     1 
ATOM   3903 O O     . TYR E 1 81  ? -1.321  34.523  48.703  1.00 59.15  ? 67   TYR E O     1 
ATOM   3904 C CB    . TYR E 1 81  ? -3.590  35.788  50.722  1.00 64.88  ? 67   TYR E CB    1 
ATOM   3905 C CG    . TYR E 1 81  ? -4.751  36.748  50.599  1.00 70.42  ? 67   TYR E CG    1 
ATOM   3906 C CD1   . TYR E 1 81  ? -4.876  37.598  49.487  1.00 73.70  ? 67   TYR E CD1   1 
ATOM   3907 C CD2   . TYR E 1 81  ? -5.708  36.844  51.613  1.00 71.15  ? 67   TYR E CD2   1 
ATOM   3908 C CE1   . TYR E 1 81  ? -5.932  38.494  49.389  1.00 77.26  ? 67   TYR E CE1   1 
ATOM   3909 C CE2   . TYR E 1 81  ? -6.763  37.736  51.516  1.00 75.18  ? 67   TYR E CE2   1 
ATOM   3910 C CZ    . TYR E 1 81  ? -6.875  38.553  50.409  1.00 77.38  ? 67   TYR E CZ    1 
ATOM   3911 O OH    . TYR E 1 81  ? -7.931  39.430  50.335  1.00 82.31  ? 67   TYR E OH    1 
ATOM   3912 N N     . ALA E 1 82  ? -1.777  33.299  50.528  1.00 56.12  ? 68   ALA E N     1 
ATOM   3913 C CA    . ALA E 1 82  ? -0.456  32.702  50.660  1.00 54.44  ? 68   ALA E CA    1 
ATOM   3914 C C     . ALA E 1 82  ? -0.130  31.668  49.567  1.00 53.12  ? 68   ALA E C     1 
ATOM   3915 O O     . ALA E 1 82  ? 1.036   31.385  49.319  1.00 52.64  ? 68   ALA E O     1 
ATOM   3916 C CB    . ALA E 1 82  ? -0.336  32.056  52.033  1.00 51.93  ? 68   ALA E CB    1 
ATOM   3917 N N     . LYS E 1 83  ? -1.168  31.115  48.951  1.00 52.74  ? 69   LYS E N     1 
ATOM   3918 C CA    . LYS E 1 83  ? -1.063  30.095  47.905  1.00 52.38  ? 69   LYS E CA    1 
ATOM   3919 C C     . LYS E 1 83  ? -0.577  28.760  48.454  1.00 50.61  ? 69   LYS E C     1 
ATOM   3920 O O     . LYS E 1 83  ? 0.155   28.037  47.794  1.00 52.86  ? 69   LYS E O     1 
ATOM   3921 C CB    . LYS E 1 83  ? -0.186  30.566  46.756  1.00 54.04  ? 69   LYS E CB    1 
ATOM   3922 C CG    . LYS E 1 83  ? -0.489  31.977  46.260  1.00 56.75  ? 69   LYS E CG    1 
ATOM   3923 C CD    . LYS E 1 83  ? -1.878  32.084  45.654  1.00 58.91  ? 69   LYS E CD    1 
ATOM   3924 C CE    . LYS E 1 83  ? -2.322  33.529  45.586  1.00 61.73  ? 69   LYS E CE    1 
ATOM   3925 N NZ    . LYS E 1 83  ? -3.706  33.660  45.063  1.00 64.79  ? 69   LYS E NZ    1 
ATOM   3926 N N     . ILE E 1 84  ? -0.998  28.439  49.672  1.00 49.04  ? 70   ILE E N     1 
ATOM   3927 C CA    . ILE E 1 84  ? -0.573  27.224  50.344  1.00 47.13  ? 70   ILE E CA    1 
ATOM   3928 C C     . ILE E 1 84  ? -1.793  26.433  50.673  1.00 48.35  ? 70   ILE E C     1 
ATOM   3929 O O     . ILE E 1 84  ? -2.904  26.885  50.400  1.00 52.19  ? 70   ILE E O     1 
ATOM   3930 C CB    . ILE E 1 84  ? 0.206   27.530  51.643  1.00 45.24  ? 70   ILE E CB    1 
ATOM   3931 C CG1   . ILE E 1 84  ? -0.724  28.056  52.730  1.00 43.72  ? 70   ILE E CG1   1 
ATOM   3932 C CG2   . ILE E 1 84  ? 1.370   28.486  51.346  1.00 45.28  ? 70   ILE E CG2   1 
ATOM   3933 C CD1   . ILE E 1 84  ? -0.012  28.655  53.917  1.00 43.14  ? 70   ILE E CD1   1 
ATOM   3934 N N     . THR E 1 85  ? -1.615  25.256  51.256  1.00 47.53  ? 71   THR E N     1 
ATOM   3935 C CA    . THR E 1 85  ? -2.769  24.449  51.615  1.00 49.80  ? 71   THR E CA    1 
ATOM   3936 C C     . THR E 1 85  ? -3.258  24.766  53.008  1.00 48.69  ? 71   THR E C     1 
ATOM   3937 O O     . THR E 1 85  ? -2.507  25.255  53.843  1.00 48.44  ? 71   THR E O     1 
ATOM   3938 C CB    . THR E 1 85  ? -2.468  22.947  51.528  1.00 52.37  ? 71   THR E CB    1 
ATOM   3939 O OG1   . THR E 1 85  ? -1.503  22.578  52.525  1.00 50.74  ? 71   THR E OG1   1 
ATOM   3940 C CG2   . THR E 1 85  ? -1.955  22.585  50.113  1.00 52.99  ? 71   THR E CG2   1 
ATOM   3941 N N     . ARG E 1 86  ? -4.525  24.469  53.258  1.00 51.23  ? 72   ARG E N     1 
ATOM   3942 C CA    . ARG E 1 86  ? -5.133  24.644  54.578  1.00 50.93  ? 72   ARG E CA    1 
ATOM   3943 C C     . ARG E 1 86  ? -4.380  23.863  55.660  1.00 49.41  ? 72   ARG E C     1 
ATOM   3944 O O     . ARG E 1 86  ? -4.290  24.293  56.813  1.00 47.60  ? 72   ARG E O     1 
ATOM   3945 C CB    . ARG E 1 86  ? -6.561  24.153  54.554  1.00 54.46  ? 72   ARG E CB    1 
ATOM   3946 C CG    . ARG E 1 86  ? -7.490  24.897  53.608  1.00 58.11  ? 72   ARG E CG    1 
ATOM   3947 C CD    . ARG E 1 86  ? -8.928  24.327  53.705  1.00 63.43  ? 72   ARG E CD    1 
ATOM   3948 N NE    . ARG E 1 86  ? -9.343  23.668  52.476  1.00 67.99  ? 72   ARG E NE    1 
ATOM   3949 C CZ    . ARG E 1 86  ? -10.194 22.644  52.411  1.00 74.71  ? 72   ARG E CZ    1 
ATOM   3950 N NH1   . ARG E 1 86  ? -10.743 22.115  53.507  1.00 75.84  ? 72   ARG E NH1   1 
ATOM   3951 N NH2   . ARG E 1 86  ? -10.494 22.129  51.227  1.00 80.30  ? 72   ARG E NH2   1 
ATOM   3952 N N     . SER E 1 87  ? -3.823  22.731  55.257  1.00 50.74  ? 73   SER E N     1 
ATOM   3953 C CA    . SER E 1 87  ? -3.126  21.826  56.152  1.00 50.97  ? 73   SER E CA    1 
ATOM   3954 C C     . SER E 1 87  ? -1.870  22.489  56.638  1.00 50.30  ? 73   SER E C     1 
ATOM   3955 O O     . SER E 1 87  ? -1.608  22.585  57.834  1.00 50.35  ? 73   SER E O     1 
ATOM   3956 C CB    . SER E 1 87  ? -2.744  20.568  55.381  1.00 53.26  ? 73   SER E CB    1 
ATOM   3957 O OG    . SER E 1 87  ? -3.204  19.436  56.067  1.00 56.81  ? 73   SER E OG    1 
ATOM   3958 N N     . ARG E 1 88  ? -1.079  22.933  55.672  1.00 51.35  ? 74   ARG E N     1 
ATOM   3959 C CA    . ARG E 1 88  ? 0.140   23.631  55.953  1.00 51.26  ? 74   ARG E CA    1 
ATOM   3960 C C     . ARG E 1 88  ? -0.164  24.850  56.789  1.00 51.29  ? 74   ARG E C     1 
ATOM   3961 O O     . ARG E 1 88  ? 0.562   25.148  57.734  1.00 54.02  ? 74   ARG E O     1 
ATOM   3962 C CB    . ARG E 1 88  ? 0.798   24.055  54.659  1.00 52.00  ? 74   ARG E CB    1 
ATOM   3963 C CG    . ARG E 1 88  ? 2.125   24.761  54.847  1.00 52.54  ? 74   ARG E CG    1 
ATOM   3964 C CD    . ARG E 1 88  ? 2.577   25.281  53.510  1.00 53.17  ? 74   ARG E CD    1 
ATOM   3965 N NE    . ARG E 1 88  ? 3.961   25.699  53.502  1.00 53.65  ? 74   ARG E NE    1 
ATOM   3966 C CZ    . ARG E 1 88  ? 4.630   25.961  52.384  1.00 57.94  ? 74   ARG E CZ    1 
ATOM   3967 N NH1   . ARG E 1 88  ? 4.027   25.847  51.203  1.00 60.53  ? 74   ARG E NH1   1 
ATOM   3968 N NH2   . ARG E 1 88  ? 5.897   26.345  52.436  1.00 57.69  ? 74   ARG E NH2   1 
ATOM   3969 N N     . LEU E 1 89  ? -1.238  25.550  56.451  1.00 49.94  ? 75   LEU E N     1 
ATOM   3970 C CA    . LEU E 1 89  ? -1.623  26.727  57.215  1.00 48.56  ? 75   LEU E CA    1 
ATOM   3971 C C     . LEU E 1 89  ? -1.959  26.405  58.676  1.00 48.52  ? 75   LEU E C     1 
ATOM   3972 O O     . LEU E 1 89  ? -1.561  27.147  59.571  1.00 47.56  ? 75   LEU E O     1 
ATOM   3973 C CB    . LEU E 1 89  ? -2.815  27.434  56.572  1.00 47.56  ? 75   LEU E CB    1 
ATOM   3974 C CG    . LEU E 1 89  ? -3.276  28.692  57.306  1.00 45.98  ? 75   LEU E CG    1 
ATOM   3975 C CD1   . LEU E 1 89  ? -2.159  29.687  57.517  1.00 44.50  ? 75   LEU E CD1   1 
ATOM   3976 C CD2   . LEU E 1 89  ? -4.392  29.332  56.502  1.00 49.04  ? 75   LEU E CD2   1 
ATOM   3977 N N     . SER E 1 90  ? -2.709  25.326  58.910  1.00 49.61  ? 76   SER E N     1 
ATOM   3978 C CA    . SER E 1 90  ? -3.062  24.935  60.279  1.00 49.37  ? 76   SER E CA    1 
ATOM   3979 C C     . SER E 1 90  ? -1.800  24.689  61.078  1.00 48.08  ? 76   SER E C     1 
ATOM   3980 O O     . SER E 1 90  ? -1.627  25.250  62.150  1.00 52.40  ? 76   SER E O     1 
ATOM   3981 C CB    . SER E 1 90  ? -3.921  23.684  60.310  1.00 49.46  ? 76   SER E CB    1 
ATOM   3982 O OG    . SER E 1 90  ? -5.140  23.915  59.620  1.00 51.68  ? 76   SER E OG    1 
ATOM   3983 N N     . HIS E 1 91  ? -0.900  23.894  60.530  1.00 45.32  ? 77   HIS E N     1 
ATOM   3984 C CA    . HIS E 1 91  ? 0.351   23.591  61.214  1.00 43.51  ? 77   HIS E CA    1 
ATOM   3985 C C     . HIS E 1 91  ? 1.125   24.859  61.479  1.00 44.71  ? 77   HIS E C     1 
ATOM   3986 O O     . HIS E 1 91  ? 1.590   25.064  62.592  1.00 49.03  ? 77   HIS E O     1 
ATOM   3987 C CB    . HIS E 1 91  ? 1.212   22.613  60.391  1.00 43.08  ? 77   HIS E CB    1 
ATOM   3988 C CG    . HIS E 1 91  ? 0.753   21.190  60.461  1.00 43.43  ? 77   HIS E CG    1 
ATOM   3989 N ND1   . HIS E 1 91  ? 0.523   20.539  61.657  1.00 43.31  ? 77   HIS E ND1   1 
ATOM   3990 C CD2   . HIS E 1 91  ? 0.487   20.291  59.488  1.00 45.41  ? 77   HIS E CD2   1 
ATOM   3991 C CE1   . HIS E 1 91  ? 0.137   19.301  61.415  1.00 46.05  ? 77   HIS E CE1   1 
ATOM   3992 N NE2   . HIS E 1 91  ? 0.117   19.120  60.105  1.00 47.24  ? 77   HIS E NE2   1 
ATOM   3993 N N     . ALA E 1 92  ? 1.218   25.744  60.475  1.00 44.33  ? 78   ALA E N     1 
ATOM   3994 C CA    . ALA E 1 92  ? 1.931   27.006  60.620  1.00 42.30  ? 78   ALA E CA    1 
ATOM   3995 C C     . ALA E 1 92  ? 1.340   27.886  61.723  1.00 44.26  ? 78   ALA E C     1 
ATOM   3996 O O     . ALA E 1 92  ? 2.080   28.470  62.517  1.00 46.12  ? 78   ALA E O     1 
ATOM   3997 C CB    . ALA E 1 92  ? 1.937   27.761  59.317  1.00 42.46  ? 78   ALA E CB    1 
ATOM   3998 N N     . VAL E 1 93  ? 0.013   27.978  61.784  1.00 44.88  ? 79   VAL E N     1 
ATOM   3999 C CA    . VAL E 1 93  ? -0.631  28.793  62.806  1.00 46.35  ? 79   VAL E CA    1 
ATOM   4000 C C     . VAL E 1 93  ? -0.568  28.150  64.221  1.00 45.80  ? 79   VAL E C     1 
ATOM   4001 O O     . VAL E 1 93  ? -0.589  28.871  65.220  1.00 45.30  ? 79   VAL E O     1 
ATOM   4002 C CB    . VAL E 1 93  ? -2.072  29.154  62.394  1.00 48.99  ? 79   VAL E CB    1 
ATOM   4003 C CG1   . VAL E 1 93  ? -2.793  29.892  63.507  1.00 50.42  ? 79   VAL E CG1   1 
ATOM   4004 C CG2   . VAL E 1 93  ? -2.061  30.007  61.128  1.00 48.79  ? 79   VAL E CG2   1 
ATOM   4005 N N     . ALA E 1 94  ? -0.481  26.822  64.319  1.00 42.48  ? 80   ALA E N     1 
ATOM   4006 C CA    . ALA E 1 94  ? -0.258  26.202  65.624  1.00 41.91  ? 80   ALA E CA    1 
ATOM   4007 C C     . ALA E 1 94  ? 1.092   26.672  66.152  1.00 44.03  ? 80   ALA E C     1 
ATOM   4008 O O     . ALA E 1 94  ? 1.252   26.952  67.352  1.00 44.62  ? 80   ALA E O     1 
ATOM   4009 C CB    . ALA E 1 94  ? -0.286  24.694  65.539  1.00 40.55  ? 80   ALA E CB    1 
ATOM   4010 N N     . ARG E 1 95  ? 2.051   26.779  65.238  1.00 45.15  ? 81   ARG E N     1 
ATOM   4011 C CA    . ARG E 1 95  ? 3.421   27.118  65.597  1.00 46.67  ? 81   ARG E CA    1 
ATOM   4012 C C     . ARG E 1 95  ? 3.521   28.585  65.943  1.00 45.42  ? 81   ARG E C     1 
ATOM   4013 O O     . ARG E 1 95  ? 4.205   28.948  66.896  1.00 44.75  ? 81   ARG E O     1 
ATOM   4014 C CB    . ARG E 1 95  ? 4.362   26.742  64.447  1.00 48.30  ? 81   ARG E CB    1 
ATOM   4015 C CG    . ARG E 1 95  ? 5.850   26.798  64.759  1.00 51.40  ? 81   ARG E CG    1 
ATOM   4016 C CD    . ARG E 1 95  ? 6.422   28.194  64.511  1.00 54.93  ? 81   ARG E CD    1 
ATOM   4017 N NE    . ARG E 1 95  ? 7.823   28.200  64.052  1.00 57.74  ? 81   ARG E NE    1 
ATOM   4018 C CZ    . ARG E 1 95  ? 8.596   29.293  64.005  1.00 61.37  ? 81   ARG E CZ    1 
ATOM   4019 N NH1   . ARG E 1 95  ? 8.137   30.487  64.399  1.00 62.73  ? 81   ARG E NH1   1 
ATOM   4020 N NH2   . ARG E 1 95  ? 9.845   29.202  63.570  1.00 61.67  ? 81   ARG E NH2   1 
ATOM   4021 N N     . LEU E 1 96  ? 2.814   29.424  65.184  1.00 45.73  ? 82   LEU E N     1 
ATOM   4022 C CA    . LEU E 1 96  ? 2.804   30.874  65.436  1.00 47.76  ? 82   LEU E CA    1 
ATOM   4023 C C     . LEU E 1 96  ? 2.020   31.236  66.714  1.00 47.83  ? 82   LEU E C     1 
ATOM   4024 O O     . LEU E 1 96  ? 2.372   32.181  67.435  1.00 49.63  ? 82   LEU E O     1 
ATOM   4025 C CB    . LEU E 1 96  ? 2.235   31.620  64.230  1.00 48.63  ? 82   LEU E CB    1 
ATOM   4026 C CG    . LEU E 1 96  ? 3.003   31.475  62.907  1.00 49.45  ? 82   LEU E CG    1 
ATOM   4027 C CD1   . LEU E 1 96  ? 2.196   32.040  61.745  1.00 49.77  ? 82   LEU E CD1   1 
ATOM   4028 C CD2   . LEU E 1 96  ? 4.357   32.167  62.977  1.00 52.21  ? 82   LEU E CD2   1 
ATOM   4029 N N     . GLU E 1 97  ? 0.943   30.502  66.960  1.00 46.26  ? 83   GLU E N     1 
ATOM   4030 C CA    . GLU E 1 97  ? 0.165   30.646  68.179  1.00 48.82  ? 83   GLU E CA    1 
ATOM   4031 C C     . GLU E 1 97  ? 1.020   30.285  69.394  1.00 49.77  ? 83   GLU E C     1 
ATOM   4032 O O     . GLU E 1 97  ? 0.998   31.012  70.393  1.00 51.19  ? 83   GLU E O     1 
ATOM   4033 C CB    . GLU E 1 97  ? -1.084  29.760  68.116  1.00 49.19  ? 83   GLU E CB    1 
ATOM   4034 C CG    . GLU E 1 97  ? -2.104  29.989  69.214  1.00 51.88  ? 83   GLU E CG    1 
ATOM   4035 C CD    . GLU E 1 97  ? -3.429  29.271  68.935  1.00 53.50  ? 83   GLU E CD    1 
ATOM   4036 O OE1   . GLU E 1 97  ? -3.393  28.087  68.556  1.00 51.62  ? 83   GLU E OE1   1 
ATOM   4037 O OE2   . GLU E 1 97  ? -4.509  29.897  69.072  1.00 57.52  ? 83   GLU E OE2   1 
ATOM   4038 N N     . LYS E 1 98  ? 1.781   29.191  69.289  1.00 47.83  ? 84   LYS E N     1 
ATOM   4039 C CA    . LYS E 1 98  ? 2.692   28.776  70.358  1.00 48.55  ? 84   LYS E CA    1 
ATOM   4040 C C     . LYS E 1 98  ? 3.636   29.909  70.724  1.00 51.93  ? 84   LYS E C     1 
ATOM   4041 O O     . LYS E 1 98  ? 3.714   30.280  71.893  1.00 53.89  ? 84   LYS E O     1 
ATOM   4042 C CB    . LYS E 1 98  ? 3.481   27.474  70.030  1.00 49.07  ? 84   LYS E CB    1 
ATOM   4043 C CG    . LYS E 1 98  ? 2.849   26.156  70.540  1.00 49.61  ? 84   LYS E CG    1 
ATOM   4044 C CD    . LYS E 1 98  ? 3.838   25.248  71.269  1.00 52.35  ? 84   LYS E CD    1 
ATOM   4045 C CE    . LYS E 1 98  ? 4.552   25.917  72.481  1.00 55.55  ? 84   LYS E CE    1 
ATOM   4046 N NZ    . LYS E 1 98  ? 3.824   26.007  73.806  1.00 55.67  ? 84   LYS E NZ    1 
ATOM   4047 N N     . ASN E 1 99  ? 4.325   30.507  69.753  1.00 52.42  ? 85   ASN E N     1 
ATOM   4048 C CA    . ASN E 1 99  ? 5.216   31.596  70.117  1.00 56.25  ? 85   ASN E CA    1 
ATOM   4049 C C     . ASN E 1 99  ? 4.536   32.959  70.290  1.00 57.28  ? 85   ASN E C     1 
ATOM   4050 O O     . ASN E 1 99  ? 5.200   33.960  70.565  1.00 60.35  ? 85   ASN E O     1 
ATOM   4051 C CB    . ASN E 1 99  ? 6.509   31.659  69.267  1.00 60.40  ? 85   ASN E CB    1 
ATOM   4052 C CG    . ASN E 1 99  ? 6.300   31.364  67.808  1.00 58.71  ? 85   ASN E CG    1 
ATOM   4053 O OD1   . ASN E 1 99  ? 6.910   30.450  67.256  1.00 54.98  ? 85   ASN E OD1   1 
ATOM   4054 N ND2   . ASN E 1 99  ? 5.460   32.148  67.169  1.00 61.93  ? 85   ASN E ND2   1 
ATOM   4055 N N     . GLY E 1 100 ? 3.212   32.994  70.191  1.00 54.62  ? 86   GLY E N     1 
ATOM   4056 C CA    . GLY E 1 100 ? 2.453   34.159  70.634  1.00 52.86  ? 86   GLY E CA    1 
ATOM   4057 C C     . GLY E 1 100 ? 2.251   35.263  69.625  1.00 51.53  ? 86   GLY E C     1 
ATOM   4058 O O     . GLY E 1 100 ? 1.693   36.300  69.956  1.00 51.52  ? 86   GLY E O     1 
ATOM   4059 N N     . TRP E 1 101 ? 2.624   35.035  68.372  1.00 52.00  ? 87   TRP E N     1 
ATOM   4060 C CA    . TRP E 1 101 ? 2.452   36.069  67.337  1.00 52.35  ? 87   TRP E CA    1 
ATOM   4061 C C     . TRP E 1 101 ? 1.073   36.028  66.689  1.00 49.00  ? 87   TRP E C     1 
ATOM   4062 O O     . TRP E 1 101 ? 0.676   36.970  66.012  1.00 46.98  ? 87   TRP E O     1 
ATOM   4063 C CB    . TRP E 1 101 ? 3.561   35.960  66.272  1.00 54.46  ? 87   TRP E CB    1 
ATOM   4064 C CG    . TRP E 1 101 ? 4.941   36.057  66.894  1.00 55.58  ? 87   TRP E CG    1 
ATOM   4065 C CD1   . TRP E 1 101 ? 5.298   36.778  68.023  1.00 58.06  ? 87   TRP E CD1   1 
ATOM   4066 C CD2   . TRP E 1 101 ? 6.116   35.408  66.460  1.00 56.65  ? 87   TRP E CD2   1 
ATOM   4067 N NE1   . TRP E 1 101 ? 6.632   36.609  68.297  1.00 59.11  ? 87   TRP E NE1   1 
ATOM   4068 C CE2   . TRP E 1 101 ? 7.159   35.770  67.353  1.00 59.21  ? 87   TRP E CE2   1 
ATOM   4069 C CE3   . TRP E 1 101 ? 6.404   34.558  65.401  1.00 58.41  ? 87   TRP E CE3   1 
ATOM   4070 C CZ2   . TRP E 1 101 ? 8.454   35.294  67.215  1.00 60.57  ? 87   TRP E CZ2   1 
ATOM   4071 C CZ3   . TRP E 1 101 ? 7.690   34.104  65.251  1.00 59.78  ? 87   TRP E CZ3   1 
ATOM   4072 C CH2   . TRP E 1 101 ? 8.701   34.467  66.157  1.00 61.08  ? 87   TRP E CH2   1 
ATOM   4073 N N     . VAL E 1 102 ? 0.322   34.958  66.950  1.00 48.87  ? 88   VAL E N     1 
ATOM   4074 C CA    . VAL E 1 102 ? -1.034  34.779  66.385  1.00 48.62  ? 88   VAL E CA    1 
ATOM   4075 C C     . VAL E 1 102 ? -1.969  34.145  67.410  1.00 48.24  ? 88   VAL E C     1 
ATOM   4076 O O     . VAL E 1 102 ? -1.522  33.454  68.329  1.00 50.01  ? 88   VAL E O     1 
ATOM   4077 C CB    . VAL E 1 102 ? -0.958  33.912  65.119  1.00 48.63  ? 88   VAL E CB    1 
ATOM   4078 C CG1   . VAL E 1 102 ? -2.314  33.383  64.717  1.00 50.27  ? 88   VAL E CG1   1 
ATOM   4079 C CG2   . VAL E 1 102 ? -0.371  34.706  63.972  1.00 48.26  ? 88   VAL E CG2   1 
ATOM   4080 N N     . ARG E 1 103 ? -3.268  34.409  67.290  1.00 48.50  ? 89   ARG E N     1 
ATOM   4081 C CA    . ARG E 1 103 ? -4.284  33.725  68.112  1.00 48.13  ? 89   ARG E CA    1 
ATOM   4082 C C     . ARG E 1 103 ? -5.484  33.433  67.240  1.00 48.43  ? 89   ARG E C     1 
ATOM   4083 O O     . ARG E 1 103 ? -5.629  34.036  66.173  1.00 48.80  ? 89   ARG E O     1 
ATOM   4084 C CB    . ARG E 1 103 ? -4.685  34.584  69.324  1.00 49.27  ? 89   ARG E CB    1 
ATOM   4085 C CG    . ARG E 1 103 ? -5.356  35.904  68.964  1.00 49.46  ? 89   ARG E CG    1 
ATOM   4086 C CD    . ARG E 1 103 ? -5.708  36.724  70.190  1.00 50.74  ? 89   ARG E CD    1 
ATOM   4087 N NE    . ARG E 1 103 ? -6.386  37.968  69.812  1.00 51.51  ? 89   ARG E NE    1 
ATOM   4088 C CZ    . ARG E 1 103 ? -7.700  38.124  69.685  1.00 52.20  ? 89   ARG E CZ    1 
ATOM   4089 N NH1   . ARG E 1 103 ? -8.539  37.129  69.933  1.00 52.50  ? 89   ARG E NH1   1 
ATOM   4090 N NH2   . ARG E 1 103 ? -8.185  39.305  69.335  1.00 54.06  ? 89   ARG E NH2   1 
ATOM   4091 N N     . ARG E 1 104 ? -6.354  32.539  67.702  1.00 50.08  ? 90   ARG E N     1 
ATOM   4092 C CA    . ARG E 1 104 ? -7.529  32.121  66.929  1.00 52.18  ? 90   ARG E CA    1 
ATOM   4093 C C     . ARG E 1 104 ? -8.848  32.453  67.619  1.00 55.96  ? 90   ARG E C     1 
ATOM   4094 O O     . ARG E 1 104 ? -8.929  32.440  68.845  1.00 56.20  ? 90   ARG E O     1 
ATOM   4095 C CB    . ARG E 1 104 ? -7.487  30.622  66.705  1.00 51.95  ? 90   ARG E CB    1 
ATOM   4096 C CG    . ARG E 1 104 ? -6.455  30.148  65.689  1.00 51.14  ? 90   ARG E CG    1 
ATOM   4097 C CD    . ARG E 1 104 ? -5.757  28.875  66.184  1.00 50.63  ? 90   ARG E CD    1 
ATOM   4098 N NE    . ARG E 1 104 ? -5.506  27.913  65.123  1.00 49.49  ? 90   ARG E NE    1 
ATOM   4099 C CZ    . ARG E 1 104 ? -4.983  26.706  65.310  1.00 48.51  ? 90   ARG E CZ    1 
ATOM   4100 N NH1   . ARG E 1 104 ? -4.624  26.297  66.518  1.00 46.99  ? 90   ARG E NH1   1 
ATOM   4101 N NH2   . ARG E 1 104 ? -4.788  25.912  64.252  1.00 50.24  ? 90   ARG E NH2   1 
ATOM   4102 N N     . GLU E 1 105 ? -9.871  32.747  66.812  1.00 58.93  ? 91   GLU E N     1 
ATOM   4103 C CA    . GLU E 1 105 ? -11.239 32.926  67.288  1.00 62.18  ? 91   GLU E CA    1 
ATOM   4104 C C     . GLU E 1 105 ? -12.220 32.208  66.361  1.00 65.28  ? 91   GLU E C     1 
ATOM   4105 O O     . GLU E 1 105 ? -11.898 31.912  65.207  1.00 64.68  ? 91   GLU E O     1 
ATOM   4106 C CB    . GLU E 1 105 ? -11.609 34.405  67.337  1.00 63.43  ? 91   GLU E CB    1 
ATOM   4107 C CG    . GLU E 1 105 ? -11.343 35.082  68.667  1.00 64.49  ? 91   GLU E CG    1 
ATOM   4108 C CD    . GLU E 1 105 ? -11.845 36.512  68.714  1.00 66.63  ? 91   GLU E CD    1 
ATOM   4109 O OE1   . GLU E 1 105 ? -12.429 36.989  67.714  1.00 67.67  ? 91   GLU E OE1   1 
ATOM   4110 O OE2   . GLU E 1 105 ? -11.666 37.163  69.768  1.00 69.12  ? 91   GLU E OE2   1 
ATOM   4111 N N     . ASP E 1 106 ? -13.421 31.953  66.874  1.00 68.32  ? 92   ASP E N     1 
ATOM   4112 C CA    . ASP E 1 106 ? -14.480 31.335  66.091  1.00 70.73  ? 92   ASP E CA    1 
ATOM   4113 C C     . ASP E 1 106 ? -15.195 32.413  65.281  1.00 70.55  ? 92   ASP E C     1 
ATOM   4114 O O     . ASP E 1 106 ? -15.258 33.563  65.708  1.00 71.45  ? 92   ASP E O     1 
ATOM   4115 C CB    . ASP E 1 106 ? -15.495 30.612  66.993  1.00 74.08  ? 92   ASP E CB    1 
ATOM   4116 C CG    . ASP E 1 106 ? -14.838 29.805  68.101  1.00 75.54  ? 92   ASP E CG    1 
ATOM   4117 O OD1   . ASP E 1 106 ? -13.668 30.102  68.452  1.00 73.81  ? 92   ASP E OD1   1 
ATOM   4118 O OD2   . ASP E 1 106 ? -15.503 28.881  68.637  1.00 78.31  ? 92   ASP E OD2   1 
ATOM   4119 N N     . CYS E 1 107 ? -15.727 32.040  64.117  1.00 69.29  ? 93   CYS E N     1 
ATOM   4120 C CA    . CYS E 1 107 ? -16.638 32.910  63.369  1.00 70.15  ? 93   CYS E CA    1 
ATOM   4121 C C     . CYS E 1 107 ? -17.992 32.833  64.086  1.00 74.36  ? 93   CYS E C     1 
ATOM   4122 O O     . CYS E 1 107 ? -18.435 31.739  64.454  1.00 75.30  ? 93   CYS E O     1 
ATOM   4123 C CB    . CYS E 1 107 ? -16.761 32.477  61.900  1.00 67.54  ? 93   CYS E CB    1 
ATOM   4124 S SG    . CYS E 1 107 ? -17.828 33.524  60.884  1.00 64.92  ? 93   CYS E SG    1 
ATOM   4125 N N     . PRO E 1 108 ? -18.635 33.989  64.335  1.00 76.62  ? 94   PRO E N     1 
ATOM   4126 C CA    . PRO E 1 108 ? -19.878 33.939  65.132  1.00 79.79  ? 94   PRO E CA    1 
ATOM   4127 C C     . PRO E 1 108 ? -21.104 33.418  64.350  1.00 81.35  ? 94   PRO E C     1 
ATOM   4128 O O     . PRO E 1 108 ? -21.914 32.689  64.915  1.00 83.54  ? 94   PRO E O     1 
ATOM   4129 C CB    . PRO E 1 108 ? -20.062 35.391  65.596  1.00 80.91  ? 94   PRO E CB    1 
ATOM   4130 C CG    . PRO E 1 108 ? -19.274 36.228  64.633  1.00 79.57  ? 94   PRO E CG    1 
ATOM   4131 C CD    . PRO E 1 108 ? -18.313 35.353  63.879  1.00 75.82  ? 94   PRO E CD    1 
ATOM   4132 N N     . SER E 1 109 ? -21.221 33.765  63.066  1.00 81.00  ? 95   SER E N     1 
ATOM   4133 C CA    . SER E 1 109 ? -22.336 33.296  62.224  1.00 81.42  ? 95   SER E CA    1 
ATOM   4134 C C     . SER E 1 109 ? -22.174 31.836  61.801  1.00 79.68  ? 95   SER E C     1 
ATOM   4135 O O     . SER E 1 109 ? -23.154 31.111  61.641  1.00 82.14  ? 95   SER E O     1 
ATOM   4136 C CB    . SER E 1 109 ? -22.478 34.173  60.980  1.00 81.32  ? 95   SER E CB    1 
ATOM   4137 N N     . ASP E 1 110 ? -20.932 31.407  61.623  1.00 76.59  ? 96   ASP E N     1 
ATOM   4138 C CA    . ASP E 1 110 ? -20.636 30.036  61.241  1.00 75.45  ? 96   ASP E CA    1 
ATOM   4139 C C     . ASP E 1 110 ? -19.681 29.417  62.263  1.00 71.11  ? 96   ASP E C     1 
ATOM   4140 O O     . ASP E 1 110 ? -18.482 29.614  62.161  1.00 66.40  ? 96   ASP E O     1 
ATOM   4141 C CB    . ASP E 1 110 ? -20.005 30.016  59.834  1.00 75.48  ? 96   ASP E CB    1 
ATOM   4142 C CG    . ASP E 1 110 ? -20.048 28.629  59.199  1.00 77.07  ? 96   ASP E CG    1 
ATOM   4143 O OD1   . ASP E 1 110 ? -20.045 27.628  59.949  1.00 76.23  ? 96   ASP E OD1   1 
ATOM   4144 O OD2   . ASP E 1 110 ? -20.099 28.533  57.951  1.00 80.31  ? 96   ASP E OD2   1 
ATOM   4145 N N     . LYS E 1 111 ? -20.196 28.640  63.218  1.00 70.88  ? 97   LYS E N     1 
ATOM   4146 C CA    . LYS E 1 111 ? -19.353 28.150  64.336  1.00 70.04  ? 97   LYS E CA    1 
ATOM   4147 C C     . LYS E 1 111 ? -18.297 27.123  63.876  1.00 68.57  ? 97   LYS E C     1 
ATOM   4148 O O     . LYS E 1 111 ? -17.791 26.336  64.664  1.00 69.73  ? 97   LYS E O     1 
ATOM   4149 C CB    . LYS E 1 111 ? -20.188 27.599  65.502  1.00 72.04  ? 97   LYS E CB    1 
ATOM   4150 N N     . ARG E 1 112 ? -17.967 27.174  62.591  1.00 66.32  ? 98   ARG E N     1 
ATOM   4151 C CA    . ARG E 1 112 ? -17.188 26.171  61.876  1.00 63.49  ? 98   ARG E CA    1 
ATOM   4152 C C     . ARG E 1 112 ? -15.915 26.836  61.382  1.00 60.65  ? 98   ARG E C     1 
ATOM   4153 O O     . ARG E 1 112 ? -14.852 26.220  61.338  1.00 59.06  ? 98   ARG E O     1 
ATOM   4154 C CB    . ARG E 1 112 ? -18.029 25.728  60.678  1.00 64.38  ? 98   ARG E CB    1 
ATOM   4155 C CG    . ARG E 1 112 ? -17.637 24.458  59.951  1.00 63.44  ? 98   ARG E CG    1 
ATOM   4156 C CD    . ARG E 1 112 ? -18.907 23.688  59.574  1.00 67.98  ? 98   ARG E CD    1 
ATOM   4157 N NE    . ARG E 1 112 ? -19.361 23.563  58.178  1.00 69.38  ? 98   ARG E NE    1 
ATOM   4158 C CZ    . ARG E 1 112 ? -19.871 24.535  57.424  1.00 69.42  ? 98   ARG E CZ    1 
ATOM   4159 N NH1   . ARG E 1 112 ? -19.926 25.790  57.848  1.00 69.11  ? 98   ARG E NH1   1 
ATOM   4160 N NH2   . ARG E 1 112 ? -20.277 24.246  56.198  1.00 70.12  ? 98   ARG E NH2   1 
ATOM   4161 N N     . GLY E 1 113 ? -16.058 28.093  60.969  1.00 60.17  ? 99   GLY E N     1 
ATOM   4162 C CA    . GLY E 1 113 ? -14.947 28.910  60.553  1.00 58.21  ? 99   GLY E CA    1 
ATOM   4163 C C     . GLY E 1 113 ? -14.046 29.301  61.705  1.00 57.23  ? 99   GLY E C     1 
ATOM   4164 O O     . GLY E 1 113 ? -14.456 29.328  62.854  1.00 57.60  ? 99   GLY E O     1 
ATOM   4165 N N     . GLN E 1 114 ? -12.797 29.601  61.376  1.00 56.05  ? 100  GLN E N     1 
ATOM   4166 C CA    . GLN E 1 114 ? -11.855 30.087  62.352  1.00 55.50  ? 100  GLN E CA    1 
ATOM   4167 C C     . GLN E 1 114 ? -11.177 31.311  61.806  1.00 54.47  ? 100  GLN E C     1 
ATOM   4168 O O     . GLN E 1 114 ? -10.845 31.358  60.629  1.00 52.56  ? 100  GLN E O     1 
ATOM   4169 C CB    . GLN E 1 114 ? -10.796 29.039  62.685  1.00 54.42  ? 100  GLN E CB    1 
ATOM   4170 C CG    . GLN E 1 114 ? -11.328 27.863  63.460  1.00 56.48  ? 100  GLN E CG    1 
ATOM   4171 C CD    . GLN E 1 114 ? -11.449 28.213  64.924  1.00 58.90  ? 100  GLN E CD    1 
ATOM   4172 O OE1   . GLN E 1 114 ? -10.448 28.267  65.658  1.00 58.86  ? 100  GLN E OE1   1 
ATOM   4173 N NE2   . GLN E 1 114 ? -12.668 28.488  65.352  1.00 60.16  ? 100  GLN E NE2   1 
ATOM   4174 N N     . PHE E 1 115 ? -10.945 32.283  62.683  1.00 55.35  ? 101  PHE E N     1 
ATOM   4175 C CA    . PHE E 1 115 ? -10.153 33.457  62.341  1.00 56.11  ? 101  PHE E CA    1 
ATOM   4176 C C     . PHE E 1 115 ? -8.738  33.300  62.878  1.00 54.01  ? 101  PHE E C     1 
ATOM   4177 O O     . PHE E 1 115 ? -8.520  32.711  63.938  1.00 53.23  ? 101  PHE E O     1 
ATOM   4178 C CB    . PHE E 1 115 ? -10.765 34.726  62.947  1.00 58.69  ? 101  PHE E CB    1 
ATOM   4179 C CG    . PHE E 1 115 ? -11.878 35.333  62.128  1.00 60.30  ? 101  PHE E CG    1 
ATOM   4180 C CD1   . PHE E 1 115 ? -11.601 36.015  60.960  1.00 60.14  ? 101  PHE E CD1   1 
ATOM   4181 C CD2   . PHE E 1 115 ? -13.200 35.241  62.546  1.00 63.10  ? 101  PHE E CD2   1 
ATOM   4182 C CE1   . PHE E 1 115 ? -12.616 36.587  60.213  1.00 61.86  ? 101  PHE E CE1   1 
ATOM   4183 C CE2   . PHE E 1 115 ? -14.220 35.809  61.803  1.00 64.15  ? 101  PHE E CE2   1 
ATOM   4184 C CZ    . PHE E 1 115 ? -13.926 36.484  60.635  1.00 64.28  ? 101  PHE E CZ    1 
ATOM   4185 N N     . ALA E 1 116 ? -7.781  33.784  62.100  1.00 54.59  ? 102  ALA E N     1 
ATOM   4186 C CA    . ALA E 1 116 ? -6.387  33.923  62.529  1.00 52.97  ? 102  ALA E CA    1 
ATOM   4187 C C     . ALA E 1 116 ? -6.172  35.398  62.752  1.00 53.27  ? 102  ALA E C     1 
ATOM   4188 O O     . ALA E 1 116 ? -6.356  36.196  61.839  1.00 53.72  ? 102  ALA E O     1 
ATOM   4189 C CB    . ALA E 1 116 ? -5.435  33.402  61.466  1.00 50.49  ? 102  ALA E CB    1 
ATOM   4190 N N     . ILE E 1 117 ? -5.810  35.753  63.974  1.00 53.33  ? 103  ILE E N     1 
ATOM   4191 C CA    . ILE E 1 117 ? -5.672  37.142  64.365  1.00 55.00  ? 103  ILE E CA    1 
ATOM   4192 C C     . ILE E 1 117 ? -4.243  37.383  64.805  1.00 55.44  ? 103  ILE E C     1 
ATOM   4193 O O     . ILE E 1 117 ? -3.676  36.575  65.554  1.00 58.51  ? 103  ILE E O     1 
ATOM   4194 C CB    . ILE E 1 117 ? -6.593  37.481  65.548  1.00 56.44  ? 103  ILE E CB    1 
ATOM   4195 C CG1   . ILE E 1 117 ? -8.054  37.126  65.216  1.00 56.58  ? 103  ILE E CG1   1 
ATOM   4196 C CG2   . ILE E 1 117 ? -6.447  38.951  65.914  1.00 58.11  ? 103  ILE E CG2   1 
ATOM   4197 C CD1   . ILE E 1 117 ? -8.970  37.062  66.413  1.00 56.64  ? 103  ILE E CD1   1 
ATOM   4198 N N     . LEU E 1 118 ? -3.657  38.473  64.314  1.00 54.61  ? 104  LEU E N     1 
ATOM   4199 C CA    . LEU E 1 118 ? -2.297  38.862  64.668  1.00 52.97  ? 104  LEU E CA    1 
ATOM   4200 C C     . LEU E 1 118 ? -2.302  39.522  66.033  1.00 52.83  ? 104  LEU E C     1 
ATOM   4201 O O     . LEU E 1 118 ? -2.994  40.509  66.227  1.00 53.32  ? 104  LEU E O     1 
ATOM   4202 C CB    . LEU E 1 118 ? -1.765  39.841  63.620  1.00 54.34  ? 104  LEU E CB    1 
ATOM   4203 C CG    . LEU E 1 118 ? -0.385  40.495  63.820  1.00 55.45  ? 104  LEU E CG    1 
ATOM   4204 C CD1   . LEU E 1 118 ? 0.710   39.434  63.880  1.00 55.07  ? 104  LEU E CD1   1 
ATOM   4205 C CD2   . LEU E 1 118 ? -0.111  41.477  62.697  1.00 55.88  ? 104  LEU E CD2   1 
ATOM   4206 N N     . THR E 1 119 ? -1.534  38.988  66.978  1.00 51.52  ? 105  THR E N     1 
ATOM   4207 C CA    . THR E 1 119 ? -1.421  39.603  68.309  1.00 52.12  ? 105  THR E CA    1 
ATOM   4208 C C     . THR E 1 119 ? -0.650  40.910  68.263  1.00 53.79  ? 105  THR E C     1 
ATOM   4209 O O     . THR E 1 119 ? 0.014   41.204  67.281  1.00 52.48  ? 105  THR E O     1 
ATOM   4210 C CB    . THR E 1 119 ? -0.655  38.693  69.269  1.00 51.51  ? 105  THR E CB    1 
ATOM   4211 O OG1   . THR E 1 119 ? 0.662   38.470  68.750  1.00 51.03  ? 105  THR E OG1   1 
ATOM   4212 C CG2   . THR E 1 119 ? -1.373  37.354  69.438  1.00 51.42  ? 105  THR E CG2   1 
ATOM   4213 N N     . ASP E 1 120 ? -0.707  41.687  69.344  1.00 57.08  ? 106  ASP E N     1 
ATOM   4214 C CA    . ASP E 1 120 ? 0.182   42.857  69.474  1.00 59.06  ? 106  ASP E CA    1 
ATOM   4215 C C     . ASP E 1 120 ? 1.662   42.468  69.287  1.00 58.15  ? 106  ASP E C     1 
ATOM   4216 O O     . ASP E 1 120 ? 2.375   43.070  68.515  1.00 57.59  ? 106  ASP E O     1 
ATOM   4217 C CB    . ASP E 1 120 ? 0.010   43.541  70.836  1.00 60.32  ? 106  ASP E CB    1 
ATOM   4218 C CG    . ASP E 1 120 ? -1.301  44.328  70.957  1.00 62.61  ? 106  ASP E CG    1 
ATOM   4219 O OD1   . ASP E 1 120 ? -1.821  44.791  69.908  1.00 65.92  ? 106  ASP E OD1   1 
ATOM   4220 O OD2   . ASP E 1 120 ? -1.788  44.507  72.106  1.00 59.12  ? 106  ASP E OD2   1 
ATOM   4221 N N     . GLU E 1 121 ? 2.110   41.472  70.029  1.00 58.07  ? 107  GLU E N     1 
ATOM   4222 C CA    . GLU E 1 121 ? 3.497   41.066  70.001  1.00 58.40  ? 107  GLU E CA    1 
ATOM   4223 C C     . GLU E 1 121 ? 3.930   40.666  68.595  1.00 60.09  ? 107  GLU E C     1 
ATOM   4224 O O     . GLU E 1 121 ? 5.081   40.892  68.205  1.00 58.57  ? 107  GLU E O     1 
ATOM   4225 C CB    . GLU E 1 121 ? 3.715   39.907  70.980  1.00 58.30  ? 107  GLU E CB    1 
ATOM   4226 C CG    . GLU E 1 121 ? 5.106   39.809  71.610  1.00 61.59  ? 107  GLU E CG    1 
ATOM   4227 C CD    . GLU E 1 121 ? 5.687   41.087  72.222  1.00 64.71  ? 107  GLU E CD    1 
ATOM   4228 O OE1   . GLU E 1 121 ? 4.970   42.106  72.382  1.00 65.56  ? 107  GLU E OE1   1 
ATOM   4229 O OE2   . GLU E 1 121 ? 6.904   41.060  72.561  1.00 67.01  ? 107  GLU E OE2   1 
ATOM   4230 N N     . GLY E 1 122 ? 3.006   40.057  67.849  1.00 60.21  ? 108  GLY E N     1 
ATOM   4231 C CA    . GLY E 1 122 ? 3.256   39.669  66.465  1.00 57.75  ? 108  GLY E CA    1 
ATOM   4232 C C     . GLY E 1 122 ? 3.500   40.893  65.622  1.00 59.42  ? 108  GLY E C     1 
ATOM   4233 O O     . GLY E 1 122 ? 4.468   40.964  64.873  1.00 61.96  ? 108  GLY E O     1 
ATOM   4234 N N     . TYR E 1 123 ? 2.634   41.888  65.777  1.00 60.69  ? 109  TYR E N     1 
ATOM   4235 C CA    . TYR E 1 123 ? 2.834   43.191  65.151  1.00 60.45  ? 109  TYR E CA    1 
ATOM   4236 C C     . TYR E 1 123 ? 4.179   43.811  65.530  1.00 61.67  ? 109  TYR E C     1 
ATOM   4237 O O     . TYR E 1 123 ? 4.788   44.496  64.711  1.00 64.88  ? 109  TYR E O     1 
ATOM   4238 C CB    . TYR E 1 123 ? 1.709   44.151  65.538  1.00 62.01  ? 109  TYR E CB    1 
ATOM   4239 C CG    . TYR E 1 123 ? 1.638   45.359  64.650  1.00 65.89  ? 109  TYR E CG    1 
ATOM   4240 C CD1   . TYR E 1 123 ? 1.043   45.275  63.393  1.00 67.51  ? 109  TYR E CD1   1 
ATOM   4241 C CD2   . TYR E 1 123 ? 2.182   46.593  65.051  1.00 67.63  ? 109  TYR E CD2   1 
ATOM   4242 C CE1   . TYR E 1 123 ? 0.992   46.388  62.548  1.00 70.69  ? 109  TYR E CE1   1 
ATOM   4243 C CE2   . TYR E 1 123 ? 2.129   47.706  64.222  1.00 70.22  ? 109  TYR E CE2   1 
ATOM   4244 C CZ    . TYR E 1 123 ? 1.534   47.600  62.975  1.00 71.64  ? 109  TYR E CZ    1 
ATOM   4245 O OH    . TYR E 1 123 ? 1.488   48.696  62.155  1.00 74.67  ? 109  TYR E OH    1 
ATOM   4246 N N     . GLU E 1 124 ? 4.631   43.603  66.765  1.00 59.94  ? 110  GLU E N     1 
ATOM   4247 C CA    . GLU E 1 124 ? 5.906   44.173  67.201  1.00 61.67  ? 110  GLU E CA    1 
ATOM   4248 C C     . GLU E 1 124 ? 7.087   43.484  66.531  1.00 62.86  ? 110  GLU E C     1 
ATOM   4249 O O     . GLU E 1 124 ? 8.128   44.116  66.334  1.00 65.47  ? 110  GLU E O     1 
ATOM   4250 C CB    . GLU E 1 124 ? 6.065   44.162  68.725  1.00 60.36  ? 110  GLU E CB    1 
ATOM   4251 N N     . VAL E 1 125 ? 6.935   42.209  66.170  1.00 60.91  ? 111  VAL E N     1 
ATOM   4252 C CA    . VAL E 1 125 ? 7.975   41.501  65.422  1.00 60.95  ? 111  VAL E CA    1 
ATOM   4253 C C     . VAL E 1 125 ? 8.081   42.019  63.986  1.00 61.89  ? 111  VAL E C     1 
ATOM   4254 O O     . VAL E 1 125 ? 9.168   42.026  63.395  1.00 61.77  ? 111  VAL E O     1 
ATOM   4255 C CB    . VAL E 1 125 ? 7.747   39.979  65.409  1.00 59.89  ? 111  VAL E CB    1 
ATOM   4256 C CG1   . VAL E 1 125 ? 8.783   39.285  64.549  1.00 62.28  ? 111  VAL E CG1   1 
ATOM   4257 C CG2   . VAL E 1 125 ? 7.857   39.423  66.812  1.00 61.21  ? 111  VAL E CG2   1 
ATOM   4258 N N     . LEU E 1 126 ? 6.958   42.429  63.409  1.00 61.50  ? 112  LEU E N     1 
ATOM   4259 C CA    . LEU E 1 126 ? 6.993   42.981  62.055  1.00 62.61  ? 112  LEU E CA    1 
ATOM   4260 C C     . LEU E 1 126 ? 7.698   44.313  62.089  1.00 65.02  ? 112  LEU E C     1 
ATOM   4261 O O     . LEU E 1 126 ? 8.608   44.543  61.299  1.00 67.67  ? 112  LEU E O     1 
ATOM   4262 C CB    . LEU E 1 126 ? 5.600   43.152  61.473  1.00 62.65  ? 112  LEU E CB    1 
ATOM   4263 C CG    . LEU E 1 126 ? 5.047   41.920  60.781  1.00 62.63  ? 112  LEU E CG    1 
ATOM   4264 C CD1   . LEU E 1 126 ? 4.811   40.831  61.809  1.00 62.99  ? 112  LEU E CD1   1 
ATOM   4265 C CD2   . LEU E 1 126 ? 3.746   42.241  60.072  1.00 62.73  ? 112  LEU E CD2   1 
ATOM   4266 N N     . ARG E 1 127 ? 7.291   45.177  63.019  1.00 65.37  ? 113  ARG E N     1 
ATOM   4267 C CA    . ARG E 1 127 ? 7.899   46.506  63.149  1.00 67.23  ? 113  ARG E CA    1 
ATOM   4268 C C     . ARG E 1 127 ? 9.393   46.364  63.342  1.00 68.18  ? 113  ARG E C     1 
ATOM   4269 O O     . ARG E 1 127 ? 10.175  47.088  62.721  1.00 72.84  ? 113  ARG E O     1 
ATOM   4270 C CB    . ARG E 1 127 ? 7.306   47.311  64.329  1.00 68.62  ? 113  ARG E CB    1 
ATOM   4271 N N     . ARG E 1 128 ? 9.793   45.424  64.192  1.00 66.12  ? 114  ARG E N     1 
ATOM   4272 C CA    . ARG E 1 128 ? 11.208  45.188  64.453  1.00 67.59  ? 114  ARG E CA    1 
ATOM   4273 C C     . ARG E 1 128 ? 11.977  44.718  63.206  1.00 68.93  ? 114  ARG E C     1 
ATOM   4274 O O     . ARG E 1 128 ? 13.077  45.207  62.945  1.00 70.51  ? 114  ARG E O     1 
ATOM   4275 C CB    . ARG E 1 128 ? 11.383  44.185  65.604  1.00 66.22  ? 114  ARG E CB    1 
ATOM   4276 C CG    . ARG E 1 128 ? 11.071  44.778  66.970  1.00 67.00  ? 114  ARG E CG    1 
ATOM   4277 C CD    . ARG E 1 128 ? 11.039  43.741  68.093  1.00 65.22  ? 114  ARG E CD    1 
ATOM   4278 N N     . THR E 1 129 ? 11.400  43.787  62.437  1.00 67.10  ? 115  THR E N     1 
ATOM   4279 C CA    . THR E 1 129 ? 12.166  43.064  61.423  1.00 67.65  ? 115  THR E CA    1 
ATOM   4280 C C     . THR E 1 129 ? 11.990  43.551  59.983  1.00 69.72  ? 115  THR E C     1 
ATOM   4281 O O     . THR E 1 129 ? 12.925  43.448  59.180  1.00 70.71  ? 115  THR E O     1 
ATOM   4282 C CB    . THR E 1 129 ? 11.840  41.581  61.467  1.00 65.93  ? 115  THR E CB    1 
ATOM   4283 O OG1   . THR E 1 129 ? 10.453  41.395  61.155  1.00 65.24  ? 115  THR E OG1   1 
ATOM   4284 C CG2   . THR E 1 129 ? 12.143  41.018  62.850  1.00 65.76  ? 115  THR E CG2   1 
ATOM   4285 N N     . ALA E 1 130 ? 10.800  44.038  59.639  1.00 69.54  ? 116  ALA E N     1 
ATOM   4286 C CA    . ALA E 1 130 ? 10.500  44.442  58.250  1.00 71.14  ? 116  ALA E CA    1 
ATOM   4287 C C     . ALA E 1 130 ? 11.622  45.193  57.550  1.00 74.43  ? 116  ALA E C     1 
ATOM   4288 O O     . ALA E 1 130 ? 12.028  44.791  56.463  1.00 77.26  ? 116  ALA E O     1 
ATOM   4289 C CB    . ALA E 1 130 ? 9.202   45.229  58.179  1.00 70.22  ? 116  ALA E CB    1 
ATOM   4290 N N     . PRO E 1 131 ? 12.141  46.272  58.163  1.00 76.90  ? 117  PRO E N     1 
ATOM   4291 C CA    . PRO E 1 131 ? 13.252  47.004  57.541  1.00 80.09  ? 117  PRO E CA    1 
ATOM   4292 C C     . PRO E 1 131 ? 14.400  46.103  57.095  1.00 80.90  ? 117  PRO E C     1 
ATOM   4293 O O     . PRO E 1 131 ? 14.898  46.257  55.985  1.00 84.18  ? 117  PRO E O     1 
ATOM   4294 C CB    . PRO E 1 131 ? 13.729  47.959  58.648  1.00 81.55  ? 117  PRO E CB    1 
ATOM   4295 C CG    . PRO E 1 131 ? 12.712  47.908  59.733  1.00 78.71  ? 117  PRO E CG    1 
ATOM   4296 C CD    . PRO E 1 131 ? 11.586  47.014  59.308  1.00 77.05  ? 117  PRO E CD    1 
ATOM   4297 N N     . GLY E 1 132 ? 14.813  45.175  57.953  1.00 80.00  ? 118  GLY E N     1 
ATOM   4298 C CA    . GLY E 1 132 ? 15.804  44.173  57.572  1.00 80.94  ? 118  GLY E CA    1 
ATOM   4299 C C     . GLY E 1 132 ? 15.343  43.403  56.346  1.00 80.64  ? 118  GLY E C     1 
ATOM   4300 O O     . GLY E 1 132 ? 16.025  43.373  55.328  1.00 84.25  ? 118  GLY E O     1 
ATOM   4301 N N     . HIS E 1 133 ? 14.160  42.806  56.430  1.00 78.07  ? 119  HIS E N     1 
ATOM   4302 C CA    . HIS E 1 133 ? 13.648  41.997  55.335  1.00 76.27  ? 119  HIS E CA    1 
ATOM   4303 C C     . HIS E 1 133 ? 13.487  42.791  54.044  1.00 78.22  ? 119  HIS E C     1 
ATOM   4304 O O     . HIS E 1 133 ? 13.712  42.266  52.957  1.00 79.94  ? 119  HIS E O     1 
ATOM   4305 C CB    . HIS E 1 133 ? 12.308  41.348  55.702  1.00 72.59  ? 119  HIS E CB    1 
ATOM   4306 C CG    . HIS E 1 133 ? 11.709  40.573  54.571  1.00 70.55  ? 119  HIS E CG    1 
ATOM   4307 N ND1   . HIS E 1 133 ? 12.265  39.402  54.101  1.00 70.08  ? 119  HIS E ND1   1 
ATOM   4308 C CD2   . HIS E 1 133 ? 10.643  40.832  53.779  1.00 69.51  ? 119  HIS E CD2   1 
ATOM   4309 C CE1   . HIS E 1 133 ? 11.544  38.954  53.089  1.00 69.62  ? 119  HIS E CE1   1 
ATOM   4310 N NE2   . HIS E 1 133 ? 10.557  39.806  52.871  1.00 69.82  ? 119  HIS E NE2   1 
ATOM   4311 N N     . VAL E 1 134 ? 13.077  44.047  54.163  1.00 68.88  ? 120  VAL E N     1 
ATOM   4312 C CA    . VAL E 1 134 ? 12.938  44.899  52.993  1.00 69.83  ? 120  VAL E CA    1 
ATOM   4313 C C     . VAL E 1 134 ? 14.304  45.129  52.341  1.00 68.75  ? 120  VAL E C     1 
ATOM   4314 O O     . VAL E 1 134 ? 14.436  44.951  51.145  1.00 66.24  ? 120  VAL E O     1 
ATOM   4315 C CB    . VAL E 1 134 ? 12.213  46.221  53.332  1.00 72.49  ? 120  VAL E CB    1 
ATOM   4316 C CG1   . VAL E 1 134 ? 12.302  47.217  52.184  1.00 73.92  ? 120  VAL E CG1   1 
ATOM   4317 C CG2   . VAL E 1 134 ? 10.748  45.933  53.643  1.00 72.88  ? 120  VAL E CG2   1 
ATOM   4318 N N     . ASP E 1 135 ? 15.312  45.514  53.128  1.00 70.16  ? 121  ASP E N     1 
ATOM   4319 C CA    . ASP E 1 135 ? 16.686  45.663  52.603  1.00 70.35  ? 121  ASP E CA    1 
ATOM   4320 C C     . ASP E 1 135 ? 17.099  44.435  51.829  1.00 68.38  ? 121  ASP E C     1 
ATOM   4321 O O     . ASP E 1 135 ? 17.441  44.537  50.658  1.00 67.38  ? 121  ASP E O     1 
ATOM   4322 C CB    . ASP E 1 135 ? 17.691  45.919  53.709  1.00 71.00  ? 121  ASP E CB    1 
ATOM   4323 N N     . ALA E 1 136 ? 17.014  43.272  52.476  1.00 67.28  ? 122  ALA E N     1 
ATOM   4324 C CA    . ALA E 1 136 ? 17.398  42.001  51.851  1.00 66.10  ? 122  ALA E CA    1 
ATOM   4325 C C     . ALA E 1 136 ? 16.687  41.771  50.511  1.00 64.83  ? 122  ALA E C     1 
ATOM   4326 O O     . ALA E 1 136 ? 17.306  41.293  49.557  1.00 67.04  ? 122  ALA E O     1 
ATOM   4327 C CB    . ALA E 1 136 ? 17.145  40.836  52.798  1.00 64.66  ? 122  ALA E CB    1 
ATOM   4328 N N     . VAL E 1 137 ? 15.406  42.128  50.441  1.00 62.94  ? 123  VAL E N     1 
ATOM   4329 C CA    . VAL E 1 137 ? 14.634  42.018  49.203  1.00 62.12  ? 123  VAL E CA    1 
ATOM   4330 C C     . VAL E 1 137 ? 15.016  43.089  48.175  1.00 62.51  ? 123  VAL E C     1 
ATOM   4331 O O     . VAL E 1 137 ? 15.001  42.831  46.973  1.00 62.73  ? 123  VAL E O     1 
ATOM   4332 C CB    . VAL E 1 137 ? 13.124  42.068  49.482  1.00 61.24  ? 123  VAL E CB    1 
ATOM   4333 C CG1   . VAL E 1 137 ? 12.335  42.178  48.183  1.00 60.92  ? 123  VAL E CG1   1 
ATOM   4334 C CG2   . VAL E 1 137 ? 12.706  40.821  50.245  1.00 60.62  ? 123  VAL E CG2   1 
ATOM   4335 N N     . ARG E 1 138 ? 15.374  44.275  48.642  1.00 62.95  ? 124  ARG E N     1 
ATOM   4336 C CA    . ARG E 1 138 ? 15.945  45.296  47.763  1.00 64.39  ? 124  ARG E CA    1 
ATOM   4337 C C     . ARG E 1 138 ? 17.279  44.831  47.158  1.00 64.51  ? 124  ARG E C     1 
ATOM   4338 O O     . ARG E 1 138 ? 17.421  44.777  45.942  1.00 63.53  ? 124  ARG E O     1 
ATOM   4339 C CB    . ARG E 1 138 ? 16.192  46.611  48.515  1.00 66.51  ? 124  ARG E CB    1 
ATOM   4340 C CG    . ARG E 1 138 ? 14.957  47.504  48.624  1.00 67.42  ? 124  ARG E CG    1 
ATOM   4341 C CD    . ARG E 1 138 ? 15.160  49.009  48.775  1.00 70.09  ? 124  ARG E CD    1 
ATOM   4342 N NE    . ARG E 1 138 ? 13.853  49.680  48.687  1.00 70.35  ? 124  ARG E NE    1 
ATOM   4343 C CZ    . ARG E 1 138 ? 13.166  49.855  47.552  1.00 70.71  ? 124  ARG E CZ    1 
ATOM   4344 N NH1   . ARG E 1 138 ? 13.634  49.402  46.377  1.00 70.58  ? 124  ARG E NH1   1 
ATOM   4345 N NH2   . ARG E 1 138 ? 11.993  50.477  47.579  1.00 69.73  ? 124  ARG E NH2   1 
ATOM   4346 N N     . GLN E 1 139 ? 18.225  44.482  48.028  1.00 64.59  ? 125  GLN E N     1 
ATOM   4347 C CA    . GLN E 1 139 ? 19.588  44.198  47.632  1.00 65.67  ? 125  GLN E CA    1 
ATOM   4348 C C     . GLN E 1 139 ? 19.649  43.035  46.665  1.00 66.40  ? 125  GLN E C     1 
ATOM   4349 O O     . GLN E 1 139 ? 20.429  43.047  45.712  1.00 67.58  ? 125  GLN E O     1 
ATOM   4350 C CB    . GLN E 1 139 ? 20.472  43.884  48.847  1.00 65.58  ? 125  GLN E CB    1 
ATOM   4351 N N     . ALA E 1 140 ? 18.844  42.015  46.921  1.00 65.73  ? 126  ALA E N     1 
ATOM   4352 C CA    . ALA E 1 140 ? 18.825  40.833  46.066  1.00 63.77  ? 126  ALA E CA    1 
ATOM   4353 C C     . ALA E 1 140 ? 18.157  41.081  44.716  1.00 62.74  ? 126  ALA E C     1 
ATOM   4354 O O     . ALA E 1 140 ? 18.518  40.456  43.732  1.00 62.88  ? 126  ALA E O     1 
ATOM   4355 C CB    . ALA E 1 140 ? 18.120  39.712  46.788  1.00 62.69  ? 126  ALA E CB    1 
ATOM   4356 N N     . VAL E 1 141 ? 17.185  41.987  44.676  1.00 62.89  ? 127  VAL E N     1 
ATOM   4357 C CA    . VAL E 1 141 ? 16.344  42.148  43.494  1.00 62.08  ? 127  VAL E CA    1 
ATOM   4358 C C     . VAL E 1 141 ? 16.303  43.573  42.961  1.00 64.34  ? 127  VAL E C     1 
ATOM   4359 O O     . VAL E 1 141 ? 16.943  43.873  41.963  1.00 66.57  ? 127  VAL E O     1 
ATOM   4360 C CB    . VAL E 1 141 ? 14.906  41.661  43.771  1.00 60.22  ? 127  VAL E CB    1 
ATOM   4361 C CG1   . VAL E 1 141 ? 14.015  41.869  42.554  1.00 59.83  ? 127  VAL E CG1   1 
ATOM   4362 C CG2   . VAL E 1 141 ? 14.924  40.201  44.173  1.00 58.48  ? 127  VAL E CG2   1 
ATOM   4363 N N     . PHE E 1 142 ? 15.570  44.460  43.624  1.00 66.52  ? 128  PHE E N     1 
ATOM   4364 C CA    . PHE E 1 142 ? 15.191  45.746  43.012  1.00 69.09  ? 128  PHE E CA    1 
ATOM   4365 C C     . PHE E 1 142 ? 16.354  46.703  42.745  1.00 72.36  ? 128  PHE E C     1 
ATOM   4366 O O     . PHE E 1 142 ? 16.382  47.368  41.705  1.00 74.22  ? 128  PHE E O     1 
ATOM   4367 C CB    . PHE E 1 142 ? 14.095  46.420  43.825  1.00 68.85  ? 128  PHE E CB    1 
ATOM   4368 C CG    . PHE E 1 142 ? 12.802  45.657  43.826  1.00 68.59  ? 128  PHE E CG    1 
ATOM   4369 C CD1   . PHE E 1 142 ? 11.933  45.757  42.755  1.00 69.84  ? 128  PHE E CD1   1 
ATOM   4370 C CD2   . PHE E 1 142 ? 12.465  44.821  44.877  1.00 67.01  ? 128  PHE E CD2   1 
ATOM   4371 C CE1   . PHE E 1 142 ? 10.742  45.052  42.739  1.00 69.45  ? 128  PHE E CE1   1 
ATOM   4372 C CE2   . PHE E 1 142 ? 11.278  44.119  44.869  1.00 66.68  ? 128  PHE E CE2   1 
ATOM   4373 C CZ    . PHE E 1 142 ? 10.410  44.238  43.801  1.00 67.77  ? 128  PHE E CZ    1 
ATOM   4374 N N     . ASP E 1 143 ? 17.330  46.740  43.646  1.00 73.52  ? 129  ASP E N     1 
ATOM   4375 C CA    . ASP E 1 143 ? 18.547  47.511  43.410  1.00 76.48  ? 129  ASP E CA    1 
ATOM   4376 C C     . ASP E 1 143 ? 19.335  47.061  42.175  1.00 77.68  ? 129  ASP E C     1 
ATOM   4377 O O     . ASP E 1 143 ? 20.217  47.796  41.722  1.00 80.77  ? 129  ASP E O     1 
ATOM   4378 C CB    . ASP E 1 143 ? 19.479  47.451  44.628  1.00 77.88  ? 129  ASP E CB    1 
ATOM   4379 C CG    . ASP E 1 143 ? 19.029  48.353  45.772  1.00 78.09  ? 129  ASP E CG    1 
ATOM   4380 O OD1   . ASP E 1 143 ? 18.174  49.248  45.550  1.00 79.33  ? 129  ASP E OD1   1 
ATOM   4381 O OD2   . ASP E 1 143 ? 19.551  48.169  46.894  1.00 77.38  ? 129  ASP E OD2   1 
ATOM   4382 N N     . ARG E 1 144 ? 19.020  45.885  41.623  1.00 75.11  ? 130  ARG E N     1 
ATOM   4383 C CA    . ARG E 1 144 ? 19.780  45.315  40.496  1.00 74.12  ? 130  ARG E CA    1 
ATOM   4384 C C     . ARG E 1 144 ? 19.090  45.405  39.135  1.00 74.51  ? 130  ARG E C     1 
ATOM   4385 O O     . ARG E 1 144 ? 19.666  45.003  38.123  1.00 77.07  ? 130  ARG E O     1 
ATOM   4386 C CB    . ARG E 1 144 ? 20.094  43.849  40.787  1.00 72.13  ? 130  ARG E CB    1 
ATOM   4387 C CG    . ARG E 1 144 ? 20.729  43.637  42.144  1.00 72.23  ? 130  ARG E CG    1 
ATOM   4388 C CD    . ARG E 1 144 ? 21.328  42.254  42.282  1.00 71.71  ? 130  ARG E CD    1 
ATOM   4389 N NE    . ARG E 1 144 ? 22.722  42.381  42.705  1.00 74.88  ? 130  ARG E NE    1 
ATOM   4390 C CZ    . ARG E 1 144 ? 23.262  41.860  43.805  1.00 75.33  ? 130  ARG E CZ    1 
ATOM   4391 N NH1   . ARG E 1 144 ? 22.551  41.115  44.656  1.00 74.13  ? 130  ARG E NH1   1 
ATOM   4392 N NH2   . ARG E 1 144 ? 24.556  42.078  44.044  1.00 77.25  ? 130  ARG E NH2   1 
ATOM   4393 N N     . LEU E 1 145 ? 17.863  45.912  39.104  1.00 73.79  ? 131  LEU E N     1 
ATOM   4394 C CA    . LEU E 1 145 ? 17.076  45.927  37.880  1.00 73.44  ? 131  LEU E CA    1 
ATOM   4395 C C     . LEU E 1 145 ? 16.648  47.337  37.536  1.00 76.15  ? 131  LEU E C     1 
ATOM   4396 O O     . LEU E 1 145 ? 16.215  48.098  38.403  1.00 76.60  ? 131  LEU E O     1 
ATOM   4397 C CB    . LEU E 1 145 ? 15.829  45.056  38.039  1.00 71.43  ? 131  LEU E CB    1 
ATOM   4398 C CG    . LEU E 1 145 ? 16.076  43.659  38.592  1.00 69.89  ? 131  LEU E CG    1 
ATOM   4399 C CD1   . LEU E 1 145 ? 14.748  42.998  38.922  1.00 69.10  ? 131  LEU E CD1   1 
ATOM   4400 C CD2   . LEU E 1 145 ? 16.869  42.814  37.614  1.00 69.81  ? 131  LEU E CD2   1 
ATOM   4401 N N     . THR E 1 146 ? 16.735  47.676  36.255  1.00 78.90  ? 132  THR E N     1 
ATOM   4402 C CA    . THR E 1 146 ? 16.229  48.957  35.776  1.00 80.66  ? 132  THR E CA    1 
ATOM   4403 C C     . THR E 1 146 ? 14.691  48.974  35.905  1.00 81.01  ? 132  THR E C     1 
ATOM   4404 O O     . THR E 1 146 ? 14.067  47.908  35.986  1.00 78.85  ? 132  THR E O     1 
ATOM   4405 C CB    . THR E 1 146 ? 16.612  49.210  34.299  1.00 81.08  ? 132  THR E CB    1 
ATOM   4406 O OG1   . THR E 1 146 ? 15.814  48.389  33.436  1.00 79.71  ? 132  THR E OG1   1 
ATOM   4407 C CG2   . THR E 1 146 ? 18.098  48.932  34.040  1.00 81.53  ? 132  THR E CG2   1 
ATOM   4408 N N     . PRO E 1 147 ? 14.079  50.178  35.938  1.00 80.66  ? 133  PRO E N     1 
ATOM   4409 C CA    . PRO E 1 147 ? 12.621  50.282  35.870  1.00 79.43  ? 133  PRO E CA    1 
ATOM   4410 C C     . PRO E 1 147 ? 11.969  49.405  34.785  1.00 77.15  ? 133  PRO E C     1 
ATOM   4411 O O     . PRO E 1 147 ? 10.988  48.708  35.069  1.00 75.92  ? 133  PRO E O     1 
ATOM   4412 C CB    . PRO E 1 147 ? 12.384  51.777  35.581  1.00 81.83  ? 133  PRO E CB    1 
ATOM   4413 C CG    . PRO E 1 147 ? 13.686  52.479  35.852  1.00 83.68  ? 133  PRO E CG    1 
ATOM   4414 C CD    . PRO E 1 147 ? 14.687  51.462  36.328  1.00 83.07  ? 133  PRO E CD    1 
ATOM   4415 N N     . GLU E 1 148 ? 12.514  49.420  33.570  1.00 76.68  ? 134  GLU E N     1 
ATOM   4416 C CA    . GLU E 1 148 ? 11.973  48.599  32.476  1.00 75.66  ? 134  GLU E CA    1 
ATOM   4417 C C     . GLU E 1 148 ? 11.829  47.119  32.885  1.00 74.41  ? 134  GLU E C     1 
ATOM   4418 O O     . GLU E 1 148 ? 10.802  46.498  32.601  1.00 73.74  ? 134  GLU E O     1 
ATOM   4419 C CB    . GLU E 1 148 ? 12.818  48.741  31.198  1.00 74.92  ? 134  GLU E CB    1 
ATOM   4420 N N     . GLN E 1 149 ? 12.825  46.581  33.595  1.00 73.62  ? 135  GLN E N     1 
ATOM   4421 C CA    . GLN E 1 149 ? 12.846  45.151  33.956  1.00 72.41  ? 135  GLN E CA    1 
ATOM   4422 C C     . GLN E 1 149 ? 11.959  44.834  35.151  1.00 71.19  ? 135  GLN E C     1 
ATOM   4423 O O     . GLN E 1 149 ? 11.370  43.762  35.219  1.00 68.91  ? 135  GLN E O     1 
ATOM   4424 C CB    . GLN E 1 149 ? 14.253  44.661  34.296  1.00 73.76  ? 135  GLN E CB    1 
ATOM   4425 C CG    . GLN E 1 149 ? 15.391  45.514  33.783  1.00 75.37  ? 135  GLN E CG    1 
ATOM   4426 C CD    . GLN E 1 149 ? 16.698  44.757  33.723  1.00 76.77  ? 135  GLN E CD    1 
ATOM   4427 O OE1   . GLN E 1 149 ? 17.610  44.995  34.510  1.00 78.26  ? 135  GLN E OE1   1 
ATOM   4428 N NE2   . GLN E 1 149 ? 16.785  43.823  32.791  1.00 77.67  ? 135  GLN E NE2   1 
ATOM   4429 N N     . GLN E 1 150 ? 11.886  45.763  36.100  1.00 71.70  ? 136  GLN E N     1 
ATOM   4430 C CA    . GLN E 1 150 ? 10.930  45.659  37.188  1.00 69.84  ? 136  GLN E CA    1 
ATOM   4431 C C     . GLN E 1 150 ? 9.526   45.621  36.620  1.00 69.43  ? 136  GLN E C     1 
ATOM   4432 O O     . GLN E 1 150 ? 8.726   44.771  37.009  1.00 71.72  ? 136  GLN E O     1 
ATOM   4433 C CB    . GLN E 1 150 ? 11.067  46.833  38.146  1.00 72.24  ? 136  GLN E CB    1 
ATOM   4434 C CG    . GLN E 1 150 ? 12.376  46.838  38.915  1.00 73.36  ? 136  GLN E CG    1 
ATOM   4435 C CD    . GLN E 1 150 ? 12.477  48.006  39.876  1.00 75.17  ? 136  GLN E CD    1 
ATOM   4436 O OE1   . GLN E 1 150 ? 11.493  48.696  40.122  1.00 75.80  ? 136  GLN E OE1   1 
ATOM   4437 N NE2   . GLN E 1 150 ? 13.682  48.251  40.401  1.00 75.34  ? 136  GLN E NE2   1 
ATOM   4438 N N     . LYS E 1 151 ? 9.223   46.527  35.691  1.00 69.82  ? 137  LYS E N     1 
ATOM   4439 C CA    . LYS E 1 151 ? 7.926   46.493  35.004  1.00 70.50  ? 137  LYS E CA    1 
ATOM   4440 C C     . LYS E 1 151 ? 7.780   45.118  34.382  1.00 71.26  ? 137  LYS E C     1 
ATOM   4441 O O     . LYS E 1 151 ? 6.797   44.435  34.638  1.00 74.31  ? 137  LYS E O     1 
ATOM   4442 C CB    . LYS E 1 151 ? 7.772   47.591  33.944  1.00 70.08  ? 137  LYS E CB    1 
ATOM   4443 N N     . SER E 1 152 ? 8.790   44.702  33.615  1.00 71.58  ? 138  SER E N     1 
ATOM   4444 C CA    . SER E 1 152 ? 8.746   43.458  32.833  1.00 71.55  ? 138  SER E CA    1 
ATOM   4445 C C     . SER E 1 152 ? 8.526   42.215  33.698  1.00 69.19  ? 138  SER E C     1 
ATOM   4446 O O     . SER E 1 152 ? 7.720   41.347  33.354  1.00 66.48  ? 138  SER E O     1 
ATOM   4447 C CB    . SER E 1 152 ? 10.041  43.302  32.009  1.00 72.54  ? 138  SER E CB    1 
ATOM   4448 N N     . LEU E 1 153 ? 9.244   42.150  34.819  1.00 68.35  ? 139  LEU E N     1 
ATOM   4449 C CA    . LEU E 1 153 ? 9.120   41.045  35.786  1.00 66.35  ? 139  LEU E CA    1 
ATOM   4450 C C     . LEU E 1 153 ? 7.685   40.841  36.261  1.00 66.31  ? 139  LEU E C     1 
ATOM   4451 O O     . LEU E 1 153 ? 7.167   39.729  36.250  1.00 66.21  ? 139  LEU E O     1 
ATOM   4452 C CB    . LEU E 1 153 ? 9.996   41.333  37.004  1.00 64.88  ? 139  LEU E CB    1 
ATOM   4453 C CG    . LEU E 1 153 ? 10.020  40.345  38.163  1.00 64.10  ? 139  LEU E CG    1 
ATOM   4454 C CD1   . LEU E 1 153 ? 10.267  38.936  37.678  1.00 63.01  ? 139  LEU E CD1   1 
ATOM   4455 C CD2   . LEU E 1 153 ? 11.073  40.722  39.202  1.00 64.70  ? 139  LEU E CD2   1 
ATOM   4456 N N     . GLY E 1 154 ? 7.049   41.926  36.679  1.00 67.10  ? 140  GLY E N     1 
ATOM   4457 C CA    . GLY E 1 154 ? 5.695   41.871  37.222  1.00 66.31  ? 140  GLY E CA    1 
ATOM   4458 C C     . GLY E 1 154 ? 4.668   41.456  36.192  1.00 66.56  ? 140  GLY E C     1 
ATOM   4459 O O     . GLY E 1 154 ? 3.746   40.703  36.499  1.00 63.62  ? 140  GLY E O     1 
ATOM   4460 N N     . GLU E 1 155 ? 4.811   41.971  34.970  1.00 68.48  ? 141  GLU E N     1 
ATOM   4461 C CA    . GLU E 1 155 ? 3.921   41.579  33.881  1.00 69.65  ? 141  GLU E CA    1 
ATOM   4462 C C     . GLU E 1 155 ? 4.038   40.082  33.676  1.00 68.31  ? 141  GLU E C     1 
ATOM   4463 O O     . GLU E 1 155 ? 3.039   39.383  33.515  1.00 70.29  ? 141  GLU E O     1 
ATOM   4464 C CB    . GLU E 1 155 ? 4.260   42.341  32.603  1.00 69.64  ? 141  GLU E CB    1 
ATOM   4465 N N     . ILE E 1 156 ? 5.267   39.594  33.742  1.00 67.87  ? 142  ILE E N     1 
ATOM   4466 C CA    . ILE E 1 156 ? 5.560   38.196  33.449  1.00 67.79  ? 142  ILE E CA    1 
ATOM   4467 C C     . ILE E 1 156 ? 5.033   37.267  34.530  1.00 67.62  ? 142  ILE E C     1 
ATOM   4468 O O     . ILE E 1 156 ? 4.366   36.275  34.227  1.00 67.76  ? 142  ILE E O     1 
ATOM   4469 C CB    . ILE E 1 156 ? 7.078   37.976  33.239  1.00 67.37  ? 142  ILE E CB    1 
ATOM   4470 C CG1   . ILE E 1 156 ? 7.502   38.595  31.909  1.00 69.40  ? 142  ILE E CG1   1 
ATOM   4471 C CG2   . ILE E 1 156 ? 7.413   36.495  33.244  1.00 65.80  ? 142  ILE E CG2   1 
ATOM   4472 C CD1   . ILE E 1 156 ? 9.001   38.769  31.755  1.00 71.61  ? 142  ILE E CD1   1 
ATOM   4473 N N     . MET E 1 157 ? 5.329   37.576  35.788  1.00 67.40  ? 143  MET E N     1 
ATOM   4474 C CA    . MET E 1 157 ? 4.931   36.685  36.861  1.00 66.97  ? 143  MET E CA    1 
ATOM   4475 C C     . MET E 1 157 ? 3.410   36.672  37.008  1.00 68.73  ? 143  MET E C     1 
ATOM   4476 O O     . MET E 1 157 ? 2.836   35.594  37.225  1.00 72.36  ? 143  MET E O     1 
ATOM   4477 C CB    . MET E 1 157 ? 5.639   37.036  38.163  1.00 65.30  ? 143  MET E CB    1 
ATOM   4478 C CG    . MET E 1 157 ? 7.169   36.908  38.099  1.00 65.49  ? 143  MET E CG    1 
ATOM   4479 S SD    . MET E 1 157 ? 7.825   35.320  37.482  1.00 64.27  ? 143  MET E SD    1 
ATOM   4480 C CE    . MET E 1 157 ? 7.794   34.264  38.919  1.00 65.55  ? 143  MET E CE    1 
ATOM   4481 N N     . ARG E 1 158 ? 2.760   37.826  36.840  1.00 68.65  ? 144  ARG E N     1 
ATOM   4482 C CA    . ARG E 1 158 ? 1.280   37.873  36.928  1.00 70.96  ? 144  ARG E CA    1 
ATOM   4483 C C     . ARG E 1 158 ? 0.622   36.921  35.950  1.00 69.06  ? 144  ARG E C     1 
ATOM   4484 O O     . ARG E 1 158 ? -0.385  36.309  36.286  1.00 69.42  ? 144  ARG E O     1 
ATOM   4485 C CB    . ARG E 1 158 ? 0.639   39.278  36.769  1.00 74.73  ? 144  ARG E CB    1 
ATOM   4486 C CG    . ARG E 1 158 ? 0.486   39.779  35.326  1.00 77.99  ? 144  ARG E CG    1 
ATOM   4487 C CD    . ARG E 1 158 ? 0.493   41.305  35.166  1.00 80.06  ? 144  ARG E CD    1 
ATOM   4488 N NE    . ARG E 1 158 ? -0.656  41.959  35.816  1.00 80.87  ? 144  ARG E NE    1 
ATOM   4489 C CZ    . ARG E 1 158 ? -0.730  43.248  36.161  1.00 81.34  ? 144  ARG E CZ    1 
ATOM   4490 N NH1   . ARG E 1 158 ? 0.291   44.087  35.987  1.00 81.67  ? 144  ARG E NH1   1 
ATOM   4491 N NH2   . ARG E 1 158 ? -1.850  43.697  36.722  1.00 81.82  ? 144  ARG E NH2   1 
ATOM   4492 N N     . ILE E 1 159 ? 1.157   36.828  34.735  1.00 68.11  ? 145  ILE E N     1 
ATOM   4493 C CA    . ILE E 1 159 ? 0.606   35.898  33.725  1.00 67.98  ? 145  ILE E CA    1 
ATOM   4494 C C     . ILE E 1 159 ? 0.754   34.446  34.171  1.00 65.76  ? 145  ILE E C     1 
ATOM   4495 O O     . ILE E 1 159 ? -0.197  33.658  34.110  1.00 66.60  ? 145  ILE E O     1 
ATOM   4496 C CB    . ILE E 1 159 ? 1.327   36.020  32.377  1.00 68.39  ? 145  ILE E CB    1 
ATOM   4497 C CG1   . ILE E 1 159 ? 1.143   37.415  31.767  1.00 69.86  ? 145  ILE E CG1   1 
ATOM   4498 C CG2   . ILE E 1 159 ? 0.812   34.959  31.424  1.00 69.35  ? 145  ILE E CG2   1 
ATOM   4499 C CD1   . ILE E 1 159 ? 2.231   37.790  30.780  1.00 69.45  ? 145  ILE E CD1   1 
ATOM   4500 N N     . VAL E 1 160 ? 1.962   34.111  34.620  1.00 63.36  ? 146  VAL E N     1 
ATOM   4501 C CA    . VAL E 1 160 ? 2.265   32.778  35.135  1.00 61.77  ? 146  VAL E CA    1 
ATOM   4502 C C     . VAL E 1 160 ? 1.334   32.416  36.274  1.00 61.22  ? 146  VAL E C     1 
ATOM   4503 O O     . VAL E 1 160 ? 0.795   31.322  36.314  1.00 61.03  ? 146  VAL E O     1 
ATOM   4504 C CB    . VAL E 1 160 ? 3.737   32.692  35.604  1.00 61.29  ? 146  VAL E CB    1 
ATOM   4505 C CG1   . VAL E 1 160 ? 4.000   31.416  36.387  1.00 60.54  ? 146  VAL E CG1   1 
ATOM   4506 C CG2   . VAL E 1 160 ? 4.672   32.757  34.402  1.00 62.25  ? 146  VAL E CG2   1 
ATOM   4507 N N     . ALA E 1 161 ? 1.146   33.347  37.203  1.00 62.18  ? 147  ALA E N     1 
ATOM   4508 C CA    . ALA E 1 161 ? 0.252   33.131  38.337  1.00 62.84  ? 147  ALA E CA    1 
ATOM   4509 C C     . ALA E 1 161 ? -1.192  32.997  37.877  1.00 64.56  ? 147  ALA E C     1 
ATOM   4510 O O     . ALA E 1 161 ? -1.848  31.982  38.178  1.00 67.63  ? 147  ALA E O     1 
ATOM   4511 C CB    . ALA E 1 161 ? 0.378   34.254  39.355  1.00 62.98  ? 147  ALA E CB    1 
ATOM   4512 N N     . GLU E 1 162 ? -1.687  33.997  37.151  1.00 63.35  ? 148  GLU E N     1 
ATOM   4513 C CA    . GLU E 1 162 ? -3.049  33.932  36.625  1.00 63.79  ? 148  GLU E CA    1 
ATOM   4514 C C     . GLU E 1 162 ? -3.266  32.576  35.969  1.00 63.44  ? 148  GLU E C     1 
ATOM   4515 O O     . GLU E 1 162 ? -4.295  31.942  36.191  1.00 65.51  ? 148  GLU E O     1 
ATOM   4516 C CB    . GLU E 1 162 ? -3.323  35.059  35.622  1.00 63.55  ? 148  GLU E CB    1 
ATOM   4517 N N     . GLY E 1 163 ? -2.272  32.120  35.200  1.00 61.90  ? 149  GLY E N     1 
ATOM   4518 C CA    . GLY E 1 163 ? -2.360  30.863  34.461  1.00 61.27  ? 149  GLY E CA    1 
ATOM   4519 C C     . GLY E 1 163 ? -2.525  29.631  35.322  1.00 60.95  ? 149  GLY E C     1 
ATOM   4520 O O     . GLY E 1 163 ? -3.189  28.671  34.932  1.00 60.98  ? 149  GLY E O     1 
ATOM   4521 N N     . LEU E 1 164 ? -1.947  29.672  36.514  1.00 60.23  ? 150  LEU E N     1 
ATOM   4522 C CA    . LEU E 1 164 ? -1.946  28.526  37.404  1.00 61.04  ? 150  LEU E CA    1 
ATOM   4523 C C     . LEU E 1 164 ? -3.108  28.517  38.398  1.00 63.35  ? 150  LEU E C     1 
ATOM   4524 O O     . LEU E 1 164 ? -3.270  27.561  39.160  1.00 63.08  ? 150  LEU E O     1 
ATOM   4525 C CB    . LEU E 1 164 ? -0.623  28.476  38.165  1.00 59.86  ? 150  LEU E CB    1 
ATOM   4526 C CG    . LEU E 1 164 ? 0.532   27.912  37.350  1.00 59.44  ? 150  LEU E CG    1 
ATOM   4527 C CD1   . LEU E 1 164 ? 1.861   28.458  37.840  1.00 57.78  ? 150  LEU E CD1   1 
ATOM   4528 C CD2   . LEU E 1 164 ? 0.506   26.389  37.411  1.00 60.20  ? 150  LEU E CD2   1 
ATOM   4529 N N     . GLN E 1 165 ? -3.885  29.590  38.437  1.00 65.06  ? 151  GLN E N     1 
ATOM   4530 C CA    . GLN E 1 165 ? -5.069  29.606  39.286  1.00 67.21  ? 151  GLN E CA    1 
ATOM   4531 C C     . GLN E 1 165 ? -6.268  30.115  38.486  1.00 70.26  ? 151  GLN E C     1 
ATOM   4532 O O     . GLN E 1 165 ? -6.781  31.190  38.749  1.00 68.61  ? 151  GLN E O     1 
ATOM   4533 C CB    . GLN E 1 165 ? -4.844  30.426  40.569  1.00 65.69  ? 151  GLN E CB    1 
ATOM   4534 C CG    . GLN E 1 165 ? -4.164  31.769  40.354  1.00 64.60  ? 151  GLN E CG    1 
ATOM   4535 C CD    . GLN E 1 165 ? -4.048  32.595  41.625  1.00 63.36  ? 151  GLN E CD    1 
ATOM   4536 O OE1   . GLN E 1 165 ? -4.216  32.092  42.731  1.00 63.10  ? 151  GLN E OE1   1 
ATOM   4537 N NE2   . GLN E 1 165 ? -3.728  33.868  41.464  1.00 63.15  ? 151  GLN E NE2   1 
ATOM   4538 N N     . PRO E 1 166 ? -6.703  29.334  37.485  1.00 74.04  ? 152  PRO E N     1 
ATOM   4539 C CA    . PRO E 1 166 ? -7.895  29.733  36.759  1.00 77.57  ? 152  PRO E CA    1 
ATOM   4540 C C     . PRO E 1 166 ? -9.152  29.541  37.627  1.00 81.39  ? 152  PRO E C     1 
ATOM   4541 O O     . PRO E 1 166 ? -9.133  28.757  38.597  1.00 80.91  ? 152  PRO E O     1 
ATOM   4542 C CB    . PRO E 1 166 ? -7.893  28.797  35.542  1.00 77.95  ? 152  PRO E CB    1 
ATOM   4543 C CG    . PRO E 1 166 ? -7.188  27.567  36.010  1.00 76.35  ? 152  PRO E CG    1 
ATOM   4544 C CD    . PRO E 1 166 ? -6.173  28.030  37.027  1.00 74.59  ? 152  PRO E CD    1 
ATOM   4545 N N     . SER E 1 167 ? -10.225 30.258  37.285  1.00 84.76  ? 153  SER E N     1 
ATOM   4546 C CA    . SER E 1 167 ? -11.495 30.152  38.020  1.00 87.91  ? 153  SER E CA    1 
ATOM   4547 C C     . SER E 1 167 ? -12.259 28.857  37.697  1.00 89.35  ? 153  SER E C     1 
ATOM   4548 O O     . SER E 1 167 ? -13.227 28.535  38.373  1.00 90.10  ? 153  SER E O     1 
ATOM   4549 C CB    . SER E 1 167 ? -12.387 31.378  37.774  1.00 89.77  ? 153  SER E CB    1 
ATOM   4550 O OG    . SER E 1 167 ? -12.815 31.445  36.426  1.00 91.86  ? 153  SER E OG    1 
ATOM   4551 N N     . GLU E 1 168 ? -11.807 28.108  36.688  1.00 89.48  ? 154  GLU E N     1 
ATOM   4552 C CA    . GLU E 1 168 ? -12.486 26.874  36.264  1.00 89.59  ? 154  GLU E CA    1 
ATOM   4553 C C     . GLU E 1 168 ? -12.811 25.959  37.448  1.00 88.43  ? 154  GLU E C     1 
ATOM   4554 O O     . GLU E 1 168 ? -12.431 24.794  37.474  1.00 87.50  ? 154  GLU E O     1 
ATOM   4555 C CB    . GLU E 1 168 ? -11.625 26.132  35.229  1.00 88.10  ? 154  GLU E CB    1 
ATOM   4556 N N     . ALA E 1 171 ? -8.733  22.977  38.412  1.00 79.50  ? 157  ALA E N     1 
ATOM   4557 C CA    . ALA E 1 171 ? -8.579  23.490  39.749  1.00 79.11  ? 157  ALA E CA    1 
ATOM   4558 C C     . ALA E 1 171 ? -7.231  23.052  40.324  1.00 77.75  ? 157  ALA E C     1 
ATOM   4559 O O     . ALA E 1 171 ? -6.210  23.691  40.061  1.00 80.19  ? 157  ALA E O     1 
ATOM   4560 C CB    . ALA E 1 171 ? -9.721  23.003  40.624  1.00 80.79  ? 157  ALA E CB    1 
ATOM   4561 N N     . ASP E 1 172 ? -7.222  21.938  41.054  1.00 76.22  ? 158  ASP E N     1 
ATOM   4562 C CA    . ASP E 1 172 ? -6.147  21.597  42.013  1.00 73.82  ? 158  ASP E CA    1 
ATOM   4563 C C     . ASP E 1 172 ? -5.432  22.811  42.666  1.00 71.25  ? 158  ASP E C     1 
ATOM   4564 O O     . ASP E 1 172 ? -4.195  22.867  42.745  1.00 66.00  ? 158  ASP E O     1 
ATOM   4565 C CB    . ASP E 1 172 ? -5.121  20.622  41.404  1.00 71.95  ? 158  ASP E CB    1 
ATOM   4566 C CG    . ASP E 1 172 ? -4.183  20.012  42.455  1.00 71.51  ? 158  ASP E CG    1 
ATOM   4567 O OD1   . ASP E 1 172 ? -4.555  19.980  43.649  1.00 71.01  ? 158  ASP E OD1   1 
ATOM   4568 O OD2   . ASP E 1 172 ? -3.074  19.561  42.086  1.00 69.77  ? 158  ASP E OD2   1 
ATOM   4569 N N     . LEU E 1 173 ? -6.233  23.764  43.143  1.00 70.50  ? 159  LEU E N     1 
ATOM   4570 C CA    . LEU E 1 173 ? -5.710  24.907  43.861  1.00 69.35  ? 159  LEU E CA    1 
ATOM   4571 C C     . LEU E 1 173 ? -5.428  24.466  45.308  1.00 67.94  ? 159  LEU E C     1 
ATOM   4572 O O     . LEU E 1 173 ? -6.268  23.829  45.924  1.00 69.47  ? 159  LEU E O     1 
ATOM   4573 C CB    . LEU E 1 173 ? -6.697  26.074  43.815  1.00 70.30  ? 159  LEU E CB    1 
ATOM   4574 C CG    . LEU E 1 173 ? -7.179  26.501  42.416  1.00 72.14  ? 159  LEU E CG    1 
ATOM   4575 C CD1   . LEU E 1 173 ? -8.236  27.593  42.481  1.00 74.49  ? 159  LEU E CD1   1 
ATOM   4576 C CD2   . LEU E 1 173 ? -6.039  26.971  41.541  1.00 71.27  ? 159  LEU E CD2   1 
ATOM   4577 N N     . PRO E 1 174 ? -4.234  24.781  45.839  1.00 65.35  ? 160  PRO E N     1 
ATOM   4578 C CA    . PRO E 1 174 ? -3.773  24.344  47.162  1.00 63.59  ? 160  PRO E CA    1 
ATOM   4579 C C     . PRO E 1 174 ? -4.801  24.511  48.267  1.00 64.67  ? 160  PRO E C     1 
ATOM   4580 O O     . PRO E 1 174 ? -5.034  23.599  49.061  1.00 65.82  ? 160  PRO E O     1 
ATOM   4581 C CB    . PRO E 1 174 ? -2.591  25.270  47.432  1.00 62.69  ? 160  PRO E CB    1 
ATOM   4582 C CG    . PRO E 1 174 ? -2.067  25.654  46.093  1.00 62.19  ? 160  PRO E CG    1 
ATOM   4583 C CD    . PRO E 1 174 ? -3.230  25.618  45.146  1.00 64.52  ? 160  PRO E CD    1 
ATOM   4584 N N     . TRP E 1 175 ? -5.435  25.672  48.309  1.00 64.94  ? 161  TRP E N     1 
ATOM   4585 C CA    . TRP E 1 175 ? -6.358  25.997  49.394  1.00 66.08  ? 161  TRP E CA    1 
ATOM   4586 C C     . TRP E 1 175 ? -7.706  25.292  49.262  1.00 69.96  ? 161  TRP E C     1 
ATOM   4587 O O     . TRP E 1 175 ? -8.520  25.326  50.203  1.00 72.12  ? 161  TRP E O     1 
ATOM   4588 C CB    . TRP E 1 175 ? -6.570  27.504  49.478  1.00 65.40  ? 161  TRP E CB    1 
ATOM   4589 C CG    . TRP E 1 175 ? -7.002  28.137  48.188  1.00 64.79  ? 161  TRP E CG    1 
ATOM   4590 C CD1   . TRP E 1 175 ? -8.273  28.403  47.798  1.00 66.47  ? 161  TRP E CD1   1 
ATOM   4591 C CD2   . TRP E 1 175 ? -6.154  28.588  47.124  1.00 62.05  ? 161  TRP E CD2   1 
ATOM   4592 N NE1   . TRP E 1 175 ? -8.273  28.997  46.552  1.00 65.43  ? 161  TRP E NE1   1 
ATOM   4593 C CE2   . TRP E 1 175 ? -6.985  29.129  46.122  1.00 62.41  ? 161  TRP E CE2   1 
ATOM   4594 C CE3   . TRP E 1 175 ? -4.773  28.593  46.927  1.00 60.14  ? 161  TRP E CE3   1 
ATOM   4595 C CZ2   . TRP E 1 175 ? -6.483  29.670  44.941  1.00 62.08  ? 161  TRP E CZ2   1 
ATOM   4596 C CZ3   . TRP E 1 175 ? -4.267  29.134  45.742  1.00 59.62  ? 161  TRP E CZ3   1 
ATOM   4597 C CH2   . TRP E 1 175 ? -5.120  29.661  44.763  1.00 60.53  ? 161  TRP E CH2   1 
ATOM   4598 N N     . LEU E 1 176 ? -7.936  24.652  48.109  1.00 71.76  ? 162  LEU E N     1 
ATOM   4599 C CA    . LEU E 1 176 ? -9.094  23.769  47.900  1.00 74.57  ? 162  LEU E CA    1 
ATOM   4600 C C     . LEU E 1 176 ? -8.707  22.296  47.887  1.00 73.97  ? 162  LEU E C     1 
ATOM   4601 O O     . LEU E 1 176 ? -9.554  21.434  47.709  1.00 77.56  ? 162  LEU E O     1 
ATOM   4602 C CB    . LEU E 1 176 ? -9.755  24.063  46.564  1.00 75.95  ? 162  LEU E CB    1 
ATOM   4603 C CG    . LEU E 1 176 ? -10.158 25.507  46.330  1.00 78.25  ? 162  LEU E CG    1 
ATOM   4604 C CD1   . LEU E 1 176 ? -10.830 25.592  44.974  1.00 80.23  ? 162  LEU E CD1   1 
ATOM   4605 C CD2   . LEU E 1 176 ? -11.083 26.007  47.443  1.00 81.12  ? 162  LEU E CD2   1 
ATOM   4606 N N     . ARG E 1 177 ? -7.417  22.026  48.007  1.00 71.13  ? 163  ARG E N     1 
ATOM   4607 C CA    . ARG E 1 177 ? -6.897  20.688  48.189  1.00 71.07  ? 163  ARG E CA    1 
ATOM   4608 C C     . ARG E 1 177 ? -7.121  20.244  49.656  1.00 71.67  ? 163  ARG E C     1 
ATOM   4609 O O     . ARG E 1 177 ? -8.003  20.747  50.358  1.00 73.10  ? 163  ARG E O     1 
ATOM   4610 C CB    . ARG E 1 177 ? -5.401  20.708  47.819  1.00 70.05  ? 163  ARG E CB    1 
ATOM   4611 C CG    . ARG E 1 177 ? -4.712  19.357  47.843  1.00 70.07  ? 163  ARG E CG    1 
ATOM   4612 C CD    . ARG E 1 177 ? -3.712  19.211  46.718  1.00 69.30  ? 163  ARG E CD    1 
ATOM   4613 N NE    . ARG E 1 177 ? -2.479  19.977  46.932  1.00 66.80  ? 163  ARG E NE    1 
ATOM   4614 C CZ    . ARG E 1 177 ? -2.154  21.116  46.322  1.00 65.44  ? 163  ARG E CZ    1 
ATOM   4615 N NH1   . ARG E 1 177 ? -2.969  21.698  45.442  1.00 67.43  ? 163  ARG E NH1   1 
ATOM   4616 N NH2   . ARG E 1 177 ? -0.989  21.681  46.596  1.00 62.70  ? 163  ARG E NH2   1 
ATOM   4617 O OXT   . ARG E 1 177 ? -6.450  19.375  50.222  1.00 69.79  ? 163  ARG E OXT   1 
ATOM   4618 N N     . TRP F 1 21  ? 11.670  51.758  52.298  1.00 91.42  ? 7    TRP F N     1 
ATOM   4619 C CA    . TRP F 1 21  ? 10.364  51.051  52.100  1.00 91.29  ? 7    TRP F CA    1 
ATOM   4620 C C     . TRP F 1 21  ? 10.192  50.696  50.639  1.00 87.17  ? 7    TRP F C     1 
ATOM   4621 O O     . TRP F 1 21  ? 10.931  51.172  49.777  1.00 89.05  ? 7    TRP F O     1 
ATOM   4622 C CB    . TRP F 1 21  ? 9.176   51.928  52.534  1.00 95.10  ? 7    TRP F CB    1 
ATOM   4623 C CG    . TRP F 1 21  ? 8.457   51.516  53.765  1.00 100.48 ? 7    TRP F CG    1 
ATOM   4624 C CD1   . TRP F 1 21  ? 7.100   51.547  53.979  1.00 105.09 ? 7    TRP F CD1   1 
ATOM   4625 C CD2   . TRP F 1 21  ? 9.039   51.009  54.963  1.00 104.05 ? 7    TRP F CD2   1 
ATOM   4626 N NE1   . TRP F 1 21  ? 6.815   51.100  55.250  1.00 108.76 ? 7    TRP F NE1   1 
ATOM   4627 C CE2   . TRP F 1 21  ? 7.986   50.760  55.875  1.00 107.36 ? 7    TRP F CE2   1 
ATOM   4628 C CE3   . TRP F 1 21  ? 10.346  50.749  55.358  1.00 103.99 ? 7    TRP F CE3   1 
ATOM   4629 C CZ2   . TRP F 1 21  ? 8.213   50.251  57.159  1.00 108.05 ? 7    TRP F CZ2   1 
ATOM   4630 C CZ3   . TRP F 1 21  ? 10.575  50.248  56.625  1.00 106.34 ? 7    TRP F CZ3   1 
ATOM   4631 C CH2   . TRP F 1 21  ? 9.512   50.000  57.512  1.00 108.30 ? 7    TRP F CH2   1 
ATOM   4632 N N     . LEU F 1 22  ? 9.179   49.889  50.360  1.00 83.10  ? 8    LEU F N     1 
ATOM   4633 C CA    . LEU F 1 22  ? 8.822   49.542  48.989  1.00 80.15  ? 8    LEU F CA    1 
ATOM   4634 C C     . LEU F 1 22  ? 7.671   50.399  48.464  1.00 79.27  ? 8    LEU F C     1 
ATOM   4635 O O     . LEU F 1 22  ? 6.641   50.493  49.108  1.00 78.86  ? 8    LEU F O     1 
ATOM   4636 C CB    . LEU F 1 22  ? 8.419   48.072  48.906  1.00 79.92  ? 8    LEU F CB    1 
ATOM   4637 C CG    . LEU F 1 22  ? 9.430   47.101  48.309  1.00 79.78  ? 8    LEU F CG    1 
ATOM   4638 C CD1   . LEU F 1 22  ? 10.779  47.207  49.008  1.00 81.30  ? 8    LEU F CD1   1 
ATOM   4639 C CD2   . LEU F 1 22  ? 8.868   45.693  48.400  1.00 78.77  ? 8    LEU F CD2   1 
ATOM   4640 N N     . THR F 1 23  ? 7.825   50.975  47.272  1.00 78.98  ? 9    THR F N     1 
ATOM   4641 C CA    . THR F 1 23  ? 6.728   51.714  46.645  1.00 80.66  ? 9    THR F CA    1 
ATOM   4642 C C     . THR F 1 23  ? 5.586   50.745  46.408  1.00 80.53  ? 9    THR F C     1 
ATOM   4643 O O     . THR F 1 23  ? 5.787   49.530  46.402  1.00 79.26  ? 9    THR F O     1 
ATOM   4644 C CB    . THR F 1 23  ? 7.109   52.371  45.291  1.00 83.26  ? 9    THR F CB    1 
ATOM   4645 O OG1   . THR F 1 23  ? 7.232   51.377  44.262  1.00 81.02  ? 9    THR F OG1   1 
ATOM   4646 C CG2   . THR F 1 23  ? 8.409   53.170  45.409  1.00 83.92  ? 9    THR F CG2   1 
ATOM   4647 N N     . ALA F 1 24  ? 4.387   51.264  46.206  1.00 82.90  ? 10   ALA F N     1 
ATOM   4648 C CA    . ALA F 1 24  ? 3.254   50.401  45.902  1.00 84.16  ? 10   ALA F CA    1 
ATOM   4649 C C     . ALA F 1 24  ? 3.454   49.677  44.572  1.00 82.41  ? 10   ALA F C     1 
ATOM   4650 O O     . ALA F 1 24  ? 2.978   48.549  44.419  1.00 81.52  ? 10   ALA F O     1 
ATOM   4651 C CB    . ALA F 1 24  ? 1.964   51.194  45.875  1.00 88.66  ? 10   ALA F CB    1 
ATOM   4652 N N     . GLU F 1 25  ? 4.166   50.305  43.630  1.00 83.26  ? 11   GLU F N     1 
ATOM   4653 C CA    . GLU F 1 25  ? 4.420   49.677  42.318  1.00 83.88  ? 11   GLU F CA    1 
ATOM   4654 C C     . GLU F 1 25  ? 5.277   48.429  42.545  1.00 80.28  ? 11   GLU F C     1 
ATOM   4655 O O     . GLU F 1 25  ? 4.889   47.306  42.163  1.00 78.94  ? 11   GLU F O     1 
ATOM   4656 C CB    . GLU F 1 25  ? 5.103   50.642  41.320  1.00 86.02  ? 11   GLU F CB    1 
ATOM   4657 N N     . GLU F 1 26  ? 6.392   48.628  43.248  1.00 78.63  ? 12   GLU F N     1 
ATOM   4658 C CA    . GLU F 1 26  ? 7.304   47.545  43.594  1.00 76.65  ? 12   GLU F CA    1 
ATOM   4659 C C     . GLU F 1 26  ? 6.599   46.415  44.358  1.00 76.64  ? 12   GLU F C     1 
ATOM   4660 O O     . GLU F 1 26  ? 6.805   45.250  44.058  1.00 75.80  ? 12   GLU F O     1 
ATOM   4661 C CB    . GLU F 1 26  ? 8.461   48.085  44.436  1.00 76.28  ? 12   GLU F CB    1 
ATOM   4662 C CG    . GLU F 1 26  ? 9.403   48.996  43.660  1.00 78.98  ? 12   GLU F CG    1 
ATOM   4663 C CD    . GLU F 1 26  ? 10.200  49.961  44.531  1.00 79.60  ? 12   GLU F CD    1 
ATOM   4664 O OE1   . GLU F 1 26  ? 10.325  49.671  45.728  1.00 77.02  ? 12   GLU F OE1   1 
ATOM   4665 O OE2   . GLU F 1 26  ? 10.650  51.038  44.035  1.00 81.97  ? 12   GLU F OE2   1 
ATOM   4666 N N     . GLN F 1 27  ? 5.778   46.761  45.348  1.00 78.38  ? 13   GLN F N     1 
ATOM   4667 C CA    . GLN F 1 27  ? 4.993   45.767  46.078  1.00 78.75  ? 13   GLN F CA    1 
ATOM   4668 C C     . GLN F 1 27  ? 4.207   44.878  45.133  1.00 79.05  ? 13   GLN F C     1 
ATOM   4669 O O     . GLN F 1 27  ? 4.187   43.660  45.308  1.00 78.59  ? 13   GLN F O     1 
ATOM   4670 C CB    . GLN F 1 27  ? 4.032   46.441  47.065  1.00 82.21  ? 13   GLN F CB    1 
ATOM   4671 C CG    . GLN F 1 27  ? 4.674   46.790  48.398  1.00 82.15  ? 13   GLN F CG    1 
ATOM   4672 C CD    . GLN F 1 27  ? 3.748   47.591  49.291  1.00 85.49  ? 13   GLN F CD    1 
ATOM   4673 O OE1   . GLN F 1 27  ? 2.741   47.072  49.779  1.00 87.41  ? 13   GLN F OE1   1 
ATOM   4674 N NE2   . GLN F 1 27  ? 4.073   48.872  49.499  1.00 85.64  ? 13   GLN F NE2   1 
ATOM   4675 N N     . LEU F 1 28  ? 3.563   45.482  44.133  1.00 80.73  ? 14   LEU F N     1 
ATOM   4676 C CA    . LEU F 1 28  ? 2.761   44.708  43.190  1.00 81.33  ? 14   LEU F CA    1 
ATOM   4677 C C     . LEU F 1 28  ? 3.623   43.728  42.426  1.00 78.43  ? 14   LEU F C     1 
ATOM   4678 O O     . LEU F 1 28  ? 3.218   42.601  42.211  1.00 76.77  ? 14   LEU F O     1 
ATOM   4679 C CB    . LEU F 1 28  ? 1.998   45.600  42.209  1.00 85.00  ? 14   LEU F CB    1 
ATOM   4680 C CG    . LEU F 1 28  ? 0.496   45.717  42.459  1.00 89.06  ? 14   LEU F CG    1 
ATOM   4681 C CD1   . LEU F 1 28  ? 0.234   46.369  43.808  1.00 89.39  ? 14   LEU F CD1   1 
ATOM   4682 C CD2   . LEU F 1 28  ? -0.209  46.453  41.323  1.00 93.13  ? 14   LEU F CD2   1 
ATOM   4683 N N     . VAL F 1 29  ? 4.813   44.165  42.024  1.00 78.43  ? 15   VAL F N     1 
ATOM   4684 C CA    . VAL F 1 29  ? 5.739   43.304  41.299  1.00 76.86  ? 15   VAL F CA    1 
ATOM   4685 C C     . VAL F 1 29  ? 6.155   42.139  42.187  1.00 72.61  ? 15   VAL F C     1 
ATOM   4686 O O     . VAL F 1 29  ? 6.007   40.976  41.814  1.00 72.47  ? 15   VAL F O     1 
ATOM   4687 C CB    . VAL F 1 29  ? 6.993   44.084  40.842  1.00 80.42  ? 15   VAL F CB    1 
ATOM   4688 C CG1   . VAL F 1 29  ? 8.076   43.131  40.343  1.00 80.28  ? 15   VAL F CG1   1 
ATOM   4689 C CG2   . VAL F 1 29  ? 6.631   45.088  39.753  1.00 83.84  ? 15   VAL F CG2   1 
ATOM   4690 N N     . TRP F 1 30  ? 6.666   42.471  43.368  1.00 69.49  ? 16   TRP F N     1 
ATOM   4691 C CA    . TRP F 1 30  ? 7.143   41.487  44.331  1.00 65.99  ? 16   TRP F CA    1 
ATOM   4692 C C     . TRP F 1 30  ? 6.052   40.492  44.680  1.00 65.72  ? 16   TRP F C     1 
ATOM   4693 O O     . TRP F 1 30  ? 6.282   39.293  44.695  1.00 64.06  ? 16   TRP F O     1 
ATOM   4694 C CB    . TRP F 1 30  ? 7.651   42.200  45.584  1.00 65.90  ? 16   TRP F CB    1 
ATOM   4695 C CG    . TRP F 1 30  ? 8.202   41.313  46.629  1.00 65.40  ? 16   TRP F CG    1 
ATOM   4696 C CD1   . TRP F 1 30  ? 7.767   41.195  47.925  1.00 65.18  ? 16   TRP F CD1   1 
ATOM   4697 C CD2   . TRP F 1 30  ? 9.303   40.415  46.487  1.00 64.44  ? 16   TRP F CD2   1 
ATOM   4698 N NE1   . TRP F 1 30  ? 8.529   40.274  48.585  1.00 66.06  ? 16   TRP F NE1   1 
ATOM   4699 C CE2   . TRP F 1 30  ? 9.477   39.776  47.729  1.00 65.52  ? 16   TRP F CE2   1 
ATOM   4700 C CE3   . TRP F 1 30  ? 10.157  40.087  45.432  1.00 63.72  ? 16   TRP F CE3   1 
ATOM   4701 C CZ2   . TRP F 1 30  ? 10.472  38.823  47.946  1.00 66.31  ? 16   TRP F CZ2   1 
ATOM   4702 C CZ3   . TRP F 1 30  ? 11.143  39.139  45.650  1.00 65.06  ? 16   TRP F CZ3   1 
ATOM   4703 C CH2   . TRP F 1 30  ? 11.292  38.521  46.901  1.00 66.36  ? 16   TRP F CH2   1 
ATOM   4704 N N     . ARG F 1 31  ? 4.855   40.992  44.951  1.00 67.81  ? 17   ARG F N     1 
ATOM   4705 C CA    . ARG F 1 31  ? 3.731   40.131  45.312  1.00 69.12  ? 17   ARG F CA    1 
ATOM   4706 C C     . ARG F 1 31  ? 3.510   39.101  44.225  1.00 67.00  ? 17   ARG F C     1 
ATOM   4707 O O     . ARG F 1 31  ? 3.493   37.900  44.488  1.00 66.25  ? 17   ARG F O     1 
ATOM   4708 C CB    . ARG F 1 31  ? 2.438   40.972  45.450  1.00 72.82  ? 17   ARG F CB    1 
ATOM   4709 C CG    . ARG F 1 31  ? 1.862   41.257  46.850  1.00 76.71  ? 17   ARG F CG    1 
ATOM   4710 C CD    . ARG F 1 31  ? 2.867   41.041  48.012  1.00 76.90  ? 17   ARG F CD    1 
ATOM   4711 N NE    . ARG F 1 31  ? 2.882   42.103  49.031  1.00 79.42  ? 17   ARG F NE    1 
ATOM   4712 C CZ    . ARG F 1 31  ? 1.893   42.379  49.889  1.00 83.22  ? 17   ARG F CZ    1 
ATOM   4713 N NH1   . ARG F 1 31  ? 0.741   41.712  49.849  1.00 85.90  ? 17   ARG F NH1   1 
ATOM   4714 N NH2   . ARG F 1 31  ? 2.054   43.357  50.783  1.00 83.38  ? 17   ARG F NH2   1 
ATOM   4715 N N     . SER F 1 32  ? 3.361   39.576  42.994  1.00 66.67  ? 18   SER F N     1 
ATOM   4716 C CA    . SER F 1 32  ? 3.053   38.675  41.887  1.00 65.92  ? 18   SER F CA    1 
ATOM   4717 C C     . SER F 1 32  ? 4.218   37.698  41.609  1.00 63.36  ? 18   SER F C     1 
ATOM   4718 O O     . SER F 1 32  ? 3.986   36.572  41.202  1.00 62.78  ? 18   SER F O     1 
ATOM   4719 C CB    . SER F 1 32  ? 2.581   39.458  40.646  1.00 67.57  ? 18   SER F CB    1 
ATOM   4720 O OG    . SER F 1 32  ? 1.481   40.280  41.022  1.00 70.18  ? 18   SER F OG    1 
ATOM   4721 N N     . TYR F 1 33  ? 5.456   38.096  41.903  1.00 62.93  ? 19   TYR F N     1 
ATOM   4722 C CA    . TYR F 1 33  ? 6.563   37.140  41.900  1.00 62.17  ? 19   TYR F CA    1 
ATOM   4723 C C     . TYR F 1 33  ? 6.333   36.036  42.919  1.00 61.75  ? 19   TYR F C     1 
ATOM   4724 O O     . TYR F 1 33  ? 6.330   34.866  42.567  1.00 61.81  ? 19   TYR F O     1 
ATOM   4725 C CB    . TYR F 1 33  ? 7.930   37.808  42.168  1.00 63.10  ? 19   TYR F CB    1 
ATOM   4726 C CG    . TYR F 1 33  ? 9.037   36.780  42.333  1.00 63.80  ? 19   TYR F CG    1 
ATOM   4727 C CD1   . TYR F 1 33  ? 9.615   36.175  41.230  1.00 63.98  ? 19   TYR F CD1   1 
ATOM   4728 C CD2   . TYR F 1 33  ? 9.453   36.371  43.597  1.00 65.03  ? 19   TYR F CD2   1 
ATOM   4729 C CE1   . TYR F 1 33  ? 10.597  35.217  41.376  1.00 65.93  ? 19   TYR F CE1   1 
ATOM   4730 C CE2   . TYR F 1 33  ? 10.435  35.407  43.757  1.00 66.77  ? 19   TYR F CE2   1 
ATOM   4731 C CZ    . TYR F 1 33  ? 11.002  34.830  42.639  1.00 67.60  ? 19   TYR F CZ    1 
ATOM   4732 O OH    . TYR F 1 33  ? 11.983  33.871  42.782  1.00 70.74  ? 19   TYR F OH    1 
ATOM   4733 N N     . ILE F 1 34  ? 6.146   36.416  44.174  1.00 63.92  ? 20   ILE F N     1 
ATOM   4734 C CA    . ILE F 1 34  ? 5.956   35.439  45.248  1.00 67.04  ? 20   ILE F CA    1 
ATOM   4735 C C     . ILE F 1 34  ? 4.868   34.430  44.901  1.00 67.55  ? 20   ILE F C     1 
ATOM   4736 O O     . ILE F 1 34  ? 5.082   33.231  45.043  1.00 68.80  ? 20   ILE F O     1 
ATOM   4737 C CB    . ILE F 1 34  ? 5.580   36.095  46.594  1.00 70.01  ? 20   ILE F CB    1 
ATOM   4738 C CG1   . ILE F 1 34  ? 6.651   37.092  47.060  1.00 72.10  ? 20   ILE F CG1   1 
ATOM   4739 C CG2   . ILE F 1 34  ? 5.406   35.044  47.677  1.00 72.84  ? 20   ILE F CG2   1 
ATOM   4740 C CD1   . ILE F 1 34  ? 8.021   36.480  47.261  1.00 72.90  ? 20   ILE F CD1   1 
ATOM   4741 N N     . GLU F 1 35  ? 3.714   34.914  44.445  1.00 67.28  ? 21   GLU F N     1 
ATOM   4742 C CA    . GLU F 1 35  ? 2.589   34.035  44.128  1.00 68.85  ? 21   GLU F CA    1 
ATOM   4743 C C     . GLU F 1 35  ? 2.984   33.045  43.043  1.00 67.24  ? 21   GLU F C     1 
ATOM   4744 O O     . GLU F 1 35  ? 2.848   31.817  43.195  1.00 67.45  ? 21   GLU F O     1 
ATOM   4745 C CB    . GLU F 1 35  ? 1.351   34.824  43.664  1.00 70.62  ? 21   GLU F CB    1 
ATOM   4746 C CG    . GLU F 1 35  ? 0.857   35.916  44.609  1.00 73.60  ? 21   GLU F CG    1 
ATOM   4747 C CD    . GLU F 1 35  ? -0.458  36.527  44.136  1.00 76.86  ? 21   GLU F CD    1 
ATOM   4748 O OE1   . GLU F 1 35  ? -0.654  36.604  42.894  1.00 75.53  ? 21   GLU F OE1   1 
ATOM   4749 O OE2   . GLU F 1 35  ? -1.294  36.927  44.999  1.00 81.89  ? 21   GLU F OE2   1 
ATOM   4750 N N     . ALA F 1 36  ? 3.478   33.589  41.946  1.00 54.18  ? 22   ALA F N     1 
ATOM   4751 C CA    . ALA F 1 36  ? 3.850   32.779  40.798  1.00 55.29  ? 22   ALA F CA    1 
ATOM   4752 C C     . ALA F 1 36  ? 4.790   31.661  41.226  1.00 56.85  ? 22   ALA F C     1 
ATOM   4753 O O     . ALA F 1 36  ? 4.513   30.473  40.982  1.00 59.89  ? 22   ALA F O     1 
ATOM   4754 C CB    . ALA F 1 36  ? 4.513   33.646  39.742  1.00 55.82  ? 22   ALA F CB    1 
ATOM   4755 N N     . ALA F 1 37  ? 5.883   32.040  41.884  1.00 56.08  ? 23   ALA F N     1 
ATOM   4756 C CA    . ALA F 1 37  ? 6.886   31.075  42.310  1.00 55.02  ? 23   ALA F CA    1 
ATOM   4757 C C     . ALA F 1 37  ? 6.303   30.019  43.237  1.00 53.92  ? 23   ALA F C     1 
ATOM   4758 O O     . ALA F 1 37  ? 6.565   28.819  43.057  1.00 55.53  ? 23   ALA F O     1 
ATOM   4759 C CB    . ALA F 1 37  ? 8.023   31.779  43.004  1.00 57.40  ? 23   ALA F CB    1 
ATOM   4760 N N     . THR F 1 38  ? 5.481   30.447  44.193  1.00 51.47  ? 24   THR F N     1 
ATOM   4761 C CA    . THR F 1 38  ? 4.877   29.505  45.126  1.00 50.08  ? 24   THR F CA    1 
ATOM   4762 C C     . THR F 1 38  ? 3.924   28.552  44.409  1.00 48.71  ? 24   THR F C     1 
ATOM   4763 O O     . THR F 1 38  ? 3.799   27.395  44.805  1.00 48.55  ? 24   THR F O     1 
ATOM   4764 C CB    . THR F 1 38  ? 4.142   30.227  46.280  1.00 51.06  ? 24   THR F CB    1 
ATOM   4765 O OG1   . THR F 1 38  ? 5.015   31.198  46.870  1.00 51.68  ? 24   THR F OG1   1 
ATOM   4766 C CG2   . THR F 1 38  ? 3.696   29.236  47.357  1.00 50.56  ? 24   THR F CG2   1 
ATOM   4767 N N     . LEU F 1 39  ? 3.244   29.043  43.375  1.00 49.64  ? 25   LEU F N     1 
ATOM   4768 C CA    . LEU F 1 39  ? 2.278   28.221  42.624  1.00 51.22  ? 25   LEU F CA    1 
ATOM   4769 C C     . LEU F 1 39  ? 2.973   27.277  41.669  1.00 51.56  ? 25   LEU F C     1 
ATOM   4770 O O     . LEU F 1 39  ? 2.528   26.141  41.498  1.00 50.85  ? 25   LEU F O     1 
ATOM   4771 C CB    . LEU F 1 39  ? 1.289   29.087  41.825  1.00 51.84  ? 25   LEU F CB    1 
ATOM   4772 C CG    . LEU F 1 39  ? 0.207   29.854  42.596  1.00 53.62  ? 25   LEU F CG    1 
ATOM   4773 C CD1   . LEU F 1 39  ? -0.402  30.922  41.695  1.00 53.88  ? 25   LEU F CD1   1 
ATOM   4774 C CD2   . LEU F 1 39  ? -0.877  28.941  43.150  1.00 53.22  ? 25   LEU F CD2   1 
ATOM   4775 N N     . LEU F 1 40  ? 4.028   27.755  41.014  1.00 51.65  ? 26   LEU F N     1 
ATOM   4776 C CA    . LEU F 1 40  ? 4.811   26.885  40.160  1.00 51.54  ? 26   LEU F CA    1 
ATOM   4777 C C     . LEU F 1 40  ? 5.413   25.722  40.947  1.00 52.65  ? 26   LEU F C     1 
ATOM   4778 O O     . LEU F 1 40  ? 5.258   24.564  40.557  1.00 54.64  ? 26   LEU F O     1 
ATOM   4779 C CB    . LEU F 1 40  ? 5.928   27.655  39.476  1.00 52.99  ? 26   LEU F CB    1 
ATOM   4780 C CG    . LEU F 1 40  ? 5.749   27.933  37.990  1.00 55.14  ? 26   LEU F CG    1 
ATOM   4781 C CD1   . LEU F 1 40  ? 6.964   28.715  37.477  1.00 56.45  ? 26   LEU F CD1   1 
ATOM   4782 C CD2   . LEU F 1 40  ? 5.566   26.655  37.185  1.00 56.26  ? 26   LEU F CD2   1 
ATOM   4783 N N     . GLU F 1 41  ? 6.134   26.017  42.035  1.00 52.59  ? 27   GLU F N     1 
ATOM   4784 C CA    . GLU F 1 41  ? 6.752   24.953  42.845  1.00 52.40  ? 27   GLU F CA    1 
ATOM   4785 C C     . GLU F 1 41  ? 5.694   23.932  43.245  1.00 53.34  ? 27   GLU F C     1 
ATOM   4786 O O     . GLU F 1 41  ? 5.937   22.728  43.225  1.00 55.07  ? 27   GLU F O     1 
ATOM   4787 C CB    . GLU F 1 41  ? 7.453   25.519  44.090  1.00 51.57  ? 27   GLU F CB    1 
ATOM   4788 N N     . ASP F 1 42  ? 4.508   24.420  43.579  1.00 52.92  ? 28   ASP F N     1 
ATOM   4789 C CA    . ASP F 1 42  ? 3.423   23.542  43.951  1.00 53.22  ? 28   ASP F CA    1 
ATOM   4790 C C     . ASP F 1 42  ? 2.938   22.686  42.771  1.00 52.04  ? 28   ASP F C     1 
ATOM   4791 O O     . ASP F 1 42  ? 2.745   21.474  42.900  1.00 52.23  ? 28   ASP F O     1 
ATOM   4792 C CB    . ASP F 1 42  ? 2.270   24.365  44.489  1.00 54.77  ? 28   ASP F CB    1 
ATOM   4793 C CG    . ASP F 1 42  ? 1.112   23.502  44.925  1.00 58.02  ? 28   ASP F CG    1 
ATOM   4794 O OD1   . ASP F 1 42  ? 0.229   23.216  44.078  1.00 56.47  ? 28   ASP F OD1   1 
ATOM   4795 O OD2   . ASP F 1 42  ? 1.081   23.121  46.123  1.00 61.44  ? 28   ASP F OD2   1 
ATOM   4796 N N     . HIS F 1 43  ? 2.738   23.328  41.630  1.00 50.82  ? 29   HIS F N     1 
ATOM   4797 C CA    . HIS F 1 43  ? 2.223   22.653  40.457  1.00 52.06  ? 29   HIS F CA    1 
ATOM   4798 C C     . HIS F 1 43  ? 3.211   21.585  39.983  1.00 52.48  ? 29   HIS F C     1 
ATOM   4799 O O     . HIS F 1 43  ? 2.824   20.460  39.646  1.00 53.28  ? 29   HIS F O     1 
ATOM   4800 C CB    . HIS F 1 43  ? 1.929   23.683  39.351  1.00 53.44  ? 29   HIS F CB    1 
ATOM   4801 C CG    . HIS F 1 43  ? 1.432   23.082  38.077  1.00 54.86  ? 29   HIS F CG    1 
ATOM   4802 N ND1   . HIS F 1 43  ? 0.374   22.207  38.037  1.00 57.06  ? 29   HIS F ND1   1 
ATOM   4803 C CD2   . HIS F 1 43  ? 1.867   23.204  36.801  1.00 57.34  ? 29   HIS F CD2   1 
ATOM   4804 C CE1   . HIS F 1 43  ? 0.163   21.829  36.786  1.00 59.20  ? 29   HIS F CE1   1 
ATOM   4805 N NE2   . HIS F 1 43  ? 1.061   22.414  36.017  1.00 58.00  ? 29   HIS F NE2   1 
ATOM   4806 N N     . LEU F 1 44  ? 4.491   21.927  39.999  1.00 52.75  ? 30   LEU F N     1 
ATOM   4807 C CA    . LEU F 1 44  ? 5.516   21.036  39.474  1.00 53.65  ? 30   LEU F CA    1 
ATOM   4808 C C     . LEU F 1 44  ? 5.824   19.901  40.435  1.00 54.02  ? 30   LEU F C     1 
ATOM   4809 O O     . LEU F 1 44  ? 5.939   18.749  40.009  1.00 57.00  ? 30   LEU F O     1 
ATOM   4810 C CB    . LEU F 1 44  ? 6.779   21.828  39.106  1.00 52.23  ? 30   LEU F CB    1 
ATOM   4811 C CG    . LEU F 1 44  ? 6.537   22.896  38.025  1.00 53.03  ? 30   LEU F CG    1 
ATOM   4812 C CD1   . LEU F 1 44  ? 7.848   23.500  37.545  1.00 52.17  ? 30   LEU F CD1   1 
ATOM   4813 C CD2   . LEU F 1 44  ? 5.759   22.325  36.839  1.00 54.17  ? 30   LEU F CD2   1 
ATOM   4814 N N     . ASP F 1 45  ? 5.992   20.219  41.713  1.00 54.07  ? 31   ASP F N     1 
ATOM   4815 C CA    . ASP F 1 45  ? 6.156   19.194  42.750  1.00 55.15  ? 31   ASP F CA    1 
ATOM   4816 C C     . ASP F 1 45  ? 5.053   18.163  42.634  1.00 56.33  ? 31   ASP F C     1 
ATOM   4817 O O     . ASP F 1 45  ? 5.326   16.981  42.727  1.00 58.15  ? 31   ASP F O     1 
ATOM   4818 C CB    . ASP F 1 45  ? 6.078   19.790  44.156  1.00 57.69  ? 31   ASP F CB    1 
ATOM   4819 C CG    . ASP F 1 45  ? 7.419   20.273  44.691  1.00 59.16  ? 31   ASP F CG    1 
ATOM   4820 O OD1   . ASP F 1 45  ? 8.474   20.074  44.040  1.00 61.26  ? 31   ASP F OD1   1 
ATOM   4821 O OD2   . ASP F 1 45  ? 7.400   20.868  45.793  1.00 61.21  ? 31   ASP F OD2   1 
ATOM   4822 N N     . ARG F 1 46  ? 3.816   18.605  42.435  1.00 54.84  ? 32   ARG F N     1 
ATOM   4823 C CA    . ARG F 1 46  ? 2.701   17.668  42.353  1.00 57.33  ? 32   ARG F CA    1 
ATOM   4824 C C     . ARG F 1 46  ? 2.703   16.830  41.093  1.00 56.73  ? 32   ARG F C     1 
ATOM   4825 O O     . ARG F 1 46  ? 2.498   15.620  41.134  1.00 59.57  ? 32   ARG F O     1 
ATOM   4826 C CB    . ARG F 1 46  ? 1.386   18.406  42.422  1.00 59.20  ? 32   ARG F CB    1 
ATOM   4827 C CG    . ARG F 1 46  ? 1.054   18.936  43.804  1.00 61.10  ? 32   ARG F CG    1 
ATOM   4828 C CD    . ARG F 1 46  ? -0.454  19.089  43.886  1.00 62.48  ? 32   ARG F CD    1 
ATOM   4829 N NE    . ARG F 1 46  ? -1.318  17.914  44.043  1.00 63.90  ? 32   ARG F NE    1 
ATOM   4830 C CZ    . ARG F 1 46  ? -1.570  17.235  45.168  1.00 64.95  ? 32   ARG F CZ    1 
ATOM   4831 N NH1   . ARG F 1 46  ? -0.989  17.530  46.326  1.00 65.57  ? 32   ARG F NH1   1 
ATOM   4832 N NH2   . ARG F 1 46  ? -2.411  16.211  45.117  1.00 65.27  ? 32   ARG F NH2   1 
ATOM   4833 N N     . GLN F 1 47  ? 2.927   17.483  39.970  1.00 54.95  ? 33   GLN F N     1 
ATOM   4834 C CA    . GLN F 1 47  ? 3.083   16.790  38.717  1.00 54.69  ? 33   GLN F CA    1 
ATOM   4835 C C     . GLN F 1 47  ? 4.166   15.703  38.826  1.00 54.14  ? 33   GLN F C     1 
ATOM   4836 O O     . GLN F 1 47  ? 3.982   14.566  38.380  1.00 54.87  ? 33   GLN F O     1 
ATOM   4837 C CB    . GLN F 1 47  ? 3.418   17.808  37.630  1.00 53.55  ? 33   GLN F CB    1 
ATOM   4838 C CG    . GLN F 1 47  ? 3.500   17.231  36.229  1.00 55.19  ? 33   GLN F CG    1 
ATOM   4839 C CD    . GLN F 1 47  ? 4.916   16.866  35.839  1.00 55.89  ? 33   GLN F CD    1 
ATOM   4840 O OE1   . GLN F 1 47  ? 5.847   17.655  36.045  1.00 53.89  ? 33   GLN F OE1   1 
ATOM   4841 N NE2   . GLN F 1 47  ? 5.093   15.665  35.273  1.00 57.40  ? 33   GLN F NE2   1 
ATOM   4842 N N     . LEU F 1 48  ? 5.293   16.040  39.427  1.00 54.22  ? 34   LEU F N     1 
ATOM   4843 C CA    . LEU F 1 48  ? 6.399   15.082  39.519  1.00 57.29  ? 34   LEU F CA    1 
ATOM   4844 C C     . LEU F 1 48  ? 6.214   14.038  40.607  1.00 58.34  ? 34   LEU F C     1 
ATOM   4845 O O     . LEU F 1 48  ? 6.710   12.930  40.478  1.00 59.61  ? 34   LEU F O     1 
ATOM   4846 C CB    . LEU F 1 48  ? 7.732   15.814  39.715  1.00 56.81  ? 34   LEU F CB    1 
ATOM   4847 C CG    . LEU F 1 48  ? 8.213   16.467  38.419  1.00 56.18  ? 34   LEU F CG    1 
ATOM   4848 C CD1   . LEU F 1 48  ? 9.203   17.576  38.692  1.00 54.87  ? 34   LEU F CD1   1 
ATOM   4849 C CD2   . LEU F 1 48  ? 8.810   15.411  37.493  1.00 57.53  ? 34   LEU F CD2   1 
ATOM   4850 N N     . GLN F 1 49  ? 5.499   14.384  41.673  1.00 59.66  ? 35   GLN F N     1 
ATOM   4851 C CA    . GLN F 1 49  ? 5.235   13.421  42.743  1.00 60.85  ? 35   GLN F CA    1 
ATOM   4852 C C     . GLN F 1 49  ? 4.291   12.313  42.276  1.00 62.60  ? 35   GLN F C     1 
ATOM   4853 O O     . GLN F 1 49  ? 4.483   11.158  42.653  1.00 66.09  ? 35   GLN F O     1 
ATOM   4854 C CB    . GLN F 1 49  ? 4.686   14.103  44.003  1.00 61.14  ? 35   GLN F CB    1 
ATOM   4855 C CG    . GLN F 1 49  ? 5.096   13.421  45.296  1.00 62.64  ? 35   GLN F CG    1 
ATOM   4856 C CD    . GLN F 1 49  ? 6.487   13.859  45.755  1.00 62.59  ? 35   GLN F CD    1 
ATOM   4857 O OE1   . GLN F 1 49  ? 7.337   13.032  46.030  1.00 64.05  ? 35   GLN F OE1   1 
ATOM   4858 N NE2   . GLN F 1 49  ? 6.710   15.178  45.854  1.00 61.13  ? 35   GLN F NE2   1 
ATOM   4859 N N     . ARG F 1 50  ? 3.307   12.636  41.439  1.00 63.35  ? 36   ARG F N     1 
ATOM   4860 C CA    . ARG F 1 50  ? 2.402   11.590  40.929  1.00 68.11  ? 36   ARG F CA    1 
ATOM   4861 C C     . ARG F 1 50  ? 2.988   10.830  39.739  1.00 69.56  ? 36   ARG F C     1 
ATOM   4862 O O     . ARG F 1 50  ? 3.026   9.606   39.758  1.00 73.99  ? 36   ARG F O     1 
ATOM   4863 C CB    . ARG F 1 50  ? 0.962   12.081  40.643  1.00 69.46  ? 36   ARG F CB    1 
ATOM   4864 C CG    . ARG F 1 50  ? 0.776   13.404  39.915  1.00 68.05  ? 36   ARG F CG    1 
ATOM   4865 C CD    . ARG F 1 50  ? -0.658  13.588  39.437  1.00 69.78  ? 36   ARG F CD    1 
ATOM   4866 N NE    . ARG F 1 50  ? -0.905  14.907  38.844  1.00 69.00  ? 36   ARG F NE    1 
ATOM   4867 C CZ    . ARG F 1 50  ? -0.649  15.259  37.578  1.00 71.24  ? 36   ARG F CZ    1 
ATOM   4868 N NH1   . ARG F 1 50  ? -0.121  14.403  36.707  1.00 72.91  ? 36   ARG F NH1   1 
ATOM   4869 N NH2   . ARG F 1 50  ? -0.907  16.504  37.172  1.00 72.10  ? 36   ARG F NH2   1 
ATOM   4870 N N     . ASP F 1 51  ? 3.496   11.549  38.743  1.00 68.83  ? 37   ASP F N     1 
ATOM   4871 C CA    . ASP F 1 51  ? 3.966   10.932  37.493  1.00 70.09  ? 37   ASP F CA    1 
ATOM   4872 C C     . ASP F 1 51  ? 5.353   10.281  37.566  1.00 70.25  ? 37   ASP F C     1 
ATOM   4873 O O     . ASP F 1 51  ? 5.727   9.512   36.681  1.00 74.29  ? 37   ASP F O     1 
ATOM   4874 C CB    . ASP F 1 51  ? 3.964   11.971  36.357  1.00 69.69  ? 37   ASP F CB    1 
ATOM   4875 C CG    . ASP F 1 51  ? 2.582   12.596  36.121  1.00 71.10  ? 37   ASP F CG    1 
ATOM   4876 O OD1   . ASP F 1 51  ? 1.587   12.117  36.703  1.00 71.55  ? 37   ASP F OD1   1 
ATOM   4877 O OD2   . ASP F 1 51  ? 2.488   13.576  35.353  1.00 71.52  ? 37   ASP F OD2   1 
ATOM   4878 N N     . ALA F 1 52  ? 6.124   10.606  38.592  1.00 67.61  ? 38   ALA F N     1 
ATOM   4879 C CA    . ALA F 1 52  ? 7.510   10.129  38.693  1.00 66.71  ? 38   ALA F CA    1 
ATOM   4880 C C     . ALA F 1 52  ? 7.958   9.754   40.114  1.00 66.58  ? 38   ALA F C     1 
ATOM   4881 O O     . ALA F 1 52  ? 9.086   9.286   40.289  1.00 67.53  ? 38   ALA F O     1 
ATOM   4882 C CB    . ALA F 1 52  ? 8.455   11.176  38.114  1.00 64.88  ? 38   ALA F CB    1 
ATOM   4883 N N     . GLY F 1 53  ? 7.115   9.996   41.122  1.00 64.63  ? 39   GLY F N     1 
ATOM   4884 C CA    . GLY F 1 53  ? 7.403   9.569   42.478  1.00 63.98  ? 39   GLY F CA    1 
ATOM   4885 C C     . GLY F 1 53  ? 8.480   10.334  43.217  1.00 62.27  ? 39   GLY F C     1 
ATOM   4886 O O     . GLY F 1 53  ? 9.098   9.789   44.127  1.00 64.06  ? 39   GLY F O     1 
ATOM   4887 N N     . MET F 1 54  ? 8.738   11.578  42.830  1.00 60.84  ? 40   MET F N     1 
ATOM   4888 C CA    . MET F 1 54  ? 9.736   12.397  43.522  1.00 59.50  ? 40   MET F CA    1 
ATOM   4889 C C     . MET F 1 54  ? 9.469   13.881  43.347  1.00 56.94  ? 40   MET F C     1 
ATOM   4890 O O     . MET F 1 54  ? 8.843   14.280  42.373  1.00 57.51  ? 40   MET F O     1 
ATOM   4891 C CB    . MET F 1 54  ? 11.136  12.068  43.018  1.00 60.64  ? 40   MET F CB    1 
ATOM   4892 C CG    . MET F 1 54  ? 11.486  12.667  41.671  1.00 61.16  ? 40   MET F CG    1 
ATOM   4893 S SD    . MET F 1 54  ? 13.064  11.967  41.139  1.00 64.50  ? 40   MET F SD    1 
ATOM   4894 C CE    . MET F 1 54  ? 12.751  11.772  39.397  1.00 64.31  ? 40   MET F CE    1 
ATOM   4895 N N     . PRO F 1 55  ? 9.963   14.706  44.283  1.00 55.33  ? 41   PRO F N     1 
ATOM   4896 C CA    . PRO F 1 55  ? 9.735   16.153  44.216  1.00 54.30  ? 41   PRO F CA    1 
ATOM   4897 C C     . PRO F 1 55  ? 10.580  16.837  43.157  1.00 52.52  ? 41   PRO F C     1 
ATOM   4898 O O     . PRO F 1 55  ? 11.503  16.232  42.623  1.00 55.41  ? 41   PRO F O     1 
ATOM   4899 C CB    . PRO F 1 55  ? 10.146  16.619  45.615  1.00 54.86  ? 41   PRO F CB    1 
ATOM   4900 C CG    . PRO F 1 55  ? 11.215  15.656  46.006  1.00 55.05  ? 41   PRO F CG    1 
ATOM   4901 C CD    . PRO F 1 55  ? 10.793  14.336  45.446  1.00 55.04  ? 41   PRO F CD    1 
ATOM   4902 N N     . HIS F 1 56  ? 10.316  18.105  42.898  1.00 51.85  ? 42   HIS F N     1 
ATOM   4903 C CA    . HIS F 1 56  ? 11.004  18.811  41.822  1.00 52.49  ? 42   HIS F CA    1 
ATOM   4904 C C     . HIS F 1 56  ? 12.534  18.896  42.015  1.00 52.22  ? 42   HIS F C     1 
ATOM   4905 O O     . HIS F 1 56  ? 13.280  18.759  41.058  1.00 52.31  ? 42   HIS F O     1 
ATOM   4906 C CB    . HIS F 1 56  ? 10.427  20.224  41.623  1.00 52.82  ? 42   HIS F CB    1 
ATOM   4907 C CG    . HIS F 1 56  ? 10.942  20.922  40.398  1.00 56.30  ? 42   HIS F CG    1 
ATOM   4908 N ND1   . HIS F 1 56  ? 11.164  22.282  40.350  1.00 56.26  ? 42   HIS F ND1   1 
ATOM   4909 C CD2   . HIS F 1 56  ? 11.299  20.442  39.178  1.00 58.87  ? 42   HIS F CD2   1 
ATOM   4910 C CE1   . HIS F 1 56  ? 11.631  22.613  39.159  1.00 57.69  ? 42   HIS F CE1   1 
ATOM   4911 N NE2   . HIS F 1 56  ? 11.730  21.513  38.429  1.00 60.25  ? 42   HIS F NE2   1 
ATOM   4912 N N     . VAL F 1 57  ? 13.000  19.120  43.233  1.00 51.88  ? 43   VAL F N     1 
ATOM   4913 C CA    . VAL F 1 57  ? 14.438  19.335  43.448  1.00 53.15  ? 43   VAL F CA    1 
ATOM   4914 C C     . VAL F 1 57  ? 15.221  18.074  43.105  1.00 53.60  ? 43   VAL F C     1 
ATOM   4915 O O     . VAL F 1 57  ? 16.269  18.149  42.466  1.00 56.33  ? 43   VAL F O     1 
ATOM   4916 C CB    . VAL F 1 57  ? 14.769  19.746  44.900  1.00 54.24  ? 43   VAL F CB    1 
ATOM   4917 C CG1   . VAL F 1 57  ? 16.221  20.196  45.008  1.00 53.88  ? 43   VAL F CG1   1 
ATOM   4918 C CG2   . VAL F 1 57  ? 13.827  20.856  45.369  1.00 55.52  ? 43   VAL F CG2   1 
ATOM   4919 N N     . TYR F 1 58  ? 14.707  16.929  43.552  1.00 53.72  ? 44   TYR F N     1 
ATOM   4920 C CA    . TYR F 1 58  ? 15.305  15.620  43.279  1.00 52.82  ? 44   TYR F CA    1 
ATOM   4921 C C     . TYR F 1 58  ? 15.397  15.369  41.772  1.00 50.85  ? 44   TYR F C     1 
ATOM   4922 O O     . TYR F 1 58  ? 16.477  15.126  41.243  1.00 48.04  ? 44   TYR F O     1 
ATOM   4923 C CB    . TYR F 1 58  ? 14.471  14.504  43.941  1.00 53.92  ? 44   TYR F CB    1 
ATOM   4924 C CG    . TYR F 1 58  ? 14.610  14.404  45.438  1.00 54.24  ? 44   TYR F CG    1 
ATOM   4925 C CD1   . TYR F 1 58  ? 15.086  15.464  46.204  1.00 54.73  ? 44   TYR F CD1   1 
ATOM   4926 C CD2   . TYR F 1 58  ? 14.243  13.244  46.100  1.00 56.55  ? 44   TYR F CD2   1 
ATOM   4927 C CE1   . TYR F 1 58  ? 15.204  15.357  47.583  1.00 56.91  ? 44   TYR F CE1   1 
ATOM   4928 C CE2   . TYR F 1 58  ? 14.337  13.136  47.480  1.00 57.44  ? 44   TYR F CE2   1 
ATOM   4929 C CZ    . TYR F 1 58  ? 14.814  14.188  48.214  1.00 57.55  ? 44   TYR F CZ    1 
ATOM   4930 O OH    . TYR F 1 58  ? 14.925  14.066  49.574  1.00 59.52  ? 44   TYR F OH    1 
ATOM   4931 N N     . TYR F 1 59  ? 14.261  15.453  41.086  1.00 50.12  ? 45   TYR F N     1 
ATOM   4932 C CA    . TYR F 1 59  ? 14.241  15.345  39.622  1.00 50.47  ? 45   TYR F CA    1 
ATOM   4933 C C     . TYR F 1 59  ? 15.365  16.164  38.962  1.00 50.37  ? 45   TYR F C     1 
ATOM   4934 O O     . TYR F 1 59  ? 16.059  15.669  38.059  1.00 50.41  ? 45   TYR F O     1 
ATOM   4935 C CB    . TYR F 1 59  ? 12.885  15.793  39.092  1.00 50.29  ? 45   TYR F CB    1 
ATOM   4936 C CG    . TYR F 1 59  ? 12.693  15.584  37.623  1.00 51.84  ? 45   TYR F CG    1 
ATOM   4937 C CD1   . TYR F 1 59  ? 12.232  14.361  37.125  1.00 53.49  ? 45   TYR F CD1   1 
ATOM   4938 C CD2   . TYR F 1 59  ? 12.973  16.601  36.712  1.00 52.58  ? 45   TYR F CD2   1 
ATOM   4939 C CE1   . TYR F 1 59  ? 12.038  14.158  35.773  1.00 53.97  ? 45   TYR F CE1   1 
ATOM   4940 C CE2   . TYR F 1 59  ? 12.806  16.398  35.347  1.00 53.69  ? 45   TYR F CE2   1 
ATOM   4941 C CZ    . TYR F 1 59  ? 12.327  15.178  34.891  1.00 54.31  ? 45   TYR F CZ    1 
ATOM   4942 O OH    . TYR F 1 59  ? 12.145  14.971  33.552  1.00 55.03  ? 45   TYR F OH    1 
ATOM   4943 N N     . GLY F 1 60  ? 15.551  17.397  39.432  1.00 50.30  ? 46   GLY F N     1 
ATOM   4944 C CA    . GLY F 1 60  ? 16.628  18.273  38.968  1.00 50.42  ? 46   GLY F CA    1 
ATOM   4945 C C     . GLY F 1 60  ? 18.014  17.659  39.133  1.00 52.10  ? 46   GLY F C     1 
ATOM   4946 O O     . GLY F 1 60  ? 18.890  17.809  38.253  1.00 52.89  ? 46   GLY F O     1 
ATOM   4947 N N     . LEU F 1 61  ? 18.227  16.945  40.237  1.00 50.33  ? 47   LEU F N     1 
ATOM   4948 C CA    . LEU F 1 61  ? 19.519  16.296  40.465  1.00 50.96  ? 47   LEU F CA    1 
ATOM   4949 C C     . LEU F 1 61  ? 19.776  15.234  39.398  1.00 50.73  ? 47   LEU F C     1 
ATOM   4950 O O     . LEU F 1 61  ? 20.861  15.172  38.817  1.00 50.62  ? 47   LEU F O     1 
ATOM   4951 C CB    . LEU F 1 61  ? 19.590  15.678  41.858  1.00 51.69  ? 47   LEU F CB    1 
ATOM   4952 C CG    . LEU F 1 61  ? 19.330  16.630  43.034  1.00 52.16  ? 47   LEU F CG    1 
ATOM   4953 C CD1   . LEU F 1 61  ? 19.367  15.872  44.364  1.00 53.41  ? 47   LEU F CD1   1 
ATOM   4954 C CD2   . LEU F 1 61  ? 20.315  17.775  43.056  1.00 52.40  ? 47   LEU F CD2   1 
ATOM   4955 N N     . LEU F 1 62  ? 18.764  14.424  39.115  1.00 50.26  ? 48   LEU F N     1 
ATOM   4956 C CA    . LEU F 1 62  ? 18.886  13.423  38.073  1.00 51.61  ? 48   LEU F CA    1 
ATOM   4957 C C     . LEU F 1 62  ? 19.186  14.039  36.720  1.00 53.08  ? 48   LEU F C     1 
ATOM   4958 O O     . LEU F 1 62  ? 20.012  13.543  35.973  1.00 54.13  ? 48   LEU F O     1 
ATOM   4959 C CB    . LEU F 1 62  ? 17.614  12.600  37.967  1.00 51.81  ? 48   LEU F CB    1 
ATOM   4960 C CG    . LEU F 1 62  ? 17.148  11.893  39.236  1.00 51.93  ? 48   LEU F CG    1 
ATOM   4961 C CD1   . LEU F 1 62  ? 16.172  10.795  38.842  1.00 53.97  ? 48   LEU F CD1   1 
ATOM   4962 C CD2   . LEU F 1 62  ? 18.316  11.309  40.021  1.00 51.25  ? 48   LEU F CD2   1 
ATOM   4963 N N     . VAL F 1 63  ? 18.509  15.135  36.412  1.00 55.35  ? 49   VAL F N     1 
ATOM   4964 C CA    . VAL F 1 63  ? 18.719  15.838  35.150  1.00 57.17  ? 49   VAL F CA    1 
ATOM   4965 C C     . VAL F 1 63  ? 20.164  16.322  35.025  1.00 57.19  ? 49   VAL F C     1 
ATOM   4966 O O     . VAL F 1 63  ? 20.766  16.203  33.975  1.00 60.84  ? 49   VAL F O     1 
ATOM   4967 C CB    . VAL F 1 63  ? 17.729  17.020  35.028  1.00 58.21  ? 49   VAL F CB    1 
ATOM   4968 C CG1   . VAL F 1 63  ? 18.075  17.914  33.855  1.00 59.45  ? 49   VAL F CG1   1 
ATOM   4969 C CG2   . VAL F 1 63  ? 16.308  16.490  34.882  1.00 59.70  ? 49   VAL F CG2   1 
ATOM   4970 N N     . LYS F 1 64  ? 20.719  16.868  36.100  1.00 55.85  ? 50   LYS F N     1 
ATOM   4971 C CA    . LYS F 1 64  ? 22.075  17.399  36.042  1.00 54.66  ? 50   LYS F CA    1 
ATOM   4972 C C     . LYS F 1 64  ? 23.107  16.298  35.851  1.00 54.23  ? 50   LYS F C     1 
ATOM   4973 O O     . LYS F 1 64  ? 24.108  16.496  35.165  1.00 56.96  ? 50   LYS F O     1 
ATOM   4974 C CB    . LYS F 1 64  ? 22.395  18.241  37.297  1.00 53.15  ? 50   LYS F CB    1 
ATOM   4975 N N     . LEU F 1 65  ? 22.872  15.135  36.451  1.00 54.04  ? 51   LEU F N     1 
ATOM   4976 C CA    . LEU F 1 65  ? 23.775  13.993  36.281  1.00 55.07  ? 51   LEU F CA    1 
ATOM   4977 C C     . LEU F 1 65  ? 23.660  13.445  34.861  1.00 56.66  ? 51   LEU F C     1 
ATOM   4978 O O     . LEU F 1 65  ? 24.675  13.222  34.190  1.00 57.02  ? 51   LEU F O     1 
ATOM   4979 C CB    . LEU F 1 65  ? 23.455  12.881  37.283  1.00 54.68  ? 51   LEU F CB    1 
ATOM   4980 C CG    . LEU F 1 65  ? 23.592  13.247  38.753  1.00 54.32  ? 51   LEU F CG    1 
ATOM   4981 C CD1   . LEU F 1 65  ? 23.269  12.041  39.622  1.00 55.31  ? 51   LEU F CD1   1 
ATOM   4982 C CD2   . LEU F 1 65  ? 24.989  13.760  39.047  1.00 54.46  ? 51   LEU F CD2   1 
ATOM   4983 N N     . ALA F 1 66  ? 22.419  13.206  34.428  1.00 56.13  ? 52   ALA F N     1 
ATOM   4984 C CA    . ALA F 1 66  ? 22.128  12.771  33.069  1.00 58.64  ? 52   ALA F CA    1 
ATOM   4985 C C     . ALA F 1 66  ? 22.831  13.637  32.025  1.00 60.09  ? 52   ALA F C     1 
ATOM   4986 O O     . ALA F 1 66  ? 23.253  13.138  30.972  1.00 59.37  ? 52   ALA F O     1 
ATOM   4987 C CB    . ALA F 1 66  ? 20.629  12.792  32.832  1.00 58.98  ? 52   ALA F CB    1 
ATOM   4988 N N     . GLU F 1 67  ? 22.972  14.925  32.339  1.00 59.79  ? 53   GLU F N     1 
ATOM   4989 C CA    . GLU F 1 67  ? 23.710  15.866  31.496  1.00 63.31  ? 53   GLU F CA    1 
ATOM   4990 C C     . GLU F 1 67  ? 25.234  15.804  31.646  1.00 64.47  ? 53   GLU F C     1 
ATOM   4991 O O     . GLU F 1 67  ? 25.951  16.309  30.791  1.00 67.47  ? 53   GLU F O     1 
ATOM   4992 C CB    . GLU F 1 67  ? 23.304  17.292  31.820  1.00 63.50  ? 53   GLU F CB    1 
ATOM   4993 C CG    . GLU F 1 67  ? 21.981  17.748  31.234  1.00 65.42  ? 53   GLU F CG    1 
ATOM   4994 C CD    . GLU F 1 67  ? 21.762  19.231  31.472  1.00 65.21  ? 53   GLU F CD    1 
ATOM   4995 O OE1   . GLU F 1 67  ? 22.228  19.731  32.525  1.00 63.69  ? 53   GLU F OE1   1 
ATOM   4996 O OE2   . GLU F 1 67  ? 21.150  19.888  30.608  1.00 65.91  ? 53   GLU F OE2   1 
ATOM   4997 N N     . SER F 1 68  ? 25.730  15.220  32.730  1.00 63.41  ? 54   SER F N     1 
ATOM   4998 C CA    . SER F 1 68  ? 27.165  15.250  33.024  1.00 64.52  ? 54   SER F CA    1 
ATOM   4999 C C     . SER F 1 68  ? 27.985  14.211  32.266  1.00 65.44  ? 54   SER F C     1 
ATOM   5000 O O     . SER F 1 68  ? 27.451  13.219  31.787  1.00 63.48  ? 54   SER F O     1 
ATOM   5001 C CB    . SER F 1 68  ? 27.390  15.054  34.517  1.00 64.35  ? 54   SER F CB    1 
ATOM   5002 O OG    . SER F 1 68  ? 26.671  16.029  35.257  1.00 64.45  ? 54   SER F OG    1 
ATOM   5003 N N     . PRO F 1 69  ? 29.304  14.445  32.151  1.00 69.04  ? 55   PRO F N     1 
ATOM   5004 C CA    . PRO F 1 69  ? 30.163  13.408  31.586  1.00 70.80  ? 55   PRO F CA    1 
ATOM   5005 C C     . PRO F 1 69  ? 30.101  12.160  32.459  1.00 69.48  ? 55   PRO F C     1 
ATOM   5006 O O     . PRO F 1 69  ? 30.081  12.278  33.689  1.00 68.72  ? 55   PRO F O     1 
ATOM   5007 C CB    . PRO F 1 69  ? 31.561  14.042  31.620  1.00 71.02  ? 55   PRO F CB    1 
ATOM   5008 C CG    . PRO F 1 69  ? 31.324  15.508  31.642  1.00 70.22  ? 55   PRO F CG    1 
ATOM   5009 C CD    . PRO F 1 69  ? 30.052  15.688  32.421  1.00 69.89  ? 55   PRO F CD    1 
ATOM   5010 N N     . ARG F 1 70  ? 30.026  10.995  31.820  1.00 68.30  ? 56   ARG F N     1 
ATOM   5011 C CA    . ARG F 1 70  ? 29.919  9.715   32.513  1.00 68.06  ? 56   ARG F CA    1 
ATOM   5012 C C     . ARG F 1 70  ? 28.758  9.654   33.533  1.00 66.49  ? 56   ARG F C     1 
ATOM   5013 O O     . ARG F 1 70  ? 28.755  8.829   34.445  1.00 65.55  ? 56   ARG F O     1 
ATOM   5014 C CB    . ARG F 1 70  ? 31.264  9.351   33.169  1.00 68.64  ? 56   ARG F CB    1 
ATOM   5015 C CG    . ARG F 1 70  ? 32.418  9.133   32.180  1.00 69.73  ? 56   ARG F CG    1 
ATOM   5016 C CD    . ARG F 1 70  ? 33.678  8.577   32.863  1.00 68.47  ? 56   ARG F CD    1 
ATOM   5017 N N     . ARG F 1 71  ? 27.765  10.519  33.342  1.00 67.49  ? 57   ARG F N     1 
ATOM   5018 C CA    . ARG F 1 71  ? 26.553  10.559  34.164  1.00 66.90  ? 57   ARG F CA    1 
ATOM   5019 C C     . ARG F 1 71  ? 26.852  10.666  35.655  1.00 65.45  ? 57   ARG F C     1 
ATOM   5020 O O     . ARG F 1 71  ? 26.084  10.180  36.499  1.00 64.72  ? 57   ARG F O     1 
ATOM   5021 C CB    . ARG F 1 71  ? 25.652  9.353   33.846  1.00 68.36  ? 57   ARG F CB    1 
ATOM   5022 C CG    . ARG F 1 71  ? 24.710  9.615   32.672  1.00 69.62  ? 57   ARG F CG    1 
ATOM   5023 C CD    . ARG F 1 71  ? 24.172  8.381   31.952  1.00 72.38  ? 57   ARG F CD    1 
ATOM   5024 N NE    . ARG F 1 71  ? 23.881  7.282   32.862  1.00 71.27  ? 57   ARG F NE    1 
ATOM   5025 C CZ    . ARG F 1 71  ? 23.350  6.138   32.459  1.00 73.75  ? 57   ARG F CZ    1 
ATOM   5026 N NH1   . ARG F 1 71  ? 23.045  5.965   31.174  1.00 74.29  ? 57   ARG F NH1   1 
ATOM   5027 N NH2   . ARG F 1 71  ? 23.126  5.170   33.336  1.00 76.34  ? 57   ARG F NH2   1 
ATOM   5028 N N     . ARG F 1 72  ? 27.942  11.359  35.972  1.00 63.80  ? 58   ARG F N     1 
ATOM   5029 C CA    . ARG F 1 72  ? 28.378  11.486  37.344  1.00 63.15  ? 58   ARG F CA    1 
ATOM   5030 C C     . ARG F 1 72  ? 28.849  12.887  37.650  1.00 61.74  ? 58   ARG F C     1 
ATOM   5031 O O     . ARG F 1 72  ? 29.176  13.646  36.756  1.00 63.17  ? 58   ARG F O     1 
ATOM   5032 C CB    . ARG F 1 72  ? 29.493  10.480  37.630  1.00 64.34  ? 58   ARG F CB    1 
ATOM   5033 C CG    . ARG F 1 72  ? 30.842  10.842  37.024  1.00 64.26  ? 58   ARG F CG    1 
ATOM   5034 C CD    . ARG F 1 72  ? 31.757  9.627   37.082  1.00 65.91  ? 58   ARG F CD    1 
ATOM   5035 N NE    . ARG F 1 72  ? 30.994  8.502   36.519  1.00 65.39  ? 58   ARG F NE    1 
ATOM   5036 C CZ    . ARG F 1 72  ? 31.140  7.205   36.741  1.00 65.60  ? 58   ARG F CZ    1 
ATOM   5037 N NH1   . ARG F 1 72  ? 32.095  6.728   37.528  1.00 66.01  ? 58   ARG F NH1   1 
ATOM   5038 N NH2   . ARG F 1 72  ? 30.303  6.369   36.119  1.00 65.56  ? 58   ARG F NH2   1 
ATOM   5039 N N     . LEU F 1 73  ? 28.919  13.191  38.939  1.00 61.07  ? 59   LEU F N     1 
ATOM   5040 C CA    . LEU F 1 73  ? 29.294  14.515  39.422  1.00 59.76  ? 59   LEU F CA    1 
ATOM   5041 C C     . LEU F 1 73  ? 29.655  14.364  40.900  1.00 59.57  ? 59   LEU F C     1 
ATOM   5042 O O     . LEU F 1 73  ? 28.991  13.611  41.613  1.00 59.99  ? 59   LEU F O     1 
ATOM   5043 C CB    . LEU F 1 73  ? 28.109  15.454  39.249  1.00 58.82  ? 59   LEU F CB    1 
ATOM   5044 C CG    . LEU F 1 73  ? 28.294  16.834  38.614  1.00 60.33  ? 59   LEU F CG    1 
ATOM   5045 C CD1   . LEU F 1 73  ? 29.090  16.788  37.318  1.00 61.91  ? 59   LEU F CD1   1 
ATOM   5046 C CD2   . LEU F 1 73  ? 26.928  17.464  38.367  1.00 58.39  ? 59   LEU F CD2   1 
ATOM   5047 N N     . ARG F 1 74  ? 30.705  15.044  41.352  1.00 59.78  ? 60   ARG F N     1 
ATOM   5048 C CA    . ARG F 1 74  ? 31.083  14.984  42.761  1.00 61.67  ? 60   ARG F CA    1 
ATOM   5049 C C     . ARG F 1 74  ? 30.050  15.765  43.562  1.00 60.82  ? 60   ARG F C     1 
ATOM   5050 O O     . ARG F 1 74  ? 29.460  16.731  43.077  1.00 60.65  ? 60   ARG F O     1 
ATOM   5051 C CB    . ARG F 1 74  ? 32.513  15.517  43.029  1.00 65.10  ? 60   ARG F CB    1 
ATOM   5052 C CG    . ARG F 1 74  ? 33.672  14.500  43.103  1.00 67.34  ? 60   ARG F CG    1 
ATOM   5053 C CD    . ARG F 1 74  ? 34.335  14.309  44.468  1.00 71.34  ? 60   ARG F CD    1 
ATOM   5054 N NE    . ARG F 1 74  ? 35.789  14.418  44.474  1.00 74.22  ? 60   ARG F NE    1 
ATOM   5055 C CZ    . ARG F 1 74  ? 36.441  15.473  44.938  1.00 76.15  ? 60   ARG F CZ    1 
ATOM   5056 N NH1   . ARG F 1 74  ? 35.765  16.513  45.423  1.00 74.59  ? 60   ARG F NH1   1 
ATOM   5057 N NH2   . ARG F 1 74  ? 37.768  15.487  44.892  1.00 79.05  ? 60   ARG F NH2   1 
ATOM   5058 N N     . MET F 1 75  ? 29.818  15.320  44.788  1.00 61.07  ? 61   MET F N     1 
ATOM   5059 C CA    . MET F 1 75  ? 28.726  15.834  45.620  1.00 60.06  ? 61   MET F CA    1 
ATOM   5060 C C     . MET F 1 75  ? 28.659  17.352  45.622  1.00 58.76  ? 61   MET F C     1 
ATOM   5061 O O     . MET F 1 75  ? 27.612  17.928  45.353  1.00 56.37  ? 61   MET F O     1 
ATOM   5062 C CB    . MET F 1 75  ? 28.874  15.335  47.069  1.00 62.56  ? 61   MET F CB    1 
ATOM   5063 C CG    . MET F 1 75  ? 28.878  13.823  47.225  1.00 63.53  ? 61   MET F CG    1 
ATOM   5064 S SD    . MET F 1 75  ? 27.569  12.994  46.319  1.00 62.96  ? 61   MET F SD    1 
ATOM   5065 C CE    . MET F 1 75  ? 26.172  13.305  47.398  1.00 64.66  ? 61   MET F CE    1 
ATOM   5066 N N     . THR F 1 76  ? 29.764  18.002  45.973  1.00 59.41  ? 62   THR F N     1 
ATOM   5067 C CA    . THR F 1 76  ? 29.744  19.449  46.126  1.00 59.73  ? 62   THR F CA    1 
ATOM   5068 C C     . THR F 1 76  ? 29.385  20.114  44.810  1.00 58.37  ? 62   THR F C     1 
ATOM   5069 O O     . THR F 1 76  ? 28.626  21.065  44.785  1.00 58.11  ? 62   THR F O     1 
ATOM   5070 C CB    . THR F 1 76  ? 31.077  19.998  46.662  1.00 62.20  ? 62   THR F CB    1 
ATOM   5071 O OG1   . THR F 1 76  ? 31.390  19.397  47.933  1.00 65.56  ? 62   THR F OG1   1 
ATOM   5072 C CG2   . THR F 1 76  ? 30.981  21.490  46.855  1.00 63.26  ? 62   THR F CG2   1 
ATOM   5073 N N     . GLU F 1 77  ? 29.921  19.604  43.713  1.00 59.23  ? 63   GLU F N     1 
ATOM   5074 C CA    . GLU F 1 77  ? 29.577  20.133  42.403  1.00 59.66  ? 63   GLU F CA    1 
ATOM   5075 C C     . GLU F 1 77  ? 28.079  20.007  42.129  1.00 56.35  ? 63   GLU F C     1 
ATOM   5076 O O     . GLU F 1 77  ? 27.441  20.923  41.625  1.00 54.83  ? 63   GLU F O     1 
ATOM   5077 C CB    . GLU F 1 77  ? 30.337  19.392  41.316  1.00 62.92  ? 63   GLU F CB    1 
ATOM   5078 C CG    . GLU F 1 77  ? 31.710  19.965  41.004  1.00 67.38  ? 63   GLU F CG    1 
ATOM   5079 C CD    . GLU F 1 77  ? 32.251  19.529  39.661  1.00 69.76  ? 63   GLU F CD    1 
ATOM   5080 O OE1   . GLU F 1 77  ? 31.765  20.081  38.646  1.00 72.86  ? 63   GLU F OE1   1 
ATOM   5081 O OE2   . GLU F 1 77  ? 33.165  18.668  39.619  1.00 71.90  ? 63   GLU F OE2   1 
ATOM   5082 N N     . LEU F 1 78  ? 27.525  18.865  42.476  1.00 54.56  ? 64   LEU F N     1 
ATOM   5083 C CA    . LEU F 1 78  ? 26.110  18.661  42.316  1.00 54.57  ? 64   LEU F CA    1 
ATOM   5084 C C     . LEU F 1 78  ? 25.332  19.679  43.141  1.00 55.90  ? 64   LEU F C     1 
ATOM   5085 O O     . LEU F 1 78  ? 24.454  20.368  42.625  1.00 57.40  ? 64   LEU F O     1 
ATOM   5086 C CB    . LEU F 1 78  ? 25.736  17.238  42.714  1.00 53.90  ? 64   LEU F CB    1 
ATOM   5087 C CG    . LEU F 1 78  ? 24.318  16.758  42.428  1.00 52.56  ? 64   LEU F CG    1 
ATOM   5088 C CD1   . LEU F 1 78  ? 23.834  17.219  41.060  1.00 52.09  ? 64   LEU F CD1   1 
ATOM   5089 C CD2   . LEU F 1 78  ? 24.260  15.234  42.544  1.00 52.55  ? 64   LEU F CD2   1 
ATOM   5090 N N     . ALA F 1 79  ? 25.677  19.809  44.412  1.00 57.75  ? 65   ALA F N     1 
ATOM   5091 C CA    . ALA F 1 79  ? 25.063  20.828  45.246  1.00 59.68  ? 65   ALA F CA    1 
ATOM   5092 C C     . ALA F 1 79  ? 25.162  22.222  44.614  1.00 61.19  ? 65   ALA F C     1 
ATOM   5093 O O     . ALA F 1 79  ? 24.207  22.989  44.683  1.00 62.91  ? 65   ALA F O     1 
ATOM   5094 C CB    . ALA F 1 79  ? 25.695  20.825  46.632  1.00 60.76  ? 65   ALA F CB    1 
ATOM   5095 N N     . LYS F 1 80  ? 26.323  22.558  44.049  1.00 63.45  ? 66   LYS F N     1 
ATOM   5096 C CA    . LYS F 1 80  ? 26.581  23.900  43.509  1.00 65.53  ? 66   LYS F CA    1 
ATOM   5097 C C     . LYS F 1 80  ? 25.672  24.222  42.335  1.00 63.08  ? 66   LYS F C     1 
ATOM   5098 O O     . LYS F 1 80  ? 25.166  25.332  42.215  1.00 63.96  ? 66   LYS F O     1 
ATOM   5099 C CB    . LYS F 1 80  ? 28.050  24.038  43.081  1.00 67.59  ? 66   LYS F CB    1 
ATOM   5100 N N     . TYR F 1 81  ? 25.451  23.241  41.475  1.00 62.84  ? 67   TYR F N     1 
ATOM   5101 C CA    . TYR F 1 81  ? 24.516  23.413  40.347  1.00 59.81  ? 67   TYR F CA    1 
ATOM   5102 C C     . TYR F 1 81  ? 23.086  23.565  40.843  1.00 55.03  ? 67   TYR F C     1 
ATOM   5103 O O     . TYR F 1 81  ? 22.355  24.432  40.383  1.00 55.68  ? 67   TYR F O     1 
ATOM   5104 C CB    . TYR F 1 81  ? 24.589  22.223  39.382  1.00 58.95  ? 67   TYR F CB    1 
ATOM   5105 C CG    . TYR F 1 81  ? 25.802  22.220  38.472  1.00 61.61  ? 67   TYR F CG    1 
ATOM   5106 C CD1   . TYR F 1 81  ? 26.018  23.254  37.549  1.00 63.77  ? 67   TYR F CD1   1 
ATOM   5107 C CD2   . TYR F 1 81  ? 26.722  21.171  38.507  1.00 61.80  ? 67   TYR F CD2   1 
ATOM   5108 C CE1   . TYR F 1 81  ? 27.118  23.243  36.704  1.00 64.15  ? 67   TYR F CE1   1 
ATOM   5109 C CE2   . TYR F 1 81  ? 27.817  21.155  37.663  1.00 62.97  ? 67   TYR F CE2   1 
ATOM   5110 C CZ    . TYR F 1 81  ? 28.005  22.189  36.770  1.00 64.22  ? 67   TYR F CZ    1 
ATOM   5111 O OH    . TYR F 1 81  ? 29.101  22.156  35.950  1.00 69.32  ? 67   TYR F OH    1 
ATOM   5112 N N     . ALA F 1 82  ? 22.706  22.705  41.778  1.00 58.28  ? 68   ALA F N     1 
ATOM   5113 C CA    . ALA F 1 82  ? 21.361  22.677  42.346  1.00 55.27  ? 68   ALA F CA    1 
ATOM   5114 C C     . ALA F 1 82  ? 21.070  23.867  43.261  1.00 54.79  ? 68   ALA F C     1 
ATOM   5115 O O     . ALA F 1 82  ? 19.908  24.200  43.495  1.00 54.31  ? 68   ALA F O     1 
ATOM   5116 C CB    . ALA F 1 82  ? 21.172  21.377  43.124  1.00 53.23  ? 68   ALA F CB    1 
ATOM   5117 N N     . LYS F 1 83  ? 22.128  24.493  43.779  1.00 56.10  ? 69   LYS F N     1 
ATOM   5118 C CA    . LYS F 1 83  ? 22.043  25.661  44.663  1.00 56.89  ? 69   LYS F CA    1 
ATOM   5119 C C     . LYS F 1 83  ? 21.477  25.263  46.051  1.00 54.97  ? 69   LYS F C     1 
ATOM   5120 O O     . LYS F 1 83  ? 20.790  26.038  46.709  1.00 53.47  ? 69   LYS F O     1 
ATOM   5121 C CB    . LYS F 1 83  ? 21.238  26.789  43.985  1.00 58.38  ? 69   LYS F CB    1 
ATOM   5122 N N     . ILE F 1 84  ? 21.817  24.052  46.490  1.00 52.65  ? 70   ILE F N     1 
ATOM   5123 C CA    . ILE F 1 84  ? 21.358  23.537  47.756  1.00 51.80  ? 70   ILE F CA    1 
ATOM   5124 C C     . ILE F 1 84  ? 22.557  23.244  48.626  1.00 51.50  ? 70   ILE F C     1 
ATOM   5125 O O     . ILE F 1 84  ? 23.692  23.423  48.191  1.00 53.53  ? 70   ILE F O     1 
ATOM   5126 C CB    . ILE F 1 84  ? 20.529  22.251  47.569  1.00 51.55  ? 70   ILE F CB    1 
ATOM   5127 C CG1   . ILE F 1 84  ? 21.433  21.069  47.188  1.00 51.96  ? 70   ILE F CG1   1 
ATOM   5128 C CG2   . ILE F 1 84  ? 19.412  22.486  46.563  1.00 51.55  ? 70   ILE F CG2   1 
ATOM   5129 C CD1   . ILE F 1 84  ? 20.686  19.856  46.686  1.00 52.18  ? 70   ILE F CD1   1 
ATOM   5130 N N     . THR F 1 85  ? 22.324  22.788  49.850  1.00 50.96  ? 71   THR F N     1 
ATOM   5131 C CA    . THR F 1 85  ? 23.448  22.479  50.727  1.00 52.33  ? 71   THR F CA    1 
ATOM   5132 C C     . THR F 1 85  ? 23.879  21.034  50.566  1.00 53.95  ? 71   THR F C     1 
ATOM   5133 O O     . THR F 1 85  ? 23.099  20.187  50.136  1.00 58.27  ? 71   THR F O     1 
ATOM   5134 C CB    . THR F 1 85  ? 23.113  22.729  52.199  1.00 51.33  ? 71   THR F CB    1 
ATOM   5135 O OG1   . THR F 1 85  ? 22.091  21.814  52.626  1.00 49.87  ? 71   THR F OG1   1 
ATOM   5136 C CG2   . THR F 1 85  ? 22.674  24.166  52.405  1.00 51.65  ? 71   THR F CG2   1 
ATOM   5137 N N     . ARG F 1 86  ? 25.123  20.758  50.927  1.00 55.17  ? 72   ARG F N     1 
ATOM   5138 C CA    . ARG F 1 86  ? 25.668  19.398  50.901  1.00 56.27  ? 72   ARG F CA    1 
ATOM   5139 C C     . ARG F 1 86  ? 24.849  18.457  51.754  1.00 55.46  ? 72   ARG F C     1 
ATOM   5140 O O     . ARG F 1 86  ? 24.734  17.271  51.447  1.00 57.35  ? 72   ARG F O     1 
ATOM   5141 C CB    . ARG F 1 86  ? 27.090  19.391  51.441  1.00 58.49  ? 72   ARG F CB    1 
ATOM   5142 C CG    . ARG F 1 86  ? 28.052  20.221  50.626  1.00 60.75  ? 72   ARG F CG    1 
ATOM   5143 C CD    . ARG F 1 86  ? 29.393  20.132  51.246  1.00 64.03  ? 72   ARG F CD    1 
ATOM   5144 N NE    . ARG F 1 86  ? 30.406  20.799  50.447  1.00 69.48  ? 72   ARG F NE    1 
ATOM   5145 C CZ    . ARG F 1 86  ? 31.488  21.380  50.947  1.00 72.47  ? 72   ARG F CZ    1 
ATOM   5146 N NH1   . ARG F 1 86  ? 31.708  21.391  52.260  1.00 74.75  ? 72   ARG F NH1   1 
ATOM   5147 N NH2   . ARG F 1 86  ? 32.336  21.971  50.138  1.00 75.66  ? 72   ARG F NH2   1 
ATOM   5148 N N     . SER F 1 87  ? 24.290  19.006  52.830  1.00 53.30  ? 73   SER F N     1 
ATOM   5149 C CA    . SER F 1 87  ? 23.554  18.242  53.802  1.00 51.30  ? 73   SER F CA    1 
ATOM   5150 C C     . SER F 1 87  ? 22.293  17.739  53.149  1.00 50.78  ? 73   SER F C     1 
ATOM   5151 O O     . SER F 1 87  ? 21.977  16.539  53.174  1.00 52.56  ? 73   SER F O     1 
ATOM   5152 C CB    . SER F 1 87  ? 23.182  19.146  54.958  1.00 51.81  ? 73   SER F CB    1 
ATOM   5153 O OG    . SER F 1 87  ? 23.673  18.598  56.147  1.00 53.20  ? 73   SER F OG    1 
ATOM   5154 N N     . ARG F 1 88  ? 21.547  18.679  52.585  1.00 48.93  ? 74   ARG F N     1 
ATOM   5155 C CA    . ARG F 1 88  ? 20.330  18.360  51.879  1.00 47.90  ? 74   ARG F CA    1 
ATOM   5156 C C     . ARG F 1 88  ? 20.627  17.390  50.753  1.00 48.65  ? 74   ARG F C     1 
ATOM   5157 O O     . ARG F 1 88  ? 19.876  16.449  50.534  1.00 49.41  ? 74   ARG F O     1 
ATOM   5158 C CB    . ARG F 1 88  ? 19.729  19.622  51.309  1.00 47.66  ? 74   ARG F CB    1 
ATOM   5159 C CG    . ARG F 1 88  ? 18.408  19.410  50.587  1.00 47.27  ? 74   ARG F CG    1 
ATOM   5160 C CD    . ARG F 1 88  ? 18.026  20.710  49.931  1.00 46.98  ? 74   ARG F CD    1 
ATOM   5161 N NE    . ARG F 1 88  ? 16.661  20.712  49.469  1.00 47.80  ? 74   ARG F NE    1 
ATOM   5162 C CZ    . ARG F 1 88  ? 16.033  21.809  49.077  1.00 48.88  ? 74   ARG F CZ    1 
ATOM   5163 N NH1   . ARG F 1 88  ? 16.667  22.970  49.092  1.00 49.40  ? 74   ARG F NH1   1 
ATOM   5164 N NH2   . ARG F 1 88  ? 14.784  21.748  48.651  1.00 50.76  ? 74   ARG F NH2   1 
ATOM   5165 N N     . LEU F 1 89  ? 21.745  17.603  50.065  1.00 49.10  ? 75   LEU F N     1 
ATOM   5166 C CA    . LEU F 1 89  ? 22.142  16.719  48.984  1.00 48.54  ? 75   LEU F CA    1 
ATOM   5167 C C     . LEU F 1 89  ? 22.423  15.311  49.457  1.00 48.89  ? 75   LEU F C     1 
ATOM   5168 O O     . LEU F 1 89  ? 21.992  14.353  48.804  1.00 52.53  ? 75   LEU F O     1 
ATOM   5169 C CB    . LEU F 1 89  ? 23.369  17.255  48.259  1.00 49.37  ? 75   LEU F CB    1 
ATOM   5170 C CG    . LEU F 1 89  ? 23.846  16.393  47.092  1.00 49.70  ? 75   LEU F CG    1 
ATOM   5171 C CD1   . LEU F 1 89  ? 22.747  16.125  46.089  1.00 49.38  ? 75   LEU F CD1   1 
ATOM   5172 C CD2   . LEU F 1 89  ? 25.003  17.091  46.415  1.00 51.79  ? 75   LEU F CD2   1 
ATOM   5173 N N     . SER F 1 90  ? 23.136  15.161  50.571  1.00 47.79  ? 76   SER F N     1 
ATOM   5174 C CA    . SER F 1 90  ? 23.415  13.827  51.108  1.00 47.70  ? 76   SER F CA    1 
ATOM   5175 C C     . SER F 1 90  ? 22.120  13.115  51.371  1.00 47.82  ? 76   SER F C     1 
ATOM   5176 O O     . SER F 1 90  ? 21.934  11.987  50.948  1.00 51.64  ? 76   SER F O     1 
ATOM   5177 C CB    . SER F 1 90  ? 24.221  13.889  52.402  1.00 48.28  ? 76   SER F CB    1 
ATOM   5178 O OG    . SER F 1 90  ? 25.474  14.496  52.187  1.00 49.10  ? 76   SER F OG    1 
ATOM   5179 N N     . HIS F 1 91  ? 21.211  13.777  52.074  1.00 47.92  ? 77   HIS F N     1 
ATOM   5180 C CA    . HIS F 1 91  ? 19.938  13.150  52.417  1.00 48.67  ? 77   HIS F CA    1 
ATOM   5181 C C     . HIS F 1 91  ? 19.215  12.756  51.138  1.00 49.10  ? 77   HIS F C     1 
ATOM   5182 O O     . HIS F 1 91  ? 18.700  11.662  51.039  1.00 48.73  ? 77   HIS F O     1 
ATOM   5183 C CB    . HIS F 1 91  ? 19.069  14.072  53.286  1.00 47.79  ? 77   HIS F CB    1 
ATOM   5184 C CG    . HIS F 1 91  ? 19.507  14.145  54.711  1.00 47.43  ? 77   HIS F CG    1 
ATOM   5185 N ND1   . HIS F 1 91  ? 19.742  13.023  55.472  1.00 48.51  ? 77   HIS F ND1   1 
ATOM   5186 C CD2   . HIS F 1 91  ? 19.750  15.206  55.521  1.00 47.09  ? 77   HIS F CD2   1 
ATOM   5187 C CE1   . HIS F 1 91  ? 20.104  13.386  56.691  1.00 49.27  ? 77   HIS F CE1   1 
ATOM   5188 N NE2   . HIS F 1 91  ? 20.111  14.706  56.748  1.00 48.30  ? 77   HIS F NE2   1 
ATOM   5189 N N     . ALA F 1 92  ? 19.200  13.657  50.164  1.00 50.40  ? 78   ALA F N     1 
ATOM   5190 C CA    . ALA F 1 92  ? 18.482  13.414  48.909  1.00 53.13  ? 78   ALA F CA    1 
ATOM   5191 C C     . ALA F 1 92  ? 19.050  12.225  48.151  1.00 54.62  ? 78   ALA F C     1 
ATOM   5192 O O     . ALA F 1 92  ? 18.301  11.400  47.645  1.00 55.08  ? 78   ALA F O     1 
ATOM   5193 C CB    . ALA F 1 92  ? 18.515  14.654  48.040  1.00 52.72  ? 78   ALA F CB    1 
ATOM   5194 N N     . VAL F 1 93  ? 20.378  12.114  48.128  1.00 55.36  ? 79   VAL F N     1 
ATOM   5195 C CA    . VAL F 1 93  ? 21.032  10.991  47.454  1.00 56.53  ? 79   VAL F CA    1 
ATOM   5196 C C     . VAL F 1 93  ? 20.931  9.670   48.217  1.00 55.75  ? 79   VAL F C     1 
ATOM   5197 O O     . VAL F 1 93  ? 20.912  8.601   47.601  1.00 55.79  ? 79   VAL F O     1 
ATOM   5198 C CB    . VAL F 1 93  ? 22.499  11.329  47.121  1.00 59.52  ? 79   VAL F CB    1 
ATOM   5199 C CG1   . VAL F 1 93  ? 23.214  10.122  46.514  1.00 62.07  ? 79   VAL F CG1   1 
ATOM   5200 C CG2   . VAL F 1 93  ? 22.546  12.505  46.144  1.00 58.92  ? 79   VAL F CG2   1 
ATOM   5201 N N     . ALA F 1 94  ? 20.817  9.715   49.543  1.00 55.94  ? 80   ALA F N     1 
ATOM   5202 C CA    . ALA F 1 94  ? 20.490  8.487   50.286  1.00 57.93  ? 80   ALA F CA    1 
ATOM   5203 C C     . ALA F 1 94  ? 19.143  7.947   49.808  1.00 60.49  ? 80   ALA F C     1 
ATOM   5204 O O     . ALA F 1 94  ? 18.960  6.731   49.660  1.00 63.70  ? 80   ALA F O     1 
ATOM   5205 C CB    . ALA F 1 94  ? 20.449  8.730   51.781  1.00 56.94  ? 80   ALA F CB    1 
ATOM   5206 N N     . ARG F 1 95  ? 18.206  8.866   49.572  1.00 59.90  ? 81   ARG F N     1 
ATOM   5207 C CA    . ARG F 1 95  ? 16.840  8.507   49.243  1.00 62.06  ? 81   ARG F CA    1 
ATOM   5208 C C     . ARG F 1 95  ? 16.787  8.008   47.817  1.00 60.85  ? 81   ARG F C     1 
ATOM   5209 O O     . ARG F 1 95  ? 16.078  7.039   47.530  1.00 63.75  ? 81   ARG F O     1 
ATOM   5210 C CB    . ARG F 1 95  ? 15.910  9.707   49.485  1.00 64.01  ? 81   ARG F CB    1 
ATOM   5211 C CG    . ARG F 1 95  ? 14.414  9.428   49.405  1.00 68.30  ? 81   ARG F CG    1 
ATOM   5212 C CD    . ARG F 1 95  ? 13.896  9.540   47.972  1.00 72.06  ? 81   ARG F CD    1 
ATOM   5213 N NE    . ARG F 1 95  ? 12.515  10.046  47.865  1.00 77.86  ? 81   ARG F NE    1 
ATOM   5214 C CZ    . ARG F 1 95  ? 11.775  10.008  46.745  1.00 81.71  ? 81   ARG F CZ    1 
ATOM   5215 N NH1   . ARG F 1 95  ? 12.252  9.474   45.613  1.00 80.95  ? 81   ARG F NH1   1 
ATOM   5216 N NH2   . ARG F 1 95  ? 10.533  10.490  46.753  1.00 85.63  ? 81   ARG F NH2   1 
ATOM   5217 N N     . LEU F 1 96  ? 17.545  8.656   46.931  1.00 58.00  ? 82   LEU F N     1 
ATOM   5218 C CA    . LEU F 1 96  ? 17.596  8.268   45.515  1.00 58.76  ? 82   LEU F CA    1 
ATOM   5219 C C     . LEU F 1 96  ? 18.365  6.954   45.291  1.00 61.85  ? 82   LEU F C     1 
ATOM   5220 O O     . LEU F 1 96  ? 18.002  6.130   44.430  1.00 63.12  ? 82   LEU F O     1 
ATOM   5221 C CB    . LEU F 1 96  ? 18.204  9.374   44.680  1.00 56.86  ? 82   LEU F CB    1 
ATOM   5222 C CG    . LEU F 1 96  ? 17.467  10.720  44.668  1.00 56.15  ? 82   LEU F CG    1 
ATOM   5223 C CD1   . LEU F 1 96  ? 18.324  11.795  44.029  1.00 54.51  ? 82   LEU F CD1   1 
ATOM   5224 C CD2   . LEU F 1 96  ? 16.138  10.615  43.947  1.00 58.82  ? 82   LEU F CD2   1 
ATOM   5225 N N     . GLU F 1 97  ? 19.409  6.753   46.092  1.00 62.09  ? 83   GLU F N     1 
ATOM   5226 C CA    . GLU F 1 97  ? 20.146  5.497   46.110  1.00 63.96  ? 83   GLU F CA    1 
ATOM   5227 C C     . GLU F 1 97  ? 19.230  4.361   46.547  1.00 66.23  ? 83   GLU F C     1 
ATOM   5228 O O     . GLU F 1 97  ? 19.249  3.284   45.945  1.00 67.83  ? 83   GLU F O     1 
ATOM   5229 C CB    . GLU F 1 97  ? 21.357  5.615   47.043  1.00 64.93  ? 83   GLU F CB    1 
ATOM   5230 C CG    . GLU F 1 97  ? 22.351  4.469   46.972  1.00 67.67  ? 83   GLU F CG    1 
ATOM   5231 C CD    . GLU F 1 97  ? 23.650  4.795   47.692  1.00 69.54  ? 83   GLU F CD    1 
ATOM   5232 O OE1   . GLU F 1 97  ? 23.585  5.287   48.837  1.00 68.61  ? 83   GLU F OE1   1 
ATOM   5233 O OE2   . GLU F 1 97  ? 24.747  4.564   47.116  1.00 74.90  ? 83   GLU F OE2   1 
ATOM   5234 N N     . LYS F 1 98  ? 18.431  4.601   47.592  1.00 65.74  ? 84   LYS F N     1 
ATOM   5235 C CA    . LYS F 1 98  ? 17.479  3.595   48.068  1.00 68.79  ? 84   LYS F CA    1 
ATOM   5236 C C     . LYS F 1 98  ? 16.572  3.126   46.958  1.00 71.36  ? 84   LYS F C     1 
ATOM   5237 O O     . LYS F 1 98  ? 16.473  1.935   46.729  1.00 75.76  ? 84   LYS F O     1 
ATOM   5238 C CB    . LYS F 1 98  ? 16.634  4.116   49.229  1.00 68.05  ? 84   LYS F CB    1 
ATOM   5239 N N     . ASN F 1 99  ? 15.920  4.039   46.252  1.00 70.55  ? 85   ASN F N     1 
ATOM   5240 C CA    . ASN F 1 99  ? 15.057  3.575   45.182  1.00 73.34  ? 85   ASN F CA    1 
ATOM   5241 C C     . ASN F 1 99  ? 15.800  3.251   43.874  1.00 73.92  ? 85   ASN F C     1 
ATOM   5242 O O     . ASN F 1 99  ? 15.175  2.913   42.879  1.00 76.49  ? 85   ASN F O     1 
ATOM   5243 C CB    . ASN F 1 99  ? 13.808  4.452   44.978  1.00 74.77  ? 85   ASN F CB    1 
ATOM   5244 C CG    . ASN F 1 99  ? 14.070  5.925   45.155  1.00 71.18  ? 85   ASN F CG    1 
ATOM   5245 O OD1   . ASN F 1 99  ? 13.417  6.588   45.958  1.00 71.43  ? 85   ASN F OD1   1 
ATOM   5246 N ND2   . ASN F 1 99  ? 14.964  6.462   44.362  1.00 69.54  ? 85   ASN F ND2   1 
ATOM   5247 N N     . GLY F 1 100 ? 17.129  3.317   43.885  1.00 71.60  ? 86   GLY F N     1 
ATOM   5248 C CA    . GLY F 1 100 ? 17.921  2.742   42.805  1.00 72.06  ? 86   GLY F CA    1 
ATOM   5249 C C     . GLY F 1 100 ? 18.219  3.637   41.618  1.00 70.96  ? 86   GLY F C     1 
ATOM   5250 O O     . GLY F 1 100 ? 18.776  3.170   40.628  1.00 70.13  ? 86   GLY F O     1 
ATOM   5251 N N     . TRP F 1 101 ? 17.872  4.922   41.703  1.00 68.94  ? 87   TRP F N     1 
ATOM   5252 C CA    . TRP F 1 101 ? 18.079  5.824   40.571  1.00 66.66  ? 87   TRP F CA    1 
ATOM   5253 C C     . TRP F 1 101 ? 19.483  6.423   40.595  1.00 64.14  ? 87   TRP F C     1 
ATOM   5254 O O     . TRP F 1 101 ? 19.924  7.012   39.612  1.00 62.45  ? 87   TRP F O     1 
ATOM   5255 C CB    . TRP F 1 101 ? 17.002  6.911   40.546  1.00 66.32  ? 87   TRP F CB    1 
ATOM   5256 C CG    . TRP F 1 101 ? 15.608  6.308   40.477  1.00 69.21  ? 87   TRP F CG    1 
ATOM   5257 C CD1   . TRP F 1 101 ? 15.241  5.130   39.858  1.00 72.03  ? 87   TRP F CD1   1 
ATOM   5258 C CD2   . TRP F 1 101 ? 14.404  6.855   41.022  1.00 69.87  ? 87   TRP F CD2   1 
ATOM   5259 N NE1   . TRP F 1 101 ? 13.890  4.919   40.002  1.00 74.64  ? 87   TRP F NE1   1 
ATOM   5260 C CE2   . TRP F 1 101 ? 13.356  5.960   40.714  1.00 74.34  ? 87   TRP F CE2   1 
ATOM   5261 C CE3   . TRP F 1 101 ? 14.108  8.018   41.725  1.00 68.07  ? 87   TRP F CE3   1 
ATOM   5262 C CZ2   . TRP F 1 101 ? 12.032  6.198   41.100  1.00 77.64  ? 87   TRP F CZ2   1 
ATOM   5263 C CZ3   . TRP F 1 101 ? 12.804  8.252   42.106  1.00 70.81  ? 87   TRP F CZ3   1 
ATOM   5264 C CH2   . TRP F 1 101 ? 11.780  7.348   41.801  1.00 75.20  ? 87   TRP F CH2   1 
ATOM   5265 N N     . VAL F 1 102 ? 20.188  6.243   41.707  1.00 62.62  ? 88   VAL F N     1 
ATOM   5266 C CA    . VAL F 1 102 ? 21.536  6.795   41.882  1.00 62.02  ? 88   VAL F CA    1 
ATOM   5267 C C     . VAL F 1 102 ? 22.425  5.813   42.653  1.00 62.83  ? 88   VAL F C     1 
ATOM   5268 O O     . VAL F 1 102 ? 21.929  4.996   43.417  1.00 63.86  ? 88   VAL F O     1 
ATOM   5269 C CB    . VAL F 1 102 ? 21.467  8.153   42.623  1.00 60.19  ? 88   VAL F CB    1 
ATOM   5270 C CG1   . VAL F 1 102 ? 22.819  8.582   43.154  1.00 59.76  ? 88   VAL F CG1   1 
ATOM   5271 C CG2   . VAL F 1 102 ? 20.935  9.238   41.702  1.00 60.70  ? 88   VAL F CG2   1 
ATOM   5272 N N     . ARG F 1 103 ? 23.734  5.876   42.422  1.00 64.23  ? 89   ARG F N     1 
ATOM   5273 C CA    . ARG F 1 103 ? 24.709  5.113   43.213  1.00 64.80  ? 89   ARG F CA    1 
ATOM   5274 C C     . ARG F 1 103 ? 25.930  5.987   43.448  1.00 64.65  ? 89   ARG F C     1 
ATOM   5275 O O     . ARG F 1 103 ? 26.110  6.982   42.761  1.00 63.17  ? 89   ARG F O     1 
ATOM   5276 C CB    . ARG F 1 103 ? 25.105  3.805   42.507  1.00 67.31  ? 89   ARG F CB    1 
ATOM   5277 C CG    . ARG F 1 103 ? 25.826  3.998   41.182  1.00 68.70  ? 89   ARG F CG    1 
ATOM   5278 C CD    . ARG F 1 103 ? 26.157  2.670   40.512  1.00 71.47  ? 89   ARG F CD    1 
ATOM   5279 N NE    . ARG F 1 103 ? 26.884  2.879   39.261  1.00 73.84  ? 89   ARG F NE    1 
ATOM   5280 C CZ    . ARG F 1 103 ? 28.210  2.958   39.137  1.00 75.79  ? 89   ARG F CZ    1 
ATOM   5281 N NH1   . ARG F 1 103 ? 29.007  2.824   40.189  1.00 76.50  ? 89   ARG F NH1   1 
ATOM   5282 N NH2   . ARG F 1 103 ? 28.747  3.173   37.940  1.00 77.64  ? 89   ARG F NH2   1 
ATOM   5283 N N     . ARG F 1 104 ? 26.754  5.604   44.419  1.00 66.93  ? 90   ARG F N     1 
ATOM   5284 C CA    . ARG F 1 104 ? 27.927  6.381   44.806  1.00 68.69  ? 90   ARG F CA    1 
ATOM   5285 C C     . ARG F 1 104 ? 29.230  5.626   44.590  1.00 71.82  ? 90   ARG F C     1 
ATOM   5286 O O     . ARG F 1 104 ? 29.272  4.412   44.732  1.00 73.82  ? 90   ARG F O     1 
ATOM   5287 C CB    . ARG F 1 104 ? 27.832  6.746   46.280  1.00 69.37  ? 90   ARG F CB    1 
ATOM   5288 C CG    . ARG F 1 104 ? 26.815  7.832   46.610  1.00 68.49  ? 90   ARG F CG    1 
ATOM   5289 C CD    . ARG F 1 104 ? 26.055  7.496   47.893  1.00 68.71  ? 90   ARG F CD    1 
ATOM   5290 N NE    . ARG F 1 104 ? 25.802  8.666   48.728  1.00 67.74  ? 90   ARG F NE    1 
ATOM   5291 C CZ    . ARG F 1 104 ? 25.215  8.628   49.922  1.00 68.57  ? 90   ARG F CZ    1 
ATOM   5292 N NH1   . ARG F 1 104 ? 24.800  7.470   50.435  1.00 69.77  ? 90   ARG F NH1   1 
ATOM   5293 N NH2   . ARG F 1 104 ? 25.041  9.755   50.613  1.00 67.29  ? 90   ARG F NH2   1 
ATOM   5294 N N     . GLU F 1 105 ? 30.286  6.366   44.257  1.00 74.43  ? 91   GLU F N     1 
ATOM   5295 C CA    . GLU F 1 105 ? 31.650  5.837   44.181  1.00 80.09  ? 91   GLU F CA    1 
ATOM   5296 C C     . GLU F 1 105 ? 32.631  6.805   44.823  1.00 82.99  ? 91   GLU F C     1 
ATOM   5297 O O     . GLU F 1 105 ? 32.336  7.990   44.971  1.00 80.87  ? 91   GLU F O     1 
ATOM   5298 C CB    . GLU F 1 105 ? 32.075  5.617   42.728  1.00 83.34  ? 91   GLU F CB    1 
ATOM   5299 C CG    . GLU F 1 105 ? 31.789  4.229   42.189  1.00 84.97  ? 91   GLU F CG    1 
ATOM   5300 C CD    . GLU F 1 105 ? 32.329  4.021   40.790  1.00 89.72  ? 91   GLU F CD    1 
ATOM   5301 O OE1   . GLU F 1 105 ? 32.949  4.953   40.226  1.00 92.99  ? 91   GLU F OE1   1 
ATOM   5302 O OE2   . GLU F 1 105 ? 32.137  2.915   40.244  1.00 92.65  ? 91   GLU F OE2   1 
ATOM   5303 N N     . ASP F 1 106 ? 33.809  6.294   45.179  1.00 89.55  ? 92   ASP F N     1 
ATOM   5304 C CA    . ASP F 1 106 ? 34.877  7.117   45.760  1.00 94.01  ? 92   ASP F CA    1 
ATOM   5305 C C     . ASP F 1 106 ? 35.678  7.779   44.641  1.00 95.75  ? 92   ASP F C     1 
ATOM   5306 O O     . ASP F 1 106 ? 35.760  7.234   43.545  1.00 97.32  ? 92   ASP F O     1 
ATOM   5307 C CB    . ASP F 1 106 ? 35.821  6.274   46.635  1.00 100.24 ? 92   ASP F CB    1 
ATOM   5308 C CG    . ASP F 1 106 ? 35.079  5.293   47.544  1.00 101.02 ? 92   ASP F CG    1 
ATOM   5309 O OD1   . ASP F 1 106 ? 33.905  4.970   47.254  1.00 101.72 ? 92   ASP F OD1   1 
ATOM   5310 O OD2   . ASP F 1 106 ? 35.677  4.834   48.539  1.00 104.60 ? 92   ASP F OD2   1 
ATOM   5311 N N     . CYS F 1 107 ? 36.232  8.963   44.912  1.00 71.24  ? 93   CYS F N     1 
ATOM   5312 C CA    . CYS F 1 107 ? 37.186  9.607   44.004  1.00 71.12  ? 93   CYS F CA    1 
ATOM   5313 C C     . CYS F 1 107 ? 38.503  8.877   44.215  1.00 75.89  ? 93   CYS F C     1 
ATOM   5314 O O     . CYS F 1 107 ? 38.884  8.608   45.361  1.00 76.09  ? 93   CYS F O     1 
ATOM   5315 C CB    . CYS F 1 107 ? 37.328  11.108  44.289  1.00 67.75  ? 93   CYS F CB    1 
ATOM   5316 S SG    . CYS F 1 107 ? 38.454  11.987  43.181  1.00 70.06  ? 93   CYS F SG    1 
ATOM   5317 N N     . PRO F 1 108 ? 39.181  8.500   43.121  1.00 80.91  ? 94   PRO F N     1 
ATOM   5318 C CA    . PRO F 1 108 ? 40.383  7.673   43.296  1.00 86.68  ? 94   PRO F CA    1 
ATOM   5319 C C     . PRO F 1 108 ? 41.621  8.456   43.782  1.00 87.12  ? 94   PRO F C     1 
ATOM   5320 O O     . PRO F 1 108 ? 42.375  7.939   44.609  1.00 88.10  ? 94   PRO F O     1 
ATOM   5321 C CB    . PRO F 1 108 ? 40.605  7.063   41.904  1.00 92.41  ? 94   PRO F CB    1 
ATOM   5322 C CG    . PRO F 1 108 ? 39.891  7.959   40.945  1.00 90.34  ? 94   PRO F CG    1 
ATOM   5323 C CD    . PRO F 1 108 ? 38.922  8.822   41.706  1.00 82.85  ? 94   PRO F CD    1 
ATOM   5324 N N     . SER F 1 109 ? 41.805  9.688   43.302  1.00 86.41  ? 95   SER F N     1 
ATOM   5325 C CA    . SER F 1 109 ? 42.940  10.532  43.728  1.00 87.55  ? 95   SER F CA    1 
ATOM   5326 C C     . SER F 1 109 ? 42.724  11.127  45.138  1.00 82.70  ? 95   SER F C     1 
ATOM   5327 O O     . SER F 1 109 ? 43.682  11.334  45.882  1.00 81.79  ? 95   SER F O     1 
ATOM   5328 C CB    . SER F 1 109 ? 43.228  11.647  42.706  1.00 90.36  ? 95   SER F CB    1 
ATOM   5329 O OG    . SER F 1 109 ? 42.441  12.799  42.962  1.00 85.30  ? 95   SER F OG    1 
ATOM   5330 N N     . ASP F 1 110 ? 41.467  11.398  45.494  1.00 78.77  ? 96   ASP F N     1 
ATOM   5331 C CA    . ASP F 1 110 ? 41.139  12.004  46.786  1.00 74.31  ? 96   ASP F CA    1 
ATOM   5332 C C     . ASP F 1 110 ? 40.155  11.102  47.519  1.00 70.36  ? 96   ASP F C     1 
ATOM   5333 O O     . ASP F 1 110 ? 38.956  11.148  47.237  1.00 68.92  ? 96   ASP F O     1 
ATOM   5334 C CB    . ASP F 1 110 ? 40.546  13.399  46.562  1.00 72.47  ? 96   ASP F CB    1 
ATOM   5335 C CG    . ASP F 1 110 ? 40.536  14.239  47.825  1.00 70.19  ? 96   ASP F CG    1 
ATOM   5336 O OD1   . ASP F 1 110 ? 40.446  13.670  48.923  1.00 68.97  ? 96   ASP F OD1   1 
ATOM   5337 O OD2   . ASP F 1 110 ? 40.608  15.480  47.730  1.00 71.18  ? 96   ASP F OD2   1 
ATOM   5338 N N     . LYS F 1 111 ? 40.651  10.295  48.464  1.00 69.20  ? 97   LYS F N     1 
ATOM   5339 C CA    . LYS F 1 111 ? 39.834  9.253   49.109  1.00 68.23  ? 97   LYS F CA    1 
ATOM   5340 C C     . LYS F 1 111 ? 38.735  9.850   50.015  1.00 64.25  ? 97   LYS F C     1 
ATOM   5341 O O     . LYS F 1 111 ? 38.205  9.194   50.906  1.00 65.43  ? 97   LYS F O     1 
ATOM   5342 C CB    . LYS F 1 111 ? 40.738  8.265   49.875  1.00 72.16  ? 97   LYS F CB    1 
ATOM   5343 C CG    . LYS F 1 111 ? 41.738  7.506   48.991  1.00 77.98  ? 97   LYS F CG    1 
ATOM   5344 C CD    . LYS F 1 111 ? 42.805  6.730   49.772  1.00 82.40  ? 97   LYS F CD    1 
ATOM   5345 N N     . ARG F 1 112 ? 38.384  11.096  49.729  1.00 60.96  ? 98   ARG F N     1 
ATOM   5346 C CA    . ARG F 1 112 ? 37.563  11.942  50.567  1.00 59.22  ? 98   ARG F CA    1 
ATOM   5347 C C     . ARG F 1 112 ? 36.312  12.286  49.793  1.00 57.55  ? 98   ARG F C     1 
ATOM   5348 O O     . ARG F 1 112 ? 35.224  12.382  50.349  1.00 57.11  ? 98   ARG F O     1 
ATOM   5349 C CB    . ARG F 1 112 ? 38.362  13.220  50.828  1.00 59.66  ? 98   ARG F CB    1 
ATOM   5350 C CG    . ARG F 1 112 ? 37.878  14.142  51.931  1.00 61.25  ? 98   ARG F CG    1 
ATOM   5351 C CD    . ARG F 1 112 ? 39.078  14.729  52.671  1.00 62.75  ? 98   ARG F CD    1 
ATOM   5352 N NE    . ARG F 1 112 ? 39.334  16.172  52.518  1.00 64.63  ? 98   ARG F NE    1 
ATOM   5353 C CZ    . ARG F 1 112 ? 39.838  16.770  51.440  1.00 67.30  ? 98   ARG F CZ    1 
ATOM   5354 N NH1   . ARG F 1 112 ? 40.094  16.095  50.324  1.00 67.44  ? 98   ARG F NH1   1 
ATOM   5355 N NH2   . ARG F 1 112 ? 40.071  18.077  51.473  1.00 71.55  ? 98   ARG F NH2   1 
ATOM   5356 N N     . GLY F 1 113 ? 36.500  12.533  48.500  1.00 57.73  ? 99   GLY F N     1 
ATOM   5357 C CA    . GLY F 1 113 ? 35.422  12.881  47.593  1.00 57.13  ? 99   GLY F CA    1 
ATOM   5358 C C     . GLY F 1 113 ? 34.525  11.711  47.274  1.00 56.76  ? 99   GLY F C     1 
ATOM   5359 O O     . GLY F 1 113 ? 34.897  10.556  47.412  1.00 54.95  ? 99   GLY F O     1 
ATOM   5360 N N     . GLN F 1 114 ? 33.308  12.031  46.881  1.00 59.26  ? 100  GLN F N     1 
ATOM   5361 C CA    . GLN F 1 114 ? 32.354  11.016  46.511  1.00 58.84  ? 100  GLN F CA    1 
ATOM   5362 C C     . GLN F 1 114 ? 31.640  11.429  45.249  1.00 56.49  ? 100  GLN F C     1 
ATOM   5363 O O     . GLN F 1 114 ? 31.373  12.604  45.045  1.00 55.13  ? 100  GLN F O     1 
ATOM   5364 C CB    . GLN F 1 114 ? 31.387  10.821  47.655  1.00 59.48  ? 100  GLN F CB    1 
ATOM   5365 C CG    . GLN F 1 114 ? 30.774  9.438   47.674  1.00 61.59  ? 100  GLN F CG    1 
ATOM   5366 C CD    . GLN F 1 114 ? 31.600  8.349   48.337  1.00 62.71  ? 100  GLN F CD    1 
ATOM   5367 O OE1   . GLN F 1 114 ? 31.056  7.289   48.593  1.00 65.14  ? 100  GLN F OE1   1 
ATOM   5368 N NE2   . GLN F 1 114 ? 32.910  8.558   48.553  1.00 63.49  ? 100  GLN F NE2   1 
ATOM   5369 N N     . PHE F 1 115 ? 31.412  10.463  44.371  1.00 57.47  ? 101  PHE F N     1 
ATOM   5370 C CA    . PHE F 1 115 ? 30.701  10.709  43.127  1.00 58.42  ? 101  PHE F CA    1 
ATOM   5371 C C     . PHE F 1 115 ? 29.268  10.258  43.312  1.00 58.11  ? 101  PHE F C     1 
ATOM   5372 O O     . PHE F 1 115 ? 29.012  9.264   43.969  1.00 59.59  ? 101  PHE F O     1 
ATOM   5373 C CB    . PHE F 1 115 ? 31.349  9.958   41.940  1.00 60.13  ? 101  PHE F CB    1 
ATOM   5374 C CG    . PHE F 1 115 ? 32.503  10.691  41.293  1.00 62.13  ? 101  PHE F CG    1 
ATOM   5375 C CD1   . PHE F 1 115 ? 32.277  11.793  40.472  1.00 64.08  ? 101  PHE F CD1   1 
ATOM   5376 C CD2   . PHE F 1 115 ? 33.816  10.275  41.490  1.00 65.30  ? 101  PHE F CD2   1 
ATOM   5377 C CE1   . PHE F 1 115 ? 33.331  12.477  39.880  1.00 65.80  ? 101  PHE F CE1   1 
ATOM   5378 C CE2   . PHE F 1 115 ? 34.881  10.954  40.895  1.00 67.85  ? 101  PHE F CE2   1 
ATOM   5379 C CZ    . PHE F 1 115 ? 34.632  12.055  40.093  1.00 68.52  ? 101  PHE F CZ    1 
ATOM   5380 N N     . ALA F 1 116 ? 28.347  11.017  42.727  1.00 59.42  ? 102  ALA F N     1 
ATOM   5381 C CA    . ALA F 1 116 ? 26.967  10.601  42.557  1.00 58.60  ? 102  ALA F CA    1 
ATOM   5382 C C     . ALA F 1 116 ? 26.809  10.223  41.102  1.00 58.24  ? 102  ALA F C     1 
ATOM   5383 O O     . ALA F 1 116 ? 27.024  11.041  40.211  1.00 61.02  ? 102  ALA F O     1 
ATOM   5384 C CB    . ALA F 1 116 ? 26.022  11.729  42.918  1.00 59.40  ? 102  ALA F CB    1 
ATOM   5385 N N     . ILE F 1 117 ? 26.424  8.980   40.862  1.00 58.84  ? 103  ILE F N     1 
ATOM   5386 C CA    . ILE F 1 117 ? 26.300  8.460   39.515  1.00 59.94  ? 103  ILE F CA    1 
ATOM   5387 C C     . ILE F 1 117 ? 24.848  8.061   39.285  1.00 57.53  ? 103  ILE F C     1 
ATOM   5388 O O     . ILE F 1 117 ? 24.255  7.384   40.116  1.00 57.48  ? 103  ILE F O     1 
ATOM   5389 C CB    . ILE F 1 117 ? 27.195  7.219   39.320  1.00 63.31  ? 103  ILE F CB    1 
ATOM   5390 C CG1   . ILE F 1 117 ? 28.647  7.547   39.691  1.00 65.39  ? 103  ILE F CG1   1 
ATOM   5391 C CG2   . ILE F 1 117 ? 27.091  6.707   37.886  1.00 65.66  ? 103  ILE F CG2   1 
ATOM   5392 C CD1   . ILE F 1 117 ? 29.527  6.336   39.903  1.00 68.02  ? 103  ILE F CD1   1 
ATOM   5393 N N     . LEU F 1 118 ? 24.304  8.475   38.146  1.00 55.55  ? 104  LEU F N     1 
ATOM   5394 C CA    . LEU F 1 118 ? 22.966  8.098   37.729  1.00 55.46  ? 104  LEU F CA    1 
ATOM   5395 C C     . LEU F 1 118 ? 22.966  6.663   37.200  1.00 56.87  ? 104  LEU F C     1 
ATOM   5396 O O     . LEU F 1 118 ? 23.671  6.360   36.248  1.00 60.83  ? 104  LEU F O     1 
ATOM   5397 C CB    . LEU F 1 118 ? 22.493  9.059   36.631  1.00 55.95  ? 104  LEU F CB    1 
ATOM   5398 C CG    . LEU F 1 118 ? 21.142  8.837   35.955  1.00 56.82  ? 104  LEU F CG    1 
ATOM   5399 C CD1   . LEU F 1 118 ? 20.018  8.904   36.966  1.00 58.15  ? 104  LEU F CD1   1 
ATOM   5400 C CD2   . LEU F 1 118 ? 20.928  9.865   34.855  1.00 58.41  ? 104  LEU F CD2   1 
ATOM   5401 N N     . THR F 1 119 ? 22.165  5.787   37.794  1.00 57.37  ? 105  THR F N     1 
ATOM   5402 C CA    . THR F 1 119 ? 22.039  4.408   37.308  1.00 58.68  ? 105  THR F CA    1 
ATOM   5403 C C     . THR F 1 119 ? 21.303  4.339   35.976  1.00 60.05  ? 105  THR F C     1 
ATOM   5404 O O     . THR F 1 119 ? 20.685  5.312   35.559  1.00 60.43  ? 105  THR F O     1 
ATOM   5405 C CB    . THR F 1 119 ? 21.217  3.570   38.275  1.00 60.04  ? 105  THR F CB    1 
ATOM   5406 O OG1   . THR F 1 119 ? 19.915  4.144   38.392  1.00 58.57  ? 105  THR F OG1   1 
ATOM   5407 C CG2   . THR F 1 119 ? 21.886  3.513   39.645  1.00 61.44  ? 105  THR F CG2   1 
ATOM   5408 N N     . ASP F 1 120 ? 21.349  3.188   35.310  1.00 63.84  ? 106  ASP F N     1 
ATOM   5409 C CA    . ASP F 1 120 ? 20.509  2.968   34.120  1.00 63.91  ? 106  ASP F CA    1 
ATOM   5410 C C     . ASP F 1 120 ? 19.042  3.215   34.446  1.00 62.38  ? 106  ASP F C     1 
ATOM   5411 O O     . ASP F 1 120 ? 18.373  3.961   33.742  1.00 61.91  ? 106  ASP F O     1 
ATOM   5412 C CB    . ASP F 1 120 ? 20.661  1.540   33.568  1.00 68.57  ? 106  ASP F CB    1 
ATOM   5413 C CG    . ASP F 1 120 ? 21.973  1.325   32.816  1.00 71.59  ? 106  ASP F CG    1 
ATOM   5414 O OD1   . ASP F 1 120 ? 22.529  2.301   32.273  1.00 69.87  ? 106  ASP F OD1   1 
ATOM   5415 O OD2   . ASP F 1 120 ? 22.446  0.169   32.755  1.00 76.50  ? 106  ASP F OD2   1 
ATOM   5416 N N     . GLU F 1 121 ? 18.546  2.587   35.514  1.00 63.03  ? 107  GLU F N     1 
ATOM   5417 C CA    . GLU F 1 121 ? 17.127  2.704   35.893  1.00 62.20  ? 107  GLU F CA    1 
ATOM   5418 C C     . GLU F 1 121 ? 16.720  4.145   36.098  1.00 58.90  ? 107  GLU F C     1 
ATOM   5419 O O     . GLU F 1 121 ? 15.599  4.543   35.767  1.00 57.75  ? 107  GLU F O     1 
ATOM   5420 C CB    . GLU F 1 121 ? 16.850  1.911   37.178  1.00 64.80  ? 107  GLU F CB    1 
ATOM   5421 N N     . GLY F 1 122 ? 17.645  4.925   36.650  1.00 57.71  ? 108  GLY F N     1 
ATOM   5422 C CA    . GLY F 1 122 ? 17.419  6.341   36.886  1.00 56.25  ? 108  GLY F CA    1 
ATOM   5423 C C     . GLY F 1 122 ? 17.240  7.055   35.566  1.00 56.49  ? 108  GLY F C     1 
ATOM   5424 O O     . GLY F 1 122 ? 16.295  7.835   35.397  1.00 55.87  ? 108  GLY F O     1 
ATOM   5425 N N     . TYR F 1 123 ? 18.147  6.779   34.623  1.00 55.56  ? 109  TYR F N     1 
ATOM   5426 C CA    . TYR F 1 123 ? 18.019  7.292   33.263  1.00 55.93  ? 109  TYR F CA    1 
ATOM   5427 C C     . TYR F 1 123 ? 16.705  6.888   32.616  1.00 54.11  ? 109  TYR F C     1 
ATOM   5428 O O     . TYR F 1 123 ? 16.137  7.652   31.859  1.00 53.54  ? 109  TYR F O     1 
ATOM   5429 C CB    . TYR F 1 123 ? 19.165  6.804   32.397  1.00 58.60  ? 109  TYR F CB    1 
ATOM   5430 C CG    . TYR F 1 123 ? 19.319  7.567   31.113  1.00 61.82  ? 109  TYR F CG    1 
ATOM   5431 C CD1   . TYR F 1 123 ? 19.942  8.803   31.098  1.00 63.45  ? 109  TYR F CD1   1 
ATOM   5432 C CD2   . TYR F 1 123 ? 18.848  7.043   29.903  1.00 64.77  ? 109  TYR F CD2   1 
ATOM   5433 C CE1   . TYR F 1 123 ? 20.103  9.507   29.911  1.00 67.41  ? 109  TYR F CE1   1 
ATOM   5434 C CE2   . TYR F 1 123 ? 19.002  7.734   28.710  1.00 67.17  ? 109  TYR F CE2   1 
ATOM   5435 C CZ    . TYR F 1 123 ? 19.632  8.964   28.722  1.00 69.50  ? 109  TYR F CZ    1 
ATOM   5436 O OH    . TYR F 1 123 ? 19.782  9.653   27.546  1.00 75.56  ? 109  TYR F OH    1 
ATOM   5437 N N     . GLU F 1 124 ? 16.212  5.698   32.937  1.00 55.65  ? 110  GLU F N     1 
ATOM   5438 C CA    . GLU F 1 124 ? 14.933  5.234   32.392  1.00 57.14  ? 110  GLU F CA    1 
ATOM   5439 C C     . GLU F 1 124 ? 13.734  5.977   32.972  1.00 58.20  ? 110  GLU F C     1 
ATOM   5440 O O     . GLU F 1 124 ? 12.734  6.139   32.283  1.00 60.55  ? 110  GLU F O     1 
ATOM   5441 C CB    . GLU F 1 124 ? 14.766  3.711   32.539  1.00 58.85  ? 110  GLU F CB    1 
ATOM   5442 C CG    . GLU F 1 124 ? 15.167  2.949   31.282  1.00 59.35  ? 110  GLU F CG    1 
ATOM   5443 N N     . VAL F 1 125 ? 13.839  6.456   34.215  1.00 59.02  ? 111  VAL F N     1 
ATOM   5444 C CA    . VAL F 1 125 ? 12.793  7.302   34.804  1.00 59.96  ? 111  VAL F CA    1 
ATOM   5445 C C     . VAL F 1 125 ? 12.751  8.681   34.141  1.00 60.50  ? 111  VAL F C     1 
ATOM   5446 O O     . VAL F 1 125 ? 11.677  9.298   34.035  1.00 64.94  ? 111  VAL F O     1 
ATOM   5447 C CB    . VAL F 1 125 ? 12.964  7.466   36.327  1.00 61.28  ? 111  VAL F CB    1 
ATOM   5448 C CG1   . VAL F 1 125 ? 11.924  8.425   36.894  1.00 65.58  ? 111  VAL F CG1   1 
ATOM   5449 C CG2   . VAL F 1 125 ? 12.817  6.128   37.005  1.00 62.38  ? 111  VAL F CG2   1 
ATOM   5450 N N     . LEU F 1 126 ? 13.903  9.194   33.729  1.00 62.49  ? 112  LEU F N     1 
ATOM   5451 C CA    . LEU F 1 126 ? 13.926  10.485  33.046  1.00 62.08  ? 112  LEU F CA    1 
ATOM   5452 C C     . LEU F 1 126 ? 13.273  10.333  31.697  1.00 63.01  ? 112  LEU F C     1 
ATOM   5453 O O     . LEU F 1 126 ? 12.396  11.120  31.347  1.00 63.51  ? 112  LEU F O     1 
ATOM   5454 C CB    . LEU F 1 126 ? 15.345  11.017  32.865  1.00 62.67  ? 112  LEU F CB    1 
ATOM   5455 C CG    . LEU F 1 126 ? 15.864  11.831  34.042  1.00 62.18  ? 112  LEU F CG    1 
ATOM   5456 C CD1   . LEU F 1 126 ? 16.034  10.914  35.226  1.00 64.10  ? 112  LEU F CD1   1 
ATOM   5457 C CD2   . LEU F 1 126 ? 17.185  12.484  33.701  1.00 62.77  ? 112  LEU F CD2   1 
ATOM   5458 N N     . ARG F 1 127 ? 13.691  9.315   30.950  1.00 63.52  ? 113  ARG F N     1 
ATOM   5459 C CA    . ARG F 1 127 ? 13.147  9.070   29.626  1.00 65.13  ? 113  ARG F CA    1 
ATOM   5460 C C     . ARG F 1 127 ? 11.632  8.922   29.712  1.00 65.39  ? 113  ARG F C     1 
ATOM   5461 O O     . ARG F 1 127 ? 10.892  9.477   28.903  1.00 63.09  ? 113  ARG F O     1 
ATOM   5462 C CB    . ARG F 1 127 ? 13.786  7.824   29.005  1.00 68.45  ? 113  ARG F CB    1 
ATOM   5463 C CG    . ARG F 1 127 ? 13.664  7.742   27.490  1.00 70.77  ? 113  ARG F CG    1 
ATOM   5464 C CD    . ARG F 1 127 ? 14.148  6.403   26.949  1.00 73.62  ? 113  ARG F CD    1 
ATOM   5465 N NE    . ARG F 1 127 ? 13.530  5.314   27.703  1.00 75.92  ? 113  ARG F NE    1 
ATOM   5466 C CZ    . ARG F 1 127 ? 12.238  4.982   27.650  1.00 77.94  ? 113  ARG F CZ    1 
ATOM   5467 N NH1   . ARG F 1 127 ? 11.390  5.612   26.835  1.00 77.36  ? 113  ARG F NH1   1 
ATOM   5468 N NH2   . ARG F 1 127 ? 11.787  3.991   28.418  1.00 80.48  ? 113  ARG F NH2   1 
ATOM   5469 N N     . ARG F 1 128 ? 11.170  8.191   30.722  1.00 68.17  ? 114  ARG F N     1 
ATOM   5470 C CA    . ARG F 1 128 ? 9.740   7.989   30.929  1.00 69.11  ? 114  ARG F CA    1 
ATOM   5471 C C     . ARG F 1 128 ? 8.975   9.281   31.266  1.00 68.39  ? 114  ARG F C     1 
ATOM   5472 O O     . ARG F 1 128 ? 7.901   9.521   30.705  1.00 69.13  ? 114  ARG F O     1 
ATOM   5473 C CB    . ARG F 1 128 ? 9.511   6.945   32.013  1.00 70.78  ? 114  ARG F CB    1 
ATOM   5474 C CG    . ARG F 1 128 ? 9.812   5.543   31.535  1.00 73.34  ? 114  ARG F CG    1 
ATOM   5475 C CD    . ARG F 1 128 ? 9.738   4.544   32.660  1.00 75.61  ? 114  ARG F CD    1 
ATOM   5476 N NE    . ARG F 1 128 ? 9.715   3.209   32.078  1.00 78.52  ? 114  ARG F NE    1 
ATOM   5477 C CZ    . ARG F 1 128 ? 8.904   2.222   32.450  1.00 81.52  ? 114  ARG F CZ    1 
ATOM   5478 N NH1   . ARG F 1 128 ? 8.006   2.391   33.421  1.00 81.44  ? 114  ARG F NH1   1 
ATOM   5479 N NH2   . ARG F 1 128 ? 8.984   1.046   31.834  1.00 84.08  ? 114  ARG F NH2   1 
ATOM   5480 N N     . THR F 1 129 ? 9.542   10.125  32.129  1.00 65.54  ? 115  THR F N     1 
ATOM   5481 C CA    . THR F 1 129 ? 8.783   11.235  32.706  1.00 64.53  ? 115  THR F CA    1 
ATOM   5482 C C     . THR F 1 129 ? 9.027   12.625  32.101  1.00 62.79  ? 115  THR F C     1 
ATOM   5483 O O     . THR F 1 129 ? 8.116   13.447  32.060  1.00 63.56  ? 115  THR F O     1 
ATOM   5484 C CB    . THR F 1 129 ? 9.054   11.332  34.203  1.00 64.73  ? 115  THR F CB    1 
ATOM   5485 O OG1   . THR F 1 129 ? 10.443  11.620  34.396  1.00 65.77  ? 115  THR F OG1   1 
ATOM   5486 C CG2   . THR F 1 129 ? 8.684   10.023  34.893  1.00 64.79  ? 115  THR F CG2   1 
ATOM   5487 N N     . ALA F 1 130 ? 10.238  12.889  31.635  1.00 62.10  ? 116  ALA F N     1 
ATOM   5488 C CA    . ALA F 1 130 ? 10.583  14.210  31.088  1.00 60.04  ? 116  ALA F CA    1 
ATOM   5489 C C     . ALA F 1 130 ? 9.505   14.841  30.220  1.00 58.32  ? 116  ALA F C     1 
ATOM   5490 O O     . ALA F 1 130 ? 9.130   15.972  30.480  1.00 60.00  ? 116  ALA F O     1 
ATOM   5491 C CB    . ALA F 1 130 ? 11.912  14.159  30.341  1.00 61.10  ? 116  ALA F CB    1 
ATOM   5492 N N     . PRO F 1 131 ? 9.011   14.124  29.186  1.00 57.09  ? 117  PRO F N     1 
ATOM   5493 C CA    . PRO F 1 131 ? 7.954   14.693  28.345  1.00 55.85  ? 117  PRO F CA    1 
ATOM   5494 C C     . PRO F 1 131 ? 6.797   15.256  29.142  1.00 54.77  ? 117  PRO F C     1 
ATOM   5495 O O     . PRO F 1 131 ? 6.338   16.362  28.854  1.00 58.64  ? 117  PRO F O     1 
ATOM   5496 C CB    . PRO F 1 131 ? 7.479   13.511  27.490  1.00 57.17  ? 117  PRO F CB    1 
ATOM   5497 C CG    . PRO F 1 131 ? 8.464   12.409  27.697  1.00 58.20  ? 117  PRO F CG    1 
ATOM   5498 C CD    . PRO F 1 131 ? 9.574   12.903  28.585  1.00 57.44  ? 117  PRO F CD    1 
ATOM   5499 N N     . GLY F 1 132 ? 6.328   14.518  30.134  1.00 53.58  ? 118  GLY F N     1 
ATOM   5500 C CA    . GLY F 1 132 ? 5.314   15.039  31.053  1.00 52.13  ? 118  GLY F CA    1 
ATOM   5501 C C     . GLY F 1 132 ? 5.782   16.325  31.711  1.00 50.04  ? 118  GLY F C     1 
ATOM   5502 O O     . GLY F 1 132 ? 5.123   17.362  31.605  1.00 49.16  ? 118  GLY F O     1 
ATOM   5503 N N     . HIS F 1 133 ? 6.939   16.269  32.363  1.00 49.52  ? 119  HIS F N     1 
ATOM   5504 C CA    . HIS F 1 133 ? 7.453   17.429  33.070  1.00 49.69  ? 119  HIS F CA    1 
ATOM   5505 C C     . HIS F 1 133 ? 7.691   18.627  32.149  1.00 50.42  ? 119  HIS F C     1 
ATOM   5506 O O     . HIS F 1 133 ? 7.467   19.777  32.542  1.00 47.59  ? 119  HIS F O     1 
ATOM   5507 C CB    . HIS F 1 133 ? 8.749   17.101  33.810  1.00 50.41  ? 119  HIS F CB    1 
ATOM   5508 C CG    . HIS F 1 133 ? 9.361   18.290  34.494  1.00 50.62  ? 119  HIS F CG    1 
ATOM   5509 N ND1   . HIS F 1 133 ? 8.778   18.897  35.591  1.00 50.19  ? 119  HIS F ND1   1 
ATOM   5510 C CD2   . HIS F 1 133 ? 10.461  19.023  34.193  1.00 49.54  ? 119  HIS F CD2   1 
ATOM   5511 C CE1   . HIS F 1 133 ? 9.513   19.932  35.953  1.00 50.74  ? 119  HIS F CE1   1 
ATOM   5512 N NE2   . HIS F 1 133 ? 10.537  20.033  35.119  1.00 50.50  ? 119  HIS F NE2   1 
ATOM   5513 N N     . VAL F 1 134 ? 8.155   18.360  30.932  1.00 52.68  ? 120  VAL F N     1 
ATOM   5514 C CA    . VAL F 1 134 ? 8.351   19.418  29.957  1.00 54.45  ? 120  VAL F CA    1 
ATOM   5515 C C     . VAL F 1 134 ? 7.009   20.071  29.609  1.00 53.62  ? 120  VAL F C     1 
ATOM   5516 O O     . VAL F 1 134 ? 6.916   21.289  29.641  1.00 54.31  ? 120  VAL F O     1 
ATOM   5517 C CB    . VAL F 1 134 ? 9.118   18.914  28.707  1.00 57.35  ? 120  VAL F CB    1 
ATOM   5518 C CG1   . VAL F 1 134 ? 9.109   19.946  27.577  1.00 57.01  ? 120  VAL F CG1   1 
ATOM   5519 C CG2   . VAL F 1 134 ? 10.555  18.600  29.091  1.00 57.62  ? 120  VAL F CG2   1 
ATOM   5520 N N     . ASP F 1 135 ? 5.990   19.280  29.290  1.00 53.61  ? 121  ASP F N     1 
ATOM   5521 C CA    . ASP F 1 135 ? 4.648   19.827  29.048  1.00 55.48  ? 121  ASP F CA    1 
ATOM   5522 C C     . ASP F 1 135 ? 4.238   20.765  30.131  1.00 56.12  ? 121  ASP F C     1 
ATOM   5523 O O     . ASP F 1 135 ? 3.940   21.934  29.875  1.00 58.45  ? 121  ASP F O     1 
ATOM   5524 C CB    . ASP F 1 135 ? 3.580   18.729  28.958  1.00 56.86  ? 121  ASP F CB    1 
ATOM   5525 C CG    . ASP F 1 135 ? 3.336   18.333  27.568  1.00 57.46  ? 121  ASP F CG    1 
ATOM   5526 O OD1   . ASP F 1 135 ? 4.353   18.210  26.863  1.00 60.99  ? 121  ASP F OD1   1 
ATOM   5527 O OD2   . ASP F 1 135 ? 2.164   18.221  27.149  1.00 57.48  ? 121  ASP F OD2   1 
ATOM   5528 N N     . ALA F 1 136 ? 4.217   20.241  31.353  1.00 55.90  ? 122  ALA F N     1 
ATOM   5529 C CA    . ALA F 1 136 ? 3.818   21.030  32.518  1.00 55.43  ? 122  ALA F CA    1 
ATOM   5530 C C     . ALA F 1 136 ? 4.574   22.364  32.613  1.00 54.02  ? 122  ALA F C     1 
ATOM   5531 O O     . ALA F 1 136 ? 3.979   23.388  32.962  1.00 56.21  ? 122  ALA F O     1 
ATOM   5532 C CB    . ALA F 1 136 ? 3.997   20.216  33.792  1.00 55.81  ? 122  ALA F CB    1 
ATOM   5533 N N     . VAL F 1 137 ? 5.865   22.353  32.295  1.00 52.59  ? 123  VAL F N     1 
ATOM   5534 C CA    . VAL F 1 137 ? 6.676   23.568  32.327  1.00 52.83  ? 123  VAL F CA    1 
ATOM   5535 C C     . VAL F 1 137 ? 6.382   24.464  31.137  1.00 54.06  ? 123  VAL F C     1 
ATOM   5536 O O     . VAL F 1 137 ? 6.450   25.685  31.238  1.00 54.99  ? 123  VAL F O     1 
ATOM   5537 C CB    . VAL F 1 137 ? 8.172   23.232  32.395  1.00 52.91  ? 123  VAL F CB    1 
ATOM   5538 C CG1   . VAL F 1 137 ? 9.021   24.477  32.188  1.00 54.31  ? 123  VAL F CG1   1 
ATOM   5539 C CG2   . VAL F 1 137 ? 8.516   22.595  33.732  1.00 52.42  ? 123  VAL F CG2   1 
ATOM   5540 N N     . ARG F 1 138 ? 6.059   23.869  30.004  1.00 56.06  ? 124  ARG F N     1 
ATOM   5541 C CA    . ARG F 1 138 ? 5.597   24.645  28.865  1.00 58.30  ? 124  ARG F CA    1 
ATOM   5542 C C     . ARG F 1 138 ? 4.296   25.350  29.168  1.00 58.67  ? 124  ARG F C     1 
ATOM   5543 O O     . ARG F 1 138 ? 4.199   26.564  29.037  1.00 59.87  ? 124  ARG F O     1 
ATOM   5544 C CB    . ARG F 1 138 ? 5.336   23.743  27.662  1.00 60.61  ? 124  ARG F CB    1 
ATOM   5545 C CG    . ARG F 1 138 ? 6.534   23.452  26.817  1.00 61.70  ? 124  ARG F CG    1 
ATOM   5546 C CD    . ARG F 1 138 ? 6.020   22.841  25.517  1.00 63.56  ? 124  ARG F CD    1 
ATOM   5547 N NE    . ARG F 1 138 ? 4.584   23.107  25.272  1.00 63.78  ? 124  ARG F NE    1 
ATOM   5548 C CZ    . ARG F 1 138 ? 3.558   22.253  25.451  1.00 65.73  ? 124  ARG F CZ    1 
ATOM   5549 N NH1   . ARG F 1 138 ? 3.732   21.004  25.884  1.00 67.43  ? 124  ARG F NH1   1 
ATOM   5550 N NH2   . ARG F 1 138 ? 2.314   22.655  25.189  1.00 65.77  ? 124  ARG F NH2   1 
ATOM   5551 N N     . GLN F 1 139 ? 3.293   24.563  29.547  1.00 59.74  ? 125  GLN F N     1 
ATOM   5552 C CA    . GLN F 1 139 ? 1.914   25.039  29.673  1.00 61.89  ? 125  GLN F CA    1 
ATOM   5553 C C     . GLN F 1 139 ? 1.801   26.134  30.740  1.00 60.25  ? 125  GLN F C     1 
ATOM   5554 O O     . GLN F 1 139 ? 1.113   27.124  30.534  1.00 59.70  ? 125  GLN F O     1 
ATOM   5555 C CB    . GLN F 1 139 ? 0.964   23.841  29.919  1.00 62.65  ? 125  GLN F CB    1 
ATOM   5556 C CG    . GLN F 1 139 ? 0.749   23.037  28.632  1.00 63.88  ? 125  GLN F CG    1 
ATOM   5557 C CD    . GLN F 1 139 ? 0.030   21.715  28.809  1.00 64.04  ? 125  GLN F CD    1 
ATOM   5558 O OE1   . GLN F 1 139 ? -0.006  21.151  29.897  1.00 66.19  ? 125  GLN F OE1   1 
ATOM   5559 N NE2   . GLN F 1 139 ? -0.562  21.217  27.728  1.00 64.77  ? 125  GLN F NE2   1 
ATOM   5560 N N     . ALA F 1 140 ? 2.552   25.985  31.828  1.00 58.34  ? 126  ALA F N     1 
ATOM   5561 C CA    . ALA F 1 140 ? 2.570   26.970  32.893  1.00 57.31  ? 126  ALA F CA    1 
ATOM   5562 C C     . ALA F 1 140 ? 3.318   28.240  32.513  1.00 55.87  ? 126  ALA F C     1 
ATOM   5563 O O     . ALA F 1 140 ? 2.972   29.319  32.989  1.00 55.69  ? 126  ALA F O     1 
ATOM   5564 C CB    . ALA F 1 140 ? 3.195   26.364  34.139  1.00 58.48  ? 126  ALA F CB    1 
ATOM   5565 N N     . VAL F 1 141 ? 4.341   28.121  31.668  1.00 53.54  ? 127  VAL F N     1 
ATOM   5566 C CA    . VAL F 1 141 ? 5.245   29.242  31.412  1.00 52.00  ? 127  VAL F CA    1 
ATOM   5567 C C     . VAL F 1 141 ? 5.394   29.611  29.934  1.00 52.25  ? 127  VAL F C     1 
ATOM   5568 O O     . VAL F 1 141 ? 4.812   30.595  29.482  1.00 52.11  ? 127  VAL F O     1 
ATOM   5569 C CB    . VAL F 1 141 ? 6.638   28.974  32.023  1.00 50.26  ? 127  VAL F CB    1 
ATOM   5570 C CG1   . VAL F 1 141 ? 7.597   30.128  31.730  1.00 50.56  ? 127  VAL F CG1   1 
ATOM   5571 C CG2   . VAL F 1 141 ? 6.524   28.759  33.519  1.00 49.64  ? 127  VAL F CG2   1 
ATOM   5572 N N     . PHE F 1 142 ? 6.154   28.822  29.180  1.00 53.18  ? 128  PHE F N     1 
ATOM   5573 C CA    . PHE F 1 142 ? 6.634   29.251  27.859  1.00 54.00  ? 128  PHE F CA    1 
ATOM   5574 C C     . PHE F 1 142 ? 5.549   29.449  26.799  1.00 54.71  ? 128  PHE F C     1 
ATOM   5575 O O     . PHE F 1 142 ? 5.603   30.410  26.032  1.00 53.69  ? 128  PHE F O     1 
ATOM   5576 C CB    . PHE F 1 142 ? 7.734   28.325  27.372  1.00 55.41  ? 128  PHE F CB    1 
ATOM   5577 C CG    . PHE F 1 142 ? 8.957   28.397  28.227  1.00 55.32  ? 128  PHE F CG    1 
ATOM   5578 C CD1   . PHE F 1 142 ? 9.842   29.452  28.101  1.00 56.07  ? 128  PHE F CD1   1 
ATOM   5579 C CD2   . PHE F 1 142 ? 9.184   27.456  29.208  1.00 55.65  ? 128  PHE F CD2   1 
ATOM   5580 C CE1   . PHE F 1 142 ? 10.957  29.550  28.929  1.00 55.97  ? 128  PHE F CE1   1 
ATOM   5581 C CE2   . PHE F 1 142 ? 10.294  27.549  30.033  1.00 55.35  ? 128  PHE F CE2   1 
ATOM   5582 C CZ    . PHE F 1 142 ? 11.186  28.593  29.888  1.00 54.56  ? 128  PHE F CZ    1 
ATOM   5583 N N     . ASP F 1 143 ? 4.537   28.594  26.800  1.00 56.05  ? 129  ASP F N     1 
ATOM   5584 C CA    . ASP F 1 143 ? 3.374   28.802  25.935  1.00 60.00  ? 129  ASP F CA    1 
ATOM   5585 C C     . ASP F 1 143 ? 2.640   30.128  26.169  1.00 61.16  ? 129  ASP F C     1 
ATOM   5586 O O     . ASP F 1 143 ? 1.822   30.523  25.337  1.00 61.02  ? 129  ASP F O     1 
ATOM   5587 C CB    . ASP F 1 143 ? 2.366   27.651  26.086  1.00 62.57  ? 129  ASP F CB    1 
ATOM   5588 C CG    . ASP F 1 143 ? 2.783   26.382  25.324  1.00 67.02  ? 129  ASP F CG    1 
ATOM   5589 O OD1   . ASP F 1 143 ? 3.687   26.440  24.458  1.00 64.27  ? 129  ASP F OD1   1 
ATOM   5590 O OD2   . ASP F 1 143 ? 2.198   25.315  25.634  1.00 74.83  ? 129  ASP F OD2   1 
ATOM   5591 N N     . ARG F 1 144 ? 2.904   30.795  27.297  1.00 61.32  ? 130  ARG F N     1 
ATOM   5592 C CA    . ARG F 1 144 ? 2.162   32.000  27.680  1.00 62.07  ? 130  ARG F CA    1 
ATOM   5593 C C     . ARG F 1 144 ? 2.926   33.313  27.475  1.00 62.68  ? 130  ARG F C     1 
ATOM   5594 O O     . ARG F 1 144 ? 2.382   34.395  27.720  1.00 63.07  ? 130  ARG F O     1 
ATOM   5595 C CB    . ARG F 1 144 ? 1.747   31.893  29.145  1.00 61.92  ? 130  ARG F CB    1 
ATOM   5596 C CG    . ARG F 1 144 ? 1.032   30.591  29.484  1.00 61.91  ? 130  ARG F CG    1 
ATOM   5597 C CD    . ARG F 1 144 ? 0.335   30.649  30.839  1.00 61.40  ? 130  ARG F CD    1 
ATOM   5598 N NE    . ARG F 1 144 ? -1.061  30.267  30.661  1.00 62.56  ? 130  ARG F NE    1 
ATOM   5599 C CZ    . ARG F 1 144 ? -1.680  29.249  31.257  1.00 63.96  ? 130  ARG F CZ    1 
ATOM   5600 N NH1   . ARG F 1 144 ? -1.068  28.478  32.172  1.00 62.69  ? 130  ARG F NH1   1 
ATOM   5601 N NH2   . ARG F 1 144 ? -2.955  29.029  30.962  1.00 66.13  ? 130  ARG F NH2   1 
ATOM   5602 N N     . LEU F 1 145 ? 4.182   33.223  27.058  1.00 61.36  ? 131  LEU F N     1 
ATOM   5603 C CA    . LEU F 1 145 ? 5.031   34.401  26.945  1.00 62.40  ? 131  LEU F CA    1 
ATOM   5604 C C     . LEU F 1 145 ? 5.567   34.568  25.521  1.00 61.68  ? 131  LEU F C     1 
ATOM   5605 O O     . LEU F 1 145 ? 5.982   33.599  24.893  1.00 59.50  ? 131  LEU F O     1 
ATOM   5606 C CB    . LEU F 1 145 ? 6.212   34.291  27.909  1.00 61.30  ? 131  LEU F CB    1 
ATOM   5607 C CG    . LEU F 1 145 ? 5.858   33.918  29.335  1.00 61.09  ? 131  LEU F CG    1 
ATOM   5608 C CD1   . LEU F 1 145 ? 7.124   33.607  30.113  1.00 60.77  ? 131  LEU F CD1   1 
ATOM   5609 C CD2   . LEU F 1 145 ? 5.067   35.028  30.006  1.00 63.34  ? 131  LEU F CD2   1 
ATOM   5610 N N     . THR F 1 146 ? 5.584   35.807  25.043  1.00 61.57  ? 132  THR F N     1 
ATOM   5611 C CA    . THR F 1 146 ? 6.189   36.116  23.759  1.00 62.01  ? 132  THR F CA    1 
ATOM   5612 C C     . THR F 1 146 ? 7.701   35.902  23.860  1.00 62.00  ? 132  THR F C     1 
ATOM   5613 O O     . THR F 1 146 ? 8.257   35.920  24.965  1.00 60.67  ? 132  THR F O     1 
ATOM   5614 C CB    . THR F 1 146 ? 5.907   37.580  23.322  1.00 62.42  ? 132  THR F CB    1 
ATOM   5615 O OG1   . THR F 1 146 ? 6.700   38.493  24.098  1.00 63.09  ? 132  THR F OG1   1 
ATOM   5616 C CG2   . THR F 1 146 ? 4.422   37.952  23.459  1.00 62.06  ? 132  THR F CG2   1 
ATOM   5617 N N     . PRO F 1 147 ? 8.375   35.681  22.714  1.00 63.77  ? 133  PRO F N     1 
ATOM   5618 C CA    . PRO F 1 147 ? 9.844   35.661  22.699  1.00 63.56  ? 133  PRO F CA    1 
ATOM   5619 C C     . PRO F 1 147 ? 10.508  36.810  23.508  1.00 63.38  ? 133  PRO F C     1 
ATOM   5620 O O     . PRO F 1 147 ? 11.431  36.560  24.279  1.00 60.32  ? 133  PRO F O     1 
ATOM   5621 C CB    . PRO F 1 147 ? 10.188  35.769  21.201  1.00 63.14  ? 133  PRO F CB    1 
ATOM   5622 C CG    . PRO F 1 147 ? 8.918   35.509  20.449  1.00 64.40  ? 133  PRO F CG    1 
ATOM   5623 C CD    . PRO F 1 147 ? 7.827   35.202  21.435  1.00 64.84  ? 133  PRO F CD    1 
ATOM   5624 N N     . GLU F 1 148 ? 10.047  38.046  23.320  1.00 65.15  ? 134  GLU F N     1 
ATOM   5625 C CA    . GLU F 1 148 ? 10.612  39.192  24.048  1.00 66.44  ? 134  GLU F CA    1 
ATOM   5626 C C     . GLU F 1 148 ? 10.652  38.945  25.563  1.00 67.18  ? 134  GLU F C     1 
ATOM   5627 O O     . GLU F 1 148 ? 11.657  39.245  26.216  1.00 68.00  ? 134  GLU F O     1 
ATOM   5628 C CB    . GLU F 1 148 ? 9.841   40.481  23.730  1.00 66.04  ? 134  GLU F CB    1 
ATOM   5629 N N     . GLN F 1 149 ? 9.582   38.364  26.106  1.00 67.46  ? 135  GLN F N     1 
ATOM   5630 C CA    . GLN F 1 149 ? 9.451   38.178  27.568  1.00 66.98  ? 135  GLN F CA    1 
ATOM   5631 C C     . GLN F 1 149 ? 10.245  36.985  28.053  1.00 65.66  ? 135  GLN F C     1 
ATOM   5632 O O     . GLN F 1 149 ? 10.755  36.991  29.167  1.00 69.74  ? 135  GLN F O     1 
ATOM   5633 C CB    . GLN F 1 149 ? 7.989   37.976  28.002  1.00 67.44  ? 135  GLN F CB    1 
ATOM   5634 C CG    . GLN F 1 149 ? 6.931   38.456  27.015  1.00 67.66  ? 135  GLN F CG    1 
ATOM   5635 C CD    . GLN F 1 149 ? 5.584   38.673  27.658  1.00 67.10  ? 135  GLN F CD    1 
ATOM   5636 O OE1   . GLN F 1 149 ? 4.645   37.899  27.453  1.00 66.31  ? 135  GLN F OE1   1 
ATOM   5637 N NE2   . GLN F 1 149 ? 5.494   39.705  28.475  1.00 67.22  ? 135  GLN F NE2   1 
ATOM   5638 N N     . GLN F 1 150 ? 10.303  35.938  27.235  1.00 64.52  ? 136  GLN F N     1 
ATOM   5639 C CA    . GLN F 1 150 ? 11.175  34.813  27.517  1.00 61.49  ? 136  GLN F CA    1 
ATOM   5640 C C     . GLN F 1 150 ? 12.614  35.284  27.597  1.00 60.29  ? 136  GLN F C     1 
ATOM   5641 O O     . GLN F 1 150 ? 13.319  34.945  28.551  1.00 60.70  ? 136  GLN F O     1 
ATOM   5642 C CB    . GLN F 1 150 ? 11.049  33.749  26.440  1.00 61.67  ? 136  GLN F CB    1 
ATOM   5643 C CG    . GLN F 1 150 ? 9.702   33.066  26.436  1.00 63.35  ? 136  GLN F CG    1 
ATOM   5644 C CD    . GLN F 1 150 ? 9.608   31.988  25.380  1.00 65.40  ? 136  GLN F CD    1 
ATOM   5645 O OE1   . GLN F 1 150 ? 10.622  31.581  24.806  1.00 67.36  ? 136  GLN F OE1   1 
ATOM   5646 N NE2   . GLN F 1 150 ? 8.397   31.495  25.135  1.00 65.18  ? 136  GLN F NE2   1 
ATOM   5647 N N     . LYS F 1 151 ? 13.039  36.084  26.615  1.00 58.11  ? 137  LYS F N     1 
ATOM   5648 C CA    . LYS F 1 151 ? 14.353  36.700  26.665  1.00 56.91  ? 137  LYS F CA    1 
ATOM   5649 C C     . LYS F 1 151 ? 14.465  37.450  27.969  1.00 56.07  ? 137  LYS F C     1 
ATOM   5650 O O     . LYS F 1 151 ? 15.382  37.207  28.745  1.00 55.67  ? 137  LYS F O     1 
ATOM   5651 C CB    . LYS F 1 151 ? 14.585  37.655  25.493  1.00 57.87  ? 137  LYS F CB    1 
ATOM   5652 N N     . SER F 1 152 ? 13.488  38.309  28.227  1.00 56.72  ? 138  SER F N     1 
ATOM   5653 C CA    . SER F 1 152 ? 13.520  39.210  29.378  1.00 59.13  ? 138  SER F CA    1 
ATOM   5654 C C     . SER F 1 152 ? 13.601  38.475  30.730  1.00 58.89  ? 138  SER F C     1 
ATOM   5655 O O     . SER F 1 152 ? 14.365  38.870  31.615  1.00 59.67  ? 138  SER F O     1 
ATOM   5656 C CB    . SER F 1 152 ? 12.291  40.134  29.344  1.00 60.48  ? 138  SER F CB    1 
ATOM   5657 O OG    . SER F 1 152 ? 12.431  41.203  30.258  1.00 64.25  ? 138  SER F OG    1 
ATOM   5658 N N     . LEU F 1 153 ? 12.799  37.427  30.883  1.00 57.62  ? 139  LEU F N     1 
ATOM   5659 C CA    . LEU F 1 153 ? 12.784  36.603  32.095  1.00 57.31  ? 139  LEU F CA    1 
ATOM   5660 C C     . LEU F 1 153 ? 14.171  36.067  32.438  1.00 56.23  ? 139  LEU F C     1 
ATOM   5661 O O     . LEU F 1 153 ? 14.615  36.141  33.582  1.00 56.57  ? 139  LEU F O     1 
ATOM   5662 C CB    . LEU F 1 153 ? 11.815  35.424  31.907  1.00 58.23  ? 139  LEU F CB    1 
ATOM   5663 C CG    . LEU F 1 153 ? 11.562  34.533  33.152  1.00 58.05  ? 139  LEU F CG    1 
ATOM   5664 C CD1   . LEU F 1 153 ? 10.172  33.913  33.273  1.00 59.16  ? 139  LEU F CD1   1 
ATOM   5665 C CD2   . LEU F 1 153 ? 12.579  33.429  33.186  1.00 58.69  ? 139  LEU F CD2   1 
ATOM   5666 N N     . GLY F 1 154 ? 14.839  35.490  31.443  1.00 56.16  ? 140  GLY F N     1 
ATOM   5667 C CA    . GLY F 1 154 ? 16.132  34.860  31.648  1.00 55.00  ? 140  GLY F CA    1 
ATOM   5668 C C     . GLY F 1 154 ? 17.200  35.859  32.016  1.00 55.90  ? 140  GLY F C     1 
ATOM   5669 O O     . GLY F 1 154 ? 18.067  35.568  32.845  1.00 55.82  ? 140  GLY F O     1 
ATOM   5670 N N     . GLU F 1 155 ? 17.180  37.017  31.359  1.00 57.95  ? 141  GLU F N     1 
ATOM   5671 C CA    . GLU F 1 155 ? 18.144  38.071  31.666  1.00 61.65  ? 141  GLU F CA    1 
ATOM   5672 C C     . GLU F 1 155 ? 17.943  38.455  33.120  1.00 63.01  ? 141  GLU F C     1 
ATOM   5673 O O     . GLU F 1 155 ? 18.906  38.644  33.849  1.00 65.06  ? 141  GLU F O     1 
ATOM   5674 C CB    . GLU F 1 155 ? 17.970  39.325  30.791  1.00 65.37  ? 141  GLU F CB    1 
ATOM   5675 C CG    . GLU F 1 155 ? 17.755  39.084  29.304  1.00 67.05  ? 141  GLU F CG    1 
ATOM   5676 C CD    . GLU F 1 155 ? 17.646  40.374  28.513  1.00 68.79  ? 141  GLU F CD    1 
ATOM   5677 O OE1   . GLU F 1 155 ? 17.360  41.422  29.114  1.00 70.47  ? 141  GLU F OE1   1 
ATOM   5678 O OE2   . GLU F 1 155 ? 17.816  40.339  27.283  1.00 72.95  ? 141  GLU F OE2   1 
ATOM   5679 N N     . ILE F 1 156 ? 16.677  38.549  33.530  1.00 62.07  ? 142  ILE F N     1 
ATOM   5680 C CA    . ILE F 1 156 ? 16.328  39.006  34.865  1.00 61.85  ? 142  ILE F CA    1 
ATOM   5681 C C     . ILE F 1 156 ? 16.739  38.016  35.945  1.00 62.14  ? 142  ILE F C     1 
ATOM   5682 O O     . ILE F 1 156 ? 17.384  38.398  36.927  1.00 63.63  ? 142  ILE F O     1 
ATOM   5683 C CB    . ILE F 1 156 ? 14.829  39.324  34.978  1.00 62.08  ? 142  ILE F CB    1 
ATOM   5684 C CG1   . ILE F 1 156 ? 14.513  40.605  34.199  1.00 62.85  ? 142  ILE F CG1   1 
ATOM   5685 C CG2   . ILE F 1 156 ? 14.421  39.509  36.435  1.00 62.47  ? 142  ILE F CG2   1 
ATOM   5686 C CD1   . ILE F 1 156 ? 13.042  40.825  33.919  1.00 62.93  ? 142  ILE F CD1   1 
ATOM   5687 N N     . MET F 1 157 ? 16.384  36.748  35.772  1.00 60.87  ? 143  MET F N     1 
ATOM   5688 C CA    . MET F 1 157 ? 16.686  35.763  36.798  1.00 61.13  ? 143  MET F CA    1 
ATOM   5689 C C     . MET F 1 157 ? 18.194  35.532  36.914  1.00 61.87  ? 143  MET F C     1 
ATOM   5690 O O     . MET F 1 157 ? 18.723  35.426  38.027  1.00 64.33  ? 143  MET F O     1 
ATOM   5691 C CB    . MET F 1 157 ? 15.923  34.462  36.558  1.00 60.14  ? 143  MET F CB    1 
ATOM   5692 C CG    . MET F 1 157 ? 14.405  34.616  36.598  1.00 60.28  ? 143  MET F CG    1 
ATOM   5693 S SD    . MET F 1 157 ? 13.752  35.437  38.076  1.00 61.42  ? 143  MET F SD    1 
ATOM   5694 C CE    . MET F 1 157 ? 13.652  34.135  39.304  1.00 62.07  ? 143  MET F CE    1 
ATOM   5695 N N     . ARG F 1 158 ? 18.891  35.523  35.785  1.00 60.31  ? 144  ARG F N     1 
ATOM   5696 C CA    . ARG F 1 158 ? 20.343  35.381  35.779  1.00 59.17  ? 144  ARG F CA    1 
ATOM   5697 C C     . ARG F 1 158 ? 21.069  36.454  36.624  1.00 59.69  ? 144  ARG F C     1 
ATOM   5698 O O     . ARG F 1 158 ? 22.022  36.142  37.349  1.00 57.58  ? 144  ARG F O     1 
ATOM   5699 C CB    . ARG F 1 158 ? 20.819  35.389  34.342  1.00 57.89  ? 144  ARG F CB    1 
ATOM   5700 C CG    . ARG F 1 158 ? 22.319  35.284  34.169  1.00 59.98  ? 144  ARG F CG    1 
ATOM   5701 C CD    . ARG F 1 158 ? 22.720  35.688  32.738  1.00 61.51  ? 144  ARG F CD    1 
ATOM   5702 N NE    . ARG F 1 158 ? 21.695  35.366  31.741  1.00 63.42  ? 144  ARG F NE    1 
ATOM   5703 C CZ    . ARG F 1 158 ? 21.799  35.641  30.455  1.00 64.10  ? 144  ARG F CZ    1 
ATOM   5704 N NH1   . ARG F 1 158 ? 22.900  36.217  30.008  1.00 64.80  ? 144  ARG F NH1   1 
ATOM   5705 N NH2   . ARG F 1 158 ? 20.807  35.335  29.623  1.00 65.15  ? 144  ARG F NH2   1 
ATOM   5706 N N     . ILE F 1 159 ? 20.603  37.699  36.554  1.00 59.15  ? 145  ILE F N     1 
ATOM   5707 C CA    . ILE F 1 159 ? 21.152  38.770  37.396  1.00 61.14  ? 145  ILE F CA    1 
ATOM   5708 C C     . ILE F 1 159 ? 20.919  38.491  38.894  1.00 62.30  ? 145  ILE F C     1 
ATOM   5709 O O     . ILE F 1 159 ? 21.827  38.636  39.721  1.00 62.95  ? 145  ILE F O     1 
ATOM   5710 C CB    . ILE F 1 159 ? 20.492  40.123  37.098  1.00 61.68  ? 145  ILE F CB    1 
ATOM   5711 C CG1   . ILE F 1 159 ? 20.780  40.552  35.653  1.00 61.51  ? 145  ILE F CG1   1 
ATOM   5712 C CG2   . ILE F 1 159 ? 20.998  41.180  38.077  1.00 63.46  ? 145  ILE F CG2   1 
ATOM   5713 C CD1   . ILE F 1 159 ? 19.771  41.534  35.099  1.00 61.18  ? 145  ILE F CD1   1 
ATOM   5714 N N     . VAL F 1 160 ? 19.679  38.138  39.224  1.00 60.99  ? 146  VAL F N     1 
ATOM   5715 C CA    . VAL F 1 160 ? 19.286  37.822  40.591  1.00 60.56  ? 146  VAL F CA    1 
ATOM   5716 C C     . VAL F 1 160 ? 20.166  36.701  41.123  1.00 60.91  ? 146  VAL F C     1 
ATOM   5717 O O     . VAL F 1 160 ? 20.646  36.776  42.248  1.00 61.83  ? 146  VAL F O     1 
ATOM   5718 C CB    . VAL F 1 160 ? 17.789  37.434  40.670  1.00 58.58  ? 146  VAL F CB    1 
ATOM   5719 C CG1   . VAL F 1 160 ? 17.445  36.809  42.016  1.00 58.50  ? 146  VAL F CG1   1 
ATOM   5720 C CG2   . VAL F 1 160 ? 16.919  38.656  40.415  1.00 58.62  ? 146  VAL F CG2   1 
ATOM   5721 N N     . ALA F 1 161 ? 20.358  35.661  40.317  1.00 60.14  ? 147  ALA F N     1 
ATOM   5722 C CA    . ALA F 1 161 ? 21.183  34.529  40.729  1.00 60.73  ? 147  ALA F CA    1 
ATOM   5723 C C     . ALA F 1 161 ? 22.634  34.955  40.875  1.00 63.06  ? 147  ALA F C     1 
ATOM   5724 O O     . ALA F 1 161 ? 23.238  34.787  41.926  1.00 62.51  ? 147  ALA F O     1 
ATOM   5725 C CB    . ALA F 1 161 ? 21.054  33.394  39.734  1.00 60.31  ? 147  ALA F CB    1 
ATOM   5726 N N     . GLU F 1 162 ? 23.189  35.542  39.815  1.00 66.10  ? 148  GLU F N     1 
ATOM   5727 C CA    . GLU F 1 162 ? 24.546  36.096  39.877  1.00 67.16  ? 148  GLU F CA    1 
ATOM   5728 C C     . GLU F 1 162 ? 24.744  36.918  41.148  1.00 66.71  ? 148  GLU F C     1 
ATOM   5729 O O     . GLU F 1 162 ? 25.750  36.766  41.845  1.00 65.66  ? 148  GLU F O     1 
ATOM   5730 C CB    . GLU F 1 162 ? 24.852  36.908  38.628  1.00 68.76  ? 148  GLU F CB    1 
ATOM   5731 C CG    . GLU F 1 162 ? 25.144  36.002  37.436  1.00 71.67  ? 148  GLU F CG    1 
ATOM   5732 C CD    . GLU F 1 162 ? 26.498  35.322  37.532  1.00 73.79  ? 148  GLU F CD    1 
ATOM   5733 O OE1   . GLU F 1 162 ? 26.968  35.086  38.671  1.00 75.35  ? 148  GLU F OE1   1 
ATOM   5734 O OE2   . GLU F 1 162 ? 27.098  35.048  36.463  1.00 75.64  ? 148  GLU F OE2   1 
ATOM   5735 N N     . GLY F 1 163 ? 23.752  37.744  41.463  1.00 64.84  ? 149  GLY F N     1 
ATOM   5736 C CA    . GLY F 1 163 ? 23.815  38.620  42.627  1.00 66.20  ? 149  GLY F CA    1 
ATOM   5737 C C     . GLY F 1 163 ? 23.915  37.885  43.956  1.00 66.35  ? 149  GLY F C     1 
ATOM   5738 O O     . GLY F 1 163 ? 24.544  38.380  44.903  1.00 66.42  ? 149  GLY F O     1 
ATOM   5739 N N     . LEU F 1 164 ? 23.308  36.703  44.020  1.00 64.75  ? 150  LEU F N     1 
ATOM   5740 C CA    . LEU F 1 164 ? 23.234  35.940  45.258  1.00 65.98  ? 150  LEU F CA    1 
ATOM   5741 C C     . LEU F 1 164 ? 24.362  34.927  45.405  1.00 66.75  ? 150  LEU F C     1 
ATOM   5742 O O     . LEU F 1 164 ? 24.503  34.297  46.445  1.00 67.61  ? 150  LEU F O     1 
ATOM   5743 C CB    . LEU F 1 164 ? 21.888  35.236  45.347  1.00 65.13  ? 150  LEU F CB    1 
ATOM   5744 C CG    . LEU F 1 164 ? 20.750  36.151  45.765  1.00 64.87  ? 150  LEU F CG    1 
ATOM   5745 C CD1   . LEU F 1 164 ? 19.426  35.645  45.228  1.00 64.11  ? 150  LEU F CD1   1 
ATOM   5746 C CD2   . LEU F 1 164 ? 20.723  36.254  47.277  1.00 67.19  ? 150  LEU F CD2   1 
ATOM   5747 N N     . GLN F 1 165 ? 25.181  34.776  44.376  1.00 69.61  ? 151  GLN F N     1 
ATOM   5748 C CA    . GLN F 1 165 ? 26.376  33.937  44.492  1.00 71.66  ? 151  GLN F CA    1 
ATOM   5749 C C     . GLN F 1 165 ? 27.614  34.676  43.986  1.00 72.43  ? 151  GLN F C     1 
ATOM   5750 O O     . GLN F 1 165 ? 28.167  34.311  42.958  1.00 75.74  ? 151  GLN F O     1 
ATOM   5751 C CB    . GLN F 1 165 ? 26.168  32.582  43.790  1.00 69.29  ? 151  GLN F CB    1 
ATOM   5752 C CG    . GLN F 1 165 ? 25.525  32.669  42.415  1.00 68.46  ? 151  GLN F CG    1 
ATOM   5753 C CD    . GLN F 1 165 ? 25.408  31.332  41.711  1.00 68.48  ? 151  GLN F CD    1 
ATOM   5754 O OE1   . GLN F 1 165 ? 25.570  30.288  42.313  1.00 72.18  ? 151  GLN F OE1   1 
ATOM   5755 N NE2   . GLN F 1 165 ? 25.122  31.364  40.421  1.00 67.57  ? 151  GLN F NE2   1 
ATOM   5756 N N     . PRO F 1 166 ? 28.040  35.742  44.703  1.00 77.66  ? 152  PRO F N     1 
ATOM   5757 C CA    . PRO F 1 166 ? 29.247  36.446  44.265  1.00 79.46  ? 152  PRO F CA    1 
ATOM   5758 C C     . PRO F 1 166 ? 30.498  35.614  44.592  1.00 79.96  ? 152  PRO F C     1 
ATOM   5759 O O     . PRO F 1 166 ? 30.439  34.722  45.454  1.00 78.11  ? 152  PRO F O     1 
ATOM   5760 C CB    . PRO F 1 166 ? 29.207  37.757  45.067  1.00 81.72  ? 152  PRO F CB    1 
ATOM   5761 C CG    . PRO F 1 166 ? 28.448  37.414  46.305  1.00 81.90  ? 152  PRO F CG    1 
ATOM   5762 C CD    . PRO F 1 166 ? 27.448  36.364  45.906  1.00 79.70  ? 152  PRO F CD    1 
ATOM   5763 N N     . SER F 1 167 ? 31.597  35.886  43.881  1.00 80.38  ? 153  SER F N     1 
ATOM   5764 C CA    . SER F 1 167 ? 32.860  35.173  44.088  1.00 81.80  ? 153  SER F CA    1 
ATOM   5765 C C     . SER F 1 167 ? 33.564  35.599  45.381  1.00 85.16  ? 153  SER F C     1 
ATOM   5766 O O     . SER F 1 167 ? 34.517  34.947  45.806  1.00 88.56  ? 153  SER F O     1 
ATOM   5767 C CB    . SER F 1 167 ? 33.785  35.370  42.885  1.00 82.93  ? 153  SER F CB    1 
ATOM   5768 N N     . GLU F 1 168 ? 33.076  36.665  46.024  1.00 85.24  ? 154  GLU F N     1 
ATOM   5769 C CA    . GLU F 1 168 ? 33.681  37.169  47.260  1.00 89.51  ? 154  GLU F CA    1 
ATOM   5770 C C     . GLU F 1 168 ? 33.859  36.022  48.257  1.00 90.00  ? 154  GLU F C     1 
ATOM   5771 O O     . GLU F 1 168 ? 33.507  36.137  49.422  1.00 91.75  ? 154  GLU F O     1 
ATOM   5772 C CB    . GLU F 1 168 ? 32.819  38.280  47.871  1.00 90.12  ? 154  GLU F CB    1 
ATOM   5773 N N     . ASP F 1 172 ? 28.334  33.168  51.939  1.00 75.39  ? 158  ASP F N     1 
ATOM   5774 C CA    . ASP F 1 172 ? 27.421  32.219  52.603  1.00 73.88  ? 158  ASP F CA    1 
ATOM   5775 C C     . ASP F 1 172 ? 26.656  31.395  51.555  1.00 70.66  ? 158  ASP F C     1 
ATOM   5776 O O     . ASP F 1 172 ? 25.420  31.316  51.557  1.00 70.62  ? 158  ASP F O     1 
ATOM   5777 C CB    . ASP F 1 172 ? 26.436  32.932  53.555  1.00 76.10  ? 158  ASP F CB    1 
ATOM   5778 C CG    . ASP F 1 172 ? 25.586  31.951  54.367  1.00 74.91  ? 158  ASP F CG    1 
ATOM   5779 O OD1   . ASP F 1 172 ? 26.019  30.786  54.523  1.00 71.79  ? 158  ASP F OD1   1 
ATOM   5780 O OD2   . ASP F 1 172 ? 24.477  32.334  54.826  1.00 75.36  ? 158  ASP F OD2   1 
ATOM   5781 N N     . LEU F 1 173 ? 27.411  30.766  50.667  1.00 69.23  ? 159  LEU F N     1 
ATOM   5782 C CA    . LEU F 1 173 ? 26.840  29.943  49.612  1.00 65.92  ? 159  LEU F CA    1 
ATOM   5783 C C     . LEU F 1 173 ? 26.469  28.576  50.184  1.00 63.79  ? 159  LEU F C     1 
ATOM   5784 O O     . LEU F 1 173 ? 27.268  27.970  50.890  1.00 63.94  ? 159  LEU F O     1 
ATOM   5785 C CB    . LEU F 1 173 ? 27.840  29.811  48.457  1.00 67.65  ? 159  LEU F CB    1 
ATOM   5786 C CG    . LEU F 1 173 ? 28.398  31.140  47.905  1.00 68.90  ? 159  LEU F CG    1 
ATOM   5787 C CD1   . LEU F 1 173 ? 29.465  30.925  46.850  1.00 70.92  ? 159  LEU F CD1   1 
ATOM   5788 C CD2   . LEU F 1 173 ? 27.292  32.006  47.333  1.00 69.20  ? 159  LEU F CD2   1 
ATOM   5789 N N     . PRO F 1 174 ? 25.245  28.087  49.884  1.00 63.02  ? 160  PRO F N     1 
ATOM   5790 C CA    . PRO F 1 174 ? 24.694  26.838  50.427  1.00 62.14  ? 160  PRO F CA    1 
ATOM   5791 C C     . PRO F 1 174 ? 25.666  25.668  50.400  1.00 62.97  ? 160  PRO F C     1 
ATOM   5792 O O     . PRO F 1 174 ? 25.832  24.962  51.387  1.00 63.87  ? 160  PRO F O     1 
ATOM   5793 C CB    . PRO F 1 174 ? 23.518  26.543  49.498  1.00 63.06  ? 160  PRO F CB    1 
ATOM   5794 C CG    . PRO F 1 174 ? 23.094  27.864  48.977  1.00 63.71  ? 160  PRO F CG    1 
ATOM   5795 C CD    . PRO F 1 174 ? 24.299  28.742  48.957  1.00 63.15  ? 160  PRO F CD    1 
ATOM   5796 N N     . TRP F 1 175 ? 26.318  25.479  49.272  1.00 64.44  ? 161  TRP F N     1 
ATOM   5797 C CA    . TRP F 1 175 ? 27.196  24.333  49.085  1.00 67.57  ? 161  TRP F CA    1 
ATOM   5798 C C     . TRP F 1 175 ? 28.537  24.463  49.821  1.00 70.16  ? 161  TRP F C     1 
ATOM   5799 O O     . TRP F 1 175 ? 29.301  23.498  49.887  1.00 73.68  ? 161  TRP F O     1 
ATOM   5800 C CB    . TRP F 1 175 ? 27.427  24.100  47.594  1.00 71.09  ? 161  TRP F CB    1 
ATOM   5801 C CG    . TRP F 1 175 ? 27.941  25.286  46.840  1.00 69.94  ? 161  TRP F CG    1 
ATOM   5802 C CD1   . TRP F 1 175 ? 29.239  25.580  46.565  1.00 72.01  ? 161  TRP F CD1   1 
ATOM   5803 C CD2   . TRP F 1 175 ? 27.162  26.322  46.262  1.00 67.84  ? 161  TRP F CD2   1 
ATOM   5804 N NE1   . TRP F 1 175 ? 29.327  26.742  45.847  1.00 70.80  ? 161  TRP F NE1   1 
ATOM   5805 C CE2   . TRP F 1 175 ? 28.060  27.220  45.653  1.00 68.74  ? 161  TRP F CE2   1 
ATOM   5806 C CE3   . TRP F 1 175 ? 25.788  26.585  46.198  1.00 67.32  ? 161  TRP F CE3   1 
ATOM   5807 C CZ2   . TRP F 1 175 ? 27.636  28.348  44.996  1.00 68.03  ? 161  TRP F CZ2   1 
ATOM   5808 C CZ3   . TRP F 1 175 ? 25.367  27.716  45.533  1.00 67.44  ? 161  TRP F CZ3   1 
ATOM   5809 C CH2   . TRP F 1 175 ? 26.286  28.579  44.945  1.00 67.37  ? 161  TRP F CH2   1 
ATOM   5810 N N     . LEU F 1 176 ? 28.823  25.660  50.348  1.00 69.31  ? 162  LEU F N     1 
ATOM   5811 C CA    . LEU F 1 176 ? 29.972  25.894  51.223  1.00 73.04  ? 162  LEU F CA    1 
ATOM   5812 C C     . LEU F 1 176 ? 29.470  26.114  52.646  1.00 71.77  ? 162  LEU F C     1 
ATOM   5813 O O     . LEU F 1 176 ? 30.063  26.873  53.424  1.00 76.15  ? 162  LEU F O     1 
ATOM   5814 C CB    . LEU F 1 176 ? 30.732  27.149  50.809  1.00 74.29  ? 162  LEU F CB    1 
ATOM   5815 C CG    . LEU F 1 176 ? 31.178  27.219  49.362  1.00 75.20  ? 162  LEU F CG    1 
ATOM   5816 C CD1   . LEU F 1 176 ? 31.919  28.530  49.151  1.00 76.70  ? 162  LEU F CD1   1 
ATOM   5817 C CD2   . LEU F 1 176 ? 32.038  26.021  48.999  1.00 80.06  ? 162  LEU F CD2   1 
ATOM   5818 N N     . ARG F 1 177 ? 28.336  25.524  52.971  1.00 68.31  ? 163  ARG F N     1 
ATOM   5819 C CA    . ARG F 1 177 ? 27.896  25.490  54.345  1.00 68.00  ? 163  ARG F CA    1 
ATOM   5820 C C     . ARG F 1 177 ? 28.483  24.241  54.990  1.00 70.61  ? 163  ARG F C     1 
ATOM   5821 O O     . ARG F 1 177 ? 29.214  23.487  54.340  1.00 72.10  ? 163  ARG F O     1 
ATOM   5822 C CB    . ARG F 1 177 ? 26.369  25.473  54.427  1.00 64.08  ? 163  ARG F CB    1 
ATOM   5823 C CG    . ARG F 1 177 ? 25.811  26.527  55.353  1.00 64.97  ? 163  ARG F CG    1 
ATOM   5824 C CD    . ARG F 1 177 ? 25.370  27.750  54.579  1.00 64.15  ? 163  ARG F CD    1 
ATOM   5825 N NE    . ARG F 1 177 ? 23.984  27.617  54.147  1.00 62.34  ? 163  ARG F NE    1 
ATOM   5826 C CZ    . ARG F 1 177 ? 23.343  28.478  53.365  1.00 62.80  ? 163  ARG F CZ    1 
ATOM   5827 N NH1   . ARG F 1 177 ? 23.949  29.548  52.879  1.00 62.97  ? 163  ARG F NH1   1 
ATOM   5828 N NH2   . ARG F 1 177 ? 22.070  28.254  53.056  1.00 64.41  ? 163  ARG F NH2   1 
ATOM   5829 O OXT   . ARG F 1 177 ? 28.222  23.972  56.161  1.00 70.86  ? 163  ARG F OXT   1 
ATOM   5830 O "O5'" . DA  G 2 1   ? -22.674 10.285  54.028  1.00 69.16  ? 1    DA  G "O5'" 1 
ATOM   5831 C "C5'" . DA  G 2 1   ? -23.060 10.535  52.662  1.00 71.11  ? 1    DA  G "C5'" 1 
ATOM   5832 C "C4'" . DA  G 2 1   ? -23.306 12.014  52.503  1.00 69.64  ? 1    DA  G "C4'" 1 
ATOM   5833 O "O4'" . DA  G 2 1   ? -23.991 12.632  53.609  1.00 71.19  ? 1    DA  G "O4'" 1 
ATOM   5834 C "C3'" . DA  G 2 1   ? -22.169 12.938  52.068  1.00 66.80  ? 1    DA  G "C3'" 1 
ATOM   5835 O "O3'" . DA  G 2 1   ? -22.376 13.461  50.755  1.00 66.61  ? 1    DA  G "O3'" 1 
ATOM   5836 C "C2'" . DA  G 2 1   ? -22.169 14.064  53.088  1.00 66.16  ? 1    DA  G "C2'" 1 
ATOM   5837 C "C1'" . DA  G 2 1   ? -23.464 13.920  53.866  1.00 67.76  ? 1    DA  G "C1'" 1 
ATOM   5838 N N9    . DA  G 2 1   ? -23.331 14.060  55.308  1.00 64.79  ? 1    DA  G N9    1 
ATOM   5839 C C8    . DA  G 2 1   ? -23.125 13.088  56.256  1.00 64.65  ? 1    DA  G C8    1 
ATOM   5840 N N7    . DA  G 2 1   ? -23.114 13.546  57.484  1.00 64.00  ? 1    DA  G N7    1 
ATOM   5841 C C5    . DA  G 2 1   ? -23.328 14.910  57.333  1.00 61.44  ? 1    DA  G C5    1 
ATOM   5842 C C6    . DA  G 2 1   ? -23.431 15.959  58.259  1.00 57.06  ? 1    DA  G C6    1 
ATOM   5843 N N6    . DA  G 2 1   ? -23.321 15.791  59.574  1.00 58.64  ? 1    DA  G N6    1 
ATOM   5844 N N1    . DA  G 2 1   ? -23.644 17.204  57.780  1.00 55.63  ? 1    DA  G N1    1 
ATOM   5845 C C2    . DA  G 2 1   ? -23.772 17.369  56.458  1.00 59.34  ? 1    DA  G C2    1 
ATOM   5846 N N3    . DA  G 2 1   ? -23.699 16.460  55.487  1.00 62.61  ? 1    DA  G N3    1 
ATOM   5847 C C4    . DA  G 2 1   ? -23.467 15.238  55.998  1.00 63.64  ? 1    DA  G C4    1 
ATOM   5848 P P     . DA  G 2 2   ? -21.126 13.931  49.889  1.00 63.95  ? 2    DA  G P     1 
ATOM   5849 O OP1   . DA  G 2 2   ? -21.564 14.025  48.474  1.00 65.59  ? 2    DA  G OP1   1 
ATOM   5850 O OP2   . DA  G 2 2   ? -19.967 13.060  50.246  1.00 61.85  ? 2    DA  G OP2   1 
ATOM   5851 O "O5'" . DA  G 2 2   ? -20.851 15.409  50.418  1.00 62.96  ? 2    DA  G "O5'" 1 
ATOM   5852 C "C5'" . DA  G 2 2   ? -21.831 16.443  50.184  1.00 66.04  ? 2    DA  G "C5'" 1 
ATOM   5853 C "C4'" . DA  G 2 2   ? -21.381 17.752  50.789  1.00 64.62  ? 2    DA  G "C4'" 1 
ATOM   5854 O "O4'" . DA  G 2 2   ? -21.419 17.668  52.234  1.00 60.38  ? 2    DA  G "O4'" 1 
ATOM   5855 C "C3'" . DA  G 2 2   ? -19.956 18.180  50.432  1.00 63.83  ? 2    DA  G "C3'" 1 
ATOM   5856 O "O3'" . DA  G 2 2   ? -20.017 19.567  50.110  1.00 67.38  ? 2    DA  G "O3'" 1 
ATOM   5857 C "C2'" . DA  G 2 2   ? -19.156 17.826  51.675  1.00 59.33  ? 2    DA  G "C2'" 1 
ATOM   5858 C "C1'" . DA  G 2 2   ? -20.166 18.047  52.771  1.00 57.01  ? 2    DA  G "C1'" 1 
ATOM   5859 N N9    . DA  G 2 2   ? -19.970 17.262  53.980  1.00 54.57  ? 2    DA  G N9    1 
ATOM   5860 C C8    . DA  G 2 2   ? -19.682 15.927  54.120  1.00 53.51  ? 2    DA  G C8    1 
ATOM   5861 N N7    . DA  G 2 2   ? -19.675 15.518  55.367  1.00 52.09  ? 2    DA  G N7    1 
ATOM   5862 C C5    . DA  G 2 2   ? -20.010 16.655  56.092  1.00 50.33  ? 2    DA  G C5    1 
ATOM   5863 C C6    . DA  G 2 2   ? -20.162 16.891  57.467  1.00 47.65  ? 2    DA  G C6    1 
ATOM   5864 N N6    . DA  G 2 2   ? -20.008 15.955  58.401  1.00 45.37  ? 2    DA  G N6    1 
ATOM   5865 N N1    . DA  G 2 2   ? -20.490 18.143  57.857  1.00 49.87  ? 2    DA  G N1    1 
ATOM   5866 C C2    . DA  G 2 2   ? -20.670 19.083  56.917  1.00 50.18  ? 2    DA  G C2    1 
ATOM   5867 N N3    . DA  G 2 2   ? -20.555 18.982  55.599  1.00 50.78  ? 2    DA  G N3    1 
ATOM   5868 C C4    . DA  G 2 2   ? -20.209 17.731  55.248  1.00 52.00  ? 2    DA  G C4    1 
ATOM   5869 P P     . DA  G 2 3   ? -18.687 20.443  49.946  1.00 70.29  ? 3    DA  G P     1 
ATOM   5870 O OP1   . DA  G 2 3   ? -18.935 21.425  48.842  1.00 70.93  ? 3    DA  G OP1   1 
ATOM   5871 O OP2   . DA  G 2 3   ? -17.518 19.533  49.894  1.00 62.55  ? 3    DA  G OP2   1 
ATOM   5872 O "O5'" . DA  G 2 3   ? -18.628 21.243  51.323  1.00 65.89  ? 3    DA  G "O5'" 1 
ATOM   5873 C "C5'" . DA  G 2 3   ? -19.548 22.324  51.588  1.00 65.92  ? 3    DA  G "C5'" 1 
ATOM   5874 C "C4'" . DA  G 2 3   ? -19.059 23.116  52.776  1.00 62.82  ? 3    DA  G "C4'" 1 
ATOM   5875 O "O4'" . DA  G 2 3   ? -18.991 22.249  53.932  1.00 59.45  ? 3    DA  G "O4'" 1 
ATOM   5876 C "C3'" . DA  G 2 3   ? -17.656 23.694  52.607  1.00 61.36  ? 3    DA  G "C3'" 1 
ATOM   5877 O "O3'" . DA  G 2 3   ? -17.587 24.989  53.215  1.00 61.87  ? 3    DA  G "O3'" 1 
ATOM   5878 C "C2'" . DA  G 2 3   ? -16.771 22.665  53.290  1.00 58.09  ? 3    DA  G "C2'" 1 
ATOM   5879 C "C1'" . DA  G 2 3   ? -17.665 22.187  54.425  1.00 56.33  ? 3    DA  G "C1'" 1 
ATOM   5880 N N9    . DA  G 2 3   ? -17.432 20.820  54.882  1.00 51.86  ? 3    DA  G N9    1 
ATOM   5881 C C8    . DA  G 2 3   ? -17.150 19.710  54.129  1.00 52.57  ? 3    DA  G C8    1 
ATOM   5882 N N7    . DA  G 2 3   ? -17.014 18.614  54.834  1.00 51.62  ? 3    DA  G N7    1 
ATOM   5883 C C5    . DA  G 2 3   ? -17.226 19.030  56.139  1.00 49.39  ? 3    DA  G C5    1 
ATOM   5884 C C6    . DA  G 2 3   ? -17.208 18.345  57.362  1.00 47.76  ? 3    DA  G C6    1 
ATOM   5885 N N6    . DA  G 2 3   ? -16.965 17.041  57.472  1.00 48.54  ? 3    DA  G N6    1 
ATOM   5886 N N1    . DA  G 2 3   ? -17.467 19.050  58.482  1.00 47.39  ? 3    DA  G N1    1 
ATOM   5887 C C2    . DA  G 2 3   ? -17.728 20.358  58.368  1.00 49.43  ? 3    DA  G C2    1 
ATOM   5888 N N3    . DA  G 2 3   ? -17.779 21.114  57.274  1.00 50.27  ? 3    DA  G N3    1 
ATOM   5889 C C4    . DA  G 2 3   ? -17.508 20.382  56.181  1.00 50.16  ? 3    DA  G C4    1 
ATOM   5890 P P     . DG  G 2 4   ? -16.274 25.883  53.025  1.00 63.66  ? 4    DG  G P     1 
ATOM   5891 O OP1   . DG  G 2 4   ? -16.697 27.288  52.823  1.00 65.07  ? 4    DG  G OP1   1 
ATOM   5892 O OP2   . DG  G 2 4   ? -15.405 25.205  52.018  1.00 62.69  ? 4    DG  G OP2   1 
ATOM   5893 O "O5'" . DG  G 2 4   ? -15.579 25.797  54.454  1.00 60.04  ? 4    DG  G "O5'" 1 
ATOM   5894 C "C5'" . DG  G 2 4   ? -16.209 26.395  55.599  1.00 56.84  ? 4    DG  G "C5'" 1 
ATOM   5895 C "C4'" . DG  G 2 4   ? -15.340 26.159  56.808  1.00 53.21  ? 4    DG  G "C4'" 1 
ATOM   5896 O "O4'" . DG  G 2 4   ? -15.335 24.747  57.104  1.00 52.24  ? 4    DG  G "O4'" 1 
ATOM   5897 C "C3'" . DG  G 2 4   ? -13.882 26.564  56.613  1.00 52.51  ? 4    DG  G "C3'" 1 
ATOM   5898 O "O3'" . DG  G 2 4   ? -13.563 27.499  57.643  1.00 53.17  ? 4    DG  G "O3'" 1 
ATOM   5899 C "C2'" . DG  G 2 4   ? -13.114 25.252  56.649  1.00 50.33  ? 4    DG  G "C2'" 1 
ATOM   5900 C "C1'" . DG  G 2 4   ? -14.033 24.311  57.390  1.00 50.02  ? 4    DG  G "C1'" 1 
ATOM   5901 N N9    . DG  G 2 4   ? -13.947 22.905  57.002  1.00 50.35  ? 4    DG  G N9    1 
ATOM   5902 C C8    . DG  G 2 4   ? -13.876 22.391  55.729  1.00 50.62  ? 4    DG  G C8    1 
ATOM   5903 N N7    . DG  G 2 4   ? -13.847 21.087  55.704  1.00 50.14  ? 4    DG  G N7    1 
ATOM   5904 C C5    . DG  G 2 4   ? -13.912 20.717  57.040  1.00 49.40  ? 4    DG  G C5    1 
ATOM   5905 C C6    . DG  G 2 4   ? -13.901 19.432  57.640  1.00 51.53  ? 4    DG  G C6    1 
ATOM   5906 O O6    . DG  G 2 4   ? -13.850 18.322  57.091  1.00 57.14  ? 4    DG  G O6    1 
ATOM   5907 N N1    . DG  G 2 4   ? -13.973 19.516  59.026  1.00 50.92  ? 4    DG  G N1    1 
ATOM   5908 C C2    . DG  G 2 4   ? -14.043 20.683  59.744  1.00 49.19  ? 4    DG  G C2    1 
ATOM   5909 N N2    . DG  G 2 4   ? -14.110 20.555  61.076  1.00 48.38  ? 4    DG  G N2    1 
ATOM   5910 N N3    . DG  G 2 4   ? -14.049 21.885  59.198  1.00 49.23  ? 4    DG  G N3    1 
ATOM   5911 C C4    . DG  G 2 4   ? -13.988 21.828  57.852  1.00 48.79  ? 4    DG  G C4    1 
ATOM   5912 P P     . DA  G 2 5   ? -12.116 28.153  57.737  1.00 49.91  ? 5    DA  G P     1 
ATOM   5913 O OP1   . DA  G 2 5   ? -12.208 29.269  58.688  1.00 50.10  ? 5    DA  G OP1   1 
ATOM   5914 O OP2   . DA  G 2 5   ? -11.654 28.423  56.359  1.00 52.27  ? 5    DA  G OP2   1 
ATOM   5915 O "O5'" . DA  G 2 5   ? -11.272 26.987  58.430  1.00 47.87  ? 5    DA  G "O5'" 1 
ATOM   5916 C "C5'" . DA  G 2 5   ? -11.679 26.544  59.733  1.00 47.05  ? 5    DA  G "C5'" 1 
ATOM   5917 C "C4'" . DA  G 2 5   ? -10.991 25.260  60.129  1.00 45.68  ? 5    DA  G "C4'" 1 
ATOM   5918 O "O4'" . DA  G 2 5   ? -11.286 24.193  59.207  1.00 45.04  ? 5    DA  G "O4'" 1 
ATOM   5919 C "C3'" . DA  G 2 5   ? -9.467  25.293  60.202  1.00 45.27  ? 5    DA  G "C3'" 1 
ATOM   5920 O "O3'" . DA  G 2 5   ? -9.063  25.624  61.536  1.00 48.34  ? 5    DA  G "O3'" 1 
ATOM   5921 C "C2'" . DA  G 2 5   ? -9.066  23.878  59.793  1.00 44.80  ? 5    DA  G "C2'" 1 
ATOM   5922 C "C1'" . DA  G 2 5   ? -10.389 23.167  59.576  1.00 43.67  ? 5    DA  G "C1'" 1 
ATOM   5923 N N9    . DA  G 2 5   ? -10.430 22.115  58.560  1.00 42.99  ? 5    DA  G N9    1 
ATOM   5924 C C8    . DA  G 2 5   ? -10.448 22.232  57.191  1.00 43.80  ? 5    DA  G C8    1 
ATOM   5925 N N7    . DA  G 2 5   ? -10.491 21.079  56.564  1.00 41.93  ? 5    DA  G N7    1 
ATOM   5926 C C5    . DA  G 2 5   ? -10.542 20.145  57.587  1.00 41.90  ? 5    DA  G C5    1 
ATOM   5927 C C6    . DA  G 2 5   ? -10.617 18.743  57.582  1.00 43.61  ? 5    DA  G C6    1 
ATOM   5928 N N6    . DA  G 2 5   ? -10.671 18.012  56.466  1.00 43.83  ? 5    DA  G N6    1 
ATOM   5929 N N1    . DA  G 2 5   ? -10.620 18.108  58.775  1.00 42.08  ? 5    DA  G N1    1 
ATOM   5930 C C2    . DA  G 2 5   ? -10.551 18.843  59.891  1.00 43.00  ? 5    DA  G C2    1 
ATOM   5931 N N3    . DA  G 2 5   ? -10.493 20.169  60.024  1.00 44.18  ? 5    DA  G N3    1 
ATOM   5932 C C4    . DA  G 2 5   ? -10.491 20.767  58.821  1.00 42.83  ? 5    DA  G C4    1 
ATOM   5933 P P     . DT  G 2 6   ? -7.522  25.518  61.982  1.00 50.18  ? 6    DT  G P     1 
ATOM   5934 O OP1   . DT  G 2 6   ? -7.328  26.393  63.169  1.00 50.01  ? 6    DT  G OP1   1 
ATOM   5935 O OP2   . DT  G 2 6   ? -6.691  25.712  60.770  1.00 52.83  ? 6    DT  G OP2   1 
ATOM   5936 O "O5'" . DT  G 2 6   ? -7.380  23.998  62.438  1.00 49.07  ? 6    DT  G "O5'" 1 
ATOM   5937 C "C5'" . DT  G 2 6   ? -8.202  23.483  63.495  1.00 48.37  ? 6    DT  G "C5'" 1 
ATOM   5938 C "C4'" . DT  G 2 6   ? -7.916  22.016  63.706  1.00 47.33  ? 6    DT  G "C4'" 1 
ATOM   5939 O "O4'" . DT  G 2 6   ? -8.176  21.279  62.493  1.00 45.11  ? 6    DT  G "O4'" 1 
ATOM   5940 C "C3'" . DT  G 2 6   ? -6.470  21.699  64.094  1.00 49.06  ? 6    DT  G "C3'" 1 
ATOM   5941 O "O3'" . DT  G 2 6   ? -6.509  21.072  65.383  1.00 53.94  ? 6    DT  G "O3'" 1 
ATOM   5942 C "C2'" . DT  G 2 6   ? -5.958  20.818  62.960  1.00 47.37  ? 6    DT  G "C2'" 1 
ATOM   5943 C "C1'" . DT  G 2 6   ? -7.222  20.247  62.360  1.00 44.31  ? 6    DT  G "C1'" 1 
ATOM   5944 N N1    . DT  G 2 6   ? -7.155  19.879  60.931  1.00 41.63  ? 6    DT  G N1    1 
ATOM   5945 C C2    . DT  G 2 6   ? -7.301  18.555  60.576  1.00 42.14  ? 6    DT  G C2    1 
ATOM   5946 O O2    . DT  G 2 6   ? -7.445  17.659  61.388  1.00 45.41  ? 6    DT  G O2    1 
ATOM   5947 N N3    . DT  G 2 6   ? -7.262  18.315  59.225  1.00 40.99  ? 6    DT  G N3    1 
ATOM   5948 C C4    . DT  G 2 6   ? -7.089  19.248  58.217  1.00 41.68  ? 6    DT  G C4    1 
ATOM   5949 O O4    . DT  G 2 6   ? -7.112  18.889  57.039  1.00 41.07  ? 6    DT  G O4    1 
ATOM   5950 C C5    . DT  G 2 6   ? -6.945  20.618  58.663  1.00 40.47  ? 6    DT  G C5    1 
ATOM   5951 C C7    . DT  G 2 6   ? -6.773  21.697  57.643  1.00 39.08  ? 6    DT  G C7    1 
ATOM   5952 C C6    . DT  G 2 6   ? -7.006  20.862  59.979  1.00 41.52  ? 6    DT  G C6    1 
ATOM   5953 P P     . DT  G 2 7   ? -5.182  20.535  66.059  1.00 56.31  ? 7    DT  G P     1 
ATOM   5954 O OP1   . DT  G 2 7   ? -5.421  20.450  67.533  1.00 56.52  ? 7    DT  G OP1   1 
ATOM   5955 O OP2   . DT  G 2 7   ? -4.059  21.339  65.520  1.00 56.31  ? 7    DT  G OP2   1 
ATOM   5956 O "O5'" . DT  G 2 7   ? -5.063  19.061  65.468  1.00 54.33  ? 7    DT  G "O5'" 1 
ATOM   5957 C "C5'" . DT  G 2 7   ? -5.963  18.014  65.875  1.00 52.91  ? 7    DT  G "C5'" 1 
ATOM   5958 C "C4'" . DT  G 2 7   ? -5.476  16.689  65.339  1.00 52.27  ? 7    DT  G "C4'" 1 
ATOM   5959 O "O4'" . DT  G 2 7   ? -5.570  16.700  63.901  1.00 51.06  ? 7    DT  G "O4'" 1 
ATOM   5960 C "C3'" . DT  G 2 7   ? -4.024  16.362  65.673  1.00 53.74  ? 7    DT  G "C3'" 1 
ATOM   5961 O "O3'" . DT  G 2 7   ? -4.001  15.245  66.557  1.00 58.02  ? 7    DT  G "O3'" 1 
ATOM   5962 C "C2'" . DT  G 2 7   ? -3.353  16.099  64.332  1.00 52.63  ? 7    DT  G "C2'" 1 
ATOM   5963 C "C1'" . DT  G 2 7   ? -4.494  15.977  63.339  1.00 51.93  ? 7    DT  G "C1'" 1 
ATOM   5964 N N1    . DT  G 2 7   ? -4.245  16.553  62.004  1.00 50.85  ? 7    DT  G N1    1 
ATOM   5965 C C2    . DT  G 2 7   ? -4.453  15.766  60.893  1.00 50.37  ? 7    DT  G C2    1 
ATOM   5966 O O2    . DT  G 2 7   ? -4.738  14.581  60.958  1.00 50.48  ? 7    DT  G O2    1 
ATOM   5967 N N3    . DT  G 2 7   ? -4.279  16.414  59.694  1.00 50.78  ? 7    DT  G N3    1 
ATOM   5968 C C4    . DT  G 2 7   ? -3.936  17.741  59.503  1.00 49.78  ? 7    DT  G C4    1 
ATOM   5969 O O4    . DT  G 2 7   ? -3.822  18.188  58.362  1.00 47.70  ? 7    DT  G O4    1 
ATOM   5970 C C5    . DT  G 2 7   ? -3.761  18.511  60.713  1.00 48.95  ? 7    DT  G C5    1 
ATOM   5971 C C7    . DT  G 2 7   ? -3.411  19.961  60.607  1.00 48.26  ? 7    DT  G C7    1 
ATOM   5972 C C6    . DT  G 2 7   ? -3.939  17.891  61.886  1.00 49.85  ? 7    DT  G C6    1 
ATOM   5973 P P     . DG  G 2 8   ? -2.619  14.825  67.264  1.00 66.49  ? 8    DG  G P     1 
ATOM   5974 O OP1   . DG  G 2 8   ? -2.941  14.182  68.558  1.00 68.48  ? 8    DG  G OP1   1 
ATOM   5975 O OP2   . DG  G 2 8   ? -1.695  15.997  67.226  1.00 62.36  ? 8    DG  G OP2   1 
ATOM   5976 O "O5'" . DG  G 2 8   ? -2.045  13.718  66.270  1.00 64.91  ? 8    DG  G "O5'" 1 
ATOM   5977 C "C5'" . DG  G 2 8   ? -2.910  12.708  65.710  1.00 61.74  ? 8    DG  G "C5'" 1 
ATOM   5978 C "C4'" . DG  G 2 8   ? -2.123  11.774  64.820  1.00 59.94  ? 8    DG  G "C4'" 1 
ATOM   5979 O "O4'" . DG  G 2 8   ? -2.091  12.301  63.475  1.00 56.92  ? 8    DG  G "O4'" 1 
ATOM   5980 C "C3'" . DG  G 2 8   ? -0.666  11.545  65.217  1.00 62.00  ? 8    DG  G "C3'" 1 
ATOM   5981 O "O3'" . DG  G 2 8   ? -0.401  10.151  65.009  1.00 65.51  ? 8    DG  G "O3'" 1 
ATOM   5982 C "C2'" . DG  G 2 8   ? 0.092   12.510  64.319  1.00 58.86  ? 8    DG  G "C2'" 1 
ATOM   5983 C "C1'" . DG  G 2 8   ? -0.756  12.531  63.059  1.00 54.72  ? 8    DG  G "C1'" 1 
ATOM   5984 N N9    . DG  G 2 8   ? -0.745  13.771  62.289  1.00 51.74  ? 8    DG  G N9    1 
ATOM   5985 C C8    . DG  G 2 8   ? -0.551  15.053  62.745  1.00 50.40  ? 8    DG  G C8    1 
ATOM   5986 N N7    . DG  G 2 8   ? -0.605  15.948  61.795  1.00 47.94  ? 8    DG  G N7    1 
ATOM   5987 C C5    . DG  G 2 8   ? -0.854  15.213  60.644  1.00 48.08  ? 8    DG  G C5    1 
ATOM   5988 C C6    . DG  G 2 8   ? -1.021  15.636  59.295  1.00 46.23  ? 8    DG  G C6    1 
ATOM   5989 O O6    . DG  G 2 8   ? -0.995  16.784  58.836  1.00 46.63  ? 8    DG  G O6    1 
ATOM   5990 N N1    . DG  G 2 8   ? -1.242  14.559  58.444  1.00 45.90  ? 8    DG  G N1    1 
ATOM   5991 C C2    . DG  G 2 8   ? -1.304  13.243  58.834  1.00 47.70  ? 8    DG  G C2    1 
ATOM   5992 N N2    . DG  G 2 8   ? -1.541  12.347  57.863  1.00 45.76  ? 8    DG  G N2    1 
ATOM   5993 N N3    . DG  G 2 8   ? -1.184  12.839  60.090  1.00 50.16  ? 8    DG  G N3    1 
ATOM   5994 C C4    . DG  G 2 8   ? -0.952  13.869  60.933  1.00 49.95  ? 8    DG  G C4    1 
ATOM   5995 P P     . DA  G 2 9   ? 1.067   9.534   65.219  1.00 72.34  ? 9    DA  G P     1 
ATOM   5996 O OP1   . DA  G 2 9   ? 0.927   8.279   65.997  1.00 76.36  ? 9    DA  G OP1   1 
ATOM   5997 O OP2   . DA  G 2 9   ? 1.983   10.605  65.701  1.00 74.03  ? 9    DA  G OP2   1 
ATOM   5998 O "O5'" . DA  G 2 9   ? 1.484   9.139   63.733  1.00 69.43  ? 9    DA  G "O5'" 1 
ATOM   5999 C "C5'" . DA  G 2 9   ? 0.505   8.570   62.847  1.00 64.99  ? 9    DA  G "C5'" 1 
ATOM   6000 C "C4'" . DA  G 2 9   ? 1.121   8.332   61.491  1.00 61.92  ? 9    DA  G "C4'" 1 
ATOM   6001 O "O4'" . DA  G 2 9   ? 1.052   9.558   60.731  1.00 57.90  ? 9    DA  G "O4'" 1 
ATOM   6002 C "C3'" . DA  G 2 9   ? 2.596   7.951   61.526  1.00 63.72  ? 9    DA  G "C3'" 1 
ATOM   6003 O "O3'" . DA  G 2 9   ? 2.863   7.063   60.438  1.00 64.68  ? 9    DA  G "O3'" 1 
ATOM   6004 C "C2'" . DA  G 2 9   ? 3.295   9.286   61.353  1.00 61.27  ? 9    DA  G "C2'" 1 
ATOM   6005 C "C1'" . DA  G 2 9   ? 2.356   9.998   60.396  1.00 57.14  ? 9    DA  G "C1'" 1 
ATOM   6006 N N9    . DA  G 2 9   ? 2.366   11.460  60.465  1.00 53.19  ? 9    DA  G N9    1 
ATOM   6007 C C8    . DA  G 2 9   ? 2.521   12.281  61.556  1.00 52.80  ? 9    DA  G C8    1 
ATOM   6008 N N7    . DA  G 2 9   ? 2.459   13.560  61.267  1.00 49.56  ? 9    DA  G N7    1 
ATOM   6009 C C5    . DA  G 2 9   ? 2.247   13.581  59.895  1.00 48.70  ? 9    DA  G C5    1 
ATOM   6010 C C6    . DA  G 2 9   ? 2.119   14.635  58.970  1.00 47.22  ? 9    DA  G C6    1 
ATOM   6011 N N6    . DA  G 2 9   ? 2.170   15.928  59.304  1.00 45.89  ? 9    DA  G N6    1 
ATOM   6012 N N1    . DA  G 2 9   ? 1.926   14.309  57.671  1.00 46.20  ? 9    DA  G N1    1 
ATOM   6013 C C2    . DA  G 2 9   ? 1.869   13.013  57.335  1.00 46.21  ? 9    DA  G C2    1 
ATOM   6014 N N3    . DA  G 2 9   ? 1.979   11.937  58.111  1.00 47.73  ? 9    DA  G N3    1 
ATOM   6015 C C4    . DA  G 2 9   ? 2.178   12.294  59.391  1.00 49.48  ? 9    DA  G C4    1 
ATOM   6016 P P     . DG  G 2 10  ? 4.257   6.265   60.363  1.00 68.34  ? 10   DG  G P     1 
ATOM   6017 O OP1   . DG  G 2 10  ? 3.955   4.832   60.103  1.00 72.50  ? 10   DG  G OP1   1 
ATOM   6018 O OP2   . DG  G 2 10  ? 5.095   6.648   61.526  1.00 68.36  ? 10   DG  G OP2   1 
ATOM   6019 O "O5'" . DG  G 2 10  ? 4.964   6.919   59.099  1.00 63.93  ? 10   DG  G "O5'" 1 
ATOM   6020 C "C5'" . DG  G 2 10  ? 4.351   6.820   57.814  1.00 63.49  ? 10   DG  G "C5'" 1 
ATOM   6021 C "C4'" . DG  G 2 10  ? 4.951   7.848   56.891  1.00 60.55  ? 10   DG  G "C4'" 1 
ATOM   6022 O "O4'" . DG  G 2 10  ? 4.657   9.170   57.392  1.00 55.89  ? 10   DG  G "O4'" 1 
ATOM   6023 C "C3'" . DG  G 2 10  ? 6.476   7.781   56.752  1.00 62.23  ? 10   DG  G "C3'" 1 
ATOM   6024 O "O3'" . DG  G 2 10  ? 6.766   7.952   55.366  1.00 64.75  ? 10   DG  G "O3'" 1 
ATOM   6025 C "C2'" . DG  G 2 10  ? 6.951   8.976   57.554  1.00 58.02  ? 10   DG  G "C2'" 1 
ATOM   6026 C "C1'" . DG  G 2 10  ? 5.825   9.941   57.255  1.00 54.43  ? 10   DG  G "C1'" 1 
ATOM   6027 N N9    . DG  G 2 10  ? 5.709   11.088  58.142  1.00 51.10  ? 10   DG  G N9    1 
ATOM   6028 C C8    . DG  G 2 10  ? 5.731   11.094  59.514  1.00 52.45  ? 10   DG  G C8    1 
ATOM   6029 N N7    . DG  G 2 10  ? 5.608   12.290  60.023  1.00 52.11  ? 10   DG  G N7    1 
ATOM   6030 C C5    . DG  G 2 10  ? 5.520   13.124  58.918  1.00 49.53  ? 10   DG  G C5    1 
ATOM   6031 C C6    . DG  G 2 10  ? 5.367   14.526  58.843  1.00 48.93  ? 10   DG  G C6    1 
ATOM   6032 O O6    . DG  G 2 10  ? 5.313   15.342  59.765  1.00 50.51  ? 10   DG  G O6    1 
ATOM   6033 N N1    . DG  G 2 10  ? 5.299   14.964  57.525  1.00 48.97  ? 10   DG  G N1    1 
ATOM   6034 C C2    . DG  G 2 10  ? 5.369   14.152  56.420  1.00 49.00  ? 10   DG  G C2    1 
ATOM   6035 N N2    . DG  G 2 10  ? 5.284   14.761  55.232  1.00 50.03  ? 10   DG  G N2    1 
ATOM   6036 N N3    . DG  G 2 10  ? 5.493   12.837  56.478  1.00 49.28  ? 10   DG  G N3    1 
ATOM   6037 C C4    . DG  G 2 10  ? 5.564   12.395  57.750  1.00 49.36  ? 10   DG  G C4    1 
ATOM   6038 P P     . DA  G 2 11  ? 8.253   7.768   54.801  1.00 68.31  ? 11   DA  G P     1 
ATOM   6039 O OP1   . DA  G 2 11  ? 8.215   6.694   53.779  1.00 73.99  ? 11   DA  G OP1   1 
ATOM   6040 O OP2   . DA  G 2 11  ? 9.188   7.672   55.942  1.00 67.99  ? 11   DA  G OP2   1 
ATOM   6041 O "O5'" . DA  G 2 11  ? 8.512   9.153   54.053  1.00 64.24  ? 11   DA  G "O5'" 1 
ATOM   6042 C "C5'" . DA  G 2 11  ? 7.535   9.635   53.108  1.00 62.40  ? 11   DA  G "C5'" 1 
ATOM   6043 C "C4'" . DA  G 2 11  ? 7.944   10.987  52.578  1.00 58.10  ? 11   DA  G "C4'" 1 
ATOM   6044 O "O4'" . DA  G 2 11  ? 7.664   11.978  53.591  1.00 53.70  ? 11   DA  G "O4'" 1 
ATOM   6045 C "C3'" . DA  G 2 11  ? 9.434   11.109  52.261  1.00 57.71  ? 11   DA  G "C3'" 1 
ATOM   6046 O "O3'" . DA  G 2 11  ? 9.681   11.940  51.131  1.00 57.98  ? 11   DA  G "O3'" 1 
ATOM   6047 C "C2'" . DA  G 2 11  ? 10.000  11.759  53.501  1.00 54.92  ? 11   DA  G "C2'" 1 
ATOM   6048 C "C1'" . DA  G 2 11  ? 8.856   12.659  53.931  1.00 52.46  ? 11   DA  G "C1'" 1 
ATOM   6049 N N9    . DA  G 2 11  ? 8.823   12.909  55.365  1.00 49.76  ? 11   DA  G N9    1 
ATOM   6050 C C8    . DA  G 2 11  ? 8.955   12.003  56.390  1.00 49.44  ? 11   DA  G C8    1 
ATOM   6051 N N7    . DA  G 2 11  ? 8.926   12.548  57.579  1.00 48.17  ? 11   DA  G N7    1 
ATOM   6052 C C5    . DA  G 2 11  ? 8.782   13.905  57.321  1.00 46.21  ? 11   DA  G C5    1 
ATOM   6053 C C6    . DA  G 2 11  ? 8.661   15.022  58.166  1.00 45.47  ? 11   DA  G C6    1 
ATOM   6054 N N6    . DA  G 2 11  ? 8.678   14.947  59.498  1.00 45.33  ? 11   DA  G N6    1 
ATOM   6055 N N1    . DA  G 2 11  ? 8.512   16.235  57.587  1.00 44.20  ? 11   DA  G N1    1 
ATOM   6056 C C2    . DA  G 2 11  ? 8.467   16.305  56.250  1.00 43.49  ? 11   DA  G C2    1 
ATOM   6057 N N3    . DA  G 2 11  ? 8.559   15.326  55.352  1.00 44.20  ? 11   DA  G N3    1 
ATOM   6058 C C4    . DA  G 2 11  ? 8.718   14.139  55.960  1.00 45.93  ? 11   DA  G C4    1 
ATOM   6059 P P     . DT  G 2 12  ? 11.188  12.077  50.558  1.00 59.54  ? 12   DT  G P     1 
ATOM   6060 O OP1   . DT  G 2 12  ? 11.130  12.042  49.072  1.00 62.33  ? 12   DT  G OP1   1 
ATOM   6061 O OP2   . DT  G 2 12  ? 12.070  11.142  51.296  1.00 58.80  ? 12   DT  G OP2   1 
ATOM   6062 O "O5'" . DT  G 2 12  ? 11.600  13.548  50.986  1.00 55.00  ? 12   DT  G "O5'" 1 
ATOM   6063 C "C5'" . DT  G 2 12  ? 10.835  14.666  50.540  1.00 53.95  ? 12   DT  G "C5'" 1 
ATOM   6064 C "C4'" . DT  G 2 12  ? 11.256  15.886  51.318  1.00 50.88  ? 12   DT  G "C4'" 1 
ATOM   6065 O "O4'" . DT  G 2 12  ? 11.047  15.656  52.727  1.00 50.20  ? 12   DT  G "O4'" 1 
ATOM   6066 C "C3'" . DT  G 2 12  ? 12.731  16.255  51.150  1.00 50.30  ? 12   DT  G "C3'" 1 
ATOM   6067 O "O3'" . DT  G 2 12  ? 12.724  17.534  50.510  1.00 49.14  ? 12   DT  G "O3'" 1 
ATOM   6068 C "C2'" . DT  G 2 12  ? 13.296  16.217  52.562  1.00 48.91  ? 12   DT  G "C2'" 1 
ATOM   6069 C "C1'" . DT  G 2 12  ? 12.063  16.351  53.429  1.00 48.21  ? 12   DT  G "C1'" 1 
ATOM   6070 N N1    . DT  G 2 12  ? 12.151  15.770  54.777  1.00 46.98  ? 12   DT  G N1    1 
ATOM   6071 C C2    . DT  G 2 12  ? 11.956  16.603  55.853  1.00 46.44  ? 12   DT  G C2    1 
ATOM   6072 O O2    . DT  G 2 12  ? 11.759  17.805  55.746  1.00 46.19  ? 12   DT  G O2    1 
ATOM   6073 N N3    . DT  G 2 12  ? 12.004  15.976  57.072  1.00 47.59  ? 12   DT  G N3    1 
ATOM   6074 C C4    . DT  G 2 12  ? 12.197  14.631  57.314  1.00 47.78  ? 12   DT  G C4    1 
ATOM   6075 O O4    . DT  G 2 12  ? 12.228  14.219  58.469  1.00 49.35  ? 12   DT  G O4    1 
ATOM   6076 C C5    . DT  G 2 12  ? 12.381  13.814  56.139  1.00 47.70  ? 12   DT  G C5    1 
ATOM   6077 C C7    . DT  G 2 12  ? 12.605  12.343  56.305  1.00 50.15  ? 12   DT  G C7    1 
ATOM   6078 C C6    . DT  G 2 12  ? 12.348  14.416  54.946  1.00 47.50  ? 12   DT  G C6    1 
ATOM   6079 P P     . DC  G 2 13  ? 14.064  18.343  50.277  1.00 49.66  ? 13   DC  G P     1 
ATOM   6080 O OP1   . DC  G 2 13  ? 13.807  19.349  49.219  1.00 49.52  ? 13   DC  G OP1   1 
ATOM   6081 O OP2   . DC  G 2 13  ? 15.176  17.364  50.122  1.00 49.79  ? 13   DC  G OP2   1 
ATOM   6082 O "O5'" . DC  G 2 13  ? 14.188  19.188  51.618  1.00 49.56  ? 13   DC  G "O5'" 1 
ATOM   6083 C "C5'" . DC  G 2 13  ? 13.365  20.351  51.792  1.00 51.62  ? 13   DC  G "C5'" 1 
ATOM   6084 C "C4'" . DC  G 2 13  ? 13.833  21.131  52.997  1.00 52.22  ? 13   DC  G "C4'" 1 
ATOM   6085 O "O4'" . DC  G 2 13  ? 13.775  20.254  54.144  1.00 50.43  ? 13   DC  G "O4'" 1 
ATOM   6086 C "C3'" . DC  G 2 13  ? 15.280  21.635  52.907  1.00 54.04  ? 13   DC  G "C3'" 1 
ATOM   6087 O "O3'" . DC  G 2 13  ? 15.388  23.028  53.269  1.00 57.06  ? 13   DC  G "O3'" 1 
ATOM   6088 C "C2'" . DC  G 2 13  ? 16.040  20.689  53.818  1.00 52.92  ? 13   DC  G "C2'" 1 
ATOM   6089 C "C1'" . DC  G 2 13  ? 14.997  20.327  54.849  1.00 51.69  ? 13   DC  G "C1'" 1 
ATOM   6090 N N1    . DC  G 2 13  ? 15.186  19.050  55.555  1.00 51.94  ? 13   DC  G N1    1 
ATOM   6091 C C2    . DC  G 2 13  ? 14.959  19.010  56.934  1.00 54.10  ? 13   DC  G C2    1 
ATOM   6092 O O2    . DC  G 2 13  ? 14.634  20.052  57.522  1.00 54.77  ? 13   DC  G O2    1 
ATOM   6093 N N3    . DC  G 2 13  ? 15.104  17.840  57.594  1.00 56.67  ? 13   DC  G N3    1 
ATOM   6094 C C4    . DC  G 2 13  ? 15.451  16.738  56.928  1.00 56.86  ? 13   DC  G C4    1 
ATOM   6095 N N4    . DC  G 2 13  ? 15.577  15.609  57.623  1.00 60.30  ? 13   DC  G N4    1 
ATOM   6096 C C5    . DC  G 2 13  ? 15.678  16.747  55.521  1.00 54.53  ? 13   DC  G C5    1 
ATOM   6097 C C6    . DC  G 2 13  ? 15.524  17.911  54.878  1.00 52.68  ? 13   DC  G C6    1 
ATOM   6098 P P     . DT  G 2 14  ? 16.828  23.777  53.246  1.00 59.60  ? 14   DT  G P     1 
ATOM   6099 O OP1   . DT  G 2 14  ? 16.652  25.121  52.653  1.00 62.85  ? 14   DT  G OP1   1 
ATOM   6100 O OP2   . DT  G 2 14  ? 17.838  22.850  52.673  1.00 61.90  ? 14   DT  G OP2   1 
ATOM   6101 O "O5'" . DT  G 2 14  ? 17.162  23.933  54.796  1.00 63.72  ? 14   DT  G "O5'" 1 
ATOM   6102 C "C5'" . DT  G 2 14  ? 16.183  24.494  55.688  1.00 64.47  ? 14   DT  G "C5'" 1 
ATOM   6103 C "C4'" . DT  G 2 14  ? 16.700  24.493  57.106  1.00 63.66  ? 14   DT  G "C4'" 1 
ATOM   6104 O "O4'" . DT  G 2 14  ? 16.703  23.138  57.606  1.00 61.83  ? 14   DT  G "O4'" 1 
ATOM   6105 C "C3'" . DT  G 2 14  ? 18.120  25.022  57.285  1.00 65.56  ? 14   DT  G "C3'" 1 
ATOM   6106 O "O3'" . DT  G 2 14  ? 18.105  25.992  58.330  1.00 68.37  ? 14   DT  G "O3'" 1 
ATOM   6107 C "C2'" . DT  G 2 14  ? 18.943  23.793  57.641  1.00 65.09  ? 14   DT  G "C2'" 1 
ATOM   6108 C "C1'" . DT  G 2 14  ? 17.927  22.858  58.261  1.00 61.87  ? 14   DT  G "C1'" 1 
ATOM   6109 N N1    . DT  G 2 14  ? 18.181  21.418  58.092  1.00 59.06  ? 14   DT  G N1    1 
ATOM   6110 C C2    . DT  G 2 14  ? 18.034  20.601  59.191  1.00 58.47  ? 14   DT  G C2    1 
ATOM   6111 O O2    . DT  G 2 14  ? 17.800  21.021  60.312  1.00 58.97  ? 14   DT  G O2    1 
ATOM   6112 N N3    . DT  G 2 14  ? 18.190  19.264  58.931  1.00 57.51  ? 14   DT  G N3    1 
ATOM   6113 C C4    . DT  G 2 14  ? 18.435  18.675  57.706  1.00 56.02  ? 14   DT  G C4    1 
ATOM   6114 O O4    . DT  G 2 14  ? 18.563  17.460  57.631  1.00 56.29  ? 14   DT  G O4    1 
ATOM   6115 C C5    . DT  G 2 14  ? 18.531  19.588  56.590  1.00 55.67  ? 14   DT  G C5    1 
ATOM   6116 C C7    . DT  G 2 14  ? 18.813  19.039  55.226  1.00 55.89  ? 14   DT  G C7    1 
ATOM   6117 C C6    . DT  G 2 14  ? 18.385  20.896  56.833  1.00 56.02  ? 14   DT  G C6    1 
ATOM   6118 P P     . DC  G 2 15  ? 19.349  26.964  58.547  1.00 76.45  ? 15   DC  G P     1 
ATOM   6119 O OP1   . DC  G 2 15  ? 18.800  28.307  58.886  1.00 79.54  ? 15   DC  G OP1   1 
ATOM   6120 O OP2   . DC  G 2 15  ? 20.275  26.807  57.393  1.00 69.89  ? 15   DC  G OP2   1 
ATOM   6121 O "O5'" . DC  G 2 15  ? 20.099  26.306  59.790  1.00 73.56  ? 15   DC  G "O5'" 1 
ATOM   6122 C "C5'" . DC  G 2 15  ? 19.387  26.045  61.011  1.00 76.32  ? 15   DC  G "C5'" 1 
ATOM   6123 C "C4'" . DC  G 2 15  ? 20.190  25.103  61.875  1.00 74.90  ? 15   DC  G "C4'" 1 
ATOM   6124 O "O4'" . DC  G 2 15  ? 20.105  23.772  61.329  1.00 71.01  ? 15   DC  G "O4'" 1 
ATOM   6125 C "C3'" . DC  G 2 15  ? 21.681  25.427  61.949  1.00 73.04  ? 15   DC  G "C3'" 1 
ATOM   6126 O "O3'" . DC  G 2 15  ? 22.019  25.878  63.261  1.00 79.99  ? 15   DC  G "O3'" 1 
ATOM   6127 C "C2'" . DC  G 2 15  ? 22.383  24.120  61.596  1.00 66.92  ? 15   DC  G "C2'" 1 
ATOM   6128 C "C1'" . DC  G 2 15  ? 21.284  23.079  61.646  1.00 66.39  ? 15   DC  G "C1'" 1 
ATOM   6129 N N1    . DC  G 2 15  ? 21.429  21.994  60.672  1.00 61.76  ? 15   DC  G N1    1 
ATOM   6130 C C2    . DC  G 2 15  ? 21.370  20.674  61.121  1.00 61.27  ? 15   DC  G C2    1 
ATOM   6131 O O2    . DC  G 2 15  ? 21.204  20.461  62.327  1.00 63.61  ? 15   DC  G O2    1 
ATOM   6132 N N3    . DC  G 2 15  ? 21.510  19.665  60.232  1.00 59.32  ? 15   DC  G N3    1 
ATOM   6133 C C4    . DC  G 2 15  ? 21.682  19.938  58.936  1.00 56.02  ? 15   DC  G C4    1 
ATOM   6134 N N4    . DC  G 2 15  ? 21.782  18.912  58.094  1.00 54.61  ? 15   DC  G N4    1 
ATOM   6135 C C5    . DC  G 2 15  ? 21.754  21.275  58.450  1.00 54.97  ? 15   DC  G C5    1 
ATOM   6136 C C6    . DC  G 2 15  ? 21.620  22.264  59.344  1.00 58.23  ? 15   DC  G C6    1 
ATOM   6137 P P     . DA  G 2 16  ? 23.541  26.300  63.593  1.00 81.57  ? 16   DA  G P     1 
ATOM   6138 O OP1   . DA  G 2 16  ? 23.485  27.474  64.511  1.00 86.77  ? 16   DA  G OP1   1 
ATOM   6139 O OP2   . DA  G 2 16  ? 24.308  26.371  62.312  1.00 75.08  ? 16   DA  G OP2   1 
ATOM   6140 O "O5'" . DA  G 2 16  ? 24.098  25.043  64.396  1.00 78.20  ? 16   DA  G "O5'" 1 
ATOM   6141 C "C5'" . DA  G 2 16  ? 23.354  24.456  65.478  1.00 79.27  ? 16   DA  G "C5'" 1 
ATOM   6142 C "C4'" . DA  G 2 16  ? 23.953  23.106  65.783  1.00 76.29  ? 16   DA  G "C4'" 1 
ATOM   6143 O "O4'" . DA  G 2 16  ? 23.788  22.259  64.624  1.00 70.74  ? 16   DA  G "O4'" 1 
ATOM   6144 C "C3'" . DA  G 2 16  ? 25.456  23.147  66.068  1.00 74.39  ? 16   DA  G "C3'" 1 
ATOM   6145 O "O3'" . DA  G 2 16  ? 25.710  22.424  67.271  1.00 79.50  ? 16   DA  G "O3'" 1 
ATOM   6146 C "C2'" . DA  G 2 16  ? 26.084  22.540  64.826  1.00 67.63  ? 16   DA  G "C2'" 1 
ATOM   6147 C "C1'" . DA  G 2 16  ? 25.009  21.591  64.353  1.00 66.13  ? 16   DA  G "C1'" 1 
ATOM   6148 N N9    . DA  G 2 16  ? 25.030  21.257  62.924  1.00 60.42  ? 16   DA  G N9    1 
ATOM   6149 C C8    . DA  G 2 16  ? 25.166  22.105  61.852  1.00 56.69  ? 16   DA  G C8    1 
ATOM   6150 N N7    . DA  G 2 16  ? 25.113  21.499  60.691  1.00 53.35  ? 16   DA  G N7    1 
ATOM   6151 C C5    . DA  G 2 16  ? 24.937  20.162  61.019  1.00 54.78  ? 16   DA  G C5    1 
ATOM   6152 C C6    . DA  G 2 16  ? 24.807  18.998  60.231  1.00 53.97  ? 16   DA  G C6    1 
ATOM   6153 N N6    . DA  G 2 16  ? 24.846  19.000  58.896  1.00 51.99  ? 16   DA  G N6    1 
ATOM   6154 N N1    . DA  G 2 16  ? 24.642  17.819  60.870  1.00 55.73  ? 16   DA  G N1    1 
ATOM   6155 C C2    . DA  G 2 16  ? 24.614  17.819  62.210  1.00 60.43  ? 16   DA  G C2    1 
ATOM   6156 N N3    . DA  G 2 16  ? 24.716  18.845  63.058  1.00 61.50  ? 16   DA  G N3    1 
ATOM   6157 C C4    . DA  G 2 16  ? 24.880  20.000  62.390  1.00 58.31  ? 16   DA  G C4    1 
ATOM   6158 P P     . DA  G 2 17  ? 27.193  22.305  67.858  1.00 81.88  ? 17   DA  G P     1 
ATOM   6159 O OP1   . DA  G 2 17  ? 27.123  22.560  69.319  1.00 88.17  ? 17   DA  G OP1   1 
ATOM   6160 O OP2   . DA  G 2 17  ? 28.103  23.119  67.000  1.00 78.26  ? 17   DA  G OP2   1 
ATOM   6161 O "O5'" . DA  G 2 17  ? 27.489  20.753  67.677  1.00 77.75  ? 17   DA  G "O5'" 1 
ATOM   6162 C "C5'" . DA  G 2 17  ? 26.427  19.811  67.908  1.00 79.14  ? 17   DA  G "C5'" 1 
ATOM   6163 C "C4'" . DA  G 2 17  ? 26.846  18.434  67.461  1.00 76.69  ? 17   DA  G "C4'" 1 
ATOM   6164 O "O4'" . DA  G 2 17  ? 26.703  18.312  66.028  1.00 70.91  ? 17   DA  G "O4'" 1 
ATOM   6165 C "C3'" . DA  G 2 17  ? 28.300  18.091  67.770  1.00 77.46  ? 17   DA  G "C3'" 1 
ATOM   6166 O "O3'" . DA  G 2 17  ? 28.308  16.760  68.280  1.00 81.67  ? 17   DA  G "O3'" 1 
ATOM   6167 C "C2'" . DA  G 2 17  ? 28.993  18.249  66.428  1.00 71.33  ? 17   DA  G "C2'" 1 
ATOM   6168 C "C1'" . DA  G 2 17  ? 27.908  17.802  65.479  1.00 67.94  ? 17   DA  G "C1'" 1 
ATOM   6169 N N9    . DA  G 2 17  ? 28.027  18.304  64.114  1.00 62.56  ? 17   DA  G N9    1 
ATOM   6170 C C8    . DA  G 2 17  ? 28.282  19.594  63.716  1.00 60.98  ? 17   DA  G C8    1 
ATOM   6171 N N7    . DA  G 2 17  ? 28.295  19.754  62.415  1.00 57.03  ? 17   DA  G N7    1 
ATOM   6172 C C5    . DA  G 2 17  ? 28.012  18.488  61.922  1.00 55.55  ? 17   DA  G C5    1 
ATOM   6173 C C6    . DA  G 2 17  ? 27.894  17.992  60.613  1.00 51.63  ? 17   DA  G C6    1 
ATOM   6174 N N6    . DA  G 2 17  ? 28.028  18.751  59.523  1.00 47.57  ? 17   DA  G N6    1 
ATOM   6175 N N1    . DA  G 2 17  ? 27.629  16.674  60.462  1.00 53.41  ? 17   DA  G N1    1 
ATOM   6176 C C2    . DA  G 2 17  ? 27.469  15.921  61.562  1.00 58.24  ? 17   DA  G C2    1 
ATOM   6177 N N3    . DA  G 2 17  ? 27.539  16.278  62.847  1.00 60.18  ? 17   DA  G N3    1 
ATOM   6178 C C4    . DA  G 2 17  ? 27.835  17.586  62.958  1.00 59.44  ? 17   DA  G C4    1 
ATOM   6179 P P     . DT  G 2 18  ? 29.679  16.050  68.628  1.00 85.23  ? 18   DT  G P     1 
ATOM   6180 O OP1   . DT  G 2 18  ? 29.437  15.086  69.728  1.00 91.32  ? 18   DT  G OP1   1 
ATOM   6181 O OP2   . DT  G 2 18  ? 30.723  17.100  68.760  1.00 86.54  ? 18   DT  G OP2   1 
ATOM   6182 O "O5'" . DT  G 2 18  ? 29.992  15.238  67.299  1.00 80.39  ? 18   DT  G "O5'" 1 
ATOM   6183 C "C5'" . DT  G 2 18  ? 29.185  14.122  66.920  1.00 79.51  ? 18   DT  G "C5'" 1 
ATOM   6184 C "C4'" . DT  G 2 18  ? 29.733  13.570  65.630  1.00 75.22  ? 18   DT  G "C4'" 1 
ATOM   6185 O "O4'" . DT  G 2 18  ? 29.712  14.610  64.635  1.00 69.01  ? 18   DT  G "O4'" 1 
ATOM   6186 C "C3'" . DT  G 2 18  ? 31.190  13.105  65.712  1.00 75.42  ? 18   DT  G "C3'" 1 
ATOM   6187 O "O3'" . DT  G 2 18  ? 31.211  11.676  65.673  1.00 79.17  ? 18   DT  G "O3'" 1 
ATOM   6188 C "C2'" . DT  G 2 18  ? 31.864  13.749  64.508  1.00 69.84  ? 18   DT  G "C2'" 1 
ATOM   6189 C "C1'" . DT  G 2 18  ? 30.702  14.288  63.692  1.00 66.33  ? 18   DT  G "C1'" 1 
ATOM   6190 N N1    . DT  G 2 18  ? 30.961  15.492  62.875  1.00 62.01  ? 18   DT  G N1    1 
ATOM   6191 C C2    . DT  G 2 18  ? 30.821  15.377  61.511  1.00 59.51  ? 18   DT  G C2    1 
ATOM   6192 O O2    . DT  G 2 18  ? 30.552  14.323  60.955  1.00 60.43  ? 18   DT  G O2    1 
ATOM   6193 N N3    . DT  G 2 18  ? 31.054  16.537  60.812  1.00 56.91  ? 18   DT  G N3    1 
ATOM   6194 C C4    . DT  G 2 18  ? 31.387  17.773  61.333  1.00 56.15  ? 18   DT  G C4    1 
ATOM   6195 O O4    . DT  G 2 18  ? 31.565  18.725  60.582  1.00 53.89  ? 18   DT  G O4    1 
ATOM   6196 C C5    . DT  G 2 18  ? 31.505  17.824  62.771  1.00 59.02  ? 18   DT  G C5    1 
ATOM   6197 C C7    . DT  G 2 18  ? 31.879  19.118  63.422  1.00 60.70  ? 18   DT  G C7    1 
ATOM   6198 C C6    . DT  G 2 18  ? 31.281  16.698  63.462  1.00 61.91  ? 18   DT  G C6    1 
ATOM   6199 P P     . DC  G 2 19  ? 32.562  10.882  65.975  1.00 83.17  ? 19   DC  G P     1 
ATOM   6200 O OP1   . DC  G 2 19  ? 32.229  9.727   66.851  1.00 88.34  ? 19   DC  G OP1   1 
ATOM   6201 O OP2   . DC  G 2 19  ? 33.588  11.867  66.397  1.00 84.14  ? 19   DC  G OP2   1 
ATOM   6202 O "O5'" . DC  G 2 19  ? 33.023  10.368  64.535  1.00 78.84  ? 19   DC  G "O5'" 1 
ATOM   6203 C "C5'" . DC  G 2 19  ? 32.094  9.842   63.574  1.00 76.20  ? 19   DC  G "C5'" 1 
ATOM   6204 C "C4'" . DC  G 2 19  ? 32.739  9.841   62.209  1.00 72.52  ? 19   DC  G "C4'" 1 
ATOM   6205 O "O4'" . DC  G 2 19  ? 32.629  11.155  61.617  1.00 67.13  ? 19   DC  G "O4'" 1 
ATOM   6206 C "C3'" . DC  G 2 19  ? 34.232  9.498   62.214  1.00 73.90  ? 19   DC  G "C3'" 1 
ATOM   6207 O "O3'" . DC  G 2 19  ? 34.455  8.286   61.493  1.00 77.53  ? 19   DC  G "O3'" 1 
ATOM   6208 C "C2'" . DC  G 2 19  ? 34.901  10.696  61.559  1.00 68.95  ? 19   DC  G "C2'" 1 
ATOM   6209 C "C1'" . DC  G 2 19  ? 33.764  11.370  60.813  1.00 64.74  ? 19   DC  G "C1'" 1 
ATOM   6210 N N1    . DC  G 2 19  ? 33.910  12.821  60.627  1.00 61.15  ? 19   DC  G N1    1 
ATOM   6211 C C2    . DC  G 2 19  ? 33.822  13.353  59.335  1.00 57.21  ? 19   DC  G C2    1 
ATOM   6212 O O2    . DC  G 2 19  ? 33.642  12.581  58.378  1.00 55.12  ? 19   DC  G O2    1 
ATOM   6213 N N3    . DC  G 2 19  ? 33.953  14.692  59.161  1.00 55.32  ? 19   DC  G N3    1 
ATOM   6214 C C4    . DC  G 2 19  ? 34.164  15.485  60.218  1.00 56.28  ? 19   DC  G C4    1 
ATOM   6215 N N4    . DC  G 2 19  ? 34.285  16.799  60.005  1.00 54.00  ? 19   DC  G N4    1 
ATOM   6216 C C5    . DC  G 2 19  ? 34.246  14.968  61.543  1.00 59.79  ? 19   DC  G C5    1 
ATOM   6217 C C6    . DC  G 2 19  ? 34.110  13.645  61.702  1.00 62.56  ? 19   DC  G C6    1 
ATOM   6218 P P     . DT  G 2 20  ? 35.910  7.634   61.457  1.00 82.71  ? 20   DT  G P     1 
ATOM   6219 O OP1   . DT  G 2 20  ? 35.752  6.172   61.318  1.00 87.60  ? 20   DT  G OP1   1 
ATOM   6220 O OP2   . DT  G 2 20  ? 36.697  8.182   62.588  1.00 85.64  ? 20   DT  G OP2   1 
ATOM   6221 O "O5'" . DT  G 2 20  ? 36.500  8.179   60.083  1.00 77.61  ? 20   DT  G "O5'" 1 
ATOM   6222 C "C5'" . DT  G 2 20  ? 35.822  7.866   58.857  1.00 74.84  ? 20   DT  G "C5'" 1 
ATOM   6223 C "C4'" . DT  G 2 20  ? 36.442  8.633   57.715  1.00 70.41  ? 20   DT  G "C4'" 1 
ATOM   6224 O "O4'" . DT  G 2 20  ? 36.273  10.048  57.943  1.00 65.26  ? 20   DT  G "O4'" 1 
ATOM   6225 C "C3'" . DT  G 2 20  ? 37.945  8.402   57.539  1.00 71.70  ? 20   DT  G "C3'" 1 
ATOM   6226 O "O3'" . DT  G 2 20  ? 38.178  7.942   56.212  1.00 72.55  ? 20   DT  G "O3'" 1 
ATOM   6227 C "C2'" . DT  G 2 20  ? 38.573  9.762   57.797  1.00 68.25  ? 20   DT  G "C2'" 1 
ATOM   6228 C "C1'" . DT  G 2 20  ? 37.435  10.715  57.498  1.00 62.68  ? 20   DT  G "C1'" 1 
ATOM   6229 N N1    . DT  G 2 20  ? 37.493  12.014  58.188  1.00 58.24  ? 20   DT  G N1    1 
ATOM   6230 C C2    . DT  G 2 20  ? 37.442  13.153  57.419  1.00 53.85  ? 20   DT  G C2    1 
ATOM   6231 O O2    . DT  G 2 20  ? 37.402  13.133  56.198  1.00 51.92  ? 20   DT  G O2    1 
ATOM   6232 N N3    . DT  G 2 20  ? 37.465  14.325  58.133  1.00 53.00  ? 20   DT  G N3    1 
ATOM   6233 C C4    . DT  G 2 20  ? 37.518  14.464  59.508  1.00 56.07  ? 20   DT  G C4    1 
ATOM   6234 O O4    . DT  G 2 20  ? 37.543  15.582  60.008  1.00 55.63  ? 20   DT  G O4    1 
ATOM   6235 C C5    . DT  G 2 20  ? 37.562  13.228  60.252  1.00 59.89  ? 20   DT  G C5    1 
ATOM   6236 C C7    . DT  G 2 20  ? 37.622  13.283  61.747  1.00 63.26  ? 20   DT  G C7    1 
ATOM   6237 C C6    . DT  G 2 20  ? 37.543  12.079  59.564  1.00 60.55  ? 20   DT  G C6    1 
ATOM   6238 P P     . DT  G 2 21  ? 39.639  7.457   55.779  1.00 77.19  ? 21   DT  G P     1 
ATOM   6239 O OP1   . DT  G 2 21  ? 39.487  6.332   54.818  1.00 79.82  ? 21   DT  G OP1   1 
ATOM   6240 O OP2   . DT  G 2 21  ? 40.447  7.261   57.015  1.00 79.85  ? 21   DT  G OP2   1 
ATOM   6241 O "O5'" . DT  G 2 21  ? 40.196  8.724   54.992  1.00 70.06  ? 21   DT  G "O5'" 1 
ATOM   6242 C "C5'" . DT  G 2 21  ? 39.474  9.246   53.870  1.00 65.04  ? 21   DT  G "C5'" 1 
ATOM   6243 C "C4'" . DT  G 2 21  ? 40.011  10.607  53.502  1.00 60.97  ? 21   DT  G "C4'" 1 
ATOM   6244 O "O4'" . DT  G 2 21  ? 39.772  11.533  54.585  1.00 58.48  ? 21   DT  G "O4'" 1 
ATOM   6245 C "C3'" . DT  G 2 21  ? 41.518  10.649  53.218  1.00 63.25  ? 21   DT  G "C3'" 1 
ATOM   6246 O "O3'" . DT  G 2 21  ? 41.714  11.053  51.860  1.00 63.87  ? 21   DT  G "O3'" 1 
ATOM   6247 C "C2'" . DT  G 2 21  ? 42.071  11.618  54.252  1.00 62.45  ? 21   DT  G "C2'" 1 
ATOM   6248 C "C1'" . DT  G 2 21  ? 40.852  12.442  54.626  1.00 58.69  ? 21   DT  G "C1'" 1 
ATOM   6249 N N1    . DT  G 2 21  ? 40.861  13.078  55.964  1.00 58.11  ? 21   DT  G N1    1 
ATOM   6250 C C2    . DT  G 2 21  ? 40.791  14.452  56.037  1.00 55.47  ? 21   DT  G C2    1 
ATOM   6251 O O2    . DT  G 2 21  ? 40.769  15.173  55.053  1.00 54.05  ? 21   DT  G O2    1 
ATOM   6252 N N3    . DT  G 2 21  ? 40.769  14.957  57.312  1.00 56.39  ? 21   DT  G N3    1 
ATOM   6253 C C4    . DT  G 2 21  ? 40.828  14.243  58.493  1.00 59.42  ? 21   DT  G C4    1 
ATOM   6254 O O4    . DT  G 2 21  ? 40.824  14.840  59.565  1.00 60.11  ? 21   DT  G O4    1 
ATOM   6255 C C5    . DT  G 2 21  ? 40.910  12.806  58.342  1.00 61.69  ? 21   DT  G C5    1 
ATOM   6256 C C7    . DT  G 2 21  ? 40.970  11.948  59.567  1.00 65.84  ? 21   DT  G C7    1 
ATOM   6257 C C6    . DT  G 2 21  ? 40.903  12.303  57.103  1.00 60.76  ? 21   DT  G C6    1 
ATOM   6258 P P     . DT  G 2 22  ? 43.190  11.116  51.231  1.00 69.87  ? 22   DT  G P     1 
ATOM   6259 O OP1   . DT  G 2 22  ? 43.094  10.942  49.755  1.00 69.67  ? 22   DT  G OP1   1 
ATOM   6260 O OP2   . DT  G 2 22  ? 44.069  10.194  52.016  1.00 73.11  ? 22   DT  G OP2   1 
ATOM   6261 O "O5'" . DT  G 2 22  ? 43.599  12.641  51.467  1.00 66.89  ? 22   DT  G "O5'" 1 
ATOM   6262 C "C5'" . DT  G 2 22  ? 43.325  13.635  50.461  1.00 64.21  ? 22   DT  G "C5'" 1 
ATOM   6263 C "C4'" . DT  G 2 22  ? 43.439  15.031  51.028  1.00 62.42  ? 22   DT  G "C4'" 1 
ATOM   6264 O "O4'" . DT  G 2 22  ? 43.054  15.023  52.416  1.00 61.87  ? 22   DT  G "O4'" 1 
ATOM   6265 C "C3'" . DT  G 2 22  ? 44.854  15.615  51.000  1.00 66.22  ? 22   DT  G "C3'" 1 
ATOM   6266 O "O3'" . DT  G 2 22  ? 45.013  16.451  49.851  1.00 64.71  ? 22   DT  G "O3'" 1 
ATOM   6267 C "C2'" . DT  G 2 22  ? 44.960  16.415  52.293  1.00 66.53  ? 22   DT  G "C2'" 1 
ATOM   6268 C "C1'" . DT  G 2 22  ? 43.671  16.130  53.055  1.00 62.16  ? 22   DT  G "C1'" 1 
ATOM   6269 N N1    . DT  G 2 22  ? 43.834  15.797  54.484  1.00 63.09  ? 22   DT  G N1    1 
ATOM   6270 C C2    . DT  G 2 22  ? 43.685  16.818  55.394  1.00 63.37  ? 22   DT  G C2    1 
ATOM   6271 O O2    . DT  G 2 22  ? 43.455  17.972  55.068  1.00 64.02  ? 22   DT  G O2    1 
ATOM   6272 N N3    . DT  G 2 22  ? 43.807  16.436  56.709  1.00 63.61  ? 22   DT  G N3    1 
ATOM   6273 C C4    . DT  G 2 22  ? 44.044  15.164  57.189  1.00 65.41  ? 22   DT  G C4    1 
ATOM   6274 O O4    . DT  G 2 22  ? 44.132  14.975  58.396  1.00 67.23  ? 22   DT  G O4    1 
ATOM   6275 C C5    . DT  G 2 22  ? 44.193  14.140  56.179  1.00 66.13  ? 22   DT  G C5    1 
ATOM   6276 C C7    . DT  G 2 22  ? 44.480  12.735  56.606  1.00 69.20  ? 22   DT  G C7    1 
ATOM   6277 C C6    . DT  G 2 22  ? 44.072  14.502  54.895  1.00 64.45  ? 22   DT  G C6    1 
ATOM   6278 O "O5'" . DA  H 2 1   ? 43.785  23.495  65.343  1.00 89.60  ? 1    DA  H "O5'" 1 
ATOM   6279 C "C5'" . DA  H 2 1   ? 43.421  24.582  64.487  1.00 91.26  ? 1    DA  H "C5'" 1 
ATOM   6280 C "C4'" . DA  H 2 1   ? 43.438  24.125  63.050  1.00 86.60  ? 1    DA  H "C4'" 1 
ATOM   6281 O "O4'" . DA  H 2 1   ? 44.080  22.885  62.720  1.00 83.40  ? 1    DA  H "O4'" 1 
ATOM   6282 C "C3'" . DA  H 2 1   ? 42.249  24.342  62.122  1.00 82.87  ? 1    DA  H "C3'" 1 
ATOM   6283 O "O3'" . DA  H 2 1   ? 42.408  25.553  61.397  1.00 89.30  ? 1    DA  H "O3'" 1 
ATOM   6284 C "C2'" . DA  H 2 1   ? 42.297  23.154  61.174  1.00 76.74  ? 1    DA  H "C2'" 1 
ATOM   6285 C "C1'" . DA  H 2 1   ? 43.597  22.425  61.471  1.00 78.27  ? 1    DA  H "C1'" 1 
ATOM   6286 N N9    . DA  H 2 1   ? 43.469  20.975  61.554  1.00 72.38  ? 1    DA  H N9    1 
ATOM   6287 C C8    . DA  H 2 1   ? 43.265  20.190  62.660  1.00 70.22  ? 1    DA  H C8    1 
ATOM   6288 N N7    . DA  H 2 1   ? 43.231  18.906  62.397  1.00 66.93  ? 1    DA  H N7    1 
ATOM   6289 C C5    . DA  H 2 1   ? 43.450  18.842  61.028  1.00 66.66  ? 1    DA  H C5    1 
ATOM   6290 C C6    . DA  H 2 1   ? 43.544  17.764  60.136  1.00 65.10  ? 1    DA  H C6    1 
ATOM   6291 N N6    . DA  H 2 1   ? 43.421  16.486  60.502  1.00 63.46  ? 1    DA  H N6    1 
ATOM   6292 N N1    . DA  H 2 1   ? 43.758  18.046  58.833  1.00 66.95  ? 1    DA  H N1    1 
ATOM   6293 C C2    . DA  H 2 1   ? 43.902  19.327  58.467  1.00 69.98  ? 1    DA  H C2    1 
ATOM   6294 N N3    . DA  H 2 1   ? 43.831  20.424  59.211  1.00 71.93  ? 1    DA  H N3    1 
ATOM   6295 C C4    . DA  H 2 1   ? 43.596  20.109  60.497  1.00 70.03  ? 1    DA  H C4    1 
ATOM   6296 P P     . DA  H 2 2   ? 41.125  26.278  60.789  1.00 91.08  ? 2    DA  H P     1 
ATOM   6297 O OP1   . DA  H 2 2   ? 41.501  27.681  60.476  1.00 100.67 ? 2    DA  H OP1   1 
ATOM   6298 O OP2   . DA  H 2 2   ? 39.970  26.002  61.683  1.00 89.37  ? 2    DA  H OP2   1 
ATOM   6299 O "O5'" . DA  H 2 2   ? 40.891  25.509  59.417  1.00 85.20  ? 2    DA  H "O5'" 1 
ATOM   6300 C "C5'" . DA  H 2 2   ? 41.874  25.614  58.376  1.00 87.69  ? 2    DA  H "C5'" 1 
ATOM   6301 C "C4'" . DA  H 2 2   ? 41.460  24.794  57.177  1.00 83.00  ? 2    DA  H "C4'" 1 
ATOM   6302 O "O4'" . DA  H 2 2   ? 41.575  23.384  57.477  1.00 75.39  ? 2    DA  H "O4'" 1 
ATOM   6303 C "C3'" . DA  H 2 2   ? 40.022  25.011  56.698  1.00 82.39  ? 2    DA  H "C3'" 1 
ATOM   6304 O "O3'" . DA  H 2 2   ? 40.077  25.126  55.277  1.00 85.73  ? 2    DA  H "O3'" 1 
ATOM   6305 C "C2'" . DA  H 2 2   ? 39.285  23.798  57.235  1.00 74.10  ? 2    DA  H "C2'" 1 
ATOM   6306 C "C1'" . DA  H 2 2   ? 40.357  22.729  57.188  1.00 69.75  ? 2    DA  H "C1'" 1 
ATOM   6307 N N9    . DA  H 2 2   ? 40.200  21.645  58.154  1.00 63.43  ? 2    DA  H N9    1 
ATOM   6308 C C8    . DA  H 2 2   ? 39.886  21.704  59.490  1.00 62.38  ? 2    DA  H C8    1 
ATOM   6309 N N7    . DA  H 2 2   ? 39.852  20.529  60.075  1.00 57.92  ? 2    DA  H N7    1 
ATOM   6310 C C5    . DA  H 2 2   ? 40.180  19.640  59.059  1.00 55.71  ? 2    DA  H C5    1 
ATOM   6311 C C6    . DA  H 2 2   ? 40.319  18.238  59.028  1.00 52.42  ? 2    DA  H C6    1 
ATOM   6312 N N6    . DA  H 2 2   ? 40.138  17.449  60.087  1.00 50.65  ? 2    DA  H N6    1 
ATOM   6313 N N1    . DA  H 2 2   ? 40.660  17.669  57.854  1.00 52.74  ? 2    DA  H N1    1 
ATOM   6314 C C2    . DA  H 2 2   ? 40.855  18.458  56.791  1.00 55.94  ? 2    DA  H C2    1 
ATOM   6315 N N3    . DA  H 2 2   ? 40.745  19.779  56.692  1.00 58.98  ? 2    DA  H N3    1 
ATOM   6316 C C4    . DA  H 2 2   ? 40.403  20.316  57.874  1.00 58.76  ? 2    DA  H C4    1 
ATOM   6317 P P     . DA  H 2 3   ? 38.745  25.088  54.383  1.00 87.22  ? 3    DA  H P     1 
ATOM   6318 O OP1   . DA  H 2 3   ? 38.915  26.045  53.247  1.00 96.30  ? 3    DA  H OP1   1 
ATOM   6319 O OP2   . DA  H 2 3   ? 37.571  25.223  55.289  1.00 86.76  ? 3    DA  H OP2   1 
ATOM   6320 O "O5'" . DA  H 2 3   ? 38.768  23.609  53.789  1.00 79.08  ? 3    DA  H "O5'" 1 
ATOM   6321 C "C5'" . DA  H 2 3   ? 39.703  23.241  52.760  1.00 80.30  ? 3    DA  H "C5'" 1 
ATOM   6322 C "C4'" . DA  H 2 3   ? 39.290  21.925  52.145  1.00 75.35  ? 3    DA  H "C4'" 1 
ATOM   6323 O "O4'" . DA  H 2 3   ? 39.282  20.905  53.171  1.00 67.73  ? 3    DA  H "O4'" 1 
ATOM   6324 C "C3'" . DA  H 2 3   ? 37.882  21.932  51.554  1.00 76.53  ? 3    DA  H "C3'" 1 
ATOM   6325 O "O3'" . DA  H 2 3   ? 37.839  21.137  50.371  1.00 77.41  ? 3    DA  H "O3'" 1 
ATOM   6326 C "C2'" . DA  H 2 3   ? 37.033  21.361  52.674  1.00 70.52  ? 3    DA  H "C2'" 1 
ATOM   6327 C "C1'" . DA  H 2 3   ? 37.984  20.360  53.302  1.00 64.15  ? 3    DA  H "C1'" 1 
ATOM   6328 N N9    . DA  H 2 3   ? 37.746  20.090  54.716  1.00 59.19  ? 3    DA  H N9    1 
ATOM   6329 C C8    . DA  H 2 3   ? 37.391  20.969  55.705  1.00 60.77  ? 3    DA  H C8    1 
ATOM   6330 N N7    . DA  H 2 3   ? 37.194  20.401  56.868  1.00 57.15  ? 3    DA  H N7    1 
ATOM   6331 C C5    . DA  H 2 3   ? 37.442  19.058  56.629  1.00 52.54  ? 3    DA  H C5    1 
ATOM   6332 C C6    . DA  H 2 3   ? 37.407  17.929  57.461  1.00 48.78  ? 3    DA  H C6    1 
ATOM   6333 N N6    . DA  H 2 3   ? 37.112  17.978  58.760  1.00 48.47  ? 3    DA  H N6    1 
ATOM   6334 N N1    . DA  H 2 3   ? 37.711  16.735  56.912  1.00 46.94  ? 3    DA  H N1    1 
ATOM   6335 C C2    . DA  H 2 3   ? 38.020  16.690  55.613  1.00 48.64  ? 3    DA  H C2    1 
ATOM   6336 N N3    . DA  H 2 3   ? 38.081  17.680  54.728  1.00 51.88  ? 3    DA  H N3    1 
ATOM   6337 C C4    . DA  H 2 3   ? 37.777  18.852  55.307  1.00 53.75  ? 3    DA  H C4    1 
ATOM   6338 P P     . DG  H 2 4   ? 36.518  21.112  49.473  1.00 81.91  ? 4    DG  H P     1 
ATOM   6339 O OP1   . DG  H 2 4   ? 36.918  21.127  48.038  1.00 88.03  ? 4    DG  H OP1   1 
ATOM   6340 O OP2   . DG  H 2 4   ? 35.594  22.148  50.001  1.00 85.89  ? 4    DG  H OP2   1 
ATOM   6341 O "O5'" . DG  H 2 4   ? 35.918  19.674  49.781  1.00 75.99  ? 4    DG  H "O5'" 1 
ATOM   6342 C "C5'" . DG  H 2 4   ? 36.620  18.498  49.373  1.00 73.87  ? 4    DG  H "C5'" 1 
ATOM   6343 C "C4'" . DG  H 2 4   ? 35.821  17.289  49.786  1.00 70.22  ? 4    DG  H "C4'" 1 
ATOM   6344 O "O4'" . DG  H 2 4   ? 35.817  17.195  51.225  1.00 65.11  ? 4    DG  H "O4'" 1 
ATOM   6345 C "C3'" . DG  H 2 4   ? 34.358  17.335  49.344  1.00 75.02  ? 4    DG  H "C3'" 1 
ATOM   6346 O "O3'" . DG  H 2 4   ? 34.118  16.157  48.582  1.00 76.61  ? 4    DG  H "O3'" 1 
ATOM   6347 C "C2'" . DG  H 2 4   ? 33.571  17.448  50.639  1.00 72.69  ? 4    DG  H "C2'" 1 
ATOM   6348 C "C1'" . DG  H 2 4   ? 34.517  16.880  51.679  1.00 65.33  ? 4    DG  H "C1'" 1 
ATOM   6349 N N9    . DG  H 2 4   ? 34.370  17.441  53.015  1.00 63.27  ? 4    DG  H N9    1 
ATOM   6350 C C8    . DG  H 2 4   ? 34.261  18.768  53.353  1.00 66.79  ? 4    DG  H C8    1 
ATOM   6351 N N7    . DG  H 2 4   ? 34.166  18.963  54.640  1.00 64.91  ? 4    DG  H N7    1 
ATOM   6352 C C5    . DG  H 2 4   ? 34.204  17.687  55.183  1.00 60.55  ? 4    DG  H C5    1 
ATOM   6353 C C6    . DG  H 2 4   ? 34.126  17.262  56.532  1.00 58.23  ? 4    DG  H C6    1 
ATOM   6354 O O6    . DG  H 2 4   ? 33.991  17.950  57.547  1.00 59.91  ? 4    DG  H O6    1 
ATOM   6355 N N1    . DG  H 2 4   ? 34.195  15.877  56.639  1.00 55.48  ? 4    DG  H N1    1 
ATOM   6356 C C2    . DG  H 2 4   ? 34.338  15.012  55.583  1.00 55.89  ? 4    DG  H C2    1 
ATOM   6357 N N2    . DG  H 2 4   ? 34.405  13.707  55.891  1.00 55.47  ? 4    DG  H N2    1 
ATOM   6358 N N3    . DG  H 2 4   ? 34.418  15.395  54.318  1.00 57.28  ? 4    DG  H N3    1 
ATOM   6359 C C4    . DG  H 2 4   ? 34.340  16.737  54.193  1.00 59.64  ? 4    DG  H C4    1 
ATOM   6360 P P     . DA  H 2 5   ? 32.727  15.914  47.889  1.00 83.42  ? 5    DA  H P     1 
ATOM   6361 O OP1   . DA  H 2 5   ? 32.890  14.799  46.926  1.00 85.16  ? 5    DA  H OP1   1 
ATOM   6362 O OP2   . DA  H 2 5   ? 32.204  17.217  47.421  1.00 90.57  ? 5    DA  H OP2   1 
ATOM   6363 O "O5'" . DA  H 2 5   ? 31.874  15.356  49.107  1.00 81.61  ? 5    DA  H "O5'" 1 
ATOM   6364 C "C5'" . DA  H 2 5   ? 32.294  14.143  49.740  1.00 77.04  ? 5    DA  H "C5'" 1 
ATOM   6365 C "C4'" . DA  H 2 5   ? 31.545  13.916  51.031  1.00 76.53  ? 5    DA  H "C4'" 1 
ATOM   6366 O "O4'" . DA  H 2 5   ? 31.793  14.969  51.977  1.00 74.31  ? 5    DA  H "O4'" 1 
ATOM   6367 C "C3'" . DA  H 2 5   ? 30.021  13.839  50.935  1.00 85.32  ? 5    DA  H "C3'" 1 
ATOM   6368 O "O3'" . DA  H 2 5   ? 29.620  12.477  50.747  1.00 89.02  ? 5    DA  H "O3'" 1 
ATOM   6369 C "C2'" . DA  H 2 5   ? 29.554  14.426  52.262  1.00 84.99  ? 5    DA  H "C2'" 1 
ATOM   6370 C "C1'" . DA  H 2 5   ? 30.854  14.718  52.996  1.00 76.35  ? 5    DA  H "C1'" 1 
ATOM   6371 N N9    . DA  H 2 5   ? 30.859  15.846  53.927  1.00 76.47  ? 5    DA  H N9    1 
ATOM   6372 C C8    . DA  H 2 5   ? 30.872  17.190  53.648  1.00 80.34  ? 5    DA  H C8    1 
ATOM   6373 N N7    . DA  H 2 5   ? 30.878  17.951  54.716  1.00 80.47  ? 5    DA  H N7    1 
ATOM   6374 C C5    . DA  H 2 5   ? 30.859  17.048  55.768  1.00 76.11  ? 5    DA  H C5    1 
ATOM   6375 C C6    . DA  H 2 5   ? 30.836  17.224  57.162  1.00 75.82  ? 5    DA  H C6    1 
ATOM   6376 N N6    . DA  H 2 5   ? 30.841  18.421  57.756  1.00 79.21  ? 5    DA  H N6    1 
ATOM   6377 N N1    . DA  H 2 5   ? 30.825  16.114  57.936  1.00 73.11  ? 5    DA  H N1    1 
ATOM   6378 C C2    . DA  H 2 5   ? 30.817  14.913  57.335  1.00 71.52  ? 5    DA  H C2    1 
ATOM   6379 N N3    . DA  H 2 5   ? 30.831  14.623  56.033  1.00 71.35  ? 5    DA  H N3    1 
ATOM   6380 C C4    . DA  H 2 5   ? 30.860  15.748  55.297  1.00 73.67  ? 5    DA  H C4    1 
ATOM   6381 P P     . DT  H 2 6   ? 28.075  12.070  50.789  1.00 58.64  ? 6    DT  H P     1 
ATOM   6382 O OP1   . DT  H 2 6   ? 27.920  10.798  50.029  1.00 60.96  ? 6    DT  H OP1   1 
ATOM   6383 O OP2   . DT  H 2 6   ? 27.262  13.268  50.422  1.00 57.17  ? 6    DT  H OP2   1 
ATOM   6384 O "O5'" . DT  H 2 6   ? 27.806  11.794  52.334  1.00 57.35  ? 6    DT  H "O5'" 1 
ATOM   6385 C "C5'" . DT  H 2 6   ? 28.583  10.790  53.005  1.00 60.40  ? 6    DT  H "C5'" 1 
ATOM   6386 C "C4'" . DT  H 2 6   ? 28.200  10.734  54.462  1.00 60.13  ? 6    DT  H "C4'" 1 
ATOM   6387 O "O4'" . DT  H 2 6   ? 28.460  12.010  55.089  1.00 59.29  ? 6    DT  H "O4'" 1 
ATOM   6388 C "C3'" . DT  H 2 6   ? 26.725  10.422  54.727  1.00 59.25  ? 6    DT  H "C3'" 1 
ATOM   6389 O "O3'" . DT  H 2 6   ? 26.676  9.202   55.470  1.00 63.29  ? 6    DT  H "O3'" 1 
ATOM   6390 C "C2'" . DT  H 2 6   ? 26.199  11.647  55.462  1.00 54.86  ? 6    DT  H "C2'" 1 
ATOM   6391 C "C1'" . DT  H 2 6   ? 27.445  12.264  56.046  1.00 55.09  ? 6    DT  H "C1'" 1 
ATOM   6392 N N1    . DT  H 2 6   ? 27.390  13.722  56.258  1.00 51.79  ? 6    DT  H N1    1 
ATOM   6393 C C2    . DT  H 2 6   ? 27.496  14.212  57.541  1.00 52.21  ? 6    DT  H C2    1 
ATOM   6394 O O2    . DT  H 2 6   ? 27.574  13.495  58.529  1.00 54.08  ? 6    DT  H O2    1 
ATOM   6395 N N3    . DT  H 2 6   ? 27.477  15.585  57.630  1.00 49.98  ? 6    DT  H N3    1 
ATOM   6396 C C4    . DT  H 2 6   ? 27.378  16.489  56.586  1.00 48.11  ? 6    DT  H C4    1 
ATOM   6397 O O4    . DT  H 2 6   ? 27.379  17.697  56.817  1.00 46.25  ? 6    DT  H O4    1 
ATOM   6398 C C5    . DT  H 2 6   ? 27.274  15.902  55.273  1.00 47.62  ? 6    DT  H C5    1 
ATOM   6399 C C7    . DT  H 2 6   ? 27.171  16.804  54.086  1.00 47.46  ? 6    DT  H C7    1 
ATOM   6400 C C6    . DT  H 2 6   ? 27.299  14.568  55.174  1.00 49.83  ? 6    DT  H C6    1 
ATOM   6401 P P     . DT  H 2 7   ? 25.285  8.628   55.981  1.00 65.09  ? 7    DT  H P     1 
ATOM   6402 O OP1   . DT  H 2 7   ? 25.457  7.158   56.215  1.00 65.33  ? 7    DT  H OP1   1 
ATOM   6403 O OP2   . DT  H 2 7   ? 24.217  9.125   55.064  1.00 60.06  ? 7    DT  H OP2   1 
ATOM   6404 O "O5'" . DT  H 2 7   ? 25.104  9.361   57.385  1.00 63.97  ? 7    DT  H "O5'" 1 
ATOM   6405 C "C5'" . DT  H 2 7   ? 25.945  9.036   58.513  1.00 66.60  ? 7    DT  H "C5'" 1 
ATOM   6406 C "C4'" . DT  H 2 7   ? 25.424  9.723   59.752  1.00 66.40  ? 7    DT  H "C4'" 1 
ATOM   6407 O "O4'" . DT  H 2 7   ? 25.575  11.150  59.612  1.00 62.59  ? 7    DT  H "O4'" 1 
ATOM   6408 C "C3'" . DT  H 2 7   ? 23.942  9.475   60.027  1.00 65.48  ? 7    DT  H "C3'" 1 
ATOM   6409 O "O3'" . DT  H 2 7   ? 23.841  8.701   61.224  1.00 73.82  ? 7    DT  H "O3'" 1 
ATOM   6410 C "C2'" . DT  H 2 7   ? 23.319  10.861  60.134  1.00 60.56  ? 7    DT  H "C2'" 1 
ATOM   6411 C "C1'" . DT  H 2 7   ? 24.494  11.816  60.218  1.00 57.55  ? 7    DT  H "C1'" 1 
ATOM   6412 N N1    . DT  H 2 7   ? 24.328  13.082  59.504  1.00 51.30  ? 7    DT  H N1    1 
ATOM   6413 C C2    . DT  H 2 7   ? 24.524  14.272  60.173  1.00 50.14  ? 7    DT  H C2    1 
ATOM   6414 O O2    . DT  H 2 7   ? 24.729  14.341  61.374  1.00 49.51  ? 7    DT  H O2    1 
ATOM   6415 N N3    . DT  H 2 7   ? 24.410  15.393  59.387  1.00 47.90  ? 7    DT  H N3    1 
ATOM   6416 C C4    . DT  H 2 7   ? 24.141  15.435  58.031  1.00 44.97  ? 7    DT  H C4    1 
ATOM   6417 O O4    . DT  H 2 7   ? 24.053  16.513  57.461  1.00 42.52  ? 7    DT  H O4    1 
ATOM   6418 C C5    . DT  H 2 7   ? 23.971  14.153  57.394  1.00 46.40  ? 7    DT  H C5    1 
ATOM   6419 C C7    . DT  H 2 7   ? 23.678  14.105  55.927  1.00 46.32  ? 7    DT  H C7    1 
ATOM   6420 C C6    . DT  H 2 7   ? 24.079  13.055  58.151  1.00 48.81  ? 7    DT  H C6    1 
ATOM   6421 P P     . DG  H 2 8   ? 22.433  8.078   61.657  1.00 76.25  ? 8    DG  H P     1 
ATOM   6422 O OP1   . DG  H 2 8   ? 22.697  6.833   62.433  1.00 77.08  ? 8    DG  H OP1   1 
ATOM   6423 O OP2   . DG  H 2 8   ? 21.558  8.031   60.451  1.00 74.38  ? 8    DG  H OP2   1 
ATOM   6424 O "O5'" . DG  H 2 8   ? 21.867  9.195   62.639  1.00 69.05  ? 8    DG  H "O5'" 1 
ATOM   6425 C "C5'" . DG  H 2 8   ? 22.712  9.812   63.630  1.00 67.73  ? 8    DG  H "C5'" 1 
ATOM   6426 C "C4'" . DG  H 2 8   ? 21.927  10.817  64.440  1.00 65.80  ? 8    DG  H "C4'" 1 
ATOM   6427 O "O4'" . DG  H 2 8   ? 21.951  12.105  63.776  1.00 61.26  ? 8    DG  H "O4'" 1 
ATOM   6428 C "C3'" . DG  H 2 8   ? 20.449  10.482  64.660  1.00 63.68  ? 8    DG  H "C3'" 1 
ATOM   6429 O "O3'" . DG  H 2 8   ? 20.154  10.825  66.016  1.00 67.33  ? 8    DG  H "O3'" 1 
ATOM   6430 C "C2'" . DG  H 2 8   ? 19.744  11.300  63.593  1.00 58.70  ? 8    DG  H "C2'" 1 
ATOM   6431 C "C1'" . DG  H 2 8   ? 20.633  12.533  63.466  1.00 57.50  ? 8    DG  H "C1'" 1 
ATOM   6432 N N9    . DG  H 2 8   ? 20.671  13.174  62.150  1.00 53.67  ? 8    DG  H N9    1 
ATOM   6433 C C8    . DG  H 2 8   ? 20.512  12.573  60.923  1.00 52.80  ? 8    DG  H C8    1 
ATOM   6434 N N7    . DG  H 2 8   ? 20.644  13.404  59.925  1.00 50.60  ? 8    DG  H N7    1 
ATOM   6435 C C5    . DG  H 2 8   ? 20.896  14.629  60.528  1.00 48.87  ? 8    DG  H C5    1 
ATOM   6436 C C6    . DG  H 2 8   ? 21.106  15.907  59.955  1.00 44.85  ? 8    DG  H C6    1 
ATOM   6437 O O6    . DG  H 2 8   ? 21.116  16.222  58.765  1.00 45.62  ? 8    DG  H O6    1 
ATOM   6438 N N1    . DG  H 2 8   ? 21.346  16.872  60.924  1.00 43.97  ? 8    DG  H N1    1 
ATOM   6439 C C2    . DG  H 2 8   ? 21.375  16.642  62.276  1.00 46.00  ? 8    DG  H C2    1 
ATOM   6440 N N2    . DG  H 2 8   ? 21.619  17.710  63.053  1.00 44.18  ? 8    DG  H N2    1 
ATOM   6441 N N3    . DG  H 2 8   ? 21.162  15.456  62.828  1.00 49.29  ? 8    DG  H N3    1 
ATOM   6442 C C4    . DG  H 2 8   ? 20.923  14.503  61.901  1.00 50.35  ? 8    DG  H C4    1 
ATOM   6443 P P     . DA  H 2 9   ? 18.665  10.712  66.617  1.00 66.98  ? 9    DA  H P     1 
ATOM   6444 O OP1   . DA  H 2 9   ? 18.770  10.063  67.953  1.00 69.36  ? 9    DA  H OP1   1 
ATOM   6445 O OP2   . DA  H 2 9   ? 17.769  10.144  65.585  1.00 67.34  ? 9    DA  H OP2   1 
ATOM   6446 O "O5'" . DA  H 2 9   ? 18.282  12.237  66.847  1.00 64.62  ? 9    DA  H "O5'" 1 
ATOM   6447 C "C5'" . DA  H 2 9   ? 19.283  13.149  67.343  1.00 64.63  ? 9    DA  H "C5'" 1 
ATOM   6448 C "C4'" . DA  H 2 9   ? 18.710  14.542  67.413  1.00 63.21  ? 9    DA  H "C4'" 1 
ATOM   6449 O "O4'" . DA  H 2 9   ? 18.820  15.167  66.112  1.00 60.13  ? 9    DA  H "O4'" 1 
ATOM   6450 C "C3'" . DA  H 2 9   ? 17.223  14.594  67.769  1.00 61.66  ? 9    DA  H "C3'" 1 
ATOM   6451 O "O3'" . DA  H 2 9   ? 17.009  15.782  68.528  1.00 61.62  ? 9    DA  H "O3'" 1 
ATOM   6452 C "C2'" . DA  H 2 9   ? 16.545  14.647  66.414  1.00 58.06  ? 9    DA  H "C2'" 1 
ATOM   6453 C "C1'" . DA  H 2 9   ? 17.529  15.489  65.618  1.00 57.47  ? 9    DA  H "C1'" 1 
ATOM   6454 N N9    . DA  H 2 9   ? 17.544  15.262  64.177  1.00 55.66  ? 9    DA  H N9    1 
ATOM   6455 C C8    . DA  H 2 9   ? 17.372  14.087  63.488  1.00 54.45  ? 9    DA  H C8    1 
ATOM   6456 N N7    . DA  H 2 9   ? 17.476  14.218  62.188  1.00 52.12  ? 9    DA  H N7    1 
ATOM   6457 C C5    . DA  H 2 9   ? 17.729  15.570  62.008  1.00 50.23  ? 9    DA  H C5    1 
ATOM   6458 C C6    . DA  H 2 9   ? 17.930  16.348  60.857  1.00 47.65  ? 9    DA  H C6    1 
ATOM   6459 N N6    . DA  H 2 9   ? 17.908  15.852  59.618  1.00 46.01  ? 9    DA  H N6    1 
ATOM   6460 N N1    . DA  H 2 9   ? 18.154  17.673  61.024  1.00 47.34  ? 9    DA  H N1    1 
ATOM   6461 C C2    . DA  H 2 9   ? 18.182  18.168  62.270  1.00 48.23  ? 9    DA  H C2    1 
ATOM   6462 N N3    . DA  H 2 9   ? 18.013  17.535  63.429  1.00 50.99  ? 9    DA  H N3    1 
ATOM   6463 C C4    . DA  H 2 9   ? 17.787  16.224  63.226  1.00 53.43  ? 9    DA  H C4    1 
ATOM   6464 P P     . DG  H 2 10  ? 15.634  16.029  69.297  1.00 62.09  ? 10   DG  H P     1 
ATOM   6465 O OP1   . DG  H 2 10  ? 15.985  16.437  70.693  1.00 61.27  ? 10   DG  H OP1   1 
ATOM   6466 O OP2   . DG  H 2 10  ? 14.727  14.876  69.037  1.00 62.13  ? 10   DG  H OP2   1 
ATOM   6467 O "O5'" . DG  H 2 10  ? 14.991  17.236  68.483  1.00 58.53  ? 10   DG  H "O5'" 1 
ATOM   6468 C "C5'" . DG  H 2 10  ? 15.692  18.478  68.415  1.00 58.76  ? 10   DG  H "C5'" 1 
ATOM   6469 C "C4'" . DG  H 2 10  ? 15.162  19.291  67.263  1.00 57.11  ? 10   DG  H "C4'" 1 
ATOM   6470 O "O4'" . DG  H 2 10  ? 15.416  18.603  66.021  1.00 56.57  ? 10   DG  H "O4'" 1 
ATOM   6471 C "C3'" . DG  H 2 10  ? 13.653  19.550  67.296  1.00 56.52  ? 10   DG  H "C3'" 1 
ATOM   6472 O "O3'" . DG  H 2 10  ? 13.497  20.924  66.934  1.00 56.94  ? 10   DG  H "O3'" 1 
ATOM   6473 C "C2'" . DG  H 2 10  ? 13.116  18.617  66.227  1.00 54.20  ? 10   DG  H "C2'" 1 
ATOM   6474 C "C1'" . DG  H 2 10  ? 14.244  18.706  65.235  1.00 55.05  ? 10   DG  H "C1'" 1 
ATOM   6475 N N9    . DG  H 2 10  ? 14.296  17.684  64.197  1.00 53.54  ? 10   DG  H N9    1 
ATOM   6476 C C8    . DG  H 2 10  ? 14.180  16.323  64.338  1.00 53.33  ? 10   DG  H C8    1 
ATOM   6477 N N7    . DG  H 2 10  ? 14.281  15.682  63.205  1.00 51.92  ? 10   DG  H N7    1 
ATOM   6478 C C5    . DG  H 2 10  ? 14.479  16.680  62.261  1.00 48.94  ? 10   DG  H C5    1 
ATOM   6479 C C6    . DG  H 2 10  ? 14.668  16.596  60.854  1.00 48.01  ? 10   DG  H C6    1 
ATOM   6480 O O6    . DG  H 2 10  ? 14.701  15.587  60.139  1.00 49.34  ? 10   DG  H O6    1 
ATOM   6481 N N1    . DG  H 2 10  ? 14.853  17.853  60.286  1.00 45.40  ? 10   DG  H N1    1 
ATOM   6482 C C2    . DG  H 2 10  ? 14.852  19.040  60.978  1.00 47.80  ? 10   DG  H C2    1 
ATOM   6483 N N2    . DG  H 2 10  ? 15.043  20.151  60.253  1.00 47.55  ? 10   DG  H N2    1 
ATOM   6484 N N3    . DG  H 2 10  ? 14.684  19.131  62.288  1.00 48.90  ? 10   DG  H N3    1 
ATOM   6485 C C4    . DG  H 2 10  ? 14.503  17.920  62.860  1.00 50.05  ? 10   DG  H C4    1 
ATOM   6486 P P     . DA  H 2 11  ? 12.092  21.646  67.021  1.00 58.37  ? 11   DA  H P     1 
ATOM   6487 O OP1   . DA  H 2 11  ? 12.275  22.805  67.946  1.00 58.74  ? 11   DA  H OP1   1 
ATOM   6488 O OP2   . DA  H 2 11  ? 11.041  20.616  67.263  1.00 54.56  ? 11   DA  H OP2   1 
ATOM   6489 O "O5'" . DA  H 2 11  ? 11.899  22.210  65.545  1.00 50.56  ? 11   DA  H "O5'" 1 
ATOM   6490 C "C5'" . DA  H 2 11  ? 12.955  22.988  64.942  1.00 48.24  ? 11   DA  H "C5'" 1 
ATOM   6491 C "C4'" . DA  H 2 11  ? 12.588  23.373  63.530  1.00 44.67  ? 11   DA  H "C4'" 1 
ATOM   6492 O "O4'" . DA  H 2 11  ? 12.740  22.215  62.685  1.00 41.90  ? 11   DA  H "O4'" 1 
ATOM   6493 C "C3'" . DA  H 2 11  ? 11.141  23.832  63.350  1.00 44.55  ? 11   DA  H "C3'" 1 
ATOM   6494 O "O3'" . DA  H 2 11  ? 11.021  24.833  62.337  1.00 44.02  ? 11   DA  H "O3'" 1 
ATOM   6495 C "C2'" . DA  H 2 11  ? 10.435  22.569  62.910  1.00 42.46  ? 11   DA  H "C2'" 1 
ATOM   6496 C "C1'" . DA  H 2 11  ? 11.502  21.910  62.069  1.00 39.85  ? 11   DA  H "C1'" 1 
ATOM   6497 N N9    . DA  H 2 11  ? 11.391  20.464  62.004  1.00 38.12  ? 11   DA  H N9    1 
ATOM   6498 C C8    . DA  H 2 11  ? 11.232  19.569  63.031  1.00 38.66  ? 11   DA  H C8    1 
ATOM   6499 N N7    . DA  H 2 11  ? 11.212  18.319  62.641  1.00 38.73  ? 11   DA  H N7    1 
ATOM   6500 C C5    . DA  H 2 11  ? 11.393  18.396  61.268  1.00 36.32  ? 11   DA  H C5    1 
ATOM   6501 C C6    . DA  H 2 11  ? 11.472  17.414  60.272  1.00 36.01  ? 11   DA  H C6    1 
ATOM   6502 N N6    . DA  H 2 11  ? 11.372  16.106  60.518  1.00 38.40  ? 11   DA  H N6    1 
ATOM   6503 N N1    . DA  H 2 11  ? 11.693  17.820  59.003  1.00 35.65  ? 11   DA  H N1    1 
ATOM   6504 C C2    . DA  H 2 11  ? 11.807  19.133  58.762  1.00 37.36  ? 11   DA  H C2    1 
ATOM   6505 N N3    . DA  H 2 11  ? 11.733  20.154  59.613  1.00 37.74  ? 11   DA  H N3    1 
ATOM   6506 C C4    . DA  H 2 11  ? 11.522  19.710  60.865  1.00 37.21  ? 11   DA  H C4    1 
ATOM   6507 P P     . DT  H 2 12  ? 9.626   25.549  62.129  1.00 52.30  ? 12   DT  H P     1 
ATOM   6508 O OP1   . DT  H 2 12  ? 9.876   27.010  61.917  1.00 48.88  ? 12   DT  H OP1   1 
ATOM   6509 O OP2   . DT  H 2 12  ? 8.671   25.067  63.184  1.00 49.32  ? 12   DT  H OP2   1 
ATOM   6510 O "O5'" . DT  H 2 12  ? 9.080   24.900  60.781  1.00 48.29  ? 12   DT  H "O5'" 1 
ATOM   6511 C "C5'" . DT  H 2 12  ? 9.810   25.116  59.584  1.00 46.12  ? 12   DT  H "C5'" 1 
ATOM   6512 C "C4'" . DT  H 2 12  ? 9.269   24.200  58.521  1.00 43.84  ? 12   DT  H "C4'" 1 
ATOM   6513 O "O4'" . DT  H 2 12  ? 9.429   22.836  58.956  1.00 41.89  ? 12   DT  H "O4'" 1 
ATOM   6514 C "C3'" . DT  H 2 12  ? 7.783   24.381  58.204  1.00 43.52  ? 12   DT  H "C3'" 1 
ATOM   6515 O "O3'" . DT  H 2 12  ? 7.739   24.889  56.872  1.00 45.78  ? 12   DT  H "O3'" 1 
ATOM   6516 C "C2'" . DT  H 2 12  ? 7.187   22.993  58.397  1.00 42.05  ? 12   DT  H "C2'" 1 
ATOM   6517 C "C1'" . DT  H 2 12  ? 8.409   22.084  58.359  1.00 40.54  ? 12   DT  H "C1'" 1 
ATOM   6518 N N1    . DT  H 2 12  ? 8.295   20.824  59.107  1.00 37.14  ? 12   DT  H N1    1 
ATOM   6519 C C2    . DT  H 2 12  ? 8.420   19.644  58.414  1.00 36.09  ? 12   DT  H C2    1 
ATOM   6520 O O2    . DT  H 2 12  ? 8.624   19.594  57.213  1.00 38.29  ? 12   DT  H O2    1 
ATOM   6521 N N3    . DT  H 2 12  ? 8.263   18.515  59.176  1.00 36.13  ? 12   DT  H N3    1 
ATOM   6522 C C4    . DT  H 2 12  ? 8.033   18.451  60.536  1.00 35.66  ? 12   DT  H C4    1 
ATOM   6523 O O4    . DT  H 2 12  ? 7.941   17.361  61.087  1.00 35.06  ? 12   DT  H O4    1 
ATOM   6524 C C5    . DT  H 2 12  ? 7.926   19.728  61.204  1.00 35.60  ? 12   DT  H C5    1 
ATOM   6525 C C7    . DT  H 2 12  ? 7.670   19.759  62.676  1.00 35.11  ? 12   DT  H C7    1 
ATOM   6526 C C6    . DT  H 2 12  ? 8.058   20.837  60.464  1.00 36.68  ? 12   DT  H C6    1 
ATOM   6527 P P     . DC  H 2 13  ? 6.374   25.018  56.073  1.00 49.08  ? 13   DC  H P     1 
ATOM   6528 O OP1   . DC  H 2 13  ? 6.625   25.976  54.969  1.00 55.58  ? 13   DC  H OP1   1 
ATOM   6529 O OP2   . DC  H 2 13  ? 5.285   25.266  57.033  1.00 46.39  ? 13   DC  H OP2   1 
ATOM   6530 O "O5'" . DC  H 2 13  ? 6.247   23.595  55.369  1.00 46.92  ? 13   DC  H "O5'" 1 
ATOM   6531 C "C5'" . DC  H 2 13  ? 7.081   23.303  54.221  1.00 46.56  ? 13   DC  H "C5'" 1 
ATOM   6532 C "C4'" . DC  H 2 13  ? 6.641   22.017  53.570  1.00 44.79  ? 13   DC  H "C4'" 1 
ATOM   6533 O "O4'" . DC  H 2 13  ? 6.695   20.970  54.566  1.00 45.71  ? 13   DC  H "O4'" 1 
ATOM   6534 C "C3'" . DC  H 2 13  ? 5.206   22.044  53.052  1.00 46.57  ? 13   DC  H "C3'" 1 
ATOM   6535 O "O3'" . DC  H 2 13  ? 5.120   21.531  51.712  1.00 47.86  ? 13   DC  H "O3'" 1 
ATOM   6536 C "C2'" . DC  H 2 13  ? 4.444   21.232  54.088  1.00 45.79  ? 13   DC  H "C2'" 1 
ATOM   6537 C "C1'" . DC  H 2 13  ? 5.497   20.246  54.568  1.00 43.17  ? 13   DC  H "C1'" 1 
ATOM   6538 N N1    . DC  H 2 13  ? 5.316   19.695  55.918  1.00 41.75  ? 13   DC  H N1    1 
ATOM   6539 C C2    . DC  H 2 13  ? 5.443   18.321  56.097  1.00 42.43  ? 13   DC  H C2    1 
ATOM   6540 O O2    . DC  H 2 13  ? 5.758   17.620  55.127  1.00 47.54  ? 13   DC  H O2    1 
ATOM   6541 N N3    . DC  H 2 13  ? 5.223   17.788  57.321  1.00 41.28  ? 13   DC  H N3    1 
ATOM   6542 C C4    . DC  H 2 13  ? 4.907   18.582  58.345  1.00 41.73  ? 13   DC  H C4    1 
ATOM   6543 N N4    . DC  H 2 13  ? 4.714   18.017  59.540  1.00 42.82  ? 13   DC  H N4    1 
ATOM   6544 C C5    . DC  H 2 13  ? 4.743   19.986  58.185  1.00 41.73  ? 13   DC  H C5    1 
ATOM   6545 C C6    . DC  H 2 13  ? 4.970   20.498  56.969  1.00 42.65  ? 13   DC  H C6    1 
ATOM   6546 P P     . DT  H 2 14  ? 3.702   21.503  50.944  1.00 49.64  ? 14   DT  H P     1 
ATOM   6547 O OP1   . DT  H 2 14  ? 3.944   21.957  49.539  1.00 54.67  ? 14   DT  H OP1   1 
ATOM   6548 O OP2   . DT  H 2 14  ? 2.683   22.191  51.780  1.00 48.58  ? 14   DT  H OP2   1 
ATOM   6549 O "O5'" . DT  H 2 14  ? 3.340   19.957  50.957  1.00 49.61  ? 14   DT  H "O5'" 1 
ATOM   6550 C "C5'" . DT  H 2 14  ? 4.307   18.977  50.516  1.00 47.16  ? 14   DT  H "C5'" 1 
ATOM   6551 C "C4'" . DT  H 2 14  ? 3.731   17.588  50.663  1.00 46.26  ? 14   DT  H "C4'" 1 
ATOM   6552 O "O4'" . DT  H 2 14  ? 3.689   17.238  52.060  1.00 43.10  ? 14   DT  H "O4'" 1 
ATOM   6553 C "C3'" . DT  H 2 14  ? 2.307   17.410  50.131  1.00 47.46  ? 14   DT  H "C3'" 1 
ATOM   6554 O "O3'" . DT  H 2 14  ? 2.292   16.274  49.267  1.00 50.91  ? 14   DT  H "O3'" 1 
ATOM   6555 C "C2'" . DT  H 2 14  ? 1.459   17.231  51.380  1.00 46.25  ? 14   DT  H "C2'" 1 
ATOM   6556 C "C1'" . DT  H 2 14  ? 2.442   16.683  52.395  1.00 43.45  ? 14   DT  H "C1'" 1 
ATOM   6557 N N1    . DT  H 2 14  ? 2.184   17.026  53.800  1.00 42.49  ? 14   DT  H N1    1 
ATOM   6558 C C2    . DT  H 2 14  ? 2.250   16.017  54.733  1.00 43.10  ? 14   DT  H C2    1 
ATOM   6559 O O2    . DT  H 2 14  ? 2.446   14.849  54.441  1.00 47.62  ? 14   DT  H O2    1 
ATOM   6560 N N3    . DT  H 2 14  ? 2.049   16.423  56.029  1.00 41.59  ? 14   DT  H N3    1 
ATOM   6561 C C4    . DT  H 2 14  ? 1.853   17.713  56.481  1.00 39.47  ? 14   DT  H C4    1 
ATOM   6562 O O4    . DT  H 2 14  ? 1.703   17.925  57.683  1.00 37.87  ? 14   DT  H O4    1 
ATOM   6563 C C5    . DT  H 2 14  ? 1.831   18.726  55.452  1.00 39.28  ? 14   DT  H C5    1 
ATOM   6564 C C7    . DT  H 2 14  ? 1.601   20.150  55.843  1.00 38.59  ? 14   DT  H C7    1 
ATOM   6565 C C6    . DT  H 2 14  ? 2.000   18.338  54.179  1.00 40.82  ? 14   DT  H C6    1 
ATOM   6566 P P     . DC  H 2 15  ? 1.053   16.011  48.313  1.00 59.26  ? 15   DC  H P     1 
ATOM   6567 O OP1   . DC  H 2 15  ? 1.574   15.499  47.018  1.00 65.70  ? 15   DC  H OP1   1 
ATOM   6568 O OP2   . DC  H 2 15  ? 0.192   17.217  48.329  1.00 60.80  ? 15   DC  H OP2   1 
ATOM   6569 O "O5'" . DC  H 2 15  ? 0.250   14.867  49.077  1.00 58.56  ? 15   DC  H "O5'" 1 
ATOM   6570 C "C5'" . DC  H 2 15  ? 0.911   13.652  49.478  1.00 58.19  ? 15   DC  H "C5'" 1 
ATOM   6571 C "C4'" . DC  H 2 15  ? 0.056   12.926  50.488  1.00 59.67  ? 15   DC  H "C4'" 1 
ATOM   6572 O "O4'" . DC  H 2 15  ? 0.146   13.607  51.756  1.00 59.37  ? 15   DC  H "O4'" 1 
ATOM   6573 C "C3'" . DC  H 2 15  ? -1.436  12.878  50.142  1.00 60.93  ? 15   DC  H "C3'" 1 
ATOM   6574 O "O3'" . DC  H 2 15  ? -1.819  11.540  49.822  1.00 63.45  ? 15   DC  H "O3'" 1 
ATOM   6575 C "C2'" . DC  H 2 15  ? -2.144  13.392  51.386  1.00 58.82  ? 15   DC  H "C2'" 1 
ATOM   6576 C "C1'" . DC  H 2 15  ? -1.064  13.411  52.449  1.00 58.21  ? 15   DC  H "C1'" 1 
ATOM   6577 N N1    . DC  H 2 15  ? -1.194  14.496  53.422  1.00 56.39  ? 15   DC  H N1    1 
ATOM   6578 C C2    . DC  H 2 15  ? -1.179  14.186  54.781  1.00 57.05  ? 15   DC  H C2    1 
ATOM   6579 O O2    . DC  H 2 15  ? -1.041  13.002  55.123  1.00 58.01  ? 15   DC  H O2    1 
ATOM   6580 N N3    . DC  H 2 15  ? -1.301  15.182  55.687  1.00 57.49  ? 15   DC  H N3    1 
ATOM   6581 C C4    . DC  H 2 15  ? -1.413  16.448  55.276  1.00 55.72  ? 15   DC  H C4    1 
ATOM   6582 N N4    . DC  H 2 15  ? -1.516  17.401  56.202  1.00 54.39  ? 15   DC  H N4    1 
ATOM   6583 C C5    . DC  H 2 15  ? -1.434  16.791  53.895  1.00 55.98  ? 15   DC  H C5    1 
ATOM   6584 C C6    . DC  H 2 15  ? -1.311  15.794  53.010  1.00 57.30  ? 15   DC  H C6    1 
ATOM   6585 P P     . DA  H 2 16  ? -3.330  11.220  49.388  1.00 64.77  ? 16   DA  H P     1 
ATOM   6586 O OP1   . DA  H 2 16  ? -3.304  10.179  48.328  1.00 66.82  ? 16   DA  H OP1   1 
ATOM   6587 O OP2   . DA  H 2 16  ? -4.031  12.510  49.149  1.00 66.18  ? 16   DA  H OP2   1 
ATOM   6588 O "O5'" . DA  H 2 16  ? -3.950  10.580  50.705  1.00 63.77  ? 16   DA  H "O5'" 1 
ATOM   6589 C "C5'" . DA  H 2 16  ? -3.261  9.537   51.417  1.00 61.25  ? 16   DA  H "C5'" 1 
ATOM   6590 C "C4'" . DA  H 2 16  ? -3.881  9.415   52.786  1.00 58.81  ? 16   DA  H "C4'" 1 
ATOM   6591 O "O4'" . DA  H 2 16  ? -3.685  10.663  53.489  1.00 55.35  ? 16   DA  H "O4'" 1 
ATOM   6592 C "C3'" . DA  H 2 16  ? -5.392  9.180   52.751  1.00 60.82  ? 16   DA  H "C3'" 1 
ATOM   6593 O "O3'" . DA  H 2 16  ? -5.695  8.089   53.619  1.00 62.00  ? 16   DA  H "O3'" 1 
ATOM   6594 C "C2'" . DA  H 2 16  ? -5.984  10.511  53.183  1.00 58.93  ? 16   DA  H "C2'" 1 
ATOM   6595 C "C1'" . DA  H 2 16  ? -4.897  11.058  54.084  1.00 56.76  ? 16   DA  H "C1'" 1 
ATOM   6596 N N9    . DA  H 2 16  ? -4.872  12.510  54.249  1.00 53.34  ? 16   DA  H N9    1 
ATOM   6597 C C8    . DA  H 2 16  ? -5.023  13.492  53.299  1.00 54.64  ? 16   DA  H C8    1 
ATOM   6598 N N7    . DA  H 2 16  ? -4.961  14.710  53.783  1.00 52.88  ? 16   DA  H N7    1 
ATOM   6599 C C5    . DA  H 2 16  ? -4.747  14.517  55.141  1.00 51.63  ? 16   DA  H C5    1 
ATOM   6600 C C6    . DA  H 2 16  ? -4.590  15.416  56.212  1.00 48.59  ? 16   DA  H C6    1 
ATOM   6601 N N6    . DA  H 2 16  ? -4.620  16.744  56.075  1.00 45.17  ? 16   DA  H N6    1 
ATOM   6602 N N1    . DA  H 2 16  ? -4.404  14.896  57.446  1.00 46.80  ? 16   DA  H N1    1 
ATOM   6603 C C2    . DA  H 2 16  ? -4.377  13.562  57.583  1.00 48.56  ? 16   DA  H C2    1 
ATOM   6604 N N3    . DA  H 2 16  ? -4.514  12.617  56.654  1.00 49.55  ? 16   DA  H N3    1 
ATOM   6605 C C4    . DA  H 2 16  ? -4.695  13.167  55.441  1.00 50.56  ? 16   DA  H C4    1 
ATOM   6606 P P     . DA  H 2 17  ? -7.200  7.582   53.802  1.00 63.77  ? 17   DA  H P     1 
ATOM   6607 O OP1   . DA  H 2 17  ? -7.198  6.099   53.746  1.00 66.49  ? 17   DA  H OP1   1 
ATOM   6608 O OP2   . DA  H 2 17  ? -8.063  8.347   52.865  1.00 62.52  ? 17   DA  H OP2   1 
ATOM   6609 O "O5'" . DA  H 2 17  ? -7.487  7.976   55.320  1.00 62.79  ? 17   DA  H "O5'" 1 
ATOM   6610 C "C5'" . DA  H 2 17  ? -6.422  7.829   56.279  1.00 59.68  ? 17   DA  H "C5'" 1 
ATOM   6611 C "C4'" . DA  H 2 17  ? -6.806  8.479   57.584  1.00 56.80  ? 17   DA  H "C4'" 1 
ATOM   6612 O "O4'" . DA  H 2 17  ? -6.619  9.913   57.503  1.00 56.26  ? 17   DA  H "O4'" 1 
ATOM   6613 C "C3'" . DA  H 2 17  ? -8.263  8.271   57.974  1.00 56.34  ? 17   DA  H "C3'" 1 
ATOM   6614 O "O3'" . DA  H 2 17  ? -8.245  7.944   59.364  1.00 55.80  ? 17   DA  H "O3'" 1 
ATOM   6615 C "C2'" . DA  H 2 17  ? -8.912  9.602   57.644  1.00 54.67  ? 17   DA  H "C2'" 1 
ATOM   6616 C "C1'" . DA  H 2 17  ? -7.798  10.567  57.936  1.00 52.00  ? 17   DA  H "C1'" 1 
ATOM   6617 N N9    . DA  H 2 17  ? -7.890  11.845  57.238  1.00 49.04  ? 17   DA  H N9    1 
ATOM   6618 C C8    . DA  H 2 17  ? -8.170  12.082  55.916  1.00 49.65  ? 17   DA  H C8    1 
ATOM   6619 N N7    . DA  H 2 17  ? -8.188  13.355  55.599  1.00 49.08  ? 17   DA  H N7    1 
ATOM   6620 C C5    . DA  H 2 17  ? -7.871  13.997  56.787  1.00 46.13  ? 17   DA  H C5    1 
ATOM   6621 C C6    . DA  H 2 17  ? -7.721  15.353  57.120  1.00 44.26  ? 17   DA  H C6    1 
ATOM   6622 N N6    . DA  H 2 17  ? -7.878  16.353  56.256  1.00 42.77  ? 17   DA  H N6    1 
ATOM   6623 N N1    . DA  H 2 17  ? -7.392  15.654  58.394  1.00 44.51  ? 17   DA  H N1    1 
ATOM   6624 C C2    . DA  H 2 17  ? -7.258  14.659  59.273  1.00 44.42  ? 17   DA  H C2    1 
ATOM   6625 N N3    . DA  H 2 17  ? -7.373  13.348  59.082  1.00 46.16  ? 17   DA  H N3    1 
ATOM   6626 C C4    . DA  H 2 17  ? -7.690  13.080  57.805  1.00 46.50  ? 17   DA  H C4    1 
ATOM   6627 P P     . DT  H 2 18  ? -9.597  7.738   60.157  1.00 82.30  ? 18   DT  H P     1 
ATOM   6628 O OP1   . DT  H 2 18  ? -9.342  6.750   61.235  1.00 90.53  ? 18   DT  H OP1   1 
ATOM   6629 O OP2   . DT  H 2 18  ? -10.685 7.531   59.167  1.00 73.87  ? 18   DT  H OP2   1 
ATOM   6630 O "O5'" . DT  H 2 18  ? -9.815  9.160   60.818  1.00 78.59  ? 18   DT  H "O5'" 1 
ATOM   6631 C "C5'" . DT  H 2 18  ? -8.942  9.643   61.834  1.00 85.53  ? 18   DT  H "C5'" 1 
ATOM   6632 C "C4'" . DT  H 2 18  ? -9.421  11.009  62.254  1.00 81.67  ? 18   DT  H "C4'" 1 
ATOM   6633 O "O4'" . DT  H 2 18  ? -9.455  11.871  61.100  1.00 74.21  ? 18   DT  H "O4'" 1 
ATOM   6634 C "C3'" . DT  H 2 18  ? -10.843 11.022  62.821  1.00 76.71  ? 18   DT  H "C3'" 1 
ATOM   6635 O "O3'" . DT  H 2 18  ? -10.759 11.239  64.235  1.00 84.87  ? 18   DT  H "O3'" 1 
ATOM   6636 C "C2'" . DT  H 2 18  ? -11.543 12.147  62.070  1.00 67.44  ? 18   DT  H "C2'" 1 
ATOM   6637 C "C1'" . DT  H 2 18  ? -10.408 12.870  61.369  1.00 68.15  ? 18   DT  H "C1'" 1 
ATOM   6638 N N1    . DT  H 2 18  ? -10.739 13.541  60.093  1.00 60.41  ? 18   DT  H N1    1 
ATOM   6639 C C2    . DT  H 2 18  ? -10.643 14.913  60.054  1.00 59.37  ? 18   DT  H C2    1 
ATOM   6640 O O2    . DT  H 2 18  ? -10.298 15.584  61.012  1.00 63.86  ? 18   DT  H O2    1 
ATOM   6641 N N3    . DT  H 2 18  ? -10.954 15.476  58.840  1.00 53.82  ? 18   DT  H N3    1 
ATOM   6642 C C4    . DT  H 2 18  ? -11.320 14.817  57.686  1.00 49.87  ? 18   DT  H C4    1 
ATOM   6643 O O4    . DT  H 2 18  ? -11.581 15.461  56.671  1.00 47.13  ? 18   DT  H O4    1 
ATOM   6644 C C5    . DT  H 2 18  ? -11.390 13.377  57.795  1.00 50.39  ? 18   DT  H C5    1 
ATOM   6645 C C7    . DT  H 2 18  ? -11.772 12.576  56.592  1.00 47.31  ? 18   DT  H C7    1 
ATOM   6646 C C6    . DT  H 2 18  ? -11.108 12.819  58.980  1.00 55.22  ? 18   DT  H C6    1 
ATOM   6647 P P     . DC  H 2 19  ? -12.044 11.049  65.156  1.00 84.93  ? 19   DC  H P     1 
ATOM   6648 O OP1   . DC  H 2 19  ? -11.625 10.343  66.402  1.00 95.33  ? 19   DC  H OP1   1 
ATOM   6649 O OP2   . DC  H 2 19  ? -13.137 10.508  64.309  1.00 76.65  ? 19   DC  H OP2   1 
ATOM   6650 O "O5'" . DC  H 2 19  ? -12.458 12.543  65.515  1.00 82.23  ? 19   DC  H "O5'" 1 
ATOM   6651 C "C5'" . DC  H 2 19  ? -11.497 13.560  65.846  1.00 85.90  ? 19   DC  H "C5'" 1 
ATOM   6652 C "C4'" . DC  H 2 19  ? -12.156 14.912  65.717  1.00 79.87  ? 19   DC  H "C4'" 1 
ATOM   6653 O "O4'" . DC  H 2 19  ? -12.150 15.321  64.332  1.00 71.20  ? 19   DC  H "O4'" 1 
ATOM   6654 C "C3'" . DC  H 2 19  ? -13.623 14.942  66.159  1.00 76.33  ? 19   DC  H "C3'" 1 
ATOM   6655 O "O3'" . DC  H 2 19  ? -13.778 15.814  67.280  1.00 82.68  ? 19   DC  H "O3'" 1 
ATOM   6656 C "C2'" . DC  H 2 19  ? -14.382 15.430  64.936  1.00 66.08  ? 19   DC  H "C2'" 1 
ATOM   6657 C "C1'" . DC  H 2 19  ? -13.309 16.077  64.088  1.00 64.09  ? 19   DC  H "C1'" 1 
ATOM   6658 N N1    . DC  H 2 19  ? -13.566 16.054  62.637  1.00 56.34  ? 19   DC  H N1    1 
ATOM   6659 C C2    . DC  H 2 19  ? -13.542 17.263  61.934  1.00 53.22  ? 19   DC  H C2    1 
ATOM   6660 O O2    . DC  H 2 19  ? -13.291 18.311  62.550  1.00 55.92  ? 19   DC  H O2    1 
ATOM   6661 N N3    . DC  H 2 19  ? -13.810 17.261  60.606  1.00 47.94  ? 19   DC  H N3    1 
ATOM   6662 C C4    . DC  H 2 19  ? -14.061 16.110  59.978  1.00 45.59  ? 19   DC  H C4    1 
ATOM   6663 N N4    . DC  H 2 19  ? -14.273 16.150  58.659  1.00 42.17  ? 19   DC  H N4    1 
ATOM   6664 C C5    . DC  H 2 19  ? -14.060 14.861  60.666  1.00 47.94  ? 19   DC  H C5    1 
ATOM   6665 C C6    . DC  H 2 19  ? -13.836 14.882  61.986  1.00 53.08  ? 19   DC  H C6    1 
ATOM   6666 P P     . DT  H 2 20  ? -15.197 15.939  68.015  1.00 83.17  ? 20   DT  H P     1 
ATOM   6667 O OP1   . DT  H 2 20  ? -14.945 16.271  69.443  1.00 92.47  ? 20   DT  H OP1   1 
ATOM   6668 O OP2   . DT  H 2 20  ? -16.006 14.737  67.667  1.00 80.05  ? 20   DT  H OP2   1 
ATOM   6669 O "O5'" . DT  H 2 20  ? -15.822 17.237  67.335  1.00 74.17  ? 20   DT  H "O5'" 1 
ATOM   6670 C "C5'" . DT  H 2 20  ? -15.131 18.488  67.443  1.00 74.87  ? 20   DT  H "C5'" 1 
ATOM   6671 C "C4'" . DT  H 2 20  ? -15.794 19.525  66.573  1.00 67.08  ? 20   DT  H "C4'" 1 
ATOM   6672 O "O4'" . DT  H 2 20  ? -15.723 19.101  65.194  1.00 61.36  ? 20   DT  H "O4'" 1 
ATOM   6673 C "C3'" . DT  H 2 20  ? -17.275 19.739  66.876  1.00 65.35  ? 20   DT  H "C3'" 1 
ATOM   6674 O "O3'" . DT  H 2 20  ? -17.468 21.121  67.162  1.00 66.50  ? 20   DT  H "O3'" 1 
ATOM   6675 C "C2'" . DT  H 2 20  ? -17.996 19.298  65.607  1.00 58.18  ? 20   DT  H "C2'" 1 
ATOM   6676 C "C1'" . DT  H 2 20  ? -16.927 19.444  64.542  1.00 54.69  ? 20   DT  H "C1'" 1 
ATOM   6677 N N1    . DT  H 2 20  ? -17.059 18.570  63.358  1.00 49.35  ? 20   DT  H N1    1 
ATOM   6678 C C2    . DT  H 2 20  ? -17.130 19.164  62.119  1.00 45.41  ? 20   DT  H C2    1 
ATOM   6679 O O2    . DT  H 2 20  ? -17.087 20.372  61.956  1.00 46.19  ? 20   DT  H O2    1 
ATOM   6680 N N3    . DT  H 2 20  ? -17.290 18.289  61.073  1.00 42.24  ? 20   DT  H N3    1 
ATOM   6681 C C4    . DT  H 2 20  ? -17.347 16.909  61.138  1.00 42.40  ? 20   DT  H C4    1 
ATOM   6682 O O4    . DT  H 2 20  ? -17.445 16.250  60.104  1.00 39.95  ? 20   DT  H O4    1 
ATOM   6683 C C5    . DT  H 2 20  ? -17.265 16.353  62.469  1.00 46.42  ? 20   DT  H C5    1 
ATOM   6684 C C7    . DT  H 2 20  ? -17.318 14.868  62.640  1.00 48.39  ? 20   DT  H C7    1 
ATOM   6685 C C6    . DT  H 2 20  ? -17.111 17.199  63.497  1.00 49.94  ? 20   DT  H C6    1 
ATOM   6686 P P     . DT  H 2 21  ? -18.891 21.639  67.670  1.00 67.39  ? 21   DT  H P     1 
ATOM   6687 O OP1   . DT  H 2 21  ? -18.660 22.752  68.622  1.00 72.87  ? 21   DT  H OP1   1 
ATOM   6688 O OP2   . DT  H 2 21  ? -19.678 20.452  68.099  1.00 69.46  ? 21   DT  H OP2   1 
ATOM   6689 O "O5'" . DT  H 2 21  ? -19.540 22.240  66.348  1.00 60.64  ? 21   DT  H "O5'" 1 
ATOM   6690 C "C5'" . DT  H 2 21  ? -18.856 23.263  65.622  1.00 59.05  ? 21   DT  H "C5'" 1 
ATOM   6691 C "C4'" . DT  H 2 21  ? -19.480 23.425  64.255  1.00 54.94  ? 21   DT  H "C4'" 1 
ATOM   6692 O "O4'" . DT  H 2 21  ? -19.332 22.208  63.484  1.00 51.76  ? 21   DT  H "O4'" 1 
ATOM   6693 C "C3'" . DT  H 2 21  ? -20.978 23.740  64.267  1.00 55.92  ? 21   DT  H "C3'" 1 
ATOM   6694 O "O3'" . DT  H 2 21  ? -21.169 25.031  63.680  1.00 55.60  ? 21   DT  H "O3'" 1 
ATOM   6695 C "C2'" . DT  H 2 21  ? -21.609 22.578  63.510  1.00 53.78  ? 21   DT  H "C2'" 1 
ATOM   6696 C "C1'" . DT  H 2 21  ? -20.462 22.063  62.665  1.00 49.95  ? 21   DT  H "C1'" 1 
ATOM   6697 N N1    . DT  H 2 21  ? -20.530 20.649  62.243  1.00 49.29  ? 21   DT  H N1    1 
ATOM   6698 C C2    . DT  H 2 21  ? -20.595 20.368  60.895  1.00 48.36  ? 21   DT  H C2    1 
ATOM   6699 O O2    . DT  H 2 21  ? -20.619 21.235  60.031  1.00 48.82  ? 21   DT  H O2    1 
ATOM   6700 N N3    . DT  H 2 21  ? -20.654 19.027  60.592  1.00 47.50  ? 21   DT  H N3    1 
ATOM   6701 C C4    . DT  H 2 21  ? -20.642 17.967  61.483  1.00 49.04  ? 21   DT  H C4    1 
ATOM   6702 O O4    . DT  H 2 21  ? -20.699 16.809  61.062  1.00 48.95  ? 21   DT  H O4    1 
ATOM   6703 C C5    . DT  H 2 21  ? -20.572 18.339  62.880  1.00 50.65  ? 21   DT  H C5    1 
ATOM   6704 C C7    . DT  H 2 21  ? -20.565 17.263  63.919  1.00 54.59  ? 21   DT  H C7    1 
ATOM   6705 C C6    . DT  H 2 21  ? -20.520 19.641  63.184  1.00 51.13  ? 21   DT  H C6    1 
ATOM   6706 P P     . DT  H 2 22  ? -22.618 25.689  63.641  1.00 58.57  ? 22   DT  H P     1 
ATOM   6707 O OP1   . DT  H 2 22  ? -22.468 27.172  63.567  1.00 59.83  ? 22   DT  H OP1   1 
ATOM   6708 O OP2   . DT  H 2 22  ? -23.407 25.087  64.751  1.00 61.65  ? 22   DT  H OP2   1 
ATOM   6709 O "O5'" . DT  H 2 22  ? -23.166 25.231  62.212  1.00 56.52  ? 22   DT  H "O5'" 1 
ATOM   6710 C "C5'" . DT  H 2 22  ? -22.975 26.072  61.065  1.00 57.08  ? 22   DT  H "C5'" 1 
ATOM   6711 C "C4'" . DT  H 2 22  ? -23.209 25.303  59.786  1.00 56.73  ? 22   DT  H "C4'" 1 
ATOM   6712 O "O4'" . DT  H 2 22  ? -22.843 23.924  59.971  1.00 54.42  ? 22   DT  H "O4'" 1 
ATOM   6713 C "C3'" . DT  H 2 22  ? -24.660 25.272  59.317  1.00 61.92  ? 22   DT  H "C3'" 1 
ATOM   6714 O "O3'" . DT  H 2 22  ? -24.898 26.296  58.349  1.00 65.81  ? 22   DT  H "O3'" 1 
ATOM   6715 C "C2'" . DT  H 2 22  ? -24.830 23.879  58.724  1.00 60.93  ? 22   DT  H "C2'" 1 
ATOM   6716 C "C1'" . DT  H 2 22  ? -23.532 23.148  59.010  1.00 54.62  ? 22   DT  H "C1'" 1 
ATOM   6717 N N1    . DT  H 2 22  ? -23.679 21.781  59.549  1.00 53.85  ? 22   DT  H N1    1 
ATOM   6718 C C2    . DT  H 2 22  ? -23.621 20.734  58.657  1.00 53.83  ? 22   DT  H C2    1 
ATOM   6719 O O2    . DT  H 2 22  ? -23.478 20.890  57.455  1.00 52.90  ? 22   DT  H O2    1 
ATOM   6720 N N3    . DT  H 2 22  ? -23.749 19.488  59.226  1.00 55.38  ? 22   DT  H N3    1 
ATOM   6721 C C4    . DT  H 2 22  ? -23.923 19.196  60.570  1.00 56.97  ? 22   DT  H C4    1 
ATOM   6722 O O4    . DT  H 2 22  ? -24.038 18.023  60.935  1.00 57.91  ? 22   DT  H O4    1 
ATOM   6723 C C5    . DT  H 2 22  ? -23.954 20.346  61.452  1.00 56.38  ? 22   DT  H C5    1 
ATOM   6724 C C7    . DT  H 2 22  ? -24.134 20.130  62.921  1.00 59.41  ? 22   DT  H C7    1 
ATOM   6725 C C6    . DT  H 2 22  ? -23.824 21.562  60.904  1.00 54.92  ? 22   DT  H C6    1 
HETATM 6726 P P     . PO4 I 3 .   ? 41.703  1.938   -23.682 1.00 102.87 ? 1164 PO4 A P     1 
HETATM 6727 O O1    . PO4 I 3 .   ? 42.251  3.079   -22.850 1.00 92.23  ? 1164 PO4 A O1    1 
HETATM 6728 O O2    . PO4 I 3 .   ? 42.773  1.454   -24.638 1.00 85.26  ? 1164 PO4 A O2    1 
HETATM 6729 O O3    . PO4 I 3 .   ? 40.523  2.425   -24.499 1.00 100.55 ? 1164 PO4 A O3    1 
HETATM 6730 O O4    . PO4 I 3 .   ? 41.278  0.812   -22.754 1.00 103.41 ? 1164 PO4 A O4    1 
HETATM 6731 P P     . PO4 J 3 .   ? 40.271  3.859   -20.092 1.00 99.99  ? 1165 PO4 A P     1 
HETATM 6732 O O1    . PO4 J 3 .   ? 39.786  3.509   -21.493 1.00 83.54  ? 1165 PO4 A O1    1 
HETATM 6733 O O2    . PO4 J 3 .   ? 41.424  4.860   -20.075 1.00 79.25  ? 1165 PO4 A O2    1 
HETATM 6734 O O3    . PO4 J 3 .   ? 40.723  2.552   -19.437 1.00 87.36  ? 1165 PO4 A O3    1 
HETATM 6735 O O4    . PO4 J 3 .   ? 39.129  4.528   -19.348 1.00 79.11  ? 1165 PO4 A O4    1 
HETATM 6736 P P     . PO4 K 3 .   ? 4.679   27.814  -11.115 1.00 94.02  ? 1023 PO4 C P     1 
HETATM 6737 O O1    . PO4 K 3 .   ? 3.892   26.522  -11.250 1.00 99.65  ? 1023 PO4 C O1    1 
HETATM 6738 O O2    . PO4 K 3 .   ? 3.826   28.861  -10.415 1.00 85.13  ? 1023 PO4 C O2    1 
HETATM 6739 O O3    . PO4 K 3 .   ? 5.025   28.321  -12.503 1.00 91.49  ? 1023 PO4 C O3    1 
HETATM 6740 O O4    . PO4 K 3 .   ? 5.938   27.515  -10.325 1.00 64.98  ? 1023 PO4 C O4    1 
HETATM 6741 P P     . PO4 L 3 .   ? 11.718  36.979  -5.911  1.00 88.12  ? 1023 PO4 D P     1 
HETATM 6742 O O1    . PO4 L 3 .   ? 10.720  36.741  -4.781  1.00 69.17  ? 1023 PO4 D O1    1 
HETATM 6743 O O2    . PO4 L 3 .   ? 11.973  38.469  -6.027  1.00 79.31  ? 1023 PO4 D O2    1 
HETATM 6744 O O3    . PO4 L 3 .   ? 11.162  36.454  -7.225  1.00 88.18  ? 1023 PO4 D O3    1 
HETATM 6745 O O4    . PO4 L 3 .   ? 13.027  36.261  -5.627  1.00 80.27  ? 1023 PO4 D O4    1 
HETATM 6746 O O     . HOH M 4 .   ? 27.963  27.098  24.767  1.00 44.56  ? 2001 HOH A O     1 
HETATM 6747 O O     . HOH M 4 .   ? 39.614  24.818  -0.708  1.00 45.80  ? 2002 HOH A O     1 
HETATM 6748 O O     . HOH M 4 .   ? 35.383  38.761  13.703  1.00 46.80  ? 2003 HOH A O     1 
HETATM 6749 O O     . HOH N 4 .   ? 14.122  26.384  15.147  1.00 58.08  ? 2001 HOH B O     1 
HETATM 6750 O O     . HOH O 4 .   ? 45.063  1.738   -3.490  1.00 43.55  ? 2001 HOH C O     1 
HETATM 6751 O O     . HOH O 4 .   ? 10.872  26.883  -15.367 1.00 62.66  ? 2002 HOH C O     1 
HETATM 6752 O O     . HOH P 4 .   ? 8.396   25.069  -13.758 1.00 50.80  ? 2001 HOH D O     1 
HETATM 6753 O O     . HOH P 4 .   ? 14.553  26.007  -16.205 1.00 52.70  ? 2002 HOH D O     1 
HETATM 6754 O O     . HOH Q 4 .   ? -9.528  25.404  56.484  1.00 40.16  ? 2001 HOH E O     1 
HETATM 6755 O O     . HOH Q 4 .   ? 6.206   27.539  68.418  1.00 43.25  ? 2002 HOH E O     1 
HETATM 6756 O O     . HOH Q 4 .   ? 8.667   46.087  30.523  1.00 40.03  ? 2003 HOH E O     1 
HETATM 6757 O O     . HOH Q 4 .   ? -7.070  20.487  44.659  1.00 59.42  ? 2004 HOH E O     1 
HETATM 6758 O O     . HOH R 4 .   ? -0.942  39.058  40.391  1.00 46.07  ? 2001 HOH F O     1 
HETATM 6759 O O     . HOH R 4 .   ? 0.499   14.779  42.929  1.00 49.24  ? 2002 HOH F O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . PRO A 19  ? 0.8679 0.7965 0.6481 0.0134  0.1879  0.0381  5   PRO A N     
2    C CA    . PRO A 19  ? 0.8997 0.8236 0.6649 -0.0087 0.1634  0.0339  5   PRO A CA    
3    C C     . PRO A 19  ? 0.8554 0.8622 0.6872 -0.0153 0.1493  0.0330  5   PRO A C     
4    O O     . PRO A 19  ? 0.9355 0.9729 0.7818 -0.0333 0.1299  0.0400  5   PRO A O     
5    C CB    . PRO A 19  ? 0.9506 0.8165 0.6549 -0.0325 0.1446  0.0389  5   PRO A CB    
6    C CG    . PRO A 19  ? 0.9426 0.8085 0.6503 -0.0237 0.1572  0.0419  5   PRO A CG    
7    C CD    . PRO A 19  ? 0.9201 0.7962 0.6510 0.0100  0.1906  0.0422  5   PRO A CD    
8    N N     . ARG A 20  ? 0.8130 0.8513 0.6804 0.0017  0.1604  0.0287  6   ARG A N     
9    C CA    . ARG A 20  ? 0.7477 0.8442 0.6600 0.0039  0.1524  0.0266  6   ARG A CA    
10   C C     . ARG A 20  ? 0.7624 0.8638 0.6716 -0.0015 0.1420  0.0249  6   ARG A C     
11   O O     . ARG A 20  ? 0.8561 0.9170 0.7298 -0.0117 0.1371  0.0255  6   ARG A O     
12   C CB    . ARG A 20  ? 0.7166 0.8301 0.6566 0.0200  0.1630  0.0256  6   ARG A CB    
13   C CG    . ARG A 20  ? 0.7364 0.8226 0.6671 0.0301  0.1759  0.0283  6   ARG A CG    
14   C CD    . ARG A 20  ? 0.7148 0.8252 0.6806 0.0394  0.1794  0.0369  6   ARG A CD    
15   N NE    . ARG A 20  ? 0.6991 0.8272 0.6773 0.0375  0.1658  0.0309  6   ARG A NE    
16   C CZ    . ARG A 20  ? 0.7122 0.8298 0.6851 0.0402  0.1666  0.0295  6   ARG A CZ    
17   N NH1   . ARG A 20  ? 0.7412 0.8297 0.6952 0.0464  0.1817  0.0339  6   ARG A NH1   
18   N NH2   . ARG A 20  ? 0.7070 0.8356 0.6855 0.0389  0.1534  0.0238  6   ARG A NH2   
19   N N     . TRP A 21  ? 0.7174 0.8598 0.6555 0.0066  0.1389  0.0238  7   TRP A N     
20   C CA    . TRP A 21  ? 0.7070 0.8609 0.6473 0.0060  0.1318  0.0244  7   TRP A CA    
21   C C     . TRP A 21  ? 0.6911 0.8336 0.6326 0.0187  0.1386  0.0144  7   TRP A C     
22   O O     . TRP A 21  ? 0.6923 0.8302 0.6415 0.0263  0.1454  0.0123  7   TRP A O     
23   C CB    . TRP A 21  ? 0.6906 0.8921 0.6546 0.0147  0.1291  0.0336  7   TRP A CB    
24   C CG    . TRP A 21  ? 0.7022 0.9347 0.6786 0.0022  0.1196  0.0548  7   TRP A CG    
25   C CD1   . TRP A 21  ? 0.7352 0.9521 0.6997 -0.0219 0.1073  0.0646  7   TRP A CD1   
26   C CD2   . TRP A 21  ? 0.7010 0.9851 0.7030 0.0142  0.1216  0.0753  7   TRP A CD2   
27   N NE1   . TRP A 21  ? 0.7359 0.9983 0.7250 -0.0319 0.0964  0.0923  7   TRP A NE1   
28   C CE2   . TRP A 21  ? 0.7235 1.0336 0.7409 -0.0071 0.1082  0.1016  7   TRP A CE2   
29   C CE3   . TRP A 21  ? 0.6970 1.0023 0.7042 0.0428  0.1343  0.0777  7   TRP A CE3   
30   C CZ2   . TRP A 21  ? 0.7158 1.0878 0.7681 0.0005  0.1093  0.1356  7   TRP A CZ2   
31   C CZ3   . TRP A 21  ? 0.7061 1.0624 0.7367 0.0564  0.1403  0.1078  7   TRP A CZ3   
32   C CH2   . TRP A 21  ? 0.7138 1.1106 0.7739 0.0357  0.1290  0.1391  7   TRP A CH2   
33   N N     . LEU A 22  ? 0.6745 0.8159 0.6118 0.0188  0.1343  0.0125  8   LEU A N     
34   C CA    . LEU A 22  ? 0.6555 0.7887 0.5951 0.0291  0.1375  0.0052  8   LEU A CA    
35   C C     . LEU A 22  ? 0.6307 0.7847 0.5771 0.0409  0.1334  0.0036  8   LEU A C     
36   O O     . LEU A 22  ? 0.6363 0.8108 0.5841 0.0444  0.1312  0.0092  8   LEU A O     
37   C CB    . LEU A 22  ? 0.6617 0.7719 0.5847 0.0242  0.1365  0.0027  8   LEU A CB    
38   C CG    . LEU A 22  ? 0.6638 0.7368 0.5710 0.0274  0.1483  0.0024  8   LEU A CG    
39   C CD1   . LEU A 22  ? 0.6857 0.7334 0.5744 0.0253  0.1570  0.0073  8   LEU A CD1   
40   C CD2   . LEU A 22  ? 0.6881 0.7328 0.5697 0.0232  0.1463  -0.0005 8   LEU A CD2   
41   N N     . THR A 23  ? 0.6338 0.7779 0.5794 0.0475  0.1314  0.0001  9   THR A N     
42   C CA    . THR A 23  ? 0.6473 0.7871 0.5763 0.0605  0.1258  -0.0027 9   THR A CA    
43   C C     . THR A 23  ? 0.6421 0.7792 0.5637 0.0649  0.1250  -0.0057 9   THR A C     
44   O O     . THR A 23  ? 0.6552 0.7892 0.5851 0.0557  0.1258  -0.0070 9   THR A O     
45   C CB    . THR A 23  ? 0.6541 0.7680 0.5711 0.0592  0.1145  -0.0032 9   THR A CB    
46   O OG1   . THR A 23  ? 0.6590 0.7620 0.5842 0.0513  0.1086  -0.0014 9   THR A OG1   
47   C CG2   . THR A 23  ? 0.6533 0.7727 0.5844 0.0517  0.1142  0.0032  9   THR A CG2   
48   N N     . ALA A 24  ? 0.6636 0.7958 0.5633 0.0819  0.1253  -0.0057 10  ALA A N     
49   C CA    . ALA A 24  ? 0.6640 0.7925 0.5551 0.0886  0.1253  -0.0073 10  ALA A CA    
50   C C     . ALA A 24  ? 0.6769 0.7761 0.5610 0.0796  0.1148  -0.0156 10  ALA A C     
51   O O     . ALA A 24  ? 0.6575 0.7575 0.5465 0.0767  0.1146  -0.0178 10  ALA A O     
52   C CB    . ALA A 24  ? 0.6927 0.8138 0.5525 0.1157  0.1323  -0.0025 10  ALA A CB    
53   N N     . GLU A 25  ? 0.7130 0.7892 0.5888 0.0730  0.1042  -0.0158 11  GLU A N     
54   C CA    . GLU A 25  ? 0.7376 0.7946 0.6160 0.0612  0.0912  -0.0138 11  GLU A CA    
55   C C     . GLU A 25  ? 0.7210 0.8002 0.6358 0.0520  0.1015  -0.0092 11  GLU A C     
56   O O     . GLU A 25  ? 0.7208 0.7961 0.6389 0.0506  0.1017  -0.0098 11  GLU A O     
57   C CB    . GLU A 25  ? 0.7643 0.7992 0.6349 0.0496  0.0729  -0.0047 11  GLU A CB    
58   C CG    . GLU A 25  ? 0.8393 0.8216 0.6498 0.0549  0.0544  -0.0083 11  GLU A CG    
59   C CD    . GLU A 25  ? 0.8662 0.8386 0.6440 0.0739  0.0649  -0.0141 11  GLU A CD    
60   O OE1   . GLU A 25  ? 0.8305 0.8406 0.6416 0.0738  0.0785  -0.0117 11  GLU A OE1   
61   O OE2   . GLU A 25  ? 0.9211 0.8427 0.6341 0.0910  0.0607  -0.0191 11  GLU A OE2   
62   N N     . GLU A 26  ? 0.7145 0.8091 0.6484 0.0482  0.1112  -0.0040 12  GLU A N     
63   C CA    . GLU A 26  ? 0.7061 0.8044 0.6563 0.0450  0.1252  0.0017  12  GLU A CA    
64   C C     . GLU A 26  ? 0.6899 0.7824 0.6267 0.0457  0.1307  -0.0064 12  GLU A C     
65   O O     . GLU A 26  ? 0.7030 0.7820 0.6376 0.0461  0.1372  -0.0039 12  GLU A O     
66   C CB    . GLU A 26  ? 0.7210 0.8258 0.6785 0.0437  0.1349  0.0068  12  GLU A CB    
67   C CG    . GLU A 26  ? 0.7220 0.8344 0.6997 0.0411  0.1313  0.0214  12  GLU A CG    
68   C CD    . GLU A 26  ? 0.7112 0.8302 0.6931 0.0413  0.1406  0.0242  12  GLU A CD    
69   O OE1   . GLU A 26  ? 0.7169 0.8392 0.6852 0.0408  0.1396  0.0132  12  GLU A OE1   
70   O OE2   . GLU A 26  ? 0.6983 0.8222 0.6992 0.0429  0.1500  0.0413  12  GLU A OE2   
71   N N     . GLN A 27  ? 0.6924 0.7962 0.6208 0.0462  0.1276  -0.0115 13  GLN A N     
72   C CA    . GLN A 27  ? 0.6960 0.7992 0.6154 0.0423  0.1264  -0.0131 13  GLN A CA    
73   C C     . GLN A 27  ? 0.6975 0.7902 0.6123 0.0462  0.1236  -0.0176 13  GLN A C     
74   O O     . GLN A 27  ? 0.7080 0.7856 0.6134 0.0410  0.1254  -0.0185 13  GLN A O     
75   C CB    . GLN A 27  ? 0.6886 0.8202 0.6120 0.0449  0.1225  -0.0072 13  GLN A CB    
76   C CG    . GLN A 27  ? 0.6819 0.8247 0.6098 0.0336  0.1215  0.0020  13  GLN A CG    
77   C CD    . GLN A 27  ? 0.6857 0.8691 0.6286 0.0390  0.1196  0.0176  13  GLN A CD    
78   O OE1   . GLN A 27  ? 0.6965 0.8997 0.6468 0.0366  0.1147  0.0302  13  GLN A OE1   
79   N NE2   . GLN A 27  ? 0.6671 0.8662 0.6168 0.0477  0.1248  0.0215  13  GLN A NE2   
80   N N     . LEU A 28  ? 0.6778 0.7702 0.5909 0.0547  0.1175  -0.0202 14  LEU A N     
81   C CA    . LEU A 28  ? 0.6705 0.7497 0.5760 0.0575  0.1120  -0.0238 14  LEU A CA    
82   C C     . LEU A 28  ? 0.6701 0.7377 0.5870 0.0516  0.1138  -0.0184 14  LEU A C     
83   O O     . LEU A 28  ? 0.6715 0.7307 0.5856 0.0516  0.1138  -0.0198 14  LEU A O     
84   C CB    . LEU A 28  ? 0.6886 0.7530 0.5728 0.0668  0.1014  -0.0264 14  LEU A CB    
85   C CG    . LEU A 28  ? 0.6893 0.7600 0.5547 0.0835  0.1061  -0.0280 14  LEU A CG    
86   C CD1   . LEU A 28  ? 0.7129 0.7555 0.5380 0.1010  0.1028  -0.0290 14  LEU A CD1   
87   C CD2   . LEU A 28  ? 0.7066 0.7753 0.5702 0.0846  0.1054  -0.0306 14  LEU A CD2   
88   N N     . VAL A 29  ? 0.6852 0.7558 0.6176 0.0485  0.1166  -0.0080 15  VAL A N     
89   C CA    . VAL A 29  ? 0.7122 0.7814 0.6634 0.0482  0.1247  0.0080  15  VAL A CA    
90   C C     . VAL A 29  ? 0.7087 0.7616 0.6447 0.0535  0.1431  0.0052  15  VAL A C     
91   O O     . VAL A 29  ? 0.6988 0.7407 0.6318 0.0576  0.1491  0.0093  15  VAL A O     
92   C CB    . VAL A 29  ? 0.7342 0.8163 0.7095 0.0465  0.1278  0.0270  15  VAL A CB    
93   C CG1   . VAL A 29  ? 0.7531 0.8396 0.7500 0.0546  0.1470  0.0516  15  VAL A CG1   
94   C CG2   . VAL A 29  ? 0.7446 0.8296 0.7262 0.0358  0.1025  0.0346  15  VAL A CG2   
95   N N     . TRP A 30  ? 0.7108 0.7552 0.6301 0.0521  0.1494  -0.0007 16  TRP A N     
96   C CA    . TRP A 30  ? 0.7383 0.7471 0.6231 0.0529  0.1609  -0.0030 16  TRP A CA    
97   C C     . TRP A 30  ? 0.7416 0.7375 0.6079 0.0480  0.1528  -0.0122 16  TRP A C     
98   O O     . TRP A 30  ? 0.7590 0.7211 0.5999 0.0530  0.1629  -0.0101 16  TRP A O     
99   C CB    . TRP A 30  ? 0.7469 0.7465 0.6128 0.0447  0.1584  -0.0067 16  TRP A CB    
100  C CG    . TRP A 30  ? 0.7912 0.7359 0.6042 0.0403  0.1632  -0.0076 16  TRP A CG    
101  C CD1   . TRP A 30  ? 0.8132 0.7405 0.5977 0.0217  0.1458  -0.0115 16  TRP A CD1   
102  C CD2   . TRP A 30  ? 0.8446 0.7355 0.6177 0.0551  0.1854  -0.0001 16  TRP A CD2   
103  N NE1   . TRP A 30  ? 0.8794 0.7340 0.5989 0.0190  0.1504  -0.0102 16  TRP A NE1   
104  C CE2   . TRP A 30  ? 0.8959 0.7226 0.6020 0.0436  0.1783  -0.0049 16  TRP A CE2   
105  C CE3   . TRP A 30  ? 0.8655 0.7550 0.6511 0.0786  0.2113  0.0157  16  TRP A CE3   
106  C CZ2   . TRP A 30  ? 0.9788 0.7245 0.6141 0.0580  0.1980  0.0001  16  TRP A CZ2   
107  C CZ3   . TRP A 30  ? 0.9355 0.7583 0.6630 0.0979  0.2368  0.0251  16  TRP A CZ3   
108  C CH2   . TRP A 30  ? 0.9979 0.7419 0.6432 0.0893  0.2311  0.0144  16  TRP A CH2   
109  N N     . ARG A 31  ? 0.7254 0.7469 0.6025 0.0416  0.1371  -0.0196 17  ARG A N     
110  C CA    . ARG A 31  ? 0.7416 0.7582 0.6074 0.0374  0.1290  -0.0246 17  ARG A CA    
111  C C     . ARG A 31  ? 0.7453 0.7511 0.6138 0.0452  0.1345  -0.0243 17  ARG A C     
112  O O     . ARG A 31  ? 0.7574 0.7348 0.6023 0.0444  0.1383  -0.0253 17  ARG A O     
113  C CB    . ARG A 31  ? 0.7142 0.7657 0.5963 0.0386  0.1175  -0.0263 17  ARG A CB    
114  C CG    . ARG A 31  ? 0.7394 0.8017 0.6159 0.0275  0.1077  -0.0199 17  ARG A CG    
115  C CD    . ARG A 31  ? 0.7167 0.8212 0.6140 0.0365  0.1053  -0.0118 17  ARG A CD    
116  N NE    . ARG A 31  ? 0.7043 0.8153 0.6023 0.0520  0.1064  -0.0153 17  ARG A NE    
117  C CZ    . ARG A 31  ? 0.6771 0.8105 0.5784 0.0702  0.1102  -0.0084 17  ARG A CZ    
118  N NH1   . ARG A 31  ? 0.6689 0.8290 0.5810 0.0756  0.1143  0.0045  17  ARG A NH1   
119  N NH2   . ARG A 31  ? 0.6728 0.7964 0.5607 0.0857  0.1116  -0.0127 17  ARG A NH2   
120  N N     . SER A 32  ? 0.7207 0.7456 0.6144 0.0508  0.1320  -0.0204 18  SER A N     
121  C CA    . SER A 32  ? 0.7302 0.7515 0.6326 0.0546  0.1320  -0.0150 18  SER A CA    
122  C C     . SER A 32  ? 0.7238 0.7276 0.6247 0.0632  0.1525  0.0001  18  SER A C     
123  O O     . SER A 32  ? 0.7180 0.7108 0.6154 0.0684  0.1582  0.0049  18  SER A O     
124  C CB    . SER A 32  ? 0.7383 0.7749 0.6595 0.0523  0.1166  -0.0097 18  SER A CB    
125  O OG    . SER A 32  ? 0.7689 0.8164 0.7094 0.0507  0.1181  0.0044  18  SER A OG    
126  N N     . TYR A 33  ? 0.7246 0.7221 0.6231 0.0686  0.1667  0.0091  19  TYR A N     
127  C CA    . TYR A 33  ? 0.7548 0.7221 0.6343 0.0852  0.1937  0.0249  19  TYR A CA    
128  C C     . TYR A 33  ? 0.7993 0.7131 0.6212 0.0859  0.1986  0.0116  19  TYR A C     
129  O O     . TYR A 33  ? 0.8036 0.6941 0.6094 0.0978  0.2120  0.0188  19  TYR A O     
130  C CB    . TYR A 33  ? 0.7638 0.7242 0.6394 0.0938  0.2100  0.0363  19  TYR A CB    
131  C CG    . TYR A 33  ? 0.8422 0.7546 0.6782 0.1184  0.2433  0.0526  19  TYR A CG    
132  C CD1   . TYR A 33  ? 0.8500 0.7799 0.7155 0.1405  0.2669  0.0854  19  TYR A CD1   
133  C CD2   . TYR A 33  ? 0.9148 0.7574 0.6763 0.1206  0.2509  0.0394  19  TYR A CD2   
134  C CE1   . TYR A 33  ? 0.9208 0.8011 0.7420 0.1721  0.3049  0.1047  19  TYR A CE1   
135  C CE2   . TYR A 33  ? 0.9868 0.7642 0.6897 0.1482  0.2838  0.0538  19  TYR A CE2   
136  C CZ    . TYR A 33  ? 0.9996 0.7960 0.7317 0.1781  0.3147  0.0862  19  TYR A CZ    
137  O OH    . TYR A 33  ? 1.0976 0.8251 0.7652 0.2148  0.3551  0.1055  19  TYR A OH    
138  N N     . ILE A 34  ? 0.7802 0.6545 0.5238 -0.0101 0.0954  -0.0777 20  ILE A N     
139  C CA    . ILE A 34  ? 0.7706 0.6370 0.5270 -0.0157 0.1011  -0.0746 20  ILE A CA    
140  C C     . ILE A 34  ? 0.7462 0.6157 0.5184 -0.0241 0.0959  -0.0778 20  ILE A C     
141  O O     . ILE A 34  ? 0.7212 0.5955 0.5027 -0.0265 0.0945  -0.0750 20  ILE A O     
142  C CB    . ILE A 34  ? 0.7747 0.6261 0.5287 -0.0141 0.1132  -0.0747 20  ILE A CB    
143  C CG1   . ILE A 34  ? 0.8025 0.6442 0.5395 -0.0036 0.1244  -0.0688 20  ILE A CG1   
144  C CG2   . ILE A 34  ? 0.7590 0.6110 0.5299 -0.0198 0.1170  -0.0765 20  ILE A CG2   
145  C CD1   . ILE A 34  ? 0.8192 0.6629 0.5560 -0.0001 0.1280  -0.0627 20  ILE A CD1   
146  N N     . GLU A 35  ? 0.7633 0.6292 0.5369 -0.0269 0.0947  -0.0830 21  GLU A N     
147  C CA    . GLU A 35  ? 0.7728 0.6371 0.5595 -0.0322 0.0939  -0.0840 21  GLU A CA    
148  C C     . GLU A 35  ? 0.7680 0.6404 0.5630 -0.0356 0.0899  -0.0828 21  GLU A C     
149  O O     . GLU A 35  ? 0.7652 0.6380 0.5678 -0.0357 0.0912  -0.0775 21  GLU A O     
150  C CB    . GLU A 35  ? 0.8044 0.6610 0.5913 -0.0346 0.0957  -0.0905 21  GLU A CB    
151  C CG    . GLU A 35  ? 0.8380 0.6855 0.6166 -0.0313 0.1009  -0.0923 21  GLU A CG    
152  C CD    . GLU A 35  ? 0.8827 0.7215 0.6627 -0.0337 0.1037  -0.0985 21  GLU A CD    
153  O OE1   . GLU A 35  ? 0.8887 0.7285 0.6742 -0.0386 0.1019  -0.1041 21  GLU A OE1   
154  O OE2   . GLU A 35  ? 0.9224 0.7530 0.7004 -0.0314 0.1094  -0.0989 21  GLU A OE2   
155  N N     . ALA A 36  ? 0.7829 0.6638 0.5766 -0.0373 0.0857  -0.0888 22  ALA A N     
156  C CA    . ALA A 36  ? 0.7835 0.6736 0.5896 -0.0423 0.0836  -0.0910 22  ALA A CA    
157  C C     . ALA A 36  ? 0.7822 0.6759 0.5897 -0.0397 0.0835  -0.0815 22  ALA A C     
158  O O     . ALA A 36  ? 0.8165 0.7073 0.6336 -0.0419 0.0870  -0.0769 22  ALA A O     
159  C CB    . ALA A 36  ? 0.7862 0.6930 0.5912 -0.0427 0.0773  -0.1017 22  ALA A CB    
160  N N     . ALA A 37  ? 0.7732 0.6714 0.5697 -0.0336 0.0815  -0.0779 23  ALA A N     
161  C CA    . ALA A 37  ? 0.7439 0.6455 0.5411 -0.0312 0.0823  -0.0705 23  ALA A CA    
162  C C     . ALA A 37  ? 0.7329 0.6281 0.5344 -0.0315 0.0860  -0.0660 23  ALA A C     
163  O O     . ALA A 37  ? 0.7430 0.6419 0.5496 -0.0313 0.0864  -0.0615 23  ALA A O     
164  C CB    . ALA A 37  ? 0.7493 0.6515 0.5337 -0.0239 0.0840  -0.0673 23  ALA A CB    
165  N N     . THR A 38  ? 0.7154 0.6036 0.5144 -0.0303 0.0886  -0.0679 24  THR A N     
166  C CA    . THR A 38  ? 0.6898 0.5792 0.4932 -0.0280 0.0905  -0.0664 24  THR A CA    
167  C C     . THR A 38  ? 0.7086 0.5963 0.5171 -0.0270 0.0911  -0.0624 24  THR A C     
168  O O     . THR A 38  ? 0.7359 0.6293 0.5453 -0.0217 0.0916  -0.0582 24  THR A O     
169  C CB    . THR A 38  ? 0.6758 0.5617 0.4792 -0.0270 0.0936  -0.0716 24  THR A CB    
170  O OG1   . THR A 38  ? 0.6468 0.5286 0.4449 -0.0272 0.0979  -0.0740 24  THR A OG1   
171  C CG2   . THR A 38  ? 0.6618 0.5580 0.4720 -0.0231 0.0936  -0.0738 24  THR A CG2   
172  N N     . LEU A 39  ? 0.7136 0.5936 0.5252 -0.0309 0.0929  -0.0642 25  LEU A N     
173  C CA    . LEU A 39  ? 0.7273 0.5996 0.5453 -0.0300 0.0990  -0.0597 25  LEU A CA    
174  C C     . LEU A 39  ? 0.7400 0.6146 0.5637 -0.0319 0.1015  -0.0555 25  LEU A C     
175  O O     . LEU A 39  ? 0.7331 0.6027 0.5579 -0.0264 0.1083  -0.0472 25  LEU A O     
176  C CB    . LEU A 39  ? 0.7588 0.6202 0.5821 -0.0356 0.1034  -0.0659 25  LEU A CB    
177  C CG    . LEU A 39  ? 0.7771 0.6317 0.5965 -0.0328 0.1046  -0.0684 25  LEU A CG    
178  C CD1   . LEU A 39  ? 0.8195 0.6660 0.6429 -0.0403 0.1075  -0.0778 25  LEU A CD1   
179  C CD2   . LEU A 39  ? 0.7751 0.6249 0.5947 -0.0231 0.1105  -0.0599 25  LEU A CD2   
180  N N     . LEU A 40  ? 0.7529 0.6354 0.5797 -0.0380 0.0971  -0.0608 26  LEU A N     
181  C CA    . LEU A 40  ? 0.7587 0.6462 0.5931 -0.0401 0.0994  -0.0579 26  LEU A CA    
182  C C     . LEU A 40  ? 0.7454 0.6370 0.5726 -0.0324 0.0992  -0.0484 26  LEU A C     
183  O O     . LEU A 40  ? 0.7525 0.6396 0.5823 -0.0291 0.1064  -0.0410 26  LEU A O     
184  C CB    . LEU A 40  ? 0.7663 0.6678 0.6047 -0.0450 0.0928  -0.0661 26  LEU A CB    
185  C CG    . LEU A 40  ? 0.8021 0.7084 0.6582 -0.0541 0.0958  -0.0769 26  LEU A CG    
186  C CD1   . LEU A 40  ? 0.7957 0.7240 0.6530 -0.0546 0.0862  -0.0856 26  LEU A CD1   
187  C CD2   . LEU A 40  ? 0.8176 0.7164 0.6885 -0.0574 0.1077  -0.0722 26  LEU A CD2   
188  N N     . GLU A 41  ? 0.7233 0.6223 0.5417 -0.0294 0.0930  -0.0495 27  GLU A N     
189  C CA    . GLU A 41  ? 0.7312 0.6367 0.5445 -0.0232 0.0928  -0.0446 27  GLU A CA    
190  C C     . GLU A 41  ? 0.7502 0.6537 0.5599 -0.0147 0.0964  -0.0392 27  GLU A C     
191  O O     . GLU A 41  ? 0.7256 0.6328 0.5317 -0.0081 0.0991  -0.0329 27  GLU A O     
192  C CB    . GLU A 41  ? 0.7097 0.6214 0.5178 -0.0223 0.0895  -0.0494 27  GLU A CB    
193  N N     . ASP A 42  ? 0.7692 0.6675 0.5784 -0.0128 0.0972  -0.0410 28  ASP A N     
194  C CA    . ASP A 42  ? 0.8018 0.7004 0.6059 -0.0009 0.1008  -0.0348 28  ASP A CA    
195  C C     . ASP A 42  ? 0.8327 0.7178 0.6376 0.0032  0.1122  -0.0237 28  ASP A C     
196  O O     . ASP A 42  ? 0.8262 0.7136 0.6225 0.0163  0.1168  -0.0143 28  ASP A O     
197  C CB    . ASP A 42  ? 0.7974 0.6927 0.6025 0.0003  0.1003  -0.0391 28  ASP A CB    
198  C CG    . ASP A 42  ? 0.8096 0.7082 0.6086 0.0160  0.1037  -0.0322 28  ASP A CG    
199  O OD1   . ASP A 42  ? 0.8578 0.7405 0.6560 0.0209  0.1141  -0.0229 28  ASP A OD1   
200  O OD2   . ASP A 42  ? 0.8053 0.7235 0.6010 0.0246  0.0973  -0.0369 28  ASP A OD2   
201  N N     . HIS A 43  ? 0.8562 0.7276 0.6719 -0.0074 0.1182  -0.0260 29  HIS A N     
202  C CA    . HIS A 43  ? 0.8765 0.7312 0.6987 -0.0065 0.1336  -0.0183 29  HIS A CA    
203  C C     . HIS A 43  ? 0.8991 0.7567 0.7215 -0.0049 0.1378  -0.0119 29  HIS A C     
204  O O     . HIS A 43  ? 0.9334 0.7803 0.7508 0.0060  0.1512  0.0007  29  HIS A O     
205  C CB    . HIS A 43  ? 0.8751 0.7196 0.7140 -0.0215 0.1385  -0.0285 29  HIS A CB    
206  C CG    . HIS A 43  ? 0.9095 0.7350 0.7616 -0.0242 0.1583  -0.0244 29  HIS A CG    
207  N ND1   . HIS A 43  ? 0.9417 0.7479 0.7876 -0.0111 0.1752  -0.0105 29  HIS A ND1   
208  C CD2   . HIS A 43  ? 0.9138 0.7367 0.7866 -0.0378 0.1662  -0.0331 29  HIS A CD2   
209  C CE1   . HIS A 43  ? 0.9638 0.7513 0.8262 -0.0176 0.1954  -0.0098 29  HIS A CE1   
210  N NE2   . HIS A 43  ? 0.9249 0.7240 0.8061 -0.0352 0.1899  -0.0251 29  HIS A NE2   
211  N N     . LEU A 44  ? 0.8524 0.7234 0.6787 -0.0134 0.1278  -0.0191 30  LEU A N     
212  C CA    . LEU A 44  ? 0.8333 0.7079 0.6623 -0.0135 0.1316  -0.0145 30  LEU A CA    
213  C C     . LEU A 44  ? 0.8390 0.7222 0.6509 0.0007  0.1291  -0.0061 30  LEU A C     
214  O O     . LEU A 44  ? 0.8942 0.7717 0.7018 0.0086  0.1396  0.0042  30  LEU A O     
215  C CB    . LEU A 44  ? 0.8014 0.6889 0.6404 -0.0252 0.1225  -0.0247 30  LEU A CB    
216  C CG    . LEU A 44  ? 0.7780 0.6644 0.6347 -0.0379 0.1237  -0.0362 30  LEU A CG    
217  C CD1   . LEU A 44  ? 0.7471 0.6516 0.6123 -0.0447 0.1149  -0.0450 30  LEU A CD1   
218  C CD2   . LEU A 44  ? 0.7904 0.6610 0.6628 -0.0419 0.1415  -0.0346 30  LEU A CD2   
219  N N     . ASP A 45  ? 0.8357 0.7329 0.6385 0.0040  0.1169  -0.0120 31  ASP A N     
220  C CA    . ASP A 45  ? 0.8423 0.7530 0.6306 0.0177  0.1134  -0.0092 31  ASP A CA    
221  C C     . ASP A 45  ? 0.8935 0.7981 0.6700 0.0351  0.1231  0.0034  31  ASP A C     
222  O O     . ASP A 45  ? 0.9506 0.8608 0.7151 0.0478  0.1268  0.0109  31  ASP A O     
223  C CB    . ASP A 45  ? 0.8177 0.7440 0.6035 0.0182  0.1021  -0.0208 31  ASP A CB    
224  C CG    . ASP A 45  ? 0.7980 0.7328 0.5887 0.0083  0.0958  -0.0308 31  ASP A CG    
225  O OD1   . ASP A 45  ? 0.7731 0.7049 0.5667 0.0033  0.0981  -0.0280 31  ASP A OD1   
226  O OD2   . ASP A 45  ? 0.7783 0.7223 0.5709 0.0063  0.0905  -0.0416 31  ASP A OD2   
227  N N     . ARG A 46  ? 0.9015 0.7946 0.6795 0.0379  0.1284  0.0063  32  ARG A N     
228  C CA    . ARG A 46  ? 0.9245 0.8103 0.6887 0.0584  0.1398  0.0205  32  ARG A CA    
229  C C     . ARG A 46  ? 0.9613 0.8245 0.7260 0.0617  0.1598  0.0349  32  ARG A C     
230  O O     . ARG A 46  ? 0.9572 0.8186 0.7045 0.0819  0.1694  0.0488  32  ARG A O     
231  C CB    . ARG A 46  ? 0.9154 0.7913 0.6824 0.0605  0.1429  0.0206  32  ARG A CB    
232  C CG    . ARG A 46  ? 0.8923 0.7917 0.6565 0.0639  0.1268  0.0091  32  ARG A CG    
233  C CD    . ARG A 46  ? 0.9004 0.7967 0.6577 0.0801  0.1320  0.0157  32  ARG A CD    
234  N NE    . ARG A 46  ? 0.9067 0.8290 0.6463 0.1048  0.1265  0.0193  32  ARG A NE    
235  C CZ    . ARG A 46  ? 0.9456 0.8704 0.6723 0.1287  0.1325  0.0300  32  ARG A CZ    
236  N NH1   . ARG A 46  ? 0.9765 0.8741 0.7065 0.1298  0.1467  0.0394  32  ARG A NH1   
237  N NH2   . ARG A 46  ? 0.9628 0.9189 0.6727 0.1530  0.1248  0.0306  32  ARG A NH2   
238  N N     . GLN A 47  ? 0.9889 0.8354 0.7742 0.0426  0.1676  0.0305  33  GLN A N     
239  C CA    . GLN A 47  ? 1.0152 0.8407 0.8091 0.0408  0.1887  0.0398  33  GLN A CA    
240  C C     . GLN A 47  ? 1.0026 0.8381 0.7864 0.0480  0.1881  0.0459  33  GLN A C     
241  O O     . GLN A 47  ? 1.0088 0.8304 0.7825 0.0624  0.2063  0.0614  33  GLN A O     
242  C CB    . GLN A 47  ? 1.0335 0.8518 0.8563 0.0160  0.1913  0.0260  33  GLN A CB    
243  C CG    . GLN A 47  ? 1.0778 0.8756 0.9186 0.0097  0.2154  0.0303  33  GLN A CG    
244  C CD    . GLN A 47  ? 1.0932 0.9042 0.9427 0.0017  0.2114  0.0266  33  GLN A CD    
245  O OE1   . GLN A 47  ? 1.0800 0.9123 0.9366 -0.0100 0.1922  0.0131  33  GLN A OE1   
246  N NE2   . GLN A 47  ? 1.1215 0.9189 0.9690 0.0100  0.2309  0.0397  33  GLN A NE2   
247  N N     . LEU A 48  ? 0.9378 0.7956 0.7228 0.0394  0.1693  0.0345  34  LEU A N     
248  C CA    . LEU A 48  ? 0.9094 0.7770 0.6863 0.0445  0.1685  0.0381  34  LEU A CA    
249  C C     . LEU A 48  ? 0.9170 0.7996 0.6666 0.0676  0.1638  0.0447  34  LEU A C     
250  O O     . LEU A 48  ? 0.9302 0.8135 0.6676 0.0790  0.1712  0.0536  34  LEU A O     
251  C CB    . LEU A 48  ? 0.8632 0.7468 0.6520 0.0281  0.1535  0.0242  34  LEU A CB    
252  C CG    . LEU A 48  ? 0.8788 0.7542 0.6930 0.0100  0.1596  0.0189  34  LEU A CG    
253  C CD1   . LEU A 48  ? 0.8782 0.7699 0.7017 -0.0031 0.1432  0.0050  34  LEU A CD1   
254  C CD2   . LEU A 48  ? 0.8984 0.7658 0.7182 0.0114  0.1752  0.0274  34  LEU A CD2   
255  N N     . GLN A 49  ? 0.9267 0.8236 0.6673 0.0755  0.1520  0.0390  35  GLN A N     
256  C CA    . GLN A 49  ? 0.9470 0.8657 0.6637 0.0989  0.1458  0.0412  35  GLN A CA    
257  C C     . GLN A 49  ? 0.9938 0.8982 0.6900 0.1248  0.1645  0.0626  35  GLN A C     
258  O O     . GLN A 49  ? 1.0367 0.9549 0.7102 0.1461  0.1654  0.0693  35  GLN A O     
259  C CB    . GLN A 49  ? 0.9114 0.8529 0.6284 0.1002  0.1290  0.0269  35  GLN A CB    
260  N N     . ARG A 50  ? 1.0007 0.8769 0.7035 0.1245  0.1810  0.0734  36  ARG A N     
261  C CA    . ARG A 50  ? 1.0598 0.9157 0.7430 0.1505  0.2044  0.0964  36  ARG A CA    
262  C C     . ARG A 50  ? 1.0879 0.9187 0.7742 0.1484  0.2270  0.1091  36  ARG A C     
263  O O     . ARG A 50  ? 1.1192 0.9486 0.7807 0.1730  0.2386  0.1249  36  ARG A O     
264  C CB    . ARG A 50  ? 1.0788 0.9101 0.7688 0.1524  0.2184  0.1036  36  ARG A CB    
265  N N     . ASP A 51  ? 1.0889 0.9023 0.8058 0.1203  0.2336  0.1013  37  ASP A N     
266  C CA    . ASP A 51  ? 1.1092 0.8970 0.8374 0.1149  0.2586  0.1108  37  ASP A CA    
267  C C     . ASP A 51  ? 1.1028 0.9064 0.8275 0.1124  0.2515  0.1081  37  ASP A C     
268  O O     . ASP A 51  ? 1.1694 0.9547 0.8967 0.1148  0.2732  0.1190  37  ASP A O     
269  C CB    . ASP A 51  ? 1.1079 0.8775 0.8747 0.0854  0.2678  0.0990  37  ASP A CB    
270  C CG    . ASP A 51  ? 1.1353 0.8846 0.9087 0.0857  0.2792  0.1008  37  ASP A CG    
271  O OD1   . ASP A 51  ? 1.2243 0.9685 0.9721 0.1111  0.2847  0.1153  37  ASP A OD1   
272  O OD2   . ASP A 51  ? 1.1391 0.8795 0.9432 0.0616  0.2827  0.0866  37  ASP A OD2   
273  N N     . ALA A 52  ? 1.0936 0.9292 0.8134 0.1078  0.2238  0.0935  38  ALA A N     
274  C CA    . ALA A 52  ? 1.0799 0.9304 0.7987 0.1032  0.2166  0.0886  38  ALA A CA    
275  C C     . ALA A 52  ? 1.0530 0.9366 0.7494 0.1155  0.1949  0.0803  38  ALA A C     
276  O O     . ALA A 52  ? 1.0299 0.9254 0.7237 0.1134  0.1901  0.0758  38  ALA A O     
277  C CB    . ALA A 52  ? 1.0520 0.9047 0.8034 0.0735  0.2089  0.0732  38  ALA A CB    
278  N N     . GLY A 53  ? 1.0396 0.9395 0.7233 0.1271  0.1824  0.0757  39  GLY A N     
279  C CA    . GLY A 53  ? 0.9984 0.9334 0.6640 0.1398  0.1639  0.0643  39  GLY A CA    
280  C C     . GLY A 53  ? 0.9453 0.9001 0.6279 0.1182  0.1449  0.0418  39  GLY A C     
281  O O     . GLY A 53  ? 0.9465 0.9271 0.6188 0.1248  0.1343  0.0306  39  GLY A O     
282  N N     . MET A 54  ? 0.9259 0.8693 0.6336 0.0941  0.1416  0.0343  40  MET A N     
283  C CA    . MET A 54  ? 0.8719 0.8297 0.5939 0.0761  0.1271  0.0155  40  MET A CA    
284  C C     . MET A 54  ? 0.8241 0.7723 0.5661 0.0578  0.1227  0.0089  40  MET A C     
285  O O     . MET A 54  ? 0.8280 0.7566 0.5781 0.0535  0.1316  0.0174  40  MET A O     
286  C CB    . MET A 54  ? 0.8910 0.8455 0.6188 0.0674  0.1311  0.0156  40  MET A CB    
287  C CG    . MET A 54  ? 0.9221 0.8554 0.6695 0.0522  0.1403  0.0222  40  MET A CG    
288  S SD    . MET A 54  ? 1.0022 0.9359 0.7533 0.0483  0.1464  0.0244  40  MET A SD    
289  C CE    . MET A 54  ? 1.0237 0.9332 0.7898 0.0440  0.1661  0.0387  40  MET A CE    
290  N N     . PRO A 55  ? 0.7710 0.7320 0.5215 0.0470  0.1109  -0.0072 41  PRO A N     
291  C CA    . PRO A 55  ? 0.7365 0.6895 0.5019 0.0324  0.1068  -0.0134 41  PRO A CA    
292  C C     . PRO A 55  ? 0.7191 0.6596 0.4985 0.0181  0.1103  -0.0114 41  PRO A C     
293  O O     . PRO A 55  ? 0.7068 0.6459 0.4870 0.0178  0.1152  -0.0067 41  PRO A O     
294  C CB    . PRO A 55  ? 0.7374 0.7075 0.5054 0.0286  0.0974  -0.0303 41  PRO A CB    
295  C CG    . PRO A 55  ? 0.7457 0.7279 0.5081 0.0323  0.0978  -0.0345 41  PRO A CG    
296  C CD    . PRO A 55  ? 0.7629 0.7456 0.5095 0.0486  0.1033  -0.0213 41  PRO A CD    
297  N N     . HIS A 56  ? 0.7392 0.6729 0.5294 0.0077  0.1075  -0.0156 42  HIS A N     
298  C CA    . HIS A 56  ? 0.7429 0.6703 0.5465 -0.0033 0.1095  -0.0152 42  HIS A CA    
299  C C     . HIS A 56  ? 0.7453 0.6799 0.5508 -0.0066 0.1072  -0.0185 42  HIS A C     
300  O O     . HIS A 56  ? 0.7642 0.6988 0.5781 -0.0100 0.1108  -0.0151 42  HIS A O     
301  C CB    . HIS A 56  ? 0.7274 0.6504 0.5389 -0.0114 0.1054  -0.0212 42  HIS A CB    
302  C CG    . HIS A 56  ? 0.7487 0.6717 0.5743 -0.0204 0.1062  -0.0235 42  HIS A CG    
303  N ND1   . HIS A 56  ? 0.7721 0.6994 0.6015 -0.0258 0.0996  -0.0311 42  HIS A ND1   
304  C CD2   . HIS A 56  ? 0.7691 0.6916 0.6071 -0.0239 0.1130  -0.0208 42  HIS A CD2   
305  C CE1   . HIS A 56  ? 0.7644 0.6979 0.6074 -0.0313 0.1001  -0.0343 42  HIS A CE1   
306  N NE2   . HIS A 56  ? 0.7775 0.7084 0.6285 -0.0317 0.1085  -0.0293 42  HIS A NE2   
307  N N     . VAL A 57  ? 0.7567 0.6977 0.5568 -0.0058 0.1030  -0.0258 43  VAL A N     
308  C CA    . VAL A 57  ? 0.7834 0.7271 0.5855 -0.0084 0.1040  -0.0284 43  VAL A CA    
309  C C     . VAL A 57  ? 0.7840 0.7311 0.5835 -0.0041 0.1089  -0.0234 43  VAL A C     
310  O O     . VAL A 57  ? 0.8023 0.7494 0.6077 -0.0062 0.1117  -0.0200 43  VAL A O     
311  C CB    . VAL A 57  ? 0.8089 0.7552 0.6085 -0.0092 0.1036  -0.0388 43  VAL A CB    
312  C CG1   . VAL A 57  ? 0.7938 0.7366 0.5958 -0.0111 0.1087  -0.0393 43  VAL A CG1   
313  C CG2   . VAL A 57  ? 0.8094 0.7518 0.6105 -0.0122 0.1004  -0.0438 43  VAL A CG2   
314  N N     . TYR A 58  ? 0.7752 0.7272 0.5650 0.0037  0.1099  -0.0228 44  TYR A N     
315  C CA    . TYR A 58  ? 0.7718 0.7266 0.5552 0.0102  0.1154  -0.0172 44  TYR A CA    
316  C C     . TYR A 58  ? 0.7782 0.7241 0.5696 0.0085  0.1227  -0.0056 44  TYR A C     
317  O O     . TYR A 58  ? 0.7900 0.7365 0.5872 0.0065  0.1269  -0.0030 44  TYR A O     
318  C CB    . TYR A 58  ? 0.7862 0.7500 0.5542 0.0229  0.1147  -0.0177 44  TYR A CB    
319  C CG    . TYR A 58  ? 0.7762 0.7569 0.5400 0.0248  0.1086  -0.0340 44  TYR A CG    
320  C CD1   . TYR A 58  ? 0.7771 0.7578 0.5520 0.0142  0.1063  -0.0463 44  TYR A CD1   
321  C CD2   . TYR A 58  ? 0.7892 0.7871 0.5389 0.0382  0.1064  -0.0385 44  TYR A CD2   
322  C CE1   . TYR A 58  ? 0.7536 0.7493 0.5303 0.0136  0.1040  -0.0644 44  TYR A CE1   
323  C CE2   . TYR A 58  ? 0.7970 0.8158 0.5477 0.0387  0.1006  -0.0583 44  TYR A CE2   
324  C CZ    . TYR A 58  ? 0.7684 0.7852 0.5351 0.0247  0.1003  -0.0722 44  TYR A CZ    
325  O OH    . TYR A 58  ? 0.7579 0.7957 0.5307 0.0232  0.0977  -0.0950 44  TYR A OH    
326  N N     . TYR A 59  ? 0.7796 0.7173 0.5738 0.0091  0.1259  0.0001  45  TYR A N     
327  C CA    . TYR A 59  ? 0.7797 0.7086 0.5881 0.0045  0.1355  0.0071  45  TYR A CA    
328  C C     . TYR A 59  ? 0.7735 0.7091 0.5992 -0.0057 0.1325  0.0019  45  TYR A C     
329  O O     . TYR A 59  ? 0.8255 0.7621 0.6621 -0.0076 0.1400  0.0054  45  TYR A O     
330  C CB    . TYR A 59  ? 0.7903 0.7085 0.6047 0.0022  0.1392  0.0087  45  TYR A CB    
331  C CG    . TYR A 59  ? 0.7969 0.7047 0.6297 -0.0037 0.1531  0.0129  45  TYR A CG    
332  C CD1   . TYR A 59  ? 0.8422 0.7359 0.6698 0.0052  0.1702  0.0251  45  TYR A CD1   
333  C CD2   . TYR A 59  ? 0.8017 0.7149 0.6580 -0.0173 0.1508  0.0033  45  TYR A CD2   
334  C CE1   . TYR A 59  ? 0.8654 0.7466 0.7143 -0.0018 0.1876  0.0275  45  TYR A CE1   
335  C CE2   . TYR A 59  ? 0.8292 0.7362 0.7085 -0.0251 0.1648  0.0023  45  TYR A CE2   
336  C CZ    . TYR A 59  ? 0.8591 0.7480 0.7363 -0.0185 0.1846  0.0143  45  TYR A CZ    
337  O OH    . TYR A 59  ? 0.8852 0.7653 0.7891 -0.0276 0.2027  0.0119  45  TYR A OH    
338  N N     . GLY A 60  ? 0.7337 0.6749 0.5615 -0.0105 0.1225  -0.0061 46  GLY A N     
339  C CA    . GLY A 60  ? 0.7052 0.6560 0.5445 -0.0152 0.1186  -0.0102 46  GLY A CA    
340  C C     . GLY A 60  ? 0.7026 0.6583 0.5398 -0.0113 0.1220  -0.0071 46  GLY A C     
341  O O     . GLY A 60  ? 0.6726 0.6372 0.5228 -0.0128 0.1234  -0.0068 46  GLY A O     
342  N N     . LEU A 61  ? 0.6947 0.6470 0.5169 -0.0059 0.1235  -0.0066 47  LEU A N     
343  C CA    . LEU A 61  ? 0.6849 0.6398 0.5043 -0.0024 0.1282  -0.0050 47  LEU A CA    
344  C C     . LEU A 61  ? 0.7102 0.6655 0.5361 -0.0010 0.1364  0.0024  47  LEU A C     
345  O O     . LEU A 61  ? 0.7207 0.6813 0.5561 -0.0013 0.1399  0.0044  47  LEU A O     
346  C CB    . LEU A 61  ? 0.6802 0.6341 0.4846 0.0018  0.1287  -0.0104 47  LEU A CB    
347  C CG    . LEU A 61  ? 0.6686 0.6213 0.4699 -0.0007 0.1242  -0.0199 47  LEU A CG    
348  C CD1   . LEU A 61  ? 0.6763 0.6335 0.4686 0.0020  0.1256  -0.0300 47  LEU A CD1   
349  C CD2   . LEU A 61  ? 0.6651 0.6145 0.4720 -0.0026 0.1260  -0.0202 47  LEU A CD2   
350  N N     . LEU A 62  ? 0.7217 0.6703 0.5431 0.0017  0.1414  0.0073  48  LEU A N     
351  C CA    . LEU A 62  ? 0.7205 0.6650 0.5486 0.0035  0.1536  0.0156  48  LEU A CA    
352  C C     . LEU A 62  ? 0.7238 0.6737 0.5788 -0.0057 0.1563  0.0135  48  LEU A C     
353  O O     . LEU A 62  ? 0.7511 0.7050 0.6182 -0.0065 0.1639  0.0161  48  LEU A O     
354  C CB    . LEU A 62  ? 0.7326 0.6655 0.5501 0.0103  0.1617  0.0231  48  LEU A CB    
355  C CG    . LEU A 62  ? 0.7357 0.6701 0.5265 0.0227  0.1581  0.0236  48  LEU A CG    
356  C CD1   . LEU A 62  ? 0.7565 0.6795 0.5344 0.0351  0.1708  0.0359  48  LEU A CD1   
357  C CD2   . LEU A 62  ? 0.7364 0.6800 0.5166 0.0270  0.1560  0.0194  48  LEU A CD2   
358  N N     . VAL A 63  ? 0.7470 0.6997 0.6127 -0.0127 0.1498  0.0069  49  VAL A N     
359  C CA    . VAL A 63  ? 0.7618 0.7264 0.6554 -0.0217 0.1501  -0.0003 49  VAL A CA    
360  C C     . VAL A 63  ? 0.7770 0.7604 0.6781 -0.0204 0.1435  -0.0038 49  VAL A C     
361  O O     . VAL A 63  ? 0.8026 0.7991 0.7259 -0.0236 0.1483  -0.0068 49  VAL A O     
362  C CB    . VAL A 63  ? 0.7591 0.7259 0.6588 -0.0280 0.1421  -0.0092 49  VAL A CB    
363  C CG1   . VAL A 63  ? 0.7513 0.7392 0.6794 -0.0363 0.1386  -0.0216 49  VAL A CG1   
364  C CG2   . VAL A 63  ? 0.7619 0.7094 0.6589 -0.0290 0.1522  -0.0050 49  VAL A CG2   
365  N N     . LYS A 64  ? 0.7714 0.7560 0.6552 -0.0145 0.1349  -0.0035 50  LYS A N     
366  C CA    . LYS A 64  ? 0.7503 0.7497 0.6384 -0.0098 0.1314  -0.0043 50  LYS A CA    
367  C C     . LYS A 64  ? 0.7194 0.7187 0.6097 -0.0060 0.1410  0.0021  50  LYS A C     
368  O O     . LYS A 64  ? 0.7142 0.7299 0.6185 -0.0034 0.1411  0.0012  50  LYS A O     
369  C CB    . LYS A 64  ? 0.7488 0.7443 0.6184 -0.0036 0.1252  -0.0042 50  LYS A CB    
370  C CG    . LYS A 64  ? 0.7607 0.7709 0.6338 0.0046  0.1232  -0.0032 50  LYS A CG    
371  C CD    . LYS A 64  ? 0.7538 0.7906 0.6487 0.0038  0.1167  -0.0100 50  LYS A CD    
372  C CE    . LYS A 64  ? 0.7785 0.8337 0.6751 0.0165  0.1152  -0.0074 50  LYS A CE    
373  N NZ    . LYS A 64  ? 0.7874 0.8771 0.7087 0.0166  0.1075  -0.0176 50  LYS A NZ    
374  N N     . LEU A 65  ? 0.7023 0.6856 0.5776 -0.0039 0.1486  0.0080  51  LEU A N     
375  C CA    . LEU A 65  ? 0.6873 0.6689 0.5619 0.0003  0.1589  0.0140  51  LEU A CA    
376  C C     . LEU A 65  ? 0.7013 0.6874 0.5986 -0.0043 0.1686  0.0156  51  LEU A C     
377  O O     . LEU A 65  ? 0.6876 0.6857 0.6010 -0.0037 0.1731  0.0158  51  LEU A O     
378  C CB    . LEU A 65  ? 0.6773 0.6444 0.5279 0.0056  0.1637  0.0177  51  LEU A CB    
379  C CG    . LEU A 65  ? 0.6657 0.6293 0.4981 0.0084  0.1573  0.0123  51  LEU A CG    
380  C CD1   . LEU A 65  ? 0.6811 0.6388 0.4934 0.0142  0.1612  0.0120  51  LEU A CD1   
381  C CD2   . LEU A 65  ? 0.6594 0.6269 0.4947 0.0107  0.1584  0.0110  51  LEU A CD2   
382  N N     . ALA A 66  ? 0.7153 0.6920 0.6167 -0.0090 0.1736  0.0159  52  ALA A N     
383  C CA    . ALA A 66  ? 0.7460 0.7238 0.6744 -0.0160 0.1866  0.0149  52  ALA A CA    
384  C C     . ALA A 66  ? 0.7338 0.7387 0.6952 -0.0230 0.1817  0.0033  52  ALA A C     
385  O O     . ALA A 66  ? 0.7342 0.7470 0.7211 -0.0273 0.1931  0.0010  52  ALA A O     
386  C CB    . ALA A 66  ? 0.7530 0.7160 0.6825 -0.0205 0.1922  0.0147  52  ALA A CB    
387  N N     . GLU A 67  ? 0.7465 0.7671 0.7066 -0.0225 0.1651  -0.0045 53  GLU A N     
388  C CA    . GLU A 67  ? 0.7670 0.8197 0.7526 -0.0241 0.1566  -0.0162 53  GLU A CA    
389  C C     . GLU A 67  ? 0.7585 0.8255 0.7416 -0.0138 0.1544  -0.0117 53  GLU A C     
390  O O     . GLU A 67  ? 0.7607 0.8580 0.7672 -0.0124 0.1498  -0.0204 53  GLU A O     
391  C CB    . GLU A 67  ? 0.7862 0.8500 0.7655 -0.0233 0.1404  -0.0246 53  GLU A CB    
392  C CG    . GLU A 67  ? 0.8010 0.8641 0.7953 -0.0348 0.1404  -0.0357 53  GLU A CG    
393  C CD    . GLU A 67  ? 0.8394 0.9189 0.8283 -0.0323 0.1237  -0.0452 53  GLU A CD    
394  O OE1   . GLU A 67  ? 0.8181 0.8931 0.7799 -0.0212 0.1154  -0.0374 53  GLU A OE1   
395  O OE2   . GLU A 67  ? 0.8755 0.9720 0.8879 -0.0413 0.1208  -0.0614 53  GLU A OE2   
396  N N     . SER A 68  ? 0.7585 0.8062 0.7142 -0.0058 0.1575  0.0001  54  SER A N     
397  C CA    . SER A 68  ? 0.7758 0.8323 0.7262 0.0050  0.1571  0.0050  54  SER A CA    
398  C C     . SER A 68  ? 0.7874 0.8499 0.7549 0.0053  0.1693  0.0081  54  SER A C     
399  O O     . SER A 68  ? 0.8109 0.8621 0.7865 -0.0017 0.1812  0.0098  54  SER A O     
400  C CB    . SER A 68  ? 0.7926 0.8254 0.7106 0.0115  0.1584  0.0129  54  SER A CB    
401  O OG    . SER A 68  ? 0.8063 0.8330 0.7101 0.0112  0.1490  0.0099  54  SER A OG    
402  N N     . PRO A 69  ? 0.8128 0.8916 0.7848 0.0151  0.1684  0.0102  55  PRO A N     
403  C CA    . PRO A 69  ? 0.8190 0.9012 0.8046 0.0166  0.1812  0.0143  55  PRO A CA    
404  C C     . PRO A 69  ? 0.8404 0.8907 0.8009 0.0172  0.1930  0.0243  55  PRO A C     
405  O O     . PRO A 69  ? 0.8924 0.9253 0.8251 0.0216  0.1902  0.0279  55  PRO A O     
406  C CB    . PRO A 69  ? 0.8178 0.9203 0.8052 0.0307  0.1771  0.0166  55  PRO A CB    
407  C CG    . PRO A 69  ? 0.8228 0.9439 0.8087 0.0357  0.1614  0.0103  55  PRO A CG    
408  C CD    . PRO A 69  ? 0.8163 0.9126 0.7825 0.0273  0.1575  0.0095  55  PRO A CD    
409  N N     . ARG A 70  ? 0.8701 0.9140 0.8412 0.0131  0.2072  0.0274  56  ARG A N     
410  C CA    . ARG A 70  ? 0.8670 0.8843 0.8130 0.0161  0.2191  0.0363  56  ARG A CA    
411  C C     . ARG A 70  ? 0.8619 0.8594 0.7798 0.0154  0.2142  0.0372  56  ARG A C     
412  O O     . ARG A 70  ? 0.8887 0.8704 0.7803 0.0210  0.2187  0.0414  56  ARG A O     
413  C CB    . ARG A 70  ? 0.8801 0.8949 0.8131 0.0256  0.2233  0.0411  56  ARG A CB    
414  C CG    . ARG A 70  ? 0.8773 0.9107 0.8368 0.0283  0.2308  0.0421  56  ARG A CG    
415  C CD    . ARG A 70  ? 0.8834 0.9098 0.8278 0.0384  0.2371  0.0476  56  ARG A CD    
416  N NE    . ARG A 70  ? 0.8862 0.8888 0.8061 0.0396  0.2483  0.0521  56  ARG A NE    
417  C CZ    . ARG A 70  ? 0.9065 0.8975 0.8071 0.0464  0.2548  0.0540  56  ARG A CZ    
418  N NH1   . ARG A 70  ? 0.9077 0.9037 0.8106 0.0528  0.2540  0.0540  56  ARG A NH1   
419  N NH2   . ARG A 70  ? 0.9253 0.8998 0.8035 0.0483  0.2635  0.0554  56  ARG A NH2   
420  N N     . ARG A 71  ? 0.8439 0.8453 0.7689 0.0089  0.2050  0.0315  57  ARG A N     
421  C CA    . ARG A 71  ? 0.8224 0.8083 0.7251 0.0083  0.1999  0.0317  57  ARG A CA    
422  C C     . ARG A 71  ? 0.8012 0.7796 0.6760 0.0144  0.1928  0.0309  57  ARG A C     
423  O O     . ARG A 71  ? 0.8037 0.7703 0.6566 0.0171  0.1924  0.0313  57  ARG A O     
424  C CB    . ARG A 71  ? 0.8587 0.8275 0.7543 0.0093  0.2142  0.0390  57  ARG A CB    
425  C CG    . ARG A 71  ? 0.8853 0.8540 0.8062 0.0003  0.2207  0.0366  57  ARG A CG    
426  C CD    . ARG A 71  ? 0.9257 0.8749 0.8427 0.0042  0.2426  0.0472  57  ARG A CD    
427  N NE    . ARG A 71  ? 0.9566 0.8992 0.9008 -0.0046 0.2578  0.0460  57  ARG A NE    
428  C CZ    . ARG A 71  ? 0.9880 0.9079 0.9274 0.0003  0.2812  0.0573  57  ARG A CZ    
429  N NH1   . ARG A 71  ? 1.0094 0.9157 0.9154 0.0155  0.2886  0.0704  57  ARG A NH1   
430  N NH2   . ARG A 71  ? 1.0075 0.9182 0.9751 -0.0089 0.2989  0.0550  57  ARG A NH2   
431  N N     . ARG A 72  ? 0.8107 0.7971 0.6877 0.0174  0.1887  0.0287  58  ARG A N     
432  C CA    . ARG A 72  ? 0.8126 0.7898 0.6687 0.0218  0.1872  0.0262  58  ARG A CA    
433  C C     . ARG A 72  ? 0.7925 0.7754 0.6521 0.0236  0.1801  0.0236  58  ARG A C     
434  O O     . ARG A 72  ? 0.7705 0.7692 0.6472 0.0250  0.1761  0.0246  58  ARG A O     
435  C CB    . ARG A 72  ? 0.8406 0.8130 0.6901 0.0274  0.1988  0.0290  58  ARG A CB    
436  C CG    . ARG A 72  ? 0.8787 0.8610 0.7442 0.0319  0.2034  0.0328  58  ARG A CG    
437  C CD    . ARG A 72  ? 0.9146 0.8912 0.7756 0.0366  0.2167  0.0363  58  ARG A CD    
438  N NE    . ARG A 72  ? 0.9775 0.9511 0.8375 0.0348  0.2228  0.0398  58  ARG A NE    
439  C CZ    . ARG A 72  ? 1.0329 0.9971 0.8771 0.0392  0.2332  0.0415  58  ARG A CZ    
440  N NH1   . ARG A 72  ? 1.0695 1.0279 0.9005 0.0434  0.2379  0.0372  58  ARG A NH1   
441  N NH2   . ARG A 72  ? 1.0110 0.9709 0.8523 0.0404  0.2408  0.0473  58  ARG A NH2   
442  N N     . LEU A 73  ? 0.8087 0.7800 0.6522 0.0250  0.1802  0.0195  59  LEU A N     
443  C CA    . LEU A 73  ? 0.7812 0.7515 0.6234 0.0287  0.1777  0.0186  59  LEU A CA    
444  C C     . LEU A 73  ? 0.7762 0.7293 0.6039 0.0289  0.1862  0.0127  59  LEU A C     
445  O O     . LEU A 73  ? 0.7542 0.7022 0.5730 0.0239  0.1859  0.0050  59  LEU A O     
446  C CB    . LEU A 73  ? 0.8025 0.7774 0.6463 0.0241  0.1656  0.0154  59  LEU A CB    
447  C CG    . LEU A 73  ? 0.8124 0.8010 0.6644 0.0294  0.1585  0.0173  59  LEU A CG    
448  C CD1   . LEU A 73  ? 0.8063 0.8165 0.6765 0.0344  0.1580  0.0208  59  LEU A CD1   
449  C CD2   . LEU A 73  ? 0.8009 0.7936 0.6550 0.0224  0.1472  0.0120  59  LEU A CD2   
450  N N     . ARG A 74  ? 0.7958 0.7410 0.6221 0.0356  0.1952  0.0151  60  ARG A N     
451  C CA    . ARG A 74  ? 0.8160 0.7428 0.6336 0.0338  0.2072  0.0065  60  ARG A CA    
452  C C     . ARG A 74  ? 0.8128 0.7340 0.6262 0.0281  0.2020  -0.0013 60  ARG A C     
453  O O     . ARG A 74  ? 0.7971 0.7237 0.6116 0.0299  0.1927  0.0037  60  ARG A O     
454  C CB    . ARG A 74  ? 0.8342 0.7489 0.6521 0.0439  0.2237  0.0130  60  ARG A CB    
455  C CG    . ARG A 74  ? 0.8445 0.7600 0.6653 0.0468  0.2331  0.0155  60  ARG A CG    
456  C CD    . ARG A 74  ? 0.8600 0.7642 0.6816 0.0594  0.2503  0.0245  60  ARG A CD    
457  N NE    . ARG A 74  ? 0.8622 0.7412 0.6785 0.0587  0.2678  0.0180  60  ARG A NE    
458  C CZ    . ARG A 74  ? 0.9151 0.7744 0.7314 0.0618  0.2904  0.0159  60  ARG A CZ    
459  N NH1   . ARG A 74  ? 0.9447 0.8067 0.7640 0.0671  0.2975  0.0208  60  ARG A NH1   
460  N NH2   . ARG A 74  ? 0.9250 0.7599 0.7402 0.0591  0.3085  0.0079  60  ARG A NH2   
461  N N     . MET A 75  ? 0.8217 0.7339 0.6314 0.0213  0.2084  -0.0154 61  MET A N     
462  C CA    . MET A 75  ? 0.8038 0.7137 0.6121 0.0144  0.2034  -0.0259 61  MET A CA    
463  C C     . MET A 75  ? 0.7979 0.6987 0.6062 0.0184  0.2050  -0.0190 61  MET A C     
464  O O     . MET A 75  ? 0.7765 0.6842 0.5838 0.0164  0.1920  -0.0178 61  MET A O     
465  C CB    . MET A 75  ? 0.8380 0.7409 0.6479 0.0074  0.2149  -0.0453 61  MET A CB    
466  C CG    . MET A 75  ? 0.8661 0.7815 0.6726 0.0054  0.2127  -0.0555 61  MET A CG    
467  S SD    . MET A 75  ? 0.8827 0.8188 0.6804 0.0077  0.1918  -0.0491 61  MET A SD    
468  C CE    . MET A 75  ? 0.8708 0.8154 0.6680 0.0017  0.1827  -0.0659 61  MET A CE    
469  N N     . THR A 76  ? 0.7984 0.6824 0.6062 0.0256  0.2225  -0.0139 62  THR A N     
470  C CA    . THR A 76  ? 0.8043 0.6773 0.6078 0.0326  0.2272  -0.0065 62  THR A CA    
471  C C     . THR A 76  ? 0.8076 0.6991 0.6083 0.0407  0.2098  0.0062  62  THR A C     
472  O O     . THR A 76  ? 0.8246 0.7174 0.6213 0.0417  0.2025  0.0073  62  THR A O     
473  C CB    . THR A 76  ? 0.8335 0.6828 0.6342 0.0435  0.2527  0.0006  62  THR A CB    
474  O OG1   . THR A 76  ? 0.8528 0.6852 0.6609 0.0330  0.2712  -0.0157 62  THR A OG1   
475  C CG2   . THR A 76  ? 0.8534 0.6897 0.6454 0.0539  0.2597  0.0100  62  THR A CG2   
476  N N     . GLU A 77  ? 0.7777 0.6850 0.5824 0.0459  0.2036  0.0137  63  GLU A N     
477  C CA    . GLU A 77  ? 0.7887 0.7190 0.5967 0.0516  0.1873  0.0208  63  GLU A CA    
478  C C     . GLU A 77  ? 0.7580 0.6980 0.5695 0.0395  0.1709  0.0130  63  GLU A C     
479  O O     . GLU A 77  ? 0.7694 0.7198 0.5808 0.0415  0.1603  0.0139  63  GLU A O     
480  C CB    . GLU A 77  ? 0.8114 0.7587 0.6290 0.0557  0.1850  0.0261  63  GLU A CB    
481  C CG    . GLU A 77  ? 0.8490 0.7948 0.6642 0.0727  0.1976  0.0371  63  GLU A CG    
482  C CD    . GLU A 77  ? 0.8875 0.8445 0.7136 0.0733  0.1999  0.0396  63  GLU A CD    
483  O OE1   . GLU A 77  ? 0.8770 0.8511 0.7149 0.0642  0.1884  0.0355  63  GLU A OE1   
484  O OE2   . GLU A 77  ? 0.9322 0.8779 0.7555 0.0827  0.2158  0.0458  63  GLU A OE2   
485  N N     . LEU A 78  ? 0.7460 0.6833 0.5595 0.0285  0.1697  0.0052  64  LEU A N     
486  C CA    . LEU A 78  ? 0.7326 0.6766 0.5478 0.0194  0.1572  -0.0005 64  LEU A CA    
487  C C     . LEU A 78  ? 0.7419 0.6770 0.5511 0.0171  0.1555  -0.0055 64  LEU A C     
488  O O     . LEU A 78  ? 0.7316 0.6739 0.5421 0.0158  0.1451  -0.0051 64  LEU A O     
489  C CB    . LEU A 78  ? 0.7322 0.6753 0.5458 0.0132  0.1584  -0.0064 64  LEU A CB    
490  C CG    . LEU A 78  ? 0.7311 0.6803 0.5443 0.0077  0.1484  -0.0090 64  LEU A CG    
491  C CD1   . LEU A 78  ? 0.7220 0.6811 0.5452 0.0069  0.1405  -0.0031 64  LEU A CD1   
492  C CD2   . LEU A 78  ? 0.7363 0.6875 0.5445 0.0080  0.1515  -0.0107 64  LEU A CD2   
493  N N     . ALA A 79  ? 0.7665 0.6858 0.5713 0.0164  0.1677  -0.0111 65  ALA A N     
494  C CA    . ALA A 79  ? 0.7726 0.6813 0.5739 0.0146  0.1701  -0.0158 65  ALA A CA    
495  C C     . ALA A 79  ? 0.7856 0.6948 0.5813 0.0245  0.1677  -0.0058 65  ALA A C     
496  O O     . ALA A 79  ? 0.7661 0.6766 0.5594 0.0222  0.1601  -0.0081 65  ALA A O     
497  C CB    . ALA A 79  ? 0.7963 0.6865 0.5984 0.0124  0.1890  -0.0241 65  ALA A CB    
498  N N     . LYS A 80  ? 0.8152 0.7263 0.6079 0.0372  0.1735  0.0049  66  LYS A N     
499  C CA    . LYS A 80  ? 0.8402 0.7569 0.6243 0.0517  0.1713  0.0144  66  LYS A CA    
500  C C     . LYS A 80  ? 0.8470 0.7887 0.6363 0.0490  0.1504  0.0118  66  LYS A C     
501  O O     . LYS A 80  ? 0.8334 0.7786 0.6152 0.0544  0.1450  0.0122  66  LYS A O     
502  C CB    . LYS A 80  ? 0.8444 0.7634 0.6239 0.0694  0.1810  0.0266  66  LYS A CB    
503  C CG    . LYS A 80  ? 0.8564 0.7868 0.6235 0.0896  0.1779  0.0365  66  LYS A CG    
504  C CD    . LYS A 80  ? 0.8475 0.7757 0.6060 0.1118  0.1922  0.0507  66  LYS A CD    
505  N N     . TYR A 81  ? 0.6969 0.8953 0.6113 0.1898  0.0619  0.0078  67  TYR A N     
506  C CA    . TYR A 81  ? 0.7106 0.9293 0.6208 0.1488  0.0561  0.0027  67  TYR A CA    
507  C C     . TYR A 81  ? 0.7063 0.8338 0.5877 0.1258  0.0679  0.0262  67  TYR A C     
508  O O     . TYR A 81  ? 0.7829 0.8726 0.6316 0.1212  0.0613  0.0291  67  TYR A O     
509  C CB    . TYR A 81  ? 0.7131 1.0242 0.6563 0.1019  0.0563  -0.0163 67  TYR A CB    
510  C CG    . TYR A 81  ? 0.7478 1.1836 0.7259 0.1179  0.0416  -0.0484 67  TYR A CG    
511  C CD1   . TYR A 81  ? 0.7837 1.2581 0.7559 0.1284  0.0194  -0.0635 67  TYR A CD1   
512  C CD2   . TYR A 81  ? 0.7444 1.2688 0.7618 0.1248  0.0486  -0.0673 67  TYR A CD2   
513  C CE1   . TYR A 81  ? 0.7929 1.4000 0.8048 0.1475  0.0023  -0.0974 67  TYR A CE1   
514  C CE2   . TYR A 81  ? 0.7649 1.4245 0.8212 0.1464  0.0349  -0.1024 67  TYR A CE2   
515  C CZ    . TYR A 81  ? 0.7766 1.4823 0.8338 0.1582  0.0108  -0.1179 67  TYR A CZ    
516  O OH    . TYR A 81  ? 0.7580 1.6136 0.8609 0.1843  -0.0058 -0.1565 67  TYR A OH    
517  N N     . ALA A 82  ? 0.6416 0.7367 0.5331 0.1155  0.0829  0.0400  68  ALA A N     
518  C CA    . ALA A 82  ? 0.6172 0.6402 0.4884 0.1008  0.0914  0.0579  68  ALA A CA    
519  C C     . ALA A 82  ? 0.6305 0.5972 0.4823 0.1347  0.1003  0.0730  68  ALA A C     
520  O O     . ALA A 82  ? 0.6294 0.5497 0.4611 0.1328  0.1050  0.0816  68  ALA A O     
521  C CB    . ALA A 82  ? 0.5846 0.6016 0.4755 0.0841  0.1005  0.0651  68  ALA A CB    
522  N N     . LYS A 83  ? 0.6392 0.6083 0.4904 0.1661  0.1026  0.0751  69  LYS A N     
523  C CA    . LYS A 83  ? 0.6679 0.5848 0.4914 0.1907  0.1147  0.0907  69  LYS A CA    
524  C C     . LYS A 83  ? 0.6675 0.5602 0.5083 0.1818  0.1337  0.1070  69  LYS A C     
525  O O     . LYS A 83  ? 0.7022 0.5676 0.5294 0.1872  0.1490  0.1184  69  LYS A O     
526  C CB    . LYS A 83  ? 0.6971 0.5870 0.4834 0.1972  0.1130  0.0905  69  LYS A CB    
527  C CG    . LYS A 83  ? 0.7117 0.6307 0.4827 0.1971  0.0897  0.0721  69  LYS A CG    
528  C CD    . LYS A 83  ? 0.7303 0.6678 0.4909 0.2288  0.0769  0.0649  69  LYS A CD    
529  C CE    . LYS A 83  ? 0.7376 0.7422 0.5081 0.2244  0.0505  0.0401  69  LYS A CE    
530  N NZ    . LYS A 83  ? 0.7617 0.7911 0.5225 0.2675  0.0318  0.0284  69  LYS A NZ    
531  N N     . ILE A 84  ? 0.6284 0.5393 0.4996 0.1684  0.1330  0.1060  70  ILE A N     
532  C CA    . ILE A 84  ? 0.6301 0.5272 0.5224 0.1567  0.1457  0.1186  70  ILE A CA    
533  C C     . ILE A 84  ? 0.6508 0.5336 0.5407 0.1615  0.1466  0.1228  70  ILE A C     
534  O O     . ILE A 84  ? 0.7155 0.5976 0.5852 0.1809  0.1358  0.1141  70  ILE A O     
535  C CB    . ILE A 84  ? 0.6186 0.5313 0.5351 0.1341  0.1394  0.1141  70  ILE A CB    
536  C CG1   . ILE A 84  ? 0.5891 0.5298 0.5175 0.1228  0.1302  0.1032  70  ILE A CG1   
537  C CG2   . ILE A 84  ? 0.6398 0.5430 0.5364 0.1294  0.1322  0.1085  70  ILE A CG2   
538  C CD1   . ILE A 84  ? 0.5924 0.5407 0.5252 0.0948  0.1233  0.0985  70  ILE A CD1   
539  N N     . THR A 85  ? 0.6210 0.4919 0.5279 0.1457  0.1556  0.1335  71  THR A N     
540  C CA    . THR A 85  ? 0.6424 0.4829 0.5347 0.1453  0.1530  0.1371  71  THR A CA    
541  C C     . THR A 85  ? 0.6140 0.4749 0.5249 0.1408  0.1408  0.1244  71  THR A C     
542  O O     . THR A 85  ? 0.5990 0.4924 0.5380 0.1259  0.1385  0.1191  71  THR A O     
543  C CB    . THR A 85  ? 0.6632 0.4803 0.5586 0.1218  0.1678  0.1542  71  THR A CB    
544  O OG1   . THR A 85  ? 0.6416 0.4956 0.5851 0.1024  0.1685  0.1534  71  THR A OG1   
545  C CG2   . THR A 85  ? 0.6941 0.5016 0.5686 0.1226  0.1862  0.1659  71  THR A CG2   
546  N N     . ARG A 86  ? 0.6809 0.5118 0.5648 0.1546  0.1323  0.1197  72  ARG A N     
547  C CA    . ARG A 86  ? 0.6774 0.5237 0.5705 0.1544  0.1229  0.1059  72  ARG A CA    
548  C C     . ARG A 86  ? 0.6444 0.4907 0.5650 0.1218  0.1261  0.1137  72  ARG A C     
549  O O     . ARG A 86  ? 0.6224 0.4958 0.5578 0.1131  0.1212  0.1034  72  ARG A O     
550  C CB    . ARG A 86  ? 0.7634 0.5543 0.6075 0.1806  0.1115  0.1004  72  ARG A CB    
551  C CG    . ARG A 86  ? 0.8041 0.5910 0.6125 0.2252  0.1001  0.0881  72  ARG A CG    
552  C CD    . ARG A 86  ? 0.9299 0.6414 0.6737 0.2588  0.0829  0.0809  72  ARG A CD    
553  N NE    . ARG A 86  ? 1.0365 0.6544 0.7120 0.2681  0.0789  0.0980  72  ARG A NE    
554  C CZ    . ARG A 86  ? 1.1801 0.6869 0.7792 0.2720  0.0681  0.1063  72  ARG A CZ    
555  N NH1   . ARG A 86  ? 1.2031 0.6767 0.7860 0.2716  0.0584  0.0976  72  ARG A NH1   
556  N NH2   . ARG A 86  ? 1.3039 0.7205 0.8300 0.2733  0.0661  0.1241  72  ARG A NH2   
557  N N     . SER A 87  ? 0.6638 0.4852 0.5894 0.1029  0.1342  0.1307  73  SER A N     
558  C CA    . SER A 87  ? 0.6385 0.4660 0.5929 0.0748  0.1333  0.1369  73  SER A CA    
559  C C     . SER A 87  ? 0.6492 0.5209 0.6375 0.0702  0.1319  0.1334  73  SER A C     
560  O O     . SER A 87  ? 0.6931 0.5725 0.6900 0.0601  0.1215  0.1275  73  SER A O     
561  C CB    . SER A 87  ? 0.6618 0.4766 0.6201 0.0547  0.1452  0.1530  73  SER A CB    
562  O OG    . SER A 87  ? 0.7283 0.5120 0.6782 0.0300  0.1384  0.1568  73  SER A OG    
563  N N     . ARG A 88  ? 0.6465 0.5351 0.6406 0.0792  0.1402  0.1365  74  ARG A N     
564  C CA    . ARG A 88  ? 0.6357 0.5444 0.6416 0.0797  0.1351  0.1324  74  ARG A CA    
565  C C     . ARG A 88  ? 0.6276 0.5398 0.6171 0.0747  0.1252  0.1208  74  ARG A C     
566  O O     . ARG A 88  ? 0.7041 0.6127 0.6904 0.0621  0.1153  0.1185  74  ARG A O     
567  C CB    . ARG A 88  ? 0.6437 0.5571 0.6418 0.0950  0.1443  0.1343  74  ARG A CB    
568  C CG    . ARG A 88  ? 0.6556 0.5687 0.6489 0.0992  0.1353  0.1293  74  ARG A CG    
569  C CD    . ARG A 88  ? 0.6749 0.5836 0.6488 0.1168  0.1432  0.1286  74  ARG A CD    
570  N NE    . ARG A 88  ? 0.6939 0.5877 0.6530 0.1279  0.1339  0.1237  74  ARG A NE    
571  C CZ    . ARG A 88  ? 0.7323 0.6170 0.6705 0.1482  0.1395  0.1212  74  ARG A CZ    
572  N NH1   . ARG A 88  ? 0.7538 0.6464 0.6856 0.1555  0.1555  0.1250  74  ARG A NH1   
573  N NH2   . ARG A 88  ? 0.7727 0.6296 0.6850 0.1641  0.1267  0.1142  74  ARG A NH2   
574  N N     . LEU A 89  ? 0.6038 0.5253 0.5784 0.0843  0.1270  0.1124  75  LEU A N     
575  C CA    . LEU A 89  ? 0.6088 0.5582 0.5747 0.0753  0.1221  0.0980  75  LEU A CA    
576  C C     . LEU A 89  ? 0.6079 0.5551 0.5723 0.0608  0.1177  0.0937  75  LEU A C     
577  O O     . LEU A 89  ? 0.6154 0.5733 0.5686 0.0384  0.1148  0.0885  75  LEU A O     
578  C CB    . LEU A 89  ? 0.5955 0.5750 0.5543 0.0967  0.1230  0.0847  75  LEU A CB    
579  C CG    . LEU A 89  ? 0.5759 0.6136 0.5359 0.0847  0.1216  0.0653  75  LEU A CG    
580  C CD1   . LEU A 89  ? 0.5805 0.6278 0.5328 0.0494  0.1206  0.0661  75  LEU A CD1   
581  C CD2   . LEU A 89  ? 0.5945 0.6768 0.5554 0.1158  0.1184  0.0485  75  LEU A CD2   
582  N N     . SER A 90  ? 0.5861 0.5105 0.5507 0.0699  0.1165  0.0959  76  SER A N     
583  C CA    . SER A 90  ? 0.5819 0.4963 0.5380 0.0587  0.1103  0.0907  76  SER A CA    
584  C C     . SER A 90  ? 0.5718 0.4725 0.5326 0.0356  0.1023  0.0992  76  SER A C     
585  O O     . SER A 90  ? 0.6084 0.5108 0.5502 0.0187  0.0982  0.0936  76  SER A O     
586  C CB    . SER A 90  ? 0.6185 0.4924 0.5644 0.0678  0.1059  0.0935  76  SER A CB    
587  O OG    . SER A 90  ? 0.6825 0.5498 0.6069 0.0970  0.1075  0.0845  76  SER A OG    
588  N N     . HIS A 91  ? 0.5513 0.4403 0.5326 0.0366  0.0997  0.1115  77  HIS A N     
589  C CA    . HIS A 91  ? 0.5492 0.4273 0.5342 0.0270  0.0862  0.1164  77  HIS A CA    
590  C C     . HIS A 91  ? 0.5492 0.4174 0.5030 0.0187  0.0818  0.1135  77  HIS A C     
591  O O     . HIS A 91  ? 0.5786 0.4207 0.5037 0.0042  0.0685  0.1131  77  HIS A O     
592  C CB    . HIS A 91  ? 0.5496 0.4397 0.5688 0.0369  0.0862  0.1248  77  HIS A CB    
593  C CG    . HIS A 91  ? 0.5612 0.4574 0.6051 0.0280  0.0862  0.1290  77  HIS A CG    
594  N ND1   . HIS A 91  ? 0.5848 0.4667 0.6247 0.0135  0.0708  0.1263  77  HIS A ND1   
595  C CD2   . HIS A 91  ? 0.5582 0.4675 0.6225 0.0250  0.0991  0.1360  77  HIS A CD2   
596  C CE1   . HIS A 91  ? 0.5966 0.4828 0.6558 0.0001  0.0723  0.1308  77  HIS A CE1   
597  N NE2   . HIS A 91  ? 0.5948 0.4973 0.6675 0.0040  0.0907  0.1376  77  HIS A NE2   
598  N N     . ALA A 92  ? 0.5139 0.3940 0.4629 0.0238  0.0911  0.1119  78  ALA A N     
599  C CA    . ALA A 92  ? 0.5564 0.4172 0.4662 0.0075  0.0855  0.1096  78  ALA A CA    
600  C C     . ALA A 92  ? 0.5843 0.4530 0.4633 -0.0237 0.0877  0.1018  78  ALA A C     
601  O O     . ALA A 92  ? 0.6603 0.4882 0.4908 -0.0494 0.0772  0.1041  78  ALA A O     
602  C CB    . ALA A 92  ? 0.5521 0.4282 0.4626 0.0159  0.0938  0.1072  78  ALA A CB    
603  N N     . VAL A 93  ? 0.5540 0.4713 0.4525 -0.0204 0.1008  0.0916  79  VAL A N     
604  C CA    . VAL A 93  ? 0.5803 0.5271 0.4558 -0.0470 0.1081  0.0797  79  VAL A CA    
605  C C     . VAL A 93  ? 0.6231 0.5345 0.4735 -0.0587 0.1004  0.0824  79  VAL A C     
606  O O     . VAL A 93  ? 0.6412 0.5533 0.4513 -0.0914 0.1043  0.0777  79  VAL A O     
607  C CB    . VAL A 93  ? 0.5516 0.5700 0.4542 -0.0280 0.1218  0.0621  79  VAL A CB    
608  C CG1   . VAL A 93  ? 0.5721 0.6409 0.4575 -0.0506 0.1331  0.0452  79  VAL A CG1   
609  C CG2   . VAL A 93  ? 0.5332 0.5874 0.4503 -0.0224 0.1249  0.0578  79  VAL A CG2   
610  N N     . ALA A 94  ? 0.6112 0.4922 0.4805 -0.0374 0.0892  0.0897  80  ALA A N     
611  C CA    . ALA A 94  ? 0.6341 0.4751 0.4761 -0.0483 0.0752  0.0926  80  ALA A CA    
612  C C     . ALA A 94  ? 0.6895 0.4774 0.4839 -0.0687 0.0592  0.1017  80  ALA A C     
613  O O     . ALA A 94  ? 0.7769 0.5308 0.5172 -0.0935 0.0528  0.1017  80  ALA A O     
614  C CB    . ALA A 94  ? 0.6122 0.4377 0.4874 -0.0277 0.0626  0.0981  80  ALA A CB    
615  N N     . ARG A 95  ? 0.7921 0.6032 0.6803 0.0058  -0.0767 0.1693  81  ARG A N     
616  C CA    . ARG A 95  ? 0.8179 0.5990 0.6283 0.0061  -0.0751 0.1471  81  ARG A CA    
617  C C     . ARG A 95  ? 0.8294 0.5914 0.5811 -0.0051 -0.0674 0.1233  81  ARG A C     
618  O O     . ARG A 95  ? 0.8247 0.5501 0.5434 -0.0058 -0.0665 0.1096  81  ARG A O     
619  C CB    . ARG A 95  ? 0.8205 0.6423 0.6267 0.0154  -0.0685 0.1655  81  ARG A CB    
620  C CG    . ARG A 95  ? 0.8618 0.6505 0.6241 0.0187  -0.0669 0.1424  81  ARG A CG    
621  C CD    . ARG A 95  ? 0.9045 0.6930 0.6345 0.0108  -0.0557 0.1097  81  ARG A CD    
622  N NE    . ARG A 95  ? 0.9239 0.7203 0.6559 0.0176  -0.0500 0.0860  81  ARG A NE    
623  C CZ    . ARG A 95  ? 0.9410 0.7263 0.6846 0.0113  -0.0399 0.0449  81  ARG A CZ    
624  N NH1   . ARG A 95  ? 0.9463 0.7097 0.6920 -0.0027 -0.0337 0.0306  81  ARG A NH1   
625  N NH2   . ARG A 95  ? 0.9529 0.7491 0.7248 0.0191  -0.0353 0.0144  81  ARG A NH2   
626  N N     . LEU A 96  ? 0.8137 0.6120 0.5660 -0.0119 -0.0601 0.1264  82  LEU A N     
627  C CA    . LEU A 96  ? 0.8224 0.6074 0.5371 -0.0243 -0.0521 0.1018  82  LEU A CA    
628  C C     . LEU A 96  ? 0.8534 0.6052 0.5599 -0.0302 -0.0568 0.0953  82  LEU A C     
629  O O     . LEU A 96  ? 0.8918 0.6193 0.5710 -0.0365 -0.0503 0.0855  82  LEU A O     
630  C CB    . LEU A 96  ? 0.7907 0.6464 0.5104 -0.0272 -0.0446 0.1021  82  LEU A CB    
631  C CG    . LEU A 96  ? 0.7776 0.7154 0.5016 -0.0164 -0.0394 0.0971  82  LEU A CG    
632  C CD1   . LEU A 96  ? 0.7568 0.8090 0.4899 -0.0119 -0.0333 0.1080  82  LEU A CD1   
633  C CD2   . LEU A 96  ? 0.8005 0.7156 0.5131 -0.0211 -0.0342 0.0446  82  LEU A CD2   
634  N N     . GLU A 97  ? 0.8495 0.6135 0.5982 -0.0263 -0.0667 0.1006  83  GLU A N     
635  C CA    . GLU A 97  ? 0.8516 0.6115 0.6041 -0.0268 -0.0746 0.0789  83  GLU A CA    
636  C C     . GLU A 97  ? 0.8641 0.6188 0.5873 -0.0170 -0.0801 0.0681  83  GLU A C     
637  O O     . GLU A 97  ? 0.8918 0.6614 0.5809 -0.0155 -0.0778 0.0628  83  GLU A O     
638  C CB    . GLU A 97  ? 0.8444 0.6255 0.6884 -0.0226 -0.0848 0.0723  83  GLU A CB    
639  C CG    . GLU A 97  ? 0.8612 0.6613 0.7279 -0.0219 -0.0941 0.0312  83  GLU A CG    
640  C CD    . GLU A 97  ? 0.8498 0.6673 0.8465 -0.0201 -0.1004 0.0197  83  GLU A CD    
641  O OE1   . GLU A 97  ? 0.8409 0.6586 0.9293 -0.0138 -0.1050 0.0276  83  GLU A OE1   
642  O OE2   . GLU A 97  ? 0.8673 0.6988 0.8921 -0.0246 -0.0995 0.0048  83  GLU A OE2   
643  N N     . LYS A 98  ? 0.8543 0.6042 0.5942 -0.0074 -0.0859 0.0729  84  LYS A N     
644  C CA    . LYS A 98  ? 0.8790 0.6409 0.5929 0.0060  -0.0901 0.0707  84  LYS A CA    
645  C C     . LYS A 98  ? 0.8978 0.6444 0.5645 0.0047  -0.0737 0.0980  84  LYS A C     
646  O O     . LYS A 98  ? 0.9351 0.7220 0.5826 0.0145  -0.0721 0.1075  84  LYS A O     
647  C CB    . LYS A 98  ? 0.8882 0.6430 0.6281 0.0152  -0.0969 0.0752  84  LYS A CB    
648  C CG    . LYS A 98  ? 0.8847 0.6730 0.7009 0.0219  -0.1150 0.0410  84  LYS A CG    
649  C CD    . LYS A 98  ? 0.9061 0.6952 0.7510 0.0322  -0.1224 0.0432  84  LYS A CD    
650  C CE    . LYS A 98  ? 0.9074 0.7299 0.8668 0.0368  -0.1396 0.0004  84  LYS A CE    
651  N NZ    . LYS A 98  ? 0.8882 0.6978 0.9435 0.0260  -0.1361 0.0087  84  LYS A NZ    
652  N N     . ASN A 99  ? 0.9031 0.6093 0.5690 -0.0055 -0.0603 0.1098  85  ASN A N     
653  C CA    . ASN A 99  ? 0.9528 0.6398 0.6187 -0.0083 -0.0424 0.1308  85  ASN A CA    
654  C C     . ASN A 99  ? 0.9446 0.6349 0.6088 -0.0212 -0.0324 0.1311  85  ASN A C     
655  O O     . ASN A 99  ? 0.9829 0.6571 0.6757 -0.0254 -0.0148 0.1520  85  ASN A O     
656  C CB    . ASN A 99  ? 0.9853 0.6371 0.6818 -0.0105 -0.0313 0.1287  85  ASN A CB    
657  C CG    . ASN A 99  ? 0.9780 0.6400 0.6773 -0.0167 -0.0361 0.0979  85  ASN A CG    
658  O OD1   . ASN A 99  ? 0.9867 0.6544 0.6921 -0.0080 -0.0407 0.0958  85  ASN A OD1   
659  N ND2   . ASN A 99  ? 0.9900 0.6725 0.6864 -0.0286 -0.0340 0.0796  85  ASN A ND2   
660  N N     . GLY A 100 ? 0.9229 0.6346 0.5720 -0.0269 -0.0421 0.1109  86  GLY A N     
661  C CA    . GLY A 100 ? 0.9270 0.6528 0.5681 -0.0358 -0.0350 0.1127  86  GLY A CA    
662  C C     . GLY A 100 ? 0.9331 0.6388 0.5869 -0.0549 -0.0246 0.0968  86  GLY A C     
663  O O     . GLY A 100 ? 0.9478 0.6616 0.6004 -0.0638 -0.0172 0.0993  86  GLY A O     
664  N N     . TRP A 101 ? 0.9325 0.6323 0.6001 -0.0591 -0.0245 0.0770  87  TRP A N     
665  C CA    . TRP A 101 ? 0.9267 0.6428 0.6102 -0.0731 -0.0162 0.0490  87  TRP A CA    
666  C C     . TRP A 101 ? 0.8739 0.6336 0.5399 -0.0754 -0.0238 0.0459  87  TRP A C     
667  O O     . TRP A 101 ? 0.8680 0.6624 0.5390 -0.0850 -0.0180 0.0259  87  TRP A O     
668  C CB    . TRP A 101 ? 0.9542 0.6869 0.6672 -0.0713 -0.0124 0.0190  87  TRP A CB    
669  C CG    . TRP A 101 ? 1.0143 0.7117 0.7635 -0.0652 -0.0065 0.0186  87  TRP A CG    
670  C CD1   . TRP A 101 ? 1.0257 0.7382 0.7744 -0.0533 -0.0125 0.0121  87  TRP A CD1   
671  C CD2   . TRP A 101 ? 1.0668 0.7176 0.8761 -0.0686 0.0090  0.0300  87  TRP A CD2   
672  N NE1   . TRP A 101 ? 1.0572 0.7297 0.8533 -0.0493 -0.0038 0.0123  87  TRP A NE1   
673  C CE2   . TRP A 101 ? 1.0851 0.7193 0.9287 -0.0580 0.0108  0.0275  87  TRP A CE2   
674  C CE3   . TRP A 101 ? 1.1079 0.7356 0.9596 -0.0777 0.0239  0.0530  87  TRP A CE3   
675  C CZ2   . TRP A 101 ? 1.1498 0.7420 1.0788 -0.0558 0.0278  0.0487  87  TRP A CZ2   
676  C CZ3   . TRP A 101 ? 1.1674 0.7593 1.1110 -0.0748 0.0426  0.0832  87  TRP A CZ3   
677  C CH2   . TRP A 101 ? 1.1837 0.7563 1.1702 -0.0638 0.0448  0.0812  87  TRP A CH2   
678  N N     . VAL A 102 ? 0.8379 0.6034 0.5023 -0.0656 -0.0358 0.0642  88  VAL A N     
679  C CA    . VAL A 102 ? 0.8168 0.6218 0.5014 -0.0648 -0.0404 0.0736  88  VAL A CA    
680  C C     . VAL A 102 ? 0.8067 0.5998 0.5146 -0.0592 -0.0517 0.0731  88  VAL A C     
681  O O     . VAL A 102 ? 0.8274 0.6040 0.5339 -0.0510 -0.0595 0.0656  88  VAL A O     
682  C CB    . VAL A 102 ? 0.8052 0.6605 0.5214 -0.0540 -0.0410 0.0960  88  VAL A CB    
683  C CG1   . VAL A 102 ? 0.7835 0.6784 0.5610 -0.0475 -0.0432 0.1300  88  VAL A CG1   
684  C CG2   . VAL A 102 ? 0.8233 0.7408 0.5234 -0.0557 -0.0315 0.0799  88  VAL A CG2   
685  N N     . ARG A 103 ? 0.7892 0.6051 0.5279 -0.0619 -0.0528 0.0737  89  ARG A N     
686  C CA    . ARG A 103 ? 0.7786 0.5995 0.5748 -0.0550 -0.0648 0.0554  89  ARG A CA    
687  C C     . ARG A 103 ? 0.7636 0.6125 0.6496 -0.0532 -0.0625 0.0791  89  ARG A C     
688  O O     . ARG A 103 ? 0.7559 0.6362 0.6325 -0.0563 -0.0511 0.1129  89  ARG A O     
689  C CB    . ARG A 103 ? 0.7814 0.6102 0.5387 -0.0578 -0.0669 0.0257  89  ARG A CB    
690  C CG    . ARG A 103 ? 0.7749 0.6124 0.5086 -0.0703 -0.0566 0.0327  89  ARG A CG    
691  C CD    . ARG A 103 ? 0.7827 0.6386 0.4796 -0.0711 -0.0570 0.0120  89  ARG A CD    
692  N NE    . ARG A 103 ? 0.7704 0.6334 0.4524 -0.0839 -0.0474 0.0177  89  ARG A NE    
693  C CZ    . ARG A 103 ? 0.7499 0.6360 0.4739 -0.0840 -0.0505 0.0062  89  ARG A CZ    
694  N NH1   . ARG A 103 ? 0.7299 0.6321 0.5358 -0.0727 -0.0625 -0.0170 89  ARG A NH1   
695  N NH2   . ARG A 103 ? 0.7537 0.6496 0.4558 -0.0956 -0.0409 0.0140  89  ARG A NH2   
696  N N     . ARG A 104 ? 0.6955 0.6858 0.5760 0.0122  0.0524  -0.0518 90  ARG A N     
697  C CA    . ARG A 104 ? 0.7165 0.7066 0.6150 0.0055  0.0495  -0.0534 90  ARG A CA    
698  C C     . ARG A 104 ? 0.7336 0.7326 0.6379 0.0159  0.0517  -0.0509 90  ARG A C     
699  O O     . ARG A 104 ? 0.7228 0.7282 0.6175 0.0325  0.0531  -0.0561 90  ARG A O     
700  C CB    . ARG A 104 ? 0.7387 0.7250 0.6485 0.0062  0.0449  -0.0710 90  ARG A CB    
701  C CG    . ARG A 104 ? 0.7760 0.7514 0.6860 -0.0060 0.0445  -0.0714 90  ARG A CG    
702  C CD    . ARG A 104 ? 0.7869 0.7631 0.7027 0.0004  0.0406  -0.0905 90  ARG A CD    
703  N NE    . ARG A 104 ? 0.7772 0.7431 0.7100 -0.0099 0.0423  -0.0944 90  ARG A NE    
704  C CZ    . ARG A 104 ? 0.7951 0.7617 0.7430 -0.0074 0.0398  -0.1111 90  ARG A CZ    
705  N NH1   . ARG A 104 ? 0.8121 0.7913 0.7573 0.0062  0.0325  -0.1274 90  ARG A NH1   
706  N NH2   . ARG A 104 ? 0.7909 0.7463 0.7571 -0.0168 0.0450  -0.1114 90  ARG A NH2   
707  N N     . GLU A 105 ? 0.7519 0.7514 0.6703 0.0083  0.0523  -0.0428 91  GLU A N     
708  C CA    . GLU A 105 ? 0.7867 0.7932 0.7141 0.0174  0.0548  -0.0409 91  GLU A CA    
709  C C     . GLU A 105 ? 0.8052 0.8069 0.7509 0.0121  0.0543  -0.0435 91  GLU A C     
710  O O     . GLU A 105 ? 0.9020 0.8962 0.8518 0.0008  0.0535  -0.0402 91  GLU A O     
711  C CB    . GLU A 105 ? 0.7922 0.8068 0.7210 0.0158  0.0596  -0.0225 91  GLU A CB    
712  C CG    . GLU A 105 ? 0.8180 0.8380 0.7352 0.0296  0.0663  -0.0183 91  GLU A CG    
713  C CD    . GLU A 105 ? 0.8554 0.8839 0.7834 0.0275  0.0733  0.0000  91  GLU A CD    
714  O OE1   . GLU A 105 ? 0.8286 0.8615 0.7726 0.0155  0.0701  0.0077  91  GLU A OE1   
715  O OE2   . GLU A 105 ? 0.9296 0.9612 0.8510 0.0396  0.0829  0.0071  91  GLU A OE2   
716  N N     . ASP A 106 ? 0.8054 0.8103 0.7611 0.0219  0.0568  -0.0478 92  ASP A N     
717  C CA    . ASP A 106 ? 0.8114 0.8105 0.7869 0.0191  0.0601  -0.0480 92  ASP A CA    
718  C C     . ASP A 106 ? 0.7822 0.7868 0.7607 0.0146  0.0630  -0.0269 92  ASP A C     
719  O O     . ASP A 106 ? 0.7749 0.7900 0.7470 0.0168  0.0630  -0.0163 92  ASP A O     
720  C CB    . ASP A 106 ? 0.8374 0.8367 0.8244 0.0320  0.0620  -0.0631 92  ASP A CB    
721  C CG    . ASP A 106 ? 0.8430 0.8441 0.8235 0.0416  0.0556  -0.0861 92  ASP A CG    
722  O OD1   . ASP A 106 ? 0.8643 0.8688 0.8261 0.0419  0.0517  -0.0855 92  ASP A OD1   
723  O OD2   . ASP A 106 ? 0.8861 0.8859 0.8805 0.0499  0.0543  -0.1057 92  ASP A OD2   
724  N N     . CYS A 107 ? 0.7609 0.7590 0.7504 0.0097  0.0662  -0.0206 93  CYS A N     
725  C CA    . CYS A 107 ? 0.7544 0.7602 0.7478 0.0095  0.0680  -0.0023 93  CYS A CA    
726  C C     . CYS A 107 ? 0.7626 0.7716 0.7687 0.0209  0.0744  -0.0029 93  CYS A C     
727  O O     . CYS A 107 ? 0.7511 0.7500 0.7689 0.0259  0.0793  -0.0161 93  CYS A O     
728  C CB    . CYS A 107 ? 0.7428 0.7401 0.7388 0.0054  0.0709  0.0060  93  CYS A CB    
729  S SG    . CYS A 107 ? 0.7138 0.7246 0.7109 0.0090  0.0704  0.0277  93  CYS A SG    
730  N N     . PRO A 108 ? 0.7658 0.7889 0.7722 0.0250  0.0745  0.0099  94  PRO A N     
731  C CA    . PRO A 108 ? 0.7747 0.8000 0.7907 0.0371  0.0815  0.0094  94  PRO A CA    
732  C C     . PRO A 108 ? 0.7782 0.7976 0.8102 0.0410  0.0895  0.0164  94  PRO A C     
733  O O     . PRO A 108 ? 0.7664 0.7778 0.8093 0.0495  0.0968  0.0072  94  PRO A O     
734  C CB    . PRO A 108 ? 0.7649 0.8073 0.7787 0.0400  0.0809  0.0231  94  PRO A CB    
735  C CG    . PRO A 108 ? 0.7550 0.8059 0.7664 0.0276  0.0734  0.0333  94  PRO A CG    
736  C CD    . PRO A 108 ? 0.7642 0.8019 0.7668 0.0187  0.0690  0.0245  94  PRO A CD    
737  N N     . SER A 109 ? 0.7661 0.7892 0.7987 0.0365  0.0886  0.0317  95  SER A N     
738  C CA    . SER A 109 ? 0.7645 0.7819 0.8092 0.0431  0.0984  0.0421  95  SER A CA    
739  C C     . SER A 109 ? 0.7692 0.7645 0.8230 0.0419  0.1073  0.0323  95  SER A C     
740  O O     . SER A 109 ? 0.8127 0.7969 0.8837 0.0493  0.1204  0.0339  95  SER A O     
741  C CB    . SER A 109 ? 0.7540 0.7846 0.7922 0.0425  0.0933  0.0614  95  SER A CB    
742  N N     . ASP A 110 ? 0.7694 0.7578 0.8150 0.0328  0.1019  0.0227  96  ASP A N     
743  C CA    . ASP A 110 ? 0.7727 0.7410 0.8312 0.0306  0.1111  0.0139  96  ASP A CA    
744  C C     . ASP A 110 ? 0.7780 0.7419 0.8393 0.0251  0.1050  -0.0105 96  ASP A C     
745  O O     . ASP A 110 ? 0.7472 0.7142 0.7925 0.0178  0.0956  -0.0139 96  ASP A O     
746  C CB    . ASP A 110 ? 0.7849 0.7494 0.8300 0.0270  0.1112  0.0275  96  ASP A CB    
747  C CG    . ASP A 110 ? 0.8157 0.7580 0.8776 0.0283  0.1271  0.0265  96  ASP A CG    
748  O OD1   . ASP A 110 ? 0.8330 0.7639 0.9189 0.0260  0.1331  0.0078  96  ASP A OD1   
749  O OD2   . ASP A 110 ? 0.8237 0.7604 0.8761 0.0326  0.1340  0.0436  96  ASP A OD2   
750  N N     . LYS A 111 ? 0.8069 0.7643 0.8887 0.0300  0.1096  -0.0286 97  LYS A N     
751  C CA    . LYS A 111 ? 0.8136 0.7721 0.8972 0.0292  0.1009  -0.0546 97  LYS A CA    
752  C C     . LYS A 111 ? 0.8178 0.7654 0.9124 0.0205  0.1014  -0.0656 97  LYS A C     
753  O O     . LYS A 111 ? 0.8223 0.7688 0.9302 0.0205  0.0966  -0.0901 97  LYS A O     
754  C CB    . LYS A 111 ? 0.8309 0.7867 0.9346 0.0387  0.1042  -0.0740 97  LYS A CB    
755  C CG    . LYS A 111 ? 0.8412 0.8072 0.9328 0.0492  0.1044  -0.0644 97  LYS A CG    
756  C CD    . LYS A 111 ? 0.8503 0.8098 0.9632 0.0595  0.1102  -0.0830 97  LYS A CD    
757  N N     . ARG A 112 ? 0.8061 0.7477 0.8934 0.0145  0.1064  -0.0473 98  ARG A N     
758  C CA    . ARG A 112 ? 0.8103 0.7388 0.9092 0.0078  0.1121  -0.0510 98  ARG A CA    
759  C C     . ARG A 112 ? 0.8006 0.7348 0.8685 0.0011  0.1017  -0.0434 98  ARG A C     
760  O O     . ARG A 112 ? 0.7853 0.7148 0.8554 -0.0046 0.0994  -0.0538 98  ARG A O     
761  C CB    . ARG A 112 ? 0.8356 0.7498 0.9476 0.0109  0.1304  -0.0318 98  ARG A CB    
762  C CG    . ARG A 112 ? 0.8513 0.7464 0.9873 0.0075  0.1452  -0.0336 98  ARG A CG    
763  C CD    . ARG A 112 ? 0.8699 0.7487 1.0385 0.0145  0.1680  -0.0257 98  ARG A CD    
764  N NE    . ARG A 112 ? 0.8922 0.7583 1.0521 0.0214  0.1853  0.0023  98  ARG A NE    
765  C CZ    . ARG A 112 ? 0.8976 0.7715 1.0252 0.0298  0.1833  0.0264  98  ARG A CZ    
766  N NH1   . ARG A 112 ? 0.8921 0.7869 0.9955 0.0298  0.1650  0.0273  98  ARG A NH1   
767  N NH2   . ARG A 112 ? 0.9029 0.7645 1.0231 0.0399  0.2003  0.0499  98  ARG A NH2   
768  N N     . GLY A 113 ? 0.7914 0.7361 0.8337 0.0018  0.0959  -0.0256 99  GLY A N     
769  C CA    . GLY A 113 ? 0.7760 0.7264 0.7910 -0.0046 0.0861  -0.0187 99  GLY A CA    
770  C C     . GLY A 113 ? 0.7598 0.7197 0.7633 -0.0070 0.0748  -0.0317 99  GLY A C     
771  O O     . GLY A 113 ? 0.7312 0.6982 0.7404 -0.0010 0.0723  -0.0424 99  GLY A O     
772  N N     . GLN A 114 ? 0.7581 0.7175 0.7433 -0.0140 0.0690  -0.0299 100 GLN A N     
773  C CA    . GLN A 114 ? 0.7418 0.7089 0.7130 -0.0150 0.0608  -0.0380 100 GLN A CA    
774  C C     . GLN A 114 ? 0.7402 0.7114 0.6907 -0.0220 0.0555  -0.0257 100 GLN A C     
775  O O     . GLN A 114 ? 0.7417 0.7062 0.6849 -0.0273 0.0559  -0.0177 100 GLN A O     
776  C CB    . GLN A 114 ? 0.7511 0.7108 0.7282 -0.0161 0.0604  -0.0545 100 GLN A CB    
777  C CG    . GLN A 114 ? 0.7694 0.7380 0.7374 -0.0101 0.0536  -0.0677 100 GLN A CG    
778  C CD    . GLN A 114 ? 0.7729 0.7448 0.7590 -0.0007 0.0519  -0.0890 100 GLN A CD    
779  O OE1   . GLN A 114 ? 0.8005 0.7823 0.7813 0.0103  0.0484  -0.0957 100 GLN A OE1   
780  N NE2   . GLN A 114 ? 0.7761 0.7402 0.7843 -0.0042 0.0543  -0.1013 100 GLN A NE2   
781  N N     . PHE A 115 ? 0.7365 0.7184 0.6788 -0.0207 0.0515  -0.0242 101 PHE A N     
782  C CA    . PHE A 115 ? 0.7474 0.7332 0.6771 -0.0284 0.0472  -0.0158 101 PHE A CA    
783  C C     . PHE A 115 ? 0.7291 0.7089 0.6466 -0.0307 0.0467  -0.0235 101 PHE A C     
784  O O     . PHE A 115 ? 0.6982 0.6788 0.6152 -0.0226 0.0482  -0.0332 101 PHE A O     
785  C CB    . PHE A 115 ? 0.7706 0.7711 0.7053 -0.0260 0.0468  -0.0071 101 PHE A CB    
786  C CG    . PHE A 115 ? 0.7931 0.8027 0.7373 -0.0266 0.0448  0.0038  101 PHE A CG    
787  C CD1   . PHE A 115 ? 0.8201 0.8328 0.7601 -0.0343 0.0381  0.0099  101 PHE A CD1   
788  C CD2   . PHE A 115 ? 0.8018 0.8181 0.7584 -0.0177 0.0487  0.0073  101 PHE A CD2   
789  C CE1   . PHE A 115 ? 0.8514 0.8761 0.7991 -0.0320 0.0345  0.0194  101 PHE A CE1   
790  C CE2   . PHE A 115 ? 0.8318 0.8581 0.7971 -0.0164 0.0471  0.0186  101 PHE A CE2   
791  C CZ    . PHE A 115 ? 0.8532 0.8850 0.8141 -0.0230 0.0395  0.0247  101 PHE A CZ    
792  N N     . ALA A 116 ? 0.7337 0.7080 0.6404 -0.0400 0.0442  -0.0200 102 ALA A N     
793  C CA    . ALA A 116 ? 0.7377 0.7064 0.6323 -0.0426 0.0451  -0.0240 102 ALA A CA    
794  C C     . ALA A 116 ? 0.7190 0.6950 0.6141 -0.0472 0.0451  -0.0160 102 ALA A C     
795  O O     . ALA A 116 ? 0.7030 0.6823 0.6014 -0.0553 0.0404  -0.0108 102 ALA A O     
796  C CB    . ALA A 116 ? 0.7483 0.7035 0.6327 -0.0499 0.0442  -0.0263 102 ALA A CB    
797  N N     . ILE A 117 ? 0.7257 0.7049 0.6195 -0.0403 0.0510  -0.0155 103 ILE A N     
798  C CA    . ILE A 117 ? 0.7430 0.7282 0.6444 -0.0432 0.0555  -0.0069 103 ILE A CA    
799  C C     . ILE A 117 ? 0.7559 0.7311 0.6467 -0.0438 0.0624  -0.0074 103 ILE A C     
800  O O     . ILE A 117 ? 0.7596 0.7301 0.6367 -0.0331 0.0661  -0.0123 103 ILE A O     
801  C CB    . ILE A 117 ? 0.7645 0.7605 0.6741 -0.0303 0.0622  -0.0013 103 ILE A CB    
802  C CG1   . ILE A 117 ? 0.7460 0.7505 0.6657 -0.0276 0.0571  -0.0010 103 ILE A CG1   
803  C CG2   . ILE A 117 ? 0.7792 0.7808 0.7034 -0.0336 0.0702  0.0094  103 ILE A CG2   
804  C CD1   . ILE A 117 ? 0.7321 0.7443 0.6547 -0.0120 0.0632  0.0009  103 ILE A CD1   
805  N N     . LEU A 118 ? 0.7507 0.7233 0.6493 -0.0557 0.0636  -0.0036 104 LEU A N     
806  C CA    . LEU A 118 ? 0.7631 0.7245 0.6556 -0.0572 0.0729  -0.0025 104 LEU A CA    
807  C C     . LEU A 118 ? 0.7584 0.7232 0.6574 -0.0452 0.0882  0.0072  104 LEU A C     
808  O O     . LEU A 118 ? 0.7803 0.7546 0.7011 -0.0472 0.0923  0.0146  104 LEU A O     
809  C CB    . LEU A 118 ? 0.7824 0.7397 0.6860 -0.0746 0.0690  -0.0041 104 LEU A CB    
810  C CG    . LEU A 118 ? 0.7918 0.7354 0.6961 -0.0798 0.0800  -0.0033 104 LEU A CG    
811  C CD1   . LEU A 118 ? 0.7913 0.7202 0.6690 -0.0743 0.0825  -0.0075 104 LEU A CD1   
812  C CD2   . LEU A 118 ? 0.7983 0.7412 0.7185 -0.0976 0.0722  -0.0094 104 LEU A CD2   
813  N N     . THR A 119 ? 0.7428 0.7008 0.6234 -0.0308 0.0974  0.0078  105 THR A N     
814  C CA    . THR A 119 ? 0.7506 0.7096 0.6312 -0.0144 0.1150  0.0193  105 THR A CA    
815  C C     . THR A 119 ? 0.7808 0.7312 0.6799 -0.0237 0.1297  0.0288  105 THR A C     
816  O O     . THR A 119 ? 0.7981 0.7406 0.7047 -0.0415 0.1247  0.0234  105 THR A O     
817  C CB    . THR A 119 ? 0.7393 0.6938 0.5915 0.0063  0.1202  0.0169  105 THR A CB    
818  O OG1   . THR A 119 ? 0.7112 0.6524 0.5542 -0.0016 0.1209  0.0133  105 THR A OG1   
819  C CG2   . THR A 119 ? 0.7262 0.6902 0.5658 0.0164  0.1060  0.0040  105 THR A CG2   
820  N N     . ASP A 120 ? 0.8304 0.7814 0.7380 -0.0104 0.1493  0.0428  106 ASP A N     
821  C CA    . ASP A 120 ? 0.8549 0.7946 0.7836 -0.0165 0.1689  0.0529  106 ASP A CA    
822  C C     . ASP A 120 ? 0.8611 0.7834 0.7713 -0.0175 0.1737  0.0497  106 ASP A C     
823  O O     . ASP A 120 ? 0.9139 0.8262 0.8411 -0.0365 0.1743  0.0457  106 ASP A O     
824  C CB    . ASP A 120 ? 0.8765 0.8164 0.8113 0.0047  0.1946  0.0716  106 ASP A CB    
825  C CG    . ASP A 120 ? 0.8837 0.8385 0.8487 0.0022  0.1959  0.0781  106 ASP A CG    
826  O OD1   . ASP A 120 ? 0.8612 0.8249 0.8538 -0.0205 0.1807  0.0699  106 ASP A OD1   
827  O OD2   . ASP A 120 ? 0.8880 0.8459 0.8479 0.0250  0.2129  0.0921  106 ASP A OD2   
828  N N     . GLU A 121 ? 0.8503 0.7701 0.7262 0.0035  0.1759  0.0498  107 GLU A N     
829  C CA    . GLU A 121 ? 0.8393 0.7441 0.6963 0.0060  0.1815  0.0483  107 GLU A CA    
830  C C     . GLU A 121 ? 0.8400 0.7388 0.6975 -0.0172 0.1634  0.0333  107 GLU A C     
831  O O     . GLU A 121 ? 0.8702 0.7531 0.7272 -0.0255 0.1704  0.0329  107 GLU A O     
832  C CB    . GLU A 121 ? 0.8606 0.7702 0.6815 0.0338  0.1807  0.0471  107 GLU A CB    
833  C CG    . GLU A 121 ? 0.9024 0.7988 0.7038 0.0504  0.1989  0.0558  107 GLU A CG    
834  C CD    . GLU A 121 ? 0.9471 0.8311 0.7640 0.0572  0.2294  0.0763  107 GLU A CD    
835  O OE1   . GLU A 121 ? 0.9764 0.8500 0.8250 0.0334  0.2355  0.0778  107 GLU A OE1   
836  O OE2   . GLU A 121 ? 1.0014 0.8858 0.8003 0.0872  0.2482  0.0906  107 GLU A OE2   
837  N N     . GLY A 122 ? 0.8232 0.7333 0.6810 -0.0263 0.1419  0.0220  108 GLY A N     
838  C CA    . GLY A 122 ? 0.7974 0.7023 0.6539 -0.0454 0.1258  0.0097  108 GLY A CA    
839  C C     . GLY A 122 ? 0.8004 0.6989 0.6817 -0.0659 0.1273  0.0089  108 GLY A C     
840  O O     . GLY A 122 ? 0.8229 0.7075 0.6999 -0.0771 0.1260  0.0027  108 GLY A O     
841  N N     . TYR A 123 ? 0.7817 0.6911 0.6908 -0.0704 0.1296  0.0138  109 TYR A N     
842  C CA    . TYR A 123 ? 0.8085 0.7154 0.7497 -0.0889 0.1312  0.0110  109 TYR A CA    
843  C C     . TYR A 123 ? 0.8261 0.7136 0.7748 -0.0905 0.1518  0.0156  109 TYR A C     
844  O O     . TYR A 123 ? 0.8520 0.7308 0.8179 -0.1079 0.1495  0.0065  109 TYR A O     
845  C CB    . TYR A 123 ? 0.8258 0.7494 0.8010 -0.0900 0.1346  0.0178  109 TYR A CB    
846  C CG    . TYR A 123 ? 0.8683 0.7972 0.8821 -0.1110 0.1278  0.0093  109 TYR A CG    
847  C CD1   . TYR A 123 ? 0.8865 0.8275 0.9007 -0.1227 0.1027  -0.0042 109 TYR A CD1   
848  C CD2   . TYR A 123 ? 0.9084 0.8314 0.9607 -0.1177 0.1467  0.0140  109 TYR A CD2   
849  C CE1   . TYR A 123 ? 0.9177 0.8674 0.9669 -0.1399 0.0930  -0.0154 109 TYR A CE1   
850  C CE2   . TYR A 123 ? 0.9447 0.8755 1.0392 -0.1377 0.1384  0.0021  109 TYR A CE2   
851  C CZ    . TYR A 123 ? 0.9540 0.8996 1.0455 -0.1483 0.1096  -0.0139 109 TYR A CZ    
852  O OH    . TYR A 123 ? 1.0093 0.9661 1.1420 -0.1659 0.0983  -0.0286 109 TYR A OH    
853  N N     . GLU A 124 ? 0.8166 0.6971 0.7527 -0.0709 0.1726  0.0294  110 GLU A N     
854  C CA    . GLU A 124 ? 0.8245 0.6847 0.7665 -0.0689 0.1963  0.0370  110 GLU A CA    
855  C C     . GLU A 124 ? 0.8198 0.6637 0.7364 -0.0736 0.1911  0.0279  110 GLU A C     
856  O O     . GLU A 124 ? 0.8147 0.6402 0.7435 -0.0819 0.2047  0.0278  110 GLU A O     
857  C CB    . GLU A 124 ? 0.8389 0.6964 0.7709 -0.0418 0.2220  0.0568  110 GLU A CB    
858  C CG    . GLU A 124 ? 0.8458 0.7026 0.8191 -0.0418 0.2457  0.0709  110 GLU A CG    
859  N N     . VAL A 125 ? 0.8133 0.6630 0.6980 -0.0687 0.1728  0.0201  111 VAL A N     
860  C CA    . VAL A 125 ? 0.8135 0.6489 0.6755 -0.0738 0.1668  0.0113  111 VAL A CA    
861  C C     . VAL A 125 ? 0.8293 0.6589 0.7037 -0.0977 0.1526  -0.0033 111 VAL A C     
862  O O     . VAL A 125 ? 0.8389 0.6504 0.7061 -0.1050 0.1559  -0.0090 111 VAL A O     
863  C CB    . VAL A 125 ? 0.7939 0.6378 0.6255 -0.0621 0.1527  0.0067  111 VAL A CB    
864  C CG1   . VAL A 125 ? 0.8031 0.6326 0.6158 -0.0680 0.1477  -0.0014 111 VAL A CG1   
865  C CG2   . VAL A 125 ? 0.8136 0.6633 0.6291 -0.0362 0.1645  0.0170  111 VAL A CG2   
866  N N     . LEU A 126 ? 0.8346 0.6800 0.7263 -0.1079 0.1368  -0.0097 112 LEU A N     
867  C CA    . LEU A 126 ? 0.8551 0.6984 0.7577 -0.1271 0.1217  -0.0248 112 LEU A CA    
868  C C     . LEU A 126 ? 0.8837 0.7157 0.8194 -0.1393 0.1351  -0.0276 112 LEU A C     
869  O O     . LEU A 126 ? 0.9098 0.7263 0.8433 -0.1501 0.1331  -0.0391 112 LEU A O     
870  C CB    . LEU A 126 ? 0.8475 0.7130 0.7622 -0.1323 0.1021  -0.0301 112 LEU A CB    
871  C CG    . LEU A 126 ? 0.8463 0.7176 0.7309 -0.1269 0.0851  -0.0336 112 LEU A CG    
872  C CD1   . LEU A 126 ? 0.8475 0.7220 0.7154 -0.1098 0.0925  -0.0234 112 LEU A CD1   
873  C CD2   . LEU A 126 ? 0.8394 0.7306 0.7363 -0.1318 0.0672  -0.0385 112 LEU A CD2   
874  N N     . ARG A 127 ? 0.8956 0.7346 0.8640 -0.1369 0.1505  -0.0171 113 ARG A N     
875  C CA    . ARG A 127 ? 0.9156 0.7441 0.9268 -0.1487 0.1674  -0.0187 113 ARG A CA    
876  C C     . ARG A 127 ? 0.9205 0.7207 0.9185 -0.1462 0.1871  -0.0158 113 ARG A C     
877  O O     . ARG A 127 ? 0.9326 0.7187 0.9507 -0.1616 0.1892  -0.0285 113 ARG A O     
878  C CB    . ARG A 127 ? 0.9086 0.7468 0.9547 -0.1414 0.1873  -0.0023 113 ARG A CB    
879  C CG    . ARG A 127 ? 0.9230 0.7588 1.0297 -0.1584 0.1994  -0.0076 113 ARG A CG    
880  C CD    . ARG A 127 ? 0.9103 0.7513 1.0537 -0.1488 0.2261  0.0125  113 ARG A CD    
881  N N     . ARG A 128 ? 0.9120 0.7055 0.8757 -0.1258 0.1996  -0.0009 114 ARG A N     
882  C CA    . ARG A 128 ? 0.9152 0.6838 0.8620 -0.1192 0.2189  0.0046  114 ARG A CA    
883  C C     . ARG A 128 ? 0.9237 0.6795 0.8476 -0.1307 0.2031  -0.0124 114 ARG A C     
884  O O     . ARG A 128 ? 0.9415 0.6749 0.8738 -0.1385 0.2158  -0.0169 114 ARG A O     
885  C CB    . ARG A 128 ? 0.9089 0.6790 0.8220 -0.0916 0.2318  0.0228  114 ARG A CB    
886  N N     . THR A 129 ? 0.9072 0.6754 0.8044 -0.1315 0.1775  -0.0215 115 THR A N     
887  C CA    . THR A 129 ? 0.9036 0.6582 0.7708 -0.1356 0.1668  -0.0326 115 THR A CA    
888  C C     . THR A 129 ? 0.9185 0.6730 0.7913 -0.1538 0.1457  -0.0533 115 THR A C     
889  O O     . THR A 129 ? 0.9192 0.6549 0.7767 -0.1594 0.1444  -0.0634 115 THR A O     
890  C CB    . THR A 129 ? 0.8883 0.6526 0.7201 -0.1217 0.1560  -0.0282 115 THR A CB    
891  O OG1   . THR A 129 ? 0.8832 0.6699 0.7193 -0.1237 0.1368  -0.0319 115 THR A OG1   
892  C CG2   . THR A 129 ? 0.9000 0.6659 0.7213 -0.1008 0.1736  -0.0116 115 THR A CG2   
893  N N     . ALA A 130 ? 0.9173 0.6931 0.8094 -0.1608 0.1289  -0.0599 116 ALA A N     
894  C CA    . ALA A 130 ? 0.9335 0.7142 0.8274 -0.1738 0.1057  -0.0802 116 ALA A CA    
895  C C     . ALA A 130 ? 0.9898 0.7497 0.8926 -0.1866 0.1081  -0.0970 116 ALA A C     
896  O O     . ALA A 130 ? 1.0660 0.8166 0.9396 -0.1877 0.0951  -0.1094 116 ALA A O     
897  C CB    . ALA A 130 ? 0.9168 0.7238 0.8429 -0.1801 0.0920  -0.0847 116 ALA A CB    
898  N N     . PRO A 131 ? 1.0173 0.7684 0.9610 -0.1954 0.1260  -0.0979 117 PRO A N     
899  C CA    . PRO A 131 ? 1.0524 0.7811 1.0086 -0.2080 0.1305  -0.1155 117 PRO A CA    
900  C C     . PRO A 131 ? 1.0732 0.7765 0.9837 -0.2012 0.1354  -0.1153 117 PRO A C     
901  O O     . PRO A 131 ? 1.1187 0.8111 1.0166 -0.2084 0.1226  -0.1353 117 PRO A O     
902  C CB    . PRO A 131 ? 1.0549 0.7725 1.0579 -0.2120 0.1608  -0.1056 117 PRO A CB    
903  C CG    . PRO A 131 ? 1.0278 0.7660 1.0448 -0.2020 0.1685  -0.0850 117 PRO A CG    
904  C CD    . PRO A 131 ? 1.0129 0.7750 0.9981 -0.1947 0.1425  -0.0846 117 PRO A CD    
905  N N     . GLY A 132 ? 1.0579 0.7528 0.9441 -0.1862 0.1533  -0.0938 118 GLY A N     
906  C CA    . GLY A 132 ? 1.0446 0.7195 0.8881 -0.1779 0.1573  -0.0914 118 GLY A CA    
907  C C     . GLY A 132 ? 1.0405 0.7231 0.8491 -0.1762 0.1317  -0.1018 118 GLY A C     
908  O O     . GLY A 132 ? 1.0552 0.7213 0.8437 -0.1799 0.1254  -0.1157 118 GLY A O     
909  N N     . HIS A 133 ? 1.0090 0.7155 0.8105 -0.1695 0.1184  -0.0948 119 HIS A N     
910  C CA    . HIS A 133 ? 0.9873 0.7005 0.7570 -0.1650 0.0983  -0.1005 119 HIS A CA    
911  C C     . HIS A 133 ? 1.0048 0.7189 0.7748 -0.1746 0.0784  -0.1230 119 HIS A C     
912  O O     . HIS A 133 ? 1.0169 0.7225 0.7524 -0.1696 0.0683  -0.1303 119 HIS A O     
913  C CB    . HIS A 133 ? 0.9667 0.7054 0.7365 -0.1570 0.0891  -0.0898 119 HIS A CB    
914  C CG    . HIS A 133 ? 0.9502 0.6947 0.6912 -0.1512 0.0719  -0.0936 119 HIS A CG    
915  N ND1   . HIS A 133 ? 0.9416 0.6725 0.6501 -0.1418 0.0760  -0.0884 119 HIS A ND1   
916  C CD2   . HIS A 133 ? 0.9361 0.6977 0.6770 -0.1519 0.0525  -0.1009 119 HIS A CD2   
917  C CE1   . HIS A 133 ? 0.9383 0.6757 0.6278 -0.1366 0.0620  -0.0911 119 HIS A CE1   
918  N NE2   . HIS A 133 ? 0.9390 0.6953 0.6455 -0.1417 0.0472  -0.0985 119 HIS A NE2   
919  N N     . VAL A 134 ? 1.0005 0.7259 0.8097 -0.1867 0.0728  -0.1345 120 VAL A N     
920  C CA    . VAL A 134 ? 1.0238 0.7539 0.8383 -0.1954 0.0513  -0.1601 120 VAL A CA    
921  C C     . VAL A 134 ? 1.0665 0.7677 0.8665 -0.1998 0.0561  -0.1757 120 VAL A C     
922  O O     . VAL A 134 ? 1.0820 0.7784 0.8490 -0.1952 0.0399  -0.1900 120 VAL A O     
923  C CB    . VAL A 134 ? 1.0178 0.7694 0.8865 -0.2082 0.0443  -0.1705 120 VAL A CB    
924  C CG1   . VAL A 134 ? 1.0515 0.8074 0.9319 -0.2179 0.0221  -0.2018 120 VAL A CG1   
925  C CG2   . VAL A 134 ? 1.0044 0.7857 0.8784 -0.2016 0.0341  -0.1580 120 VAL A CG2   
926  N N     . ASP A 135 ? 1.0817 0.7622 0.9029 -0.2061 0.0801  -0.1715 121 ASP A N     
927  C CA    . ASP A 135 ? 1.1238 0.7730 0.9304 -0.2092 0.0889  -0.1838 121 ASP A CA    
928  C C     . ASP A 135 ? 1.1216 0.7581 0.8697 -0.1950 0.0849  -0.1788 121 ASP A C     
929  O O     . ASP A 135 ? 1.1190 0.7454 0.8417 -0.1941 0.0714  -0.1977 121 ASP A O     
930  C CB    . ASP A 135 ? 1.1533 0.7802 0.9806 -0.2112 0.1217  -0.1693 121 ASP A CB    
931  C CG    . ASP A 135 ? 1.1913 0.8119 1.0766 -0.2281 0.1319  -0.1837 121 ASP A CG    
932  O OD1   . ASP A 135 ? 1.2154 0.8456 1.1276 -0.2411 0.1124  -0.2111 121 ASP A OD1   
933  O OD2   . ASP A 135 ? 1.2134 0.8187 1.1188 -0.2270 0.1616  -0.1669 121 ASP A OD2   
934  N N     . ALA A 136 ? 1.1007 0.7383 0.8293 -0.1829 0.0973  -0.1538 122 ALA A N     
935  C CA    . ALA A 136 ? 1.1051 0.7308 0.7860 -0.1693 0.0981  -0.1458 122 ALA A CA    
936  C C     . ALA A 136 ? 1.1030 0.7381 0.7541 -0.1631 0.0742  -0.1571 122 ALA A C     
937  O O     . ALA A 136 ? 1.1030 0.7200 0.7168 -0.1553 0.0730  -0.1622 122 ALA A O     
938  C CB    . ALA A 136 ? 1.0710 0.7054 0.7465 -0.1581 0.1103  -0.1205 122 ALA A CB    
939  N N     . VAL A 137 ? 1.0746 0.7374 0.7412 -0.1646 0.0567  -0.1599 123 VAL A N     
940  C CA    . VAL A 137 ? 1.0822 0.7567 0.7219 -0.1562 0.0340  -0.1700 123 VAL A CA    
941  C C     . VAL A 137 ? 1.1074 0.7759 0.7436 -0.1617 0.0174  -0.1997 123 VAL A C     
942  O O     . VAL A 137 ? 1.1447 0.8098 0.7412 -0.1496 0.0037  -0.2092 123 VAL A O     
943  C CB    . VAL A 137 ? 1.0558 0.7627 0.7145 -0.1549 0.0210  -0.1633 123 VAL A CB    
944  C CG1   . VAL A 137 ? 1.0834 0.8039 0.7169 -0.1451 -0.0030 -0.1752 123 VAL A CG1   
945  C CG2   . VAL A 137 ? 1.0203 0.7318 0.6743 -0.1461 0.0345  -0.1374 123 VAL A CG2   
946  N N     . ARG A 138 ? 0.8412 0.7542 0.8314 -0.0606 0.0810  -0.0191 124 ARG A N     
947  C CA    . ARG A 138 ? 0.8637 0.7509 0.8491 -0.0691 0.0692  -0.0288 124 ARG A CA    
948  C C     . ARG A 138 ? 0.8828 0.7349 0.8556 -0.0463 0.0568  -0.0441 124 ARG A C     
949  O O     . ARG A 138 ? 0.8635 0.7248 0.8398 -0.0355 0.0538  -0.0612 124 ARG A O     
950  C CB    . ARG A 138 ? 0.9043 0.7619 0.8807 -0.0976 0.0609  -0.0150 124 ARG A CB    
951  C CG    . ARG A 138 ? 0.8916 0.7903 0.8811 -0.1229 0.0695  -0.0064 124 ARG A CG    
952  C CD    . ARG A 138 ? 0.9281 0.8066 0.9116 -0.1553 0.0596  0.0013  124 ARG A CD    
953  N NE    . ARG A 138 ? 0.8948 0.8294 0.8940 -0.1733 0.0698  0.0049  124 ARG A NE    
954  C CZ    . ARG A 138 ? 0.8690 0.8363 0.8807 -0.1691 0.0739  -0.0094 124 ARG A CZ    
955  N NH1   . ARG A 138 ? 0.8613 0.8142 0.8727 -0.1491 0.0692  -0.0278 124 ARG A NH1   
956  N NH2   . ARG A 138 ? 0.8481 0.8677 0.8722 -0.1836 0.0823  -0.0055 124 ARG A NH2   
957  N N     . GLN A 139 ? 0.9125 0.7282 0.8700 -0.0376 0.0494  -0.0382 125 GLN A N     
958  C CA    . GLN A 139 ? 0.9503 0.7258 0.8916 -0.0147 0.0340  -0.0528 125 GLN A CA    
959  C C     . GLN A 139 ? 0.9365 0.7486 0.8849 0.0131  0.0391  -0.0702 125 GLN A C     
960  O O     . GLN A 139 ? 0.9953 0.7962 0.9375 0.0297  0.0284  -0.0892 125 GLN A O     
961  C CB    . GLN A 139 ? 0.9692 0.7038 0.8922 -0.0077 0.0259  -0.0414 125 GLN A CB    
962  N N     . ALA A 140 ? 0.9080 0.7656 0.8689 0.0173  0.0547  -0.0638 126 ALA A N     
963  C CA    . ALA A 140 ? 0.8745 0.7719 0.8425 0.0386  0.0604  -0.0763 126 ALA A CA    
964  C C     . ALA A 140 ? 0.8631 0.7927 0.8436 0.0352  0.0643  -0.0864 126 ALA A C     
965  O O     . ALA A 140 ? 0.8505 0.8033 0.8319 0.0532  0.0626  -0.1006 126 ALA A O     
966  C CB    . ALA A 140 ? 0.8278 0.7588 0.8043 0.0398  0.0742  -0.0650 126 ALA A CB    
967  N N     . VAL A 141 ? 0.8785 0.8147 0.8683 0.0129  0.0694  -0.0787 127 VAL A N     
968  C CA    . VAL A 141 ? 0.8577 0.8303 0.8604 0.0095  0.0749  -0.0854 127 VAL A CA    
969  C C     . VAL A 141 ? 0.8984 0.8558 0.9010 -0.0063 0.0673  -0.0912 127 VAL A C     
970  O O     . VAL A 141 ? 0.9329 0.8848 0.9316 0.0029  0.0578  -0.1081 127 VAL A O     
971  C CB    . VAL A 141 ? 0.8104 0.8203 0.8270 0.0008  0.0898  -0.0724 127 VAL A CB    
972  C CG1   . VAL A 141 ? 0.7937 0.8383 0.8216 -0.0015 0.0942  -0.0776 127 VAL A CG1   
973  C CG2   . VAL A 141 ? 0.7947 0.8208 0.8118 0.0145  0.0961  -0.0684 127 VAL A CG2   
974  N N     . PHE A 142 ? 0.8880 0.8426 0.8948 -0.0298 0.0709  -0.0784 128 PHE A N     
975  C CA    . PHE A 142 ? 0.9049 0.8638 0.9163 -0.0476 0.0673  -0.0830 128 PHE A CA    
976  C C     . PHE A 142 ? 0.9473 0.8593 0.9456 -0.0524 0.0496  -0.0944 128 PHE A C     
977  O O     . PHE A 142 ? 0.9604 0.8789 0.9614 -0.0553 0.0438  -0.1084 128 PHE A O     
978  C CB    . PHE A 142 ? 0.9047 0.8817 0.9241 -0.0714 0.0757  -0.0666 128 PHE A CB    
979  C CG    . PHE A 142 ? 0.8781 0.9017 0.9106 -0.0653 0.0904  -0.0602 128 PHE A CG    
980  C CD1   . PHE A 142 ? 0.8806 0.9417 0.9239 -0.0627 0.0952  -0.0667 128 PHE A CD1   
981  C CD2   . PHE A 142 ? 0.8677 0.8961 0.9006 -0.0609 0.0980  -0.0484 128 PHE A CD2   
982  C CE1   . PHE A 142 ? 0.8407 0.9371 0.8935 -0.0556 0.1062  -0.0607 128 PHE A CE1   
983  C CE2   . PHE A 142 ? 0.8330 0.8979 0.8764 -0.0545 0.1089  -0.0443 128 PHE A CE2   
984  C CZ    . PHE A 142 ? 0.8228 0.9187 0.8754 -0.0517 0.1124  -0.0500 128 PHE A CZ    
985  N N     . ASP A 143 ? 0.9720 0.8349 0.9549 -0.0525 0.0397  -0.0891 129 ASP A N     
986  C CA    . ASP A 143 ? 1.0191 0.8261 0.9857 -0.0535 0.0194  -0.1008 129 ASP A CA    
987  C C     . ASP A 143 ? 1.0318 0.8395 0.9944 -0.0252 0.0103  -0.1270 129 ASP A C     
988  O O     . ASP A 143 ? 1.0877 0.8541 1.0383 -0.0243 -0.0078 -0.1421 129 ASP A O     
989  C CB    . ASP A 143 ? 1.0486 0.8006 0.9968 -0.0533 0.0096  -0.0892 129 ASP A CB    
990  C CG    . ASP A 143 ? 1.0613 0.7996 1.0080 -0.0874 0.0112  -0.0652 129 ASP A CG    
991  O OD1   . ASP A 143 ? 1.0646 0.8283 1.0223 -0.1130 0.0159  -0.0608 129 ASP A OD1   
992  O OD2   . ASP A 143 ? 1.0708 0.7759 1.0046 -0.0886 0.0070  -0.0504 129 ASP A OD2   
993  N N     . ARG A 144 ? 0.9876 0.8424 0.9593 -0.0028 0.0215  -0.1323 130 ARG A N     
994  C CA    . ARG A 144 ? 0.9933 0.8602 0.9609 0.0263  0.0140  -0.1558 130 ARG A CA    
995  C C     . ARG A 144 ? 0.9668 0.8862 0.9485 0.0279  0.0202  -0.1671 130 ARG A C     
996  O O     . ARG A 144 ? 0.9683 0.9058 0.9473 0.0506  0.0140  -0.1872 130 ARG A O     
997  C CB    . ARG A 144 ? 0.9710 0.8584 0.9367 0.0509  0.0203  -0.1540 130 ARG A CB    
998  C CG    . ARG A 144 ? 1.0008 0.8439 0.9530 0.0524  0.0156  -0.1419 130 ARG A CG    
999  C CD    . ARG A 144 ? 0.9820 0.8443 0.9294 0.0811  0.0176  -0.1465 130 ARG A CD    
1000 N NE    . ARG A 144 ? 1.0553 0.8639 0.9809 0.0996  -0.0011 -0.1561 130 ARG A NE    
1001 C CZ    . ARG A 144 ? 1.0939 0.8788 1.0083 0.1084  -0.0032 -0.1462 130 ARG A CZ    
1002 N NH1   . ARG A 144 ? 1.0721 0.8854 0.9958 0.1005  0.0129  -0.1272 130 ARG A NH1   
1003 N NH2   . ARG A 144 ? 1.1532 0.8850 1.0456 0.1278  -0.0232 -0.1570 130 ARG A NH2   
1004 N N     . LEU A 145 ? 0.9407 0.8875 0.9363 0.0054  0.0317  -0.1548 131 LEU A N     
1005 C CA    . LEU A 145 ? 0.9078 0.9070 0.9164 0.0070  0.0387  -0.1621 131 LEU A CA    
1006 C C     . LEU A 145 ? 0.9243 0.9210 0.9375 -0.0159 0.0345  -0.1656 131 LEU A C     
1007 O O     . LEU A 145 ? 0.9274 0.9060 0.9415 -0.0402 0.0359  -0.1518 131 LEU A O     
1008 C CB    . LEU A 145 ? 0.8546 0.8991 0.8763 0.0057  0.0571  -0.1445 131 LEU A CB    
1009 C CG    . LEU A 145 ? 0.8333 0.8820 0.8520 0.0214  0.0628  -0.1370 131 LEU A CG    
1010 C CD1   . LEU A 145 ? 0.8063 0.8877 0.8367 0.0142  0.0785  -0.1185 131 LEU A CD1   
1011 C CD2   . LEU A 145 ? 0.8290 0.9009 0.8437 0.0467  0.0583  -0.1531 131 LEU A CD2   
1012 N N     . THR A 146 ? 0.9351 0.9562 0.9514 -0.0087 0.0295  -0.1841 132 THR A N     
1013 C CA    . THR A 146 ? 0.9587 0.9887 0.9812 -0.0295 0.0264  -0.1892 132 THR A CA    
1014 C C     . THR A 146 ? 0.9407 1.0176 0.9784 -0.0426 0.0436  -0.1709 132 THR A C     
1015 O O     . THR A 146 ? 0.9449 1.0499 0.9881 -0.0308 0.0561  -0.1593 132 THR A O     
1016 C CB    . THR A 146 ? 0.9689 1.0231 0.9920 -0.0152 0.0177  -0.2148 132 THR A CB    
1017 O OG1   . THR A 146 ? 0.9246 1.0416 0.9587 -0.0006 0.0308  -0.2120 132 THR A OG1   
1018 C CG2   . THR A 146 ? 1.0060 1.0235 1.0136 0.0075  0.0003  -0.2369 132 THR A CG2   
1019 N N     . PRO A 147 ? 0.9483 1.0335 0.9918 -0.0669 0.0432  -0.1686 133 PRO A N     
1020 C CA    . PRO A 147 ? 0.9018 1.0373 0.9588 -0.0746 0.0575  -0.1556 133 PRO A CA    
1021 C C     . PRO A 147 ? 0.8618 1.0468 0.9264 -0.0527 0.0663  -0.1578 133 PRO A C     
1022 O O     . PRO A 147 ? 0.8459 1.0550 0.9164 -0.0478 0.0784  -0.1424 133 PRO A O     
1023 C CB    . PRO A 147 ? 0.9197 1.0644 0.9805 -0.0989 0.0514  -0.1625 133 PRO A CB    
1024 C CG    . PRO A 147 ? 0.9760 1.0624 1.0240 -0.1108 0.0337  -0.1735 133 PRO A CG    
1025 C CD    . PRO A 147 ? 0.9953 1.0386 1.0314 -0.0913 0.0293  -0.1735 133 PRO A CD    
1026 N N     . GLU A 148 ? 0.8502 1.0493 0.9133 -0.0396 0.0593  -0.1765 134 GLU A N     
1027 C CA    . GLU A 148 ? 0.8061 1.0547 0.8749 -0.0204 0.0665  -0.1769 134 GLU A CA    
1028 C C     . GLU A 148 ? 0.7648 1.0151 0.8321 -0.0062 0.0752  -0.1621 134 GLU A C     
1029 O O     . GLU A 148 ? 0.7254 1.0092 0.7986 -0.0014 0.0851  -0.1490 134 GLU A O     
1030 C CB    . GLU A 148 ? 0.8267 1.0904 0.8921 -0.0061 0.0562  -0.2009 134 GLU A CB    
1031 N N     . GLN A 149 ? 0.7730 0.9855 0.8315 -0.0004 0.0705  -0.1638 135 GLN A N     
1032 C CA    . GLN A 149 ? 0.7508 0.9671 0.8074 0.0127  0.0774  -0.1525 135 GLN A CA    
1033 C C     . GLN A 149 ? 0.7310 0.9363 0.7911 0.0019  0.0872  -0.1314 135 GLN A C     
1034 O O     . GLN A 149 ? 0.6930 0.9158 0.7557 0.0083  0.0954  -0.1188 135 GLN A O     
1035 C CB    . GLN A 149 ? 0.7923 0.9769 0.8376 0.0256  0.0685  -0.1631 135 GLN A CB    
1036 C CG    . GLN A 149 ? 0.8323 0.9947 0.8694 0.0308  0.0527  -0.1872 135 GLN A CG    
1037 C CD    . GLN A 149 ? 0.8667 1.0155 0.8924 0.0537  0.0438  -0.2007 135 GLN A CD    
1038 O OE1   . GLN A 149 ? 0.9311 1.0288 0.9456 0.0549  0.0334  -0.2059 135 GLN A OE1   
1039 N NE2   . GLN A 149 ? 0.8574 1.0546 0.8851 0.0725  0.0471  -0.2060 135 GLN A NE2   
1040 N N     . GLN A 150 ? 0.7544 0.9312 0.8137 -0.0153 0.0853  -0.1276 136 GLN A N     
1041 C CA    . GLN A 150 ? 0.7297 0.9053 0.7933 -0.0256 0.0943  -0.1095 136 GLN A CA    
1042 C C     . GLN A 150 ? 0.7102 0.9279 0.7832 -0.0243 0.1025  -0.1025 136 GLN A C     
1043 O O     . GLN A 150 ? 0.7279 0.9538 0.8033 -0.0195 0.1099  -0.0898 136 GLN A O     
1044 C CB    . GLN A 150 ? 0.7362 0.8858 0.7979 -0.0466 0.0904  -0.1068 136 GLN A CB    
1045 C CG    . GLN A 150 ? 0.7585 0.8587 0.8083 -0.0483 0.0814  -0.1093 136 GLN A CG    
1046 C CD    . GLN A 150 ? 0.7727 0.8472 0.8192 -0.0728 0.0766  -0.1030 136 GLN A CD    
1047 O OE1   . GLN A 150 ? 0.7662 0.8665 0.8206 -0.0885 0.0824  -0.0951 136 GLN A OE1   
1048 N NE2   . GLN A 150 ? 0.8096 0.8347 0.8433 -0.0763 0.0651  -0.1058 136 GLN A NE2   
1049 N N     . LYS A 151 ? 0.7082 0.9506 0.7856 -0.0279 0.1000  -0.1112 137 LYS A N     
1050 C CA    . LYS A 151 ? 0.6865 0.9696 0.7709 -0.0233 0.1061  -0.1054 137 LYS A CA    
1051 C C     . LYS A 151 ? 0.6777 0.9740 0.7605 -0.0070 0.1096  -0.0990 137 LYS A C     
1052 O O     . LYS A 151 ? 0.6801 0.9832 0.7645 -0.0032 0.1154  -0.0852 137 LYS A O     
1053 C CB    . LYS A 151 ? 0.6821 0.9932 0.7702 -0.0268 0.1016  -0.1184 137 LYS A CB    
1054 N N     . SER A 152 ? 0.7000 0.9989 0.7789 0.0021  0.1048  -0.1093 138 SER A N     
1055 C CA    . SER A 152 ? 0.6885 1.0104 0.7658 0.0153  0.1074  -0.1036 138 SER A CA    
1056 C C     . SER A 152 ? 0.6733 0.9783 0.7482 0.0166  0.1125  -0.0883 138 SER A C     
1057 O O     . SER A 152 ? 0.6474 0.9692 0.7229 0.0199  0.1166  -0.0748 138 SER A O     
1058 C CB    . SER A 152 ? 0.7150 1.0462 0.7878 0.0257  0.1004  -0.1206 138 SER A CB    
1059 O OG    . SER A 152 ? 0.7358 1.1045 0.8080 0.0364  0.1029  -0.1151 138 SER A OG    
1060 N N     . LEU A 153 ? 0.6972 0.9679 0.7686 0.0133  0.1112  -0.0903 139 LEU A N     
1061 C CA    . LEU A 153 ? 0.6965 0.9507 0.7659 0.0137  0.1155  -0.0781 139 LEU A CA    
1062 C C     . LEU A 153 ? 0.6904 0.9464 0.7639 0.0090  0.1213  -0.0631 139 LEU A C     
1063 O O     . LEU A 153 ? 0.6768 0.9372 0.7494 0.0118  0.1241  -0.0519 139 LEU A O     
1064 C CB    . LEU A 153 ? 0.7128 0.9297 0.7777 0.0096  0.1127  -0.0822 139 LEU A CB    
1065 C CG    . LEU A 153 ? 0.7098 0.9085 0.7722 0.0098  0.1165  -0.0720 139 LEU A CG    
1066 C CD1   . LEU A 153 ? 0.6892 0.9061 0.7497 0.0193  0.1180  -0.0688 139 LEU A CD1   
1067 C CD2   . LEU A 153 ? 0.7298 0.8936 0.7858 0.0075  0.1120  -0.0767 139 LEU A CD2   
1068 N N     . GLY A 154 ? 0.6919 0.9451 0.7690 0.0016  0.1219  -0.0638 140 GLY A N     
1069 C CA    . GLY A 154 ? 0.6758 0.9319 0.7558 0.0006  0.1257  -0.0533 140 GLY A CA    
1070 C C     . GLY A 154 ? 0.6740 0.9531 0.7546 0.0082  0.1261  -0.0460 140 GLY A C     
1071 O O     . GLY A 154 ? 0.6680 0.9408 0.7470 0.0118  0.1271  -0.0352 140 GLY A O     
1072 N N     . GLU A 155 ? 0.6663 0.9705 0.7481 0.0107  0.1240  -0.0520 141 GLU A N     
1073 C CA    . GLU A 155 ? 0.6547 0.9824 0.7354 0.0179  0.1235  -0.0434 141 GLU A CA    
1074 C C     . GLU A 155 ? 0.6584 0.9812 0.7342 0.0201  0.1237  -0.0316 141 GLU A C     
1075 O O     . GLU A 155 ? 0.6766 0.9969 0.7492 0.0225  0.1230  -0.0174 141 GLU A O     
1076 C CB    . GLU A 155 ? 0.6510 1.0102 0.7336 0.0201  0.1212  -0.0534 141 GLU A CB    
1077 N N     . ILE A 156 ? 0.6477 0.9676 0.7221 0.0190  0.1236  -0.0376 142 ILE A N     
1078 C CA    . ILE A 156 ? 0.6404 0.9661 0.7108 0.0194  0.1239  -0.0279 142 ILE A CA    
1079 C C     . ILE A 156 ? 0.6269 0.9243 0.6953 0.0149  0.1253  -0.0162 142 ILE A C     
1080 O O     . ILE A 156 ? 0.6407 0.9395 0.7056 0.0124  0.1242  -0.0015 142 ILE A O     
1081 C CB    . ILE A 156 ? 0.6381 0.9741 0.7071 0.0228  0.1226  -0.0406 142 ILE A CB    
1082 C CG1   . ILE A 156 ? 0.6292 1.0006 0.6989 0.0290  0.1197  -0.0512 142 ILE A CG1   
1083 C CG2   . ILE A 156 ? 0.6447 0.9893 0.7101 0.0215  0.1236  -0.0308 142 ILE A CG2   
1084 C CD1   . ILE A 156 ? 0.6350 1.0117 0.7025 0.0364  0.1157  -0.0704 142 ILE A CD1   
1085 N N     . MET A 157 ? 0.6220 0.8936 0.6919 0.0130  0.1267  -0.0225 143 MET A N     
1086 C CA    . MET A 157 ? 0.6094 0.8572 0.6775 0.0099  0.1276  -0.0143 143 MET A CA    
1087 C C     . MET A 157 ? 0.6263 0.8641 0.6936 0.0111  0.1259  -0.0049 143 MET A C     
1088 O O     . MET A 157 ? 0.6092 0.8334 0.6728 0.0090  0.1238  0.0056  143 MET A O     
1089 C CB    . MET A 157 ? 0.6190 0.8458 0.6882 0.0084  0.1294  -0.0227 143 MET A CB    
1090 C CG    . MET A 157 ? 0.6221 0.8513 0.6891 0.0103  0.1287  -0.0320 143 MET A CG    
1091 S SD    . MET A 157 ? 0.6511 0.9004 0.7145 0.0121  0.1284  -0.0269 143 MET A SD    
1092 C CE    . MET A 157 ? 0.6523 0.8793 0.7141 0.0080  0.1303  -0.0206 143 MET A CE    
1093 N N     . ARG A 158 ? 0.6466 0.8916 0.7166 0.0152  0.1255  -0.0096 144 ARG A N     
1094 C CA    . ARG A 158 ? 0.6573 0.8961 0.7253 0.0212  0.1225  -0.0036 144 ARG A CA    
1095 C C     . ARG A 158 ? 0.6512 0.8901 0.7128 0.0229  0.1177  0.0111  144 ARG A C     
1096 O O     . ARG A 158 ? 0.6617 0.8777 0.7179 0.0259  0.1127  0.0194  144 ARG A O     
1097 C CB    . ARG A 158 ? 0.7076 0.9659 0.7799 0.0254  0.1231  -0.0124 144 ARG A CB    
1098 C CG    . ARG A 158 ? 0.7777 1.0346 0.8481 0.0356  0.1197  -0.0103 144 ARG A CG    
1099 C CD    . ARG A 158 ? 0.8313 1.1038 0.9077 0.0350  0.1225  -0.0219 144 ARG A CD    
1100 N NE    . ARG A 158 ? 0.8647 1.1583 0.9465 0.0261  0.1254  -0.0305 144 ARG A NE    
1101 C CZ    . ARG A 158 ? 0.8884 1.1788 0.9739 0.0145  0.1282  -0.0379 144 ARG A CZ    
1102 N NH1   . ARG A 158 ? 0.8668 1.1377 0.9519 0.0099  0.1302  -0.0372 144 ARG A NH1   
1103 N NH2   . ARG A 158 ? 0.8788 1.1843 0.9673 0.0072  0.1280  -0.0461 144 ARG A NH2   
1104 N N     . ILE A 159 ? 0.6418 0.9053 0.7027 0.0205  0.1180  0.0146  145 ILE A N     
1105 C CA    . ILE A 159 ? 0.6549 0.9225 0.7086 0.0184  0.1134  0.0321  145 ILE A CA    
1106 C C     . ILE A 159 ? 0.6687 0.9158 0.7180 0.0083  0.1115  0.0430  145 ILE A C     
1107 O O     . ILE A 159 ? 0.6911 0.9160 0.7327 0.0055  0.1049  0.0578  145 ILE A O     
1108 C CB    . ILE A 159 ? 0.6595 0.9672 0.7138 0.0169  0.1149  0.0330  145 ILE A CB    
1109 C CG1   . ILE A 159 ? 0.6507 0.9826 0.7090 0.0256  0.1156  0.0224  145 ILE A CG1   
1110 C CG2   . ILE A 159 ? 0.6857 1.0007 0.7317 0.0111  0.1102  0.0547  145 ILE A CG2   
1111 C CD1   . ILE A 159 ? 0.6278 0.9987 0.6894 0.0257  0.1178  0.0130  145 ILE A CD1   
1112 N N     . VAL A 160 ? 0.6478 0.9021 0.7010 0.0029  0.1163  0.0353  146 VAL A N     
1113 C CA    . VAL A 160 ? 0.6462 0.8888 0.6966 -0.0073 0.1155  0.0429  146 VAL A CA    
1114 C C     . VAL A 160 ? 0.6610 0.8627 0.7090 -0.0072 0.1116  0.0449  146 VAL A C     
1115 O O     . VAL A 160 ? 0.6948 0.8782 0.7366 -0.0157 0.1060  0.0578  146 VAL A O     
1116 C CB    . VAL A 160 ? 0.6188 0.8762 0.6738 -0.0080 0.1209  0.0304  146 VAL A CB    
1117 C CG1   . VAL A 160 ? 0.6138 0.8591 0.6668 -0.0170 0.1205  0.0356  146 VAL A CG1   
1118 C CG2   . VAL A 160 ? 0.6169 0.9169 0.6723 -0.0067 0.1225  0.0279  146 VAL A CG2   
1119 N N     . ALA A 161 ? 0.6447 0.8341 0.6969 0.0018  0.1138  0.0319  147 ALA A N     
1120 C CA    . ALA A 161 ? 0.6673 0.8247 0.7174 0.0054  0.1099  0.0302  147 ALA A CA    
1121 C C     . ALA A 161 ? 0.7073 0.8454 0.7495 0.0112  0.1006  0.0400  147 ALA A C     
1122 O O     . ALA A 161 ? 0.7124 0.8209 0.7478 0.0073  0.0929  0.0478  147 ALA A O     
1123 C CB    . ALA A 161 ? 0.6427 0.8015 0.6988 0.0134  0.1145  0.0152  147 ALA A CB    
1124 N N     . GLU A 162 ? 0.7247 0.8779 0.7670 0.0209  0.1001  0.0387  148 GLU A N     
1125 C CA    . GLU A 162 ? 0.7409 0.8769 0.7741 0.0301  0.0901  0.0479  148 GLU A CA    
1126 C C     . GLU A 162 ? 0.7667 0.8836 0.7902 0.0177  0.0825  0.0677  148 GLU A C     
1127 O O     . GLU A 162 ? 0.7939 0.8729 0.8075 0.0202  0.0714  0.0750  148 GLU A O     
1128 C CB    . GLU A 162 ? 0.7270 0.8934 0.7617 0.0390  0.0917  0.0469  148 GLU A CB    
1129 N N     . GLY A 163 ? 0.7705 0.9145 0.7962 0.0037  0.0876  0.0758  149 GLY A N     
1130 C CA    . GLY A 163 ? 0.7807 0.9187 0.7976 -0.0126 0.0814  0.0972  149 GLY A CA    
1131 C C     . GLY A 163 ? 0.8026 0.9049 0.8151 -0.0247 0.0755  0.1019  149 GLY A C     
1132 O O     . GLY A 163 ? 0.8198 0.8965 0.8213 -0.0365 0.0649  0.1204  149 GLY A O     
1133 N N     . LEU A 164 ? 0.7843 0.8836 0.8046 -0.0230 0.0815  0.0857  150 LEU A N     
1134 C CA    . LEU A 164 ? 0.7961 0.8690 0.8139 -0.0348 0.0771  0.0873  150 LEU A CA    
1135 C C     . LEU A 164 ? 0.8311 0.8573 0.8435 -0.0236 0.0674  0.0799  150 LEU A C     
1136 O O     . LEU A 164 ? 0.8461 0.8455 0.8553 -0.0322 0.0615  0.0798  150 LEU A O     
1137 C CB    . LEU A 164 ? 0.7631 0.8616 0.7911 -0.0382 0.0882  0.0743  150 LEU A CB    
1138 C CG    . LEU A 164 ? 0.7413 0.8816 0.7717 -0.0519 0.0940  0.0821  150 LEU A CG    
1139 C CD1   . LEU A 164 ? 0.6971 0.8663 0.7368 -0.0447 0.1048  0.0652  150 LEU A CD1   
1140 C CD2   . LEU A 164 ? 0.7639 0.8961 0.7888 -0.0731 0.0880  0.0959  150 LEU A CD2   
1141 N N     . GLN A 165 ? 0.8483 0.8689 0.8600 -0.0032 0.0655  0.0713  151 GLN A N     
1142 C CA    . GLN A 165 ? 0.8955 0.8768 0.9008 0.0119  0.0547  0.0625  151 GLN A CA    
1143 C C     . GLN A 165 ? 0.9521 0.9187 0.9474 0.0273  0.0446  0.0687  151 GLN A C     
1144 O O     . GLN A 165 ? 0.9413 0.9182 0.9389 0.0485  0.0455  0.0554  151 GLN A O     
1145 C CB    . GLN A 165 ? 0.8527 0.8478 0.8678 0.0257  0.0625  0.0402  151 GLN A CB    
1146 C CG    . GLN A 165 ? 0.8108 0.8495 0.8364 0.0319  0.0755  0.0321  151 GLN A CG    
1147 C CD    . GLN A 165 ? 0.7915 0.8432 0.8248 0.0427  0.0816  0.0139  151 GLN A CD    
1148 O OE1   . GLN A 165 ? 0.8086 0.8435 0.8412 0.0447  0.0786  0.0063  151 GLN A OE1   
1149 N NE2   . GLN A 165 ? 0.7690 0.8534 0.8094 0.0480  0.0897  0.0073  151 GLN A NE2   
1150 N N     . PRO A 166 ? 1.0339 0.9795 1.0173 0.0161  0.0344  0.0902  152 PRO A N     
1151 C CA    . PRO A 166 ? 1.1089 1.0332 1.0797 0.0330  0.0221  0.0973  152 PRO A CA    
1152 C C     . PRO A 166 ? 1.1936 1.0658 1.1534 0.0525  0.0057  0.0863  152 PRO A C     
1153 O O     . PRO A 166 ? 1.2498 1.0934 1.2087 0.0459  0.0009  0.0793  152 PRO A O     
1154 C CB    . PRO A 166 ? 1.1194 1.0324 1.0791 0.0116  0.0148  0.1259  152 PRO A CB    
1155 C CG    . PRO A 166 ? 1.1036 1.0073 1.0654 -0.0148 0.0157  0.1316  152 PRO A CG    
1156 C CD    . PRO A 166 ? 1.0461 0.9841 1.0252 -0.0120 0.0317  0.1095  152 PRO A CD    
1157 N N     . SER A 167 ? 1.2352 1.0981 1.1862 0.0781  -0.0035 0.0830  153 SER A N     
1158 C CA    . SER A 167 ? 1.2851 1.1013 1.2236 0.1028  -0.0212 0.0702  153 SER A CA    
1159 C C     . SER A 167 ? 1.3653 1.1102 1.2824 0.0943  -0.0439 0.0884  153 SER A C     
1160 O O     . SER A 167 ? 1.4130 1.1083 1.3185 0.1108  -0.0611 0.0765  153 SER A O     
1161 C CB    . SER A 167 ? 1.2761 1.1127 1.2117 0.1356  -0.0239 0.0595  153 SER A CB    
1162 N N     . GLU A 168 ? 1.3924 1.1341 1.3044 0.0674  -0.0442 0.1164  154 GLU A N     
1163 C CA    . GLU A 168 ? 1.4602 1.1411 1.3494 0.0575  -0.0660 0.1418  154 GLU A CA    
1164 C C     . GLU A 168 ? 1.5148 1.1325 1.3933 0.0379  -0.0821 0.1462  154 GLU A C     
1165 O O     . GLU A 168 ? 1.5370 1.1262 1.4042 0.0078  -0.0915 0.1737  154 GLU A O     
1166 C CB    . GLU A 168 ? 1.4370 1.1497 1.3258 0.0327  -0.0589 0.1716  154 GLU A CB    
1167 N N     . ALA A 169 ? 1.5024 1.1033 1.3849 0.0538  -0.0852 0.1188  155 ALA A N     
1168 C CA    . ALA A 169 ? 1.5659 1.0954 1.4344 0.0489  -0.1067 0.1143  155 ALA A CA    
1169 C C     . ALA A 169 ? 1.5686 1.0925 1.4414 0.0066  -0.1039 0.1270  155 ALA A C     
1170 O O     . ALA A 169 ? 1.5347 1.0721 1.4196 0.0032  -0.0964 0.1076  155 ALA A O     
1171 C CB    . ALA A 169 ? 1.6493 1.1027 1.4897 0.0621  -0.1359 0.1273  155 ALA A CB    
1172 N N     . GLY A 170 ? 1.5881 1.0951 1.4506 -0.0257 -0.1106 0.1596  156 GLY A N     
1173 C CA    . GLY A 170 ? 1.5740 1.0825 1.4402 -0.0675 -0.1086 0.1725  156 GLY A CA    
1174 C C     . GLY A 170 ? 1.4782 1.0714 1.3681 -0.0837 -0.0801 0.1709  156 GLY A C     
1175 O O     . GLY A 170 ? 1.4645 1.0913 1.3562 -0.1126 -0.0730 0.1955  156 GLY A O     
1176 N N     . ALA A 171 ? 1.4037 1.0320 1.3107 -0.0639 -0.0651 0.1419  157 ALA A N     
1177 C CA    . ALA A 171 ? 1.3207 1.0219 1.2488 -0.0738 -0.0402 0.1362  157 ALA A CA    
1178 C C     . ALA A 171 ? 1.2952 1.0008 1.2334 -0.0772 -0.0354 0.1151  157 ALA A C     
1179 O O     . ALA A 171 ? 1.3442 1.0017 1.2751 -0.0670 -0.0498 0.1004  157 ALA A O     
1180 C CB    . ALA A 171 ? 1.2581 1.0067 1.1974 -0.0466 -0.0243 0.1243  157 ALA A CB    
1181 N N     . ASP A 172 ? 1.2122 0.9772 1.1665 -0.0898 -0.0158 0.1129  158 ASP A N     
1182 C CA    . ASP A 172 ? 1.1470 0.9274 1.1112 -0.0979 -0.0091 0.0978  158 ASP A CA    
1183 C C     . ASP A 172 ? 1.0534 0.8770 1.0334 -0.0740 0.0090  0.0744  158 ASP A C     
1184 O O     . ASP A 172 ? 0.9912 0.8628 0.9831 -0.0819 0.0246  0.0721  158 ASP A O     
1185 C CB    . ASP A 172 ? 1.1338 0.9496 1.1016 -0.1327 -0.0027 0.1161  158 ASP A CB    
1186 C CG    . ASP A 172 ? 1.1250 0.9577 1.1014 -0.1436 0.0024  0.1029  158 ASP A CG    
1187 O OD1   . ASP A 172 ? 1.1383 0.9389 1.1136 -0.1310 -0.0047 0.0839  158 ASP A OD1   
1188 O OD2   . ASP A 172 ? 1.1117 0.9942 1.0957 -0.1629 0.0135  0.1105  158 ASP A OD2   
1189 N N     . LEU A 173 ? 1.0182 0.8252 0.9969 -0.0446 0.0056  0.0576  159 LEU A N     
1190 C CA    . LEU A 173 ? 0.9449 0.7918 0.9367 -0.0243 0.0211  0.0385  159 LEU A CA    
1191 C C     . LEU A 173 ? 0.9180 0.7655 0.9152 -0.0240 0.0224  0.0210  159 LEU A C     
1192 O O     . LEU A 173 ? 0.9499 0.7565 0.9389 -0.0205 0.0074  0.0127  159 LEU A O     
1193 C CB    . LEU A 173 ? 0.9524 0.7911 0.9409 0.0055  0.0169  0.0281  159 LEU A CB    
1194 C CG    . LEU A 173 ? 0.9618 0.7959 0.9429 0.0086  0.0128  0.0444  159 LEU A CG    
1195 C CD1   . LEU A 173 ? 0.9730 0.8001 0.9496 0.0402  0.0068  0.0319  159 LEU A CD1   
1196 C CD2   . LEU A 173 ? 0.9110 0.7957 0.9021 -0.0028 0.0296  0.0550  159 LEU A CD2   
1197 N N     . PRO A 174 ? 0.8554 0.7483 0.8652 -0.0262 0.0394  0.0149  160 PRO A N     
1198 C CA    . PRO A 174 ? 0.8308 0.7328 0.8462 -0.0263 0.0426  0.0002  160 PRO A CA    
1199 C C     . PRO A 174 ? 0.8541 0.7305 0.8654 -0.0058 0.0322  -0.0196 160 PRO A C     
1200 O O     . PRO A 174 ? 0.8996 0.7562 0.9079 -0.0111 0.0235  -0.0278 160 PRO A O     
1201 C CB    . PRO A 174 ? 0.7868 0.7373 0.8138 -0.0199 0.0612  -0.0044 160 PRO A CB    
1202 C CG    . PRO A 174 ? 0.7679 0.7372 0.7962 -0.0270 0.0677  0.0106  160 PRO A CG    
1203 C CD    . PRO A 174 ? 0.7979 0.7349 0.8163 -0.0257 0.0552  0.0205  160 PRO A CD    
1204 N N     . TRP A 175 ? 0.8284 0.7094 0.8397 0.0181  0.0325  -0.0284 161 TRP A N     
1205 C CA    . TRP A 175 ? 0.8292 0.7003 0.8377 0.0418  0.0243  -0.0496 161 TRP A CA    
1206 C C     . TRP A 175 ? 0.8952 0.7081 0.8889 0.0482  0.0011  -0.0536 161 TRP A C     
1207 O O     . TRP A 175 ? 0.9197 0.7194 0.9090 0.0691  -0.0094 -0.0739 161 TRP A O     
1208 C CB    . TRP A 175 ? 0.7924 0.6970 0.8060 0.0643  0.0326  -0.0575 161 TRP A CB    
1209 C CG    . TRP A 175 ? 0.7907 0.6900 0.8001 0.0689  0.0308  -0.0460 161 TRP A CG    
1210 C CD1   . TRP A 175 ? 0.8263 0.6994 0.8253 0.0885  0.0165  -0.0503 161 TRP A CD1   
1211 C CD2   . TRP A 175 ? 0.7624 0.6855 0.7775 0.0556  0.0429  -0.0297 161 TRP A CD2   
1212 N NE1   . TRP A 175 ? 0.8216 0.7027 0.8198 0.0874  0.0198  -0.0363 161 TRP A NE1   
1213 C CE2   . TRP A 175 ? 0.7785 0.6910 0.7868 0.0669  0.0361  -0.0241 161 TRP A CE2   
1214 C CE3   . TRP A 175 ? 0.7294 0.6827 0.7537 0.0375  0.0579  -0.0209 161 TRP A CE3   
1215 C CZ2   . TRP A 175 ? 0.7636 0.6972 0.7751 0.0592  0.0445  -0.0100 161 TRP A CZ2   
1216 C CZ3   . TRP A 175 ? 0.7120 0.6838 0.7388 0.0312  0.0652  -0.0084 161 TRP A CZ3   
1217 C CH2   . TRP A 175 ? 0.7265 0.6898 0.7475 0.0411  0.0589  -0.0031 161 TRP A CH2   
1218 N N     . LEU A 176 ? 0.9318 0.7106 0.9166 0.0314  -0.0079 -0.0343 162 LEU A N     
1219 C CA    . LEU A 176 ? 1.0099 0.7234 0.9777 0.0315  -0.0323 -0.0333 162 LEU A CA    
1220 C C     . LEU A 176 ? 1.0353 0.7239 0.9999 -0.0002 -0.0393 -0.0238 162 LEU A C     
1221 O O     . LEU A 176 ? 1.1049 0.7354 1.0546 -0.0101 -0.0601 -0.0168 162 LEU A O     
1222 C CB    . LEU A 176 ? 1.0414 0.7292 0.9983 0.0345  -0.0407 -0.0158 162 LEU A CB    
1223 C CG    . LEU A 176 ? 1.0338 0.7490 0.9932 0.0646  -0.0347 -0.0235 162 LEU A CG    
1224 C CD1   . LEU A 176 ? 1.0710 0.7566 1.0175 0.0659  -0.0454 -0.0046 162 LEU A CD1   
1225 C CD2   . LEU A 176 ? 1.0495 0.7596 1.0058 0.0986  -0.0440 -0.0520 162 LEU A CD2   
1226 N N     . ARG A 177 ? 0.9987 0.7300 0.9762 -0.0162 -0.0235 -0.0242 163 ARG A N     
1227 C CA    . ARG A 177 ? 1.0252 0.7437 1.0010 -0.0469 -0.0289 -0.0168 163 ARG A CA    
1228 C C     . ARG A 177 ? 1.0548 0.7423 1.0259 -0.0375 -0.0436 -0.0400 163 ARG A C     
1229 O O     . ARG A 177 ? 1.0570 0.7357 1.0257 -0.0065 -0.0492 -0.0603 163 ARG A O     
1230 C CB    . ARG A 177 ? 0.9731 0.7524 0.9636 -0.0633 -0.0075 -0.0112 163 ARG A CB    
1231 C CG    . ARG A 177 ? 0.9814 0.7666 0.9702 -0.0988 -0.0076 0.0124  163 ARG A CG    
1232 C CD    . ARG A 177 ? 0.9477 0.7636 0.9396 -0.1015 0.0044  0.0310  163 ARG A CD    
1233 N NE    . ARG A 177 ? 0.8790 0.7567 0.8847 -0.1008 0.0252  0.0285  163 ARG A NE    
1234 C CZ    . ARG A 177 ? 0.8405 0.7541 0.8513 -0.0982 0.0380  0.0380  163 ARG A CZ    
1235 N NH1   . ARG A 177 ? 0.8507 0.7511 0.8555 -0.0967 0.0338  0.0516  163 ARG A NH1   
1236 N NH2   . ARG A 177 ? 0.7937 0.7559 0.8150 -0.0956 0.0539  0.0331  163 ARG A NH2   
1237 O OXT   . ARG A 177 ? 1.0894 0.7644 1.0591 -0.0598 -0.0505 -0.0403 163 ARG A OXT   
1238 N N     . PRO B 19  ? 1.3299 1.1161 1.4887 -0.0694 0.1188  0.3762  5   PRO B N     
1239 C CA    . PRO B 19  ? 1.2297 1.0970 1.3323 -0.0691 0.1160  0.3083  5   PRO B CA    
1240 C C     . PRO B 19  ? 1.1711 1.0059 1.2863 -0.0574 0.1367  0.2196  5   PRO B C     
1241 O O     . PRO B 19  ? 1.1688 0.9801 1.2787 -0.0840 0.1579  0.1856  5   PRO B O     
1242 C CB    . PRO B 19  ? 1.2311 1.1723 1.2667 -0.1202 0.1181  0.3114  5   PRO B CB    
1243 C CG    . PRO B 19  ? 1.3231 1.2042 1.3746 -0.1530 0.1314  0.3582  5   PRO B CG    
1244 C CD    . PRO B 19  ? 1.3927 1.1963 1.5143 -0.1206 0.1208  0.4291  5   PRO B CD    
1245 N N     . ARG B 20  ? 1.1254 0.9700 1.2551 -0.0225 0.1300  0.1856  6   ARG B N     
1246 C CA    . ARG B 20  ? 1.0608 0.9019 1.1897 -0.0158 0.1435  0.1097  6   ARG B CA    
1247 C C     . ARG B 20  ? 1.0036 0.9193 1.0761 -0.0264 0.1349  0.0783  6   ARG B C     
1248 O O     . ARG B 20  ? 1.0027 0.9698 1.0396 -0.0477 0.1273  0.0995  6   ARG B O     
1249 C CB    . ARG B 20  ? 1.0255 0.8474 1.1984 0.0206  0.1411  0.0917  6   ARG B CB    
1250 N N     . TRP B 21  ? 0.9528 0.8774 1.0237 -0.0148 0.1376  0.0271  7   TRP B N     
1251 C CA    . TRP B 21  ? 0.9018 0.8822 0.9432 -0.0112 0.1263  0.0014  7   TRP B CA    
1252 C C     . TRP B 21  ? 0.8722 0.8406 0.9267 0.0037  0.1290  -0.0361 7   TRP B C     
1253 O O     . TRP B 21  ? 0.8862 0.8206 0.9655 0.0039  0.1419  -0.0503 7   TRP B O     
1254 C CB    . TRP B 21  ? 0.9054 0.9268 0.9210 -0.0361 0.1302  -0.0204 7   TRP B CB    
1255 C CG    . TRP B 21  ? 0.9315 1.0124 0.9209 -0.0577 0.1242  -0.0014 7   TRP B CG    
1256 C CD1   . TRP B 21  ? 0.9464 1.0703 0.9180 -0.0879 0.1320  -0.0180 7   TRP B CD1   
1257 C CD2   . TRP B 21  ? 0.9518 1.0731 0.9302 -0.0574 0.1113  0.0330  7   TRP B CD2   
1258 N NE1   . TRP B 21  ? 0.9657 1.1563 0.9147 -0.1096 0.1263  0.0004  7   TRP B NE1   
1259 C CE2   . TRP B 21  ? 0.9734 1.1664 0.9246 -0.0921 0.1130  0.0336  7   TRP B CE2   
1260 C CE3   . TRP B 21  ? 0.9566 1.0749 0.9465 -0.0344 0.0989  0.0599  7   TRP B CE3   
1261 C CZ2   . TRP B 21  ? 0.9888 1.2567 0.9203 -0.1079 0.1026  0.0612  7   TRP B CZ2   
1262 C CZ3   . TRP B 21  ? 0.9709 1.1606 0.9431 -0.0461 0.0868  0.0898  7   TRP B CZ3   
1263 C CH2   . TRP B 21  ? 0.9817 1.2474 0.9234 -0.0840 0.0887  0.0908  7   TRP B CH2   
1264 N N     . LEU B 22  ? 0.8285 0.8293 0.8698 0.0114  0.1186  -0.0537 8   LEU B N     
1265 C CA    . LEU B 22  ? 0.7962 0.7965 0.8435 0.0192  0.1177  -0.0791 8   LEU B CA    
1266 C C     . LEU B 22  ? 0.7671 0.7907 0.8081 0.0099  0.1175  -0.1026 8   LEU B C     
1267 O O     . LEU B 22  ? 0.7413 0.7902 0.7775 0.0080  0.1116  -0.1077 8   LEU B O     
1268 C CB    . LEU B 22  ? 0.7761 0.7912 0.8202 0.0322  0.1054  -0.0764 8   LEU B CB    
1269 C CG    . LEU B 22  ? 0.7813 0.7856 0.8389 0.0433  0.1060  -0.0725 8   LEU B CG    
1270 C CD1   . LEU B 22  ? 0.8366 0.8213 0.9154 0.0512  0.1105  -0.0509 8   LEU B CD1   
1271 C CD2   . LEU B 22  ? 0.7486 0.7737 0.7991 0.0486  0.0956  -0.0712 8   LEU B CD2   
1272 N N     . THR B 23  ? 0.7681 0.7951 0.8149 0.0036  0.1239  -0.1203 9   THR B N     
1273 C CA    . THR B 23  ? 0.7560 0.8206 0.8010 -0.0024 0.1190  -0.1372 9   THR B CA    
1274 C C     . THR B 23  ? 0.7343 0.8140 0.7830 0.0139  0.0996  -0.1280 9   THR B C     
1275 O O     . THR B 23  ? 0.7384 0.8009 0.7857 0.0230  0.0942  -0.1150 9   THR B O     
1276 C CB    . THR B 23  ? 0.7546 0.8425 0.8031 -0.0171 0.1279  -0.1575 9   THR B CB    
1277 O OG1   . THR B 23  ? 0.7653 0.8654 0.8120 -0.0126 0.1202  -0.1522 9   THR B OG1   
1278 C CG2   . THR B 23  ? 0.7764 0.8361 0.8369 -0.0346 0.1528  -0.1738 9   THR B CG2   
1279 N N     . ALA B 24  ? 0.7384 0.8496 0.7994 0.0178  0.0895  -0.1348 10  ALA B N     
1280 C CA    . ALA B 24  ? 0.7658 0.8807 0.8469 0.0352  0.0712  -0.1227 10  ALA B CA    
1281 C C     . ALA B 24  ? 0.7937 0.9108 0.8666 0.0339  0.0620  -0.1013 10  ALA B C     
1282 O O     . ALA B 24  ? 0.8223 0.9216 0.9047 0.0426  0.0513  -0.0832 10  ALA B O     
1283 C CB    . ALA B 24  ? 0.7575 0.9083 0.8701 0.0447  0.0607  -0.1328 10  ALA B CB    
1284 N N     . GLU B 25  ? 0.8231 0.9682 0.8797 0.0171  0.0687  -0.1072 11  GLU B N     
1285 C CA    . GLU B 25  ? 0.8375 1.0081 0.8817 0.0060  0.0622  -0.0916 11  GLU B CA    
1286 C C     . GLU B 25  ? 0.8322 0.9658 0.8674 0.0061  0.0700  -0.0897 11  GLU B C     
1287 O O     . GLU B 25  ? 0.8343 0.9631 0.8673 0.0071  0.0588  -0.0672 11  GLU B O     
1288 C CB    . GLU B 25  ? 0.8388 1.0666 0.8712 -0.0198 0.0735  -0.1133 11  GLU B CB    
1289 N N     . GLU B 26  ? 0.8293 0.9367 0.8648 0.0054  0.0885  -0.1101 12  GLU B N     
1290 C CA    . GLU B 26  ? 0.8183 0.8996 0.8546 0.0101  0.0951  -0.1096 12  GLU B CA    
1291 C C     . GLU B 26  ? 0.8128 0.8728 0.8498 0.0236  0.0833  -0.0913 12  GLU B C     
1292 O O     . GLU B 26  ? 0.8348 0.8952 0.8685 0.0216  0.0810  -0.0849 12  GLU B O     
1293 C CB    . GLU B 26  ? 0.8274 0.8802 0.8768 0.0135  0.1118  -0.1225 12  GLU B CB    
1294 C CG    . GLU B 26  ? 0.8729 0.9371 0.9369 -0.0027 0.1313  -0.1517 12  GLU B CG    
1295 C CD    . GLU B 26  ? 0.8929 0.9135 0.9816 0.0007  0.1475  -0.1565 12  GLU B CD    
1296 O OE1   . GLU B 26  ? 0.9062 0.9062 0.9867 0.0057  0.1427  -0.1370 12  GLU B OE1   
1297 O OE2   . GLU B 26  ? 0.8955 0.9046 1.0177 -0.0033 0.1658  -0.1795 12  GLU B OE2   
1298 N N     . GLN B 27  ? 0.8024 0.8523 0.8473 0.0327  0.0787  -0.0903 13  GLN B N     
1299 C CA    . GLN B 27  ? 0.8142 0.8532 0.8697 0.0403  0.0719  -0.0860 13  GLN B CA    
1300 C C     . GLN B 27  ? 0.8117 0.8467 0.8754 0.0387  0.0604  -0.0700 13  GLN B C     
1301 O O     . GLN B 27  ? 0.7791 0.8030 0.8448 0.0360  0.0608  -0.0672 13  GLN B O     
1302 C CB    . GLN B 27  ? 0.8410 0.8864 0.9138 0.0454  0.0711  -0.0992 13  GLN B CB    
1303 C CG    . GLN B 27  ? 0.8547 0.9088 0.9165 0.0403  0.0813  -0.1072 13  GLN B CG    
1304 C CD    . GLN B 27  ? 0.8854 0.9642 0.9615 0.0368  0.0835  -0.1275 13  GLN B CD    
1305 O OE1   . GLN B 27  ? 0.8350 0.9266 0.9368 0.0391  0.0820  -0.1460 13  GLN B OE1   
1306 N NE2   . GLN B 27  ? 0.9063 0.9957 0.9716 0.0278  0.0900  -0.1307 13  GLN B NE2   
1307 N N     . LEU B 28  ? 0.8242 0.8738 0.8931 0.0374  0.0496  -0.0558 14  LEU B N     
1308 C CA    . LEU B 28  ? 0.8554 0.9022 0.9338 0.0333  0.0349  -0.0255 14  LEU B CA    
1309 C C     . LEU B 28  ? 0.8600 0.9176 0.9101 0.0134  0.0394  -0.0169 14  LEU B C     
1310 O O     . LEU B 28  ? 0.9000 0.9404 0.9553 0.0062  0.0348  0.0006  14  LEU B O     
1311 C CB    . LEU B 28  ? 0.8808 0.9595 0.9690 0.0345  0.0180  -0.0015 14  LEU B CB    
1312 C CG    . LEU B 28  ? 0.9188 0.9782 1.0606 0.0565  0.0019  0.0136  14  LEU B CG    
1313 C CD1   . LEU B 28  ? 0.8826 0.9336 1.0493 0.0721  0.0130  -0.0280 14  LEU B CD1   
1314 C CD2   . LEU B 28  ? 0.9490 1.0523 1.1036 0.0591  -0.0211 0.0513  14  LEU B CD2   
1315 N N     . VAL B 29  ? 0.8521 0.9400 0.8791 0.0021  0.0509  -0.0344 15  VAL B N     
1316 C CA    . VAL B 29  ? 0.8506 0.9626 0.8591 -0.0177 0.0587  -0.0392 15  VAL B CA    
1317 C C     . VAL B 29  ? 0.8498 0.9347 0.8640 -0.0105 0.0660  -0.0495 15  VAL B C     
1318 O O     . VAL B 29  ? 0.8716 0.9592 0.8802 -0.0246 0.0640  -0.0387 15  VAL B O     
1319 C CB    . VAL B 29  ? 0.8366 0.9852 0.8394 -0.0279 0.0751  -0.0715 15  VAL B CB    
1320 C CG1   . VAL B 29  ? 0.8409 1.0167 0.8403 -0.0433 0.0876  -0.0912 15  VAL B CG1   
1321 C CG2   . VAL B 29  ? 0.8410 1.0424 0.8334 -0.0461 0.0699  -0.0667 15  VAL B CG2   
1322 N N     . TRP B 30  ? 0.8114 0.8783 0.8361 0.0076  0.0738  -0.0677 16  TRP B N     
1323 C CA    . TRP B 30  ? 0.7924 0.8532 0.8230 0.0146  0.0785  -0.0760 16  TRP B CA    
1324 C C     . TRP B 30  ? 0.7963 0.8412 0.8341 0.0102  0.0730  -0.0686 16  TRP B C     
1325 O O     . TRP B 30  ? 0.8253 0.8799 0.8615 -0.0001 0.0764  -0.0726 16  TRP B O     
1326 C CB    . TRP B 30  ? 0.7796 0.8324 0.8188 0.0315  0.0829  -0.0831 16  TRP B CB    
1327 C CG    . TRP B 30  ? 0.7800 0.8462 0.8249 0.0382  0.0842  -0.0852 16  TRP B CG    
1328 C CD1   . TRP B 30  ? 0.7807 0.8555 0.8276 0.0413  0.0822  -0.0849 16  TRP B CD1   
1329 C CD2   . TRP B 30  ? 0.7743 0.8646 0.8266 0.0404  0.0877  -0.0904 16  TRP B CD2   
1330 N NE1   . TRP B 30  ? 0.7851 0.8923 0.8357 0.0443  0.0820  -0.0841 16  TRP B NE1   
1331 C CE2   . TRP B 30  ? 0.7740 0.8878 0.8311 0.0472  0.0845  -0.0866 16  TRP B CE2   
1332 C CE3   . TRP B 30  ? 0.7768 0.8841 0.8359 0.0353  0.0938  -0.1024 16  TRP B CE3   
1333 C CZ2   . TRP B 30  ? 0.7568 0.9083 0.8275 0.0539  0.0842  -0.0889 16  TRP B CZ2   
1334 C CZ3   . TRP B 30  ? 0.7795 0.9193 0.8567 0.0425  0.0962  -0.1114 16  TRP B CZ3   
1335 C CH2   . TRP B 30  ? 0.7633 0.9234 0.8471 0.0541  0.0899  -0.1018 16  TRP B CH2   
1336 N N     . ARG B 31  ? 0.8131 0.8361 0.8672 0.0168  0.0665  -0.0634 17  ARG B N     
1337 C CA    . ARG B 31  ? 0.8379 0.8392 0.9177 0.0134  0.0654  -0.0658 17  ARG B CA    
1338 C C     . ARG B 31  ? 0.8475 0.8379 0.9242 -0.0060 0.0611  -0.0424 17  ARG B C     
1339 O O     . ARG B 31  ? 0.8444 0.8309 0.9265 -0.0200 0.0684  -0.0514 17  ARG B O     
1340 C CB    . ARG B 31  ? 0.8679 0.8518 0.9829 0.0272  0.0611  -0.0731 17  ARG B CB    
1341 C CG    . ARG B 31  ? 0.9103 0.8583 1.0711 0.0265  0.0557  -0.0644 17  ARG B CG    
1342 C CD    . ARG B 31  ? 0.9300 0.8634 1.1116 0.0109  0.0676  -0.0835 17  ARG B CD    
1343 N NE    . ARG B 31  ? 0.9791 0.8711 1.2301 0.0155  0.0683  -0.0924 17  ARG B NE    
1344 C CZ    . ARG B 31  ? 1.0103 0.8784 1.2991 -0.0006 0.0814  -0.1139 17  ARG B CZ    
1345 N NH1   . ARG B 31  ? 1.0021 0.8943 1.2576 -0.0240 0.0936  -0.1281 17  ARG B NH1   
1346 N NH2   . ARG B 31  ? 1.0454 0.8679 1.4144 0.0067  0.0838  -0.1253 17  ARG B NH2   
1347 N N     . SER B 32  ? 0.8531 0.8509 0.9166 -0.0131 0.0504  -0.0125 18  SER B N     
1348 C CA    . SER B 32  ? 0.9067 0.9024 0.9631 -0.0384 0.0442  0.0201  18  SER B CA    
1349 C C     . SER B 32  ? 0.8806 0.9111 0.9070 -0.0616 0.0565  0.0048  18  SER B C     
1350 O O     . SER B 32  ? 0.9225 0.9466 0.9471 -0.0867 0.0582  0.0187  18  SER B O     
1351 C CB    . SER B 32  ? 0.9438 0.9613 0.9905 -0.0455 0.0269  0.0616  18  SER B CB    
1352 O OG    . SER B 32  ? 0.9636 1.0374 0.9767 -0.0524 0.0322  0.0451  18  SER B OG    
1353 N N     . TYR B 33  ? 0.7623 0.7684 0.9201 -0.0507 0.2201  -0.1785 19  TYR B N     
1354 C CA    . TYR B 33  ? 0.7645 0.7454 0.9310 -0.0479 0.2212  -0.1637 19  TYR B CA    
1355 C C     . TYR B 33  ? 0.7612 0.7256 0.8831 -0.0427 0.2176  -0.1205 19  TYR B C     
1356 O O     . TYR B 33  ? 0.7738 0.7324 0.8594 -0.0334 0.2099  -0.1159 19  TYR B O     
1357 C CB    . TYR B 33  ? 0.7851 0.7465 1.0339 -0.0585 0.2335  -0.1643 19  TYR B CB    
1358 C CG    . TYR B 33  ? 0.8068 0.7421 1.0663 -0.0533 0.2328  -0.1449 19  TYR B CG    
1359 C CD1   . TYR B 33  ? 0.8146 0.7588 1.0771 -0.0464 0.2283  -0.1774 19  TYR B CD1   
1360 C CD2   . TYR B 33  ? 0.8321 0.7439 1.0972 -0.0548 0.2359  -0.0942 19  TYR B CD2   
1361 C CE1   . TYR B 33  ? 0.8251 0.7492 1.0997 -0.0411 0.2273  -0.1637 19  TYR B CE1   
1362 C CE2   . TYR B 33  ? 0.8472 0.7386 1.1234 -0.0480 0.2336  -0.0769 19  TYR B CE2   
1363 C CZ    . TYR B 33  ? 0.8425 0.7369 1.1252 -0.0411 0.2293  -0.1135 19  TYR B CZ    
1364 O OH    . TYR B 33  ? 0.8126 0.6902 1.1095 -0.0341 0.2268  -0.1002 19  TYR B OH    
1365 N N     . ILE B 34  ? 0.7409 0.7064 0.8685 -0.0497 0.2237  -0.0905 20  ILE B N     
1366 C CA    . ILE B 34  ? 0.7342 0.7001 0.8259 -0.0455 0.2210  -0.0540 20  ILE B CA    
1367 C C     . ILE B 34  ? 0.7033 0.6776 0.7366 -0.0330 0.2079  -0.0651 20  ILE B C     
1368 O O     . ILE B 34  ? 0.6702 0.6353 0.6805 -0.0260 0.2031  -0.0518 20  ILE B O     
1369 C CB    . ILE B 34  ? 0.7666 0.7572 0.8640 -0.0556 0.2287  -0.0260 20  ILE B CB    
1370 C CG1   . ILE B 34  ? 0.7968 0.7770 0.9611 -0.0702 0.2424  -0.0026 20  ILE B CG1   
1371 C CG2   . ILE B 34  ? 0.7762 0.7848 0.8365 -0.0501 0.2251  0.0049  20  ILE B CG2   
1372 C CD1   . ILE B 34  ? 0.8148 0.7658 1.0118 -0.0675 0.2437  0.0261  20  ILE B CD1   
1373 N N     . GLU B 35  ? 0.7004 0.6924 0.7174 -0.0302 0.2016  -0.0887 21  GLU B N     
1374 C CA    . GLU B 35  ? 0.7029 0.7001 0.6796 -0.0183 0.1878  -0.0959 21  GLU B CA    
1375 C C     . GLU B 35  ? 0.7248 0.7047 0.6865 -0.0115 0.1814  -0.0984 21  GLU B C     
1376 O O     . GLU B 35  ? 0.7599 0.7303 0.6996 -0.0056 0.1758  -0.0860 21  GLU B O     
1377 C CB    . GLU B 35  ? 0.7015 0.7191 0.6751 -0.0148 0.1802  -0.1205 21  GLU B CB    
1378 N N     . ALA B 36  ? 0.7410 0.7249 0.7182 -0.0135 0.1831  -0.1178 22  ALA B N     
1379 C CA    . ALA B 36  ? 0.7098 0.6939 0.6728 -0.0090 0.1782  -0.1234 22  ALA B CA    
1380 C C     . ALA B 36  ? 0.6831 0.6455 0.6447 -0.0093 0.1822  -0.1049 22  ALA B C     
1381 O O     . ALA B 36  ? 0.6870 0.6444 0.6212 -0.0044 0.1758  -0.0942 22  ALA B O     
1382 C CB    . ALA B 36  ? 0.7202 0.7265 0.7116 -0.0133 0.1826  -0.1540 22  ALA B CB    
1383 N N     . ALA B 37  ? 0.6683 0.6186 0.6658 -0.0153 0.1924  -0.0996 23  ALA B N     
1384 C CA    . ALA B 37  ? 0.6701 0.6029 0.6739 -0.0140 0.1953  -0.0823 23  ALA B CA    
1385 C C     . ALA B 37  ? 0.6721 0.6015 0.6411 -0.0088 0.1901  -0.0583 23  ALA B C     
1386 O O     . ALA B 37  ? 0.6966 0.6200 0.6499 -0.0047 0.1871  -0.0531 23  ALA B O     
1387 C CB    . ALA B 37  ? 0.6752 0.5952 0.7320 -0.0198 0.2049  -0.0720 23  ALA B CB    
1388 N N     . THR B 38  ? 0.6595 0.6003 0.6207 -0.0096 0.1896  -0.0487 24  THR B N     
1389 C CA    . THR B 38  ? 0.6569 0.6079 0.5941 -0.0048 0.1849  -0.0354 24  THR B CA    
1390 C C     . THR B 38  ? 0.6621 0.6093 0.5748 0.0017  0.1744  -0.0475 24  THR B C     
1391 O O     . THR B 38  ? 0.6862 0.6337 0.5884 0.0056  0.1708  -0.0420 24  THR B O     
1392 C CB    . THR B 38  ? 0.6612 0.6413 0.5992 -0.0081 0.1871  -0.0296 24  THR B CB    
1393 O OG1   . THR B 38  ? 0.6617 0.6456 0.6287 -0.0169 0.1978  -0.0104 24  THR B OG1   
1394 C CG2   . THR B 38  ? 0.6478 0.6544 0.5686 -0.0032 0.1830  -0.0230 24  THR B CG2   
1395 N N     . LEU B 39  ? 0.6672 0.6140 0.5761 0.0028  0.1690  -0.0620 25  LEU B N     
1396 C CA    . LEU B 39  ? 0.6707 0.6135 0.5645 0.0086  0.1578  -0.0642 25  LEU B CA    
1397 C C     . LEU B 39  ? 0.6894 0.6232 0.5745 0.0071  0.1586  -0.0581 25  LEU B C     
1398 O O     . LEU B 39  ? 0.7333 0.6598 0.6110 0.0092  0.1529  -0.0494 25  LEU B O     
1399 C CB    . LEU B 39  ? 0.6740 0.6276 0.5680 0.0119  0.1498  -0.0754 25  LEU B CB    
1400 C CG    . LEU B 39  ? 0.6673 0.6351 0.5711 0.0151  0.1455  -0.0865 25  LEU B CG    
1401 C CD1   . LEU B 39  ? 0.6674 0.6492 0.5746 0.0179  0.1394  -0.0995 25  LEU B CD1   
1402 C CD2   . LEU B 39  ? 0.6612 0.6277 0.5707 0.0225  0.1350  -0.0877 25  LEU B CD2   
1403 N N     . LEU B 40  ? 0.6932 0.6320 0.5861 0.0026  0.1660  -0.0656 26  LEU B N     
1404 C CA    . LEU B 40  ? 0.7148 0.6570 0.6023 0.0000  0.1683  -0.0654 26  LEU B CA    
1405 C C     . LEU B 40  ? 0.7078 0.6353 0.5959 0.0004  0.1715  -0.0541 26  LEU B C     
1406 O O     . LEU B 40  ? 0.7271 0.6536 0.6030 -0.0003 0.1688  -0.0467 26  LEU B O     
1407 C CB    . LEU B 40  ? 0.7214 0.6799 0.6304 -0.0043 0.1758  -0.0866 26  LEU B CB    
1408 C CG    . LEU B 40  ? 0.7195 0.7158 0.6191 -0.0062 0.1729  -0.1024 26  LEU B CG    
1409 C CD1   . LEU B 40  ? 0.7186 0.7375 0.6541 -0.0104 0.1812  -0.1355 26  LEU B CD1   
1410 C CD2   . LEU B 40  ? 0.7202 0.7305 0.5937 -0.0079 0.1695  -0.0876 26  LEU B CD2   
1411 N N     . GLU B 41  ? 0.7047 0.6248 0.6100 0.0012  0.1769  -0.0502 27  GLU B N     
1412 C CA    . GLU B 41  ? 0.7000 0.6151 0.6066 0.0036  0.1783  -0.0390 27  GLU B CA    
1413 C C     . GLU B 41  ? 0.7042 0.6209 0.5934 0.0063  0.1717  -0.0343 27  GLU B C     
1414 O O     . GLU B 41  ? 0.7004 0.6163 0.5867 0.0065  0.1713  -0.0324 27  GLU B O     
1415 C CB    . GLU B 41  ? 0.7052 0.6215 0.6319 0.0050  0.1827  -0.0258 27  GLU B CB    
1416 N N     . ASP B 42  ? 0.7016 0.6229 0.5875 0.0082  0.1663  -0.0370 28  ASP B N     
1417 C CA    . ASP B 42  ? 0.7053 0.6294 0.5912 0.0114  0.1589  -0.0404 28  ASP B CA    
1418 C C     . ASP B 42  ? 0.7268 0.6369 0.6107 0.0091  0.1539  -0.0364 28  ASP B C     
1419 O O     . ASP B 42  ? 0.7569 0.6632 0.6490 0.0084  0.1521  -0.0356 28  ASP B O     
1420 C CB    . ASP B 42  ? 0.6991 0.6354 0.5912 0.0147  0.1534  -0.0499 28  ASP B CB    
1421 C CG    . ASP B 42  ? 0.7033 0.6459 0.6116 0.0192  0.1446  -0.0623 28  ASP B CG    
1422 O OD1   . ASP B 42  ? 0.6996 0.6249 0.6189 0.0207  0.1362  -0.0617 28  ASP B OD1   
1423 O OD2   . ASP B 42  ? 0.6875 0.6573 0.6033 0.0213  0.1456  -0.0727 28  ASP B OD2   
1424 N N     . HIS B 43  ? 0.7229 0.6319 0.5993 0.0072  0.1519  -0.0327 29  HIS B N     
1425 C CA    . HIS B 43  ? 0.7403 0.6466 0.6138 0.0042  0.1466  -0.0194 29  HIS B CA    
1426 C C     . HIS B 43  ? 0.7433 0.6531 0.6104 -0.0030 0.1541  -0.0136 29  HIS B C     
1427 O O     . HIS B 43  ? 0.7630 0.6672 0.6371 -0.0074 0.1519  -0.0007 29  HIS B O     
1428 C CB    . HIS B 43  ? 0.7602 0.6821 0.6229 0.0045  0.1429  -0.0167 29  HIS B CB    
1429 C CG    . HIS B 43  ? 0.7838 0.7163 0.6404 0.0009  0.1369  0.0062  29  HIS B CG    
1430 N ND1   . HIS B 43  ? 0.8022 0.7174 0.6774 0.0023  0.1273  0.0265  29  HIS B ND1   
1431 C CD2   . HIS B 43  ? 0.8165 0.7826 0.6552 -0.0048 0.1393  0.0136  29  HIS B CD2   
1432 C CE1   . HIS B 43  ? 0.8449 0.7785 0.7122 -0.0031 0.1241  0.0543  29  HIS B CE1   
1433 N NE2   . HIS B 43  ? 0.8494 0.8202 0.6898 -0.0076 0.1315  0.0462  29  HIS B NE2   
1434 N N     . LEU B 44  ? 0.7177 0.6372 0.5799 -0.0047 0.1629  -0.0243 30  LEU B N     
1435 C CA    . LEU B 44  ? 0.7262 0.6565 0.5863 -0.0109 0.1699  -0.0254 30  LEU B CA    
1436 C C     . LEU B 44  ? 0.7108 0.6306 0.5804 -0.0097 0.1719  -0.0257 30  LEU B C     
1437 O O     . LEU B 44  ? 0.7155 0.6396 0.5860 -0.0161 0.1740  -0.0206 30  LEU B O     
1438 C CB    . LEU B 44  ? 0.7268 0.6736 0.5928 -0.0115 0.1769  -0.0435 30  LEU B CB    
1439 C CG    . LEU B 44  ? 0.7305 0.7028 0.5907 -0.0136 0.1757  -0.0520 30  LEU B CG    
1440 C CD1   . LEU B 44  ? 0.7231 0.7190 0.6035 -0.0154 0.1833  -0.0799 30  LEU B CD1   
1441 C CD2   . LEU B 44  ? 0.7378 0.7350 0.5774 -0.0196 0.1715  -0.0349 30  LEU B CD2   
1442 N N     . ASP B 45  ? 0.6997 0.6137 0.5773 -0.0024 0.1714  -0.0307 31  ASP B N     
1443 C CA    . ASP B 45  ? 0.6885 0.6055 0.5750 0.0007  0.1711  -0.0331 31  ASP B CA    
1444 C C     . ASP B 45  ? 0.6728 0.5847 0.5687 -0.0027 0.1665  -0.0327 31  ASP B C     
1445 O O     . ASP B 45  ? 0.6787 0.5949 0.5841 -0.0060 0.1688  -0.0362 31  ASP B O     
1446 C CB    . ASP B 45  ? 0.6864 0.6135 0.5772 0.0087  0.1692  -0.0344 31  ASP B CB    
1447 C CG    . ASP B 45  ? 0.6819 0.6155 0.5781 0.0127  0.1738  -0.0277 31  ASP B CG    
1448 O OD1   . ASP B 45  ? 0.6645 0.5931 0.5676 0.0112  0.1778  -0.0295 31  ASP B OD1   
1449 O OD2   . ASP B 45  ? 0.6887 0.6375 0.5878 0.0174  0.1730  -0.0199 31  ASP B OD2   
1450 N N     . ARG B 46  ? 0.6916 0.5942 0.5929 -0.0020 0.1596  -0.0296 32  ARG B N     
1451 C CA    . ARG B 46  ? 0.7184 0.6109 0.6465 -0.0047 0.1535  -0.0287 32  ARG B CA    
1452 C C     . ARG B 46  ? 0.7286 0.6137 0.6587 -0.0160 0.1559  -0.0085 32  ARG B C     
1453 O O     . ARG B 46  ? 0.7378 0.6184 0.6934 -0.0220 0.1568  -0.0082 32  ARG B O     
1454 C CB    . ARG B 46  ? 0.7177 0.6021 0.6614 0.0010  0.1434  -0.0305 32  ARG B CB    
1455 C CG    . ARG B 46  ? 0.7098 0.6134 0.6612 0.0098  0.1410  -0.0544 32  ARG B CG    
1456 C CD    . ARG B 46  ? 0.7108 0.6121 0.7018 0.0148  0.1299  -0.0694 32  ARG B CD    
1457 N NE    . ARG B 46  ? 0.7028 0.6206 0.7304 0.0157  0.1288  -0.0951 32  ARG B NE    
1458 C CZ    . ARG B 46  ? 0.7143 0.6297 0.7972 0.0186  0.1194  -0.1157 32  ARG B CZ    
1459 N NH1   . ARG B 46  ? 0.7283 0.6207 0.8356 0.0221  0.1091  -0.1075 32  ARG B NH1   
1460 N NH2   . ARG B 46  ? 0.7164 0.6559 0.8374 0.0189  0.1194  -0.1470 32  ARG B NH2   
1461 N N     . GLN B 47  ? 0.7393 0.6311 0.6454 -0.0198 0.1574  0.0075  33  GLN B N     
1462 C CA    . GLN B 47  ? 0.7623 0.6651 0.6632 -0.0321 0.1611  0.0300  33  GLN B CA    
1463 C C     . GLN B 47  ? 0.7686 0.6833 0.6699 -0.0395 0.1714  0.0206  33  GLN B C     
1464 O O     . GLN B 47  ? 0.7931 0.7089 0.7107 -0.0508 0.1744  0.0344  33  GLN B O     
1465 C CB    . GLN B 47  ? 0.7694 0.6982 0.6408 -0.0334 0.1620  0.0376  33  GLN B CB    
1466 C CG    . GLN B 47  ? 0.7948 0.7557 0.6547 -0.0469 0.1658  0.0633  33  GLN B CG    
1467 C CD    . GLN B 47  ? 0.7802 0.7752 0.6254 -0.0545 0.1782  0.0456  33  GLN B CD    
1468 O OE1   . GLN B 47  ? 0.7677 0.7735 0.6053 -0.0483 0.1818  0.0172  33  GLN B OE1   
1469 N NE2   . GLN B 47  ? 0.7935 0.8062 0.6426 -0.0684 0.1847  0.0610  33  GLN B NE2   
1470 N N     . LEU B 48  ? 0.7439 0.6673 0.6340 -0.0332 0.1764  -0.0016 34  LEU B N     
1471 C CA    . LEU B 48  ? 0.7500 0.6879 0.6436 -0.0376 0.1845  -0.0131 34  LEU B CA    
1472 C C     . LEU B 48  ? 0.7541 0.6837 0.6722 -0.0352 0.1832  -0.0238 34  LEU B C     
1473 O O     . LEU B 48  ? 0.7772 0.7186 0.7055 -0.0424 0.1891  -0.0291 34  LEU B O     
1474 C CB    . LEU B 48  ? 0.7388 0.6895 0.6236 -0.0302 0.1884  -0.0308 34  LEU B CB    
1475 C CG    . LEU B 48  ? 0.7576 0.7339 0.6289 -0.0363 0.1926  -0.0326 34  LEU B CG    
1476 C CD1   . LEU B 48  ? 0.7464 0.7255 0.6253 -0.0269 0.1935  -0.0524 34  LEU B CD1   
1477 C CD2   . LEU B 48  ? 0.7682 0.7778 0.6384 -0.0492 0.2008  -0.0347 34  LEU B CD2   
1478 N N     . GLN B 49  ? 0.7571 0.6760 0.6867 -0.0254 0.1761  -0.0321 35  GLN B N     
1479 C CA    . GLN B 49  ? 0.7661 0.6923 0.7231 -0.0224 0.1743  -0.0507 35  GLN B CA    
1480 C C     . GLN B 49  ? 0.7832 0.6970 0.7767 -0.0342 0.1739  -0.0460 35  GLN B C     
1481 O O     . GLN B 49  ? 0.7873 0.7122 0.8067 -0.0384 0.1771  -0.0617 35  GLN B O     
1482 C CB    . GLN B 49  ? 0.7619 0.6973 0.7242 -0.0096 0.1672  -0.0657 35  GLN B CB    
1483 C CG    . GLN B 49  ? 0.7676 0.7369 0.7437 -0.0027 0.1668  -0.0894 35  GLN B CG    
1484 C CD    . GLN B 49  ? 0.7793 0.7677 0.7331 0.0036  0.1708  -0.0848 35  GLN B CD    
1485 O OE1   . GLN B 49  ? 0.7735 0.7675 0.7094 0.0115  0.1697  -0.0744 35  GLN B OE1   
1486 N NE2   . GLN B 49  ? 0.8052 0.8042 0.7678 -0.0001 0.1750  -0.0923 35  GLN B NE2   
1487 N N     . ARG B 50  ? 0.8164 0.7091 0.8182 -0.0396 0.1695  -0.0231 36  ARG B N     
1488 C CA    . ARG B 50  ? 0.8617 0.7380 0.9105 -0.0519 0.1684  -0.0093 36  ARG B CA    
1489 C C     . ARG B 50  ? 0.8565 0.7424 0.8955 -0.0695 0.1785  0.0170  36  ARG B C     
1490 O O     . ARG B 50  ? 0.8739 0.7618 0.9469 -0.0807 0.1841  0.0134  36  ARG B O     
1491 C CB    . ARG B 50  ? 0.8947 0.7447 0.9743 -0.0490 0.1567  0.0078  36  ARG B CB    
1492 C CG    . ARG B 50  ? 0.9055 0.7538 0.9460 -0.0437 0.1517  0.0315  36  ARG B CG    
1493 C CD    . ARG B 50  ? 0.9592 0.7833 1.0397 -0.0424 0.1392  0.0561  36  ARG B CD    
1494 N NE    . ARG B 50  ? 0.9762 0.8055 1.0212 -0.0348 0.1325  0.0736  36  ARG B NE    
1495 C CZ    . ARG B 50  ? 0.9852 0.8332 0.9949 -0.0416 0.1344  0.1089  36  ARG B CZ    
1496 N NH1   . ARG B 50  ? 0.9861 0.8520 0.9868 -0.0576 0.1438  0.1341  36  ARG B NH1   
1497 N NH2   . ARG B 50  ? 0.9988 0.8577 0.9824 -0.0329 0.1274  0.1159  36  ARG B NH2   
1498 N N     . ASP B 51  ? 0.8656 0.7667 0.8604 -0.0725 0.1817  0.0383  37  ASP B N     
1499 C CA    . ASP B 51  ? 0.8712 0.7982 0.8538 -0.0908 0.1915  0.0645  37  ASP B CA    
1500 C C     . ASP B 51  ? 0.8530 0.8098 0.8216 -0.0956 0.2032  0.0401  37  ASP B C     
1501 O O     . ASP B 51  ? 0.8791 0.8638 0.8461 -0.1127 0.2128  0.0547  37  ASP B O     
1502 C CB    . ASP B 51  ? 0.8804 0.8308 0.8233 -0.0917 0.1899  0.0892  37  ASP B CB    
1503 C CG    . ASP B 51  ? 0.9065 0.8329 0.8643 -0.0864 0.1769  0.1179  37  ASP B CG    
1504 O OD1   . ASP B 51  ? 0.9147 0.8047 0.9217 -0.0846 0.1696  0.1216  37  ASP B OD1   
1505 O OD2   . ASP B 51  ? 0.9049 0.8531 0.8316 -0.0834 0.1731  0.1331  37  ASP B OD2   
1506 N N     . ALA B 52  ? 0.8533 0.8100 0.8130 -0.0803 0.2019  0.0055  38  ALA B N     
1507 C CA    . ALA B 52  ? 0.8327 0.8177 0.7828 -0.0801 0.2100  -0.0184 38  ALA B CA    
1508 C C     . ALA B 52  ? 0.8126 0.7948 0.7784 -0.0662 0.2068  -0.0485 38  ALA B C     
1509 O O     . ALA B 52  ? 0.8125 0.8179 0.7779 -0.0640 0.2115  -0.0672 38  ALA B O     
1510 C CB    . ALA B 52  ? 0.8253 0.8324 0.7434 -0.0749 0.2119  -0.0246 38  ALA B CB    
1511 N N     . GLY B 53  ? 0.8057 0.7689 0.7869 -0.0562 0.1983  -0.0546 39  GLY B N     
1512 C CA    . GLY B 53  ? 0.8039 0.7815 0.8011 -0.0443 0.1949  -0.0821 39  GLY B CA    
1513 C C     . GLY B 53  ? 0.7970 0.7899 0.7709 -0.0273 0.1918  -0.0900 39  GLY B C     
1514 O O     . GLY B 53  ? 0.8103 0.8287 0.7935 -0.0184 0.1902  -0.1074 39  GLY B O     
1515 N N     . MET B 54  ? 0.7932 0.7740 0.7427 -0.0227 0.1906  -0.0762 40  MET B N     
1516 C CA    . MET B 54  ? 0.7775 0.7671 0.7175 -0.0078 0.1876  -0.0777 40  MET B CA    
1517 C C     . MET B 54  ? 0.7749 0.7462 0.6996 -0.0041 0.1851  -0.0644 40  MET B C     
1518 O O     . MET B 54  ? 0.7960 0.7536 0.7116 -0.0130 0.1867  -0.0562 40  MET B O     
1519 C CB    . MET B 54  ? 0.7810 0.7850 0.7251 -0.0074 0.1924  -0.0855 40  MET B CB    
1520 C CG    . MET B 54  ? 0.7926 0.7936 0.7279 -0.0162 0.1981  -0.0834 40  MET B CG    
1521 S SD    . MET B 54  ? 0.7815 0.8129 0.7348 -0.0166 0.2038  -0.1057 40  MET B SD    
1522 C CE    . MET B 54  ? 0.7792 0.8314 0.7180 -0.0385 0.2139  -0.1054 40  MET B CE    
1523 N N     . PRO B 55  ? 0.7347 0.7107 0.6591 0.0085  0.1813  -0.0596 41  PRO B N     
1524 C CA    . PRO B 55  ? 0.7227 0.6835 0.6391 0.0108  0.1800  -0.0485 41  PRO B CA    
1525 C C     . PRO B 55  ? 0.7205 0.6729 0.6412 0.0079  0.1845  -0.0508 41  PRO B C     
1526 O O     . PRO B 55  ? 0.7308 0.6933 0.6617 0.0059  0.1881  -0.0616 41  PRO B O     
1527 C CB    . PRO B 55  ? 0.7212 0.6982 0.6431 0.0230  0.1759  -0.0385 41  PRO B CB    
1528 C CG    . PRO B 55  ? 0.7264 0.7234 0.6616 0.0295  0.1752  -0.0423 41  PRO B CG    
1529 C CD    . PRO B 55  ? 0.7169 0.7180 0.6517 0.0207  0.1778  -0.0605 41  PRO B CD    
1530 N N     . HIS B 56  ? 0.7249 0.6657 0.6428 0.0074  0.1844  -0.0463 42  HIS B N     
1531 C CA    . HIS B 56  ? 0.7153 0.6578 0.6434 0.0036  0.1886  -0.0579 42  HIS B CA    
1532 C C     . HIS B 56  ? 0.7210 0.6676 0.6842 0.0107  0.1900  -0.0670 42  HIS B C     
1533 O O     . HIS B 56  ? 0.7280 0.6896 0.7070 0.0071  0.1939  -0.0884 42  HIS B O     
1534 C CB    . HIS B 56  ? 0.7229 0.6562 0.6481 0.0026  0.1877  -0.0554 42  HIS B CB    
1535 C CG    . HIS B 56  ? 0.7340 0.6812 0.6713 -0.0023 0.1918  -0.0752 42  HIS B CG    
1536 N ND1   . HIS B 56  ? 0.7611 0.7041 0.7196 -0.0009 0.1927  -0.0830 42  HIS B ND1   
1537 C CD2   . HIS B 56  ? 0.7722 0.7478 0.7072 -0.0096 0.1957  -0.0928 42  HIS B CD2   
1538 C CE1   . HIS B 56  ? 0.7865 0.7560 0.7585 -0.0058 0.1963  -0.1099 42  HIS B CE1   
1539 N NE2   . HIS B 56  ? 0.7890 0.7828 0.7442 -0.0111 0.1982  -0.1158 42  HIS B NE2   
1540 N N     . VAL B 57  ? 0.7440 0.6836 0.7247 0.0211  0.1862  -0.0507 43  VAL B N     
1541 C CA    . VAL B 57  ? 0.7543 0.6922 0.7816 0.0300  0.1852  -0.0527 43  VAL B CA    
1542 C C     . VAL B 57  ? 0.7577 0.7134 0.7949 0.0322  0.1853  -0.0700 43  VAL B C     
1543 O O     . VAL B 57  ? 0.7683 0.7303 0.8439 0.0339  0.1868  -0.0928 43  VAL B O     
1544 C CB    . VAL B 57  ? 0.7618 0.6956 0.8062 0.0408  0.1799  -0.0195 43  VAL B CB    
1545 C CG1   . VAL B 57  ? 0.7843 0.7084 0.8923 0.0498  0.1776  -0.0164 43  VAL B CG1   
1546 C CG2   . VAL B 57  ? 0.7725 0.6985 0.8009 0.0365  0.1809  -0.0019 43  VAL B CG2   
1547 N N     . TYR B 58  ? 0.7030 0.5377 0.5026 0.0798  0.0784  0.0589  44  TYR B N     
1548 C CA    . TYR B 58  ? 0.7276 0.5543 0.5313 0.0664  0.0827  0.0560  44  TYR B CA    
1549 C C     . TYR B 58  ? 0.7370 0.5764 0.5369 0.0718  0.0893  0.0643  44  TYR B C     
1550 O O     . TYR B 58  ? 0.7426 0.6039 0.5546 0.0647  0.0846  0.0574  44  TYR B O     
1551 C CB    . TYR B 58  ? 0.7618 0.5517 0.5560 0.0567  0.0955  0.0555  44  TYR B CB    
1552 C CG    . TYR B 58  ? 0.7547 0.5408 0.5540 0.0458  0.0888  0.0433  44  TYR B CG    
1553 C CD1   . TYR B 58  ? 0.7675 0.5714 0.5729 0.0505  0.0748  0.0401  44  TYR B CD1   
1554 C CD2   . TYR B 58  ? 0.7786 0.5455 0.5753 0.0293  0.0985  0.0340  44  TYR B CD2   
1555 C CE1   . TYR B 58  ? 0.7784 0.5819 0.5851 0.0423  0.0693  0.0318  44  TYR B CE1   
1556 C CE2   . TYR B 58  ? 0.7948 0.5672 0.5945 0.0197  0.0922  0.0221  44  TYR B CE2   
1557 C CZ    . TYR B 58  ? 0.7868 0.5781 0.5903 0.0278  0.0769  0.0229  44  TYR B CZ    
1558 O OH    . TYR B 58  ? 0.8031 0.6030 0.6065 0.0195  0.0709  0.0134  44  TYR B OH    
1559 N N     . TYR B 59  ? 0.7672 0.5942 0.5491 0.0866  0.1011  0.0801  45  TYR B N     
1560 C CA    . TYR B 59  ? 0.7935 0.6380 0.5670 0.0961  0.1076  0.0919  45  TYR B CA    
1561 C C     . TYR B 59  ? 0.7533 0.6487 0.5419 0.0954  0.0941  0.0811  45  TYR B C     
1562 O O     . TYR B 59  ? 0.7023 0.6145 0.4943 0.0896  0.0963  0.0795  45  TYR B O     
1563 C CB    . TYR B 59  ? 0.8438 0.6814 0.5954 0.1217  0.1180  0.1130  45  TYR B CB    
1564 C CG    . TYR B 59  ? 0.8933 0.7470 0.6297 0.1352  0.1275  0.1307  45  TYR B CG    
1565 C CD1   . TYR B 59  ? 0.9716 0.7838 0.6912 0.1330  0.1487  0.1459  45  TYR B CD1   
1566 C CD2   . TYR B 59  ? 0.8930 0.8058 0.6308 0.1487  0.1174  0.1313  45  TYR B CD2   
1567 C CE1   . TYR B 59  ? 1.0037 0.8297 0.7058 0.1463  0.1591  0.1653  45  TYR B CE1   
1568 C CE2   . TYR B 59  ? 0.9297 0.8649 0.6512 0.1622  0.1257  0.1482  45  TYR B CE2   
1569 C CZ    . TYR B 59  ? 0.9917 0.8821 0.6945 0.1620  0.1462  0.1671  45  TYR B CZ    
1570 O OH    . TYR B 59  ? 1.0765 0.9875 0.7598 0.1763  0.1561  0.1870  45  TYR B OH    
1571 N N     . GLY B 60  ? 0.7296 0.6480 0.5271 0.0995  0.0828  0.0717  46  GLY B N     
1572 C CA    . GLY B 60  ? 0.6994 0.6602 0.5127 0.0953  0.0739  0.0565  46  GLY B CA    
1573 C C     . GLY B 60  ? 0.7056 0.6634 0.5371 0.0791  0.0703  0.0431  46  GLY B C     
1574 O O     . GLY B 60  ? 0.7498 0.7365 0.5910 0.0756  0.0697  0.0340  46  GLY B O     
1575 N N     . LEU B 61  ? 0.6780 0.6057 0.5140 0.0703  0.0685  0.0413  47  LEU B N     
1576 C CA    . LEU B 61  ? 0.6531 0.5834 0.5059 0.0596  0.0648  0.0309  47  LEU B CA    
1577 C C     . LEU B 61  ? 0.6614 0.6014 0.5140 0.0545  0.0719  0.0324  47  LEU B C     
1578 O O     . LEU B 61  ? 0.6690 0.6319 0.5361 0.0511  0.0702  0.0224  47  LEU B O     
1579 C CB    . LEU B 61  ? 0.6395 0.5468 0.4946 0.0530  0.0613  0.0297  47  LEU B CB    
1580 C CG    . LEU B 61  ? 0.6408 0.5370 0.4937 0.0569  0.0555  0.0294  47  LEU B CG    
1581 C CD1   . LEU B 61  ? 0.6462 0.5281 0.4990 0.0505  0.0521  0.0283  47  LEU B CD1   
1582 C CD2   . LEU B 61  ? 0.6232 0.5328 0.4883 0.0594  0.0514  0.0214  47  LEU B CD2   
1583 N N     . LEU B 62  ? 0.6682 0.5882 0.5041 0.0538  0.0824  0.0446  48  LEU B N     
1584 C CA    . LEU B 62  ? 0.6983 0.6237 0.5306 0.0472  0.0928  0.0477  48  LEU B CA    
1585 C C     . LEU B 62  ? 0.6879 0.6490 0.5186 0.0553  0.0932  0.0491  48  LEU B C     
1586 O O     . LEU B 62  ? 0.6957 0.6783 0.5354 0.0480  0.0953  0.0417  48  LEU B O     
1587 C CB    . LEU B 62  ? 0.7274 0.6160 0.5379 0.0460  0.1097  0.0629  48  LEU B CB    
1588 C CG    . LEU B 62  ? 0.7239 0.5779 0.5339 0.0345  0.1137  0.0583  48  LEU B CG    
1589 C CD1   . LEU B 62  ? 0.7611 0.5767 0.5525 0.0269  0.1374  0.0685  48  LEU B CD1   
1590 C CD2   . LEU B 62  ? 0.7058 0.5789 0.5385 0.0190  0.1034  0.0389  48  LEU B CD2   
1591 N N     . VAL B 63  ? 0.6969 0.6708 0.5167 0.0702  0.0912  0.0564  49  VAL B N     
1592 C CA    . VAL B 63  ? 0.6834 0.7027 0.5009 0.0779  0.0908  0.0549  49  VAL B CA    
1593 C C     . VAL B 63  ? 0.6713 0.7203 0.5140 0.0679  0.0832  0.0307  49  VAL B C     
1594 O O     . VAL B 63  ? 0.7157 0.7972 0.5624 0.0648  0.0862  0.0236  49  VAL B O     
1595 C CB    . VAL B 63  ? 0.6855 0.7237 0.4899 0.0958  0.0883  0.0633  49  VAL B CB    
1596 C CG1   . VAL B 63  ? 0.6852 0.7855 0.4912 0.1009  0.0857  0.0544  49  VAL B CG1   
1597 C CG2   . VAL B 63  ? 0.7306 0.7399 0.5078 0.1115  0.1000  0.0909  49  VAL B CG2   
1598 N N     . LYS B 64  ? 0.6495 0.6857 0.5079 0.0638  0.0756  0.0185  50  LYS B N     
1599 C CA    . LYS B 64  ? 0.6448 0.6995 0.5256 0.0570  0.0728  -0.0030 50  LYS B CA    
1600 C C     . LYS B 64  ? 0.6466 0.7005 0.5417 0.0495  0.0747  -0.0095 50  LYS B C     
1601 O O     . LYS B 64  ? 0.6532 0.7327 0.5630 0.0461  0.0772  -0.0255 50  LYS B O     
1602 C CB    . LYS B 64  ? 0.6384 0.6719 0.5289 0.0564  0.0678  -0.0101 50  LYS B CB    
1603 N N     . LEU B 65  ? 0.6245 0.6540 0.5164 0.0461  0.0749  -0.0001 51  LEU B N     
1604 C CA    . LEU B 65  ? 0.6038 0.6419 0.5095 0.0385  0.0769  -0.0072 51  LEU B CA    
1605 C C     . LEU B 65  ? 0.6326 0.6947 0.5306 0.0340  0.0862  -0.0054 51  LEU B C     
1606 O O     . LEU B 65  ? 0.6241 0.7139 0.5375 0.0304  0.0882  -0.0190 51  LEU B O     
1607 C CB    . LEU B 65  ? 0.5975 0.6128 0.5014 0.0323  0.0762  -0.0015 51  LEU B CB    
1608 C CG    . LEU B 65  ? 0.5890 0.5858 0.4984 0.0366  0.0670  -0.0020 51  LEU B CG    
1609 C CD1   . LEU B 65  ? 0.5983 0.5851 0.5061 0.0275  0.0672  -0.0005 51  LEU B CD1   
1610 C CD2   . LEU B 65  ? 0.5739 0.5832 0.5048 0.0438  0.0615  -0.0133 51  LEU B CD2   
1611 N N     . ALA B 66  ? 0.6470 0.6974 0.5202 0.0359  0.0937  0.0126  52  ALA B N     
1612 C CA    . ALA B 66  ? 0.6568 0.7272 0.5155 0.0349  0.1046  0.0204  52  ALA B CA    
1613 C C     . ALA B 66  ? 0.6581 0.7765 0.5251 0.0382  0.1022  0.0066  52  ALA B C     
1614 O O     . ALA B 66  ? 0.6459 0.7922 0.5119 0.0330  0.1094  0.0033  52  ALA B O     
1615 C CB    . ALA B 66  ? 0.6827 0.7311 0.5107 0.0449  0.1133  0.0456  52  ALA B CB    
1616 N N     . GLU B 67  ? 0.6488 0.7782 0.5230 0.0446  0.0941  -0.0032 53  GLU B N     
1617 C CA    . GLU B 67  ? 0.6482 0.8238 0.5325 0.0439  0.0938  -0.0228 53  GLU B CA    
1618 C C     . GLU B 67  ? 0.6338 0.8143 0.5477 0.0356  0.0937  -0.0476 53  GLU B C     
1619 O O     . GLU B 67  ? 0.6381 0.8555 0.5624 0.0316  0.0977  -0.0675 53  GLU B O     
1620 C CB    . GLU B 67  ? 0.6560 0.8419 0.5385 0.0500  0.0886  -0.0281 53  GLU B CB    
1621 C CG    . GLU B 67  ? 0.6906 0.9006 0.5467 0.0630  0.0891  -0.0100 53  GLU B CG    
1622 C CD    . GLU B 67  ? 0.6821 0.9185 0.5424 0.0657  0.0841  -0.0234 53  GLU B CD    
1623 O OE1   . GLU B 67  ? 0.6722 0.8814 0.5491 0.0588  0.0811  -0.0363 53  GLU B OE1   
1624 O OE2   . GLU B 67  ? 0.6909 0.9785 0.5375 0.0747  0.0842  -0.0212 53  GLU B OE2   
1625 N N     . SER B 68  ? 0.6345 0.7812 0.5620 0.0346  0.0902  -0.0474 54  SER B N     
1626 C CA    . SER B 68  ? 0.6373 0.7848 0.5925 0.0335  0.0907  -0.0673 54  SER B CA    
1627 C C     . SER B 68  ? 0.6383 0.8109 0.6057 0.0285  0.0962  -0.0763 54  SER B C     
1628 O O     . SER B 68  ? 0.6119 0.7917 0.5668 0.0231  0.0991  -0.0649 54  SER B O     
1629 C CB    . SER B 68  ? 0.6444 0.7542 0.6077 0.0390  0.0840  -0.0611 54  SER B CB    
1630 O OG    . SER B 68  ? 0.6675 0.7549 0.6200 0.0424  0.0801  -0.0539 54  SER B OG    
1631 N N     . PRO B 69  ? 0.6618 0.8461 0.6540 0.0301  0.1002  -0.0977 55  PRO B N     
1632 C CA    . PRO B 69  ? 0.6731 0.8818 0.6809 0.0275  0.1047  -0.1073 55  PRO B CA    
1633 C C     . PRO B 69  ? 0.6891 0.8845 0.7002 0.0288  0.0989  -0.0951 55  PRO B C     
1634 O O     . PRO B 69  ? 0.7389 0.9062 0.7526 0.0369  0.0915  -0.0874 55  PRO B O     
1635 C CB    . PRO B 69  ? 0.6721 0.8825 0.7069 0.0343  0.1107  -0.1306 55  PRO B CB    
1636 C CG    . PRO B 69  ? 0.6713 0.8695 0.7007 0.0327  0.1137  -0.1381 55  PRO B CG    
1637 C CD    . PRO B 69  ? 0.6677 0.8410 0.6750 0.0339  0.1039  -0.1150 55  PRO B CD    
1638 N N     . ARG B 70  ? 0.6893 0.9084 0.6987 0.0190  0.1035  -0.0945 56  ARG B N     
1639 C CA    . ARG B 70  ? 0.6980 0.9155 0.7110 0.0140  0.1009  -0.0884 56  ARG B CA    
1640 C C     . ARG B 70  ? 0.6922 0.8731 0.6860 0.0120  0.0954  -0.0700 56  ARG B C     
1641 O O     . ARG B 70  ? 0.6711 0.8499 0.6709 0.0093  0.0914  -0.0688 56  ARG B O     
1642 C CB    . ARG B 70  ? 0.7116 0.9458 0.7554 0.0260  0.0963  -0.1018 56  ARG B CB    
1643 C CG    . ARG B 70  ? 0.7435 1.0160 0.8086 0.0274  0.1042  -0.1218 56  ARG B CG    
1644 C CD    . ARG B 70  ? 0.7543 1.0432 0.8491 0.0450  0.1004  -0.1316 56  ARG B CD    
1645 N NE    . ARG B 70  ? 0.7745 1.0851 0.8737 0.0396  0.0948  -0.1280 56  ARG B NE    
1646 C CZ    . ARG B 70  ? 0.8064 1.1392 0.9274 0.0566  0.0878  -0.1315 56  ARG B CZ    
1647 N NH1   . ARG B 70  ? 0.8338 1.1601 0.9728 0.0838  0.0871  -0.1346 56  ARG B NH1   
1648 N NH2   . ARG B 70  ? 0.7960 1.1594 0.9204 0.0469  0.0834  -0.1324 56  ARG B NH2   
1649 N N     . ARG B 71  ? 0.7022 0.8609 0.6732 0.0133  0.0961  -0.0575 57  ARG B N     
1650 C CA    . ARG B 71  ? 0.7048 0.8276 0.6557 0.0124  0.0934  -0.0403 57  ARG B CA    
1651 C C     . ARG B 71  ? 0.7052 0.8107 0.6673 0.0196  0.0826  -0.0410 57  ARG B C     
1652 O O     . ARG B 71  ? 0.7339 0.8188 0.6859 0.0145  0.0811  -0.0325 57  ARG B O     
1653 C CB    . ARG B 71  ? 0.7044 0.8189 0.6383 -0.0027 0.1046  -0.0303 57  ARG B CB    
1654 C CG    . ARG B 71  ? 0.7135 0.8241 0.6204 -0.0028 0.1157  -0.0153 57  ARG B CG    
1655 C CD    . ARG B 71  ? 0.7406 0.8465 0.6320 -0.0183 0.1334  -0.0069 57  ARG B CD    
1656 N NE    . ARG B 71  ? 0.7383 0.8218 0.6327 -0.0334 0.1387  -0.0094 57  ARG B NE    
1657 C CZ    . ARG B 71  ? 0.7587 0.8294 0.6407 -0.0519 0.1581  -0.0052 57  ARG B CZ    
1658 N NH1   . ARG B 71  ? 0.7728 0.8468 0.6354 -0.0541 0.1735  0.0068  57  ARG B NH1   
1659 N NH2   . ARG B 71  ? 0.7680 0.8243 0.6558 -0.0694 0.1638  -0.0137 57  ARG B NH2   
1660 N N     . ARG B 72  ? 0.6890 0.8007 0.6700 0.0320  0.0773  -0.0508 58  ARG B N     
1661 C CA    . ARG B 72  ? 0.6892 0.7875 0.6795 0.0429  0.0684  -0.0487 58  ARG B CA    
1662 C C     . ARG B 72  ? 0.6665 0.7452 0.6611 0.0556  0.0676  -0.0506 58  ARG B C     
1663 O O     . ARG B 72  ? 0.6664 0.7509 0.6643 0.0549  0.0743  -0.0603 58  ARG B O     
1664 C CB    . ARG B 72  ? 0.6873 0.8165 0.7004 0.0478  0.0660  -0.0580 58  ARG B CB    
1665 C CG    . ARG B 72  ? 0.6738 0.8201 0.7088 0.0601  0.0704  -0.0712 58  ARG B CG    
1666 C CD    . ARG B 72  ? 0.6755 0.8622 0.7325 0.0650  0.0690  -0.0803 58  ARG B CD    
1667 N NE    . ARG B 72  ? 0.6992 0.9103 0.7503 0.0432  0.0726  -0.0836 58  ARG B NE    
1668 C CZ    . ARG B 72  ? 0.7006 0.9485 0.7637 0.0375  0.0704  -0.0904 58  ARG B CZ    
1669 N NH1   . ARG B 72  ? 0.6823 0.9550 0.7642 0.0565  0.0616  -0.0927 58  ARG B NH1   
1670 N NH2   . ARG B 72  ? 0.6905 0.9527 0.7460 0.0128  0.0788  -0.0949 58  ARG B NH2   
1671 N N     . LEU B 73  ? 0.6710 0.7281 0.6645 0.0652  0.0613  -0.0424 59  LEU B N     
1672 C CA    . LEU B 73  ? 0.6903 0.7198 0.6843 0.0747  0.0636  -0.0419 59  LEU B CA    
1673 C C     . LEU B 73  ? 0.6815 0.6963 0.6761 0.0883  0.0567  -0.0304 59  LEU B C     
1674 O O     . LEU B 73  ? 0.6946 0.7150 0.6800 0.0845  0.0485  -0.0221 59  LEU B O     
1675 C CB    . LEU B 73  ? 0.6744 0.6877 0.6490 0.0654  0.0646  -0.0379 59  LEU B CB    
1676 C CG    . LEU B 73  ? 0.6925 0.7021 0.6692 0.0627  0.0734  -0.0500 59  LEU B CG    
1677 C CD1   . LEU B 73  ? 0.7033 0.7405 0.6945 0.0592  0.0820  -0.0680 59  LEU B CD1   
1678 C CD2   . LEU B 73  ? 0.6807 0.6920 0.6377 0.0551  0.0719  -0.0449 59  LEU B CD2   
1679 N N     . ARG B 74  ? 0.6621 0.6587 0.6665 0.1041  0.0620  -0.0301 60  ARG B N     
1680 C CA    . ARG B 74  ? 0.6668 0.6502 0.6679 0.1208  0.0567  -0.0151 60  ARG B CA    
1681 C C     . ARG B 74  ? 0.6632 0.6183 0.6437 0.1140  0.0542  -0.0050 60  ARG B C     
1682 O O     . ARG B 74  ? 0.6856 0.6232 0.6590 0.1019  0.0605  -0.0109 60  ARG B O     
1683 C CB    . ARG B 74  ? 0.7057 0.6700 0.7205 0.1430  0.0675  -0.0139 60  ARG B CB    
1684 C CG    . ARG B 74  ? 0.7003 0.7020 0.7354 0.1580  0.0655  -0.0184 60  ARG B CG    
1685 C CD    . ARG B 74  ? 0.7289 0.7073 0.7786 0.1826  0.0801  -0.0180 60  ARG B CD    
1686 N NE    . ARG B 74  ? 0.7860 0.7306 0.8244 0.2037  0.0824  0.0036  60  ARG B NE    
1687 C CZ    . ARG B 74  ? 0.8251 0.7690 0.8707 0.2376  0.0858  0.0182  60  ARG B CZ    
1688 N NH1   . ARG B 74  ? 0.8352 0.8140 0.9029 0.2559  0.0867  0.0116  60  ARG B NH1   
1689 N NH2   . ARG B 74  ? 0.8494 0.7592 0.8790 0.2554  0.0892  0.0410  60  ARG B NH2   
1690 N N     . MET B 75  ? 0.6703 0.6283 0.6415 0.1213  0.0447  0.0085  61  MET B N     
1691 C CA    . MET B 75  ? 0.6695 0.6075 0.6203 0.1129  0.0409  0.0171  61  MET B CA    
1692 C C     . MET B 75  ? 0.6735 0.5730 0.6178 0.1106  0.0518  0.0171  61  MET B C     
1693 O O     . MET B 75  ? 0.6661 0.5588 0.6005 0.0960  0.0528  0.0126  61  MET B O     
1694 C CB    . MET B 75  ? 0.6991 0.6465 0.6423 0.1256  0.0318  0.0310  61  MET B CB    
1695 C CG    . MET B 75  ? 0.7068 0.7022 0.6569 0.1243  0.0212  0.0269  61  MET B CG    
1696 S SD    . MET B 75  ? 0.7050 0.7134 0.6520 0.0951  0.0211  0.0124  61  MET B SD    
1697 C CE    . MET B 75  ? 0.7056 0.6933 0.6292 0.0842  0.0178  0.0186  61  MET B CE    
1698 N N     . THR B 76  ? 0.6920 0.5672 0.6421 0.1253  0.0622  0.0213  62  THR B N     
1699 C CA    . THR B 76  ? 0.7067 0.5435 0.6510 0.1193  0.0765  0.0188  62  THR B CA    
1700 C C     . THR B 76  ? 0.6926 0.5366 0.6441 0.1004  0.0843  -0.0029 62  THR B C     
1701 O O     . THR B 76  ? 0.7286 0.5639 0.6716 0.0864  0.0888  -0.0089 62  THR B O     
1702 C CB    . THR B 76  ? 0.7470 0.5473 0.6958 0.1383  0.0924  0.0272  62  THR B CB    
1703 O OG1   . THR B 76  ? 0.7619 0.5639 0.7008 0.1599  0.0842  0.0507  62  THR B OG1   
1704 C CG2   . THR B 76  ? 0.7649 0.5228 0.7065 0.1261  0.1110  0.0218  62  THR B CG2   
1705 N N     . GLU B 77  ? 0.6688 0.5352 0.6359 0.1003  0.0859  -0.0154 63  GLU B N     
1706 C CA    . GLU B 77  ? 0.6544 0.5387 0.6274 0.0836  0.0925  -0.0363 63  GLU B CA    
1707 C C     . GLU B 77  ? 0.6274 0.5345 0.5854 0.0716  0.0811  -0.0337 63  GLU B C     
1708 O O     . GLU B 77  ? 0.6146 0.5290 0.5672 0.0599  0.0854  -0.0432 63  GLU B O     
1709 C CB    . GLU B 77  ? 0.6377 0.5456 0.6290 0.0867  0.0962  -0.0492 63  GLU B CB    
1710 N N     . LEU B 78  ? 0.6494 0.5670 0.5998 0.0754  0.0683  -0.0204 64  LEU B N     
1711 C CA    . LEU B 78  ? 0.6517 0.5799 0.5863 0.0672  0.0612  -0.0150 64  LEU B CA    
1712 C C     . LEU B 78  ? 0.6560 0.5653 0.5777 0.0644  0.0619  -0.0106 64  LEU B C     
1713 O O     . LEU B 78  ? 0.6752 0.5961 0.5896 0.0579  0.0634  -0.0152 64  LEU B O     
1714 C CB    . LEU B 78  ? 0.6313 0.5675 0.5614 0.0686  0.0520  -0.0049 64  LEU B CB    
1715 C CG    . LEU B 78  ? 0.6493 0.5896 0.5636 0.0608  0.0496  0.0007  64  LEU B CG    
1716 C CD1   . LEU B 78  ? 0.6531 0.6096 0.5638 0.0569  0.0552  -0.0044 64  LEU B CD1   
1717 C CD2   . LEU B 78  ? 0.6358 0.5865 0.5512 0.0567  0.0465  0.0030  64  LEU B CD2   
1718 N N     . ALA B 79  ? 0.6635 0.5486 0.5820 0.0707  0.0611  -0.0014 65  ALA B N     
1719 C CA    . ALA B 79  ? 0.6715 0.5386 0.5780 0.0669  0.0636  0.0019  65  ALA B CA    
1720 C C     . ALA B 79  ? 0.6883 0.5557 0.6000 0.0569  0.0762  -0.0142 65  ALA B C     
1721 O O     . ALA B 79  ? 0.6787 0.5544 0.5821 0.0496  0.0765  -0.0177 65  ALA B O     
1722 C CB    . ALA B 79  ? 0.6967 0.5386 0.5986 0.0766  0.0638  0.0151  65  ALA B CB    
1723 N N     . LYS B 80  ? 0.6915 0.5538 0.6180 0.0560  0.0878  -0.0264 66  LYS B N     
1724 C CA    . LYS B 80  ? 0.6923 0.5562 0.6262 0.0420  0.1037  -0.0478 66  LYS B CA    
1725 C C     . LYS B 80  ? 0.6761 0.5871 0.6095 0.0323  0.0998  -0.0617 66  LYS B C     
1726 O O     . LYS B 80  ? 0.6628 0.5893 0.5950 0.0203  0.1065  -0.0756 66  LYS B O     
1727 C CB    . LYS B 80  ? 0.7297 0.5756 0.6808 0.0427  0.1202  -0.0608 66  LYS B CB    
1728 C CG    . LYS B 80  ? 0.7323 0.5801 0.6934 0.0232  0.1411  -0.0896 66  LYS B CG    
1729 C CD    . LYS B 80  ? 0.7712 0.5840 0.7480 0.0257  0.1625  -0.1005 66  LYS B CD    
1730 N N     . TYR B 81  ? 0.6784 0.6159 0.6123 0.0378  0.0904  -0.0581 67  TYR B N     
1731 C CA    . TYR B 81  ? 0.6593 0.6432 0.5883 0.0340  0.0867  -0.0651 67  TYR B CA    
1732 C C     . TYR B 81  ? 0.6525 0.6422 0.5642 0.0385  0.0782  -0.0514 67  TYR B C     
1733 O O     . TYR B 81  ? 0.6419 0.6656 0.5500 0.0349  0.0796  -0.0604 67  TYR B O     
1734 C CB    . TYR B 81  ? 0.6598 0.6634 0.5894 0.0398  0.0810  -0.0598 67  TYR B CB    
1735 C CG    . TYR B 81  ? 0.6985 0.7155 0.6454 0.0347  0.0902  -0.0787 67  TYR B CG    
1736 C CD1   . TYR B 81  ? 0.7271 0.7789 0.6818 0.0227  0.1003  -0.1042 67  TYR B CD1   
1737 C CD2   . TYR B 81  ? 0.7115 0.7137 0.6682 0.0412  0.0895  -0.0743 67  TYR B CD2   
1738 C CE1   . TYR B 81  ? 0.7069 0.7711 0.6780 0.0167  0.1107  -0.1247 67  TYR B CE1   
1739 C CE2   . TYR B 81  ? 0.7087 0.7233 0.6824 0.0381  0.0992  -0.0927 67  TYR B CE2   
1740 C CZ    . TYR B 81  ? 0.7134 0.7560 0.6939 0.0255  0.1103  -0.1179 67  TYR B CZ    
1741 O OH    . TYR B 81  ? 0.7373 0.7916 0.7355 0.0213  0.1218  -0.1391 67  TYR B OH    
1742 N N     . ALA B 82  ? 0.6407 0.6011 0.5429 0.0465  0.0703  -0.0317 68  ALA B N     
1743 C CA    . ALA B 82  ? 0.6629 0.6207 0.5492 0.0517  0.0642  -0.0188 68  ALA B CA    
1744 C C     . ALA B 82  ? 0.6668 0.6172 0.5508 0.0463  0.0681  -0.0242 68  ALA B C     
1745 O O     . ALA B 82  ? 0.6650 0.6263 0.5386 0.0502  0.0652  -0.0195 68  ALA B O     
1746 C CB    . ALA B 82  ? 0.6751 0.6051 0.5541 0.0574  0.0573  -0.0020 68  ALA B CB    
1747 N N     . LYS B 83  ? 0.6860 0.6153 0.5793 0.0381  0.0768  -0.0333 69  LYS B N     
1748 C CA    . LYS B 83  ? 0.7082 0.6241 0.5993 0.0295  0.0849  -0.0390 69  LYS B CA    
1749 C C     . LYS B 83  ? 0.7033 0.5919 0.5803 0.0359  0.0782  -0.0205 69  LYS B C     
1750 O O     . LYS B 83  ? 0.7121 0.6024 0.5822 0.0313  0.0807  -0.0222 69  LYS B O     
1751 C CB    . LYS B 83  ? 0.7347 0.6943 0.6269 0.0212  0.0887  -0.0560 69  LYS B CB    
1752 C CG    . LYS B 83  ? 0.7394 0.7419 0.6435 0.0149  0.0934  -0.0760 69  LYS B CG    
1753 C CD    . LYS B 83  ? 0.7671 0.7499 0.6864 0.0001  0.1099  -0.0953 69  LYS B CD    
1754 C CE    . LYS B 83  ? 0.7664 0.7877 0.6972 -0.0039 0.1127  -0.1130 69  LYS B CE    
1755 N NZ    . LYS B 83  ? 0.8131 0.8090 0.7600 -0.0176 0.1318  -0.1334 69  LYS B NZ    
1756 N N     . ILE B 84  ? 0.6769 0.5459 0.5507 0.0452  0.0705  -0.0055 70  ILE B N     
1757 C CA    . ILE B 84  ? 0.6772 0.5283 0.5381 0.0501  0.0638  0.0092  70  ILE B CA    
1758 C C     . ILE B 84  ? 0.7127 0.5377 0.5745 0.0553  0.0659  0.0185  70  ILE B C     
1759 O O     . ILE B 84  ? 0.7389 0.5551 0.6118 0.0563  0.0739  0.0139  70  ILE B O     
1760 C CB    . ILE B 84  ? 0.6636 0.5236 0.5184 0.0560  0.0535  0.0171  70  ILE B CB    
1761 C CG1   . ILE B 84  ? 0.6744 0.5352 0.5375 0.0600  0.0496  0.0201  70  ILE B CG1   
1762 C CG2   . ILE B 84  ? 0.6609 0.5440 0.5131 0.0572  0.0539  0.0128  70  ILE B CG2   
1763 C CD1   . ILE B 84  ? 0.6619 0.5320 0.5211 0.0607  0.0448  0.0234  70  ILE B CD1   
1764 N N     . THR B 85  ? 0.7099 0.5247 0.5593 0.0600  0.0601  0.0315  71  THR B N     
1765 C CA    . THR B 85  ? 0.7035 0.5010 0.5507 0.0700  0.0612  0.0442  71  THR B CA    
1766 C C     . THR B 85  ? 0.6991 0.5143 0.5521 0.0795  0.0502  0.0491  71  THR B C     
1767 O O     . THR B 85  ? 0.6913 0.5257 0.5449 0.0751  0.0422  0.0444  71  THR B O     
1768 C CB    . THR B 85  ? 0.7148 0.5011 0.5440 0.0714  0.0607  0.0562  71  THR B CB    
1769 O OG1   . THR B 85  ? 0.7222 0.5285 0.5433 0.0701  0.0482  0.0572  71  THR B OG1   
1770 C CG2   . THR B 85  ? 0.7105 0.4824 0.5345 0.0593  0.0733  0.0495  71  THR B CG2   
1771 N N     . ARG B 86  ? 0.7456 0.5540 0.6028 0.0931  0.0522  0.0585  72  ARG B N     
1772 C CA    . ARG B 86  ? 0.7424 0.5766 0.6067 0.1038  0.0418  0.0624  72  ARG B CA    
1773 C C     . ARG B 86  ? 0.7208 0.5795 0.5741 0.1003  0.0293  0.0649  72  ARG B C     
1774 O O     . ARG B 86  ? 0.7024 0.5901 0.5628 0.0983  0.0214  0.0590  72  ARG B O     
1775 C CB    . ARG B 86  ? 0.7712 0.5955 0.6379 0.1251  0.0466  0.0768  72  ARG B CB    
1776 C CG    . ARG B 86  ? 0.8041 0.5994 0.6834 0.1283  0.0631  0.0715  72  ARG B CG    
1777 C CD    . ARG B 86  ? 0.8460 0.6251 0.7254 0.1540  0.0705  0.0893  72  ARG B CD    
1778 N NE    . ARG B 86  ? 0.8856 0.6333 0.7792 0.1579  0.0897  0.0821  72  ARG B NE    
1779 C CZ    . ARG B 86  ? 0.9507 0.6576 0.8413 0.1764  0.1079  0.0964  72  ARG B CZ    
1780 N NH1   . ARG B 86  ? 1.0252 0.7199 0.8963 0.1946  0.1082  0.1225  72  ARG B NH1   
1781 N NH2   . ARG B 86  ? 0.9612 0.6381 0.8669 0.1770  0.1280  0.0849  72  ARG B NH2   
1782 N N     . SER B 87  ? 0.7051 0.5535 0.5415 0.0980  0.0297  0.0717  73  SER B N     
1783 C CA    . SER B 87  ? 0.6971 0.5688 0.5216 0.0943  0.0202  0.0725  73  SER B CA    
1784 C C     . SER B 87  ? 0.7134 0.5911 0.5400 0.0776  0.0188  0.0574  73  SER B C     
1785 O O     . SER B 87  ? 0.7197 0.6218 0.5492 0.0713  0.0134  0.0494  73  SER B O     
1786 C CB    . SER B 87  ? 0.7194 0.5752 0.5250 0.0941  0.0240  0.0817  73  SER B CB    
1787 O OG    . SER B 87  ? 0.7501 0.6301 0.5444 0.1050  0.0168  0.0933  73  SER B OG    
1788 N N     . ARG B 88  ? 0.7415 0.5971 0.5664 0.0706  0.0259  0.0529  74  ARG B N     
1789 C CA    . ARG B 88  ? 0.7118 0.5671 0.5368 0.0606  0.0277  0.0430  74  ARG B CA    
1790 C C     . ARG B 88  ? 0.7045 0.5719 0.5422 0.0590  0.0268  0.0376  74  ARG B C     
1791 O O     . ARG B 88  ? 0.7393 0.6111 0.5751 0.0506  0.0280  0.0314  74  ARG B O     
1792 C CB    . ARG B 88  ? 0.6951 0.5359 0.5189 0.0591  0.0347  0.0407  74  ARG B CB    
1793 C CG    . ARG B 88  ? 0.6994 0.5398 0.5202 0.0554  0.0378  0.0353  74  ARG B CG    
1794 C CD    . ARG B 88  ? 0.6909 0.5322 0.5132 0.0574  0.0432  0.0325  74  ARG B CD    
1795 N NE    . ARG B 88  ? 0.7051 0.5477 0.5209 0.0603  0.0467  0.0316  74  ARG B NE    
1796 C CZ    . ARG B 88  ? 0.7193 0.5731 0.5343 0.0643  0.0503  0.0288  74  ARG B CZ    
1797 N NH1   . ARG B 88  ? 0.7160 0.5797 0.5374 0.0603  0.0522  0.0228  74  ARG B NH1   
1798 N NH2   . ARG B 88  ? 0.7214 0.5779 0.5294 0.0727  0.0540  0.0312  74  ARG B NH2   
1799 N N     . LEU B 89  ? 0.6871 0.5573 0.5371 0.0659  0.0276  0.0390  75  LEU B N     
1800 C CA    . LEU B 89  ? 0.6775 0.5626 0.5401 0.0642  0.0276  0.0332  75  LEU B CA    
1801 C C     . LEU B 89  ? 0.6776 0.5877 0.5438 0.0616  0.0216  0.0301  75  LEU B C     
1802 O O     . LEU B 89  ? 0.6807 0.6001 0.5504 0.0513  0.0242  0.0223  75  LEU B O     
1803 C CB    . LEU B 89  ? 0.6937 0.5785 0.5701 0.0727  0.0308  0.0328  75  LEU B CB    
1804 C CG    . LEU B 89  ? 0.6939 0.5976 0.5841 0.0710  0.0315  0.0257  75  LEU B CG    
1805 C CD1   . LEU B 89  ? 0.7037 0.6079 0.5886 0.0605  0.0355  0.0213  75  LEU B CD1   
1806 C CD2   . LEU B 89  ? 0.6806 0.5811 0.5842 0.0787  0.0372  0.0224  75  LEU B CD2   
1807 N N     . SER B 90  ? 0.6821 0.6069 0.5468 0.0706  0.0151  0.0361  76  SER B N     
1808 C CA    . SER B 90  ? 0.6584 0.6222 0.5277 0.0682  0.0082  0.0304  76  SER B CA    
1809 C C     . SER B 90  ? 0.6331 0.5989 0.4937 0.0481  0.0110  0.0184  76  SER B C     
1810 O O     . SER B 90  ? 0.6245 0.6091 0.4923 0.0347  0.0138  0.0057  76  SER B O     
1811 C CB    . SER B 90  ? 0.6785 0.6636 0.5429 0.0847  0.0002  0.0416  76  SER B CB    
1812 O OG    . SER B 90  ? 0.7012 0.6765 0.5732 0.1055  0.0019  0.0540  76  SER B OG    
1813 N N     . HIS B 91  ? 0.5668 0.4698 0.6370 0.1292  -0.0126 0.0973  77  HIS B N     
1814 C CA    . HIS B 91  ? 0.5390 0.4271 0.5997 0.1306  -0.0041 0.1034  77  HIS B CA    
1815 C C     . HIS B 91  ? 0.5436 0.4292 0.5961 0.1237  0.0029  0.1082  77  HIS B C     
1816 O O     . HIS B 91  ? 0.5500 0.4236 0.5919 0.1182  0.0105  0.1037  77  HIS B O     
1817 C CB    . HIS B 91  ? 0.5180 0.3969 0.5761 0.1413  -0.0023 0.1181  77  HIS B CB    
1818 C CG    . HIS B 91  ? 0.5108 0.3823 0.5683 0.1459  -0.0062 0.1127  77  HIS B CG    
1819 N ND1   . HIS B 91  ? 0.5213 0.3811 0.5707 0.1417  -0.0055 0.1017  77  HIS B ND1   
1820 C CD2   . HIS B 91  ? 0.5003 0.3734 0.5613 0.1520  -0.0118 0.1175  77  HIS B CD2   
1821 C CE1   . HIS B 91  ? 0.5123 0.3657 0.5596 0.1455  -0.0111 0.1003  77  HIS B CE1   
1822 N NE2   . HIS B 91  ? 0.4968 0.3566 0.5505 0.1525  -0.0140 0.1094  77  HIS B NE2   
1823 N N     . ALA B 92  ? 0.5514 0.4463 0.6051 0.1213  -0.0006 0.1176  78  ALA B N     
1824 C CA    . ALA B 92  ? 0.5792 0.4704 0.6224 0.1138  0.0041  0.1250  78  ALA B CA    
1825 C C     . ALA B 92  ? 0.6012 0.4913 0.6383 0.1009  0.0090  0.1083  78  ALA B C     
1826 O O     . ALA B 92  ? 0.6159 0.4936 0.6398 0.0950  0.0166  0.1094  78  ALA B O     
1827 C CB    . ALA B 92  ? 0.5835 0.4872 0.6273 0.1096  -0.0039 0.1387  78  ALA B CB    
1828 N N     . VAL B 93  ? 0.6103 0.5127 0.6569 0.0973  0.0059  0.0934  79  VAL B N     
1829 C CA    . VAL B 93  ? 0.6264 0.5340 0.6729 0.0865  0.0126  0.0778  79  VAL B CA    
1830 C C     . VAL B 93  ? 0.6389 0.5472 0.6897 0.0847  0.0169  0.0684  79  VAL B C     
1831 O O     . VAL B 93  ? 0.6527 0.5631 0.6990 0.0727  0.0243  0.0600  79  VAL B O     
1832 C CB    . VAL B 93  ? 0.6332 0.5525 0.6889 0.0860  0.0112  0.0665  79  VAL B CB    
1833 C CG1   . VAL B 93  ? 0.6552 0.5850 0.7172 0.0776  0.0210  0.0506  79  VAL B CG1   
1834 C CG2   . VAL B 93  ? 0.6362 0.5486 0.6767 0.0796  0.0081  0.0751  79  VAL B CG2   
1835 N N     . ALA B 94  ? 0.6340 0.5395 0.6901 0.0936  0.0121  0.0701  80  ALA B N     
1836 C CA    . ALA B 94  ? 0.6244 0.5251 0.6759 0.0872  0.0151  0.0638  80  ALA B CA    
1837 C C     . ALA B 94  ? 0.6705 0.5455 0.6957 0.0794  0.0251  0.0703  80  ALA B C     
1838 O O     . ALA B 94  ? 0.6823 0.5529 0.6967 0.0652  0.0310  0.0626  80  ALA B O     
1839 C CB    . ALA B 94  ? 0.5992 0.4930 0.6518 0.0959  0.0087  0.0665  80  ALA B CB    
1840 N N     . ARG B 95  ? 0.6721 0.5306 0.6870 0.0887  0.0271  0.0857  81  ARG B N     
1841 C CA    . ARG B 95  ? 0.7304 0.5592 0.7195 0.0872  0.0374  0.0956  81  ARG B CA    
1842 C C     . ARG B 95  ? 0.7412 0.5700 0.7201 0.0736  0.0417  0.0933  81  ARG B C     
1843 O O     . ARG B 95  ? 0.7563 0.5626 0.7115 0.0634  0.0508  0.0916  81  ARG B O     
1844 C CB    . ARG B 95  ? 0.7380 0.5561 0.7265 0.1049  0.0382  0.1158  81  ARG B CB    
1845 C CG    . ARG B 95  ? 0.7777 0.5605 0.7405 0.1105  0.0513  0.1291  81  ARG B CG    
1846 C CD    . ARG B 95  ? 0.7888 0.5694 0.7433 0.1066  0.0526  0.1398  81  ARG B CD    
1847 N NE    . ARG B 95  ? 0.8287 0.5873 0.7724 0.1230  0.0608  0.1628  81  ARG B NE    
1848 C CZ    . ARG B 95  ? 0.8367 0.5849 0.7675 0.1222  0.0630  0.1765  81  ARG B CZ    
1849 N NH1   . ARG B 95  ? 0.8349 0.5884 0.7567 0.1029  0.0587  0.1676  81  ARG B NH1   
1850 N NH2   . ARG B 95  ? 0.8374 0.5688 0.7636 0.1414  0.0707  0.2000  81  ARG B NH2   
1851 N N     . LEU B 96  ? 0.7367 0.5868 0.7287 0.0714  0.0359  0.0924  82  LEU B N     
1852 C CA    . LEU B 96  ? 0.7625 0.6117 0.7424 0.0566  0.0401  0.0894  82  LEU B CA    
1853 C C     . LEU B 96  ? 0.7761 0.6364 0.7586 0.0406  0.0464  0.0694  82  LEU B C     
1854 O O     . LEU B 96  ? 0.8021 0.6511 0.7654 0.0252  0.0546  0.0658  82  LEU B O     
1855 C CB    . LEU B 96  ? 0.7640 0.6275 0.7510 0.0562  0.0329  0.0940  82  LEU B CB    
1856 C CG    . LEU B 96  ? 0.7804 0.6417 0.7672 0.0674  0.0248  0.1163  82  LEU B CG    
1857 C CD1   . LEU B 96  ? 0.7674 0.6436 0.7585 0.0620  0.0160  0.1180  82  LEU B CD1   
1858 C CD2   . LEU B 96  ? 0.8216 0.6629 0.7877 0.0661  0.0284  0.1335  82  LEU B CD2   
1859 N N     . GLU B 97  ? 0.7577 0.6417 0.7646 0.0442  0.0426  0.0580  83  GLU B N     
1860 C CA    . GLU B 97  ? 0.7568 0.6606 0.7747 0.0315  0.0474  0.0421  83  GLU B CA    
1861 C C     . GLU B 97  ? 0.7812 0.6667 0.7779 0.0189  0.0524  0.0413  83  GLU B C     
1862 O O     . GLU B 97  ? 0.7975 0.6865 0.7856 0.0002  0.0604  0.0329  83  GLU B O     
1863 C CB    . GLU B 97  ? 0.7457 0.6786 0.7957 0.0418  0.0399  0.0349  83  GLU B CB    
1864 C CG    . GLU B 97  ? 0.7545 0.7206 0.8273 0.0322  0.0440  0.0210  83  GLU B CG    
1865 C CD    . GLU B 97  ? 0.7560 0.7507 0.8627 0.0475  0.0366  0.0170  83  GLU B CD    
1866 O OE1   . GLU B 97  ? 0.7319 0.7213 0.8417 0.0588  0.0256  0.0228  83  GLU B OE1   
1867 O OE2   . GLU B 97  ? 0.8037 0.8235 0.9323 0.0494  0.0431  0.0084  83  GLU B OE2   
1868 N N     . LYS B 98  ? 0.7721 0.6344 0.7560 0.0275  0.0495  0.0500  84  LYS B N     
1869 C CA    . LYS B 98  ? 0.7878 0.6203 0.7408 0.0150  0.0561  0.0499  84  LYS B CA    
1870 C C     . LYS B 98  ? 0.8393 0.6438 0.7605 0.0029  0.0671  0.0531  84  LYS B C     
1871 O O     . LYS B 98  ? 0.8903 0.6898 0.7945 -0.0187 0.0735  0.0444  84  LYS B O     
1872 C CB    . LYS B 98  ? 0.7833 0.5853 0.7206 0.0283  0.0555  0.0599  84  LYS B CB    
1873 C CG    . LYS B 98  ? 0.7710 0.5839 0.7174 0.0255  0.0476  0.0533  84  LYS B CG    
1874 N N     . ASN B 99  ? 0.8674 0.6551 0.7798 0.0148  0.0685  0.0664  85  ASN B N     
1875 C CA    . ASN B 99  ? 0.9154 0.6737 0.7947 0.0032  0.0779  0.0709  85  ASN B CA    
1876 C C     . ASN B 99  ? 0.8795 0.6587 0.7638 -0.0135 0.0797  0.0613  85  ASN B C     
1877 O O     . ASN B 99  ? 0.9012 0.6567 0.7571 -0.0247 0.0863  0.0651  85  ASN B O     
1878 C CB    . ASN B 99  ? 0.9739 0.6983 0.8339 0.0211  0.0803  0.0928  85  ASN B CB    
1879 C CG    . ASN B 99  ? 0.9350 0.6820 0.8244 0.0426  0.0699  0.1053  85  ASN B CG    
1880 O OD1   . ASN B 99  ? 0.9113 0.6463 0.8026 0.0614  0.0704  0.1182  85  ASN B OD1   
1881 N ND2   . ASN B 99  ? 0.9497 0.7264 0.8582 0.0384  0.0621  0.1023  85  ASN B ND2   
1882 N N     . GLY B 100 ? 0.8399 0.6605 0.7583 -0.0147 0.0752  0.0493  86  GLY B N     
1883 C CA    . GLY B 100 ? 0.8470 0.6874 0.7701 -0.0319 0.0817  0.0369  86  GLY B CA    
1884 C C     . GLY B 100 ? 0.8497 0.6900 0.7702 -0.0304 0.0811  0.0413  86  GLY B C     
1885 O O     . GLY B 100 ? 0.8482 0.6972 0.7655 -0.0459 0.0894  0.0311  86  GLY B O     
1886 N N     . TRP B 101 ? 0.8236 0.6555 0.7450 -0.0137 0.0717  0.0564  87  TRP B N     
1887 C CA    . TRP B 101 ? 0.8145 0.6447 0.7280 -0.0167 0.0688  0.0625  87  TRP B CA    
1888 C C     . TRP B 101 ? 0.7724 0.6296 0.7112 -0.0123 0.0668  0.0522  87  TRP B C     
1889 O O     . TRP B 101 ? 0.7716 0.6253 0.6994 -0.0197 0.0670  0.0528  87  TRP B O     
1890 C CB    . TRP B 101 ? 0.8223 0.6343 0.7241 -0.0041 0.0589  0.0866  87  TRP B CB    
1891 C CG    . TRP B 101 ? 0.8574 0.6361 0.7310 -0.0051 0.0641  0.0980  87  TRP B CG    
1892 C CD1   . TRP B 101 ? 0.8948 0.6524 0.7406 -0.0236 0.0748  0.0904  87  TRP B CD1   
1893 C CD2   . TRP B 101 ? 0.8666 0.6264 0.7345 0.0134  0.0608  0.1193  87  TRP B CD2   
1894 N NE1   . TRP B 101 ? 0.9398 0.6616 0.7593 -0.0175 0.0780  0.1052  87  TRP B NE1   
1895 C CE2   . TRP B 101 ? 0.9339 0.6568 0.7680 0.0069  0.0706  0.1234  87  TRP B CE2   
1896 C CE3   . TRP B 101 ? 0.8588 0.6288 0.7464 0.0348  0.0522  0.1357  87  TRP B CE3   
1897 C CZ2   . TRP B 101 ? 0.9758 0.6687 0.7950 0.0245  0.0735  0.1439  87  TRP B CZ2   
1898 C CZ3   . TRP B 101 ? 0.8916 0.6385 0.7696 0.0519  0.0551  0.1561  87  TRP B CZ3   
1899 C CH2   . TRP B 101 ? 0.9475 0.6548 0.7915 0.0482  0.0664  0.1602  87  TRP B CH2   
1900 N N     . VAL B 102 ? 0.7308 0.6103 0.6991 -0.0007 0.0648  0.0437  88  VAL B N     
1901 C CA    . VAL B 102 ? 0.6985 0.5991 0.6903 0.0079  0.0633  0.0353  88  VAL B CA    
1902 C C     . VAL B 102 ? 0.6815 0.6110 0.7036 0.0113  0.0679  0.0208  88  VAL B C     
1903 O O     . VAL B 102 ? 0.6586 0.5921 0.6850 0.0093  0.0665  0.0205  88  VAL B O     
1904 C CB    . VAL B 102 ? 0.6651 0.5635 0.6638 0.0249  0.0498  0.0480  88  VAL B CB    
1905 C CG1   . VAL B 102 ? 0.6454 0.5615 0.6672 0.0360  0.0481  0.0386  88  VAL B CG1   
1906 C CG2   . VAL B 102 ? 0.6888 0.5700 0.6638 0.0193  0.0441  0.0627  88  VAL B CG2   
1907 N N     . ARG B 103 ? 0.6964 0.6447 0.7374 0.0152  0.0743  0.0096  89  ARG B N     
1908 C CA    . ARG B 103 ? 0.7021 0.6845 0.7795 0.0233  0.0764  -0.0005 89  ARG B CA    
1909 C C     . ARG B 103 ? 0.6957 0.6848 0.7901 0.0412  0.0752  -0.0033 89  ARG B C     
1910 O O     . ARG B 103 ? 0.6950 0.6619 0.7688 0.0411  0.0770  -0.0012 89  ARG B O     
1911 C CB    . ARG B 103 ? 0.7053 0.7095 0.7922 0.0081  0.0923  -0.0127 89  ARG B CB    
1912 C CG    . ARG B 103 ? 0.7257 0.7234 0.8025 0.0021  0.1089  -0.0212 89  ARG B CG    
1913 C CD    . ARG B 103 ? 0.7434 0.7647 0.8305 -0.0139 0.1268  -0.0330 89  ARG B CD    
1914 N NE    . ARG B 103 ? 0.7639 0.7746 0.8382 -0.0193 0.1460  -0.0421 89  ARG B NE    
1915 C CZ    . ARG B 103 ? 0.7736 0.8013 0.8721 -0.0054 0.1597  -0.0509 89  ARG B CZ    
1916 N NH1   . ARG B 103 ? 0.7591 0.8202 0.9006 0.0163  0.1547  -0.0506 89  ARG B NH1   
1917 N NH2   . ARG B 103 ? 0.8015 0.8093 0.8780 -0.0132 0.1799  -0.0595 89  ARG B NH2   
1918 N N     . ARG B 104 ? 0.6961 0.7136 0.8247 0.0550  0.0716  -0.0070 90  ARG B N     
1919 C CA    . ARG B 104 ? 0.7072 0.7281 0.8515 0.0747  0.0703  -0.0088 90  ARG B CA    
1920 C C     . ARG B 104 ? 0.7226 0.7748 0.8996 0.0830  0.0849  -0.0195 90  ARG B C     
1921 O O     . ARG B 104 ? 0.7227 0.8094 0.9251 0.0768  0.0886  -0.0230 90  ARG B O     
1922 C CB    . ARG B 104 ? 0.6894 0.7148 0.8466 0.0885  0.0522  -0.0010 90  ARG B CB    
1923 C CG    . ARG B 104 ? 0.6887 0.6837 0.8186 0.0878  0.0401  0.0106  90  ARG B CG    
1924 C CD    . ARG B 104 ? 0.6824 0.6814 0.8176 0.0894  0.0275  0.0174  90  ARG B CD    
1925 N NE    . ARG B 104 ? 0.6887 0.6699 0.8150 0.1002  0.0156  0.0268  90  ARG B NE    
1926 C CZ    . ARG B 104 ? 0.6959 0.6734 0.8219 0.1035  0.0058  0.0330  90  ARG B CZ    
1927 N NH1   . ARG B 104 ? 0.7049 0.6919 0.8350 0.0951  0.0051  0.0310  90  ARG B NH1   
1928 N NH2   . ARG B 104 ? 0.7038 0.6658 0.8219 0.1130  -0.0027 0.0412  90  ARG B NH2   
1929 N N     . GLU B 105 ? 0.7487 0.7881 0.9238 0.0966  0.0939  -0.0238 91  GLU B N     
1930 C CA    . GLU B 105 ? 0.7849 0.8506 0.9935 0.1127  0.1096  -0.0318 91  GLU B CA    
1931 C C     . GLU B 105 ? 0.8085 0.8592 1.0206 0.1374  0.1055  -0.0296 91  GLU B C     
1932 O O     . GLU B 105 ? 0.8096 0.8234 0.9896 0.1368  0.0950  -0.0245 91  GLU B O     
1933 C CB    . GLU B 105 ? 0.8153 0.8694 1.0083 0.1030  0.1361  -0.0426 91  GLU B CB    
1934 C CG    . GLU B 105 ? 0.8399 0.9283 1.0514 0.0868  0.1480  -0.0482 91  GLU B CG    
1935 C CD    . GLU B 105 ? 0.8835 0.9599 1.0801 0.0784  0.1773  -0.0599 91  GLU B CD    
1936 O OE1   . GLU B 105 ? 0.9121 0.9498 1.0809 0.0851  0.1888  -0.0640 91  GLU B OE1   
1937 O OE2   . GLU B 105 ? 0.8782 0.9810 1.0871 0.0631  0.1897  -0.0653 91  GLU B OE2   
1938 N N     . ASP B 106 ? 0.8032 0.8826 1.0537 0.1586  0.1146  -0.0323 92  ASP B N     
1939 C CA    . ASP B 106 ? 0.8262 0.8886 1.0794 0.1846  0.1133  -0.0302 92  ASP B CA    
1940 C C     . ASP B 106 ? 0.8609 0.8807 1.0818 0.1882  0.1382  -0.0393 92  ASP B C     
1941 O O     . ASP B 106 ? 0.8981 0.9200 1.1146 0.1776  0.1602  -0.0480 92  ASP B O     
1942 C CB    . ASP B 106 ? 0.8186 0.9304 1.1285 0.2088  0.1125  -0.0265 92  ASP B CB    
1943 C CG    . ASP B 106 ? 0.7924 0.9542 1.1358 0.1984  0.0929  -0.0192 92  ASP B CG    
1944 O OD1   . ASP B 106 ? 0.8576 1.0201 1.1850 0.1727  0.0891  -0.0205 92  ASP B OD1   
1945 O OD2   . ASP B 106 ? 0.7509 0.9487 1.1335 0.2149  0.0812  -0.0115 92  ASP B OD2   
1946 N N     . CYS B 107 ? 0.8552 0.8323 1.0481 0.2003  0.1357  -0.0378 93  CYS B N     
1947 C CA    . CYS B 107 ? 0.8988 0.8301 1.0579 0.2060  0.1612  -0.0466 93  CYS B CA    
1948 C C     . CYS B 107 ? 0.9432 0.9013 1.1471 0.2380  0.1802  -0.0492 93  CYS B C     
1949 O O     . CYS B 107 ? 0.9533 0.9402 1.1951 0.2599  0.1655  -0.0407 93  CYS B O     
1950 C CB    . CYS B 107 ? 0.9060 0.7798 1.0153 0.2050  0.1517  -0.0435 93  CYS B CB    
1951 S SG    . CYS B 107 ? 0.9363 0.7390 0.9868 0.2051  0.1836  -0.0549 93  CYS B SG    
1952 N N     . PRO B 108 ? 0.9696 0.9196 1.1703 0.2412  0.2135  -0.0598 94  PRO B N     
1953 C CA    . PRO B 108 ? 0.9768 0.9617 1.2292 0.2743  0.2336  -0.0600 94  PRO B CA    
1954 C C     . PRO B 108 ? 1.0193 0.9623 1.2582 0.3063  0.2422  -0.0581 94  PRO B C     
1955 O O     . PRO B 108 ? 1.0347 1.0145 1.3244 0.3380  0.2403  -0.0499 94  PRO B O     
1956 C CB    . PRO B 108 ? 1.0118 0.9971 1.2598 0.2649  0.2694  -0.0724 94  PRO B CB    
1957 C CG    . PRO B 108 ? 1.0348 0.9583 1.2094 0.2313  0.2718  -0.0801 94  PRO B CG    
1958 C CD    . PRO B 108 ? 0.9998 0.9072 1.1489 0.2159  0.2346  -0.0707 94  PRO B CD    
1959 N N     . SER B 109 ? 1.0527 0.9187 1.2218 0.2968  0.2507  -0.0644 95  SER B N     
1960 C CA    . SER B 109 ? 1.0890 0.9016 1.2315 0.3231  0.2608  -0.0638 95  SER B CA    
1961 C C     . SER B 109 ? 1.0693 0.8817 1.2151 0.3312  0.2259  -0.0516 95  SER B C     
1962 O O     . SER B 109 ? 1.1147 0.9117 1.2681 0.3623  0.2283  -0.0464 95  SER B O     
1963 C CB    . SER B 109 ? 1.1372 0.8629 1.1944 0.3027  0.2808  -0.0750 95  SER B CB    
1964 N N     . ASP B 110 ? 1.0253 0.8509 1.1624 0.3036  0.1951  -0.0465 96  ASP B N     
1965 C CA    . ASP B 110 ? 0.9881 0.8091 1.1212 0.3060  0.1632  -0.0358 96  ASP B CA    
1966 C C     . ASP B 110 ? 0.9273 0.8169 1.1121 0.2992  0.1363  -0.0270 96  ASP B C     
1967 O O     . ASP B 110 ? 0.9107 0.8105 1.0845 0.2704  0.1243  -0.0270 96  ASP B O     
1968 C CB    . ASP B 110 ? 1.0065 0.7694 1.0705 0.2768  0.1536  -0.0371 96  ASP B CB    
1969 C CG    . ASP B 110 ? 1.0105 0.7532 1.0588 0.2811  0.1281  -0.0277 96  ASP B CG    
1970 O OD1   . ASP B 110 ? 0.9690 0.7527 1.0611 0.2962  0.1086  -0.0189 96  ASP B OD1   
1971 O OD2   . ASP B 110 ? 1.0328 0.7177 1.0218 0.2665  0.1272  -0.0288 96  ASP B OD2   
1972 N N     . LYS B 111 ? 0.8902 0.8230 1.1272 0.3249  0.1266  -0.0184 97  LYS B N     
1973 C CA    . LYS B 111 ? 0.8420 0.8402 1.1279 0.3184  0.1037  -0.0101 97  LYS B CA    
1974 C C     . LYS B 111 ? 0.8208 0.8074 1.0837 0.2998  0.0730  -0.0034 97  LYS B C     
1975 O O     . LYS B 111 ? 0.8208 0.8466 1.1141 0.2983  0.0511  0.0051  97  LYS B O     
1976 C CB    . LYS B 111 ? 0.8453 0.8913 1.1902 0.3502  0.1003  -0.0004 97  LYS B CB    
1977 N N     . ARG B 112 ? 0.8298 0.7632 1.0376 0.2831  0.0731  -0.0071 98  ARG B N     
1978 C CA    . ARG B 112 ? 0.7885 0.7021 0.9687 0.2682  0.0492  -0.0005 98  ARG B CA    
1979 C C     . ARG B 112 ? 0.7646 0.6717 0.9190 0.2377  0.0485  -0.0027 98  ARG B C     
1980 O O     . ARG B 112 ? 0.7527 0.6715 0.9070 0.2238  0.0307  0.0038  98  ARG B O     
1981 C CB    . ARG B 112 ? 0.8152 0.6702 0.9511 0.2761  0.0515  -0.0007 98  ARG B CB    
1982 C CG    . ARG B 112 ? 0.7843 0.6180 0.8951 0.2676  0.0281  0.0073  98  ARG B CG    
1983 C CD    . ARG B 112 ? 0.8169 0.6113 0.9083 0.2888  0.0277  0.0094  98  ARG B CD    
1984 N NE    . ARG B 112 ? 0.8321 0.5654 0.8621 0.2750  0.0309  0.0074  98  ARG B NE    
1985 C CZ    . ARG B 112 ? 0.8662 0.5576 0.8563 0.2673  0.0519  -0.0008 98  ARG B CZ    
1986 N NH1   . ARG B 112 ? 0.8861 0.5869 0.8902 0.2737  0.0748  -0.0091 98  ARG B NH1   
1987 N NH2   . ARG B 112 ? 0.8996 0.5380 0.8320 0.2503  0.0504  -0.0007 98  ARG B NH2   
1988 N N     . GLY B 113 ? 0.7882 0.6737 0.9187 0.2280  0.0694  -0.0111 99  GLY B N     
1989 C CA    . GLY B 113 ? 0.7758 0.6523 0.8789 0.1994  0.0698  -0.0119 99  GLY B CA    
1990 C C     . GLY B 113 ? 0.7375 0.6578 0.8708 0.1884  0.0690  -0.0122 99  GLY B C     
1991 O O     . GLY B 113 ? 0.7119 0.6706 0.8862 0.1998  0.0752  -0.0150 99  GLY B O     
1992 N N     . GLN B 114 ? 0.7273 0.6416 0.8390 0.1655  0.0611  -0.0078 100 GLN B N     
1993 C CA    . GLN B 114 ? 0.7004 0.6432 0.8271 0.1511  0.0621  -0.0081 100 GLN B CA    
1994 C C     . GLN B 114 ? 0.7218 0.6403 0.8114 0.1283  0.0694  -0.0087 100 GLN B C     
1995 O O     . GLN B 114 ? 0.7225 0.6117 0.7787 0.1190  0.0623  -0.0025 100 GLN B O     
1996 C CB    . GLN B 114 ? 0.6645 0.6263 0.8048 0.1481  0.0419  0.0015  100 GLN B CB    
1997 C CG    . GLN B 114 ? 0.6651 0.6559 0.8425 0.1657  0.0330  0.0028  100 GLN B CG    
1998 C CD    . GLN B 114 ? 0.6687 0.7008 0.8822 0.1663  0.0426  -0.0030 100 GLN B CD    
1999 O OE1   . GLN B 114 ? 0.6640 0.7183 0.9079 0.1840  0.0475  -0.0053 100 GLN B OE1   
2000 N NE2   . GLN B 114 ? 0.6733 0.7163 0.8834 0.1467  0.0465  -0.0045 100 GLN B NE2   
2001 N N     . PHE B 115 ? 0.6584 0.7320 0.6944 0.0478  0.0075  -0.0662 101 PHE B N     
2002 C CA    . PHE B 115 ? 0.6480 0.7313 0.6694 0.0561  0.0220  -0.0797 101 PHE B CA    
2003 C C     . PHE B 115 ? 0.6601 0.7328 0.6530 0.0375  0.0204  -0.0737 101 PHE B C     
2004 O O     . PHE B 115 ? 0.6680 0.7391 0.6606 0.0219  0.0085  -0.0567 101 PHE B O     
2005 C CB    . PHE B 115 ? 0.6468 0.7729 0.6931 0.0746  0.0332  -0.0761 101 PHE B CB    
2006 C CG    . PHE B 115 ? 0.6525 0.7835 0.7124 0.1026  0.0390  -0.0937 101 PHE B CG    
2007 C CD1   . PHE B 115 ? 0.6623 0.7787 0.7014 0.1163  0.0450  -0.1185 101 PHE B CD1   
2008 C CD2   . PHE B 115 ? 0.6504 0.7983 0.7434 0.1169  0.0359  -0.0861 101 PHE B CD2   
2009 C CE1   . PHE B 115 ? 0.6736 0.7859 0.7196 0.1440  0.0453  -0.1384 101 PHE B CE1   
2010 C CE2   . PHE B 115 ? 0.6847 0.8305 0.7863 0.1470  0.0391  -0.1057 101 PHE B CE2   
2011 C CZ    . PHE B 115 ? 0.6876 0.8126 0.7632 0.1608  0.0425  -0.1334 101 PHE B CZ    
2012 N N     . ALA B 116 ? 0.6587 0.7210 0.6282 0.0399  0.0295  -0.0879 102 ALA B N     
2013 C CA    . ALA B 116 ? 0.6737 0.7287 0.6188 0.0285  0.0301  -0.0849 102 ALA B CA    
2014 C C     . ALA B 116 ? 0.6853 0.7720 0.6395 0.0382  0.0421  -0.0853 102 ALA B C     
2015 O O     . ALA B 116 ? 0.6832 0.7782 0.6362 0.0544  0.0529  -0.1008 102 ALA B O     
2016 C CB    . ALA B 116 ? 0.6905 0.7165 0.6060 0.0264  0.0331  -0.0975 102 ALA B CB    
2017 N N     . ILE B 117 ? 0.6806 0.7854 0.6441 0.0283  0.0381  -0.0664 103 ILE B N     
2018 C CA    . ILE B 117 ? 0.6562 0.8003 0.6328 0.0368  0.0500  -0.0585 103 ILE B CA    
2019 C C     . ILE B 117 ? 0.6655 0.7963 0.6238 0.0217  0.0451  -0.0516 103 ILE B C     
2020 O O     . ILE B 117 ? 0.6605 0.7664 0.6124 0.0029  0.0276  -0.0409 103 ILE B O     
2021 C CB    . ILE B 117 ? 0.6507 0.8385 0.6670 0.0378  0.0492  -0.0330 103 ILE B CB    
2022 C CG1   . ILE B 117 ? 0.6584 0.8543 0.6942 0.0539  0.0514  -0.0394 103 ILE B CG1   
2023 C CG2   . ILE B 117 ? 0.6331 0.8702 0.6627 0.0489  0.0651  -0.0201 103 ILE B CG2   
2024 C CD1   . ILE B 117 ? 0.6712 0.9050 0.7498 0.0522  0.0465  -0.0115 103 ILE B CD1   
2025 N N     . LEU B 118 ? 0.6532 0.7980 0.6016 0.0312  0.0580  -0.0583 104 LEU B N     
2026 C CA    . LEU B 118 ? 0.6516 0.7882 0.5875 0.0194  0.0539  -0.0497 104 LEU B CA    
2027 C C     . LEU B 118 ? 0.6510 0.8250 0.6174 0.0093  0.0494  -0.0170 104 LEU B C     
2028 O O     . LEU B 118 ? 0.6341 0.8585 0.6222 0.0226  0.0640  -0.0056 104 LEU B O     
2029 C CB    . LEU B 118 ? 0.6397 0.7831 0.5577 0.0336  0.0685  -0.0653 104 LEU B CB    
2030 C CG    . LEU B 118 ? 0.6296 0.7692 0.5360 0.0257  0.0669  -0.0572 104 LEU B CG    
2031 C CD1   . LEU B 118 ? 0.6330 0.7216 0.5186 0.0113  0.0519  -0.0617 104 LEU B CD1   
2032 C CD2   . LEU B 118 ? 0.6158 0.7669 0.5064 0.0420  0.0805  -0.0730 104 LEU B CD2   
2033 N N     . THR B 119 ? 0.6781 0.8275 0.6459 -0.0132 0.0280  -0.0008 105 THR B N     
2034 C CA    . THR B 119 ? 0.6741 0.8564 0.6773 -0.0281 0.0179  0.0360  105 THR B CA    
2035 C C     . THR B 119 ? 0.6852 0.8957 0.6905 -0.0248 0.0293  0.0477  105 THR B C     
2036 O O     . THR B 119 ? 0.6881 0.8804 0.6624 -0.0145 0.0395  0.0253  105 THR B O     
2037 C CB    . THR B 119 ? 0.7035 0.8387 0.7020 -0.0542 -0.0150 0.0468  105 THR B CB    
2038 O OG1   . THR B 119 ? 0.7206 0.8055 0.6788 -0.0554 -0.0205 0.0270  105 THR B OG1   
2039 C CG2   . THR B 119 ? 0.7197 0.8266 0.7125 -0.0593 -0.0300 0.0386  105 THR B CG2   
2040 N N     . ASP B 120 ? 0.6997 0.9566 0.7441 -0.0348 0.0263  0.0866  106 ASP B N     
2041 C CA    . ASP B 120 ? 0.7076 0.9889 0.7558 -0.0369 0.0320  0.1054  106 ASP B CA    
2042 C C     . ASP B 120 ? 0.7400 0.9574 0.7578 -0.0510 0.0125  0.0929  106 ASP B C     
2043 O O     . ASP B 120 ? 0.7370 0.9501 0.7309 -0.0406 0.0244  0.0795  106 ASP B O     
2044 C CB    . ASP B 120 ? 0.7119 1.0491 0.8138 -0.0525 0.0249  0.1578  106 ASP B CB    
2045 C CG    . ASP B 120 ? 0.7070 1.1256 0.8390 -0.0303 0.0532  0.1757  106 ASP B CG    
2046 O OD1   . ASP B 120 ? 0.6847 1.1189 0.7894 -0.0001 0.0800  0.1475  106 ASP B OD1   
2047 O OD2   . ASP B 120 ? 0.7359 1.2033 0.9203 -0.0422 0.0470  0.2195  106 ASP B OD2   
2048 N N     . GLU B 121 ? 0.7750 0.9418 0.7924 -0.0726 -0.0186 0.0967  107 GLU B N     
2049 C CA    . GLU B 121 ? 0.8269 0.9287 0.8142 -0.0827 -0.0399 0.0849  107 GLU B CA    
2050 C C     . GLU B 121 ? 0.8010 0.8680 0.7404 -0.0625 -0.0236 0.0428  107 GLU B C     
2051 O O     . GLU B 121 ? 0.8289 0.8703 0.7480 -0.0599 -0.0250 0.0347  107 GLU B O     
2052 C CB    . GLU B 121 ? 0.8660 0.9117 0.8519 -0.1052 -0.0795 0.0909  107 GLU B CB    
2053 C CG    . GLU B 121 ? 0.8981 0.9319 0.8791 -0.1050 -0.0852 0.0793  107 GLU B CG    
2054 C CD    . GLU B 121 ? 0.9106 1.0064 0.9445 -0.1119 -0.0827 0.1111  107 GLU B CD    
2055 O OE1   . GLU B 121 ? 0.9222 1.0827 0.9964 -0.1114 -0.0680 0.1419  107 GLU B OE1   
2056 O OE2   . GLU B 121 ? 0.9161 0.9981 0.9503 -0.1158 -0.0945 0.1065  107 GLU B OE2   
2057 N N     . GLY B 122 ? 0.7549 0.8258 0.6823 -0.0484 -0.0084 0.0201  108 GLY B N     
2058 C CA    . GLY B 122 ? 0.7392 0.7873 0.6314 -0.0307 0.0073  -0.0138 108 GLY B CA    
2059 C C     . GLY B 122 ? 0.7361 0.8178 0.6279 -0.0168 0.0285  -0.0169 108 GLY B C     
2060 O O     . GLY B 122 ? 0.7636 0.8217 0.6327 -0.0110 0.0312  -0.0310 108 GLY B O     
2061 N N     . TYR B 123 ? 0.7240 0.8621 0.6394 -0.0097 0.0430  -0.0026 109 TYR B N     
2062 C CA    . TYR B 123 ? 0.7151 0.8890 0.6265 0.0041  0.0606  -0.0022 109 TYR B CA    
2063 C C     . TYR B 123 ? 0.7032 0.8708 0.6144 -0.0068 0.0516  0.0159  109 TYR B C     
2064 O O     . TYR B 123 ? 0.6696 0.8401 0.5641 0.0028  0.0601  0.0069  109 TYR B O     
2065 C CB    . TYR B 123 ? 0.7320 0.9701 0.6668 0.0154  0.0765  0.0153  109 TYR B CB    
2066 C CG    . TYR B 123 ? 0.7480 1.0199 0.6660 0.0376  0.0962  0.0059  109 TYR B CG    
2067 C CD1   . TYR B 123 ? 0.7548 1.0154 0.6494 0.0575  0.1054  -0.0281 109 TYR B CD1   
2068 C CD2   . TYR B 123 ? 0.7712 1.0859 0.6964 0.0384  0.1030  0.0328  109 TYR B CD2   
2069 C CE1   . TYR B 123 ? 0.7918 1.0771 0.6656 0.0787  0.1185  -0.0397 109 TYR B CE1   
2070 C CE2   . TYR B 123 ? 0.8104 1.1552 0.7126 0.0608  0.1198  0.0230  109 TYR B CE2   
2071 C CZ    . TYR B 123 ? 0.8203 1.1480 0.6946 0.0815  0.1264  -0.0152 109 TYR B CZ    
2072 O OH    . TYR B 123 ? 0.8497 1.2014 0.6962 0.1044  0.1380  -0.0272 109 TYR B OH    
2073 N N     . GLU B 124 ? 0.7339 0.8906 0.6656 -0.0278 0.0309  0.0426  110 GLU B N     
2074 C CA    . GLU B 124 ? 0.7575 0.9014 0.6929 -0.0400 0.0172  0.0620  110 GLU B CA    
2075 C C     . GLU B 124 ? 0.7591 0.8384 0.6611 -0.0377 0.0069  0.0357  110 GLU B C     
2076 O O     . GLU B 124 ? 0.7688 0.8420 0.6663 -0.0376 0.0044  0.0419  110 GLU B O     
2077 C CB    . GLU B 124 ? 0.7774 0.9243 0.7491 -0.0651 -0.0077 0.1008  110 GLU B CB    
2078 C CG    . GLU B 124 ? 0.7747 0.9966 0.7842 -0.0682 0.0034  0.1430  110 GLU B CG    
2079 C CD    . GLU B 124 ? 0.7853 1.0214 0.7857 -0.0632 0.0110  0.1519  110 GLU B CD    
2080 O OE1   . GLU B 124 ? 0.7860 0.9693 0.7744 -0.0728 -0.0091 0.1478  110 GLU B OE1   
2081 O OE2   . GLU B 124 ? 0.7661 1.0650 0.7683 -0.0471 0.0367  0.1617  110 GLU B OE2   
2082 N N     . VAL B 125 ? 0.7497 0.7854 0.6290 -0.0337 0.0025  0.0087  111 VAL B N     
2083 C CA    . VAL B 125 ? 0.7467 0.7300 0.5928 -0.0248 -0.0009 -0.0168 111 VAL B CA    
2084 C C     . VAL B 125 ? 0.7131 0.7166 0.5471 -0.0065 0.0224  -0.0347 111 VAL B C     
2085 O O     . VAL B 125 ? 0.7185 0.6991 0.5379 0.0005  0.0220  -0.0432 111 VAL B O     
2086 C CB    . VAL B 125 ? 0.7611 0.6994 0.5833 -0.0226 -0.0091 -0.0380 111 VAL B CB    
2087 C CG1   . VAL B 125 ? 0.7930 0.6887 0.5810 -0.0075 -0.0062 -0.0621 111 VAL B CG1   
2088 C CG2   . VAL B 125 ? 0.7804 0.6869 0.6080 -0.0410 -0.0391 -0.0233 111 VAL B CG2   
2089 N N     . LEU B 126 ? 0.6816 0.7257 0.5227 0.0022  0.0401  -0.0404 112 LEU B N     
2090 C CA    . LEU B 126 ? 0.6782 0.7395 0.5093 0.0174  0.0559  -0.0560 112 LEU B CA    
2091 C C     . LEU B 126 ? 0.6938 0.7804 0.5296 0.0174  0.0573  -0.0393 112 LEU B C     
2092 O O     . LEU B 126 ? 0.7162 0.7919 0.5413 0.0235  0.0583  -0.0468 112 LEU B O     
2093 C CB    . LEU B 126 ? 0.6543 0.7466 0.4892 0.0280  0.0693  -0.0672 112 LEU B CB    
2094 C CG    . LEU B 126 ? 0.6523 0.7190 0.4793 0.0324  0.0705  -0.0886 112 LEU B CG    
2095 C CD1   . LEU B 126 ? 0.6727 0.7168 0.5026 0.0211  0.0596  -0.0820 112 LEU B CD1   
2096 C CD2   . LEU B 126 ? 0.6672 0.7589 0.4987 0.0444  0.0802  -0.1012 112 LEU B CD2   
2097 N N     . ARG B 127 ? 0.7024 0.8275 0.5568 0.0109  0.0578  -0.0134 113 ARG B N     
2098 C CA    . ARG B 127 ? 0.7348 0.8923 0.5942 0.0108  0.0604  0.0083  113 ARG B CA    
2099 C C     . ARG B 127 ? 0.7239 0.8424 0.5819 0.0011  0.0438  0.0164  113 ARG B C     
2100 O O     . ARG B 127 ? 0.7051 0.8300 0.5555 0.0069  0.0461  0.0180  113 ARG B O     
2101 C CB    . ARG B 127 ? 0.7864 0.9953 0.6719 0.0039  0.0634  0.0428  113 ARG B CB    
2102 C CG    . ARG B 127 ? 0.8445 1.1067 0.7294 0.0120  0.0752  0.0638  113 ARG B CG    
2103 C CD    . ARG B 127 ? 0.9000 1.2213 0.8158 0.0054  0.0801  0.1062  113 ARG B CD    
2104 N NE    . ARG B 127 ? 0.9590 1.2642 0.9086 -0.0217 0.0572  0.1404  113 ARG B NE    
2105 C CZ    . ARG B 127 ? 1.0073 1.2946 0.9651 -0.0362 0.0404  0.1619  113 ARG B CZ    
2106 N NH1   . ARG B 127 ? 1.0299 1.3156 0.9651 -0.0264 0.0455  0.1540  113 ARG B NH1   
2107 N NH2   . ARG B 127 ? 1.0426 1.3095 1.0327 -0.0615 0.0146  0.1921  113 ARG B NH2   
2108 N N     . ARG B 128 ? 0.7041 0.7795 0.5676 -0.0121 0.0250  0.0204  114 ARG B N     
2109 C CA    . ARG B 128 ? 0.7258 0.7545 0.5852 -0.0182 0.0057  0.0250  114 ARG B CA    
2110 C C     . ARG B 128 ? 0.7303 0.7279 0.5646 -0.0013 0.0124  -0.0040 114 ARG B C     
2111 O O     . ARG B 128 ? 0.7354 0.7234 0.5688 0.0018  0.0078  0.0017  114 ARG B O     
2112 C CB    . ARG B 128 ? 0.7349 0.7169 0.5991 -0.0335 -0.0200 0.0310  114 ARG B CB    
2113 N N     . THR B 129 ? 0.7287 0.7166 0.5476 0.0097  0.0237  -0.0308 115 THR B N     
2114 C CA    . THR B 129 ? 0.7718 0.7303 0.5726 0.0246  0.0286  -0.0529 115 THR B CA    
2115 C C     . THR B 129 ? 0.7386 0.7277 0.5391 0.0370  0.0458  -0.0646 115 THR B C     
2116 O O     . THR B 129 ? 0.7569 0.7345 0.5537 0.0470  0.0476  -0.0704 115 THR B O     
2117 C CB    . THR B 129 ? 0.7991 0.7226 0.5825 0.0291  0.0276  -0.0717 115 THR B CB    
2118 O OG1   . THR B 129 ? 0.8267 0.7786 0.6152 0.0283  0.0392  -0.0783 115 THR B OG1   
2119 C CG2   . THR B 129 ? 0.8276 0.7095 0.6050 0.0179  0.0044  -0.0641 115 THR B CG2   
2120 N N     . ALA B 130 ? 0.7143 0.7398 0.5195 0.0374  0.0558  -0.0677 116 ALA B N     
2121 C CA    . ALA B 130 ? 0.7244 0.7721 0.5280 0.0477  0.0654  -0.0804 116 ALA B CA    
2122 C C     . ALA B 130 ? 0.7487 0.8018 0.5530 0.0525  0.0630  -0.0751 116 ALA B C     
2123 O O     . ALA B 130 ? 0.7796 0.8254 0.5852 0.0604  0.0653  -0.0857 116 ALA B O     
2124 C CB    . ALA B 130 ? 0.7309 0.8160 0.5354 0.0497  0.0720  -0.0818 116 ALA B CB    
2125 N N     . PRO B 131 ? 0.7549 0.8246 0.5620 0.0474  0.0579  -0.0550 117 PRO B N     
2126 C CA    . PRO B 131 ? 0.7530 0.8263 0.5615 0.0515  0.0534  -0.0475 117 PRO B CA    
2127 C C     . PRO B 131 ? 0.7629 0.8005 0.5746 0.0582  0.0502  -0.0541 117 PRO B C     
2128 O O     . PRO B 131 ? 0.7832 0.8278 0.5995 0.0662  0.0515  -0.0586 117 PRO B O     
2129 C CB    . PRO B 131 ? 0.7780 0.8633 0.5924 0.0416  0.0456  -0.0192 117 PRO B CB    
2130 C CG    . PRO B 131 ? 0.7789 0.8781 0.5977 0.0327  0.0478  -0.0103 117 PRO B CG    
2131 C CD    . PRO B 131 ? 0.7492 0.8440 0.5615 0.0383  0.0570  -0.0349 117 PRO B CD    
2132 N N     . GLY B 132 ? 0.7585 0.7588 0.5674 0.0566  0.0449  -0.0542 118 GLY B N     
2133 C CA    . GLY B 132 ? 0.7530 0.7188 0.5581 0.0694  0.0450  -0.0638 118 GLY B CA    
2134 C C     . GLY B 132 ? 0.7325 0.7093 0.5389 0.0795  0.0586  -0.0801 118 GLY B C     
2135 O O     . GLY B 132 ? 0.7152 0.6995 0.5317 0.0902  0.0628  -0.0805 118 GLY B O     
2136 N N     . HIS B 133 ? 0.7006 0.6807 0.5016 0.0753  0.0642  -0.0901 119 HIS B N     
2137 C CA    . HIS B 133 ? 0.6892 0.6786 0.4952 0.0823  0.0747  -0.1014 119 HIS B CA    
2138 C C     . HIS B 133 ? 0.6852 0.7069 0.5082 0.0826  0.0752  -0.1007 119 HIS B C     
2139 O O     . HIS B 133 ? 0.6986 0.7276 0.5359 0.0897  0.0800  -0.1018 119 HIS B O     
2140 C CB    . HIS B 133 ? 0.6751 0.6635 0.4748 0.0760  0.0777  -0.1098 119 HIS B CB    
2141 C CG    . HIS B 133 ? 0.6530 0.6521 0.4624 0.0807  0.0861  -0.1172 119 HIS B CG    
2142 N ND1   . HIS B 133 ? 0.6598 0.6479 0.4677 0.0921  0.0946  -0.1177 119 HIS B ND1   
2143 C CD2   . HIS B 133 ? 0.6347 0.6547 0.4565 0.0762  0.0859  -0.1221 119 HIS B CD2   
2144 C CE1   . HIS B 133 ? 0.6628 0.6693 0.4872 0.0913  0.0996  -0.1184 119 HIS B CE1   
2145 N NE2   . HIS B 133 ? 0.6262 0.6478 0.4594 0.0810  0.0921  -0.1224 119 HIS B NE2   
2146 N N     . VAL B 134 ? 0.6661 0.7082 0.4874 0.0755  0.0691  -0.0971 120 VAL B N     
2147 C CA    . VAL B 134 ? 0.6531 0.7195 0.4827 0.0765  0.0641  -0.0987 120 VAL B CA    
2148 C C     . VAL B 134 ? 0.6554 0.7234 0.4984 0.0823  0.0604  -0.0883 120 VAL B C     
2149 O O     . VAL B 134 ? 0.6560 0.7345 0.5168 0.0853  0.0583  -0.0891 120 VAL B O     
2150 C CB    . VAL B 134 ? 0.6609 0.7491 0.4763 0.0728  0.0595  -0.0982 120 VAL B CB    
2151 C CG1   . VAL B 134 ? 0.6637 0.7707 0.4787 0.0757  0.0495  -0.1006 120 VAL B CG1   
2152 C CG2   . VAL B 134 ? 0.6548 0.7457 0.4629 0.0715  0.0639  -0.1102 120 VAL B CG2   
2153 N N     . ASP B 135 ? 0.6984 0.7565 0.5375 0.0833  0.0577  -0.0762 121 ASP B N     
2154 C CA    . ASP B 135 ? 0.7214 0.7776 0.5751 0.0915  0.0543  -0.0654 121 ASP B CA    
2155 C C     . ASP B 135 ? 0.7132 0.7642 0.5831 0.1033  0.0637  -0.0692 121 ASP B C     
2156 O O     . ASP B 135 ? 0.6961 0.7673 0.5889 0.1071  0.0617  -0.0634 121 ASP B O     
2157 C CB    . ASP B 135 ? 0.7603 0.7915 0.6077 0.0933  0.0497  -0.0541 121 ASP B CB    
2158 C CG    . ASP B 135 ? 0.7877 0.8338 0.6304 0.0831  0.0393  -0.0387 121 ASP B CG    
2159 O OD1   . ASP B 135 ? 0.7687 0.8441 0.6048 0.0772  0.0385  -0.0399 121 ASP B OD1   
2160 O OD2   . ASP B 135 ? 0.8497 0.8766 0.6935 0.0821  0.0313  -0.0247 121 ASP B OD2   
2161 N N     . ALA B 136 ? 0.7207 0.7470 0.5788 0.1097  0.0730  -0.0763 122 ALA B N     
2162 C CA    . ALA B 136 ? 0.7545 0.7786 0.6223 0.1253  0.0859  -0.0775 122 ALA B CA    
2163 C C     . ALA B 136 ? 0.7346 0.7906 0.6280 0.1212  0.0890  -0.0756 122 ALA B C     
2164 O O     . ALA B 136 ? 0.7705 0.8445 0.6894 0.1317  0.0955  -0.0651 122 ALA B O     
2165 C CB    . ALA B 136 ? 0.7711 0.7635 0.6123 0.1315  0.0933  -0.0882 122 ALA B CB    
2166 N N     . VAL B 137 ? 0.7213 0.7846 0.6106 0.1064  0.0828  -0.0838 123 VAL B N     
2167 C CA    . VAL B 137 ? 0.7021 0.7877 0.6156 0.0997  0.0785  -0.0830 123 VAL B CA    
2168 C C     . VAL B 137 ? 0.7049 0.8115 0.6394 0.0950  0.0628  -0.0753 123 VAL B C     
2169 O O     . VAL B 137 ? 0.6952 0.8207 0.6618 0.0925  0.0571  -0.0666 123 VAL B O     
2170 C CB    . VAL B 137 ? 0.7213 0.8012 0.6206 0.0885  0.0740  -0.0970 123 VAL B CB    
2171 C CG1   . VAL B 137 ? 0.7233 0.8185 0.6470 0.0804  0.0617  -0.0978 123 VAL B CG1   
2172 C CG2   . VAL B 137 ? 0.7353 0.7980 0.6205 0.0919  0.0872  -0.1015 123 VAL B CG2   
2173 N N     . ARG B 138 ? 0.6931 0.7978 0.6108 0.0925  0.0536  -0.0759 124 ARG B N     
2174 C CA    . ARG B 138 ? 0.6991 0.8217 0.6316 0.0900  0.0377  -0.0673 124 ARG B CA    
2175 C C     . ARG B 138 ? 0.6966 0.8310 0.6619 0.1001  0.0420  -0.0490 124 ARG B C     
2176 O O     . ARG B 138 ? 0.6741 0.8297 0.6731 0.0974  0.0327  -0.0386 124 ARG B O     
2177 C CB    . ARG B 138 ? 0.7308 0.8515 0.6368 0.0879  0.0305  -0.0665 124 ARG B CB    
2178 C CG    . ARG B 138 ? 0.7498 0.8747 0.6283 0.0810  0.0212  -0.0799 124 ARG B CG    
2179 C CD    . ARG B 138 ? 0.7632 0.8983 0.6221 0.0809  0.0136  -0.0706 124 ARG B CD    
2180 N NE    . ARG B 138 ? 0.7644 0.9032 0.6435 0.0843  0.0095  -0.0519 124 ARG B NE    
2181 C CZ    . ARG B 138 ? 0.7746 0.9020 0.6561 0.0883  0.0165  -0.0387 124 ARG B CZ    
2182 N NH1   . ARG B 138 ? 0.7617 0.8724 0.6269 0.0868  0.0260  -0.0399 124 ARG B NH1   
2183 N NH2   . ARG B 138 ? 0.7815 0.9122 0.6843 0.0939  0.0109  -0.0229 124 ARG B NH2   
2184 N N     . GLN B 139 ? 0.7089 0.8282 0.6653 0.1126  0.0543  -0.0444 125 GLN B N     
2185 C CA    . GLN B 139 ? 0.6956 0.8235 0.6778 0.1278  0.0589  -0.0279 125 GLN B CA    
2186 C C     . GLN B 139 ? 0.6840 0.8329 0.6999 0.1377  0.0719  -0.0182 125 GLN B C     
2187 O O     . GLN B 139 ? 0.6917 0.8685 0.7468 0.1430  0.0690  0.0005  125 GLN B O     
2188 C CB    . GLN B 139 ? 0.7154 0.8124 0.6746 0.1406  0.0660  -0.0294 125 GLN B CB    
2189 C CG    . GLN B 139 ? 0.7349 0.8251 0.6787 0.1304  0.0500  -0.0256 125 GLN B CG    
2190 C CD    . GLN B 139 ? 0.7743 0.8291 0.6982 0.1377  0.0503  -0.0249 125 GLN B CD    
2191 O OE1   . GLN B 139 ? 0.8061 0.8322 0.7135 0.1467  0.0599  -0.0352 125 GLN B OE1   
2192 N NE2   . GLN B 139 ? 0.7962 0.8505 0.7201 0.1326  0.0365  -0.0119 125 GLN B NE2   
2193 N N     . ALA B 140 ? 0.6723 0.8133 0.6766 0.1384  0.0849  -0.0274 126 ALA B N     
2194 C CA    . ALA B 140 ? 0.6630 0.8291 0.6984 0.1469  0.0991  -0.0143 126 ALA B CA    
2195 C C     . ALA B 140 ? 0.6535 0.8505 0.7303 0.1287  0.0829  -0.0023 126 ALA B C     
2196 O O     . ALA B 140 ? 0.6681 0.8991 0.7896 0.1339  0.0888  0.0206  126 ALA B O     
2197 C CB    . ALA B 140 ? 0.6655 0.8126 0.6720 0.1521  0.1155  -0.0265 126 ALA B CB    
2198 N N     . VAL B 141 ? 0.6508 0.8362 0.7133 0.1087  0.0617  -0.0166 127 VAL B N     
2199 C CA    . VAL B 141 ? 0.6552 0.8566 0.7493 0.0911  0.0413  -0.0112 127 VAL B CA    
2200 C C     . VAL B 141 ? 0.6854 0.8862 0.7791 0.0783  0.0107  -0.0156 127 VAL B C     
2201 O O     . VAL B 141 ? 0.7058 0.9300 0.8387 0.0749  -0.0039 0.0035  127 VAL B O     
2202 C CB    . VAL B 141 ? 0.6320 0.8155 0.7075 0.0817  0.0415  -0.0273 127 VAL B CB    
2203 C CG1   . VAL B 141 ? 0.6213 0.8123 0.7286 0.0636  0.0147  -0.0235 127 VAL B CG1   
2204 C CG2   . VAL B 141 ? 0.6228 0.8097 0.6986 0.0938  0.0691  -0.0203 127 VAL B CG2   
2205 N N     . PHE B 142 ? 0.7252 0.9019 0.7739 0.0727  0.0011  -0.0392 128 PHE B N     
2206 C CA    . PHE B 142 ? 0.7497 0.9234 0.7884 0.0621  -0.0300 -0.0481 128 PHE B CA    
2207 C C     . PHE B 142 ? 0.7556 0.9427 0.8003 0.0642  -0.0422 -0.0354 128 PHE B C     
2208 O O     . PHE B 142 ? 0.7809 0.9758 0.8427 0.0550  -0.0709 -0.0306 128 PHE B O     
2209 C CB    . PHE B 142 ? 0.7610 0.9115 0.7475 0.0612  -0.0325 -0.0752 128 PHE B CB    
2210 C CG    . PHE B 142 ? 0.7614 0.8984 0.7479 0.0570  -0.0298 -0.0876 128 PHE B CG    
2211 C CD1   . PHE B 142 ? 0.7728 0.9032 0.7766 0.0467  -0.0564 -0.0932 128 PHE B CD1   
2212 C CD2   . PHE B 142 ? 0.7532 0.8814 0.7245 0.0625  -0.0045 -0.0923 128 PHE B CD2   
2213 C CE1   . PHE B 142 ? 0.7777 0.8938 0.7845 0.0428  -0.0562 -0.1027 128 PHE B CE1   
2214 C CE2   . PHE B 142 ? 0.7594 0.8764 0.7324 0.0584  -0.0032 -0.1016 128 PHE B CE2   
2215 C CZ    . PHE B 142 ? 0.7709 0.8825 0.7629 0.0488  -0.0281 -0.1062 128 PHE B CZ    
2216 N N     . ASP B 143 ? 0.7475 0.9349 0.7804 0.0758  -0.0238 -0.0287 129 ASP B N     
2217 C CA    . ASP B 143 ? 0.7691 0.9704 0.8141 0.0792  -0.0338 -0.0123 129 ASP B CA    
2218 C C     . ASP B 143 ? 0.7759 1.0057 0.8814 0.0793  -0.0412 0.0134  129 ASP B C     
2219 O O     . ASP B 143 ? 0.7942 1.0386 0.9167 0.0793  -0.0565 0.0285  129 ASP B O     
2220 C CB    . ASP B 143 ? 0.7809 0.9723 0.8085 0.0926  -0.0132 -0.0078 129 ASP B CB    
2221 C CG    . ASP B 143 ? 0.8137 0.9878 0.7907 0.0893  -0.0141 -0.0217 129 ASP B CG    
2222 O OD1   . ASP B 143 ? 0.7983 0.9733 0.7497 0.0807  -0.0301 -0.0340 129 ASP B OD1   
2223 O OD2   . ASP B 143 ? 0.8333 0.9927 0.7963 0.0969  0.0008  -0.0192 129 ASP B OD2   
2224 N N     . ARG B 144 ? 0.9847 0.9328 0.7692 -0.0101 0.0627  0.0803  130 ARG B N     
2225 C CA    . ARG B 144 ? 0.9764 0.9270 0.7750 0.0088  0.0618  0.0754  130 ARG B CA    
2226 C C     . ARG B 144 ? 0.9191 0.9044 0.7263 0.0074  0.0735  0.0650  130 ARG B C     
2227 O O     . ARG B 144 ? 0.9405 0.9353 0.7646 0.0201  0.0728  0.0638  130 ARG B O     
2228 C CB    . ARG B 144 ? 0.9817 0.9064 0.7868 0.0308  0.0650  0.0637  130 ARG B CB    
2229 C CG    . ARG B 144 ? 1.0199 0.9038 0.8180 0.0340  0.0498  0.0689  130 ARG B CG    
2230 C CD    . ARG B 144 ? 1.0368 0.8955 0.8380 0.0619  0.0489  0.0550  130 ARG B CD    
2231 N NE    . ARG B 144 ? 1.0655 0.8932 0.8705 0.0756  0.0271  0.0621  130 ARG B NE    
2232 C CZ    . ARG B 144 ? 1.1356 0.9201 0.9354 0.0863  0.0113  0.0569  130 ARG B CZ    
2233 N NH1   . ARG B 144 ? 1.1379 0.9055 0.9272 0.0847  0.0145  0.0448  130 ARG B NH1   
2234 N NH2   . ARG B 144 ? 1.1846 0.9404 0.9910 0.1000  -0.0109 0.0628  130 ARG B NH2   
2235 N N     . LEU B 145 ? 0.8734 0.8781 0.6721 -0.0073 0.0825  0.0575  131 LEU B N     
2236 C CA    . LEU B 145 ? 0.8603 0.8916 0.6690 -0.0092 0.0902  0.0449  131 LEU B CA    
2237 C C     . LEU B 145 ? 0.8559 0.9132 0.6507 -0.0243 0.0850  0.0456  131 LEU B C     
2238 O O     . LEU B 145 ? 0.8742 0.9359 0.6496 -0.0356 0.0860  0.0498  131 LEU B O     
2239 C CB    . LEU B 145 ? 0.8415 0.8704 0.6541 -0.0082 0.1052  0.0289  131 LEU B CB    
2240 C CG    . LEU B 145 ? 0.8406 0.8448 0.6583 0.0067  0.1111  0.0271  131 LEU B CG    
2241 C CD1   . LEU B 145 ? 0.8319 0.8340 0.6487 0.0045  0.1234  0.0142  131 LEU B CD1   
2242 C CD2   . LEU B 145 ? 0.8378 0.8462 0.6751 0.0232  0.1125  0.0291  131 LEU B CD2   
2243 N N     . THR B 146 ? 0.8703 0.9475 0.6755 -0.0239 0.0793  0.0414  132 THR B N     
2244 C CA    . THR B 146 ? 0.9019 1.0054 0.6909 -0.0354 0.0729  0.0367  132 THR B CA    
2245 C C     . THR B 146 ? 0.8842 0.9965 0.6671 -0.0406 0.0847  0.0158  132 THR B C     
2246 O O     . THR B 146 ? 0.8831 0.9822 0.6811 -0.0355 0.0955  0.0061  132 THR B O     
2247 C CB    . THR B 146 ? 0.9297 1.0509 0.7328 -0.0338 0.0590  0.0359  132 THR B CB    
2248 O OG1   . THR B 146 ? 0.9681 1.1136 0.7502 -0.0434 0.0519  0.0259  132 THR B OG1   
2249 C CG2   . THR B 146 ? 0.8901 1.0114 0.7286 -0.0267 0.0632  0.0251  132 THR B CG2   
2250 N N     . PRO B 147 ? 0.8926 1.0280 0.6512 -0.0492 0.0830  0.0094  133 PRO B N     
2251 C CA    . PRO B 147 ? 0.8900 1.0369 0.6442 -0.0507 0.0918  -0.0144 133 PRO B CA    
2252 C C     . PRO B 147 ? 0.8638 1.0024 0.6466 -0.0453 0.0913  -0.0334 133 PRO B C     
2253 O O     . PRO B 147 ? 0.8504 0.9796 0.6428 -0.0429 0.1016  -0.0457 133 PRO B O     
2254 C CB    . PRO B 147 ? 0.9292 1.1078 0.6542 -0.0561 0.0844  -0.0202 133 PRO B CB    
2255 C CG    . PRO B 147 ? 0.9465 1.1297 0.6566 -0.0606 0.0743  0.0072  133 PRO B CG    
2256 C CD    . PRO B 147 ? 0.9259 1.0781 0.6571 -0.0569 0.0746  0.0263  133 PRO B CD    
2257 N N     . GLU B 148 ? 0.8664 1.0089 0.6661 -0.0443 0.0783  -0.0331 134 GLU B N     
2258 C CA    . GLU B 148 ? 0.8668 1.0030 0.7001 -0.0421 0.0757  -0.0454 134 GLU B CA    
2259 C C     . GLU B 148 ? 0.8513 0.9672 0.7061 -0.0362 0.0903  -0.0391 134 GLU B C     
2260 O O     . GLU B 148 ? 0.8711 0.9799 0.7423 -0.0360 0.0946  -0.0517 134 GLU B O     
2261 C CB    . GLU B 148 ? 0.8674 1.0132 0.7226 -0.0429 0.0592  -0.0387 134 GLU B CB    
2262 N N     . GLN B 149 ? 0.8322 0.9375 0.6847 -0.0305 0.0964  -0.0205 135 GLN B N     
2263 C CA    . GLN B 149 ? 0.7986 0.8866 0.6665 -0.0219 0.1089  -0.0147 135 GLN B CA    
2264 C C     . GLN B 149 ? 0.7994 0.8744 0.6514 -0.0221 0.1200  -0.0220 135 GLN B C     
2265 O O     . GLN B 149 ? 0.8156 0.8794 0.6796 -0.0172 0.1289  -0.0249 135 GLN B O     
2266 C CB    . GLN B 149 ? 0.7834 0.8631 0.6531 -0.0116 0.1094  0.0033  135 GLN B CB    
2267 C CG    . GLN B 149 ? 0.7899 0.8814 0.6603 -0.0120 0.0954  0.0141  135 GLN B CG    
2268 C CD    . GLN B 149 ? 0.7731 0.8588 0.6580 0.0026  0.0957  0.0282  135 GLN B CD    
2269 O OE1   . GLN B 149 ? 0.7903 0.8635 0.6611 0.0076  0.0899  0.0384  135 GLN B OE1   
2270 N NE2   . GLN B 149 ? 0.7527 0.8492 0.6681 0.0100  0.1014  0.0297  135 GLN B NE2   
2271 N N     . GLN B 150 ? 0.8128 0.8913 0.6389 -0.0279 0.1193  -0.0219 136 GLN B N     
2272 C CA    . GLN B 150 ? 0.8200 0.8928 0.6348 -0.0298 0.1286  -0.0291 136 GLN B CA    
2273 C C     . GLN B 150 ? 0.8355 0.9149 0.6604 -0.0306 0.1313  -0.0499 136 GLN B C     
2274 O O     . GLN B 150 ? 0.8238 0.8911 0.6569 -0.0270 0.1390  -0.0556 136 GLN B O     
2275 C CB    . GLN B 150 ? 0.8195 0.9051 0.6093 -0.0381 0.1273  -0.0228 136 GLN B CB    
2276 C CG    . GLN B 150 ? 0.8348 0.9068 0.6172 -0.0384 0.1219  -0.0008 136 GLN B CG    
2277 C CD    . GLN B 150 ? 0.8415 0.9282 0.6027 -0.0499 0.1199  0.0111  136 GLN B CD    
2278 O OE1   . GLN B 150 ? 0.8224 0.9321 0.5737 -0.0559 0.1267  0.0020  136 GLN B OE1   
2279 N NE2   . GLN B 150 ? 0.8554 0.9301 0.6116 -0.0524 0.1105  0.0328  136 GLN B NE2   
2280 N N     . LYS B 151 ? 0.8558 0.9523 0.6800 -0.0344 0.1225  -0.0619 137 LYS B N     
2281 C CA    . LYS B 151 ? 0.8594 0.9572 0.6968 -0.0337 0.1200  -0.0843 137 LYS B CA    
2282 C C     . LYS B 151 ? 0.8330 0.9122 0.7019 -0.0303 0.1217  -0.0794 137 LYS B C     
2283 O O     . LYS B 151 ? 0.8266 0.8942 0.7050 -0.0274 0.1275  -0.0867 137 LYS B O     
2284 C CB    . LYS B 151 ? 0.8882 1.0032 0.7219 -0.0369 0.1051  -0.0983 137 LYS B CB    
2285 C CG    . LYS B 151 ? 0.8943 1.0120 0.7323 -0.0347 0.0988  -0.1279 137 LYS B CG    
2286 C CD    . LYS B 151 ? 0.9124 1.0475 0.7386 -0.0363 0.0816  -0.1430 137 LYS B CD    
2287 C CE    . LYS B 151 ? 0.9292 1.0527 0.7813 -0.0352 0.0650  -0.1671 137 LYS B CE    
2288 N NZ    . LYS B 151 ? 0.9316 1.0612 0.7916 -0.0402 0.0437  -0.1688 137 LYS B NZ    
2289 N N     . SER B 152 ? 0.8314 0.9108 0.7165 -0.0300 0.1174  -0.0644 138 SER B N     
2290 C CA    . SER B 152 ? 0.8174 0.8885 0.7353 -0.0276 0.1195  -0.0555 138 SER B CA    
2291 C C     . SER B 152 ? 0.7867 0.8424 0.7033 -0.0200 0.1341  -0.0468 138 SER B C     
2292 O O     . SER B 152 ? 0.7569 0.8045 0.6928 -0.0193 0.1370  -0.0474 138 SER B O     
2293 C CB    . SER B 152 ? 0.8177 0.9001 0.7521 -0.0269 0.1143  -0.0389 138 SER B CB    
2294 O OG    . SER B 152 ? 0.8265 0.9107 0.7979 -0.0271 0.1152  -0.0296 138 SER B OG    
2295 N N     . LEU B 153 ? 0.7739 0.8241 0.6674 -0.0147 0.1408  -0.0388 139 LEU B N     
2296 C CA    . LEU B 153 ? 0.7530 0.7871 0.6388 -0.0065 0.1514  -0.0338 139 LEU B CA    
2297 C C     . LEU B 153 ? 0.7468 0.7729 0.6322 -0.0084 0.1545  -0.0468 139 LEU B C     
2298 O O     . LEU B 153 ? 0.7470 0.7630 0.6423 -0.0033 0.1600  -0.0434 139 LEU B O     
2299 C CB    . LEU B 153 ? 0.7660 0.7925 0.6265 -0.0035 0.1518  -0.0279 139 LEU B CB    
2300 C CG    . LEU B 153 ? 0.7812 0.7882 0.6297 0.0052  0.1579  -0.0250 139 LEU B CG    
2301 C CD1   . LEU B 153 ? 0.7781 0.7805 0.6374 0.0177  0.1648  -0.0175 139 LEU B CD1   
2302 C CD2   . LEU B 153 ? 0.8108 0.8072 0.6404 0.0067  0.1526  -0.0178 139 LEU B CD2   
2303 N N     . GLY B 154 ? 0.7301 0.7637 0.6039 -0.0145 0.1511  -0.0611 140 GLY B N     
2304 C CA    . GLY B 154 ? 0.7207 0.7505 0.5953 -0.0141 0.1537  -0.0754 140 GLY B CA    
2305 C C     . GLY B 154 ? 0.7154 0.7397 0.6155 -0.0140 0.1490  -0.0847 140 GLY B C     
2306 O O     . GLY B 154 ? 0.6951 0.7073 0.6037 -0.0102 0.1518  -0.0873 140 GLY B O     
2307 N N     . GLU B 155 ? 0.7377 0.7691 0.6520 -0.0188 0.1392  -0.0887 141 GLU B N     
2308 C CA    . GLU B 155 ? 0.7509 0.7735 0.6960 -0.0209 0.1304  -0.0947 141 GLU B CA    
2309 C C     . GLU B 155 ? 0.7616 0.7733 0.7248 -0.0185 0.1373  -0.0731 141 GLU B C     
2310 O O     . GLU B 155 ? 0.7794 0.7780 0.7605 -0.0178 0.1355  -0.0735 141 GLU B O     
2311 C CB    . GLU B 155 ? 0.7888 0.8202 0.7494 -0.0278 0.1157  -0.0997 141 GLU B CB    
2312 C CG    . GLU B 155 ? 0.8185 0.8666 0.7530 -0.0289 0.1097  -0.1164 141 GLU B CG    
2313 C CD    . GLU B 155 ? 0.8598 0.9125 0.8087 -0.0340 0.0900  -0.1314 141 GLU B CD    
2314 O OE1   . GLU B 155 ? 0.8626 0.9206 0.8290 -0.0397 0.0824  -0.1179 141 GLU B OE1   
2315 O OE2   . GLU B 155 ? 0.9025 0.9548 0.8453 -0.0309 0.0812  -0.1587 141 GLU B OE2   
2316 N N     . ILE B 156 ? 0.7663 0.7850 0.7236 -0.0156 0.1450  -0.0538 142 ILE B N     
2317 C CA    . ILE B 156 ? 0.7624 0.7792 0.7337 -0.0108 0.1536  -0.0321 142 ILE B CA    
2318 C C     . ILE B 156 ? 0.7725 0.7751 0.7281 -0.0025 0.1628  -0.0300 142 ILE B C     
2319 O O     . ILE B 156 ? 0.8002 0.7966 0.7719 -0.0013 0.1648  -0.0200 142 ILE B O     
2320 C CB    . ILE B 156 ? 0.7456 0.7768 0.7131 -0.0056 0.1595  -0.0157 142 ILE B CB    
2321 C CG1   . ILE B 156 ? 0.7482 0.7959 0.7432 -0.0144 0.1490  -0.0124 142 ILE B CG1   
2322 C CG2   . ILE B 156 ? 0.7426 0.7764 0.7144 0.0047  0.1724  0.0044  142 ILE B CG2   
2323 C CD1   . ILE B 156 ? 0.7468 0.8107 0.7378 -0.0092 0.1509  -0.0015 142 ILE B CD1   
2324 N N     . MET B 157 ? 0.7555 0.7534 0.6813 0.0025  0.1666  -0.0372 143 MET B N     
2325 C CA    . MET B 157 ? 0.7599 0.7444 0.6706 0.0105  0.1725  -0.0355 143 MET B CA    
2326 C C     . MET B 157 ? 0.7697 0.7449 0.6916 0.0079  0.1680  -0.0471 143 MET B C     
2327 O O     . MET B 157 ? 0.8181 0.7832 0.7431 0.0131  0.1704  -0.0396 143 MET B O     
2328 C CB    . MET B 157 ? 0.7662 0.7465 0.6480 0.0143  0.1740  -0.0395 143 MET B CB    
2329 C CG    . MET B 157 ? 0.7638 0.7474 0.6349 0.0204  0.1762  -0.0284 143 MET B CG    
2330 S SD    . MET B 157 ? 0.7712 0.7568 0.6457 0.0352  0.1857  -0.0108 143 MET B SD    
2331 C CE    . MET B 157 ? 0.7900 0.7828 0.6563 0.0422  0.1846  -0.0054 143 MET B CE    
2332 N N     . ARG B 158 ? 0.7732 0.7532 0.7017 0.0015  0.1606  -0.0652 144 ARG B N     
2333 C CA    . ARG B 158 ? 0.7759 0.7479 0.7185 0.0017  0.1543  -0.0805 144 ARG B CA    
2334 C C     . ARG B 158 ? 0.7657 0.7249 0.7377 0.0006  0.1489  -0.0699 144 ARG B C     
2335 O O     . ARG B 158 ? 0.7517 0.6978 0.7315 0.0047  0.1467  -0.0704 144 ARG B O     
2336 C CB    . ARG B 158 ? 0.7799 0.7642 0.7219 -0.0021 0.1473  -0.1041 144 ARG B CB    
2337 C CG    . ARG B 158 ? 0.8057 0.7880 0.7580 0.0019  0.1405  -0.1281 144 ARG B CG    
2338 C CD    . ARG B 158 ? 0.7928 0.7975 0.7298 0.0019  0.1393  -0.1502 144 ARG B CD    
2339 N N     . ILE B 159 ? 0.7798 0.7440 0.7703 -0.0055 0.1461  -0.0574 145 ILE B N     
2340 C CA    . ILE B 159 ? 0.7962 0.7518 0.8196 -0.0098 0.1408  -0.0405 145 ILE B CA    
2341 C C     . ILE B 159 ? 0.7935 0.7470 0.8082 -0.0026 0.1527  -0.0163 145 ILE B C     
2342 O O     . ILE B 159 ? 0.7736 0.7140 0.8031 -0.0022 0.1489  -0.0074 145 ILE B O     
2343 C CB    . ILE B 159 ? 0.8094 0.7777 0.8579 -0.0192 0.1364  -0.0275 145 ILE B CB    
2344 C CG1   . ILE B 159 ? 0.8209 0.7901 0.8785 -0.0261 0.1206  -0.0519 145 ILE B CG1   
2345 C CG2   . ILE B 159 ? 0.8415 0.8048 0.9272 -0.0256 0.1323  -0.0029 145 ILE B CG2   
2346 C CD1   . ILE B 159 ? 0.8183 0.8057 0.8884 -0.0335 0.1173  -0.0425 145 ILE B CD1   
2347 N N     . VAL B 160 ? 0.7669 0.7331 0.7567 0.0041  0.1655  -0.0063 146 VAL B N     
2348 C CA    . VAL B 160 ? 0.7551 0.7221 0.7277 0.0148  0.1770  0.0126  146 VAL B CA    
2349 C C     . VAL B 160 ? 0.7496 0.6989 0.7057 0.0211  0.1745  0.0033  146 VAL B C     
2350 O O     . VAL B 160 ? 0.7800 0.7234 0.7381 0.0254  0.1759  0.0184  146 VAL B O     
2351 C CB    . VAL B 160 ? 0.7521 0.7314 0.6972 0.0243  0.1875  0.0161  146 VAL B CB    
2352 C CG1   . VAL B 160 ? 0.7610 0.7375 0.6789 0.0394  0.1968  0.0267  146 VAL B CG1   
2353 C CG2   . VAL B 160 ? 0.7476 0.7488 0.7134 0.0207  0.1912  0.0305  146 VAL B CG2   
2354 N N     . ALA B 161 ? 0.7368 0.6808 0.6787 0.0212  0.1704  -0.0196 147 ALA B N     
2355 C CA    . ALA B 161 ? 0.7522 0.6835 0.6839 0.0265  0.1667  -0.0298 147 ALA B CA    
2356 C C     . ALA B 161 ? 0.7784 0.6979 0.7386 0.0237  0.1566  -0.0330 147 ALA B C     
2357 O O     . ALA B 161 ? 0.8263 0.7353 0.7876 0.0289  0.1548  -0.0217 147 ALA B O     
2358 C CB    . ALA B 161 ? 0.7480 0.6837 0.6650 0.0253  0.1654  -0.0505 147 ALA B CB    
2359 N N     . GLU B 162 ? 0.7601 0.6801 0.7432 0.0165  0.1481  -0.0480 148 GLU B N     
2360 C CA    . GLU B 162 ? 0.7820 0.6862 0.7967 0.0146  0.1347  -0.0526 148 GLU B CA    
2361 C C     . GLU B 162 ? 0.8092 0.7041 0.8399 0.0130  0.1339  -0.0221 148 GLU B C     
2362 O O     . GLU B 162 ? 0.7998 0.6787 0.8426 0.0164  0.1261  -0.0173 148 GLU B O     
2363 C CB    . GLU B 162 ? 0.7896 0.6944 0.8271 0.0073  0.1234  -0.0707 148 GLU B CB    
2364 N N     . GLY B 163 ? 0.8306 0.7389 0.8622 0.0083  0.1424  0.0005  149 GLY B N     
2365 C CA    . GLY B 163 ? 0.8611 0.7701 0.9095 0.0054  0.1446  0.0343  149 GLY B CA    
2366 C C     . GLY B 163 ? 0.8795 0.7854 0.9028 0.0166  0.1517  0.0496  149 GLY B C     
2367 O O     . GLY B 163 ? 0.9203 0.8202 0.9591 0.0150  0.1483  0.0741  149 GLY B O     
2368 N N     . LEU B 164 ? 0.8608 0.7703 0.8459 0.0274  0.1595  0.0361  150 LEU B N     
2369 C CA    . LEU B 164 ? 0.8708 0.7783 0.8257 0.0398  0.1648  0.0475  150 LEU B CA    
2370 C C     . LEU B 164 ? 0.8697 0.7585 0.8227 0.0444  0.1532  0.0325  150 LEU B C     
2371 O O     . LEU B 164 ? 0.8721 0.7563 0.8029 0.0542  0.1531  0.0410  150 LEU B O     
2372 C CB    . LEU B 164 ? 0.8653 0.7845 0.7812 0.0497  0.1765  0.0418  150 LEU B CB    
2373 C CG    . LEU B 164 ? 0.8643 0.8058 0.7753 0.0528  0.1904  0.0631  150 LEU B CG    
2374 C CD1   . LEU B 164 ? 0.8539 0.8031 0.7402 0.0593  0.1968  0.0487  150 LEU B CD1   
2375 C CD2   . LEU B 164 ? 0.8883 0.8373 0.7802 0.0644  0.1979  0.0884  150 LEU B CD2   
2376 N N     . GLN B 165 ? 0.8740 0.7541 0.8499 0.0390  0.1427  0.0094  151 GLN B N     
2377 C CA    . GLN B 165 ? 0.9003 0.7663 0.8833 0.0445  0.1311  -0.0044 151 GLN B CA    
2378 C C     . GLN B 165 ? 0.9348 0.7860 0.9594 0.0392  0.1163  -0.0118 151 GLN B C     
2379 O O     . GLN B 165 ? 0.9756 0.8264 1.0123 0.0403  0.1099  -0.0403 151 GLN B O     
2380 C CB    . GLN B 165 ? 0.8752 0.7491 0.8398 0.0487  0.1329  -0.0307 151 GLN B CB    
2381 C CG    . GLN B 165 ? 0.8669 0.7550 0.8315 0.0418  0.1383  -0.0483 151 GLN B CG    
2382 C CD    . GLN B 165 ? 0.8408 0.7405 0.7905 0.0437  0.1404  -0.0685 151 GLN B CD    
2383 O OE1   . GLN B 165 ? 0.8190 0.7165 0.7561 0.0495  0.1384  -0.0685 151 GLN B OE1   
2384 N NE2   . GLN B 165 ? 0.8108 0.7246 0.7633 0.0380  0.1433  -0.0845 151 GLN B NE2   
2385 N N     . PRO B 166 ? 0.9452 0.7851 0.9929 0.0341  0.1099  0.0143  152 PRO B N     
2386 C CA    . PRO B 166 ? 0.9824 0.8012 1.0728 0.0296  0.0909  0.0063  152 PRO B CA    
2387 C C     . PRO B 166 ? 0.9971 0.7985 1.0960 0.0407  0.0775  -0.0060 152 PRO B C     
2388 O O     . PRO B 166 ? 0.9504 0.7549 1.0252 0.0490  0.0818  0.0030  152 PRO B O     
2389 C CB    . PRO B 166 ? 0.9937 0.8072 1.1075 0.0187  0.0880  0.0451  152 PRO B CB    
2390 C CG    . PRO B 166 ? 0.9794 0.8087 1.0584 0.0242  0.1041  0.0737  152 PRO B CG    
2391 C CD    . PRO B 166 ? 0.9478 0.7948 0.9854 0.0326  0.1188  0.0522  152 PRO B CD    
2392 N N     . SER B 167 ? 1.0366 0.8197 1.1703 0.0422  0.0595  -0.0272 153 SER B N     
2393 C CA    . SER B 167 ? 1.0709 0.8373 1.2206 0.0547  0.0443  -0.0402 153 SER B CA    
2394 C C     . SER B 167 ? 1.1113 0.8541 1.2780 0.0540  0.0313  -0.0056 153 SER B C     
2395 O O     . SER B 167 ? 1.1099 0.8405 1.2842 0.0653  0.0197  -0.0095 153 SER B O     
2396 C CB    . SER B 167 ? 1.0603 0.8148 1.2418 0.0599  0.0283  -0.0771 153 SER B CB    
2397 N N     . GLU B 168 ? 1.1334 0.8734 1.3068 0.0406  0.0336  0.0303  154 GLU B N     
2398 C CA    . GLU B 168 ? 1.1922 0.9105 1.3896 0.0358  0.0195  0.0688  154 GLU B CA    
2399 C C     . GLU B 168 ? 1.2370 0.9531 1.4133 0.0458  0.0185  0.0917  154 GLU B C     
2400 O O     . GLU B 168 ? 1.2788 1.0063 1.4359 0.0413  0.0285  0.1305  154 GLU B O     
2401 C CB    . GLU B 168 ? 1.1848 0.9131 1.3916 0.0180  0.0274  0.1067  154 GLU B CB    
2402 N N     . ALA B 169 ? 1.2674 0.9715 1.4480 0.0603  0.0059  0.0680  155 ALA B N     
2403 C CA    . ALA B 169 ? 1.3132 1.0025 1.4937 0.0693  -0.0077 0.0895  155 ALA B CA    
2404 C C     . ALA B 169 ? 1.3318 1.0421 1.4612 0.0762  0.0063  0.1087  155 ALA B C     
2405 O O     . ALA B 169 ? 1.3407 1.0578 1.4524 0.0890  0.0051  0.0868  155 ALA B O     
2406 C CB    . ALA B 169 ? 1.3460 1.0067 1.5653 0.0594  -0.0271 0.1267  155 ALA B CB    
2407 N N     . GLY B 170 ? 1.3419 1.0639 1.4494 0.0686  0.0180  0.1488  156 GLY B N     
2408 C CA    . GLY B 170 ? 1.3202 1.0600 1.3768 0.0774  0.0285  0.1690  156 GLY B CA    
2409 C C     . GLY B 170 ? 1.2805 1.0508 1.2950 0.0766  0.0546  0.1660  156 GLY B C     
2410 O O     . GLY B 170 ? 1.2606 1.0478 1.2356 0.0816  0.0657  0.1920  156 GLY B O     
2411 N N     . ALA B 171 ? 1.2126 0.9903 1.2342 0.0719  0.0635  0.1348  157 ALA B N     
2412 C CA    . ALA B 171 ? 1.1820 0.9861 1.1714 0.0699  0.0866  0.1334  157 ALA B CA    
2413 C C     . ALA B 171 ? 1.1452 0.9615 1.0837 0.0835  0.0943  0.1193  157 ALA B C     
2414 O O     . ALA B 171 ? 1.1524 0.9592 1.0848 0.0921  0.0823  0.1021  157 ALA B O     
2415 C CB    . ALA B 171 ? 1.1656 0.9735 1.1781 0.0602  0.0917  0.1074  157 ALA B CB    
2416 N N     . ASP B 172 ? 1.1156 0.9529 1.0209 0.0857  0.1127  0.1257  158 ASP B N     
2417 C CA    . ASP B 172 ? 1.1006 0.9470 0.9541 0.1001  0.1181  0.1192  158 ASP B CA    
2418 C C     . ASP B 172 ? 1.0489 0.8972 0.8930 0.1003  0.1213  0.0834  158 ASP B C     
2419 O O     . ASP B 172 ? 1.0662 0.9270 0.8809 0.1050  0.1337  0.0792  158 ASP B O     
2420 C CB    . ASP B 172 ? 1.1006 0.9698 0.9220 0.1061  0.1354  0.1481  158 ASP B CB    
2421 C CG    . ASP B 172 ? 1.1104 0.9861 0.8744 0.1248  0.1381  0.1400  158 ASP B CG    
2422 O OD1   . ASP B 172 ? 1.1208 0.9806 0.8721 0.1314  0.1223  0.1220  158 ASP B OD1   
2423 O OD2   . ASP B 172 ? 1.0974 0.9944 0.8303 0.1338  0.1544  0.1497  158 ASP B OD2   
2424 N N     . LEU B 173 ? 0.9942 0.8319 0.8651 0.0958  0.1100  0.0586  159 LEU B N     
2425 C CA    . LEU B 173 ? 0.9424 0.7853 0.8098 0.0934  0.1128  0.0288  159 LEU B CA    
2426 C C     . LEU B 173 ? 0.9284 0.7691 0.7625 0.1035  0.1057  0.0184  159 LEU B C     
2427 O O     . LEU B 173 ? 0.9648 0.7970 0.7982 0.1101  0.0918  0.0209  159 LEU B O     
2428 C CB    . LEU B 173 ? 0.9274 0.7669 0.8362 0.0861  0.1051  0.0074  159 LEU B CB    
2429 C CG    . LEU B 173 ? 0.9200 0.7552 0.8654 0.0770  0.1053  0.0134  159 LEU B CG    
2430 C CD1   . LEU B 173 ? 0.8981 0.7294 0.8798 0.0752  0.0955  -0.0124 159 LEU B CD1   
2431 C CD2   . LEU B 173 ? 0.8951 0.7426 0.8350 0.0689  0.1200  0.0177  159 LEU B CD2   
2432 N N     . PRO B 174 ? 0.8864 0.7327 0.6945 0.1049  0.1124  0.0069  160 PRO B N     
2433 C CA    . PRO B 174 ? 0.8875 0.7279 0.6630 0.1140  0.1027  -0.0037 160 PRO B CA    
2434 C C     . PRO B 174 ? 0.8767 0.7116 0.6693 0.1135  0.0849  -0.0163 160 PRO B C     
2435 O O     . PRO B 174 ? 0.9029 0.7297 0.6741 0.1233  0.0714  -0.0142 160 PRO B O     
2436 C CB    . PRO B 174 ? 0.8544 0.6991 0.6224 0.1088  0.1095  -0.0190 160 PRO B CB    
2437 C CG    . PRO B 174 ? 0.8441 0.6993 0.6225 0.1033  0.1263  -0.0092 160 PRO B CG    
2438 C CD    . PRO B 174 ? 0.8511 0.7075 0.6624 0.0975  0.1266  0.0029  160 PRO B CD    
2439 N N     . TRP B 175 ? 0.8449 0.6870 0.6758 0.1033  0.0847  -0.0299 161 TRP B N     
2440 C CA    . TRP B 175 ? 0.8380 0.6833 0.6912 0.1027  0.0704  -0.0436 161 TRP B CA    
2441 C C     . TRP B 175 ? 0.8585 0.6968 0.7302 0.1099  0.0582  -0.0349 161 TRP B C     
2442 O O     . TRP B 175 ? 0.8348 0.6763 0.7240 0.1127  0.0441  -0.0438 161 TRP B O     
2443 C CB    . TRP B 175 ? 0.7997 0.6625 0.6856 0.0918  0.0768  -0.0610 161 TRP B CB    
2444 C CG    . TRP B 175 ? 0.7866 0.6534 0.6968 0.0878  0.0870  -0.0613 161 TRP B CG    
2445 C CD1   . TRP B 175 ? 0.7797 0.6478 0.7249 0.0901  0.0818  -0.0671 161 TRP B CD1   
2446 C CD2   . TRP B 175 ? 0.7664 0.6351 0.6697 0.0814  0.1012  -0.0575 161 TRP B CD2   
2447 N NE1   . TRP B 175 ? 0.7758 0.6438 0.7352 0.0852  0.0904  -0.0685 161 TRP B NE1   
2448 C CE2   . TRP B 175 ? 0.7606 0.6305 0.6954 0.0789  0.1026  -0.0617 161 TRP B CE2   
2449 C CE3   . TRP B 175 ? 0.7617 0.6307 0.6371 0.0788  0.1110  -0.0519 161 TRP B CE3   
2450 C CZ2   . TRP B 175 ? 0.7504 0.6223 0.6896 0.0720  0.1123  -0.0596 161 TRP B CZ2   
2451 C CZ3   . TRP B 175 ? 0.7619 0.6357 0.6431 0.0726  0.1226  -0.0488 161 TRP B CZ3   
2452 C CH2   . TRP B 175 ? 0.7480 0.6236 0.6609 0.0684  0.1227  -0.0522 161 TRP B CH2   
2453 N N     . LEU B 176 ? 0.8775 0.7072 0.7477 0.1124  0.0627  -0.0155 162 LEU B N     
2454 C CA    . LEU B 176 ? 0.8898 0.7082 0.7724 0.1195  0.0493  -0.0005 162 LEU B CA    
2455 C C     . LEU B 176 ? 0.9300 0.7410 0.7694 0.1295  0.0450  0.0220  162 LEU B C     
2456 O O     . LEU B 176 ? 0.9621 0.7642 0.8051 0.1349  0.0355  0.0421  162 LEU B O     
2457 C CB    . LEU B 176 ? 0.8741 0.6866 0.7909 0.1141  0.0531  0.0088  162 LEU B CB    
2458 C CG    . LEU B 176 ? 0.8324 0.6527 0.7880 0.1073  0.0566  -0.0158 162 LEU B CG    
2459 C CD1   . LEU B 176 ? 0.8389 0.6463 0.8262 0.1035  0.0546  -0.0065 162 LEU B CD1   
2460 C CD2   . LEU B 176 ? 0.8239 0.6523 0.8035 0.1128  0.0446  -0.0374 162 LEU B CD2   
2461 N N     . ARG B 177 ? 0.9479 0.7624 0.7455 0.1335  0.0506  0.0185  163 ARG B N     
2462 C CA    . ARG B 177 ? 0.9984 0.8096 0.7481 0.1466  0.0473  0.0357  163 ARG B CA    
2463 C C     . ARG B 177 ? 1.0232 0.8265 0.7648 0.1548  0.0234  0.0276  163 ARG B C     
2464 O O     . ARG B 177 ? 1.0188 0.8224 0.7977 0.1493  0.0123  0.0115  163 ARG B O     
2465 C CB    . ARG B 177 ? 1.0191 0.8355 0.7266 0.1517  0.0592  0.0295  163 ARG B CB    
2466 C CG    . ARG B 177 ? 1.0579 0.8835 0.7312 0.1611  0.0735  0.0552  163 ARG B CG    
2467 C CD    . ARG B 177 ? 1.0409 0.8787 0.7360 0.1507  0.0952  0.0636  163 ARG B CD    
2468 N NE    . ARG B 177 ? 1.0534 0.8969 0.7256 0.1540  0.1058  0.0479  163 ARG B NE    
2469 C CZ    . ARG B 177 ? 1.0453 0.9000 0.7332 0.1460  0.1227  0.0490  163 ARG B CZ    
2470 N NH1   . ARG B 177 ? 1.0297 0.8908 0.7565 0.1330  0.1307  0.0638  163 ARG B NH1   
2471 N NH2   . ARG B 177 ? 1.0537 0.9109 0.7196 0.1513  0.1290  0.0344  163 ARG B NH2   
2472 O OXT   . ARG B 177 ? 1.0596 0.8589 0.7587 0.1678  0.0146  0.0368  163 ARG B OXT   
2473 O "O5'" . DA  C 1   ? 1.0182 0.6847 1.1863 0.0972  0.2297  0.1454  1   DA  C "O5'" 
2474 C "C5'" . DA  C 1   ? 1.0450 0.7329 1.1946 0.0961  0.2036  0.2167  1   DA  C "C5'" 
2475 C "C4'" . DA  C 1   ? 1.0221 0.7412 1.1756 0.1072  0.1706  0.2480  1   DA  C "C4'" 
2476 O "O4'" . DA  C 1   ? 1.0031 0.7019 1.2374 0.1242  0.1861  0.2252  1   DA  C "O4'" 
2477 C "C3'" . DA  C 1   ? 0.9786 0.7356 1.0361 0.0972  0.1413  0.2220  1   DA  C "C3'" 
2478 O "O3'" . DA  C 1   ? 1.0354 0.8400 1.0551 0.0851  0.1104  0.2774  1   DA  C "O3'" 
2479 C "C2'" . DA  C 1   ? 0.9462 0.7019 1.0332 0.1124  0.1372  0.1936  1   DA  C "C2'" 
2480 C "C1'" . DA  C 1   ? 0.9408 0.6650 1.1397 0.1285  0.1619  0.2058  1   DA  C "C1'" 
2481 N N9    . DA  C 1   ? 0.8876 0.5904 1.1137 0.1312  0.1874  0.1425  1   DA  C N9    
2482 C C8    . DA  C 1   ? 0.8747 0.5554 1.1077 0.1209  0.2208  0.0908  1   DA  C C8    
2483 N N7    . DA  C 1   ? 0.8516 0.5319 1.1031 0.1179  0.2371  0.0412  1   DA  C N7    
2484 C C5    . DA  C 1   ? 0.8399 0.5344 1.1012 0.1301  0.2152  0.0610  1   DA  C C5    
2485 C C6    . DA  C 1   ? 0.8144 0.5159 1.0935 0.1309  0.2201  0.0293  1   DA  C C6    
2486 N N6    . DA  C 1   ? 0.7793 0.4807 1.0638 0.1153  0.2489  -0.0293 1   DA  C N6    
2487 N N1    . DA  C 1   ? 0.8191 0.5362 1.1075 0.1437  0.1946  0.0590  1   DA  C N1    
2488 C C2    . DA  C 1   ? 0.8381 0.5717 1.1156 0.1521  0.1639  0.1174  1   DA  C C2    
2489 N N3    . DA  C 1   ? 0.8554 0.5907 1.1099 0.1484  0.1554  0.1541  1   DA  C N3    
2490 C C4    . DA  C 1   ? 0.8581 0.5681 1.1066 0.1389  0.1837  0.1225  1   DA  C C4    
2491 P P     . DA  C 2   ? 1.0661 0.9158 0.9801 0.0590  0.0915  0.2503  2   DA  C P     
2492 O OP1   . DA  C 2   ? 1.1375 1.0426 1.0161 0.0352  0.0687  0.3117  2   DA  C OP1   
2493 O OP2   . DA  C 2   ? 1.0058 0.8285 0.8825 0.0516  0.1151  0.1887  2   DA  C OP2   
2494 O "O5'" . DA  C 2   ? 1.0149 0.8828 0.9331 0.0697  0.0739  0.2281  2   DA  C "O5'" 
2495 C "C5'" . DA  C 2   ? 1.0327 0.9335 0.9944 0.0786  0.0488  0.2790  2   DA  C "C5'" 
2496 C "C4'" . DA  C 2   ? 0.9952 0.9054 0.9575 0.0868  0.0398  0.2423  2   DA  C "C4'" 
2497 O "O4'" . DA  C 2   ? 0.9556 0.8132 0.9686 0.1091  0.0637  0.2045  2   DA  C "O4'" 
2498 C "C3'" . DA  C 2   ? 0.9773 0.9089 0.8617 0.0658  0.0390  0.1900  2   DA  C "C3'" 
2499 O "O3'" . DA  C 2   ? 0.9750 0.9529 0.8578 0.0607  0.0167  0.1944  2   DA  C "O3'" 
2500 C "C2'" . DA  C 2   ? 0.9316 0.8106 0.8240 0.0803  0.0646  0.1351  2   DA  C "C2'" 
2501 C "C1'" . DA  C 2   ? 0.9148 0.7646 0.8822 0.1053  0.0710  0.1460  2   DA  C "C1'" 
2502 N N9    . DA  C 2   ? 0.8829 0.6890 0.8727 0.1142  0.0983  0.1108  2   DA  C N9    
2503 C C8    . DA  C 2   ? 0.8652 0.6497 0.8441 0.1083  0.1170  0.0974  2   DA  C C8    
2504 N N7    . DA  C 2   ? 0.8378 0.5988 0.8421 0.1129  0.1385  0.0628  2   DA  C N7    
2505 C C5    . DA  C 2   ? 0.8556 0.6196 0.8881 0.1219  0.1358  0.0538  2   DA  C C5    
2506 C C6    . DA  C 2   ? 0.8441 0.5987 0.9048 0.1230  0.1541  0.0186  2   DA  C C6    
2507 N N6    . DA  C 2   ? 0.8424 0.5895 0.9064 0.1131  0.1772  -0.0151 2   DA  C N6    
2508 N N1    . DA  C 2   ? 0.8617 0.6235 0.9448 0.1295  0.1487  0.0165  2   DA  C N1    
2509 C C2    . DA  C 2   ? 0.8630 0.6421 0.9442 0.1363  0.1244  0.0478  2   DA  C C2    
2510 N N3    . DA  C 2   ? 0.8600 0.6578 0.9136 0.1332  0.1034  0.0820  2   DA  C N3    
2511 C C4    . DA  C 2   ? 0.8704 0.6584 0.8984 0.1253  0.1113  0.0834  2   DA  C C4    
2512 P P     . DA  C 3   ? 0.9475 0.9470 0.7812 0.0421  0.0206  0.1370  3   DA  C P     
2513 O OP1   . DA  C 3   ? 0.9474 1.0241 0.7589 0.0166  -0.0052 0.1566  3   DA  C OP1   
2514 O OP2   . DA  C 3   ? 0.9477 0.9227 0.7415 0.0295  0.0450  0.0958  3   DA  C OP2   
2515 O "O5'" . DA  C 3   ? 0.9153 0.8749 0.7948 0.0696  0.0300  0.1085  3   DA  C "O5'" 
2516 C "C5'" . DA  C 3   ? 0.9127 0.8893 0.8406 0.0828  0.0141  0.1294  3   DA  C "C5'" 
2517 C "C4'" . DA  C 3   ? 0.8867 0.8309 0.8336 0.0968  0.0296  0.0870  3   DA  C "C4'" 
2518 O "O4'" . DA  C 3   ? 0.8712 0.7619 0.8349 0.1124  0.0518  0.0720  3   DA  C "O4'" 
2519 C "C3'" . DA  C 3   ? 0.8793 0.8316 0.7850 0.0806  0.0400  0.0414  3   DA  C "C3'" 
2520 O "O3'" . DA  C 3   ? 0.8639 0.8159 0.7955 0.0876  0.0424  0.0217  3   DA  C "O3'" 
2521 C "C2'" . DA  C 3   ? 0.8530 0.7608 0.7448 0.0865  0.0620  0.0189  3   DA  C "C2'" 
2522 C "C1'" . DA  C 3   ? 0.8222 0.6954 0.7530 0.1080  0.0673  0.0324  3   DA  C "C1'" 
2523 N N9    . DA  C 3   ? 0.8087 0.6534 0.7320 0.1107  0.0818  0.0268  3   DA  C N9    
2524 C C8    . DA  C 3   ? 0.8188 0.6643 0.7146 0.1001  0.0844  0.0323  3   DA  C C8    
2525 N N7    . DA  C 3   ? 0.8010 0.6208 0.7024 0.1047  0.0994  0.0217  3   DA  C N7    
2526 C C5    . DA  C 3   ? 0.7887 0.5954 0.7180 0.1155  0.1068  0.0080  3   DA  C C5    
2527 C C6    . DA  C 3   ? 0.7865 0.5794 0.7293 0.1169  0.1230  -0.0111 3   DA  C C6    
2528 N N6    . DA  C 3   ? 0.7813 0.5682 0.7165 0.1110  0.1336  -0.0198 3   DA  C N6    
2529 N N1    . DA  C 3   ? 0.7847 0.5780 0.7475 0.1195  0.1293  -0.0245 3   DA  C N1    
2530 C C2    . DA  C 3   ? 0.7768 0.5761 0.7513 0.1249  0.1204  -0.0182 3   DA  C C2    
2531 N N3    . DA  C 3   ? 0.7664 0.5784 0.7354 0.1265  0.1039  -0.0009 3   DA  C N3    
2532 C C4    . DA  C 3   ? 0.7847 0.6030 0.7281 0.1199  0.0973  0.0116  3   DA  C C4    
2533 P P     . DG  C 4   ? 0.8678 0.8293 0.7822 0.0717  0.0572  -0.0220 4   DG  C P     
2534 O OP1   . DG  C 4   ? 0.8361 0.8329 0.7726 0.0660  0.0472  -0.0272 4   DG  C OP1   
2535 O OP2   . DG  C 4   ? 0.8747 0.8531 0.7500 0.0475  0.0656  -0.0384 4   DG  C OP2   
2536 O "O5'" . DG  C 4   ? 0.7788 0.6872 0.7097 0.0907  0.0786  -0.0387 4   DG  C "O5'" 
2537 C "C5'" . DG  C 4   ? 0.7181 0.6074 0.6806 0.1073  0.0805  -0.0346 4   DG  C "C5'" 
2538 C "C4'" . DG  C 4   ? 0.6809 0.5380 0.6429 0.1147  0.0992  -0.0466 4   DG  C "C4'" 
2539 O "O4'" . DG  C 4   ? 0.6788 0.5206 0.6265 0.1186  0.1009  -0.0377 4   DG  C "O4'" 
2540 C "C3'" . DG  C 4   ? 0.6652 0.5209 0.6264 0.1069  0.1140  -0.0653 4   DG  C "C3'" 
2541 O "O3'" . DG  C 4   ? 0.6560 0.4992 0.6392 0.1129  0.1256  -0.0687 4   DG  C "O3'" 
2542 C "C2'" . DG  C 4   ? 0.6741 0.5177 0.6215 0.1077  0.1196  -0.0619 4   DG  C "C2'" 
2543 C "C1'" . DG  C 4   ? 0.6800 0.5132 0.6186 0.1171  0.1120  -0.0457 4   DG  C "C1'" 
2544 N N9    . DG  C 4   ? 0.6874 0.5173 0.6085 0.1148  0.1108  -0.0409 4   DG  C N9    
2545 C C8    . DG  C 4   ? 0.6881 0.5291 0.5915 0.1040  0.1071  -0.0414 4   DG  C C8    
2546 N N7    . DG  C 4   ? 0.7039 0.5368 0.5961 0.1034  0.1097  -0.0373 4   DG  C N7    
2547 C C5    . DG  C 4   ? 0.6847 0.5055 0.5882 0.1133  0.1142  -0.0362 4   DG  C C5    
2548 C C6    . DG  C 4   ? 0.6961 0.5125 0.5968 0.1133  0.1192  -0.0369 4   DG  C C6    
2549 O O6    . DG  C 4   ? 0.7308 0.5447 0.6219 0.1082  0.1221  -0.0376 4   DG  C O6    
2550 N N1    . DG  C 4   ? 0.6882 0.5101 0.5968 0.1152  0.1225  -0.0393 4   DG  C N1    
2551 C C2    . DG  C 4   ? 0.6751 0.5011 0.5917 0.1175  0.1224  -0.0386 4   DG  C C2    
2552 N N2    . DG  C 4   ? 0.6596 0.5012 0.5745 0.1111  0.1271  -0.0415 4   DG  C N2    
2553 N N3    . DG  C 4   ? 0.6660 0.4879 0.5900 0.1210  0.1193  -0.0374 4   DG  C N3    
2554 C C4    . DG  C 4   ? 0.6809 0.5023 0.5987 0.1186  0.1146  -0.0373 4   DG  C C4    
2555 P P     . DA  C 5   ? 0.6344 0.4700 0.6441 0.1090  0.1468  -0.0804 5   DA  C P     
2556 O OP1   . DA  C 5   ? 0.6163 0.4439 0.6464 0.1133  0.1553  -0.0769 5   DA  C OP1   
2557 O OP2   . DA  C 5   ? 0.6391 0.4941 0.6538 0.0916  0.1536  -0.1065 5   DA  C OP2   
2558 O "O5'" . DA  C 5   ? 0.6412 0.4636 0.6506 0.1169  0.1510  -0.0623 5   DA  C "O5'" 
2559 C "C5'" . DA  C 5   ? 0.6291 0.4494 0.6249 0.1241  0.1446  -0.0413 5   DA  C "C5'" 
2560 C "C4'" . DA  C 5   ? 0.6420 0.4658 0.6342 0.1271  0.1425  -0.0257 5   DA  C "C4'" 
2561 O "O4'" . DA  C 5   ? 0.6427 0.4666 0.6144 0.1244  0.1356  -0.0359 5   DA  C "O4'" 
2562 C "C3'" . DA  C 5   ? 0.6607 0.4823 0.6977 0.1310  0.1556  -0.0140 5   DA  C "C3'" 
2563 O "O3'" . DA  C 5   ? 0.6953 0.5261 0.7506 0.1351  0.1569  0.0184  5   DA  C "O3'" 
2564 C "C2'" . DA  C 5   ? 0.6521 0.4789 0.6842 0.1314  0.1510  -0.0139 5   DA  C "C2'" 
2565 C "C1'" . DA  C 5   ? 0.6428 0.4721 0.6236 0.1271  0.1367  -0.0236 5   DA  C "C1'" 
2566 N N9    . DA  C 5   ? 0.6406 0.4680 0.6067 0.1224  0.1353  -0.0362 5   DA  C N9    
2567 C C8    . DA  C 5   ? 0.6628 0.4884 0.6226 0.1127  0.1400  -0.0555 5   DA  C C8    
2568 N N7    . DA  C 5   ? 0.6822 0.5093 0.6252 0.1067  0.1394  -0.0601 5   DA  C N7    
2569 C C5    . DA  C 5   ? 0.6704 0.4986 0.6135 0.1148  0.1343  -0.0459 5   DA  C C5    
2570 C C6    . DA  C 5   ? 0.6781 0.5093 0.6118 0.1123  0.1336  -0.0462 5   DA  C C6    
2571 N N6    . DA  C 5   ? 0.6819 0.5091 0.6018 0.1025  0.1389  -0.0579 5   DA  C N6    
2572 N N1    . DA  C 5   ? 0.6636 0.5090 0.6003 0.1157  0.1283  -0.0355 5   DA  C N1    
2573 C C2    . DA  C 5   ? 0.6654 0.5234 0.6085 0.1193  0.1235  -0.0218 5   DA  C C2    
2574 N N3    . DA  C 5   ? 0.6666 0.5178 0.6183 0.1232  0.1249  -0.0169 5   DA  C N3    
2575 C C4    . DA  C 5   ? 0.6523 0.4861 0.6067 0.1221  0.1308  -0.0313 5   DA  C C4    
2576 P P     . DT  C 6   ? 0.7447 0.5802 0.8666 0.1437  0.1673  0.0524  6   DT  C P     
2577 O OP1   . DT  C 6   ? 0.7982 0.6425 0.9399 0.1447  0.1708  0.0887  6   DT  C OP1   
2578 O OP2   . DT  C 6   ? 0.7587 0.5737 0.9315 0.1439  0.1889  0.0248  6   DT  C OP2   
2579 O "O5'" . DT  C 6   ? 0.7016 0.5654 0.8048 0.1445  0.1488  0.0731  6   DT  C "O5'" 
2580 C "C5'" . DT  C 6   ? 0.6977 0.5929 0.7468 0.1347  0.1313  0.0856  6   DT  C "C5'" 
2581 C "C4'" . DT  C 6   ? 0.7105 0.6367 0.7534 0.1325  0.1178  0.0965  6   DT  C "C4'" 
2582 O "O4'" . DT  C 6   ? 0.6843 0.5868 0.7163 0.1340  0.1213  0.0604  6   DT  C "O4'" 
2583 C "C3'" . DT  C 6   ? 0.7203 0.6708 0.8307 0.1427  0.1148  0.1426  6   DT  C "C3'" 
2584 O "O3'" . DT  C 6   ? 0.7671 0.7798 0.8534 0.1305  0.0938  0.1795  6   DT  C "O3'" 
2585 C "C2'" . DT  C 6   ? 0.6997 0.6320 0.8398 0.1497  0.1220  0.1183  6   DT  C "C2'" 
2586 C "C1'" . DT  C 6   ? 0.6774 0.5966 0.7448 0.1387  0.1185  0.0738  6   DT  C "C1'" 
2587 N N1    . DT  C 6   ? 0.6620 0.5496 0.7346 0.1394  0.1312  0.0378  6   DT  C N1    
2588 C C2    . DT  C 6   ? 0.6822 0.5787 0.7416 0.1350  0.1274  0.0256  6   DT  C C2    
2589 O O2    . DT  C 6   ? 0.7039 0.6347 0.7502 0.1305  0.1139  0.0391  6   DT  C O2    
2590 N N3    . DT  C 6   ? 0.6760 0.5466 0.7356 0.1308  0.1415  -0.0057 6   DT  C N3    
2591 C C4    . DT  C 6   ? 0.6716 0.5182 0.7403 0.1266  0.1577  -0.0282 6   DT  C C4    
2592 O O4    . DT  C 6   ? 0.6875 0.5251 0.7479 0.1152  0.1696  -0.0560 6   DT  C O4    
2593 C C5    . DT  C 6   ? 0.6527 0.4932 0.7401 0.1317  0.1612  -0.0181 6   DT  C C5    
2594 C C7    . DT  C 6   ? 0.6539 0.4783 0.7545 0.1222  0.1804  -0.0481 6   DT  C C7    
2595 C C6    . DT  C 6   ? 0.6542 0.5110 0.7436 0.1395  0.1484  0.0154  6   DT  C C6    
2596 P P     . DT  C 7   ? 0.8863 0.9003 0.6574 0.2491  0.1101  -0.1840 7   DT  C P     
2597 O OP1   . DT  C 7   ? 0.9485 1.0036 0.6768 0.2836  0.1135  -0.2165 7   DT  C OP1   
2598 O OP2   . DT  C 7   ? 0.8601 0.8561 0.6029 0.2328  0.1295  -0.1353 7   DT  C OP2   
2599 O "O5'" . DT  C 7   ? 0.8751 0.8699 0.6868 0.2403  0.0767  -0.2017 7   DT  C "O5'" 
2600 C "C5'" . DT  C 7   ? 0.8741 0.8813 0.7323 0.2540  0.0500  -0.2508 7   DT  C "C5'" 
2601 C "C4'" . DT  C 7   ? 0.8489 0.8370 0.7433 0.2445  0.0242  -0.2556 7   DT  C "C4'" 
2602 O "O4'" . DT  C 7   ? 0.7963 0.7522 0.7378 0.2143  0.0259  -0.2226 7   DT  C "O4'" 
2603 C "C3'" . DT  C 7   ? 0.8545 0.8421 0.6915 0.2494  0.0241  -0.2406 7   DT  C "C3'" 
2604 O "O3'" . DT  C 7   ? 0.8902 0.8973 0.7324 0.2735  -0.0032 -0.2857 7   DT  C "O3'" 
2605 C "C2'" . DT  C 7   ? 0.8105 0.7646 0.6742 0.2197  0.0255  -0.2039 7   DT  C "C2'" 
2606 C "C1'" . DT  C 7   ? 0.7812 0.7199 0.7190 0.2023  0.0201  -0.2030 7   DT  C "C1'" 
2607 N N1    . DT  C 7   ? 0.7601 0.6743 0.7022 0.1760  0.0348  -0.1584 7   DT  C N1    
2608 C C2    . DT  C 7   ? 0.7269 0.6219 0.7242 0.1581  0.0254  -0.1444 7   DT  C C2    
2609 O O2    . DT  C 7   ? 0.7471 0.6418 0.7997 0.1607  0.0066  -0.1646 7   DT  C O2    
2610 N N3    . DT  C 7   ? 0.6976 0.5761 0.6862 0.1385  0.0389  -0.1054 7   DT  C N3    
2611 C C4    . DT  C 7   ? 0.6866 0.5640 0.6286 0.1343  0.0571  -0.0843 7   DT  C C4    
2612 O O4    . DT  C 7   ? 0.6144 0.4787 0.5562 0.1188  0.0632  -0.0558 7   DT  C O4    
2613 C C5    . DT  C 7   ? 0.7239 0.6191 0.6235 0.1513  0.0675  -0.0987 7   DT  C C5    
2614 C C7    . DT  C 7   ? 0.7299 0.6250 0.5945 0.1474  0.0887  -0.0753 7   DT  C C7    
2615 C C6    . DT  C 7   ? 0.7519 0.6655 0.6487 0.1715  0.0575  -0.1324 7   DT  C C6    
2616 P P     . DG  C 8   ? 0.9791 0.9953 0.7595 0.2893  -0.0101 -0.2830 8   DG  C P     
2617 O OP1   . DG  C 8   ? 1.0108 1.0626 0.7753 0.3260  -0.0342 -0.3376 8   DG  C OP1   
2618 O OP2   . DG  C 8   ? 0.9537 0.9650 0.6670 0.2820  0.0211  -0.2328 8   DG  C OP2   
2619 O "O5'" . DG  C 8   ? 0.9610 0.9482 0.7996 0.2677  -0.0276 -0.2752 8   DG  C "O5'" 
2620 C "C5'" . DG  C 8   ? 0.9250 0.9026 0.8584 0.2595  -0.0497 -0.3016 8   DG  C "C5'" 
2621 C "C4'" . DG  C 8   ? 0.8829 0.8367 0.8599 0.2400  -0.0574 -0.2838 8   DG  C "C4'" 
2622 O "O4'" . DG  C 8   ? 0.8299 0.7583 0.8200 0.2094  -0.0342 -0.2360 8   DG  C "O4'" 
2623 C "C3'" . DG  C 8   ? 0.8890 0.8446 0.8120 0.2475  -0.0598 -0.2749 8   DG  C "C3'" 
2624 O "O3'" . DG  C 8   ? 0.8841 0.8338 0.8754 0.2468  -0.0852 -0.2971 8   DG  C "O3'" 
2625 C "C2'" . DG  C 8   ? 0.8603 0.7963 0.7442 0.2236  -0.0291 -0.2202 8   DG  C "C2'" 
2626 C "C1'" . DG  C 8   ? 0.8276 0.7448 0.7729 0.1986  -0.0203 -0.2023 8   DG  C "C1'" 
2627 N N9    . DG  C 8   ? 0.7830 0.6891 0.6945 0.1815  0.0068  -0.1624 8   DG  C N9    
2628 C C8    . DG  C 8   ? 0.7705 0.6846 0.6185 0.1878  0.0250  -0.1482 8   DG  C C8    
2629 N N7    . DG  C 8   ? 0.7646 0.6655 0.6085 0.1694  0.0436  -0.1164 8   DG  C N7    
2630 C C5    . DG  C 8   ? 0.7357 0.6207 0.6331 0.1514  0.0379  -0.1073 8   DG  C C5    
2631 C C6    . DG  C 8   ? 0.6895 0.5596 0.6002 0.1308  0.0493  -0.0764 8   DG  C C6    
2632 O O6    . DG  C 8   ? 0.6893 0.5556 0.5722 0.1237  0.0637  -0.0557 8   DG  C O6    
2633 N N1    . DG  C 8   ? 0.6661 0.5272 0.6314 0.1197  0.0418  -0.0705 8   DG  C N1    
2634 C C2    . DG  C 8   ? 0.6723 0.5361 0.6868 0.1256  0.0252  -0.0928 8   DG  C C2    
2635 N N2    . DG  C 8   ? 0.6434 0.4982 0.7172 0.1123  0.0241  -0.0769 8   DG  C N2    
2636 N N3    . DG  C 8   ? 0.7126 0.5892 0.7213 0.1448  0.0102  -0.1278 8   DG  C N3    
2637 C C4    . DG  C 8   ? 0.7337 0.6212 0.6768 0.1576  0.0176  -0.1325 8   DG  C C4    
2638 P P     . DA  C 9   ? 0.8977 0.8449 0.8674 0.2513  -0.0953 -0.2933 9   DA  C P     
2639 O OP1   . DA  C 9   ? 0.8882 0.8509 0.9073 0.2746  -0.1344 -0.3478 9   DA  C OP1   
2640 O OP2   . DA  C 9   ? 0.8848 0.8375 0.7560 0.2579  -0.0766 -0.2645 9   DA  C OP2   
2641 O "O5'" . DA  C 9   ? 0.8386 0.7584 0.8666 0.2181  -0.0803 -0.2575 9   DA  C "O5'" 
2642 C "C5'" . DA  C 9   ? 0.8257 0.7347 0.9437 0.2020  -0.0810 -0.2572 9   DA  C "C5'" 
2643 C "C4'" . DA  C 9   ? 0.7958 0.6849 0.9448 0.1743  -0.0606 -0.2153 9   DA  C "C4'" 
2644 O "O4'" . DA  C 9   ? 0.7826 0.6629 0.8781 0.1582  -0.0313 -0.1738 9   DA  C "O4'" 
2645 C "C3'" . DA  C 9   ? 0.7854 0.6723 0.9155 0.1741  -0.0612 -0.2096 9   DA  C "C3'" 
2646 O "O3'" . DA  C 9   ? 0.7837 0.6596 0.9903 0.1550  -0.0535 -0.1924 9   DA  C "O3'" 
2647 C "C2'" . DA  C 9   ? 0.7770 0.6605 0.8157 0.1677  -0.0362 -0.1754 9   DA  C "C2'" 
2648 C "C1'" . DA  C 9   ? 0.7308 0.6058 0.7744 0.1503  -0.0153 -0.1478 9   DA  C "C1'" 
2649 N N9    . DA  C 9   ? 0.7133 0.5888 0.6825 0.1495  0.0027  -0.1276 9   DA  C N9    
2650 C C8    . DA  C 9   ? 0.7321 0.6193 0.6386 0.1672  0.0013  -0.1370 9   DA  C C8    
2651 N N7    . DA  C 9   ? 0.7234 0.6078 0.5866 0.1604  0.0219  -0.1118 9   DA  C N7    
2652 C C5    . DA  C 9   ? 0.6768 0.5476 0.5702 0.1384  0.0339  -0.0881 9   DA  C C5    
2653 C C6    . DA  C 9   ? 0.6748 0.5383 0.5491 0.1243  0.0524  -0.0601 9   DA  C C6    
2654 N N6    . DA  C 9   ? 0.6875 0.5541 0.5180 0.1281  0.0637  -0.0509 9   DA  C N6    
2655 N N1    . DA  C 9   ? 0.6569 0.5118 0.5619 0.1077  0.0589  -0.0411 9   DA  C N1    
2656 C C2    . DA  C 9   ? 0.6629 0.5159 0.6209 0.1037  0.0515  -0.0454 9   DA  C C2    
2657 N N3    . DA  C 9   ? 0.6504 0.5077 0.6435 0.1138  0.0346  -0.0714 9   DA  C N3    
2658 C C4    . DA  C 9   ? 0.6698 0.5360 0.6247 0.1319  0.0243  -0.0946 9   DA  C C4    
2659 P P     . DG  C 10  ? 0.8355 0.7097 1.0627 0.1533  -0.0570 -0.1937 10  DG  C P     
2660 O OP1   . DG  C 10  ? 0.7729 0.6460 1.1172 0.1504  -0.0713 -0.2109 10  DG  C OP1   
2661 O OP2   . DG  C 10  ? 0.8264 0.7096 0.9817 0.1739  -0.0727 -0.2130 10  DG  C OP2   
2662 O "O5'" . DG  C 10  ? 0.7286 0.5936 0.9209 0.1303  -0.0207 -0.1451 10  DG  C "O5'" 
2663 C "C5'" . DG  C 10  ? 0.6977 0.5567 0.9297 0.1106  0.0018  -0.1127 10  DG  C "C5'" 
2664 C "C4'" . DG  C 10  ? 0.6811 0.5376 0.8458 0.0974  0.0309  -0.0761 10  DG  C "C4'" 
2665 O "O4'" . DG  C 10  ? 0.6784 0.5348 0.7654 0.1042  0.0307  -0.0764 10  DG  C "O4'" 
2666 C "C3'" . DG  C 10  ? 0.6663 0.5248 0.8102 0.0948  0.0394  -0.0724 10  DG  C "C3'" 
2667 O "O3'" . DG  C 10  ? 0.6692 0.5293 0.8097 0.0784  0.0686  -0.0384 10  DG  C "O3'" 
2668 C "C2'" . DG  C 10  ? 0.6525 0.5113 0.7136 0.1054  0.0340  -0.0789 10  DG  C "C2'" 
2669 C "C1'" . DG  C 10  ? 0.6228 0.4795 0.6513 0.1020  0.0427  -0.0645 10  DG  C "C1'" 
2670 N N9    . DG  C 10  ? 0.5867 0.4451 0.5512 0.1136  0.0380  -0.0704 10  DG  C N9    
2671 C C8    . DG  C 10  ? 0.5943 0.4591 0.5363 0.1333  0.0189  -0.0949 10  DG  C C8    
2672 N N7    . DG  C 10  ? 0.5957 0.4634 0.4800 0.1400  0.0253  -0.0873 10  DG  C N7    
2673 C C5    . DG  C 10  ? 0.5796 0.4404 0.4534 0.1230  0.0464  -0.0605 10  DG  C C5    
2674 C C6    . DG  C 10  ? 0.5786 0.4386 0.4100 0.1208  0.0603  -0.0437 10  DG  C C6    
2675 O O6    . DG  C 10  ? 0.5734 0.4389 0.3683 0.1326  0.0612  -0.0445 10  DG  C O6    
2676 N N1    . DG  C 10  ? 0.5775 0.4318 0.4151 0.1043  0.0746  -0.0237 10  DG  C N1    
2677 C C2    . DG  C 10  ? 0.5781 0.4305 0.4500 0.0925  0.0789  -0.0161 10  DG  C C2    
2678 N N2    . DG  C 10  ? 0.5783 0.4301 0.4407 0.0813  0.0922  0.0036  10  DG  C N2    
2679 N N3    . DG  C 10  ? 0.5715 0.4248 0.4865 0.0930  0.0711  -0.0264 10  DG  C N3    
2680 C C4    . DG  C 10  ? 0.5713 0.4276 0.4887 0.1080  0.0533  -0.0506 10  DG  C C4    
2681 P P     . DA  C 11  ? 0.7540 0.6202 0.8901 0.0722  0.0851  -0.0311 11  DA  C P     
2682 O OP1   . DA  C 11  ? 0.7084 0.5810 0.9144 0.0612  0.1040  -0.0122 11  DA  C OP1   
2683 O OP2   . DA  C 11  ? 0.7358 0.6004 0.8610 0.0844  0.0644  -0.0589 11  DA  C OP2   
2684 O "O5'" . DA  C 11  ? 0.7043 0.5731 0.7639 0.0668  0.1037  -0.0108 11  DA  C "O5'" 
2685 C "C5'" . DA  C 11  ? 0.7165 0.5870 0.7615 0.0596  0.1176  0.0145  11  DA  C "C5'" 
2686 C "C4'" . DA  C 11  ? 0.6988 0.5729 0.6750 0.0581  0.1279  0.0234  11  DA  C "C4'" 
2687 O "O4'" . DA  C 11  ? 0.6932 0.5585 0.6317 0.0661  0.1122  0.0101  11  DA  C "O4'" 
2688 C "C3'" . DA  C 11  ? 0.6818 0.5645 0.6435 0.0573  0.1378  0.0172  11  DA  C "C3'" 
2689 O "O3'" . DA  C 11  ? 0.7263 0.6205 0.6486 0.0536  0.1541  0.0303  11  DA  C "O3'" 
2690 C "C2'" . DA  C 11  ? 0.6515 0.5252 0.5884 0.0661  0.1199  -0.0026 11  DA  C "C2'" 
2691 C "C1'" . DA  C 11  ? 0.6497 0.5159 0.5569 0.0696  0.1117  0.0011  11  DA  C "C1'" 
2692 N N9    . DA  C 11  ? 0.6461 0.5055 0.5411 0.0813  0.0936  -0.0145 11  DA  C N9    
2693 C C8    . DA  C 11  ? 0.6191 0.4770 0.5387 0.0911  0.0763  -0.0329 11  DA  C C8    
2694 N N7    . DA  C 11  ? 0.6313 0.4879 0.5198 0.1043  0.0635  -0.0418 11  DA  C N7    
2695 C C5    . DA  C 11  ? 0.6420 0.4973 0.4913 0.1009  0.0753  -0.0265 11  DA  C C5    
2696 C C6    . DA  C 11  ? 0.6517 0.5069 0.4623 0.1100  0.0747  -0.0222 11  DA  C C6    
2697 N N6    . DA  C 11  ? 0.6603 0.5195 0.4528 0.1268  0.0623  -0.0314 11  DA  C N6    
2698 N N1    . DA  C 11  ? 0.6705 0.5240 0.4632 0.1028  0.0879  -0.0074 11  DA  C N1    
2699 C C2    . DA  C 11  ? 0.6812 0.5348 0.4846 0.0898  0.0978  -0.0002 11  DA  C C2    
2700 N N3    . DA  C 11  ? 0.6497 0.5061 0.4779 0.0821  0.1013  -0.0006 11  DA  C N3    
2701 C C4    . DA  C 11  ? 0.6419 0.4982 0.4963 0.0871  0.0911  -0.0127 11  DA  C C4    
2702 P P     . DT  C 12  ? 0.7500 0.6589 0.6619 0.0534  0.1667  0.0210  12  DT  C P     
2703 O OP1   . DT  C 12  ? 0.7369 0.6668 0.6336 0.0505  0.1895  0.0393  12  DT  C OP1   
2704 O OP2   . DT  C 12  ? 0.6763 0.5817 0.6302 0.0550  0.1604  0.0042  12  DT  C OP2   
2705 O "O5'" . DT  C 12  ? 0.6930 0.5959 0.5633 0.0580  0.1553  0.0086  12  DT  C "O5'" 
2706 C "C5'" . DT  C 12  ? 0.6904 0.5933 0.5247 0.0585  0.1542  0.0172  12  DT  C "C5'" 
2707 C "C4'" . DT  C 12  ? 0.6669 0.5604 0.4847 0.0628  0.1419  0.0053  12  DT  C "C4'" 
2708 O "O4'" . DT  C 12  ? 0.6511 0.5294 0.4796 0.0668  0.1292  0.0022  12  DT  C "O4'" 
2709 C "C3'" . DT  C 12  ? 0.6502 0.5518 0.4736 0.0646  0.1436  -0.0111 12  DT  C "C3'" 
2710 O "O3'" . DT  C 12  ? 0.6461 0.5544 0.4488 0.0662  0.1427  -0.0153 12  DT  C "O3'" 
2711 C "C2'" . DT  C 12  ? 0.6360 0.5229 0.4752 0.0687  0.1311  -0.0167 12  DT  C "C2'" 
2712 C "C1'" . DT  C 12  ? 0.6337 0.5079 0.4603 0.0714  0.1230  -0.0063 12  DT  C "C1'" 
2713 N N1    . DT  C 12  ? 0.6261 0.4911 0.4618 0.0786  0.1109  -0.0096 12  DT  C N1    
2714 C C2    . DT  C 12  ? 0.6325 0.4903 0.4502 0.0864  0.1037  -0.0046 12  DT  C C2    
2715 O O2    . DT  C 12  ? 0.6277 0.4844 0.4325 0.0855  0.1081  0.0027  12  DT  C O2    
2716 N N3    . DT  C 12  ? 0.6183 0.4728 0.4359 0.0970  0.0912  -0.0087 12  DT  C N3    
2717 C C4    . DT  C 12  ? 0.6125 0.4681 0.4531 0.1000  0.0816  -0.0210 12  DT  C C4    
2718 O O4    . DT  C 12  ? 0.6041 0.4588 0.4397 0.1130  0.0663  -0.0275 12  DT  C O4    
2719 C C5    . DT  C 12  ? 0.5876 0.4484 0.4583 0.0889  0.0911  -0.0249 12  DT  C C5    
2720 C C7    . DT  C 12  ? 0.5769 0.4393 0.4884 0.0905  0.0831  -0.0376 12  DT  C C7    
2721 C C6    . DT  C 12  ? 0.5849 0.4512 0.4476 0.0793  0.1069  -0.0171 12  DT  C C6    
2722 P P     . DC  C 13  ? 0.6526 0.5691 0.4677 0.0695  0.1397  -0.0361 13  DC  C P     
2723 O OP1   . DC  C 13  ? 0.6548 0.5853 0.4497 0.0725  0.1385  -0.0436 13  DC  C OP1   
2724 O OP2   . DC  C 13  ? 0.6752 0.6015 0.5137 0.0692  0.1467  -0.0478 13  DC  C OP2   
2725 O "O5'" . DC  C 13  ? 0.6345 0.5311 0.4637 0.0715  0.1276  -0.0322 13  DC  C "O5'" 
2726 C "C5'" . DC  C 13  ? 0.6173 0.5070 0.4362 0.0724  0.1227  -0.0249 13  DC  C "C5'" 
2727 C "C4'" . DC  C 13  ? 0.6148 0.4913 0.4558 0.0754  0.1171  -0.0190 13  DC  C "C4'" 
2728 O "O4'" . DC  C 13  ? 0.5905 0.4573 0.4264 0.0781  0.1161  -0.0077 13  DC  C "O4'" 
2729 C "C3'" . DC  C 13  ? 0.6457 0.5263 0.5253 0.0771  0.1134  -0.0334 13  DC  C "C3'" 
2730 O "O3'" . DC  C 13  ? 0.6570 0.5320 0.5650 0.0788  0.1094  -0.0298 13  DC  C "O3'" 
2731 C "C2'" . DC  C 13  ? 0.6423 0.5161 0.5331 0.0791  0.1120  -0.0278 13  DC  C "C2'" 
2732 C "C1'" . DC  C 13  ? 0.6292 0.4922 0.4911 0.0819  0.1120  -0.0078 13  DC  C "C1'" 
2733 N N1    . DC  C 13  ? 0.6516 0.5114 0.5089 0.0855  0.1076  -0.0064 13  DC  C N1    
2734 C C2    . DC  C 13  ? 0.6421 0.4938 0.4871 0.0947  0.1017  0.0083  13  DC  C C2    
2735 O O2    . DC  C 13  ? 0.6633 0.5116 0.5017 0.0984  0.1049  0.0236  13  DC  C O2    
2736 N N3    . DC  C 13  ? 0.6480 0.4987 0.4899 0.1009  0.0925  0.0047  13  DC  C N3    
2737 C C4    . DC  C 13  ? 0.6721 0.5273 0.5318 0.0959  0.0915  -0.0109 13  DC  C C4    
2738 N N4    . DC  C 13  ? 0.6899 0.5437 0.5561 0.1029  0.0796  -0.0170 13  DC  C N4    
2739 C C5    . DC  C 13  ? 0.6366 0.5008 0.5096 0.0856  0.1027  -0.0216 13  DC  C C5    
2740 C C6    . DC  C 13  ? 0.6404 0.5076 0.5069 0.0819  0.1093  -0.0199 13  DC  C C6    
2741 P P     . DT  C 14  ? 0.7059 0.5831 0.6744 0.0808  0.1030  -0.0435 14  DT  C P     
2742 O OP1   . DT  C 14  ? 0.6752 0.5576 0.6723 0.0816  0.0970  -0.0566 14  DT  C OP1   
2743 O OP2   . DT  C 14  ? 0.6809 0.5691 0.6581 0.0810  0.1022  -0.0642 14  DT  C OP2   
2744 O "O5'" . DT  C 14  ? 0.6583 0.5194 0.6459 0.0839  0.1048  -0.0134 14  DT  C "O5'" 
2745 C "C5'" . DT  C 14  ? 0.6463 0.4987 0.6167 0.0859  0.1113  0.0129  14  DT  C "C5'" 
2746 C "C4'" . DT  C 14  ? 0.6553 0.4990 0.6365 0.0926  0.1144  0.0425  14  DT  C "C4'" 
2747 O "O4'" . DT  C 14  ? 0.6532 0.4962 0.5938 0.0968  0.1113  0.0447  14  DT  C "O4'" 
2748 C "C3'" . DT  C 14  ? 0.6526 0.4937 0.7006 0.0939  0.1098  0.0460  14  DT  C "C3'" 
2749 O "O3'" . DT  C 14  ? 0.6860 0.5210 0.7608 0.0987  0.1189  0.0813  14  DT  C "O3'" 
2750 C "C2'" . DT  C 14  ? 0.6501 0.4901 0.6868 0.0976  0.1028  0.0446  14  DT  C "C2'" 
2751 C "C1'" . DT  C 14  ? 0.6499 0.4894 0.6176 0.1022  0.1054  0.0542  14  DT  C "C1'" 
2752 N N1    . DT  C 14  ? 0.6654 0.5073 0.6117 0.1027  0.0974  0.0375  14  DT  C N1    
2753 C C2    . DT  C 14  ? 0.6908 0.5302 0.6059 0.1130  0.0915  0.0511  14  DT  C C2    
2754 O O2    . DT  C 14  ? 0.7260 0.5637 0.6235 0.1233  0.0938  0.0777  14  DT  C O2    
2755 N N3    . DT  C 14  ? 0.6916 0.5334 0.6006 0.1126  0.0828  0.0316  14  DT  C N3    
2756 C C4    . DT  C 14  ? 0.6863 0.5341 0.6136 0.1027  0.0845  0.0053  14  DT  C C4    
2757 O O4    . DT  C 14  ? 0.6933 0.5435 0.6217 0.1032  0.0788  -0.0075 14  DT  C O4    
2758 C C5    . DT  C 14  ? 0.6728 0.5263 0.6198 0.0940  0.0930  -0.0061 14  DT  C C5    
2759 C C7    . DT  C 14  ? 0.6732 0.5398 0.6308 0.0868  0.0979  -0.0335 14  DT  C C7    
2760 C C6    . DT  C 14  ? 0.6552 0.5049 0.6114 0.0947  0.0965  0.0080  14  DT  C C6    
2761 P P     . DC  C 15  ? 0.7511 0.5819 0.9170 0.0992  0.1170  0.0936  15  DC  C P     
2762 O OP1   . DC  C 15  ? 0.7478 0.5770 0.9511 0.0989  0.1294  0.1162  15  DC  C OP1   
2763 O OP2   . DC  C 15  ? 0.7104 0.5464 0.9205 0.0941  0.1024  0.0524  15  DC  C OP2   
2764 O "O5'" . DC  C 15  ? 0.7540 0.5798 0.9098 0.1090  0.1171  0.1280  15  DC  C "O5'" 
2765 C "C5'" . DC  C 15  ? 0.7523 0.5791 0.8461 0.1196  0.1280  0.1633  15  DC  C "C5'" 
2766 C "C4'" . DC  C 15  ? 0.7673 0.5928 0.8423 0.1307  0.1186  0.1802  15  DC  C "C4'" 
2767 O "O4'" . DC  C 15  ? 0.7336 0.5607 0.7676 0.1284  0.1046  0.1445  15  DC  C "O4'" 
2768 C "C3'" . DC  C 15  ? 0.7658 0.5849 0.9227 0.1308  0.1105  0.1925  15  DC  C "C3'" 
2769 O "O3'" . DC  C 15  ? 0.8270 0.6457 0.9901 0.1442  0.1196  0.2477  15  DC  C "O3'" 
2770 C "C2'" . DC  C 15  ? 0.7479 0.5662 0.8945 0.1308  0.0914  0.1632  15  DC  C "C2'" 
2771 C "C1'" . DC  C 15  ? 0.7318 0.5556 0.7897 0.1337  0.0904  0.1471  15  DC  C "C1'" 
2772 N N1    . DC  C 15  ? 0.7220 0.5481 0.7739 0.1262  0.0793  0.1042  15  DC  C N1    
2773 C C2    . DC  C 15  ? 0.7277 0.5553 0.7377 0.1339  0.0677  0.0973  15  DC  C C2    
2774 O O2    . DC  C 15  ? 0.7455 0.5737 0.7185 0.1489  0.0637  0.1240  15  DC  C O2    
2775 N N3    . DC  C 15  ? 0.7046 0.5355 0.7190 0.1264  0.0613  0.0613  15  DC  C N3    
2776 C C4    . DC  C 15  ? 0.6791 0.5147 0.7248 0.1137  0.0675  0.0338  15  DC  C C4    
2777 N N4    . DC  C 15  ? 0.6733 0.5160 0.7197 0.1080  0.0658  0.0033  15  DC  C N4    
2778 C C5    . DC  C 15  ? 0.6727 0.5087 0.7533 0.1080  0.0756  0.0356  15  DC  C C5    
2779 C C6    . DC  C 15  ? 0.6989 0.5286 0.7869 0.1135  0.0806  0.0705  15  DC  C C6    
2780 P P     . DA  C 16  ? 0.8688 0.6800 1.1238 0.1468  0.1134  0.2761  16  DA  C P     
2781 O OP1   . DA  C 16  ? 0.9260 0.7388 1.2122 0.1543  0.1351  0.3353  16  DA  C OP1   
2782 O OP2   . DA  C 16  ? 0.8258 0.6324 1.1593 0.1326  0.0996  0.2296  16  DA  C OP2   
2783 O "O5'" . DA  C 16  ? 0.8750 0.6866 1.0833 0.1612  0.0966  0.2875  16  DA  C "O5'" 
2784 C "C5'" . DA  C 16  ? 0.9024 0.7235 1.0133 0.1786  0.0994  0.3103  16  DA  C "C5'" 
2785 C "C4'" . DA  C 16  ? 0.9127 0.7330 0.9970 0.1884  0.0737  0.2966  16  DA  C "C4'" 
2786 O "O4'" . DA  C 16  ? 0.8525 0.6700 0.9362 0.1740  0.0617  0.2369  16  DA  C "O4'" 
2787 C "C3'" . DA  C 16  ? 0.9239 0.7356 1.0859 0.1922  0.0602  0.3212  16  DA  C "C3'" 
2788 O "O3'" . DA  C 16  ? 0.9737 0.7910 1.0838 0.2152  0.0458  0.3513  16  DA  C "O3'" 
2789 C "C2'" . DA  C 16  ? 0.8907 0.6952 1.1080 0.1757  0.0441  0.2649  16  DA  C "C2'" 
2790 C "C1'" . DA  C 16  ? 0.8602 0.6713 0.9989 0.1723  0.0417  0.2216  16  DA  C "C1'" 
2791 N N9    . DA  C 16  ? 0.8154 0.6263 0.9836 0.1542  0.0399  0.1671  16  DA  C N9    
2792 C C8    . DA  C 16  ? 0.7963 0.6071 1.0195 0.1393  0.0493  0.1452  16  DA  C C8    
2793 N N7    . DA  C 16  ? 0.7808 0.5972 1.0045 0.1287  0.0466  0.0969  16  DA  C N7    
2794 C C5    . DA  C 16  ? 0.7570 0.5750 0.9331 0.1350  0.0360  0.0880  16  DA  C C5    
2795 C C6    . DA  C 16  ? 0.7372 0.5616 0.8991 0.1292  0.0318  0.0483  16  DA  C C6    
2796 N N6    . DA  C 16  ? 0.7057 0.5390 0.8884 0.1169  0.0400  0.0111  16  DA  C N6    
2797 N N1    . DA  C 16  ? 0.7486 0.5726 0.8747 0.1385  0.0192  0.0485  16  DA  C N1    
2798 C C2    . DA  C 16  ? 0.7774 0.5972 0.8745 0.1548  0.0090  0.0836  16  DA  C C2    
2799 N N3    . DA  C 16  ? 0.7772 0.5934 0.8736 0.1632  0.0140  0.1260  16  DA  C N3    
2800 C C4    . DA  C 16  ? 0.7756 0.5900 0.9174 0.1512  0.0291  0.1274  16  DA  C C4    
2801 P P     . DA  C 17  ? 0.9131 0.8026 0.6964 0.0687  0.1180  0.1887  17  DA  C P     
2802 O OP1   . DA  C 17  ? 0.9178 0.8824 0.6674 0.0995  0.1329  0.2073  17  DA  C OP1   
2803 O OP2   . DA  C 17  ? 0.9119 0.7322 0.7160 0.0484  0.1398  0.2142  17  DA  C OP2   
2804 O "O5'" . DA  C 17  ? 0.8899 0.7929 0.6742 0.0816  0.0925  0.1662  17  DA  C "O5'" 
2805 C "C5'" . DA  C 17  ? 0.8793 0.8340 0.6957 0.0848  0.0714  0.1089  17  DA  C "C5'" 
2806 C "C4'" . DA  C 17  ? 0.8726 0.8256 0.7173 0.0866  0.0590  0.0837  17  DA  C "C4'" 
2807 O "O4'" . DA  C 17  ? 0.8583 0.7290 0.7337 0.0619  0.0646  0.0926  17  DA  C "O4'" 
2808 C "C3'" . DA  C 17  ? 0.8949 0.8598 0.6966 0.1107  0.0594  0.1166  17  DA  C "C3'" 
2809 O "O3'" . DA  C 17  ? 0.9050 0.9553 0.7319 0.1321  0.0408  0.0617  17  DA  C "O3'" 
2810 C "C2'" . DA  C 17  ? 0.8687 0.7385 0.6772 0.0866  0.0665  0.1464  17  DA  C "C2'" 
2811 C "C1'" . DA  C 17  ? 0.8267 0.6686 0.6889 0.0636  0.0640  0.1137  17  DA  C "C1'" 
2812 N N9    . DA  C 17  ? 0.7873 0.5632 0.6507 0.0491  0.0723  0.1403  17  DA  C N9    
2813 C C8    . DA  C 17  ? 0.7960 0.5486 0.6390 0.0430  0.0786  0.1629  17  DA  C C8    
2814 N N7    . DA  C 17  ? 0.7622 0.4921 0.6135 0.0416  0.0800  0.1680  17  DA  C N7    
2815 C C5    . DA  C 17  ? 0.7714 0.4924 0.6455 0.0467  0.0822  0.1649  17  DA  C C5    
2816 C C6    . DA  C 17  ? 0.7777 0.4819 0.6660 0.0570  0.0935  0.1803  17  DA  C C6    
2817 N N6    . DA  C 17  ? 0.7948 0.5100 0.6625 0.0720  0.0937  0.1945  17  DA  C N6    
2818 N N1    . DA  C 17  ? 0.7735 0.4641 0.7071 0.0562  0.1093  0.1762  17  DA  C N1    
2819 C C2    . DA  C 17  ? 0.7779 0.4877 0.7465 0.0447  0.1049  0.1388  17  DA  C C2    
2820 N N3    . DA  C 17  ? 0.7709 0.5207 0.7187 0.0435  0.0860  0.1152  17  DA  C N3    
2821 C C4    . DA  C 17  ? 0.7732 0.5184 0.6678 0.0454  0.0787  0.1402  17  DA  C C4    
2822 P P     . DT  C 18  ? 0.9809 1.0750 0.7701 0.1700  0.0341  0.0781  18  DT  C P     
2823 O OP1   . DT  C 18  ? 0.9982 1.2481 0.8000 0.2126  0.0123  0.0084  18  DT  C OP1   
2824 O OP2   . DT  C 18  ? 1.0001 1.0371 0.7257 0.1858  0.0583  0.1662  18  DT  C OP2   
2825 O "O5'" . DT  C 18  ? 0.9330 0.9541 0.7725 0.1364  0.0319  0.0621  18  DT  C "O5'" 
2826 C "C5'" . DT  C 18  ? 0.9005 0.9466 0.8300 0.1155  0.0276  -0.0123 18  DT  C "C5'" 
2827 C "C4'" . DT  C 18  ? 0.8950 0.8648 0.8531 0.0920  0.0377  0.0021  18  DT  C "C4'" 
2828 O "O4'" . DT  C 18  ? 0.8800 0.7486 0.8075 0.0721  0.0522  0.0641  18  DT  C "O4'" 
2829 C "C3'" . DT  C 18  ? 0.9104 0.9038 0.8257 0.1178  0.0258  0.0193  18  DT  C "C3'" 
2830 O "O3'" . DT  C 18  ? 0.9367 0.9984 0.9249 0.1184  0.0193  -0.0539 18  DT  C "O3'" 
2831 C "C2'" . DT  C 18  ? 0.8907 0.7770 0.7787 0.0981  0.0384  0.0808  18  DT  C "C2'" 
2832 C "C1'" . DT  C 18  ? 0.8604 0.6876 0.7806 0.0680  0.0552  0.0876  18  DT  C "C1'" 
2833 N N1    . DT  C 18  ? 0.8274 0.5899 0.7097 0.0600  0.0626  0.1375  18  DT  C N1    
2834 C C2    . DT  C 18  ? 0.8062 0.5301 0.7081 0.0505  0.0751  0.1508  18  DT  C C2    
2835 O O2    . DT  C 18  ? 0.7934 0.5153 0.7433 0.0457  0.0888  0.1371  18  DT  C O2    
2836 N N3    . DT  C 18  ? 0.7764 0.4773 0.6485 0.0514  0.0759  0.1768  18  DT  C N3    
2837 C C4    . DT  C 18  ? 0.7895 0.4879 0.6371 0.0500  0.0723  0.1849  18  DT  C C4    
2838 O O4    . DT  C 18  ? 0.8296 0.5241 0.6772 0.0484  0.0745  0.1864  18  DT  C O4    
2839 C C5    . DT  C 18  ? 0.7964 0.5127 0.6286 0.0560  0.0707  0.1863  18  DT  C C5    
2840 C C7    . DT  C 18  ? 0.7981 0.5037 0.6181 0.0553  0.0840  0.2065  18  DT  C C7    
2841 C C6    . DT  C 18  ? 0.8113 0.5667 0.6513 0.0660  0.0627  0.1648  18  DT  C C6    
2842 P P     . DC  C 19  ? 0.9711 1.1033 0.9299 0.1568  0.0002  -0.0645 19  DC  C P     
2843 O OP1   . DC  C 19  ? 0.9287 1.2149 0.9527 0.1809  -0.0181 -0.1690 19  DC  C OP1   
2844 O OP2   . DC  C 19  ? 0.9957 1.0980 0.8489 0.1926  -0.0011 0.0210  19  DC  C OP2   
2845 O "O5'" . DC  C 19  ? 0.9205 0.9683 0.9214 0.1212  0.0159  -0.0539 19  DC  C "O5'" 
2846 C "C5'" . DC  C 19  ? 0.8796 0.8775 0.9784 0.0767  0.0450  -0.0811 19  DC  C "C5'" 
2847 C "C4'" . DC  C 19  ? 0.8682 0.7823 0.9568 0.0601  0.0624  -0.0304 19  DC  C "C4'" 
2848 O "O4'" . DC  C 19  ? 0.8786 0.7114 0.9008 0.0562  0.0682  0.0426  19  DC  C "O4'" 
2849 C "C3'" . DC  C 19  ? 0.8550 0.7984 0.8977 0.0844  0.0409  -0.0241 19  DC  C "C3'" 
2850 O "O3'" . DC  C 19  ? 0.8541 0.8155 0.9760 0.0678  0.0564  -0.0659 19  DC  C "O3'" 
2851 C "C2'" . DC  C 19  ? 0.8341 0.6965 0.7982 0.0871  0.0406  0.0529  19  DC  C "C2'" 
2852 C "C1'" . DC  C 19  ? 0.8209 0.6222 0.8002 0.0620  0.0640  0.0796  19  DC  C "C1'" 
2853 N N1    . DC  C 19  ? 0.8060 0.5621 0.7239 0.0657  0.0601  0.1281  19  DC  C N1    
2854 C C2    . DC  C 19  ? 0.8049 0.5252 0.7176 0.0595  0.0732  0.1562  19  DC  C C2    
2855 O O2    . DC  C 19  ? 0.8002 0.5189 0.7469 0.0559  0.0928  0.1578  19  DC  C O2    
2856 N N3    . DC  C 19  ? 0.7844 0.4872 0.6628 0.0623  0.0685  0.1765  19  DC  C N3    
2857 C C4    . DC  C 19  ? 0.7734 0.4716 0.6303 0.0647  0.0609  0.1807  19  DC  C C4    
2858 N N4    . DC  C 19  ? 0.7693 0.4522 0.6198 0.0610  0.0644  0.1890  19  DC  C N4    
2859 C C5    . DC  C 19  ? 0.7954 0.5204 0.6436 0.0765  0.0539  0.1728  19  DC  C C5    
2860 C C6    . DC  C 19  ? 0.8015 0.5656 0.6772 0.0798  0.0488  0.1410  19  DC  C C6    
2861 P P     . DT  C 20  ? 0.8693 0.8793 0.9684 0.0925  0.0348  -0.0801 20  DT  C P     
2862 O OP1   . DT  C 20  ? 0.8564 0.9373 1.0738 0.0756  0.0491  -0.1671 20  DT  C OP1   
2863 O OP2   . DT  C 20  ? 0.8672 0.9223 0.8750 0.1426  0.0015  -0.0583 20  DT  C OP2   
2864 O "O5'" . DT  C 20  ? 0.8373 0.7551 0.9004 0.0785  0.0501  -0.0127 20  DT  C "O5'" 
2865 C "C5'" . DT  C 20  ? 0.8525 0.7237 0.9774 0.0474  0.0919  -0.0002 20  DT  C "C5'" 
2866 C "C4'" . DT  C 20  ? 0.8458 0.6663 0.9116 0.0528  0.0959  0.0614  20  DT  C "C4'" 
2867 O "O4'" . DT  C 20  ? 0.8443 0.6295 0.8409 0.0620  0.0805  0.1005  20  DT  C "O4'" 
2868 C "C3'" . DT  C 20  ? 0.8405 0.6857 0.8761 0.0698  0.0722  0.0544  20  DT  C "C3'" 
2869 O "O3'" . DT  C 20  ? 0.8612 0.7021 0.9237 0.0619  0.0997  0.0683  20  DT  C "O3'" 
2870 C "C2'" . DT  C 20  ? 0.8389 0.6523 0.7996 0.0878  0.0484  0.0904  20  DT  C "C2'" 
2871 C "C1'" . DT  C 20  ? 0.8081 0.5839 0.7569 0.0760  0.0637  0.1205  20  DT  C "C1'" 
2872 N N1    . DT  C 20  ? 0.7718 0.5224 0.6775 0.0833  0.0496  0.1398  20  DT  C N1    
2873 C C2    . DT  C 20  ? 0.7648 0.4970 0.6551 0.0821  0.0531  0.1572  20  DT  C C2    
2874 O O2    . DT  C 20  ? 0.7496 0.4991 0.6447 0.0852  0.0626  0.1612  20  DT  C O2    
2875 N N3    . DT  C 20  ? 0.7772 0.4863 0.6522 0.0826  0.0487  0.1658  20  DT  C N3    
2876 C C4    . DT  C 20  ? 0.8013 0.5000 0.6620 0.0904  0.0462  0.1757  20  DT  C C4    
2877 O O4    . DT  C 20  ? 0.8198 0.4935 0.6769 0.0897  0.0543  0.1906  20  DT  C O4    
2878 C C5    . DT  C 20  ? 0.7990 0.5349 0.6583 0.1035  0.0375  0.1616  20  DT  C C5    
2879 C C7    . DT  C 20  ? 0.8226 0.5846 0.6543 0.1309  0.0331  0.1720  20  DT  C C7    
2880 C C6    . DT  C 20  ? 0.7790 0.5405 0.6678 0.0960  0.0376  0.1360  20  DT  C C6    
2881 P P     . DT  C 21  ? 0.8652 0.7391 0.9205 0.0744  0.0846  0.0524  21  DT  C P     
2882 O OP1   . DT  C 21  ? 0.8269 0.7201 0.9535 0.0585  0.1277  0.0445  21  DT  C OP1   
2883 O OP2   . DT  C 21  ? 0.8948 0.8025 0.9309 0.0954  0.0463  0.0187  21  DT  C OP2   
2884 O "O5'" . DT  C 21  ? 0.8179 0.6695 0.8112 0.0897  0.0727  0.0904  21  DT  C "O5'" 
2885 C "C5'" . DT  C 21  ? 0.8158 0.6624 0.7986 0.0920  0.0992  0.1275  21  DT  C "C5'" 
2886 C "C4'" . DT  C 21  ? 0.8125 0.6656 0.7507 0.1087  0.0757  0.1316  21  DT  C "C4'" 
2887 O "O4'" . DT  C 21  ? 0.8103 0.6236 0.7319 0.1028  0.0573  0.1302  21  DT  C "O4'" 
2888 C "C3'" . DT  C 21  ? 0.7915 0.6726 0.7315 0.1207  0.0531  0.1017  21  DT  C "C3'" 
2889 O "O3'" . DT  C 21  ? 0.7908 0.7325 0.7217 0.1405  0.0596  0.1010  21  DT  C "O3'" 
2890 C "C2'" . DT  C 21  ? 0.7894 0.6288 0.7247 0.1212  0.0299  0.0903  21  DT  C "C2'" 
2891 C "C1'" . DT  C 21  ? 0.7781 0.5899 0.6973 0.1116  0.0377  0.1118  21  DT  C "C1'" 
2892 N N1    . DT  C 21  ? 0.7667 0.5300 0.6807 0.1085  0.0312  0.1199  21  DT  C N1    
2893 C C2    . DT  C 21  ? 0.7968 0.5415 0.7216 0.1048  0.0338  0.1164  21  DT  C C2    
2894 O O2    . DT  C 21  ? 0.7991 0.5808 0.7400 0.1058  0.0335  0.0926  21  DT  C O2    
2895 N N3    . DT  C 21  ? 0.8132 0.5109 0.7360 0.1051  0.0400  0.1366  21  DT  C N3    
2896 C C4    . DT  C 21  ? 0.8197 0.5073 0.7168 0.1194  0.0382  0.1597  21  DT  C C4    
2897 O O4    . DT  C 21  ? 0.8302 0.4892 0.7191 0.1299  0.0497  0.1867  21  DT  C O4    
2898 C C5    . DT  C 21  ? 0.8063 0.5349 0.6953 0.1252  0.0263  0.1452  21  DT  C C5    
2899 C C7    . DT  C 21  ? 0.8209 0.5802 0.6915 0.1498  0.0177  0.1461  21  DT  C C7    
2900 C C6    . DT  C 21  ? 0.7656 0.5201 0.6704 0.1143  0.0268  0.1266  21  DT  C C6    
2901 P P     . DT  C 22  ? 0.7955 0.7907 0.7415 0.1562  0.0406  0.0591  22  DT  C P     
2902 O OP1   . DT  C 22  ? 0.8173 0.9050 0.7488 0.1844  0.0585  0.0676  22  DT  C OP1   
2903 O OP2   . DT  C 22  ? 0.8038 0.7698 0.7701 0.1473  0.0301  0.0440  22  DT  C OP2   
2904 O "O5'" . DT  C 22  ? 0.8138 0.8033 0.7777 0.1582  0.0189  0.0223  22  DT  C "O5'" 
2905 C "C5'" . DT  C 22  ? 0.8151 0.8877 0.7802 0.1786  0.0163  -0.0046 22  DT  C "C5'" 
2906 C "C4'" . DT  C 22  ? 0.8148 0.8606 0.8245 0.1658  0.0062  -0.0444 22  DT  C "C4'" 
2907 O "O4'" . DT  C 22  ? 0.8321 0.7672 0.8348 0.1407  0.0136  -0.0046 22  DT  C "O4'" 
2908 C "C3'" . DT  C 22  ? 0.8199 0.8768 0.9110 0.1643  -0.0043 -0.1142 22  DT  C "C3'" 
2909 O "O3'" . DT  C 22  ? 0.8145 1.0012 0.9452 0.1861  -0.0151 -0.1896 22  DT  C "O3'" 
2910 C "C2'" . DT  C 22  ? 0.8398 0.7886 0.9785 0.1393  0.0087  -0.1072 22  DT  C "C2'" 
2911 C "C1'" . DT  C 22  ? 0.8518 0.7449 0.9195 0.1289  0.0163  -0.0378 22  DT  C "C1'" 
2912 N N1    . DT  C 22  ? 0.8908 0.6830 0.9475 0.1208  0.0268  0.0110  22  DT  C N1    
2913 C C2    . DT  C 22  ? 0.9427 0.6748 1.0344 0.1093  0.0460  0.0206  22  DT  C C2    
2914 O O2    . DT  C 22  ? 0.9594 0.7127 1.1051 0.0972  0.0542  -0.0202 22  DT  C O2    
2915 N N3    . DT  C 22  ? 0.9731 0.6355 1.0387 0.1182  0.0583  0.0762  22  DT  C N3    
2916 C C4    . DT  C 22  ? 0.9689 0.6322 0.9825 0.1382  0.0463  0.1069  22  DT  C C4    
2917 O O4    . DT  C 22  ? 1.0181 0.6468 1.0070 0.1587  0.0564  0.1506  22  DT  C O4    
2918 C C5    . DT  C 22  ? 0.9054 0.6287 0.9017 0.1390  0.0256  0.0810  22  DT  C C5    
2919 C C7    . DT  C 22  ? 0.8919 0.6337 0.8555 0.1559  0.0140  0.0930  22  DT  C C7    
2920 C C6    . DT  C 22  ? 0.8718 0.6488 0.8875 0.1304  0.0205  0.0429  22  DT  C C6    
2921 O "O5'" . DA  D 1   ? 1.0111 0.7639 1.2707 0.1138  0.3074  0.2854  1   DA  D "O5'" 
2922 C "C5'" . DA  D 1   ? 1.0095 0.7487 1.3775 0.0949  0.3309  0.2669  1   DA  D "C5'" 
2923 C "C4'" . DA  D 1   ? 0.9826 0.7246 1.3907 0.0746  0.2963  0.2145  1   DA  D "C4'" 
2924 O "O4'" . DA  D 1   ? 0.9739 0.7140 1.3311 0.0817  0.2748  0.2186  1   DA  D "O4'" 
2925 C "C3'" . DA  D 1   ? 0.9581 0.7226 1.3495 0.0620  0.2564  0.1661  1   DA  D "C3'" 
2926 O "O3'" . DA  D 1   ? 0.9811 0.7460 1.4720 0.0472  0.2569  0.1243  1   DA  D "O3'" 
2927 C "C2'" . DA  D 1   ? 0.9345 0.7061 1.2632 0.0643  0.2168  0.1472  1   DA  D "C2'" 
2928 C "C1'" . DA  D 1   ? 0.9124 0.6668 1.2415 0.0728  0.2312  0.1752  1   DA  D "C1'" 
2929 N N9    . DA  D 1   ? 0.8550 0.6178 1.0996 0.0840  0.2103  0.1908  1   DA  D N9    
2930 C C8    . DA  D 1   ? 0.8479 0.6167 1.0342 0.1006  0.2163  0.2276  1   DA  D C8    
2931 N N7    . DA  D 1   ? 0.8139 0.5939 0.9475 0.1062  0.1898  0.2247  1   DA  D N7    
2932 C C5    . DA  D 1   ? 0.8186 0.5965 0.9699 0.0937  0.1704  0.1902  1   DA  D C5    
2933 C C6    . DA  D 1   ? 0.8129 0.5965 0.9341 0.0944  0.1463  0.1753  1   DA  D C6    
2934 N N6    . DA  D 1   ? 0.8120 0.6067 0.8924 0.1031  0.1348  0.1894  1   DA  D N6    
2935 N N1    . DA  D 1   ? 0.8002 0.5790 0.9391 0.0895  0.1354  0.1437  1   DA  D N1    
2936 C C2    . DA  D 1   ? 0.7976 0.5704 0.9872 0.0830  0.1413  0.1208  1   DA  D C2    
2937 N N3    . DA  D 1   ? 0.7909 0.5592 1.0285 0.0768  0.1622  0.1274  1   DA  D N3    
2938 C C4    . DA  D 1   ? 0.8145 0.5836 1.0274 0.0826  0.1795  0.1669  1   DA  D C4    
2939 P P     . DA  D 2   ? 1.0237 0.8125 1.5255 0.0390  0.2309  0.0802  2   DA  D P     
2940 O OP1   . DA  D 2   ? 1.0170 0.8053 1.6486 0.0270  0.2440  0.0452  2   DA  D OP1   
2941 O OP2   . DA  D 2   ? 0.9570 0.7549 1.3894 0.0453  0.2376  0.1099  2   DA  D OP2   
2942 O "O5'" . DA  D 2   ? 0.9346 0.7362 1.3769 0.0436  0.1810  0.0408  2   DA  D "O5'" 
2943 C "C5'" . DA  D 2   ? 0.9208 0.7175 1.4048 0.0449  0.1652  0.0057  2   DA  D "C5'" 
2944 C "C4'" . DA  D 2   ? 0.8793 0.6871 1.2847 0.0579  0.1253  -0.0194 2   DA  D "C4'" 
2945 O "O4'" . DA  D 2   ? 0.8534 0.6529 1.1750 0.0638  0.1275  0.0206  2   DA  D "O4'" 
2946 C "C3'" . DA  D 2   ? 0.8146 0.6442 1.1816 0.0636  0.1001  -0.0446 2   DA  D "C3'" 
2947 O "O3'" . DA  D 2   ? 0.8307 0.6703 1.1872 0.0807  0.0670  -0.0919 2   DA  D "O3'" 
2948 C "C2'" . DA  D 2   ? 0.7808 0.6088 1.0555 0.0659  0.1030  -0.0034 2   DA  D "C2'" 
2949 C "C1'" . DA  D 2   ? 0.7587 0.5713 1.0044 0.0703  0.1078  0.0203  2   DA  D "C1'" 
2950 N N9    . DA  D 2   ? 0.7232 0.5321 0.9148 0.0702  0.1191  0.0643  2   DA  D N9    
2951 C C8    . DA  D 2   ? 0.7274 0.5364 0.9170 0.0669  0.1402  0.0962  2   DA  D C8    
2952 N N7    . DA  D 2   ? 0.7296 0.5399 0.8645 0.0739  0.1395  0.1244  2   DA  D N7    
2953 C C5    . DA  D 2   ? 0.6978 0.5070 0.8068 0.0776  0.1204  0.1126  2   DA  D C5    
2954 C C6    . DA  D 2   ? 0.6900 0.5016 0.7571 0.0840  0.1115  0.1271  2   DA  D C6    
2955 N N6    . DA  D 2   ? 0.6866 0.5061 0.7263 0.0895  0.1134  0.1510  2   DA  D N6    
2956 N N1    . DA  D 2   ? 0.6927 0.5001 0.7502 0.0882  0.1003  0.1134  2   DA  D N1    
2957 C C2    . DA  D 2   ? 0.6992 0.5016 0.7760 0.0908  0.0951  0.0857  2   DA  D C2    
2958 N N3    . DA  D 2   ? 0.7030 0.5068 0.8196 0.0868  0.0957  0.0631  2   DA  D N3    
2959 C C4    . DA  D 2   ? 0.7094 0.5161 0.8462 0.0775  0.1101  0.0788  2   DA  D C4    
2960 P P     . DA  D 3   ? 0.8725 0.7327 1.1699 0.0994  0.0365  -0.1193 3   DA  D P     
2961 O OP1   . DA  D 3   ? 0.8481 0.7252 1.1875 0.1181  0.0068  -0.1818 3   DA  D OP1   
2962 O OP2   . DA  D 3   ? 0.8519 0.7196 1.1401 0.0872  0.0475  -0.0984 3   DA  D OP2   
2963 O "O5'" . DA  D 3   ? 0.8408 0.6901 1.0395 0.1150  0.0324  -0.0927 3   DA  D "O5'" 
2964 C "C5'" . DA  D 3   ? 0.7957 0.6377 0.9750 0.1344  0.0224  -0.1069 3   DA  D "C5'" 
2965 C "C4'" . DA  D 3   ? 0.7806 0.6160 0.8703 0.1521  0.0223  -0.0820 3   DA  D "C4'" 
2966 O "O4'" . DA  D 3   ? 0.7437 0.5681 0.8162 0.1319  0.0435  -0.0337 3   DA  D "O4'" 
2967 C "C3'" . DA  D 3   ? 0.7896 0.6379 0.8299 0.1712  0.0086  -0.0933 3   DA  D "C3'" 
2968 O "O3'" . DA  D 3   ? 0.8286 0.6702 0.8008 0.2041  0.0062  -0.0894 3   DA  D "O3'" 
2969 C "C2'" . DA  D 3   ? 0.7402 0.5863 0.7691 0.1478  0.0243  -0.0564 3   DA  D "C2'" 
2970 C "C1'" . DA  D 3   ? 0.7216 0.5516 0.7493 0.1332  0.0430  -0.0196 3   DA  D "C1'" 
2971 N N9    . DA  D 3   ? 0.6727 0.5026 0.7124 0.1098  0.0571  0.0101  3   DA  D N9    
2972 C C8    . DA  D 3   ? 0.6550 0.4917 0.7333 0.0944  0.0640  0.0102  3   DA  D C8    
2973 N N7    . DA  D 3   ? 0.6397 0.4749 0.7070 0.0839  0.0774  0.0419  3   DA  D N7    
2974 C C5    . DA  D 3   ? 0.6405 0.4700 0.6684 0.0895  0.0753  0.0587  3   DA  D C5    
2975 C C6    . DA  D 3   ? 0.6357 0.4662 0.6415 0.0866  0.0798  0.0851  3   DA  D C6    
2976 N N6    . DA  D 3   ? 0.6197 0.4568 0.6244 0.0819  0.0869  0.1018  3   DA  D N6    
2977 N N1    . DA  D 3   ? 0.6615 0.4876 0.6489 0.0927  0.0766  0.0919  3   DA  D N1    
2978 C C2    . DA  D 3   ? 0.6566 0.4745 0.6376 0.1039  0.0743  0.0792  3   DA  D C2    
2979 N N3    . DA  D 3   ? 0.6562 0.4727 0.6421 0.1133  0.0685  0.0548  3   DA  D N3    
2980 C C4    . DA  D 3   ? 0.6594 0.4837 0.6729 0.1040  0.0665  0.0424  3   DA  D C4    
2981 P P     . DG  D 4   ? 0.8473 0.6979 0.7589 0.2371  -0.0041 -0.0984 4   DG  D P     
2982 O OP1   . DG  D 4   ? 0.8560 0.7067 0.7202 0.2848  -0.0147 -0.1200 4   DG  D OP1   
2983 O OP2   . DG  D 4   ? 0.8233 0.6937 0.7695 0.2253  -0.0181 -0.1216 4   DG  D OP2   
2984 O "O5'" . DG  D 4   ? 0.8174 0.6513 0.6898 0.2277  0.0215  -0.0480 4   DG  D "O5'" 
2985 C "C5'" . DG  D 4   ? 0.8137 0.6287 0.6618 0.2357  0.0411  -0.0189 4   DG  D "C5'" 
2986 C "C4'" . DG  D 4   ? 0.7892 0.5943 0.6245 0.2233  0.0615  0.0183  4   DG  D "C4'" 
2987 O "O4'" . DG  D 4   ? 0.7177 0.5282 0.5942 0.1837  0.0616  0.0290  4   DG  D "O4'" 
2988 C "C3'" . DG  D 4   ? 0.8050 0.6130 0.6059 0.2423  0.0619  0.0178  4   DG  D "C3'" 
2989 O "O3'" . DG  D 4   ? 0.8453 0.6345 0.6146 0.2650  0.0880  0.0472  4   DG  D "O3'" 
2990 C "C2'" . DG  D 4   ? 0.7609 0.5784 0.5930 0.2068  0.0581  0.0215  4   DG  D "C2'" 
2991 C "C1'" . DG  D 4   ? 0.7205 0.5346 0.5892 0.1756  0.0647  0.0384  4   DG  D "C1'" 
2992 N N9    . DG  D 4   ? 0.7006 0.5267 0.6014 0.1470  0.0575  0.0349  4   DG  D N9    
2993 C C8    . DG  D 4   ? 0.7130 0.5518 0.6368 0.1414  0.0456  0.0118  4   DG  D C8    
2994 N N7    . DG  D 4   ? 0.6742 0.5188 0.6243 0.1184  0.0497  0.0209  4   DG  D N7    
2995 C C5    . DG  D 4   ? 0.6550 0.4939 0.5926 0.1106  0.0584  0.0466  4   DG  D C5    
2996 C C6    . DG  D 4   ? 0.6357 0.4800 0.5810 0.0954  0.0626  0.0631  4   DG  D C6    
2997 O O6    . DG  D 4   ? 0.6620 0.5137 0.6219 0.0866  0.0658  0.0653  4   DG  D O6    
2998 N N1    . DG  D 4   ? 0.6173 0.4588 0.5543 0.0953  0.0645  0.0774  4   DG  D N1    
2999 C C2    . DG  D 4   ? 0.6114 0.4426 0.5423 0.1053  0.0690  0.0808  4   DG  D C2    
3000 N N2    . DG  D 4   ? 0.5837 0.4158 0.5262 0.1016  0.0714  0.0916  4   DG  D N2    
3001 N N3    . DG  D 4   ? 0.6296 0.4516 0.5459 0.1219  0.0718  0.0729  4   DG  D N3    
3002 C C4    . DG  D 4   ? 0.6697 0.4976 0.5859 0.1250  0.0631  0.0538  4   DG  D C4    
3003 P P     . DA  D 5   ? 0.8845 0.6674 0.6142 0.2940  0.1007  0.0582  5   DA  D P     
3004 O OP1   . DA  D 5   ? 0.9059 0.6645 0.6105 0.3245  0.1357  0.0910  5   DA  D OP1   
3005 O OP2   . DA  D 5   ? 0.8682 0.6696 0.5695 0.3194  0.0741  0.0237  5   DA  D OP2   
3006 O "O5'" . DA  D 5   ? 0.8067 0.5911 0.5765 0.2536  0.1053  0.0713  5   DA  D "O5'" 
3007 C "C5'" . DA  D 5   ? 0.7826 0.5577 0.5917 0.2277  0.1218  0.0940  5   DA  D "C5'" 
3008 C "C4'" . DA  D 5   ? 0.7514 0.5367 0.5944 0.1936  0.1139  0.0920  5   DA  D "C4'" 
3009 O "O4'" . DA  D 5   ? 0.7433 0.5474 0.5964 0.1724  0.0895  0.0719  5   DA  D "O4'" 
3010 C "C3'" . DA  D 5   ? 0.7793 0.5623 0.6119 0.2012  0.1197  0.0932  5   DA  D "C3'" 
3011 O "O3'" . DA  D 5   ? 0.8003 0.5659 0.6583 0.2033  0.1473  0.1156  5   DA  D "O3'" 
3012 C "C2'" . DA  D 5   ? 0.7512 0.5538 0.6026 0.1713  0.0981  0.0764  5   DA  D "C2'" 
3013 C "C1'" . DA  D 5   ? 0.7137 0.5258 0.5837 0.1521  0.0860  0.0718  5   DA  D "C1'" 
3014 N N9    . DA  D 5   ? 0.6880 0.5170 0.5649 0.1366  0.0687  0.0560  5   DA  D N9    
3015 C C8    . DA  D 5   ? 0.7015 0.5397 0.5738 0.1435  0.0570  0.0361  5   DA  D C8    
3016 N N7    . DA  D 5   ? 0.6569 0.5077 0.5520 0.1248  0.0507  0.0293  5   DA  D N7    
3017 C C5    . DA  D 5   ? 0.6398 0.4905 0.5415 0.1091  0.0562  0.0462  5   DA  D C5    
3018 C C6    . DA  D 5   ? 0.6083 0.4690 0.5214 0.0942  0.0560  0.0516  5   DA  D C6    
3019 N N6    . DA  D 5   ? 0.6092 0.4784 0.5380 0.0885  0.0571  0.0460  5   DA  D N6    
3020 N N1    . DA  D 5   ? 0.6116 0.4746 0.5229 0.0894  0.0559  0.0621  5   DA  D N1    
3021 C C2    . DA  D 5   ? 0.6357 0.4906 0.5496 0.0934  0.0579  0.0659  5   DA  D C2    
3022 N N3    . DA  D 5   ? 0.6368 0.4779 0.5467 0.1048  0.0657  0.0676  5   DA  D N3    
3023 C C4    . DA  D 5   ? 0.6586 0.4983 0.5543 0.1147  0.0638  0.0583  5   DA  D C4    
3024 P P     . DT  D 6   ? 0.8713 0.6300 0.7379 0.2062  0.1595  0.1200  6   DT  D P     
3025 O OP1   . DT  D 6   ? 0.8665 0.5987 0.7579 0.2236  0.1996  0.1480  6   DT  D OP1   
3026 O OP2   . DT  D 6   ? 0.8137 0.5813 0.6335 0.2241  0.1446  0.1057  6   DT  D OP2   
3027 O "O5'" . DT  D 6   ? 0.7514 0.5277 0.6631 0.1669  0.1402  0.1043  6   DT  D "O5'" 
3028 C "C5'" . DT  D 6   ? 0.7201 0.4997 0.6818 0.1469  0.1407  0.1061  6   DT  D "C5'" 
3029 C "C4'" . DT  D 6   ? 0.6881 0.4889 0.6739 0.1219  0.1170  0.0860  6   DT  D "C4'" 
3030 O "O4'" . DT  D 6   ? 0.6563 0.4739 0.6049 0.1158  0.0945  0.0752  6   DT  D "O4'" 
3031 C "C3'" . DT  D 6   ? 0.7158 0.5144 0.7179 0.1205  0.1209  0.0776  6   DT  D "C3'" 
3032 O "O3'" . DT  D 6   ? 0.7441 0.5490 0.8106 0.1062  0.1187  0.0662  6   DT  D "O3'" 
3033 C "C2'" . DT  D 6   ? 0.6790 0.4953 0.6414 0.1151  0.0982  0.0624  6   DT  D "C2'" 
3034 C "C1'" . DT  D 6   ? 0.6313 0.4622 0.5795 0.1063  0.0816  0.0606  6   DT  D "C1'" 
3035 N N1    . DT  D 6   ? 0.6208 0.4618 0.5341 0.1067  0.0705  0.0547  6   DT  D N1    
3036 C C2    . DT  D 6   ? 0.6229 0.4816 0.5332 0.0955  0.0570  0.0471  6   DT  D C2    
3037 O O2    . DT  D 6   ? 0.6658 0.5347 0.5902 0.0894  0.0491  0.0425  6   DT  D O2    
3038 N N3    . DT  D 6   ? 0.5992 0.4647 0.4924 0.0958  0.0539  0.0434  6   DT  D N3    
3039 C C4    . DT  D 6   ? 0.5845 0.4456 0.4673 0.1060  0.0555  0.0389  6   DT  D C4    
3040 O O4    . DT  D 6   ? 0.5565 0.4276 0.4417 0.1037  0.0511  0.0302  6   DT  D O4    
3041 C C5    . DT  D 6   ? 0.6063 0.4517 0.4797 0.1228  0.0641  0.0441  6   DT  D C5    
3042 C C7    . DT  D 6   ? 0.6103 0.4545 0.4623 0.1444  0.0614  0.0350  6   DT  D C7    
3043 C C6    . DT  D 6   ? 0.6312 0.4651 0.5189 0.1223  0.0748  0.0556  6   DT  D C6    
3044 P P     . DT  D 7   ? 0.8056 0.6106 0.9110 0.1010  0.1196  0.0492  7   DT  D P     
3045 O OP1   . DT  D 7   ? 0.8077 0.6131 1.0017 0.0919  0.1261  0.0384  7   DT  D OP1   
3046 O OP2   . DT  D 7   ? 0.7630 0.5473 0.8379 0.1181  0.1414  0.0641  7   DT  D OP2   
3047 O "O5'" . DT  D 7   ? 0.7412 0.5751 0.8152 0.0908  0.0844  0.0246  7   DT  D "O5'" 
3048 C "C5'" . DT  D 7   ? 0.7114 0.5703 0.7984 0.0826  0.0587  0.0078  7   DT  D "C5'" 
3049 C "C4'" . DT  D 7   ? 0.7042 0.5849 0.7541 0.0828  0.0352  -0.0103 7   DT  D "C4'" 
3050 O "O4'" . DT  D 7   ? 0.6845 0.5632 0.6743 0.0858  0.0382  0.0059  7   DT  D "O4'" 
3051 C "C3'" . DT  D 7   ? 0.7077 0.5875 0.7750 0.0831  0.0349  -0.0296 7   DT  D "C3'" 
3052 O "O3'" . DT  D 7   ? 0.7255 0.6301 0.8224 0.0836  0.0091  -0.0626 7   DT  D "O3'" 
3053 C "C2'" . DT  D 7   ? 0.6887 0.5689 0.6946 0.0873  0.0360  -0.0216 7   DT  D "C2'" 
3054 C "C1'" . DT  D 7   ? 0.6873 0.5738 0.6520 0.0879  0.0326  -0.0047 7   DT  D "C1'" 
3055 N N1    . DT  D 7   ? 0.6738 0.5512 0.6037 0.0909  0.0434  0.0098  7   DT  D N1    
3056 C C2    . DT  D 7   ? 0.6787 0.5689 0.5777 0.0909  0.0383  0.0119  7   DT  D C2    
3057 O O2    . DT  D 7   ? 0.6652 0.5713 0.5530 0.0924  0.0290  0.0075  7   DT  D O2    
3058 N N3    . DT  D 7   ? 0.6767 0.5612 0.5612 0.0935  0.0459  0.0182  7   DT  D N3    
3059 C C4    . DT  D 7   ? 0.6717 0.5414 0.5555 0.1017  0.0543  0.0221  7   DT  D C4    
3060 O O4    . DT  D 7   ? 0.6974 0.5692 0.5687 0.1080  0.0542  0.0202  7   DT  D O4    
3061 C C5    . DT  D 7   ? 0.6756 0.5291 0.5791 0.1060  0.0641  0.0274  7   DT  D C5    
3062 C C7    . DT  D 7   ? 0.7008 0.5354 0.5945 0.1243  0.0799  0.0386  7   DT  D C7    
3063 C C6    . DT  D 7   ? 0.6679 0.5253 0.6006 0.0975  0.0599  0.0211  7   DT  D C6    
3064 P P     . DG  D 8   ? 0.7793 0.6869 0.9176 0.0838  0.0035  -0.0941 8   DG  D P     
3065 O OP1   . DG  D 8   ? 0.7697 0.7009 0.9719 0.0850  -0.0220 -0.1325 8   DG  D OP1   
3066 O OP2   . DG  D 8   ? 0.7431 0.6181 0.9061 0.0807  0.0367  -0.0757 8   DG  D OP2   
3067 O "O5'" . DG  D 8   ? 0.7681 0.6916 0.8335 0.0931  -0.0108 -0.1001 8   DG  D "O5'" 
3068 C "C5'" . DG  D 8   ? 0.7374 0.6835 0.7462 0.1035  -0.0283 -0.0968 8   DG  D "C5'" 
3069 C "C4'" . DG  D 8   ? 0.7304 0.6856 0.6823 0.1140  -0.0305 -0.0986 8   DG  D "C4'" 
3070 O "O4'" . DG  D 8   ? 0.7048 0.6442 0.6211 0.1081  -0.0084 -0.0665 8   DG  D "O4'" 
3071 C "C3'" . DG  D 8   ? 0.7346 0.6896 0.7077 0.1156  -0.0338 -0.1259 8   DG  D "C3'" 
3072 O "O3'" . DG  D 8   ? 0.7670 0.7466 0.6927 0.1355  -0.0512 -0.1432 8   DG  D "O3'" 
3073 C "C2'" . DG  D 8   ? 0.7222 0.6518 0.6864 0.1062  -0.0069 -0.1010 8   DG  D "C2'" 
3074 C "C1'" . DG  D 8   ? 0.7013 0.6312 0.6155 0.1064  0.0018  -0.0702 8   DG  D "C1'" 
3075 N N9    . DG  D 8   ? 0.6752 0.5841 0.5891 0.0994  0.0217  -0.0463 8   DG  D N9    
3076 C C8    . DG  D 8   ? 0.6733 0.5606 0.6198 0.0962  0.0355  -0.0391 8   DG  D C8    
3077 N N7    . DG  D 8   ? 0.6650 0.5405 0.5908 0.0993  0.0484  -0.0198 8   DG  D N7    
3078 C C5    . DG  D 8   ? 0.6487 0.5394 0.5402 0.0992  0.0423  -0.0171 8   DG  D C5    
3079 C C6    . DG  D 8   ? 0.6549 0.5459 0.5274 0.1016  0.0475  -0.0067 8   DG  D C6    
3080 O O6    . DG  D 8   ? 0.6693 0.5496 0.5395 0.1086  0.0538  -0.0002 8   DG  D O6    
3081 N N1    . DG  D 8   ? 0.6658 0.5729 0.5245 0.0992  0.0452  -0.0063 8   DG  D N1    
3082 C C2    . DG  D 8   ? 0.6687 0.5888 0.5162 0.1009  0.0402  -0.0104 8   DG  D C2    
3083 N N2    . DG  D 8   ? 0.6697 0.6006 0.5038 0.1036  0.0478  -0.0018 8   DG  D N2    
3084 N N3    . DG  D 8   ? 0.6678 0.5913 0.5208 0.1037  0.0295  -0.0237 8   DG  D N3    
3085 C C4    . DG  D 8   ? 0.6568 0.5656 0.5391 0.0997  0.0302  -0.0285 8   DG  D C4    
3086 P P     . DA  D 9   ? 0.8053 0.7915 0.7323 0.1446  -0.0587 -0.1745 9   DA  D P     
3087 O OP1   . DA  D 9   ? 0.8471 0.8659 0.7619 0.1703  -0.0919 -0.2138 9   DA  D OP1   
3088 O OP2   . DA  D 9   ? 0.7971 0.7591 0.7892 0.1271  -0.0447 -0.1811 9   DA  D OP2   
3089 O "O5'" . DA  D 9   ? 0.7854 0.7686 0.6458 0.1504  -0.0394 -0.1458 9   DA  D "O5'" 
3090 C "C5'" . DA  D 9   ? 0.8057 0.7970 0.6136 0.1604  -0.0321 -0.1171 9   DA  D "C5'" 
3091 C "C4'" . DA  D 9   ? 0.8205 0.8067 0.5938 0.1618  -0.0088 -0.0946 9   DA  D "C4'" 
3092 O "O4'" . DA  D 9   ? 0.8134 0.7790 0.6109 0.1398  0.0093  -0.0721 9   DA  D "O4'" 
3093 C "C3'" . DA  D 9   ? 0.8374 0.8268 0.6070 0.1689  -0.0097 -0.1166 9   DA  D "C3'" 
3094 O "O3'" . DA  D 9   ? 0.8698 0.8672 0.5930 0.1842  0.0077  -0.0985 9   DA  D "O3'" 
3095 C "C2'" . DA  D 9   ? 0.7875 0.7543 0.5994 0.1465  0.0020  -0.1122 9   DA  D "C2'" 
3096 C "C1'" . DA  D 9   ? 0.7755 0.7325 0.5847 0.1347  0.0174  -0.0790 9   DA  D "C1'" 
3097 N N9    . DA  D 9   ? 0.7518 0.6884 0.5949 0.1199  0.0241  -0.0711 9   DA  D N9    
3098 C C8    . DA  D 9   ? 0.7432 0.6661 0.6263 0.1141  0.0211  -0.0813 9   DA  D C8    
3099 N N7    . DA  D 9   ? 0.7066 0.6106 0.6029 0.1090  0.0347  -0.0641 9   DA  D N7    
3100 C C5    . DA  D 9   ? 0.6933 0.6027 0.5605 0.1099  0.0406  -0.0484 9   DA  D C5    
3101 C C6    . DA  D 9   ? 0.7003 0.6014 0.5639 0.1110  0.0491  -0.0337 9   DA  D C6    
3102 N N6    . DA  D 9   ? 0.7212 0.6039 0.5962 0.1159  0.0568  -0.0258 9   DA  D N6    
3103 N N1    . DA  D 9   ? 0.6807 0.5941 0.5318 0.1109  0.0507  -0.0290 9   DA  D N1    
3104 C C2    . DA  D 9   ? 0.6733 0.6018 0.5131 0.1105  0.0514  -0.0304 9   DA  D C2    
3105 N N3    . DA  D 9   ? 0.6973 0.6336 0.5244 0.1147  0.0462  -0.0385 9   DA  D N3    
3106 C C4    . DA  D 9   ? 0.7043 0.6322 0.5464 0.1139  0.0370  -0.0511 9   DA  D C4    
3107 P P     . DG  D 10  ? 0.9107 0.9170 0.6116 0.2012  0.0094  -0.1176 10  DG  D P     
3108 O OP1   . DG  D 10  ? 0.9430 0.9681 0.5822 0.2359  0.0144  -0.1097 10  DG  D OP1   
3109 O OP2   . DG  D 10  ? 0.8930 0.8969 0.6324 0.1960  -0.0119 -0.1571 10  DG  D OP2   
3110 O "O5'" . DG  D 10  ? 0.8568 0.8496 0.5747 0.1838  0.0356  -0.0955 10  DG  D "O5'" 
3111 C "C5'" . DG  D 10  ? 0.8439 0.8354 0.5558 0.1805  0.0598  -0.0615 10  DG  D "C5'" 
3112 C "C4'" . DG  D 10  ? 0.8124 0.7934 0.5620 0.1604  0.0712  -0.0546 10  DG  D "C4'" 
3113 O "O4'" . DG  D 10  ? 0.7868 0.7537 0.5660 0.1435  0.0582  -0.0601 10  DG  D "O4'" 
3114 C "C3'" . DG  D 10  ? 0.8331 0.8160 0.5865 0.1644  0.0747  -0.0697 10  DG  D "C3'" 
3115 O "O3'" . DG  D 10  ? 0.8185 0.8042 0.5931 0.1586  0.0947  -0.0540 10  DG  D "O3'" 
3116 C "C2'" . DG  D 10  ? 0.8131 0.7814 0.5944 0.1527  0.0595  -0.0866 10  DG  D "C2'" 
3117 C "C1'" . DG  D 10  ? 0.7928 0.7521 0.5917 0.1391  0.0592  -0.0699 10  DG  D "C1'" 
3118 N N9    . DG  D 10  ? 0.7968 0.7394 0.6187 0.1313  0.0500  -0.0758 10  DG  D N9    
3119 C C8    . DG  D 10  ? 0.7927 0.7288 0.6292 0.1316  0.0387  -0.0933 10  DG  D C8    
3120 N N7    . DG  D 10  ? 0.7749 0.6924 0.6402 0.1250  0.0415  -0.0887 10  DG  D N7    
3121 C C5    . DG  D 10  ? 0.7849 0.6981 0.6425 0.1243  0.0511  -0.0693 10  DG  D C5    
3122 C C6    . DG  D 10  ? 0.7938 0.6900 0.6617 0.1265  0.0584  -0.0559 10  DG  D C6    
3123 O O6    . DG  D 10  ? 0.8508 0.7279 0.7399 0.1280  0.0648  -0.0517 10  DG  D O6    
3124 N N1    . DG  D 10  ? 0.7500 0.6541 0.6050 0.1308  0.0597  -0.0476 10  DG  D N1    
3125 C C2    . DG  D 10  ? 0.7486 0.6724 0.5973 0.1285  0.0587  -0.0504 10  DG  D C2    
3126 N N2    . DG  D 10  ? 0.7442 0.6761 0.5990 0.1326  0.0578  -0.0489 10  DG  D N2    
3127 N N3    . DG  D 10  ? 0.7848 0.7203 0.6253 0.1258  0.0597  -0.0552 10  DG  D N3    
3128 C C4    . DG  D 10  ? 0.7826 0.7127 0.6208 0.1260  0.0540  -0.0649 10  DG  D C4    
3129 P P     . DA  D 11  ? 0.8646 0.8314 0.7010 0.0442  0.1399  0.2319  11  DA  D P     
3130 O OP1   . DA  D 11  ? 0.8868 0.8810 0.7289 0.0269  0.1437  0.2858  11  DA  D OP1   
3131 O OP2   . DA  D 11  ? 0.8215 0.8280 0.6208 0.0579  0.1500  0.1955  11  DA  D OP2   
3132 O "O5'" . DA  D 11  ? 0.7965 0.7192 0.6648 0.0380  0.1416  0.2038  11  DA  D "O5'" 
3133 C "C5'" . DA  D 11  ? 0.8017 0.6775 0.7191 0.0305  0.1266  0.2167  11  DA  D "C5'" 
3134 C "C4'" . DA  D 11  ? 0.7632 0.6140 0.7011 0.0302  0.1294  0.1790  11  DA  D "C4'" 
3135 O "O4'" . DA  D 11  ? 0.7520 0.5882 0.6787 0.0454  0.1260  0.1390  11  DA  D "O4'" 
3136 C "C3'" . DA  D 11  ? 0.7420 0.6225 0.6582 0.0251  0.1488  0.1655  11  DA  D "C3'" 
3137 O "O3'" . DA  D 11  ? 0.7421 0.6026 0.6920 0.0187  0.1474  0.1520  11  DA  D "O3'" 
3138 C "C2'" . DA  D 11  ? 0.7069 0.5934 0.5880 0.0394  0.1549  0.1284  11  DA  D "C2'" 
3139 C "C1'" . DA  D 11  ? 0.7038 0.5545 0.6023 0.0480  0.1415  0.1102  11  DA  D "C1'" 
3140 N N9    . DA  D 11  ? 0.6875 0.5441 0.5604 0.0594  0.1433  0.0879  11  DA  D N9    
3141 C C8    . DA  D 11  ? 0.6829 0.5654 0.5311 0.0655  0.1451  0.0931  11  DA  D C8    
3142 N N7    . DA  D 11  ? 0.6562 0.5376 0.4950 0.0738  0.1458  0.0659  11  DA  D N7    
3143 C C5    . DA  D 11  ? 0.6506 0.5068 0.5040 0.0721  0.1460  0.0458  11  DA  D C5    
3144 C C6    . DA  D 11  ? 0.6216 0.4716 0.4746 0.0755  0.1486  0.0182  11  DA  D C6    
3145 N N6    . DA  D 11  ? 0.6274 0.4896 0.4710 0.0798  0.1511  0.0045  11  DA  D N6    
3146 N N1    . DA  D 11  ? 0.6153 0.4526 0.4802 0.0737  0.1489  0.0045  11  DA  D N1    
3147 C C2    . DA  D 11  ? 0.6401 0.4670 0.5221 0.0704  0.1442  0.0132  11  DA  D C2    
3148 N N3    . DA  D 11  ? 0.6737 0.4995 0.5650 0.0651  0.1411  0.0384  11  DA  D N3    
3149 C C4    . DA  D 11  ? 0.6808 0.5232 0.5542 0.0654  0.1434  0.0564  11  DA  D C4    
3150 P P     . DT  D 12  ? 0.7629 0.6508 0.7030 0.0134  0.1625  0.1394  12  DT  D P     
3151 O OP1   . DT  D 12  ? 0.7614 0.6414 0.7509 -0.0017 0.1590  0.1535  12  DT  D OP1   
3152 O OP2   . DT  D 12  ? 0.7421 0.6772 0.6410 0.0154  0.1760  0.1448  12  DT  D OP2   
3153 O "O5'" . DT  D 12  ? 0.7368 0.6061 0.6619 0.0277  0.1617  0.0953  12  DT  D "O5'" 
3154 C "C5'" . DT  D 12  ? 0.7220 0.5600 0.6759 0.0324  0.1497  0.0753  12  DT  D "C5'" 
3155 C "C4'" . DT  D 12  ? 0.7154 0.5492 0.6396 0.0451  0.1525  0.0433  12  DT  D "C4'" 
3156 O "O4'" . DT  D 12  ? 0.7396 0.5757 0.6357 0.0507  0.1553  0.0439  12  DT  D "O4'" 
3157 C "C3'" . DT  D 12  ? 0.6900 0.5390 0.5904 0.0473  0.1618  0.0311  12  DT  D "C3'" 
3158 O "O3'" . DT  D 12  ? 0.6817 0.5207 0.5941 0.0532  0.1557  0.0085  12  DT  D "O3'" 
3159 C "C2'" . DT  D 12  ? 0.6978 0.5516 0.5605 0.0538  0.1679  0.0255  12  DT  D "C2'" 
3160 C "C1'" . DT  D 12  ? 0.7051 0.5457 0.5706 0.0564  0.1629  0.0257  12  DT  D "C1'" 
3161 N N1    . DT  D 12  ? 0.7189 0.5686 0.5621 0.0594  0.1669  0.0277  12  DT  D N1    
3162 C C2    . DT  D 12  ? 0.7200 0.5619 0.5521 0.0637  0.1680  0.0119  12  DT  D C2    
3163 O O2    . DT  D 12  ? 0.7361 0.5687 0.5703 0.0652  0.1672  -0.0009 12  DT  D O2    
3164 N N3    . DT  D 12  ? 0.6899 0.5423 0.5101 0.0660  0.1704  0.0108  12  DT  D N3    
3165 C C4    . DT  D 12  ? 0.6879 0.5627 0.5022 0.0676  0.1707  0.0211  12  DT  D C4    
3166 O O4    . DT  D 12  ? 0.6998 0.5870 0.5072 0.0723  0.1706  0.0131  12  DT  D O4    
3167 C C5    . DT  D 12  ? 0.6743 0.5629 0.4940 0.0628  0.1711  0.0406  12  DT  D C5    
3168 C C7    . DT  D 12  ? 0.6746 0.6022 0.4834 0.0638  0.1733  0.0551  12  DT  D C7    
3169 C C6    . DT  D 12  ? 0.6932 0.5663 0.5292 0.0575  0.1697  0.0439  12  DT  D C6    
3170 P P     . DC  D 13  ? 0.6732 0.5192 0.5637 0.0604  0.1583  -0.0086 13  DC  D P     
3171 O OP1   . DC  D 13  ? 0.7164 0.5608 0.6316 0.0655  0.1491  -0.0278 13  DC  D OP1   
3172 O OP2   . DC  D 13  ? 0.6833 0.5490 0.5650 0.0562  0.1658  0.0000  13  DC  D OP2   
3173 O "O5'" . DC  D 13  ? 0.6879 0.5247 0.5439 0.0683  0.1601  -0.0165 13  DC  D "O5'" 
3174 C "C5'" . DC  D 13  ? 0.6726 0.5058 0.5310 0.0741  0.1550  -0.0305 13  DC  D "C5'" 
3175 C "C4'" . DC  D 13  ? 0.6624 0.4947 0.4860 0.0771  0.1605  -0.0314 13  DC  D "C4'" 
3176 O "O4'" . DC  D 13  ? 0.6423 0.4702 0.4579 0.0715  0.1667  -0.0198 13  DC  D "O4'" 
3177 C "C3'" . DC  D 13  ? 0.6644 0.4940 0.4646 0.0815  0.1602  -0.0302 13  DC  D "C3'" 
3178 O "O3'" . DC  D 13  ? 0.6761 0.5110 0.4543 0.0866  0.1595  -0.0337 13  DC  D "O3'" 
3179 C "C2'" . DC  D 13  ? 0.6494 0.4715 0.4401 0.0771  0.1649  -0.0194 13  DC  D "C2'" 
3180 C "C1'" . DC  D 13  ? 0.6329 0.4556 0.4264 0.0717  0.1702  -0.0155 13  DC  D "C1'" 
3181 N N1    . DC  D 13  ? 0.6230 0.4490 0.4186 0.0687  0.1732  -0.0097 13  DC  D N1    
3182 C C2    . DC  D 13  ? 0.6085 0.4323 0.3987 0.0663  0.1766  -0.0099 13  DC  D C2    
3183 O O2    . DC  D 13  ? 0.6216 0.4411 0.4055 0.0639  0.1794  -0.0112 13  DC  D O2    
3184 N N3    . DC  D 13  ? 0.6036 0.4372 0.3975 0.0668  0.1771  -0.0103 13  DC  D N3    
3185 C C4    . DC  D 13  ? 0.6094 0.4603 0.4071 0.0690  0.1759  -0.0075 13  DC  D C4    
3186 N N4    . DC  D 13  ? 0.5986 0.4705 0.3968 0.0719  0.1759  -0.0105 13  DC  D N4    
3187 C C5    . DC  D 13  ? 0.6077 0.4625 0.4109 0.0681  0.1750  -0.0030 13  DC  D C5    
3188 C C6    . DC  D 13  ? 0.6264 0.4655 0.4308 0.0684  0.1728  -0.0059 13  DC  D C6    
3189 P P     . DT  D 14  ? 0.7376 0.5652 0.4897 0.0928  0.1547  -0.0264 14  DT  D P     
3190 O OP1   . DT  D 14  ? 0.7617 0.6092 0.5009 0.1025  0.1492  -0.0354 14  DT  D OP1   
3191 O OP2   . DT  D 14  ? 0.7029 0.5211 0.4660 0.0949  0.1496  -0.0277 14  DT  D OP2   
3192 O "O5'" . DT  D 14  ? 0.7447 0.5597 0.4791 0.0844  0.1614  -0.0084 14  DT  D "O5'" 
3193 C "C5'" . DT  D 14  ? 0.7376 0.5668 0.4658 0.0776  0.1706  -0.0059 14  DT  D "C5'" 
3194 C "C4'" . DT  D 14  ? 0.7496 0.5644 0.4708 0.0669  0.1764  0.0121  14  DT  D "C4'" 
3195 O "O4'" . DT  D 14  ? 0.7376 0.5398 0.4790 0.0634  0.1772  0.0077  14  DT  D "O4'" 
3196 C "C3'" . DT  D 14  ? 0.7878 0.5812 0.4953 0.0680  0.1684  0.0311  14  DT  D "C3'" 
3197 O "O3'" . DT  D 14  ? 0.8296 0.6281 0.5226 0.0567  0.1758  0.0531  14  DT  D "O3'" 
3198 C "C2'" . DT  D 14  ? 0.7624 0.5313 0.4919 0.0680  0.1621  0.0273  14  DT  D "C2'" 
3199 C "C1'" . DT  D 14  ? 0.7505 0.5303 0.4958 0.0615  0.1717  0.0167  14  DT  D "C1'" 
3200 N N1    . DT  D 14  ? 0.7183 0.4982 0.4820 0.0660  0.1678  0.0033  14  DT  D N1    
3201 C C2    . DT  D 14  ? 0.7196 0.5004 0.4988 0.0616  0.1701  -0.0014 14  DT  D C2    
3202 O O2    . DT  D 14  ? 0.7504 0.5265 0.5339 0.0525  0.1750  0.0047  14  DT  D O2    
3203 N N3    . DT  D 14  ? 0.6967 0.4909 0.4876 0.0680  0.1668  -0.0146 14  DT  D N3    
3204 C C4    . DT  D 14  ? 0.6867 0.4950 0.4767 0.0748  0.1643  -0.0199 14  DT  D C4    
3205 O O4    . DT  D 14  ? 0.6811 0.5123 0.4795 0.0784  0.1640  -0.0287 14  DT  D O4    
3206 C C5    . DT  D 14  ? 0.6867 0.4887 0.4666 0.0769  0.1624  -0.0152 14  DT  D C5    
3207 C C7    . DT  D 14  ? 0.6655 0.4841 0.4519 0.0817  0.1602  -0.0218 14  DT  D C7    
3208 C C6    . DT  D 14  ? 0.7064 0.4948 0.4728 0.0742  0.1632  -0.0056 14  DT  D C6    
3209 P P     . DC  D 15  ? 0.8986 0.6788 0.5730 0.0559  0.1667  0.0837  15  DC  D P     
3210 O OP1   . DC  D 15  ? 0.9034 0.7186 0.5494 0.0484  0.1776  0.1028  15  DC  D OP1   
3211 O OP2   . DC  D 15  ? 0.8956 0.6605 0.5682 0.0731  0.1493  0.0752  15  DC  D OP2   
3212 O "O5'" . DC  D 15  ? 0.8642 0.6079 0.5672 0.0441  0.1633  0.0960  15  DC  D "O5'" 
3213 C "C5'" . DC  D 15  ? 0.8615 0.6132 0.5817 0.0276  0.1772  0.0971  15  DC  D "C5'" 
3214 C "C4'" . DC  D 15  ? 0.8569 0.5746 0.6154 0.0235  0.1676  0.0942  15  DC  D "C4'" 
3215 O "O4'" . DC  D 15  ? 0.8106 0.5310 0.5838 0.0368  0.1624  0.0616  15  DC  D "O4'" 
3216 C "C3'" . DC  D 15  ? 0.9031 0.5810 0.6722 0.0262  0.1475  0.1146  15  DC  D "C3'" 
3217 O "O3'" . DC  D 15  ? 0.9737 0.6316 0.7665 0.0065  0.1481  0.1425  15  DC  D "O3'" 
3218 C "C2'" . DC  D 15  ? 0.8753 0.5388 0.6733 0.0419  0.1316  0.0823  15  DC  D "C2'" 
3219 C "C1'" . DC  D 15  ? 0.8068 0.5002 0.6102 0.0423  0.1455  0.0541  15  DC  D "C1'" 
3220 N N1    . DC  D 15  ? 0.7574 0.4645 0.5635 0.0587  0.1395  0.0258  15  DC  D N1    
3221 C C2    . DC  D 15  ? 0.7522 0.4730 0.5837 0.0624  0.1383  0.0007  15  DC  D C2    
3222 O O2    . DC  D 15  ? 0.7430 0.4597 0.5980 0.0538  0.1398  -0.0015 15  DC  D O2    
3223 N N3    . DC  D 15  ? 0.7394 0.4832 0.5708 0.0752  0.1353  -0.0209 15  DC  D N3    
3224 C C4    . DC  D 15  ? 0.7367 0.4854 0.5500 0.0824  0.1337  -0.0194 15  DC  D C4    
3225 N N4    . DC  D 15  ? 0.7173 0.4945 0.5348 0.0912  0.1331  -0.0381 15  DC  D N4    
3226 C C5    . DC  D 15  ? 0.7450 0.4767 0.5362 0.0808  0.1327  0.0010  15  DC  D C5    
3227 C C6    . DC  D 15  ? 0.7595 0.4730 0.5446 0.0697  0.1357  0.0238  15  DC  D C6    
3228 P P     . DA  D 16  ? 1.0670 0.6752 0.8824 0.0053  0.1237  0.1720  16  DA  D P     
3229 O OP1   . DA  D 16  ? 1.0954 0.7003 0.9072 -0.0199 0.1328  0.2217  16  DA  D OP1   
3230 O OP2   . DA  D 16  ? 1.0430 0.6424 0.8366 0.0285  0.1059  0.1650  16  DA  D OP2   
3231 O "O5'" . DA  D 16  ? 1.0442 0.6266 0.9230 0.0074  0.1088  0.1419  16  DA  D "O5'" 
3232 C "C5'" . DA  D 16  ? 0.9971 0.5942 0.9064 -0.0064 0.1222  0.1262  16  DA  D "C5'" 
3233 C "C4'" . DA  D 16  ? 0.9632 0.5496 0.9240 0.0077  0.1032  0.0836  16  DA  D "C4'" 
3234 O "O4'" . DA  D 16  ? 0.8963 0.5099 0.8309 0.0302  0.1031  0.0504  16  DA  D "O4'" 
3235 C "C3'" . DA  D 16  ? 1.0222 0.5599 1.0311 0.0136  0.0710  0.0883  16  DA  D "C3'" 
3236 O "O3'" . DA  D 16  ? 1.0511 0.5777 1.1296 0.0090  0.0591  0.0638  16  DA  D "O3'" 
3237 C "C2'" . DA  D 16  ? 0.9933 0.5389 0.9868 0.0417  0.0560  0.0586  16  DA  D "C2'" 
3238 C "C1'" . DA  D 16  ? 0.9199 0.5175 0.8869 0.0487  0.0770  0.0256  16  DA  D "C1'" 
3239 N N9    . DA  D 16  ? 0.8737 0.4958 0.8047 0.0667  0.0782  0.0096  16  DA  D N9    
3240 C C8    . DA  D 16  ? 0.8803 0.4974 0.7721 0.0718  0.0781  0.0294  16  DA  D C8    
3241 N N7    . DA  D 16  ? 0.8355 0.4807 0.7115 0.0870  0.0791  0.0049  16  DA  D N7    
3242 C C5    . DA  D 16  ? 0.8115 0.4846 0.7124 0.0918  0.0810  -0.0291 16  DA  D C5    
3243 C C6    . DA  D 16  ? 0.7843 0.5008 0.6825 0.1040  0.0848  -0.0600 16  DA  D C6    
3244 N N6    . DA  D 16  ? 0.7703 0.5049 0.6463 0.1119  0.0873  -0.0634 16  DA  D N6    
3245 N N1    . DA  D 16  ? 0.7787 0.5247 0.7007 0.1074  0.0856  -0.0872 16  DA  D N1    
3246 C C2    . DA  D 16  ? 0.7912 0.5206 0.7432 0.1000  0.0814  -0.0885 16  DA  D C2    
3247 N N3    . DA  D 16  ? 0.8173 0.5029 0.7816 0.0857  0.0783  -0.0614 16  DA  D N3    
3248 C C4    . DA  D 16  ? 0.8252 0.4853 0.7594 0.0816  0.0792  -0.0294 16  DA  D C4    
3249 P P     . DA  D 17  ? 1.1632 0.6382 1.3171 0.0155  0.0200  0.0574  17  DA  D P     
3250 O OP1   . DA  D 17  ? 1.2282 0.6792 1.4447 -0.0097 0.0181  0.0728  17  DA  D OP1   
3251 O OP2   . DA  D 17  ? 1.1692 0.6104 1.2992 0.0240  0.0027  0.0889  17  DA  D OP2   
3252 O "O5'" . DA  D 17  ? 1.1158 0.6238 1.3009 0.0441  0.0050  -0.0135 17  DA  D "O5'" 
3253 C "C5'" . DA  D 17  ? 1.0401 0.6015 1.2142 0.0463  0.0256  -0.0476 17  DA  D "C5'" 
3254 C "C4'" . DA  D 17  ? 0.9855 0.5878 1.1752 0.0757  0.0111  -0.1071 17  DA  D "C4'" 
3255 O "O4'" . DA  D 17  ? 0.9666 0.5956 1.0926 0.0882  0.0225  -0.1049 17  DA  D "O4'" 
3256 C "C3'" . DA  D 17  ? 1.0217 0.5995 1.2842 0.0932  -0.0287 -0.1392 17  DA  D "C3'" 
3257 O "O3'" . DA  D 17  ? 1.0170 0.6444 1.3225 0.1110  -0.0385 -0.2015 17  DA  D "O3'" 
3258 C "C2'" . DA  D 17  ? 1.0184 0.5966 1.2441 0.1106  -0.0366 -0.1370 17  DA  D "C2'" 
3259 C "C1'" . DA  D 17  ? 0.9505 0.5845 1.1021 0.1118  -0.0034 -0.1377 17  DA  D "C1'" 
3260 N N9    . DA  D 17  ? 0.9147 0.5483 1.0115 0.1166  0.0037  -0.1162 17  DA  D N9    
3261 C C8    . DA  D 17  ? 0.9369 0.5253 1.0093 0.1084  0.0009  -0.0714 17  DA  D C8    
3262 N N7    . DA  D 17  ? 0.9234 0.5285 0.9526 0.1185  0.0060  -0.0693 17  DA  D N7    
3263 C C5    . DA  D 17  ? 0.8654 0.5288 0.8916 0.1311  0.0143  -0.1111 17  DA  D C5    
3264 C C6    . DA  D 17  ? 0.8197 0.5267 0.8159 0.1424  0.0230  -0.1276 17  DA  D C6    
3265 N N6    . DA  D 17  ? 0.8318 0.5284 0.7967 0.1450  0.0237  -0.1095 17  DA  D N6    
3266 N N1    . DA  D 17  ? 0.7920 0.5592 0.7931 0.1504  0.0313  -0.1627 17  DA  D N1    
3267 C C2    . DA  D 17  ? 0.8034 0.5873 0.8360 0.1511  0.0283  -0.1851 17  DA  D C2    
3268 N N3    . DA  D 17  ? 0.8357 0.5815 0.9035 0.1429  0.0185  -0.1793 17  DA  D N3    
3269 C C4    . DA  D 17  ? 0.8687 0.5525 0.9323 0.1311  0.0128  -0.1391 17  DA  D C4    
3270 P P     . DT  D 18  ? 0.8177 0.7428 0.9315 -0.0392 0.0259  -0.1069 18  DT  D P     
3271 O OP1   . DT  D 18  ? 0.8000 0.7788 0.9500 -0.0383 0.0060  -0.1520 18  DT  D OP1   
3272 O OP2   . DT  D 18  ? 0.7737 0.6706 0.9248 -0.0532 0.0506  -0.0850 18  DT  D OP2   
3273 O "O5'" . DT  D 18  ? 0.8201 0.7266 0.8708 -0.0243 0.0206  -0.0955 18  DT  D "O5'" 
3274 C "C5'" . DT  D 18  ? 0.8351 0.7742 0.8545 -0.0001 0.0080  -0.0911 18  DT  D "C5'" 
3275 C "C4'" . DT  D 18  ? 0.8544 0.7686 0.8360 0.0102  0.0142  -0.0702 18  DT  D "C4'" 
3276 O "O4'" . DT  D 18  ? 0.8580 0.7265 0.8399 0.0000  0.0300  -0.0526 18  DT  D "O4'" 
3277 C "C3'" . DT  D 18  ? 0.8497 0.7582 0.8264 0.0025  0.0113  -0.0926 18  DT  D "C3'" 
3278 O "O3'" . DT  D 18  ? 0.8920 0.8593 0.8416 0.0282  -0.0005 -0.1017 18  DT  D "O3'" 
3279 C "C2'" . DT  D 18  ? 0.8329 0.6886 0.7939 -0.0055 0.0268  -0.0673 18  DT  D "C2'" 
3280 C "C1'" . DT  D 18  ? 0.8242 0.6700 0.7852 -0.0003 0.0349  -0.0449 18  DT  D "C1'" 
3281 N N1    . DT  D 18  ? 0.8002 0.6267 0.7665 -0.0124 0.0458  -0.0428 18  DT  D N1    
3282 C C2    . DT  D 18  ? 0.7884 0.6020 0.7598 -0.0091 0.0543  -0.0374 18  DT  D C2    
3283 O O2    . DT  D 18  ? 0.7776 0.5836 0.7547 0.0041  0.0595  -0.0196 18  DT  D O2    
3284 N N3    . DT  D 18  ? 0.7792 0.6065 0.7595 -0.0182 0.0592  -0.0529 18  DT  D N3    
3285 C C4    . DT  D 18  ? 0.7490 0.6121 0.7214 -0.0219 0.0594  -0.0573 18  DT  D C4    
3286 O O4    . DT  D 18  ? 0.7549 0.6623 0.7292 -0.0209 0.0623  -0.0724 18  DT  D O4    
3287 C C5    . DT  D 18  ? 0.7552 0.6172 0.7289 -0.0235 0.0585  -0.0438 18  DT  D C5    
3288 C C7    . DT  D 18  ? 0.7555 0.6610 0.7388 -0.0217 0.0697  -0.0275 18  DT  D C7    
3289 C C6    . DT  D 18  ? 0.7663 0.6059 0.7429 -0.0226 0.0502  -0.0454 18  DT  D C6    
3290 P P     . DC  D 19  ? 0.9171 0.9095 0.8703 0.0272  -0.0075 -0.1484 19  DC  D P     
3291 O OP1   . DC  D 19  ? 0.9073 1.0135 0.8581 0.0514  -0.0297 -0.1939 19  DC  D OP1   
3292 O OP2   . DC  D 19  ? 0.8700 0.7996 0.8788 -0.0050 0.0047  -0.1673 19  DC  D OP2   
3293 O "O5'" . DC  D 19  ? 0.8952 0.8679 0.8008 0.0439  0.0047  -0.1073 19  DC  D "O5'" 
3294 C "C5'" . DC  D 19  ? 0.8925 0.8828 0.7699 0.0719  0.0146  -0.0496 19  DC  D "C5'" 
3295 C "C4'" . DC  D 19  ? 0.8807 0.8216 0.7480 0.0701  0.0332  -0.0171 19  DC  D "C4'" 
3296 O "O4'" . DC  D 19  ? 0.8317 0.6989 0.7254 0.0423  0.0433  -0.0085 19  DC  D "O4'" 
3297 C "C3'" . DC  D 19  ? 0.8793 0.8190 0.7344 0.0642  0.0301  -0.0506 19  DC  D "C3'" 
3298 O "O3'" . DC  D 19  ? 0.9256 0.9168 0.7491 0.0966  0.0382  -0.0252 19  DC  D "O3'" 
3299 C "C2'" . DC  D 19  ? 0.8418 0.7008 0.7166 0.0349  0.0412  -0.0425 19  DC  D "C2'" 
3300 C "C1'" . DC  D 19  ? 0.8096 0.6436 0.6985 0.0310  0.0505  -0.0090 19  DC  D "C1'" 
3301 N N1    . DC  D 19  ? 0.7542 0.5530 0.6629 0.0069  0.0533  -0.0164 19  DC  D N1    
3302 C C2    . DC  D 19  ? 0.7392 0.5240 0.6652 0.0009  0.0639  -0.0065 19  DC  D C2    
3303 O O2    . DC  D 19  ? 0.7655 0.5476 0.7048 0.0111  0.0754  0.0133  19  DC  D O2    
3304 N N3    . DC  D 19  ? 0.7161 0.5076 0.6531 -0.0126 0.0635  -0.0201 19  DC  D N3    
3305 C C4    . DC  D 19  ? 0.6937 0.4960 0.6261 -0.0174 0.0596  -0.0239 19  DC  D C4    
3306 N N4    . DC  D 19  ? 0.6756 0.5125 0.6134 -0.0200 0.0630  -0.0257 19  DC  D N4    
3307 C C5    . DC  D 19  ? 0.7019 0.4970 0.6356 -0.0168 0.0545  -0.0280 19  DC  D C5    
3308 C C6    . DC  D 19  ? 0.7318 0.5297 0.6531 -0.0060 0.0481  -0.0337 19  DC  D C6    
3309 P P     . DT  D 20  ? 0.9589 0.9725 0.7679 0.1014  0.0366  -0.0642 20  DT  D P     
3310 O OP1   . DT  D 20  ? 0.9840 1.1135 0.7516 0.1494  0.0373  -0.0511 20  DT  D OP1   
3311 O OP2   . DT  D 20  ? 0.9065 0.8979 0.7572 0.0739  0.0246  -0.1347 20  DT  D OP2   
3312 O "O5'" . DT  D 20  ? 0.8993 0.8341 0.7160 0.0863  0.0571  -0.0225 20  DT  D "O5'" 
3313 C "C5'" . DT  D 20  ? 0.9030 0.8358 0.7228 0.1018  0.0777  0.0421  20  DT  D "C5'" 
3314 C "C4'" . DT  D 20  ? 0.8934 0.7592 0.7398 0.0775  0.0903  0.0541  20  DT  D "C4'" 
3315 O "O4'" . DT  D 20  ? 0.8731 0.6901 0.7426 0.0462  0.0816  0.0326  20  DT  D "O4'" 
3316 C "C3'" . DT  D 20  ? 0.9089 0.7734 0.7399 0.0770  0.0906  0.0328  20  DT  D "C3'" 
3317 O "O3'" . DT  D 20  ? 0.9199 0.7859 0.7628 0.0867  0.1115  0.0735  20  DT  D "O3'" 
3318 C "C2'" . DT  D 20  ? 0.8897 0.7019 0.7426 0.0468  0.0837  0.0086  20  DT  D "C2'" 
3319 C "C1'" . DT  D 20  ? 0.8694 0.6615 0.7440 0.0312  0.0829  0.0223  20  DT  D "C1'" 
3320 N N1    . DT  D 20  ? 0.8558 0.6315 0.7426 0.0125  0.0748  0.0049  20  DT  D N1    
3321 C C2    . DT  D 20  ? 0.8472 0.6249 0.7516 0.0009  0.0772  0.0095  20  DT  D C2    
3322 O O2    . DT  D 20  ? 0.8557 0.6413 0.7778 -0.0009 0.0834  0.0143  20  DT  D O2    
3323 N N3    . DT  D 20  ? 0.8126 0.5998 0.7233 -0.0060 0.0741  0.0057  20  DT  D N3    
3324 C C4    . DT  D 20  ? 0.8150 0.5925 0.7337 -0.0077 0.0729  0.0007  20  DT  D C4    
3325 O O4    . DT  D 20  ? 0.8150 0.6086 0.7501 -0.0104 0.0776  0.0113  20  DT  D O4    
3326 C C5    . DT  D 20  ? 0.8333 0.6011 0.7480 -0.0027 0.0676  -0.0195 20  DT  D C5    
3327 C C7    . DT  D 20  ? 0.8558 0.6229 0.8048 -0.0087 0.0655  -0.0442 20  DT  D C7    
3328 C C6    . DT  D 20  ? 0.8447 0.6216 0.7353 0.0101  0.0669  -0.0174 20  DT  D C6    
3329 P P     . DT  D 21  ? 0.9715 0.8477 0.8008 0.0949  0.1183  0.0652  21  DT  D P     
3330 O OP1   . DT  D 21  ? 0.9946 0.9154 0.8258 0.1241  0.1431  0.1172  21  DT  D OP1   
3331 O OP2   . DT  D 21  ? 0.9677 0.8619 0.7780 0.0984  0.1032  0.0077  21  DT  D OP2   
3332 O "O5'" . DT  D 21  ? 0.8672 0.6899 0.7318 0.0652  0.1195  0.0648  21  DT  D "O5'" 
3333 C "C5'" . DT  D 21  ? 0.8194 0.6284 0.7312 0.0507  0.1291  0.0866  21  DT  D "C5'" 
3334 C "C4'" . DT  D 21  ? 0.7934 0.5921 0.7247 0.0281  0.1192  0.0650  21  DT  D "C4'" 
3335 O "O4'" . DT  D 21  ? 0.7714 0.5617 0.6853 0.0194  0.1036  0.0447  21  DT  D "O4'" 
3336 C "C3'" . DT  D 21  ? 0.8040 0.6113 0.7269 0.0340  0.1220  0.0670  21  DT  D "C3'" 
3337 O "O3'" . DT  D 21  ? 0.8075 0.6382 0.7748 0.0244  0.1274  0.0699  21  DT  D "O3'" 
3338 C "C2'" . DT  D 21  ? 0.7806 0.5797 0.6911 0.0315  0.1122  0.0548  21  DT  D "C2'" 
3339 C "C1'" . DT  D 21  ? 0.7569 0.5576 0.6715 0.0179  0.1013  0.0439  21  DT  D "C1'" 
3340 N N1    . DT  D 21  ? 0.7333 0.5224 0.6428 0.0166  0.0966  0.0385  21  DT  D N1    
3341 C C2    . DT  D 21  ? 0.7302 0.5499 0.6504 0.0135  0.0944  0.0467  21  DT  D C2    
3342 O O2    . DT  D 21  ? 0.7310 0.6010 0.6581 0.0133  0.0909  0.0462  21  DT  D O2    
3343 N N3    . DT  D 21  ? 0.7203 0.5280 0.6519 0.0138  0.0981  0.0528  21  DT  D N3    
3344 C C4    . DT  D 21  ? 0.7388 0.5065 0.6841 0.0112  0.1002  0.0356  21  DT  D C4    
3345 O O4    . DT  D 21  ? 0.7240 0.4850 0.7033 0.0081  0.1074  0.0400  21  DT  D O4    
3346 C C5    . DT  D 21  ? 0.7332 0.4879 0.6588 0.0155  0.0955  0.0112  21  DT  D C5    
3347 C C7    . DT  D 21  ? 0.7264 0.4754 0.6673 0.0172  0.0922  -0.0286 21  DT  D C7    
3348 C C6    . DT  D 21  ? 0.7278 0.4945 0.6314 0.0206  0.0958  0.0219  21  DT  D C6    
3349 P P     . DT  D 22  ? 0.7905 0.6446 0.7624 0.0329  0.1327  0.0795  22  DT  D P     
3350 O OP1   . DT  D 22  ? 0.8148 0.6974 0.8479 0.0234  0.1428  0.0798  22  DT  D OP1   
3351 O OP2   . DT  D 22  ? 0.8358 0.6699 0.7712 0.0532  0.1410  0.0879  22  DT  D OP2   
3352 O "O5'" . DT  D 22  ? 0.8032 0.6921 0.7733 0.0309  0.1189  0.0720  22  DT  D "O5'" 
3353 C "C5'" . DT  D 22  ? 0.8070 0.7656 0.8135 0.0210  0.1086  0.0509  22  DT  D "C5'" 
3354 C "C4'" . DT  D 22  ? 0.7991 0.8129 0.7865 0.0307  0.0974  0.0544  22  DT  D "C4'" 
3355 O "O4'" . DT  D 22  ? 0.8225 0.7787 0.7805 0.0319  0.0999  0.0671  22  DT  D "O4'" 
3356 C "C3'" . DT  D 22  ? 0.8104 0.8759 0.7940 0.0572  0.1040  0.0940  22  DT  D "C3'" 
3357 O "O3'" . DT  D 22  ? 0.8121 0.9986 0.8190 0.0633  0.0914  0.0755  22  DT  D "O3'" 
3358 C "C2'" . DT  D 22  ? 0.8178 0.8782 0.7861 0.0729  0.1116  0.1294  22  DT  D "C2'" 
3359 C "C1'" . DT  D 22  ? 0.8283 0.8285 0.7817 0.0513  0.1042  0.0999  22  DT  D "C1'" 
3360 N N1    . DT  D 22  ? 0.8137 0.7384 0.7679 0.0531  0.1172  0.1176  22  DT  D N1    
3361 C C2    . DT  D 22  ? 0.8095 0.7568 0.7739 0.0616  0.1240  0.1430  22  DT  D C2    
3362 O O2    . DT  D 22  ? 0.7873 0.8264 0.7452 0.0745  0.1199  0.1577  22  DT  D O2    
3363 N N3    . DT  D 22  ? 0.8129 0.6889 0.8055 0.0577  0.1381  0.1473  22  DT  D N3    
3364 C C4    . DT  D 22  ? 0.8246 0.6291 0.8276 0.0485  0.1404  0.1155  22  DT  D C4    
3365 O O4    . DT  D 22  ? 0.8617 0.6246 0.9065 0.0437  0.1507  0.1030  22  DT  D O4    
3366 C C5    . DT  D 22  ? 0.8310 0.6319 0.8026 0.0470  0.1315  0.0944  22  DT  D C5    
3367 C C7    . DT  D 22  ? 0.8315 0.5924 0.8022 0.0474  0.1337  0.0595  22  DT  D C7    
3368 C C6    . DT  D 22  ? 0.8114 0.6628 0.7650 0.0478  0.1229  0.1023  22  DT  D C6    
3369 N N     . ASN E 16  ? 1.0032 1.4265 1.2907 0.2299  -0.0582 0.0584  2   ASN E N     
3370 C CA    . ASN E 16  ? 0.9870 1.2898 1.2126 0.2094  -0.0109 0.0443  2   ASN E CA    
3371 C C     . ASN E 16  ? 0.9738 1.2799 1.2161 0.1656  0.0277  -0.0003 2   ASN E C     
3372 O O     . ASN E 16  ? 0.9923 1.2357 1.2324 0.1653  0.0705  -0.0129 2   ASN E O     
3373 C CB    . ASN E 16  ? 1.0027 1.2351 1.2381 0.2554  0.0164  0.0658  2   ASN E CB    
3374 N N     . ASP E 17  ? 0.9482 1.3214 1.1981 0.1248  0.0159  -0.0253 3   ASP E N     
3375 C CA    . ASP E 17  ? 0.9257 1.2718 1.1521 0.0730  0.0555  -0.0665 3   ASP E CA    
3376 C C     . ASP E 17  ? 0.9251 1.2334 1.0617 0.0286  0.0483  -0.0760 3   ASP E C     
3377 O O     . ASP E 17  ? 0.9203 1.1795 1.0137 -0.0106 0.0835  -0.1041 3   ASP E O     
3378 C CB    . ASP E 17  ? 0.9103 1.3600 1.2348 0.0556  0.0721  -0.1012 3   ASP E CB    
3379 C CG    . ASP E 17  ? 0.9063 1.4843 1.2741 0.0362  0.0314  -0.1105 3   ASP E CG    
3380 O OD1   . ASP E 17  ? 0.8948 1.4991 1.2406 0.0566  -0.0181 -0.0788 3   ASP E OD1   
3381 O OD2   . ASP E 17  ? 0.8927 1.5463 1.3123 -0.0048 0.0513  -0.1529 3   ASP E OD2   
3382 N N     . GLU E 18  ? 0.9184 1.2380 1.0204 0.0362  0.0081  -0.0519 4   GLU E N     
3383 C CA    . GLU E 18  ? 0.9083 1.1938 0.9298 -0.0033 0.0035  -0.0604 4   GLU E CA    
3384 C C     . GLU E 18  ? 0.8945 1.0684 0.8359 0.0077  0.0143  -0.0447 4   GLU E C     
3385 O O     . GLU E 18  ? 0.8907 1.0385 0.8292 0.0434  0.0017  -0.0179 4   GLU E O     
3386 C CB    . GLU E 18  ? 0.9235 1.2859 0.9467 -0.0083 -0.0437 -0.0471 4   GLU E CB    
3387 C CG    . GLU E 18  ? 0.9256 1.2530 0.9142 0.0309  -0.0744 -0.0053 4   GLU E CG    
3388 C CD    . GLU E 18  ? 0.9523 1.3617 0.9428 0.0319  -0.1253 0.0128  4   GLU E CD    
3389 O OE1   . GLU E 18  ? 0.9415 1.4324 0.9440 -0.0099 -0.1383 -0.0119 4   GLU E OE1   
3390 O OE2   . GLU E 18  ? 0.9770 1.3654 0.9486 0.0717  -0.1508 0.0511  4   GLU E OE2   
3391 N N     . PRO E 19  ? 0.8949 1.0046 0.7712 -0.0227 0.0393  -0.0624 5   PRO E N     
3392 C CA    . PRO E 19  ? 0.9010 0.9177 0.7157 -0.0090 0.0533  -0.0532 5   PRO E CA    
3393 C C     . PRO E 19  ? 0.8990 0.8972 0.6828 0.0072  0.0300  -0.0313 5   PRO E C     
3394 O O     . PRO E 19  ? 0.9195 0.9208 0.6698 -0.0142 0.0211  -0.0340 5   PRO E O     
3395 C CB    . PRO E 19  ? 0.9513 0.9146 0.7064 -0.0426 0.0828  -0.0753 5   PRO E CB    
3396 C CG    . PRO E 19  ? 0.9665 0.9931 0.7371 -0.0831 0.0788  -0.0953 5   PRO E CG    
3397 C CD    . PRO E 19  ? 0.9262 1.0495 0.7844 -0.0719 0.0589  -0.0941 5   PRO E CD    
3398 N N     . ARG E 20  ? 0.8749 0.8473 0.6638 0.0377  0.0277  -0.0149 6   ARG E N     
3399 C CA    . ARG E 20  ? 0.8409 0.7823 0.5949 0.0475  0.0180  -0.0014 6   ARG E CA    
3400 C C     . ARG E 20  ? 0.8402 0.7287 0.5528 0.0450  0.0367  -0.0129 6   ARG E C     
3401 O O     . ARG E 20  ? 0.8482 0.7156 0.5451 0.0366  0.0535  -0.0258 6   ARG E O     
3402 C CB    . ARG E 20  ? 0.8274 0.7624 0.6036 0.0758  0.0147  0.0165  6   ARG E CB    
3403 C CG    . ARG E 20  ? 0.8456 0.8260 0.6608 0.0939  -0.0062 0.0367  6   ARG E CG    
3404 C CD    . ARG E 20  ? 0.8519 0.8037 0.6871 0.1258  0.0059  0.0524  6   ARG E CD    
3405 N NE    . ARG E 20  ? 0.8668 0.7566 0.6565 0.1207  0.0240  0.0479  6   ARG E NE    
3406 C CZ    . ARG E 20  ? 0.8975 0.7486 0.6897 0.1296  0.0499  0.0440  6   ARG E CZ    
3407 N NH1   . ARG E 20  ? 0.9083 0.7618 0.7436 0.1478  0.0660  0.0463  6   ARG E NH1   
3408 N NH2   . ARG E 20  ? 0.8990 0.7116 0.6518 0.1163  0.0637  0.0332  6   ARG E NH2   
3409 N N     . TRP E 21  ? 0.8392 0.7074 0.5317 0.0521  0.0345  -0.0085 7   TRP E N     
3410 C CA    . TRP E 21  ? 0.8241 0.6652 0.5007 0.0620  0.0465  -0.0175 7   TRP E CA    
3411 C C     . TRP E 21  ? 0.7935 0.6353 0.4865 0.0736  0.0480  -0.0139 7   TRP E C     
3412 O O     . TRP E 21  ? 0.7934 0.6399 0.4998 0.0765  0.0435  -0.0016 7   TRP E O     
3413 C CB    . TRP E 21  ? 0.8449 0.6749 0.4969 0.0553  0.0489  -0.0238 7   TRP E CB    
3414 C CG    . TRP E 21  ? 0.8673 0.6776 0.4932 0.0452  0.0600  -0.0328 7   TRP E CG    
3415 C CD1   . TRP E 21  ? 0.8969 0.6950 0.5104 0.0342  0.0685  -0.0364 7   TRP E CD1   
3416 C CD2   . TRP E 21  ? 0.8846 0.6778 0.4909 0.0408  0.0722  -0.0429 7   TRP E CD2   
3417 N NE1   . TRP E 21  ? 0.9249 0.6897 0.5050 0.0234  0.0872  -0.0467 7   TRP E NE1   
3418 C CE2   . TRP E 21  ? 0.9160 0.6785 0.4946 0.0298  0.0894  -0.0499 7   TRP E CE2   
3419 C CE3   . TRP E 21  ? 0.8854 0.6838 0.4958 0.0420  0.0767  -0.0506 7   TRP E CE3   
3420 C CZ2   . TRP E 21  ? 0.9518 0.6839 0.5075 0.0248  0.1116  -0.0617 7   TRP E CZ2   
3421 C CZ3   . TRP E 21  ? 0.9104 0.6898 0.5064 0.0369  0.0965  -0.0642 7   TRP E CZ3   
3422 C CH2   . TRP E 21  ? 0.9495 0.6935 0.5185 0.0308  0.1141  -0.0683 7   TRP E CH2   
3423 N N     . LEU E 22  ? 0.7618 0.5979 0.4492 0.0799  0.0550  -0.0246 8   LEU E N     
3424 C CA    . LEU E 22  ? 0.7648 0.6002 0.4592 0.0794  0.0629  -0.0294 8   LEU E CA    
3425 C C     . LEU E 22  ? 0.7544 0.5949 0.4400 0.0704  0.0663  -0.0401 8   LEU E C     
3426 O O     . LEU E 22  ? 0.7608 0.6185 0.4445 0.0728  0.0633  -0.0518 8   LEU E O     
3427 C CB    . LEU E 22  ? 0.7832 0.6208 0.4740 0.0825  0.0684  -0.0405 8   LEU E CB    
3428 C CG    . LEU E 22  ? 0.7849 0.6068 0.4857 0.0808  0.0824  -0.0385 8   LEU E CG    
3429 C CD1   . LEU E 22  ? 0.7614 0.5818 0.4807 0.0854  0.0816  -0.0270 8   LEU E CD1   
3430 C CD2   . LEU E 22  ? 0.8073 0.6274 0.4854 0.0772  0.0862  -0.0514 8   LEU E CD2   
3431 N N     . THR E 23  ? 0.7563 0.5779 0.4359 0.0613  0.0772  -0.0375 9   THR E N     
3432 C CA    . THR E 23  ? 0.7660 0.5864 0.4328 0.0441  0.0899  -0.0541 9   THR E CA    
3433 C C     . THR E 23  ? 0.7575 0.6151 0.4401 0.0382  0.0956  -0.0814 9   THR E C     
3434 O O     . THR E 23  ? 0.7864 0.6546 0.4758 0.0446  0.0922  -0.0833 9   THR E O     
3435 C CB    . THR E 23  ? 0.8072 0.5799 0.4483 0.0329  0.1093  -0.0465 9   THR E CB    
3436 O OG1   . THR E 23  ? 0.8212 0.5782 0.4662 0.0290  0.1298  -0.0549 9   THR E OG1   
3437 C CG2   . THR E 23  ? 0.8200 0.5657 0.4466 0.0478  0.0948  -0.0127 9   THR E CG2   
3438 N N     . ALA E 24  ? 0.7715 0.6551 0.4598 0.0236  0.1044  -0.1050 10  ALA E N     
3439 C CA    . ALA E 24  ? 0.7593 0.7009 0.4710 0.0169  0.1048  -0.1344 10  ALA E CA    
3440 C C     . ALA E 24  ? 0.8041 0.7305 0.5035 -0.0071 0.1255  -0.1475 10  ALA E C     
3441 O O     . ALA E 24  ? 0.8093 0.7804 0.5185 -0.0129 0.1199  -0.1660 10  ALA E O     
3442 C CB    . ALA E 24  ? 0.7618 0.7465 0.4952 0.0031  0.1148  -0.1631 10  ALA E CB    
3443 N N     . GLU E 25  ? 0.8566 0.7157 0.5274 -0.0216 0.1514  -0.1381 11  GLU E N     
3444 C CA    . GLU E 25  ? 0.8959 0.7203 0.5473 -0.0457 0.1834  -0.1518 11  GLU E CA    
3445 C C     . GLU E 25  ? 0.8848 0.7061 0.5421 -0.0284 0.1729  -0.1382 11  GLU E C     
3446 O O     . GLU E 25  ? 0.8982 0.7422 0.5535 -0.0478 0.1821  -0.1618 11  GLU E O     
3447 C CB    . GLU E 25  ? 0.9579 0.6886 0.5674 -0.0539 0.2177  -0.1361 11  GLU E CB    
3448 C CG    . GLU E 25  ? 0.9846 0.6728 0.5661 -0.0476 0.2158  -0.1143 11  GLU E CG    
3449 C CD    . GLU E 25  ? 0.9472 0.6792 0.5368 -0.0669 0.2131  -0.1389 11  GLU E CD    
3450 O OE1   . GLU E 25  ? 0.8659 0.6633 0.4938 -0.0497 0.1822  -0.1406 11  GLU E OE1   
3451 O OE2   . GLU E 25  ? 0.9963 0.6869 0.5497 -0.0978 0.2465  -0.1552 11  GLU E OE2   
3452 N N     . GLU E 26  ? 0.8818 0.6773 0.5441 0.0026  0.1564  -0.1038 12  GLU E N     
3453 C CA    . GLU E 26  ? 0.8794 0.6673 0.5502 0.0176  0.1522  -0.0922 12  GLU E CA    
3454 C C     . GLU E 26  ? 0.8457 0.6841 0.5180 0.0153  0.1334  -0.1080 12  GLU E C     
3455 O O     . GLU E 26  ? 0.8691 0.7006 0.5296 0.0040  0.1449  -0.1184 12  GLU E O     
3456 C CB    . GLU E 26  ? 0.8851 0.6611 0.5710 0.0466  0.1342  -0.0601 12  GLU E CB    
3457 C CG    . GLU E 26  ? 0.9375 0.6662 0.6209 0.0587  0.1470  -0.0367 12  GLU E CG    
3458 C CD    . GLU E 26  ? 0.9393 0.6840 0.6421 0.0829  0.1198  -0.0093 12  GLU E CD    
3459 O OE1   . GLU E 26  ? 0.9184 0.6948 0.6193 0.0801  0.0966  -0.0105 12  GLU E OE1   
3460 O OE2   . GLU E 26  ? 0.9636 0.6933 0.6861 0.1042  0.1233  0.0112  12  GLU E OE2   
3461 N N     . GLN E 27  ? 0.8007 0.6835 0.4815 0.0275  0.1064  -0.1087 13  GLN E N     
3462 C CA    . GLN E 27  ? 0.7849 0.7134 0.4605 0.0353  0.0841  -0.1177 13  GLN E CA    
3463 C C     . GLN E 27  ? 0.8164 0.7822 0.4836 0.0062  0.0920  -0.1488 13  GLN E C     
3464 O O     . GLN E 27  ? 0.8312 0.8075 0.4755 0.0038  0.0830  -0.1525 13  GLN E O     
3465 C CB    . GLN E 27  ? 0.7627 0.7313 0.4543 0.0567  0.0616  -0.1159 13  GLN E CB    
3466 C CG    . GLN E 27  ? 0.7565 0.6913 0.4406 0.0828  0.0516  -0.0895 13  GLN E CG    
3467 C CD    . GLN E 27  ? 0.7537 0.7128 0.4512 0.1018  0.0411  -0.0902 13  GLN E CD    
3468 O OE1   . GLN E 27  ? 0.7822 0.7803 0.4840 0.1230  0.0251  -0.0951 13  GLN E OE1   
3469 N NE2   . GLN E 27  ? 0.7494 0.6848 0.4514 0.0963  0.0505  -0.0844 13  GLN E NE2   
3470 N N     . LEU E 28  ? 0.8488 0.8313 0.5269 -0.0219 0.1120  -0.1738 14  LEU E N     
3471 C CA    . LEU E 28  ? 0.8725 0.8978 0.5431 -0.0627 0.1263  -0.2131 14  LEU E CA    
3472 C C     . LEU E 28  ? 0.9168 0.8831 0.5529 -0.0904 0.1601  -0.2200 14  LEU E C     
3473 O O     . LEU E 28  ? 0.9524 0.9530 0.5680 -0.1212 0.1630  -0.2475 14  LEU E O     
3474 C CB    . LEU E 28  ? 0.8871 0.9337 0.5736 -0.0954 0.1516  -0.2444 14  LEU E CB    
3475 C CG    . LEU E 28  ? 0.8782 1.0395 0.6049 -0.1000 0.1278  -0.2754 14  LEU E CG    
3476 C CD1   . LEU E 28  ? 0.8465 1.0310 0.6017 -0.0489 0.0929  -0.2479 14  LEU E CD1   
3477 C CD2   . LEU E 28  ? 0.9107 1.0901 0.6500 -0.1474 0.1659  -0.3175 14  LEU E CD2   
3478 N N     . VAL E 29  ? 0.9261 0.8067 0.5560 -0.0806 0.1877  -0.1970 15  VAL E N     
3479 C CA    . VAL E 29  ? 0.9733 0.7879 0.5790 -0.0969 0.2259  -0.1995 15  VAL E CA    
3480 C C     . VAL E 29  ? 0.9485 0.7763 0.5413 -0.0875 0.2059  -0.1931 15  VAL E C     
3481 O O     . VAL E 29  ? 0.9715 0.7979 0.5325 -0.1203 0.2230  -0.2172 15  VAL E O     
3482 C CB    . VAL E 29  ? 0.9970 0.7291 0.6111 -0.0708 0.2502  -0.1678 15  VAL E CB    
3483 C CG1   . VAL E 29  ? 1.0398 0.7101 0.6445 -0.0731 0.2870  -0.1657 15  VAL E CG1   
3484 C CG2   . VAL E 29  ? 1.0207 0.7121 0.6214 -0.0862 0.2806  -0.1741 15  VAL E CG2   
3485 N N     . TRP E 30  ? 0.9063 0.7402 0.5146 -0.0481 0.1739  -0.1628 16  TRP E N     
3486 C CA    . TRP E 30  ? 0.9109 0.7408 0.4963 -0.0382 0.1591  -0.1538 16  TRP E CA    
3487 C C     . TRP E 30  ? 0.9267 0.8110 0.4748 -0.0562 0.1354  -0.1742 16  TRP E C     
3488 O O     . TRP E 30  ? 0.9661 0.8307 0.4714 -0.0765 0.1454  -0.1837 16  TRP E O     
3489 C CB    . TRP E 30  ? 0.8684 0.6972 0.4705 0.0010  0.1319  -0.1235 16  TRP E CB    
3490 C CG    . TRP E 30  ? 0.8972 0.7033 0.4660 0.0085  0.1256  -0.1142 16  TRP E CG    
3491 C CD1   . TRP E 30  ? 0.8988 0.7179 0.4392 0.0295  0.0949  -0.1019 16  TRP E CD1   
3492 C CD2   . TRP E 30  ? 0.9237 0.6794 0.4781 -0.0054 0.1571  -0.1174 16  TRP E CD2   
3493 N NE1   . TRP E 30  ? 0.9329 0.7051 0.4312 0.0257  0.1060  -0.0968 16  TRP E NE1   
3494 C CE2   . TRP E 30  ? 0.9424 0.6804 0.4530 0.0020  0.1445  -0.1085 16  TRP E CE2   
3495 C CE3   . TRP E 30  ? 0.9424 0.6596 0.5161 -0.0216 0.2002  -0.1270 16  TRP E CE3   
3496 C CZ2   . TRP E 30  ? 0.9870 0.6741 0.4719 -0.0135 0.1744  -0.1133 16  TRP E CZ2   
3497 C CZ3   . TRP E 30  ? 0.9657 0.6404 0.5259 -0.0320 0.2290  -0.1318 16  TRP E CZ3   
3498 C CH2   . TRP E 30  ? 0.9901 0.6520 0.5060 -0.0315 0.2165  -0.1270 16  TRP E CH2   
3499 N N     . ARG E 31  ? 0.6808 0.6683 0.5720 0.0532  0.1330  -0.1590 17  ARG E N     
3500 C CA    . ARG E 31  ? 0.6603 0.6801 0.5764 0.0475  0.1500  -0.1432 17  ARG E CA    
3501 C C     . ARG E 31  ? 0.6315 0.6866 0.5771 0.0322  0.1519  -0.1372 17  ARG E C     
3502 O O     . ARG E 31  ? 0.6129 0.6939 0.5864 0.0196  0.1518  -0.1350 17  ARG E O     
3503 C CB    . ARG E 31  ? 0.6771 0.6886 0.5716 0.0647  0.1703  -0.1264 17  ARG E CB    
3504 C CG    . ARG E 31  ? 0.6825 0.6959 0.5792 0.0709  0.1811  -0.1184 17  ARG E CG    
3505 C CD    . ARG E 31  ? 0.7116 0.6972 0.5720 0.0946  0.1992  -0.1062 17  ARG E CD    
3506 N NE    . ARG E 31  ? 0.6959 0.7120 0.5775 0.0963  0.2185  -0.0849 17  ARG E NE    
3507 C CZ    . ARG E 31  ? 0.7124 0.7152 0.5754 0.1163  0.2411  -0.0679 17  ARG E CZ    
3508 N NH1   . ARG E 31  ? 0.7788 0.7324 0.5913 0.1385  0.2474  -0.0703 17  ARG E NH1   
3509 N NH2   . ARG E 31  ? 0.6797 0.7162 0.5754 0.1144  0.2574  -0.0481 17  ARG E NH2   
3510 N N     . SER E 32  ? 0.6363 0.6877 0.5711 0.0348  0.1545  -0.1339 18  SER E N     
3511 C CA    . SER E 32  ? 0.6219 0.7022 0.5814 0.0205  0.1570  -0.1272 18  SER E CA    
3512 C C     . SER E 32  ? 0.6178 0.7066 0.5940 0.0055  0.1424  -0.1400 18  SER E C     
3513 O O     . SER E 32  ? 0.6108 0.7230 0.6083 -0.0079 0.1427  -0.1359 18  SER E O     
3514 C CB    . SER E 32  ? 0.6360 0.7064 0.5801 0.0272  0.1661  -0.1198 18  SER E CB    
3515 O OG    . SER E 32  ? 0.6509 0.6910 0.5664 0.0347  0.1560  -0.1326 18  SER E OG    
3516 N N     . TYR E 33  ? 0.6423 0.7107 0.6096 0.0085  0.1293  -0.1549 19  TYR E N     
3517 C CA    . TYR E 33  ? 0.6317 0.7093 0.6215 -0.0037 0.1191  -0.1647 19  TYR E CA    
3518 C C     . TYR E 33  ? 0.6176 0.7124 0.6297 -0.0114 0.1244  -0.1609 19  TYR E C     
3519 O O     . TYR E 33  ? 0.6284 0.7400 0.6556 -0.0220 0.1267  -0.1579 19  TYR E O     
3520 C CB    . TYR E 33  ? 0.6597 0.7158 0.6461 0.0011  0.1029  -0.1803 19  TYR E CB    
3521 C CG    . TYR E 33  ? 0.6529 0.7216 0.6722 -0.0106 0.0969  -0.1873 19  TYR E CG    
3522 C CD1   . TYR E 33  ? 0.6486 0.7254 0.6763 -0.0170 0.0953  -0.1886 19  TYR E CD1   
3523 C CD2   . TYR E 33  ? 0.6695 0.7392 0.7109 -0.0141 0.0960  -0.1910 19  TYR E CD2   
3524 C CE1   . TYR E 33  ? 0.6603 0.7464 0.7173 -0.0250 0.0943  -0.1924 19  TYR E CE1   
3525 C CE2   . TYR E 33  ? 0.6722 0.7521 0.7465 -0.0233 0.0957  -0.1945 19  TYR E CE2   
3526 C CZ    . TYR E 33  ? 0.6621 0.7504 0.7438 -0.0279 0.0955  -0.1947 19  TYR E CZ    
3527 O OH    . TYR E 33  ? 0.6473 0.7435 0.7606 -0.0344 0.0993  -0.1959 19  TYR E OH    
3528 N N     . ILE E 34  ? 0.6265 0.7122 0.6352 -0.0046 0.1267  -0.1610 20  ILE E N     
3529 C CA    . ILE E 34  ? 0.6139 0.7109 0.6399 -0.0093 0.1333  -0.1571 20  ILE E CA    
3530 C C     . ILE E 34  ? 0.5846 0.7065 0.6172 -0.0146 0.1420  -0.1438 20  ILE E C     
3531 O O     . ILE E 34  ? 0.5650 0.6967 0.6101 -0.0220 0.1436  -0.1428 20  ILE E O     
3532 C CB    . ILE E 34  ? 0.6429 0.7239 0.6582 0.0010  0.1377  -0.1561 20  ILE E CB    
3533 C CG1   . ILE E 34  ? 0.6726 0.7242 0.6800 0.0055  0.1243  -0.1711 20  ILE E CG1   
3534 C CG2   . ILE E 34  ? 0.6269 0.7176 0.6585 -0.0029 0.1466  -0.1512 20  ILE E CG2   
3535 C CD1   . ILE E 34  ? 0.6751 0.7286 0.7136 -0.0057 0.1150  -0.1822 20  ILE E CD1   
3536 N N     . GLU E 35  ? 0.6009 0.7308 0.6255 -0.0096 0.1476  -0.1331 21  GLU E N     
3537 C CA    . GLU E 35  ? 0.6159 0.7715 0.6526 -0.0148 0.1520  -0.1200 21  GLU E CA    
3538 C C     . GLU E 35  ? 0.6391 0.8027 0.6826 -0.0283 0.1443  -0.1236 21  GLU E C     
3539 O O     . GLU E 35  ? 0.6586 0.8316 0.7081 -0.0346 0.1421  -0.1216 21  GLU E O     
3540 C CB    . GLU E 35  ? 0.6293 0.7939 0.6657 -0.0078 0.1603  -0.1065 21  GLU E CB    
3541 C CG    . GLU E 35  ? 0.6518 0.8026 0.6740 0.0093  0.1713  -0.1007 21  GLU E CG    
3542 C CD    . GLU E 35  ? 0.6712 0.8341 0.6992 0.0178  0.1848  -0.0830 21  GLU E CD    
3543 O OE1   . GLU E 35  ? 0.6537 0.8299 0.6949 0.0103  0.1850  -0.0774 21  GLU E OE1   
3544 O OE2   . GLU E 35  ? 0.7136 0.8712 0.7342 0.0325  0.1971  -0.0734 21  GLU E OE2   
3545 N N     . ALA E 36  ? 0.6312 0.7856 0.6679 -0.0307 0.1405  -0.1293 22  ALA E N     
3546 C CA    . ALA E 36  ? 0.6174 0.7741 0.6557 -0.0421 0.1345  -0.1327 22  ALA E CA    
3547 C C     . ALA E 36  ? 0.6101 0.7623 0.6511 -0.0466 0.1321  -0.1395 22  ALA E C     
3548 O O     . ALA E 36  ? 0.6361 0.7936 0.6764 -0.0535 0.1301  -0.1366 22  ALA E O     
3549 C CB    . ALA E 36  ? 0.6314 0.7732 0.6585 -0.0404 0.1322  -0.1392 22  ALA E CB    
3550 N N     . ALA E 37  ? 0.5998 0.7397 0.6439 -0.0418 0.1322  -0.1482 23  ALA E N     
3551 C CA    . ALA E 37  ? 0.5873 0.7216 0.6401 -0.0447 0.1344  -0.1530 23  ALA E CA    
3552 C C     . ALA E 37  ? 0.5752 0.7150 0.6281 -0.0442 0.1412  -0.1456 23  ALA E C     
3553 O O     . ALA E 37  ? 0.5705 0.7060 0.6187 -0.0472 0.1441  -0.1444 23  ALA E O     
3554 C CB    . ALA E 37  ? 0.6007 0.7241 0.6667 -0.0404 0.1324  -0.1622 23  ALA E CB    
3555 N N     . THR E 38  ? 0.5733 0.7190 0.6266 -0.0382 0.1443  -0.1398 24  THR E N     
3556 C CA    . THR E 38  ? 0.5624 0.7122 0.6133 -0.0351 0.1505  -0.1320 24  THR E CA    
3557 C C     . THR E 38  ? 0.5766 0.7379 0.6184 -0.0394 0.1445  -0.1246 24  THR E C     
3558 O O     . THR E 38  ? 0.5522 0.7091 0.5844 -0.0379 0.1462  -0.1214 24  THR E O     
3559 C CB    . THR E 38  ? 0.5425 0.6950 0.5946 -0.0259 0.1560  -0.1265 24  THR E CB    
3560 O OG1   . THR E 38  ? 0.5397 0.6763 0.5970 -0.0227 0.1574  -0.1353 24  THR E OG1   
3561 C CG2   . THR E 38  ? 0.5462 0.6994 0.5943 -0.0205 0.1636  -0.1188 24  THR E CG2   
3562 N N     . LEU E 39  ? 0.5737 0.7464 0.6177 -0.0445 0.1370  -0.1223 25  LEU E N     
3563 C CA    . LEU E 39  ? 0.5906 0.7744 0.6319 -0.0516 0.1271  -0.1164 25  LEU E CA    
3564 C C     . LEU E 39  ? 0.6047 0.7725 0.6307 -0.0595 0.1213  -0.1233 25  LEU E C     
3565 O O     . LEU E 39  ? 0.6318 0.7959 0.6444 -0.0622 0.1133  -0.1211 25  LEU E O     
3566 C CB    . LEU E 39  ? 0.5985 0.7997 0.6542 -0.0553 0.1235  -0.1097 25  LEU E CB    
3567 C CG    . LEU E 39  ? 0.6067 0.8258 0.6774 -0.0463 0.1300  -0.0982 25  LEU E CG    
3568 C CD1   . LEU E 39  ? 0.6260 0.8541 0.7095 -0.0476 0.1335  -0.0921 25  LEU E CD1   
3569 C CD2   . LEU E 39  ? 0.6033 0.8407 0.6825 -0.0452 0.1233  -0.0881 25  LEU E CD2   
3570 N N     . LEU E 40  ? 0.5975 0.7531 0.6222 -0.0616 0.1245  -0.1316 26  LEU E N     
3571 C CA    . LEU E 40  ? 0.6005 0.7370 0.6087 -0.0663 0.1230  -0.1376 26  LEU E CA    
3572 C C     . LEU E 40  ? 0.6208 0.7409 0.6161 -0.0600 0.1310  -0.1376 26  LEU E C     
3573 O O     . LEU E 40  ? 0.6439 0.7491 0.6150 -0.0611 0.1269  -0.1368 26  LEU E O     
3574 C CB    . LEU E 40  ? 0.5920 0.7199 0.6048 -0.0665 0.1264  -0.1453 26  LEU E CB    
3575 C CG    . LEU E 40  ? 0.6172 0.7413 0.6219 -0.0741 0.1198  -0.1471 26  LEU E CG    
3576 C CD1   . LEU E 40  ? 0.6120 0.7267 0.6199 -0.0704 0.1233  -0.1545 26  LEU E CD1   
3577 C CD2   . LEU E 40  ? 0.6434 0.7525 0.6258 -0.0809 0.1141  -0.1473 26  LEU E CD2   
3578 N N     . GLU E 41  ? 0.6068 0.7255 0.6160 -0.0528 0.1427  -0.1385 27  GLU E N     
3579 C CA    . GLU E 41  ? 0.6465 0.7480 0.6473 -0.0457 0.1555  -0.1365 27  GLU E CA    
3580 C C     . GLU E 41  ? 0.6832 0.7814 0.6597 -0.0418 0.1510  -0.1295 27  GLU E C     
3581 O O     . GLU E 41  ? 0.7082 0.7830 0.6577 -0.0367 0.1558  -0.1279 27  GLU E O     
3582 C CB    . GLU E 41  ? 0.6136 0.7170 0.6396 -0.0403 0.1676  -0.1372 27  GLU E CB    
3583 N N     . ASP E 42  ? 0.6809 0.8005 0.6651 -0.0426 0.1414  -0.1246 28  ASP E N     
3584 C CA    . ASP E 42  ? 0.7136 0.8345 0.6799 -0.0382 0.1330  -0.1176 28  ASP E CA    
3585 C C     . ASP E 42  ? 0.7571 0.8685 0.6997 -0.0452 0.1156  -0.1193 28  ASP E C     
3586 O O     . ASP E 42  ? 0.7667 0.8571 0.6771 -0.0392 0.1108  -0.1179 28  ASP E O     
3587 C CB    . ASP E 42  ? 0.7148 0.8644 0.7025 -0.0370 0.1277  -0.1106 28  ASP E CB    
3588 C CG    . ASP E 42  ? 0.7585 0.9143 0.7343 -0.0313 0.1169  -0.1024 28  ASP E CG    
3589 O OD1   . ASP E 42  ? 0.8193 0.9864 0.7962 -0.0390 0.0976  -0.1007 28  ASP E OD1   
3590 O OD2   . ASP E 42  ? 0.7917 0.9407 0.7585 -0.0191 0.1267  -0.0975 28  ASP E OD2   
3591 N N     . HIS E 43  ? 0.7503 0.8728 0.7059 -0.0571 0.1058  -0.1227 29  HIS E N     
3592 C CA    . HIS E 43  ? 0.7643 0.8778 0.7020 -0.0665 0.0874  -0.1249 29  HIS E CA    
3593 C C     . HIS E 43  ? 0.8023 0.8760 0.7005 -0.0629 0.0925  -0.1310 29  HIS E C     
3594 O O     . HIS E 43  ? 0.8713 0.9222 0.7344 -0.0622 0.0788  -0.1319 29  HIS E O     
3595 C CB    . HIS E 43  ? 0.7513 0.8821 0.7134 -0.0794 0.0813  -0.1264 29  HIS E CB    
3596 C CG    . HIS E 43  ? 0.8046 0.9245 0.7527 -0.0917 0.0625  -0.1293 29  HIS E CG    
3597 N ND1   . HIS E 43  ? 0.8574 0.9792 0.7983 -0.0955 0.0409  -0.1263 29  HIS E ND1   
3598 C CD2   . HIS E 43  ? 0.8503 0.9547 0.7896 -0.1011 0.0605  -0.1354 29  HIS E CD2   
3599 C CE1   . HIS E 43  ? 0.8999 1.0066 0.8289 -0.1083 0.0252  -0.1313 29  HIS E CE1   
3600 N NE2   . HIS E 43  ? 0.8785 0.9736 0.8050 -0.1117 0.0385  -0.1365 29  HIS E NE2   
3601 N N     . LEU E 44  ? 0.7446 0.8080 0.6477 -0.0592 0.1114  -0.1346 30  LEU E N     
3602 C CA    . LEU E 44  ? 0.7421 0.7690 0.6131 -0.0546 0.1207  -0.1384 30  LEU E CA    
3603 C C     . LEU E 44  ? 0.7681 0.7679 0.6100 -0.0394 0.1339  -0.1340 30  LEU E C     
3604 O O     . LEU E 44  ? 0.8355 0.7989 0.6317 -0.0337 0.1320  -0.1347 30  LEU E O     
3605 C CB    . LEU E 44  ? 0.7055 0.7347 0.5994 -0.0555 0.1355  -0.1424 30  LEU E CB    
3606 C CG    . LEU E 44  ? 0.6655 0.7120 0.5774 -0.0675 0.1245  -0.1465 30  LEU E CG    
3607 C CD1   . LEU E 44  ? 0.6444 0.6865 0.5699 -0.0655 0.1365  -0.1510 30  LEU E CD1   
3608 C CD2   . LEU E 44  ? 0.7044 0.7372 0.5894 -0.0770 0.1071  -0.1485 30  LEU E CD2   
3609 N N     . ASP E 45  ? 0.7462 0.7589 0.6107 -0.0319 0.1482  -0.1294 31  ASP E N     
3610 C CA    . ASP E 45  ? 0.7622 0.7504 0.6005 -0.0165 0.1622  -0.1232 31  ASP E CA    
3611 C C     . ASP E 45  ? 0.8128 0.7842 0.6064 -0.0120 0.1423  -0.1214 31  ASP E C     
3612 O O     . ASP E 45  ? 0.8947 0.8257 0.6413 0.0010  0.1494  -0.1194 31  ASP E O     
3613 C CB    . ASP E 45  ? 0.7494 0.7587 0.6194 -0.0116 0.1738  -0.1182 31  ASP E CB    
3614 C CG    . ASP E 45  ? 0.7316 0.7409 0.6358 -0.0098 0.1983  -0.1186 31  ASP E CG    
3615 O OD1   . ASP E 45  ? 0.7495 0.7440 0.6555 -0.0102 0.2089  -0.1211 31  ASP E OD1   
3616 O OD2   . ASP E 45  ? 0.6995 0.7233 0.6305 -0.0077 0.2062  -0.1160 31  ASP E OD2   
3617 N N     . ARG E 46  ? 0.8023 0.8030 0.6106 -0.0214 0.1173  -0.1215 32  ARG E N     
3618 C CA    . ARG E 46  ? 0.8517 0.8413 0.6256 -0.0181 0.0928  -0.1199 32  ARG E CA    
3619 C C     . ARG E 46  ? 0.9146 0.8696 0.6453 -0.0228 0.0759  -0.1269 32  ARG E C     
3620 O O     . ARG E 46  ? 0.9495 0.8656 0.6258 -0.0116 0.0664  -0.1272 32  ARG E O     
3621 C CB    . ARG E 46  ? 0.8378 0.8723 0.6499 -0.0280 0.0709  -0.1166 32  ARG E CB    
3622 C CG    . ARG E 46  ? 0.8220 0.8824 0.6615 -0.0189 0.0833  -0.1083 32  ARG E CG    
3623 C CD    . ARG E 46  ? 0.8262 0.9163 0.6817 -0.0197 0.0595  -0.1017 32  ARG E CD    
3624 N NE    . ARG E 46  ? 0.8727 0.9444 0.6938 -0.0016 0.0572  -0.0961 32  ARG E NE    
3625 C CZ    . ARG E 46  ? 0.8978 0.9846 0.7188 0.0021  0.0321  -0.0907 32  ARG E CZ    
3626 N NH1   . ARG E 46  ? 0.8872 1.0097 0.7464 -0.0127 0.0077  -0.0894 32  ARG E NH1   
3627 N NH2   . ARG E 46  ? 0.9468 1.0119 0.7304 0.0217  0.0318  -0.0857 32  ARG E NH2   
3628 N N     . GLN E 47  ? 0.9048 0.8698 0.6555 -0.0383 0.0715  -0.1327 33  GLN E N     
3629 C CA    . GLN E 47  ? 0.9485 0.8776 0.6589 -0.0439 0.0581  -0.1399 33  GLN E CA    
3630 C C     . GLN E 47  ? 1.0080 0.8816 0.6620 -0.0258 0.0794  -0.1400 33  GLN E C     
3631 O O     . GLN E 47  ? 1.0751 0.9024 0.6687 -0.0192 0.0659  -0.1434 33  GLN E O     
3632 C CB    . GLN E 47  ? 0.9277 0.8757 0.6718 -0.0605 0.0592  -0.1446 33  GLN E CB    
3633 C CG    . GLN E 47  ? 0.9857 0.8978 0.6923 -0.0685 0.0456  -0.1522 33  GLN E CG    
3634 C CD    . GLN E 47  ? 1.0045 0.8776 0.6796 -0.0579 0.0712  -0.1543 33  GLN E CD    
3635 O OE1   . GLN E 47  ? 1.0008 0.8922 0.7096 -0.0558 0.0944  -0.1523 33  GLN E OE1   
3636 N NE2   . GLN E 47  ? 1.0520 0.8695 0.6621 -0.0503 0.0662  -0.1580 33  GLN E NE2   
3637 N N     . LEU E 48  ? 0.9639 0.8398 0.6375 -0.0169 0.1124  -0.1359 34  LEU E N     
3638 C CA    . LEU E 48  ? 1.0120 0.8380 0.6419 0.0010  0.1388  -0.1330 34  LEU E CA    
3639 C C     . LEU E 48  ? 1.0493 0.8450 0.6377 0.0216  0.1475  -0.1261 34  LEU E C     
3640 O O     . LEU E 48  ? 1.0847 0.8256 0.6137 0.0385  0.1600  -0.1240 34  LEU E O     
3641 C CB    . LEU E 48  ? 0.9795 0.8210 0.6546 0.0021  0.1703  -0.1302 34  LEU E CB    
3642 C CG    . LEU E 48  ? 0.9594 0.8084 0.6509 -0.0109 0.1660  -0.1367 34  LEU E CG    
3643 C CD1   . LEU E 48  ? 0.8940 0.7761 0.6467 -0.0141 0.1851  -0.1355 34  LEU E CD1   
3644 C CD2   . LEU E 48  ? 1.0117 0.8045 0.6436 -0.0013 0.1736  -0.1379 34  LEU E CD2   
3645 N N     . GLN E 49  ? 0.6587 1.0059 0.9068 -0.1084 0.0659  -0.0840 35  GLN E N     
3646 C CA    . GLN E 49  ? 0.6689 1.0194 0.9066 -0.0893 0.0388  -0.0962 35  GLN E CA    
3647 C C     . GLN E 49  ? 0.6868 1.0554 0.9592 -0.1048 0.0080  -0.1075 35  GLN E C     
3648 O O     . GLN E 49  ? 0.7058 1.0439 0.9452 -0.0962 -0.0186 -0.1188 35  GLN E O     
3649 C CB    . GLN E 49  ? 0.6576 1.0460 0.9073 -0.0615 0.0457  -0.0945 35  GLN E CB    
3650 C CG    . GLN E 49  ? 0.6716 1.0313 0.8736 -0.0353 0.0276  -0.1034 35  GLN E CG    
3651 C CD    . GLN E 49  ? 0.6821 0.9829 0.8199 -0.0292 0.0385  -0.1000 35  GLN E CD    
3652 O OE1   . GLN E 49  ? 0.6707 0.9668 0.7921 -0.0195 0.0587  -0.0920 35  GLN E OE1   
3653 N NE2   . GLN E 49  ? 0.6867 0.9424 0.7880 -0.0337 0.0242  -0.1063 35  GLN E NE2   
3654 N N     . ARG E 50  ? 0.6889 1.1036 1.0257 -0.1285 0.0110  -0.1046 36  ARG E N     
3655 C CA    . ARG E 50  ? 0.7145 1.1467 1.0881 -0.1475 -0.0229 -0.1165 36  ARG E CA    
3656 C C     . ARG E 50  ? 0.7211 1.0924 1.0601 -0.1740 -0.0336 -0.1202 36  ARG E C     
3657 O O     . ARG E 50  ? 0.7337 1.0716 1.0439 -0.1733 -0.0664 -0.1332 36  ARG E O     
3658 C CB    . ARG E 50  ? 0.7279 1.2437 1.1956 -0.1628 -0.0216 -0.1140 36  ARG E CB    
3659 C CG    . ARG E 50  ? 0.7359 1.2818 1.2442 -0.1804 0.0195  -0.0975 36  ARG E CG    
3660 C CD    . ARG E 50  ? 0.7557 1.3898 1.3648 -0.1959 0.0148  -0.0975 36  ARG E CD    
3661 N NE    . ARG E 50  ? 0.7973 1.4324 1.4447 -0.2384 -0.0052 -0.1030 36  ARG E NE    
3662 C CZ    . ARG E 50  ? 0.8165 1.4370 1.4773 -0.2735 0.0194  -0.0926 36  ARG E CZ    
3663 N NH1   . ARG E 50  ? 0.7917 1.3948 1.4278 -0.2680 0.0642  -0.0763 36  ARG E NH1   
3664 N NH2   . ARG E 50  ? 0.8653 1.4824 1.5585 -0.3137 -0.0022 -0.0989 36  ARG E NH2   
3665 N N     . ASP E 51  ? 0.7095 1.0595 1.0429 -0.1940 -0.0060 -0.1088 37  ASP E N     
3666 C CA    . ASP E 51  ? 0.7476 1.0392 1.0501 -0.2202 -0.0134 -0.1110 37  ASP E CA    
3667 C C     . ASP E 51  ? 0.7556 0.9705 0.9734 -0.2032 -0.0152 -0.1135 37  ASP E C     
3668 O O     . ASP E 51  ? 0.8179 0.9775 0.9995 -0.2175 -0.0276 -0.1183 37  ASP E O     
3669 C CB    . ASP E 51  ? 0.7616 1.0531 1.0843 -0.2464 0.0185  -0.0971 37  ASP E CB    
3670 C CG    . ASP E 51  ? 0.7595 1.1262 1.1709 -0.2684 0.0259  -0.0927 37  ASP E CG    
3671 O OD1   . ASP E 51  ? 0.7514 1.1730 1.2142 -0.2658 0.0010  -0.1020 37  ASP E OD1   
3672 O OD2   . ASP E 51  ? 0.7693 1.1410 1.1990 -0.2863 0.0583  -0.0791 37  ASP E OD2   
3673 N N     . ALA E 52  ? 0.7238 0.9340 0.9101 -0.1732 -0.0027 -0.1100 38  ALA E N     
3674 C CA    . ALA E 52  ? 0.7268 0.8735 0.8423 -0.1570 0.0016  -0.1098 38  ALA E CA    
3675 C C     . ALA E 52  ? 0.6978 0.8405 0.7833 -0.1263 -0.0037 -0.1140 38  ALA E C     
3676 O O     . ALA E 52  ? 0.6834 0.7788 0.7165 -0.1135 0.0003  -0.1138 38  ALA E O     
3677 C CB    . ALA E 52  ? 0.7232 0.8518 0.8221 -0.1586 0.0333  -0.0960 38  ALA E CB    
3678 N N     . GLY E 53  ? 0.6975 0.8884 0.8154 -0.1140 -0.0111 -0.1171 39  GLY E N     
3679 C CA    . GLY E 53  ? 0.6976 0.8784 0.7831 -0.0863 -0.0192 -0.1223 39  GLY E CA    
3680 C C     . GLY E 53  ? 0.6946 0.8630 0.7515 -0.0699 0.0055  -0.1133 39  GLY E C     
3681 O O     . GLY E 53  ? 0.7898 0.9299 0.8061 -0.0519 0.0019  -0.1166 39  GLY E O     
3682 N N     . MET E 54  ? 0.6718 0.8582 0.7471 -0.0763 0.0298  -0.1022 40  MET E N     
3683 C CA    . MET E 54  ? 0.6505 0.8262 0.7003 -0.0618 0.0490  -0.0946 40  MET E CA    
3684 C C     . MET E 54  ? 0.6347 0.8412 0.7108 -0.0642 0.0704  -0.0842 40  MET E C     
3685 O O     . MET E 54  ? 0.6769 0.9047 0.7871 -0.0810 0.0769  -0.0803 40  MET E O     
3686 C CB    . MET E 54  ? 0.6508 0.7798 0.6617 -0.0639 0.0565  -0.0913 40  MET E CB    
3687 C CG    . MET E 54  ? 0.6609 0.7823 0.6790 -0.0796 0.0703  -0.0833 40  MET E CG    
3688 S SD    . MET E 54  ? 0.7101 0.7772 0.6819 -0.0761 0.0750  -0.0813 40  MET E SD    
3689 C CE    . MET E 54  ? 0.7856 0.8308 0.7601 -0.0976 0.0751  -0.0798 40  MET E CE    
3690 N N     . PRO E 55  ? 0.5869 0.7915 0.6439 -0.0481 0.0817  -0.0797 41  PRO E N     
3691 C CA    . PRO E 55  ? 0.5914 0.8190 0.6631 -0.0450 0.1013  -0.0704 41  PRO E CA    
3692 C C     . PRO E 55  ? 0.5967 0.8019 0.6557 -0.0554 0.1169  -0.0613 41  PRO E C     
3693 O O     . PRO E 55  ? 0.5958 0.7702 0.6347 -0.0617 0.1122  -0.0624 41  PRO E O     
3694 C CB    . PRO E 55  ? 0.5782 0.7980 0.6211 -0.0232 0.1018  -0.0713 41  PRO E CB    
3695 C CG    . PRO E 55  ? 0.5651 0.7483 0.5743 -0.0216 0.0905  -0.0765 41  PRO E CG    
3696 C CD    . PRO E 55  ? 0.5791 0.7596 0.5991 -0.0314 0.0756  -0.0836 41  PRO E CD    
3697 N N     . HIS E 56  ? 0.6036 0.8209 0.6699 -0.0542 0.1361  -0.0521 42  HIS E N     
3698 C CA    . HIS E 56  ? 0.6544 0.8470 0.7050 -0.0626 0.1507  -0.0431 42  HIS E CA    
3699 C C     . HIS E 56  ? 0.6381 0.7947 0.6481 -0.0534 0.1465  -0.0423 42  HIS E C     
3700 O O     . HIS E 56  ? 0.6289 0.7605 0.6257 -0.0604 0.1482  -0.0393 42  HIS E O     
3701 C CB    . HIS E 56  ? 0.7172 0.9229 0.7738 -0.0591 0.1739  -0.0328 42  HIS E CB    
3702 C CG    . HIS E 56  ? 0.7990 0.9748 0.8362 -0.0677 0.1897  -0.0230 42  HIS E CG    
3703 N ND1   . HIS E 56  ? 0.8347 0.9951 0.8449 -0.0561 0.2078  -0.0135 42  HIS E ND1   
3704 C CD2   . HIS E 56  ? 0.8404 0.9918 0.8735 -0.0843 0.1895  -0.0214 42  HIS E CD2   
3705 C CE1   . HIS E 56  ? 0.8556 0.9846 0.8469 -0.0649 0.2181  -0.0062 42  HIS E CE1   
3706 N NE2   . HIS E 56  ? 0.8673 0.9904 0.8724 -0.0822 0.2078  -0.0107 42  HIS E NE2   
3707 N N     . VAL E 57  ? 0.6251 0.7797 0.6171 -0.0381 0.1402  -0.0453 43  VAL E N     
3708 C CA    . VAL E 57  ? 0.6409 0.7696 0.6039 -0.0316 0.1355  -0.0443 43  VAL E CA    
3709 C C     . VAL E 57  ? 0.6439 0.7577 0.6050 -0.0378 0.1261  -0.0486 43  VAL E C     
3710 O O     . VAL E 57  ? 0.6329 0.7285 0.5821 -0.0379 0.1277  -0.0447 43  VAL E O     
3711 C CB    . VAL E 57  ? 0.6596 0.7859 0.6040 -0.0180 0.1288  -0.0476 43  VAL E CB    
3712 C CG1   . VAL E 57  ? 0.6575 0.7624 0.5798 -0.0146 0.1236  -0.0453 43  VAL E CG1   
3713 C CG2   . VAL E 57  ? 0.7024 0.8401 0.6434 -0.0075 0.1386  -0.0444 43  VAL E CG2   
3714 N N     . TYR E 58  ? 0.6253 0.7448 0.5949 -0.0400 0.1166  -0.0563 44  TYR E N     
3715 C CA    . TYR E 58  ? 0.6092 0.7085 0.5701 -0.0436 0.1095  -0.0606 44  TYR E CA    
3716 C C     . TYR E 58  ? 0.6395 0.7234 0.6013 -0.0544 0.1142  -0.0572 44  TYR E C     
3717 O O     . TYR E 58  ? 0.6212 0.6832 0.5673 -0.0518 0.1173  -0.0541 44  TYR E O     
3718 C CB    . TYR E 58  ? 0.5843 0.6873 0.5479 -0.0426 0.0973  -0.0697 44  TYR E CB    
3719 C CG    . TYR E 58  ? 0.5660 0.6684 0.5153 -0.0303 0.0923  -0.0737 44  TYR E CG    
3720 C CD1   . TYR E 58  ? 0.5421 0.6476 0.4834 -0.0234 0.0974  -0.0699 44  TYR E CD1   
3721 C CD2   . TYR E 58  ? 0.5655 0.6571 0.5027 -0.0254 0.0812  -0.0816 44  TYR E CD2   
3722 C CE1   . TYR E 58  ? 0.5344 0.6313 0.4572 -0.0142 0.0926  -0.0738 44  TYR E CE1   
3723 C CE2   . TYR E 58  ? 0.5659 0.6484 0.4828 -0.0141 0.0780  -0.0847 44  TYR E CE2   
3724 C CZ    . TYR E 58  ? 0.5437 0.6287 0.4542 -0.0097 0.0842  -0.0807 44  TYR E CZ    
3725 O OH    . TYR E 58  ? 0.5528 0.6213 0.4378 -0.0001 0.0805  -0.0842 44  TYR E OH    
3726 N N     . TYR E 59  ? 0.6609 0.7562 0.6418 -0.0663 0.1153  -0.0572 45  TYR E N     
3727 C CA    . TYR E 59  ? 0.7088 0.7832 0.6868 -0.0795 0.1204  -0.0537 45  TYR E CA    
3728 C C     . TYR E 59  ? 0.7254 0.7783 0.6817 -0.0731 0.1324  -0.0446 45  TYR E C     
3729 O O     . TYR E 59  ? 0.7330 0.7547 0.6694 -0.0737 0.1335  -0.0431 45  TYR E O     
3730 C CB    . TYR E 59  ? 0.7225 0.8197 0.7310 -0.0953 0.1251  -0.0520 45  TYR E CB    
3731 C CG    . TYR E 59  ? 0.7561 0.8275 0.7615 -0.1142 0.1292  -0.0492 45  TYR E CG    
3732 C CD1   . TYR E 59  ? 0.7673 0.8246 0.7754 -0.1282 0.1139  -0.0574 45  TYR E CD1   
3733 C CD2   . TYR E 59  ? 0.7850 0.8393 0.7784 -0.1178 0.1474  -0.0387 45  TYR E CD2   
3734 C CE1   . TYR E 59  ? 0.8013 0.8282 0.8020 -0.1477 0.1164  -0.0554 45  TYR E CE1   
3735 C CE2   . TYR E 59  ? 0.8065 0.8298 0.7914 -0.1360 0.1524  -0.0357 45  TYR E CE2   
3736 C CZ    . TYR E 59  ? 0.8249 0.8344 0.8141 -0.1520 0.1367  -0.0443 45  TYR E CZ    
3737 O OH    . TYR E 59  ? 0.8872 0.8582 0.8623 -0.1719 0.1403  -0.0419 45  TYR E OH    
3738 N N     . GLY E 60  ? 0.7013 0.7675 0.6571 -0.0643 0.1399  -0.0390 46  GLY E N     
3739 C CA    . GLY E 60  ? 0.6916 0.7387 0.6249 -0.0545 0.1467  -0.0313 46  GLY E CA    
3740 C C     . GLY E 60  ? 0.6959 0.7308 0.6168 -0.0436 0.1396  -0.0327 46  GLY E C     
3741 O O     . GLY E 60  ? 0.7509 0.7645 0.6552 -0.0373 0.1431  -0.0276 46  GLY E O     
3742 N N     . LEU E 61  ? 0.6639 0.7117 0.5925 -0.0402 0.1312  -0.0390 47  LEU E N     
3743 C CA    . LEU E 61  ? 0.6489 0.6900 0.5723 -0.0314 0.1284  -0.0394 47  LEU E CA    
3744 C C     . LEU E 61  ? 0.6865 0.7004 0.5970 -0.0324 0.1321  -0.0393 47  LEU E C     
3745 O O     . LEU E 61  ? 0.6887 0.6906 0.5903 -0.0222 0.1362  -0.0348 47  LEU E O     
3746 C CB    . LEU E 61  ? 0.6241 0.6773 0.5538 -0.0303 0.1223  -0.0455 47  LEU E CB    
3747 C CG    . LEU E 61  ? 0.6117 0.6828 0.5457 -0.0284 0.1176  -0.0468 47  LEU E CG    
3748 C CD1   . LEU E 61  ? 0.6029 0.6755 0.5353 -0.0278 0.1126  -0.0528 47  LEU E CD1   
3749 C CD2   . LEU E 61  ? 0.6103 0.6851 0.5422 -0.0219 0.1157  -0.0415 47  LEU E CD2   
3750 N N     . LEU E 62  ? 0.6968 0.7002 0.6052 -0.0433 0.1290  -0.0447 48  LEU E N     
3751 C CA    . LEU E 62  ? 0.7252 0.6932 0.6127 -0.0450 0.1300  -0.0460 48  LEU E CA    
3752 C C     . LEU E 62  ? 0.7421 0.6863 0.6140 -0.0448 0.1381  -0.0387 48  LEU E C     
3753 O O     . LEU E 62  ? 0.7468 0.6617 0.5957 -0.0346 0.1427  -0.0360 48  LEU E O     
3754 C CB    . LEU E 62  ? 0.7330 0.6933 0.6215 -0.0595 0.1201  -0.0542 48  LEU E CB    
3755 C CG    . LEU E 62  ? 0.7282 0.7042 0.6241 -0.0575 0.1097  -0.0623 48  LEU E CG    
3756 C CD1   . LEU E 62  ? 0.7499 0.7059 0.6369 -0.0679 0.0959  -0.0712 48  LEU E CD1   
3757 C CD2   . LEU E 62  ? 0.7177 0.6864 0.5996 -0.0423 0.1143  -0.0618 48  LEU E CD2   
3758 N N     . VAL E 63  ? 0.7291 0.6830 0.6101 -0.0538 0.1418  -0.0348 49  VAL E N     
3759 C CA    . VAL E 63  ? 0.7484 0.6741 0.6085 -0.0534 0.1512  -0.0269 49  VAL E CA    
3760 C C     . VAL E 63  ? 0.7423 0.6628 0.5881 -0.0309 0.1540  -0.0207 49  VAL E C     
3761 O O     . VAL E 63  ? 0.7838 0.6695 0.6022 -0.0219 0.1589  -0.0163 49  VAL E O     
3762 C CB    . VAL E 63  ? 0.7591 0.6979 0.6307 -0.0651 0.1586  -0.0224 49  VAL E CB    
3763 C CG1   . VAL E 63  ? 0.8082 0.7121 0.6500 -0.0613 0.1705  -0.0127 49  VAL E CG1   
3764 C CG2   . VAL E 63  ? 0.7813 0.7281 0.6741 -0.0887 0.1562  -0.0276 49  VAL E CG2   
3765 N N     . LYS E 64  ? 0.6914 0.6452 0.5552 -0.0211 0.1492  -0.0207 50  LYS E N     
3766 C CA    . LYS E 64  ? 0.6947 0.6508 0.5532 -0.0013 0.1479  -0.0155 50  LYS E CA    
3767 C C     . LYS E 64  ? 0.6919 0.6415 0.5490 0.0116  0.1493  -0.0159 50  LYS E C     
3768 O O     . LYS E 64  ? 0.7187 0.6579 0.5647 0.0295  0.1513  -0.0103 50  LYS E O     
3769 C CB    . LYS E 64  ? 0.6768 0.6670 0.5544 0.0033  0.1394  -0.0161 50  LYS E CB    
3770 C CG    . LYS E 64  ? 0.7160 0.7101 0.5904 0.0226  0.1334  -0.0110 50  LYS E CG    
3771 C CD    . LYS E 64  ? 0.7762 0.7348 0.6170 0.0327  0.1387  -0.0039 50  LYS E CD    
3772 C CE    . LYS E 64  ? 0.8144 0.7787 0.6533 0.0563  0.1291  0.0004  50  LYS E CE    
3773 N NZ    . LYS E 64  ? 0.8883 0.8092 0.6853 0.0699  0.1345  0.0075  50  LYS E NZ    
3774 N N     . LEU E 65  ? 0.6557 0.6099 0.5214 0.0054  0.1491  -0.0219 51  LEU E N     
3775 C CA    . LEU E 65  ? 0.6606 0.6031 0.5196 0.0185  0.1552  -0.0215 51  LEU E CA    
3776 C C     . LEU E 65  ? 0.7319 0.6239 0.5525 0.0226  0.1616  -0.0199 51  LEU E C     
3777 O O     . LEU E 65  ? 0.7642 0.6404 0.5702 0.0426  0.1688  -0.0145 51  LEU E O     
3778 C CB    . LEU E 65  ? 0.6379 0.5867 0.5042 0.0112  0.1545  -0.0283 51  LEU E CB    
3779 C CG    . LEU E 65  ? 0.5867 0.5752 0.4831 0.0068  0.1495  -0.0304 51  LEU E CG    
3780 C CD1   . LEU E 65  ? 0.5777 0.5593 0.4690 0.0024  0.1509  -0.0364 51  LEU E CD1   
3781 C CD2   . LEU E 65  ? 0.5766 0.5933 0.4967 0.0193  0.1513  -0.0244 51  LEU E CD2   
3782 N N     . ALA E 66  ? 0.7650 0.6317 0.5699 0.0037  0.1583  -0.0245 52  ALA E N     
3783 C CA    . ALA E 66  ? 0.8263 0.6378 0.5910 0.0014  0.1618  -0.0237 52  ALA E CA    
3784 C C     . ALA E 66  ? 0.8497 0.6401 0.5929 0.0169  0.1689  -0.0146 52  ALA E C     
3785 O O     . ALA E 66  ? 0.8769 0.6186 0.5804 0.0281  0.1748  -0.0121 52  ALA E O     
3786 C CB    . ALA E 66  ? 0.8446 0.6459 0.6105 -0.0270 0.1550  -0.0290 52  ALA E CB    
3787 N N     . GLU E 67  ? 0.8371 0.6578 0.5996 0.0189  0.1675  -0.0100 53  GLU E N     
3788 C CA    . GLU E 67  ? 0.8982 0.7002 0.6382 0.0369  0.1713  -0.0015 53  GLU E CA    
3789 C C     . GLU E 67  ? 0.9093 0.7313 0.6587 0.0673  0.1706  0.0025  53  GLU E C     
3790 O O     . GLU E 67  ? 0.9263 0.7266 0.6512 0.0883  0.1725  0.0091  53  GLU E O     
3791 C CB    . GLU E 67  ? 0.8992 0.7215 0.6502 0.0300  0.1686  0.0016  53  GLU E CB    
3792 C CG    . GLU E 67  ? 0.9342 0.7300 0.6699 0.0059  0.1755  0.0027  53  GLU E CG    
3793 C CD    . GLU E 67  ? 0.9472 0.7550 0.6835 0.0066  0.1776  0.0081  53  GLU E CD    
3794 O OE1   . GLU E 67  ? 0.9028 0.7509 0.6625 0.0169  0.1686  0.0068  53  GLU E OE1   
3795 O OE2   . GLU E 67  ? 0.9896 0.7614 0.6985 -0.0029 0.1889  0.0139  53  GLU E OE2   
3796 N N     . SER E 68  ? 0.8841 0.7487 0.6703 0.0697  0.1682  -0.0009 54  SER E N     
3797 C CA    . SER E 68  ? 0.8927 0.7913 0.7040 0.0943  0.1675  0.0033  54  SER E CA    
3798 C C     . SER E 68  ? 0.9408 0.8140 0.7321 0.1175  0.1799  0.0068  54  SER E C     
3799 O O     . SER E 68  ? 0.9733 0.8024 0.7310 0.1123  0.1880  0.0039  54  SER E O     
3800 C CB    . SER E 68  ? 0.8493 0.8012 0.7086 0.0849  0.1630  -0.0007 54  SER E CB    
3801 O OG    . SER E 68  ? 0.8213 0.7931 0.6940 0.0674  0.1517  -0.0039 54  SER E OG    
3802 N N     . PRO E 69  ? 0.9444 0.8448 0.7555 0.1450  0.1805  0.0130  55  PRO E N     
3803 C CA    . PRO E 69  ? 0.9763 0.8607 0.7746 0.1709  0.1960  0.0172  55  PRO E CA    
3804 C C     . PRO E 69  ? 0.9551 0.8518 0.7705 0.1615  0.2073  0.0135  55  PRO E C     
3805 O O     . PRO E 69  ? 0.9186 0.8627 0.7786 0.1456  0.2025  0.0106  55  PRO E O     
3806 C CB    . PRO E 69  ? 0.9674 0.9011 0.8047 0.1991  0.1915  0.0240  55  PRO E CB    
3807 C CG    . PRO E 69  ? 0.9580 0.9024 0.7982 0.1922  0.1714  0.0235  55  PRO E CG    
3808 C CD    . PRO E 69  ? 0.9146 0.8569 0.7559 0.1559  0.1662  0.0163  55  PRO E CD    
3809 N N     . ARG E 70  ? 1.0113 0.8568 0.7829 0.1718  0.2219  0.0134  56  ARG E N     
3810 C CA    . ARG E 70  ? 1.0143 0.8543 0.7846 0.1669  0.2345  0.0101  56  ARG E CA    
3811 C C     . ARG E 70  ? 0.9696 0.8179 0.7504 0.1327  0.2230  0.0010  56  ARG E C     
3812 O O     . ARG E 70  ? 0.9345 0.7929 0.7260 0.1274  0.2303  -0.0015 56  ARG E O     
3813 C CB    . ARG E 70  ? 1.0021 0.8954 0.8208 0.1873  0.2503  0.0173  56  ARG E CB    
3814 C CG    . ARG E 70  ? 1.0529 0.9374 0.8602 0.2265  0.2651  0.0265  56  ARG E CG    
3815 C CD    . ARG E 70  ? 1.0536 0.9999 0.9198 0.2443  0.2833  0.0343  56  ARG E CD    
3816 N NE    . ARG E 70  ? 1.0650 0.9945 0.9197 0.2385  0.3039  0.0332  56  ARG E NE    
3817 C CZ    . ARG E 70  ? 1.0598 1.0375 0.9636 0.2444  0.3243  0.0395  56  ARG E CZ    
3818 N NH1   . ARG E 70  ? 1.0171 1.0709 0.9946 0.2546  0.3250  0.0470  56  ARG E NH1   
3819 N NH2   . ARG E 70  ? 1.0888 1.0365 0.9671 0.2397  0.3439  0.0384  56  ARG E NH2   
3820 N N     . ARG E 71  ? 0.9476 0.7887 0.7223 0.1118  0.2066  -0.0032 57  ARG E N     
3821 C CA    . ARG E 71  ? 0.9024 0.7518 0.6866 0.0823  0.1949  -0.0116 57  ARG E CA    
3822 C C     . ARG E 71  ? 0.8340 0.7388 0.6662 0.0750  0.1933  -0.0128 57  ARG E C     
3823 O O     . ARG E 71  ? 0.7793 0.6836 0.6117 0.0589  0.1892  -0.0194 57  ARG E O     
3824 C CB    . ARG E 71  ? 0.9332 0.7284 0.6732 0.0733  0.1950  -0.0188 57  ARG E CB    
3825 C CG    . ARG E 71  ? 0.9701 0.7169 0.6725 0.0617  0.1872  -0.0211 57  ARG E CG    
3826 C CD    . ARG E 71  ? 1.0588 0.7383 0.7040 0.0734  0.1939  -0.0230 57  ARG E CD    
3827 N NE    . ARG E 71  ? 1.1070 0.7443 0.7206 0.0546  0.1825  -0.0332 57  ARG E NE    
3828 C CZ    . ARG E 71  ? 1.1703 0.7538 0.7456 0.0390  0.1725  -0.0378 57  ARG E CZ    
3829 N NH1   . ARG E 71  ? 1.2131 0.7728 0.7722 0.0375  0.1749  -0.0325 57  ARG E NH1   
3830 N NH2   . ARG E 71  ? 1.1890 0.7403 0.7412 0.0230  0.1584  -0.0484 57  ARG E NH2   
3831 N N     . ARG E 72  ? 0.8090 0.7588 0.6799 0.0866  0.1945  -0.0066 58  ARG E N     
3832 C CA    . ARG E 72  ? 0.7765 0.7755 0.6928 0.0790  0.1936  -0.0069 58  ARG E CA    
3833 C C     . ARG E 72  ? 0.7578 0.8005 0.7108 0.0779  0.1793  -0.0045 58  ARG E C     
3834 O O     . ARG E 72  ? 0.8232 0.8619 0.7688 0.0906  0.1734  -0.0007 58  ARG E O     
3835 C CB    . ARG E 72  ? 0.7796 0.7896 0.7107 0.0949  0.2141  -0.0014 58  ARG E CB    
3836 C CG    . ARG E 72  ? 0.7756 0.8132 0.7330 0.1201  0.2219  0.0077  58  ARG E CG    
3837 N N     . LEU E 73  ? 0.7212 0.7992 0.7074 0.0635  0.1726  -0.0071 59  LEU E N     
3838 C CA    . LEU E 73  ? 0.6984 0.8122 0.7139 0.0592  0.1548  -0.0069 59  LEU E CA    
3839 C C     . LEU E 73  ? 0.6609 0.8072 0.7118 0.0444  0.1535  -0.0090 59  LEU E C     
3840 O O     . LEU E 73  ? 0.6452 0.7757 0.6831 0.0318  0.1604  -0.0133 59  LEU E O     
3841 C CB    . LEU E 73  ? 0.7030 0.7957 0.6905 0.0483  0.1416  -0.0113 59  LEU E CB    
3842 C CG    . LEU E 73  ? 0.7338 0.8275 0.7144 0.0574  0.1278  -0.0085 59  LEU E CG    
3843 C CD1   . LEU E 73  ? 0.7648 0.8463 0.7342 0.0812  0.1326  -0.0019 59  LEU E CD1   
3844 C CD2   . LEU E 73  ? 0.7682 0.8328 0.7155 0.0460  0.1250  -0.0114 59  LEU E CD2   
3845 N N     . ARG E 74  ? 0.6453 0.8338 0.7388 0.0453  0.1431  -0.0065 60  ARG E N     
3846 C CA    . ARG E 74  ? 0.6178 0.8331 0.7439 0.0268  0.1403  -0.0087 60  ARG E CA    
3847 C C     . ARG E 74  ? 0.6084 0.8080 0.7121 0.0097  0.1238  -0.0162 60  ARG E C     
3848 O O     . ARG E 74  ? 0.6104 0.7969 0.6911 0.0134  0.1098  -0.0182 60  ARG E O     
3849 C CB    . ARG E 74  ? 0.6141 0.8813 0.7973 0.0297  0.1309  -0.0044 60  ARG E CB    
3850 C CG    . ARG E 74  ? 0.6359 0.9256 0.8512 0.0430  0.1556  0.0038  60  ARG E CG    
3851 C CD    . ARG E 74  ? 0.6412 0.9920 0.9229 0.0489  0.1458  0.0088  60  ARG E CD    
3852 N NE    . ARG E 74  ? 0.6323 1.0127 0.9526 0.0221  0.1308  0.0052  60  ARG E NE    
3853 C CZ    . ARG E 74  ? 0.6248 1.0553 1.0105 0.0117  0.1373  0.0099  60  ARG E CZ    
3854 N NH1   . ARG E 74  ? 0.6556 1.1207 1.0829 0.0288  0.1612  0.0195  60  ARG E NH1   
3855 N NH2   . ARG E 74  ? 0.6193 1.0646 1.0293 -0.0165 0.1203  0.0052  60  ARG E NH2   
3856 N N     . MET E 75  ? 0.6078 0.8055 0.7149 -0.0072 0.1275  -0.0195 61  MET E N     
3857 C CA    . MET E 75  ? 0.6107 0.7872 0.6895 -0.0201 0.1158  -0.0267 61  MET E CA    
3858 C C     . MET E 75  ? 0.6036 0.7853 0.6780 -0.0204 0.0920  -0.0293 61  MET E C     
3859 O O     . MET E 75  ? 0.5780 0.7370 0.6187 -0.0172 0.0872  -0.0320 61  MET E O     
3860 C CB    . MET E 75  ? 0.6264 0.8019 0.7127 -0.0369 0.1206  -0.0290 61  MET E CB    
3861 C CG    . MET E 75  ? 0.6482 0.8083 0.7274 -0.0359 0.1456  -0.0265 61  MET E CG    
3862 S SD    . MET E 75  ? 0.7055 0.8258 0.7366 -0.0234 0.1541  -0.0295 61  MET E SD    
3863 C CE    . MET E 75  ? 0.6984 0.7937 0.6953 -0.0338 0.1418  -0.0385 61  MET E CE    
3864 N N     . THR E 76  ? 0.6103 0.8210 0.7184 -0.0238 0.0771  -0.0282 62  THR E N     
3865 C CA    . THR E 76  ? 0.6373 0.8451 0.7328 -0.0232 0.0512  -0.0316 62  THR E CA    
3866 C C     . THR E 76  ? 0.6588 0.8530 0.7286 -0.0039 0.0481  -0.0290 62  THR E C     
3867 O O     . THR E 76  ? 0.6667 0.8357 0.6992 -0.0011 0.0389  -0.0316 62  THR E O     
3868 C CB    . THR E 76  ? 0.6639 0.9060 0.8024 -0.0305 0.0303  -0.0319 62  THR E CB    
3869 O OG1   . THR E 76  ? 0.6700 0.9200 0.8309 -0.0524 0.0353  -0.0337 62  THR E OG1   
3870 C CG2   . THR E 76  ? 0.6869 0.9140 0.7991 -0.0286 0.0004  -0.0369 62  THR E CG2   
3871 N N     . GLU E 77  ? 0.6623 0.8675 0.7464 0.0106  0.0587  -0.0231 63  GLU E N     
3872 C CA    . GLU E 77  ? 0.6769 0.8600 0.7295 0.0284  0.0588  -0.0199 63  GLU E CA    
3873 C C     . GLU E 77  ? 0.6624 0.8088 0.6731 0.0238  0.0714  -0.0216 63  GLU E C     
3874 O O     . GLU E 77  ? 0.7078 0.8306 0.6855 0.0296  0.0676  -0.0209 63  GLU E O     
3875 C CB    . GLU E 77  ? 0.6994 0.8920 0.7672 0.0452  0.0718  -0.0135 63  GLU E CB    
3876 C CG    . GLU E 77  ? 0.7301 0.9548 0.8295 0.0613  0.0560  -0.0099 63  GLU E CG    
3877 C CD    . GLU E 77  ? 0.7730 0.9896 0.8650 0.0846  0.0705  -0.0032 63  GLU E CD    
3878 O OE1   . GLU E 77  ? 0.7393 0.9730 0.8577 0.0878  0.0889  0.0002  63  GLU E OE1   
3879 O OE2   . GLU E 77  ? 0.8317 1.0172 0.8840 0.1001  0.0658  -0.0011 63  GLU E OE2   
3880 N N     . LEU E 78  ? 0.6387 0.7803 0.6513 0.0139  0.0872  -0.0235 64  LEU E N     
3881 C CA    . LEU E 78  ? 0.6383 0.7529 0.6208 0.0082  0.0968  -0.0260 64  LEU E CA    
3882 C C     . LEU E 78  ? 0.6359 0.7441 0.6012 0.0018  0.0864  -0.0300 64  LEU E C     
3883 O O     . LEU E 78  ? 0.6334 0.7241 0.5741 0.0045  0.0888  -0.0289 64  LEU E O     
3884 C CB    . LEU E 78  ? 0.6251 0.7353 0.6115 0.0006  0.1103  -0.0287 64  LEU E CB    
3885 C CG    . LEU E 78  ? 0.6470 0.7341 0.6096 -0.0050 0.1173  -0.0320 64  LEU E CG    
3886 C CD1   . LEU E 78  ? 0.6825 0.7514 0.6267 -0.0001 0.1206  -0.0285 64  LEU E CD1   
3887 C CD2   . LEU E 78  ? 0.6479 0.7242 0.6086 -0.0068 0.1281  -0.0342 64  LEU E CD2   
3888 N N     . ALA E 79  ? 0.6237 0.7432 0.6001 -0.0064 0.0766  -0.0340 65  ALA E N     
3889 C CA    . ALA E 79  ? 0.6301 0.7376 0.5838 -0.0094 0.0660  -0.0379 65  ALA E CA    
3890 C C     . ALA E 79  ? 0.6763 0.7719 0.6074 0.0021  0.0550  -0.0352 65  ALA E C     
3891 O O     . ALA E 79  ? 0.7087 0.7844 0.6089 0.0056  0.0578  -0.0355 65  ALA E O     
3892 C CB    . ALA E 79  ? 0.6196 0.7348 0.5855 -0.0203 0.0545  -0.0423 65  ALA E CB    
3893 N N     . LYS E 80  ? 0.6938 0.8006 0.6385 0.0103  0.0438  -0.0322 66  LYS E N     
3894 C CA    . LYS E 80  ? 0.7345 0.8242 0.6509 0.0243  0.0297  -0.0300 66  LYS E CA    
3895 C C     . LYS E 80  ? 0.7592 0.8223 0.6432 0.0337  0.0466  -0.0245 66  LYS E C     
3896 O O     . LYS E 80  ? 0.7866 0.8226 0.6315 0.0416  0.0446  -0.0230 66  LYS E O     
3897 C CB    . LYS E 80  ? 0.7368 0.8480 0.6785 0.0341  0.0115  -0.0281 66  LYS E CB    
3898 C CG    . LYS E 80  ? 0.7713 0.8591 0.6766 0.0520  -0.0069 -0.0265 66  LYS E CG    
3899 C CD    . LYS E 80  ? 0.7804 0.8941 0.7138 0.0613  -0.0346 -0.0273 66  LYS E CD    
3900 N N     . TYR E 81  ? 0.6780 0.9172 0.7594 0.0905  0.0477  0.0475  67  TYR E N     
3901 C CA    . TYR E 81  ? 0.7237 0.8990 0.7791 0.1030  0.0743  0.0527  67  TYR E CA    
3902 C C     . TYR E 81  ? 0.6827 0.8256 0.7222 0.0761  0.0749  0.0357  67  TYR E C     
3903 O O     . TYR E 81  ? 0.7057 0.8218 0.7200 0.0812  0.0832  0.0426  67  TYR E O     
3904 C CB    . TYR E 81  ? 0.7570 0.8925 0.8155 0.1128  0.1034  0.0540  67  TYR E CB    
3905 C CG    . TYR E 81  ? 0.8243 0.9701 0.8814 0.1559  0.1168  0.0789  67  TYR E CG    
3906 C CD1   . TYR E 81  ? 0.8821 1.0088 0.9094 0.1900  0.1276  0.1025  67  TYR E CD1   
3907 C CD2   . TYR E 81  ? 0.8161 0.9898 0.8973 0.1686  0.1226  0.0819  67  TYR E CD2   
3908 C CE1   . TYR E 81  ? 0.9262 1.0629 0.9464 0.2390  0.1432  0.1294  67  TYR E CE1   
3909 C CE2   . TYR E 81  ? 0.8637 1.0520 0.9409 0.2171  0.1388  0.1088  67  TYR E CE2   
3910 C CZ    . TYR E 81  ? 0.9080 1.0783 0.9540 0.2540  0.1490  0.1329  67  TYR E CZ    
3911 O OH    . TYR E 81  ? 0.9676 1.1546 1.0052 0.3109  0.1678  0.1634  67  TYR E OH    
3912 N N     . ALA E 82  ? 0.6426 0.7931 0.6965 0.0511  0.0682  0.0164  68  ALA E N     
3913 C CA    . ALA E 82  ? 0.6310 0.7644 0.6729 0.0315  0.0699  0.0026  68  ALA E CA    
3914 C C     . ALA E 82  ? 0.6210 0.7613 0.6359 0.0321  0.0529  0.0021  68  ALA E C     
3915 O O     . ALA E 82  ? 0.6252 0.7521 0.6227 0.0285  0.0596  -0.0010 68  ALA E O     
3916 C CB    . ALA E 82  ? 0.5908 0.7319 0.6505 0.0125  0.0682  -0.0148 68  ALA E CB    
3917 N N     . LYS E 83  ? 0.6107 0.7742 0.6190 0.0361  0.0317  0.0056  69  LYS E N     
3918 C CA    . LYS E 83  ? 0.6207 0.7798 0.5897 0.0339  0.0134  0.0025  69  LYS E CA    
3919 C C     . LYS E 83  ? 0.6107 0.7518 0.5606 0.0157  0.0078  -0.0156 69  LYS E C     
3920 O O     . LYS E 83  ? 0.6630 0.7764 0.5689 0.0198  0.0066  -0.0193 69  LYS E O     
3921 C CB    . LYS E 83  ? 0.6596 0.7958 0.5978 0.0521  0.0239  0.0138  69  LYS E CB    
3922 C CG    . LYS E 83  ? 0.6905 0.8279 0.6380 0.0735  0.0372  0.0341  69  LYS E CG    
3923 C CD    . LYS E 83  ? 0.7053 0.8794 0.6539 0.0869  0.0174  0.0455  69  LYS E CD    
3924 C CE    . LYS E 83  ? 0.7371 0.9101 0.6982 0.1147  0.0364  0.0671  69  LYS E CE    
3925 N NZ    . LYS E 83  ? 0.7554 0.9832 0.7231 0.1347  0.0177  0.0829  69  LYS E NZ    
3926 N N     . ILE E 84  ? 0.5781 0.7303 0.5549 0.0002  0.0073  -0.0251 70  ILE E N     
3927 C CA    . ILE E 84  ? 0.5687 0.6978 0.5241 -0.0132 0.0063  -0.0400 70  ILE E CA    
3928 C C     . ILE E 84  ? 0.5798 0.7206 0.5368 -0.0362 -0.0111 -0.0466 70  ILE E C     
3929 O O     . ILE E 84  ? 0.6063 0.7877 0.5891 -0.0405 -0.0228 -0.0383 70  ILE E O     
3930 C CB    . ILE E 84  ? 0.5353 0.6661 0.5174 -0.0128 0.0246  -0.0450 70  ILE E CB    
3931 C CG1   . ILE E 84  ? 0.4933 0.6486 0.5192 -0.0217 0.0264  -0.0459 70  ILE E CG1   
3932 C CG2   . ILE E 84  ? 0.5337 0.6653 0.5215 0.0000  0.0416  -0.0371 70  ILE E CG2   
3933 C CD1   . ILE E 84  ? 0.4788 0.6340 0.5265 -0.0219 0.0438  -0.0508 70  ILE E CD1   
3934 N N     . THR E 85  ? 0.5896 0.6984 0.5178 -0.0507 -0.0114 -0.0593 71  THR E N     
3935 C CA    . THR E 85  ? 0.6167 0.7323 0.5432 -0.0811 -0.0256 -0.0656 71  THR E CA    
3936 C C     . THR E 85  ? 0.5747 0.7223 0.5532 -0.0871 -0.0162 -0.0648 71  THR E C     
3937 O O     . THR E 85  ? 0.5665 0.7103 0.5637 -0.0709 0.0013  -0.0655 71  THR E O     
3938 C CB    . THR E 85  ? 0.6960 0.7434 0.5504 -0.0968 -0.0278 -0.0792 71  THR E CB    
3939 O OG1   . THR E 85  ? 0.6893 0.7052 0.5334 -0.0814 -0.0072 -0.0834 71  THR E OG1   
3940 C CG2   . THR E 85  ? 0.7401 0.7443 0.5289 -0.0870 -0.0348 -0.0808 71  THR E CG2   
3941 N N     . ARG E 86  ? 0.5880 0.7712 0.5875 -0.1126 -0.0279 -0.0631 72  ARG E N     
3942 C CA    . ARG E 86  ? 0.5586 0.7734 0.6032 -0.1186 -0.0177 -0.0608 72  ARG E CA    
3943 C C     . ARG E 86  ? 0.5651 0.7285 0.5837 -0.1205 -0.0024 -0.0724 72  ARG E C     
3944 O O     . ARG E 86  ? 0.5281 0.7037 0.5767 -0.1104 0.0126  -0.0718 72  ARG E O     
3945 C CB    . ARG E 86  ? 0.5807 0.8448 0.6438 -0.1521 -0.0334 -0.0560 72  ARG E CB    
3946 C CG    . ARG E 86  ? 0.5914 0.9296 0.6868 -0.1479 -0.0502 -0.0402 72  ARG E CG    
3947 C CD    . ARG E 86  ? 0.6268 1.0353 0.7479 -0.1875 -0.0670 -0.0337 72  ARG E CD    
3948 N NE    . ARG E 86  ? 0.6937 1.1111 0.7783 -0.2203 -0.0956 -0.0377 72  ARG E NE    
3949 C CZ    . ARG E 86  ? 0.7771 1.2141 0.8474 -0.2755 -0.1134 -0.0432 72  ARG E CZ    
3950 N NH1   . ARG E 86  ? 0.7793 1.2305 0.8719 -0.3037 -0.1035 -0.0432 72  ARG E NH1   
3951 N NH2   . ARG E 86  ? 0.8616 1.3004 0.8891 -0.3066 -0.1410 -0.0493 72  ARG E NH2   
3952 N N     . SER E 87  ? 0.6239 0.7254 0.5786 -0.1294 -0.0048 -0.0822 73  SER E N     
3953 C CA    . SER E 87  ? 0.6578 0.7048 0.5738 -0.1257 0.0105  -0.0902 73  SER E CA    
3954 C C     . SER E 87  ? 0.6435 0.6951 0.5726 -0.0906 0.0257  -0.0888 73  SER E C     
3955 O O     . SER E 87  ? 0.6360 0.6951 0.5822 -0.0829 0.0383  -0.0901 73  SER E O     
3956 C CB    . SER E 87  ? 0.7415 0.7104 0.5720 -0.1338 0.0075  -0.0983 73  SER E CB    
3957 O OG    . SER E 87  ? 0.8151 0.7364 0.6070 -0.1594 0.0133  -0.1044 73  SER E OG    
3958 N N     . ARG E 88  ? 0.6609 0.7111 0.5791 -0.0718 0.0240  -0.0858 74  ARG E N     
3959 C CA    . ARG E 88  ? 0.6493 0.7157 0.5826 -0.0462 0.0365  -0.0829 74  ARG E CA    
3960 C C     . ARG E 88  ? 0.6148 0.7259 0.6082 -0.0482 0.0414  -0.0810 74  ARG E C     
3961 O O     . ARG E 88  ? 0.6420 0.7638 0.6468 -0.0402 0.0522  -0.0838 74  ARG E O     
3962 C CB    . ARG E 88  ? 0.6634 0.7296 0.5829 -0.0317 0.0341  -0.0768 74  ARG E CB    
3963 C CG    . ARG E 88  ? 0.6564 0.7479 0.5920 -0.0121 0.0474  -0.0719 74  ARG E CG    
3964 C CD    . ARG E 88  ? 0.6664 0.7606 0.5931 -0.0014 0.0466  -0.0631 74  ARG E CD    
3965 N NE    . ARG E 88  ? 0.6621 0.7817 0.5945 0.0142  0.0602  -0.0563 74  ARG E NE    
3966 C CZ    . ARG E 88  ? 0.7208 0.8430 0.6379 0.0278  0.0649  -0.0461 74  ARG E CZ    
3967 N NH1   . ARG E 88  ? 0.7719 0.8661 0.6618 0.0300  0.0558  -0.0434 74  ARG E NH1   
3968 N NH2   . ARG E 88  ? 0.7012 0.8606 0.6300 0.0376  0.0784  -0.0376 74  ARG E NH2   
3969 N N     . LEU E 89  ? 0.5783 0.7150 0.6042 -0.0570 0.0340  -0.0755 75  LEU E N     
3970 C CA    . LEU E 89  ? 0.5365 0.7017 0.6069 -0.0531 0.0429  -0.0723 75  LEU E CA    
3971 C C     . LEU E 89  ? 0.5314 0.6992 0.6127 -0.0592 0.0513  -0.0781 75  LEU E C     
3972 O O     . LEU E 89  ? 0.5137 0.6848 0.6087 -0.0524 0.0632  -0.0817 75  LEU E O     
3973 C CB    . LEU E 89  ? 0.5046 0.7004 0.6022 -0.0523 0.0361  -0.0606 75  LEU E CB    
3974 C CG    . LEU E 89  ? 0.4678 0.6804 0.5989 -0.0395 0.0506  -0.0546 75  LEU E CG    
3975 C CD1   . LEU E 89  ? 0.4604 0.6461 0.5843 -0.0306 0.0652  -0.0588 75  LEU E CD1   
3976 C CD2   . LEU E 89  ? 0.4878 0.7359 0.6395 -0.0282 0.0452  -0.0378 75  LEU E CD2   
3977 N N     . SER E 90  ? 0.5508 0.7133 0.6210 -0.0748 0.0460  -0.0793 76  SER E N     
3978 C CA    . SER E 90  ? 0.5458 0.7080 0.6220 -0.0800 0.0563  -0.0826 76  SER E CA    
3979 C C     . SER E 90  ? 0.5457 0.6842 0.5969 -0.0665 0.0663  -0.0908 76  SER E C     
3980 O O     . SER E 90  ? 0.5918 0.7411 0.6579 -0.0597 0.0764  -0.0941 76  SER E O     
3981 C CB    . SER E 90  ? 0.5572 0.7074 0.6148 -0.1047 0.0510  -0.0821 76  SER E CB    
3982 O OG    . SER E 90  ? 0.5612 0.7541 0.6483 -0.1214 0.0389  -0.0729 76  SER E OG    
3983 N N     . HIS E 91  ? 0.5340 0.6438 0.5439 -0.0598 0.0639  -0.0929 77  HIS E N     
3984 C CA    . HIS E 91  ? 0.5213 0.6244 0.5075 -0.0413 0.0728  -0.0962 77  HIS E CA    
3985 C C     . HIS E 91  ? 0.5139 0.6539 0.5309 -0.0351 0.0753  -0.0981 77  HIS E C     
3986 O O     . HIS E 91  ? 0.5625 0.7173 0.5829 -0.0310 0.0817  -0.1029 77  HIS E O     
3987 C CB    . HIS E 91  ? 0.5445 0.6145 0.4781 -0.0263 0.0728  -0.0937 77  HIS E CB    
3988 C CG    . HIS E 91  ? 0.5868 0.5977 0.4657 -0.0312 0.0765  -0.0945 77  HIS E CG    
3989 N ND1   . HIS E 91  ? 0.5972 0.5889 0.4596 -0.0309 0.0874  -0.0955 77  HIS E ND1   
3990 C CD2   . HIS E 91  ? 0.6471 0.6039 0.4745 -0.0390 0.0726  -0.0950 77  HIS E CD2   
3991 C CE1   . HIS E 91  ? 0.6741 0.5985 0.4771 -0.0398 0.0917  -0.0958 77  HIS E CE1   
3992 N NE2   . HIS E 91  ? 0.7058 0.6054 0.4837 -0.0464 0.0823  -0.0968 77  HIS E NE2   
3993 N N     . ALA E 92  ? 0.4994 0.6507 0.5343 -0.0377 0.0708  -0.0947 78  ALA E N     
3994 C CA    . ALA E 92  ? 0.4590 0.6329 0.5153 -0.0399 0.0753  -0.0966 78  ALA E CA    
3995 C C     . ALA E 92  ? 0.4768 0.6516 0.5533 -0.0479 0.0824  -0.1029 78  ALA E C     
3996 O O     . ALA E 92  ? 0.4971 0.6822 0.5731 -0.0535 0.0873  -0.1107 78  ALA E O     
3997 C CB    . ALA E 92  ? 0.4586 0.6313 0.5233 -0.0409 0.0727  -0.0894 78  ALA E CB    
3998 N N     . VAL E 93  ? 0.4823 0.6496 0.5733 -0.0486 0.0835  -0.0991 79  VAL E N     
3999 C CA    . VAL E 93  ? 0.4980 0.6616 0.6015 -0.0483 0.0945  -0.1024 79  VAL E CA    
4000 C C     . VAL E 93  ? 0.4949 0.6586 0.5868 -0.0480 0.0996  -0.1102 79  VAL E C     
4001 O O     . VAL E 93  ? 0.4921 0.6482 0.5810 -0.0477 0.1094  -0.1175 79  VAL E O     
4002 C CB    . VAL E 93  ? 0.5216 0.6923 0.6477 -0.0421 0.0966  -0.0905 79  VAL E CB    
4003 C CG1   . VAL E 93  ? 0.5393 0.7045 0.6721 -0.0334 0.1127  -0.0909 79  VAL E CG1   
4004 C CG2   . VAL E 93  ? 0.5182 0.6862 0.6494 -0.0365 0.0944  -0.0817 79  VAL E CG2   
4005 N N     . ALA E 94  ? 0.4583 0.6215 0.5344 -0.0467 0.0951  -0.1087 80  ALA E N     
4006 C CA    . ALA E 94  ? 0.4583 0.6184 0.5157 -0.0419 0.1017  -0.1140 80  ALA E CA    
4007 C C     . ALA E 94  ? 0.4839 0.6601 0.5291 -0.0394 0.1007  -0.1232 80  ALA E C     
4008 O O     . ALA E 94  ? 0.4931 0.6730 0.5293 -0.0388 0.