data_43C9
# 
_entry.id   43C9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   43C9         
RCSB  RCSB000625   
WWPDB D_1000000625 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          43CA 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        43C9 
_pdbx_database_status.recvd_initial_deposition_date   1999-03-10 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Thayer, M.M.'  1 
'Getzoff, E.D.' 2 
'Roberts, V.A.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural basis for amide hydrolysis catalyzed by the 43C9 antibody.'                                  J.Mol.Biol.  291 
329  345  1999 JMOBAK UK 0022-2836 0070 ? 10438624 10.1006/jmbi.1999.2960 
1       'Catalytic antibody model and mutagenesis implicate arginine in transition-state stabilization.'         J.Mol.Biol.  235 
1098 1116 1994 JMOBAK UK 0022-2836 0070 ? 8289310  10.1006/jmbi.1994.1060 
2       'Site-directed mutagenesis of a catalytic antibody: an arginine and a histidine residue play key roles.' Biochemistry 33  
1994 2003 1994 BICHAW US 0006-2960 0033 ? 8117656  10.1021/bi00174a004    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Thayer, M.M.'      1  ? 
primary 'Olender, E.H.'     2  ? 
primary 'Arvai, A.S.'       3  ? 
primary 'Koike, C.K.'       4  ? 
primary 'Canestrelli, I.L.' 5  ? 
primary 'Stewart, J.D.'     6  ? 
primary 'Benkovic, S.J.'    7  ? 
primary 'Getzoff, E.D.'     8  ? 
primary 'Roberts, V.A.'     9  ? 
1       'Roberts, V.A.'     10 ? 
1       'Stewart, J.'       11 ? 
1       'Benkovic, S.J.'    12 ? 
1       'Getzoff, E.D.'     13 ? 
2       'Stewart, J.D.'     14 ? 
2       'Roberts, V.A.'     15 ? 
2       'Thomas, N.R.'      16 ? 
2       'Getzoff, E.D.'     17 ? 
2       'Benkovic, S.J.'    18 ? 
# 
_cell.entry_id           43C9 
_cell.length_a           104.130 
_cell.length_b           112.660 
_cell.length_c           245.120 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         43C9 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN))' 12434.939 4   ? ? FV ? 
2 polymer man 'PROTEIN (IMMUNOGLOBULIN (HEAVY CHAIN))' 12846.444 4   ? ? FV ? 
3 water   nat water                                    18.015    162 ? ? ?  ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DVVMTQTPSSLAMSVGQKVTMSCKSSQSLLNISNQKNYLAWYQQKPGQSPKLLVYFASTRESGVPDRFIGSGSGTDFTLT
ISSVQAEDQADYFCQQHYRAPRTFGGGTKLEIK
;
;DVVMTQTPSSLAMSVGQKVTMSCKSSQSLLNISNQKNYLAWYQQKPGQSPKLLVYFASTRESGVPDRFIGSGSGTDFTLT
ISSVQAEDQADYFCQQHYRAPRTFGGGTKLEIK
;
A,C,E,G ? 
2 'polypeptide(L)' no no 
;GQVQLVESGPGLVAPSQSLSITCTVSGISLSRYNVHWVRQSPGKGLEWLGMIWGGGSIEYNPALKSRLSISKDNSKSQIF
LKMNSLQTDDSAMYYCVSYGYGGDRFSYWGQGTLVTVS
;
;GQVQLVESGPGLVAPSQSLSITCTVSGISLSRYNVHWVRQSPGKGLEWLGMIWGGGSIEYNPALKSRLSISKDNSKSQIF
LKMNSLQTDDSAMYYCVSYGYGGDRFSYWGQGTLVTVS
;
B,D,F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   VAL n 
1 3   VAL n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   THR n 
1 8   PRO n 
1 9   SER n 
1 10  SER n 
1 11  LEU n 
1 12  ALA n 
1 13  MET n 
1 14  SER n 
1 15  VAL n 
1 16  GLY n 
1 17  GLN n 
1 18  LYS n 
1 19  VAL n 
1 20  THR n 
1 21  MET n 
1 22  SER n 
1 23  CYS n 
1 24  LYS n 
1 25  SER n 
1 26  SER n 
1 27  GLN n 
1 28  SER n 
1 29  LEU n 
1 30  LEU n 
1 31  ASN n 
1 32  ILE n 
1 33  SER n 
1 34  ASN n 
1 35  GLN n 
1 36  LYS n 
1 37  ASN n 
1 38  TYR n 
1 39  LEU n 
1 40  ALA n 
1 41  TRP n 
1 42  TYR n 
1 43  GLN n 
1 44  GLN n 
1 45  LYS n 
1 46  PRO n 
1 47  GLY n 
1 48  GLN n 
1 49  SER n 
1 50  PRO n 
1 51  LYS n 
1 52  LEU n 
1 53  LEU n 
1 54  VAL n 
1 55  TYR n 
1 56  PHE n 
1 57  ALA n 
1 58  SER n 
1 59  THR n 
1 60  ARG n 
1 61  GLU n 
1 62  SER n 
1 63  GLY n 
1 64  VAL n 
1 65  PRO n 
1 66  ASP n 
1 67  ARG n 
1 68  PHE n 
1 69  ILE n 
1 70  GLY n 
1 71  SER n 
1 72  GLY n 
1 73  SER n 
1 74  GLY n 
1 75  THR n 
1 76  ASP n 
1 77  PHE n 
1 78  THR n 
1 79  LEU n 
1 80  THR n 
1 81  ILE n 
1 82  SER n 
1 83  SER n 
1 84  VAL n 
1 85  GLN n 
1 86  ALA n 
1 87  GLU n 
1 88  ASP n 
1 89  GLN n 
1 90  ALA n 
1 91  ASP n 
1 92  TYR n 
1 93  PHE n 
1 94  CYS n 
1 95  GLN n 
1 96  GLN n 
1 97  HIS n 
1 98  TYR n 
1 99  ARG n 
1 100 ALA n 
1 101 PRO n 
1 102 ARG n 
1 103 THR n 
1 104 PHE n 
1 105 GLY n 
1 106 GLY n 
1 107 GLY n 
1 108 THR n 
1 109 LYS n 
1 110 LEU n 
1 111 GLU n 
1 112 ILE n 
1 113 LYS n 
2 1   GLY n 
2 2   GLN n 
2 3   VAL n 
2 4   GLN n 
2 5   LEU n 
2 6   VAL n 
2 7   GLU n 
2 8   SER n 
2 9   GLY n 
2 10  PRO n 
2 11  GLY n 
2 12  LEU n 
2 13  VAL n 
2 14  ALA n 
2 15  PRO n 
2 16  SER n 
2 17  GLN n 
2 18  SER n 
2 19  LEU n 
2 20  SER n 
2 21  ILE n 
2 22  THR n 
2 23  CYS n 
2 24  THR n 
2 25  VAL n 
2 26  SER n 
2 27  GLY n 
2 28  ILE n 
2 29  SER n 
2 30  LEU n 
2 31  SER n 
2 32  ARG n 
2 33  TYR n 
2 34  ASN n 
2 35  VAL n 
2 36  HIS n 
2 37  TRP n 
2 38  VAL n 
2 39  ARG n 
2 40  GLN n 
2 41  SER n 
2 42  PRO n 
2 43  GLY n 
2 44  LYS n 
2 45  GLY n 
2 46  LEU n 
2 47  GLU n 
2 48  TRP n 
2 49  LEU n 
2 50  GLY n 
2 51  MET n 
2 52  ILE n 
2 53  TRP n 
2 54  GLY n 
2 55  GLY n 
2 56  GLY n 
2 57  SER n 
2 58  ILE n 
2 59  GLU n 
2 60  TYR n 
2 61  ASN n 
2 62  PRO n 
2 63  ALA n 
2 64  LEU n 
2 65  LYS n 
2 66  SER n 
2 67  ARG n 
2 68  LEU n 
2 69  SER n 
2 70  ILE n 
2 71  SER n 
2 72  LYS n 
2 73  ASP n 
2 74  ASN n 
2 75  SER n 
2 76  LYS n 
2 77  SER n 
2 78  GLN n 
2 79  ILE n 
2 80  PHE n 
2 81  LEU n 
2 82  LYS n 
2 83  MET n 
2 84  ASN n 
2 85  SER n 
2 86  LEU n 
2 87  GLN n 
2 88  THR n 
2 89  ASP n 
2 90  ASP n 
2 91  SER n 
2 92  ALA n 
2 93  MET n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  VAL n 
2 98  SER n 
2 99  TYR n 
2 100 GLY n 
2 101 TYR n 
2 102 GLY n 
2 103 GLY n 
2 104 ASP n 
2 105 ARG n 
2 106 PHE n 
2 107 SER n 
2 108 TYR n 
2 109 TRP n 
2 110 GLY n 
2 111 GLN n 
2 112 GLY n 
2 113 THR n 
2 114 LEU n 
2 115 VAL n 
2 116 THR n 
2 117 VAL n 
2 118 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP Q9ERZ9_MOUSE Q9ERZ9 1 1  ? ? 
2 UNP HV44_MOUSE   P01820 2 20 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 43C9 A 1 ? 113 ? Q9ERZ9 1  ? 107 ? 1 107 
2 2 43C9 B 1 ? 118 ? P01820 20 ? 114 ? 0 112 
3 1 43C9 C 1 ? 113 ? Q9ERZ9 1  ? 107 ? 1 107 
4 2 43C9 D 1 ? 118 ? P01820 20 ? 114 ? 0 112 
5 1 43C9 E 1 ? 113 ? Q9ERZ9 1  ? 107 ? 1 107 
6 2 43C9 F 1 ? 118 ? P01820 20 ? 114 ? 0 112 
7 1 43C9 G 1 ? 113 ? Q9ERZ9 1  ? 107 ? 1 107 
8 2 43C9 H 1 ? 118 ? P01820 20 ? 114 ? 0 112 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          43C9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.59 
_exptl_crystal.density_percent_sol   65.8 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '80% NACL, 50 MM MOPS PH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI111 CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             1.08 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     43C9 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   65372 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.081 
_reflns.pdbx_netI_over_sigmaI        16 
_reflns.B_iso_Wilson_estimate        41.8 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   0.564 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.37 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 43C9 
_refine.ls_number_reflns_obs                     46487 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               100000 
_refine.pdbx_data_cutoff_low_absF                0.1 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    64.2 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21 
_refine.ls_R_factor_R_free                       0.265 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.24 
_refine.ls_number_reflns_R_free                  2348 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               54.8 
_refine.aniso_B[1][1]                            7.36 
_refine.aniso_B[2][2]                            25.25 
_refine.aniso_B[3][3]                            -0.24 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;WITH THE EXCEPTION OF THE LAST LINKER RESIDUE
(RESIDUE 0 IN CHAINS B, D, F, AND H), THE FLEXIBLE LINKER
BETWEEN THE LIGHT AND HEAVY CHAINS WAS NOT OBSERVED IN THE
CRYSTAL STRUCTURE.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7092 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             162 
_refine_hist.number_atoms_total               7254 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.752 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.2 
_refine_ls_shell.d_res_low                        2.3 
_refine_ls_shell.number_reflns_R_work             1529 
_refine_ls_shell.R_factor_R_work                  0.354 
_refine_ls_shell.percent_reflns_obs               18 
_refine_ls_shell.R_factor_R_free                  0.396 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            0.84 
_refine_ls_shell.number_reflns_R_free             75 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAMH19.SOL TOPH19.SOL   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.079680 0.996800  -0.006140 0.996680  0.079570  -0.017410 -0.016870 -0.007510 -0.999830 -3.45806  3.91068   62.25752 
2 given ? -0.091420 -0.864330 0.494550  -0.866820 -0.175380 -0.466760 0.490170  -0.471360 -0.733180 40.16598  144.57294 37.10586 
3 given ? -0.833720 -0.175760 -0.523470 -0.112500 -0.874050 0.472640  -0.540600 0.452940  0.708940  102.57515 74.63538  44.18444 
4 given ? -0.058780 0.998270  0.003120  0.998190  0.058810  -0.012550 -0.012710 0.002380  -0.999920 -4.81884  4.09029   61.89333 
5 given ? -0.088740 -0.876410 0.473330  -0.857990 -0.174120 -0.483250 0.505940  -0.448990 -0.736500 41.46558  144.42966 34.88335 
6 given ? -0.850250 -0.173710 -0.496890 -0.112630 -0.862080 0.494100  -0.514190 0.476070  0.713420  103.58128 73.85614  41.11970 
# 
_struct.entry_id                  43C9 
_struct.title                     'CRYSTALLOGRAPHIC STRUCTURE OF THE ESTEROLYTIC AND AMIDOLYTIC 43C9 ANTIBODY' 
_struct.pdbx_descriptor           '43C9 ANTIBODY (FV FRAGMENT)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        43C9 
_struct_keywords.pdbx_keywords   IMMUNOGLOBULIN 
_struct_keywords.text            IMMUNOGLOBULIN 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
3 ? ? 
4 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 85 ? GLN A 89 ? GLN A 79 GLN A 83 5 ? 5 
HELX_P HELX_P2  2  SER B 29 ? TYR B 33 ? SER B 28 TYR B 32 5 ? 5 
HELX_P HELX_P3  3  ALA B 63 ? SER B 66 ? ALA B 62 SER B 65 5 ? 4 
HELX_P HELX_P4  4  GLN B 87 ? SER B 91 ? GLN B 83 SER B 87 5 ? 5 
HELX_P HELX_P5  5  GLN C 85 ? GLN C 89 ? GLN C 79 GLN C 83 5 ? 5 
HELX_P HELX_P6  6  PRO D 62 ? LYS D 65 ? PRO D 61 LYS D 64 5 ? 4 
HELX_P HELX_P7  7  ASN D 74 ? LYS D 76 ? ASN D 73 LYS D 75 5 ? 3 
HELX_P HELX_P8  8  GLN D 87 ? SER D 91 ? GLN D 83 SER D 87 5 ? 5 
HELX_P HELX_P9  9  ASN F 61 ? SER F 66 ? ASN F 60 SER F 65 1 ? 6 
HELX_P HELX_P10 10 GLN F 87 ? SER F 91 ? GLN F 83 SER F 87 5 ? 5 
HELX_P HELX_P11 11 GLN G 85 ? GLN G 89 ? GLN G 79 GLN G 83 5 ? 5 
HELX_P HELX_P12 12 ASN H 61 ? SER H 66 ? ASN H 60 SER H 65 1 ? 6 
HELX_P HELX_P13 13 GLN H 87 ? SER H 91 ? GLN H 83 SER H 87 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 94 SG ? ? A CYS 23 A CYS 88 1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf2 disulf ? ? C CYS 23 SG ? ? ? 1_555 C CYS 94 SG ? ? C CYS 23 C CYS 88 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf3 disulf ? ? E CYS 23 SG ? ? ? 1_555 E CYS 94 SG ? ? E CYS 23 E CYS 88 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf4 disulf ? ? G CYS 23 SG ? ? ? 1_555 G CYS 94 SG ? ? G CYS 23 G CYS 88 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf5 disulf ? ? B CYS 23 SG ? ? ? 1_555 B CYS 96 SG ? ? B CYS 22 B CYS 92 1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf6 disulf ? ? D CYS 23 SG ? ? ? 1_555 D CYS 96 SG ? ? D CYS 22 D CYS 92 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf7 disulf ? ? F CYS 23 SG ? ? ? 1_555 F CYS 96 SG ? ? F CYS 22 F CYS 92 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf8 disulf ? ? H CYS 23 SG ? ? ? 1_555 H CYS 96 SG ? ? H CYS 22 H CYS 92 1_555 ? ? ? ? ? ? ? 2.038 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 7   A . ? THR 7  A PRO 8   A ? PRO 8  A 1 -3.00 
2 ALA 100 A . ? ALA 94 A PRO 101 A ? PRO 95 A 1 -0.62 
3 THR 7   C . ? THR 7  C PRO 8   C ? PRO 8  C 1 -0.59 
4 ALA 100 C . ? ALA 94 C PRO 101 C ? PRO 95 C 1 -0.69 
5 THR 7   E . ? THR 7  E PRO 8   E ? PRO 8  E 1 -0.72 
6 ALA 100 E . ? ALA 94 E PRO 101 E ? PRO 95 E 1 -1.43 
7 THR 7   G . ? THR 7  G PRO 8   G ? PRO 8  G 1 -0.21 
8 ALA 100 G . ? ALA 94 G PRO 101 G ? PRO 95 G 1 -0.29 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 4 ? 
D ? 6 ? 
E ? 2 ? 
F ? 4 ? 
G ? 5 ? 
H ? 4 ? 
I ? 5 ? 
J ? 2 ? 
K ? 4 ? 
L ? 2 ? 
M ? 3 ? 
N ? 4 ? 
O ? 5 ? 
P ? 2 ? 
Q ? 4 ? 
R ? 5 ? 
S ? 4 ? 
T ? 5 ? 
U ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? parallel      
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
R 1 2 ? parallel      
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
R 4 5 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
T 4 5 ? anti-parallel 
U 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 4   ? THR A 7   ? MET A 4   THR A 7   
A 2 VAL A 19  ? LYS A 24  ? VAL A 19  LYS A 24  
A 3 ASP A 76  ? ILE A 81  ? ASP A 70  ILE A 75  
A 4 PHE A 68  ? SER A 73  ? PHE A 62  SER A 67  
B 1 SER A 10  ? SER A 14  ? SER A 10  SER A 14  
B 2 THR A 108 ? LYS A 113 ? THR A 102 LYS A 107 
B 3 ALA A 90  ? GLN A 96  ? ALA A 84  GLN A 90  
B 4 LEU A 39  ? GLN A 44  ? LEU A 33  GLN A 38  
B 5 PRO A 50  ? VAL A 54  ? PRO A 44  VAL A 48  
C 1 GLN B 4   ? SER B 8   ? GLN B 3   SER B 7   
C 2 LEU B 19  ? SER B 26  ? LEU B 18  SER B 25  
C 3 GLN B 78  ? MET B 83  ? GLN B 77  MET B 82  
C 4 LEU B 68  ? ASP B 73  ? LEU B 67  ASP B 72  
D 1 THR B 113 ? VAL B 115 ? THR B 107 VAL B 109 
D 2 ALA B 92  ? TYR B 99  ? ALA B 88  TYR B 95  
D 3 ASN B 34  ? SER B 41  ? ASN B 33  SER B 40  
D 4 GLY B 45  ? ILE B 52  ? GLY B 44  ILE B 51  
D 5 ILE B 58  ? TYR B 60  ? ILE B 57  TYR B 59  
E 1 VAL B 97  ? TYR B 99  ? VAL B 93  TYR B 95  
E 2 SER B 107 ? TRP B 109 ? SER B 101 TRP B 103 
F 1 MET C 4   ? THR C 7   ? MET C 4   THR C 7   
F 2 VAL C 19  ? LYS C 24  ? VAL C 19  LYS C 24  
F 3 ASP C 76  ? ILE C 81  ? ASP C 70  ILE C 75  
F 4 PHE C 68  ? SER C 73  ? PHE C 62  SER C 67  
G 1 SER C 10  ? SER C 14  ? SER C 10  SER C 14  
G 2 THR C 108 ? LYS C 113 ? THR C 102 LYS C 107 
G 3 ALA C 90  ? GLN C 96  ? ALA C 84  GLN C 90  
G 4 LEU C 39  ? GLN C 44  ? LEU C 33  GLN C 38  
G 5 LYS C 51  ? VAL C 54  ? LYS C 45  VAL C 48  
H 1 GLN D 4   ? SER D 8   ? GLN D 3   SER D 7   
H 2 LEU D 19  ? SER D 26  ? LEU D 18  SER D 25  
H 3 GLN D 78  ? MET D 83  ? GLN D 77  MET D 82  
H 4 LEU D 68  ? ASP D 73  ? LEU D 67  ASP D 72  
I 1 THR D 113 ? VAL D 115 ? THR D 107 VAL D 109 
I 2 ALA D 92  ? GLY D 100 ? ALA D 88  GLY D 96  
I 3 ASN D 34  ? SER D 41  ? ASN D 33  SER D 40  
I 4 GLY D 45  ? ILE D 52  ? GLY D 44  ILE D 51  
I 5 ILE D 58  ? TYR D 60  ? ILE D 57  TYR D 59  
J 1 VAL D 97  ? TYR D 99  ? VAL D 93  TYR D 95  
J 2 SER D 107 ? TRP D 109 ? SER D 101 TRP D 103 
K 1 MET E 4   ? THR E 7   ? MET E 4   THR E 7   
K 2 VAL E 19  ? LYS E 24  ? VAL E 19  LYS E 24  
K 3 ASP E 76  ? ILE E 81  ? ASP E 70  ILE E 75  
K 4 PHE E 68  ? SER E 73  ? PHE E 62  SER E 67  
L 1 SER E 10  ? SER E 14  ? SER E 10  SER E 14  
L 2 THR E 108 ? LYS E 113 ? THR E 102 LYS E 107 
M 1 ALA E 90  ? GLN E 96  ? ALA E 84  GLN E 90  
M 2 LEU E 39  ? GLN E 44  ? LEU E 33  GLN E 38  
M 3 LYS E 51  ? VAL E 54  ? LYS E 45  VAL E 48  
N 1 GLN F 4   ? SER F 8   ? GLN F 3   SER F 7   
N 2 ILE F 21  ? SER F 26  ? ILE F 20  SER F 25  
N 3 GLN F 78  ? LEU F 81  ? GLN F 77  LEU F 80  
N 4 ILE F 70  ? ASP F 73  ? ILE F 69  ASP F 72  
O 1 THR F 113 ? VAL F 115 ? THR F 107 VAL F 109 
O 2 ALA F 92  ? TYR F 99  ? ALA F 88  TYR F 95  
O 3 ASN F 34  ? SER F 41  ? ASN F 33  SER F 40  
O 4 GLY F 45  ? ILE F 52  ? GLY F 44  ILE F 51  
O 5 ILE F 58  ? TYR F 60  ? ILE F 57  TYR F 59  
P 1 VAL F 97  ? TYR F 99  ? VAL F 93  TYR F 95  
P 2 SER F 107 ? TRP F 109 ? SER F 101 TRP F 103 
Q 1 MET G 4   ? THR G 7   ? MET G 4   THR G 7   
Q 2 VAL G 19  ? LYS G 24  ? VAL G 19  LYS G 24  
Q 3 ASP G 76  ? ILE G 81  ? ASP G 70  ILE G 75  
Q 4 PHE G 68  ? SER G 73  ? PHE G 62  SER G 67  
R 1 SER G 10  ? SER G 14  ? SER G 10  SER G 14  
R 2 THR G 108 ? LYS G 113 ? THR G 102 LYS G 107 
R 3 ALA G 90  ? GLN G 96  ? ALA G 84  GLN G 90  
R 4 LEU G 39  ? GLN G 44  ? LEU G 33  GLN G 38  
R 5 LYS G 51  ? VAL G 54  ? LYS G 45  VAL G 48  
S 1 GLN H 4   ? SER H 8   ? GLN H 3   SER H 7   
S 2 ILE H 21  ? SER H 26  ? ILE H 20  SER H 25  
S 3 GLN H 78  ? LEU H 81  ? GLN H 77  LEU H 80  
S 4 ILE H 70  ? ASP H 73  ? ILE H 69  ASP H 72  
T 1 THR H 113 ? VAL H 115 ? THR H 107 VAL H 109 
T 2 ALA H 92  ? TYR H 99  ? ALA H 88  TYR H 95  
T 3 ASN H 34  ? SER H 41  ? ASN H 33  SER H 40  
T 4 GLY H 45  ? ILE H 52  ? GLY H 44  ILE H 51  
T 5 ILE H 58  ? TYR H 60  ? ILE H 57  TYR H 59  
U 1 VAL H 97  ? TYR H 99  ? VAL H 93  TYR H 95  
U 2 SER H 107 ? TRP H 109 ? SER H 101 TRP H 103 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 5   ? O THR A 5   N LYS A 24  ? N LYS A 24  
A 2 3 O VAL A 19  ? O VAL A 19  N ILE A 81  ? N ILE A 75  
A 3 4 O ASP A 76  ? O ASP A 70  N SER A 73  ? N SER A 67  
B 1 2 O LEU A 11  ? O LEU A 11  N LYS A 109 ? N LYS A 103 
B 2 3 O THR A 108 ? O THR A 102 N TYR A 92  ? N TYR A 86  
B 3 4 O ASP A 91  ? O ASP A 85  N GLN A 44  ? N GLN A 38  
B 4 5 O TRP A 41  ? O TRP A 35  N VAL A 54  ? N VAL A 48  
C 1 2 O GLN B 4   ? O GLN B 3   N SER B 26  ? N SER B 25  
C 2 3 O LEU B 19  ? O LEU B 18  N MET B 83  ? N MET B 82  
C 3 4 O GLN B 78  ? O GLN B 77  N ASP B 73  ? N ASP B 72  
D 1 2 O THR B 113 ? O THR B 107 N TYR B 94  ? N TYR B 90  
D 2 3 O MET B 93  ? O MET B 89  N GLN B 40  ? N GLN B 39  
D 3 4 O VAL B 35  ? O VAL B 34  N ILE B 52  ? N ILE B 51  
D 4 5 O MET B 51  ? O MET B 50  N GLU B 59  ? N GLU B 58  
E 1 2 O SER B 98  ? O SER B 94  N TYR B 108 ? N TYR B 102 
F 1 2 O THR C 5   ? O THR C 5   N LYS C 24  ? N LYS C 24  
F 2 3 O VAL C 19  ? O VAL C 19  N ILE C 81  ? N ILE C 75  
F 3 4 O ASP C 76  ? O ASP C 70  N SER C 73  ? N SER C 67  
G 1 2 O LEU C 11  ? O LEU C 11  N LYS C 109 ? N LYS C 103 
G 2 3 O THR C 108 ? O THR C 102 N TYR C 92  ? N TYR C 86  
G 3 4 O ASP C 91  ? O ASP C 85  N GLN C 44  ? N GLN C 38  
G 4 5 O TRP C 41  ? O TRP C 35  N VAL C 54  ? N VAL C 48  
H 1 2 O GLN D 4   ? O GLN D 3   N SER D 26  ? N SER D 25  
H 2 3 O LEU D 19  ? O LEU D 18  N MET D 83  ? N MET D 82  
H 3 4 O GLN D 78  ? O GLN D 77  N ASP D 73  ? N ASP D 72  
I 1 2 O THR D 113 ? O THR D 107 N TYR D 94  ? N TYR D 90  
I 2 3 O MET D 93  ? O MET D 89  N GLN D 40  ? N GLN D 39  
I 3 4 O VAL D 35  ? O VAL D 34  N ILE D 52  ? N ILE D 51  
I 4 5 O MET D 51  ? O MET D 50  N GLU D 59  ? N GLU D 58  
J 1 2 O SER D 98  ? O SER D 94  N TYR D 108 ? N TYR D 102 
K 1 2 O THR E 5   ? O THR E 5   N LYS E 24  ? N LYS E 24  
K 2 3 O VAL E 19  ? O VAL E 19  N ILE E 81  ? N ILE E 75  
K 3 4 O ASP E 76  ? O ASP E 70  N SER E 73  ? N SER E 67  
L 1 2 O LEU E 11  ? O LEU E 11  N LYS E 109 ? N LYS E 103 
M 1 2 O ASP E 91  ? O ASP E 85  N GLN E 44  ? N GLN E 38  
M 2 3 O TRP E 41  ? O TRP E 35  N VAL E 54  ? N VAL E 48  
N 1 2 O GLN F 4   ? O GLN F 3   N SER F 26  ? N SER F 25  
N 2 3 O ILE F 21  ? O ILE F 20  N LEU F 81  ? N LEU F 80  
N 3 4 O GLN F 78  ? O GLN F 77  N ASP F 73  ? N ASP F 72  
O 1 2 O THR F 113 ? O THR F 107 N TYR F 94  ? N TYR F 90  
O 2 3 O MET F 93  ? O MET F 89  N GLN F 40  ? N GLN F 39  
O 3 4 O VAL F 35  ? O VAL F 34  N ILE F 52  ? N ILE F 51  
O 4 5 O MET F 51  ? O MET F 50  N GLU F 59  ? N GLU F 58  
P 1 2 O SER F 98  ? O SER F 94  N TYR F 108 ? N TYR F 102 
Q 1 2 O THR G 5   ? O THR G 5   N LYS G 24  ? N LYS G 24  
Q 2 3 O VAL G 19  ? O VAL G 19  N ILE G 81  ? N ILE G 75  
Q 3 4 O ASP G 76  ? O ASP G 70  N SER G 73  ? N SER G 67  
R 1 2 O LEU G 11  ? O LEU G 11  N LYS G 109 ? N LYS G 103 
R 2 3 O THR G 108 ? O THR G 102 N TYR G 92  ? N TYR G 86  
R 3 4 O ASP G 91  ? O ASP G 85  N GLN G 44  ? N GLN G 38  
R 4 5 O TRP G 41  ? O TRP G 35  N VAL G 54  ? N VAL G 48  
S 1 2 O GLN H 4   ? O GLN H 3   N SER H 26  ? N SER H 25  
S 2 3 O ILE H 21  ? O ILE H 20  N LEU H 81  ? N LEU H 80  
S 3 4 O GLN H 78  ? O GLN H 77  N ASP H 73  ? N ASP H 72  
T 1 2 O THR H 113 ? O THR H 107 N TYR H 94  ? N TYR H 90  
T 2 3 O MET H 93  ? O MET H 89  N GLN H 40  ? N GLN H 39  
T 3 4 O VAL H 35  ? O VAL H 34  N ILE H 52  ? N ILE H 51  
T 4 5 O MET H 51  ? O MET H 50  N GLU H 59  ? N GLU H 58  
U 1 2 O SER H 98  ? O SER H 94  N TYR H 108 ? N TYR H 102 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Author ? ? ? ? 2 
;CATALYTIC SITE IS BELIEVED TO INCLUDE: HIS 91 IN THE VARIABLE LIGHT CHAIN - NUCLEOPHILE THAT FORMS A COVALENT BOND TO THE SUBSTRATE ARG 96 IN THE VARIABLE LIGHT CHAIN - SIDE CHAIN STABILIZES NEGATIVE CHARGE FORMED IN THE TRANSITION STATES OF THE REACTION
;
AC2 Author ? ? ? ? 2 
;CATALYTIC SITE IS BELIEVED TO INCLUDE: HIS 91 IN THE VARIABLE LIGHT CHAIN - NUCLEOPHILE THAT FORMS A COVALENT BOND TO THE SUBSTRATE ARG 96 IN THE VARIABLE LIGHT CHAIN - SIDE CHAIN STABILIZES NEGATIVE CHARGE FORMED IN THE TRANSITION STATES OF THE REACTION
;
AC3 Author ? ? ? ? 2 
;CATALYTIC SITE IS BELIEVED TO INCLUDE: HIS 91 IN THE VARIABLE LIGHT CHAIN - NUCLEOPHILE THAT FORMS A COVALENT BOND TO THE SUBSTRATE ARG 96 IN THE VARIABLE LIGHT CHAIN - SIDE CHAIN STABILIZES NEGATIVE CHARGE FORMED IN THE TRANSITION STATES OF THE REACTION
;
AC4 Author ? ? ? ? 2 
;CATALYTIC SITE IS BELIEVED TO INCLUDE: HIS 91 IN THE VARIABLE LIGHT CHAIN - NUCLEOPHILE THAT FORMS A COVALENT BOND TO THE SUBSTRATE ARG 96 IN THE VARIABLE LIGHT CHAIN - SIDE CHAIN STABILIZES NEGATIVE CHARGE FORMED IN THE TRANSITION STATES OF THE REACTION
;
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 HIS A 97  ? HIS A 91 . ? 1_555 ? 
2 AC1 2 ARG A 102 ? ARG A 96 . ? 1_555 ? 
3 AC2 2 HIS C 97  ? HIS C 91 . ? 1_555 ? 
4 AC2 2 ARG C 102 ? ARG C 96 . ? 1_555 ? 
5 AC3 2 HIS E 97  ? HIS E 91 . ? 1_555 ? 
6 AC3 2 ARG E 102 ? ARG E 96 . ? 1_555 ? 
7 AC4 2 HIS G 97  ? HIS G 91 . ? 1_555 ? 
8 AC4 2 ARG G 102 ? ARG G 96 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          43C9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    43C9 
_atom_sites.fract_transf_matrix[1][1]   0.009603 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008876 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004080 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 7.422   50.761 33.806 1.00 64.60  ? 1   ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 8.287   50.204 34.870 1.00 77.57  ? 1   ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 8.848   48.834 34.503 1.00 77.32  ? 1   ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 9.752   48.357 35.183 1.00 82.14  ? 1   ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 7.507   50.107 36.205 1.00 86.78  ? 1   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 8.392   49.691 37.423 1.00 92.57  ? 1   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 9.630   49.891 37.411 1.00 93.28  ? 1   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 7.826   49.183 38.422 1.00 96.45  ? 1   ASP A OD2 1 
ATOM   9    N N   . VAL A 1 2   ? 8.333   48.184 33.458 1.00 70.66  ? 2   VAL A N   1 
ATOM   10   C CA  . VAL A 1 2   ? 8.864   46.859 33.118 1.00 63.77  ? 2   VAL A CA  1 
ATOM   11   C C   . VAL A 1 2   ? 10.397  47.012 32.964 1.00 58.68  ? 2   VAL A C   1 
ATOM   12   O O   . VAL A 1 2   ? 10.879  47.598 32.010 1.00 62.61  ? 2   VAL A O   1 
ATOM   13   C CB  . VAL A 1 2   ? 8.149   46.194 31.855 1.00 62.22  ? 2   VAL A CB  1 
ATOM   14   C CG1 . VAL A 1 2   ? 8.587   44.744 31.697 1.00 57.29  ? 2   VAL A CG1 1 
ATOM   15   C CG2 . VAL A 1 2   ? 6.623   46.182 32.007 1.00 54.58  ? 2   VAL A CG2 1 
ATOM   16   N N   . VAL A 1 3   ? 11.127  46.618 34.002 1.00 52.60  ? 3   VAL A N   1 
ATOM   17   C CA  . VAL A 1 3   ? 12.576  46.724 34.032 1.00 47.60  ? 3   VAL A CA  1 
ATOM   18   C C   . VAL A 1 3   ? 13.302  45.587 33.343 1.00 47.13  ? 3   VAL A C   1 
ATOM   19   O O   . VAL A 1 3   ? 13.288  44.449 33.821 1.00 45.32  ? 3   VAL A O   1 
ATOM   20   C CB  . VAL A 1 3   ? 13.100  46.837 35.484 1.00 41.79  ? 3   VAL A CB  1 
ATOM   21   C CG1 . VAL A 1 3   ? 14.576  46.500 35.561 1.00 34.74  ? 3   VAL A CG1 1 
ATOM   22   C CG2 . VAL A 1 3   ? 12.887  48.238 35.971 1.00 40.73  ? 3   VAL A CG2 1 
ATOM   23   N N   . MET A 1 4   ? 14.038  45.943 32.297 1.00 45.51  ? 4   MET A N   1 
ATOM   24   C CA  . MET A 1 4   ? 14.813  44.989 31.533 1.00 44.96  ? 4   MET A CA  1 
ATOM   25   C C   . MET A 1 4   ? 16.258  44.988 32.003 1.00 44.01  ? 4   MET A C   1 
ATOM   26   O O   . MET A 1 4   ? 16.932  46.008 31.936 1.00 51.50  ? 4   MET A O   1 
ATOM   27   C CB  . MET A 1 4   ? 14.717  45.332 30.061 1.00 44.71  ? 4   MET A CB  1 
ATOM   28   C CG  . MET A 1 4   ? 13.281  45.342 29.558 1.00 49.38  ? 4   MET A CG  1 
ATOM   29   S SD  . MET A 1 4   ? 12.390  43.801 29.955 1.00 40.40  ? 4   MET A SD  1 
ATOM   30   C CE  . MET A 1 4   ? 13.497  42.533 29.307 1.00 27.83  ? 4   MET A CE  1 
ATOM   31   N N   . THR A 1 5   ? 16.726  43.830 32.454 1.00 41.87  ? 5   THR A N   1 
ATOM   32   C CA  . THR A 1 5   ? 18.072  43.666 32.983 1.00 44.64  ? 5   THR A CA  1 
ATOM   33   C C   . THR A 1 5   ? 18.875  42.578 32.236 1.00 48.18  ? 5   THR A C   1 
ATOM   34   O O   . THR A 1 5   ? 18.538  41.381 32.277 1.00 51.03  ? 5   THR A O   1 
ATOM   35   C CB  . THR A 1 5   ? 18.001  43.367 34.539 1.00 42.72  ? 5   THR A CB  1 
ATOM   36   O OG1 . THR A 1 5   ? 17.625  44.566 35.244 1.00 39.89  ? 5   THR A OG1 1 
ATOM   37   C CG2 . THR A 1 5   ? 19.335  42.845 35.078 1.00 35.71  ? 5   THR A CG2 1 
ATOM   38   N N   . GLN A 1 6   ? 19.951  42.991 31.565 1.00 49.02  ? 6   GLN A N   1 
ATOM   39   C CA  . GLN A 1 6   ? 20.786  42.042 30.816 1.00 44.50  ? 6   GLN A CA  1 
ATOM   40   C C   . GLN A 1 6   ? 21.993  41.600 31.619 1.00 39.20  ? 6   GLN A C   1 
ATOM   41   O O   . GLN A 1 6   ? 22.397  42.282 32.539 1.00 41.15  ? 6   GLN A O   1 
ATOM   42   C CB  . GLN A 1 6   ? 21.235  42.638 29.484 1.00 43.24  ? 6   GLN A CB  1 
ATOM   43   C CG  . GLN A 1 6   ? 20.108  43.040 28.578 1.00 37.35  ? 6   GLN A CG  1 
ATOM   44   C CD  . GLN A 1 6   ? 20.579  43.339 27.176 1.00 45.72  ? 6   GLN A CD  1 
ATOM   45   O OE1 . GLN A 1 6   ? 20.209  44.354 26.590 1.00 47.19  ? 6   GLN A OE1 1 
ATOM   46   N NE2 . GLN A 1 6   ? 21.380  42.445 26.618 1.00 43.50  ? 6   GLN A NE2 1 
ATOM   47   N N   . THR A 1 7   ? 22.593  40.481 31.238 1.00 43.46  ? 7   THR A N   1 
ATOM   48   C CA  . THR A 1 7   ? 23.736  39.934 31.964 1.00 44.40  ? 7   THR A CA  1 
ATOM   49   C C   . THR A 1 7   ? 24.519  38.963 31.081 1.00 46.68  ? 7   THR A C   1 
ATOM   50   O O   . THR A 1 7   ? 23.912  38.171 30.344 1.00 48.71  ? 7   THR A O   1 
ATOM   51   C CB  . THR A 1 7   ? 23.227  39.175 33.186 1.00 45.87  ? 7   THR A CB  1 
ATOM   52   O OG1 . THR A 1 7   ? 22.828  40.114 34.176 1.00 54.65  ? 7   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 7   ? 24.275  38.247 33.746 1.00 56.14  ? 7   THR A CG2 1 
ATOM   54   N N   . PRO A 1 8   ? 25.871  39.017 31.138 1.00 44.69  ? 8   PRO A N   1 
ATOM   55   C CA  . PRO A 1 8   ? 26.627  39.990 31.945 1.00 43.53  ? 8   PRO A CA  1 
ATOM   56   C C   . PRO A 1 8   ? 26.732  41.314 31.220 1.00 43.23  ? 8   PRO A C   1 
ATOM   57   O O   . PRO A 1 8   ? 26.327  41.402 30.066 1.00 46.05  ? 8   PRO A O   1 
ATOM   58   C CB  . PRO A 1 8   ? 27.996  39.310 32.096 1.00 41.37  ? 8   PRO A CB  1 
ATOM   59   C CG  . PRO A 1 8   ? 28.105  38.454 30.885 1.00 39.90  ? 8   PRO A CG  1 
ATOM   60   C CD  . PRO A 1 8   ? 26.728  37.884 30.758 1.00 38.26  ? 8   PRO A CD  1 
ATOM   61   N N   . SER A 1 9   ? 27.244  42.347 31.880 1.00 43.97  ? 9   SER A N   1 
ATOM   62   C CA  . SER A 1 9   ? 27.387  43.658 31.233 1.00 42.56  ? 9   SER A CA  1 
ATOM   63   C C   . SER A 1 9   ? 28.528  43.624 30.202 1.00 39.94  ? 9   SER A C   1 
ATOM   64   O O   . SER A 1 9   ? 28.684  44.539 29.377 1.00 36.99  ? 9   SER A O   1 
ATOM   65   C CB  . SER A 1 9   ? 27.666  44.741 32.279 1.00 41.45  ? 9   SER A CB  1 
ATOM   66   O OG  . SER A 1 9   ? 29.024  44.725 32.703 1.00 51.44  ? 9   SER A OG  1 
ATOM   67   N N   . SER A 1 10  ? 29.310  42.551 30.263 1.00 37.74  ? 10  SER A N   1 
ATOM   68   C CA  . SER A 1 10  ? 30.451  42.375 29.400 1.00 41.45  ? 10  SER A CA  1 
ATOM   69   C C   . SER A 1 10  ? 31.159  41.041 29.644 1.00 42.15  ? 10  SER A C   1 
ATOM   70   O O   . SER A 1 10  ? 31.305  40.598 30.788 1.00 37.57  ? 10  SER A O   1 
ATOM   71   C CB  . SER A 1 10  ? 31.448  43.518 29.659 1.00 47.69  ? 10  SER A CB  1 
ATOM   72   O OG  . SER A 1 10  ? 31.805  43.616 31.044 1.00 48.06  ? 10  SER A OG  1 
ATOM   73   N N   . LEU A 1 11  ? 31.652  40.438 28.569 1.00 43.70  ? 11  LEU A N   1 
ATOM   74   C CA  . LEU A 1 11  ? 32.383  39.182 28.669 1.00 44.59  ? 11  LEU A CA  1 
ATOM   75   C C   . LEU A 1 11  ? 33.353  39.092 27.518 1.00 43.67  ? 11  LEU A C   1 
ATOM   76   O O   . LEU A 1 11  ? 33.195  39.784 26.493 1.00 40.10  ? 11  LEU A O   1 
ATOM   77   C CB  . LEU A 1 11  ? 31.456  37.956 28.667 1.00 48.90  ? 11  LEU A CB  1 
ATOM   78   C CG  . LEU A 1 11  ? 30.692  37.467 27.431 1.00 43.77  ? 11  LEU A CG  1 
ATOM   79   C CD1 . LEU A 1 11  ? 30.078  36.120 27.779 1.00 46.16  ? 11  LEU A CD1 1 
ATOM   80   C CD2 . LEU A 1 11  ? 29.608  38.458 27.028 1.00 40.44  ? 11  LEU A CD2 1 
ATOM   81   N N   . ALA A 1 12  ? 34.363  38.254 27.717 1.00 39.79  ? 12  ALA A N   1 
ATOM   82   C CA  . ALA A 1 12  ? 35.392  38.045 26.736 1.00 39.50  ? 12  ALA A CA  1 
ATOM   83   C C   . ALA A 1 12  ? 35.347  36.590 26.412 1.00 44.46  ? 12  ALA A C   1 
ATOM   84   O O   . ALA A 1 12  ? 35.429  35.745 27.312 1.00 45.64  ? 12  ALA A O   1 
ATOM   85   C CB  . ALA A 1 12  ? 36.738  38.406 27.295 1.00 34.83  ? 12  ALA A CB  1 
ATOM   86   N N   . MET A 1 13  ? 35.085  36.312 25.138 1.00 50.50  ? 13  MET A N   1 
ATOM   87   C CA  . MET A 1 13  ? 35.027  34.953 24.626 1.00 52.37  ? 13  MET A CA  1 
ATOM   88   C C   . MET A 1 13  ? 36.075  34.834 23.546 1.00 51.65  ? 13  MET A C   1 
ATOM   89   O O   . MET A 1 13  ? 36.741  35.810 23.179 1.00 47.12  ? 13  MET A O   1 
ATOM   90   C CB  . MET A 1 13  ? 33.647  34.625 24.064 1.00 52.47  ? 13  MET A CB  1 
ATOM   91   C CG  . MET A 1 13  ? 32.575  34.542 25.128 1.00 54.23  ? 13  MET A CG  1 
ATOM   92   S SD  . MET A 1 13  ? 32.570  32.990 26.037 1.00 54.96  ? 13  MET A SD  1 
ATOM   93   C CE  . MET A 1 13  ? 30.762  32.989 26.547 1.00 57.07  ? 13  MET A CE  1 
ATOM   94   N N   . SER A 1 14  ? 36.176  33.639 23.004 1.00 51.92  ? 14  SER A N   1 
ATOM   95   C CA  . SER A 1 14  ? 37.160  33.366 21.993 1.00 52.02  ? 14  SER A CA  1 
ATOM   96   C C   . SER A 1 14  ? 36.462  32.653 20.828 1.00 51.18  ? 14  SER A C   1 
ATOM   97   O O   . SER A 1 14  ? 35.461  31.952 21.022 1.00 51.12  ? 14  SER A O   1 
ATOM   98   C CB  . SER A 1 14  ? 38.257  32.508 22.624 1.00 43.30  ? 14  SER A CB  1 
ATOM   99   O OG  . SER A 1 14  ? 39.411  32.483 21.818 1.00 52.76  ? 14  SER A OG  1 
ATOM   100  N N   . VAL A 1 15  ? 36.955  32.884 19.619 1.00 45.69  ? 15  VAL A N   1 
ATOM   101  C CA  . VAL A 1 15  ? 36.385  32.276 18.424 1.00 47.37  ? 15  VAL A CA  1 
ATOM   102  C C   . VAL A 1 15  ? 36.076  30.788 18.544 1.00 44.76  ? 15  VAL A C   1 
ATOM   103  O O   . VAL A 1 15  ? 36.901  30.016 19.027 1.00 48.20  ? 15  VAL A O   1 
ATOM   104  C CB  . VAL A 1 15  ? 37.323  32.489 17.211 1.00 50.55  ? 15  VAL A CB  1 
ATOM   105  C CG1 . VAL A 1 15  ? 36.862  31.655 16.016 1.00 47.30  ? 15  VAL A CG1 1 
ATOM   106  C CG2 . VAL A 1 15  ? 37.368  33.971 16.848 1.00 49.02  ? 15  VAL A CG2 1 
ATOM   107  N N   . GLY A 1 16  ? 34.881  30.408 18.103 1.00 41.64  ? 16  GLY A N   1 
ATOM   108  C CA  . GLY A 1 16  ? 34.442  29.022 18.119 1.00 47.46  ? 16  GLY A CA  1 
ATOM   109  C C   . GLY A 1 16  ? 33.702  28.509 19.352 1.00 49.76  ? 16  GLY A C   1 
ATOM   110  O O   . GLY A 1 16  ? 33.211  27.364 19.345 1.00 47.33  ? 16  GLY A O   1 
ATOM   111  N N   . GLN A 1 17  ? 33.606  29.349 20.390 1.00 48.20  ? 17  GLN A N   1 
ATOM   112  C CA  . GLN A 1 17  ? 32.967  28.987 21.654 1.00 42.49  ? 17  GLN A CA  1 
ATOM   113  C C   . GLN A 1 17  ? 31.495  29.354 21.719 1.00 44.70  ? 17  GLN A C   1 
ATOM   114  O O   . GLN A 1 17  ? 31.035  30.215 20.971 1.00 45.34  ? 17  GLN A O   1 
ATOM   115  C CB  . GLN A 1 17  ? 33.714  29.641 22.808 1.00 38.04  ? 17  GLN A CB  1 
ATOM   116  C CG  . GLN A 1 17  ? 35.195  29.287 22.849 1.00 46.87  ? 17  GLN A CG  1 
ATOM   117  C CD  . GLN A 1 17  ? 35.964  30.060 23.912 1.00 49.75  ? 17  GLN A CD  1 
ATOM   118  O OE1 . GLN A 1 17  ? 35.597  31.178 24.282 1.00 56.69  ? 17  GLN A OE1 1 
ATOM   119  N NE2 . GLN A 1 17  ? 37.037  29.466 24.407 1.00 51.18  ? 17  GLN A NE2 1 
ATOM   120  N N   . LYS A 1 18  ? 30.743  28.631 22.544 1.00 46.65  ? 18  LYS A N   1 
ATOM   121  C CA  . LYS A 1 18  ? 29.318  28.896 22.734 1.00 49.72  ? 18  LYS A CA  1 
ATOM   122  C C   . LYS A 1 18  ? 29.218  30.103 23.662 1.00 49.03  ? 18  LYS A C   1 
ATOM   123  O O   . LYS A 1 18  ? 29.835  30.149 24.722 1.00 47.81  ? 18  LYS A O   1 
ATOM   124  C CB  . LYS A 1 18  ? 28.641  27.692 23.381 1.00 59.45  ? 18  LYS A CB  1 
ATOM   125  C CG  . LYS A 1 18  ? 27.102  27.714 23.393 1.00 66.34  ? 18  LYS A CG  1 
ATOM   126  C CD  . LYS A 1 18  ? 26.547  26.507 24.191 1.00 66.73  ? 18  LYS A CD  1 
ATOM   127  C CE  . LYS A 1 18  ? 25.064  26.276 23.942 1.00 62.99  ? 18  LYS A CE  1 
ATOM   128  N NZ  . LYS A 1 18  ? 24.427  25.518 25.053 1.00 58.12  ? 18  LYS A NZ  1 
ATOM   129  N N   . VAL A 1 19  ? 28.447  31.092 23.255 1.00 49.06  ? 19  VAL A N   1 
ATOM   130  C CA  . VAL A 1 19  ? 28.316  32.296 24.040 1.00 47.23  ? 19  VAL A CA  1 
ATOM   131  C C   . VAL A 1 19  ? 26.918  32.394 24.601 1.00 50.10  ? 19  VAL A C   1 
ATOM   132  O O   . VAL A 1 19  ? 25.918  32.271 23.872 1.00 47.56  ? 19  VAL A O   1 
ATOM   133  C CB  . VAL A 1 19  ? 28.661  33.550 23.174 1.00 45.93  ? 19  VAL A CB  1 
ATOM   134  C CG1 . VAL A 1 19  ? 28.248  34.833 23.862 1.00 43.11  ? 19  VAL A CG1 1 
ATOM   135  C CG2 . VAL A 1 19  ? 30.148  33.580 22.894 1.00 40.83  ? 19  VAL A CG2 1 
ATOM   136  N N   . THR A 1 20  ? 26.839  32.624 25.903 1.00 49.29  ? 20  THR A N   1 
ATOM   137  C CA  . THR A 1 20  ? 25.536  32.749 26.504 1.00 48.55  ? 20  THR A CA  1 
ATOM   138  C C   . THR A 1 20  ? 25.297  34.029 27.256 1.00 46.51  ? 20  THR A C   1 
ATOM   139  O O   . THR A 1 20  ? 25.997  34.340 28.211 1.00 48.90  ? 20  THR A O   1 
ATOM   140  C CB  . THR A 1 20  ? 25.235  31.585 27.416 1.00 49.86  ? 20  THR A CB  1 
ATOM   141  O OG1 . THR A 1 20  ? 25.237  30.377 26.644 1.00 54.06  ? 20  THR A OG1 1 
ATOM   142  C CG2 . THR A 1 20  ? 23.867  31.774 28.044 1.00 48.73  ? 20  THR A CG2 1 
ATOM   143  N N   . MET A 1 21  ? 24.276  34.754 26.835 1.00 43.09  ? 21  MET A N   1 
ATOM   144  C CA  . MET A 1 21  ? 23.945  35.985 27.490 1.00 42.55  ? 21  MET A CA  1 
ATOM   145  C C   . MET A 1 21  ? 22.474  36.019 27.804 1.00 44.32  ? 21  MET A C   1 
ATOM   146  O O   . MET A 1 21  ? 21.631  35.627 26.995 1.00 42.56  ? 21  MET A O   1 
ATOM   147  C CB  . MET A 1 21  ? 24.425  37.201 26.705 1.00 40.66  ? 21  MET A CB  1 
ATOM   148  C CG  . MET A 1 21  ? 23.945  37.323 25.303 1.00 43.78  ? 21  MET A CG  1 
ATOM   149  S SD  . MET A 1 21  ? 24.981  38.504 24.398 1.00 47.97  ? 21  MET A SD  1 
ATOM   150  C CE  . MET A 1 21  ? 26.067  37.405 23.614 1.00 35.46  ? 21  MET A CE  1 
ATOM   151  N N   . SER A 1 22  ? 22.202  36.444 29.028 1.00 45.97  ? 22  SER A N   1 
ATOM   152  C CA  . SER A 1 22  ? 20.874  36.500 29.596 1.00 48.39  ? 22  SER A CA  1 
ATOM   153  C C   . SER A 1 22  ? 20.193  37.869 29.574 1.00 45.36  ? 22  SER A C   1 
ATOM   154  O O   . SER A 1 22  ? 20.868  38.892 29.574 1.00 47.63  ? 22  SER A O   1 
ATOM   155  C CB  . SER A 1 22  ? 20.994  35.999 31.039 1.00 50.48  ? 22  SER A CB  1 
ATOM   156  O OG  . SER A 1 22  ? 19.923  36.434 31.862 1.00 69.08  ? 22  SER A OG  1 
ATOM   157  N N   . CYS A 1 23  ? 18.859  37.864 29.595 1.00 39.60  ? 23  CYS A N   1 
ATOM   158  C CA  . CYS A 1 23  ? 18.031  39.076 29.642 1.00 40.01  ? 23  CYS A CA  1 
ATOM   159  C C   . CYS A 1 23  ? 16.800  38.751 30.516 1.00 44.93  ? 23  CYS A C   1 
ATOM   160  O O   . CYS A 1 23  ? 16.171  37.708 30.319 1.00 49.37  ? 23  CYS A O   1 
ATOM   161  C CB  . CYS A 1 23  ? 17.603  39.486 28.243 1.00 34.20  ? 23  CYS A CB  1 
ATOM   162  S SG  . CYS A 1 23  ? 16.214  40.668 28.178 1.00 46.86  ? 23  CYS A SG  1 
ATOM   163  N N   . LYS A 1 24  ? 16.487  39.591 31.509 1.00 45.16  ? 24  LYS A N   1 
ATOM   164  C CA  . LYS A 1 24  ? 15.344  39.342 32.406 1.00 46.32  ? 24  LYS A CA  1 
ATOM   165  C C   . LYS A 1 24  ? 14.424  40.530 32.586 1.00 44.55  ? 24  LYS A C   1 
ATOM   166  O O   . LYS A 1 24  ? 14.894  41.653 32.712 1.00 50.13  ? 24  LYS A O   1 
ATOM   167  C CB  . LYS A 1 24  ? 15.817  38.904 33.801 1.00 47.66  ? 24  LYS A CB  1 
ATOM   168  C CG  . LYS A 1 24  ? 16.821  37.775 33.746 1.00 61.33  ? 24  LYS A CG  1 
ATOM   169  C CD  . LYS A 1 24  ? 16.775  36.847 34.956 1.00 62.85  ? 24  LYS A CD  1 
ATOM   170  C CE  . LYS A 1 24  ? 17.694  35.629 34.705 1.00 64.54  ? 24  LYS A CE  1 
ATOM   171  N NZ  . LYS A 1 24  ? 17.628  34.529 35.729 1.00 60.04  ? 24  LYS A NZ  1 
ATOM   172  N N   . SER A 1 25  ? 13.118  40.282 32.630 1.00 44.04  ? 25  SER A N   1 
ATOM   173  C CA  . SER A 1 25  ? 12.135  41.348 32.844 1.00 44.23  ? 25  SER A CA  1 
ATOM   174  C C   . SER A 1 25  ? 11.575  41.288 34.253 1.00 45.13  ? 25  SER A C   1 
ATOM   175  O O   . SER A 1 25  ? 11.531  40.222 34.878 1.00 42.25  ? 25  SER A O   1 
ATOM   176  C CB  . SER A 1 25  ? 10.969  41.251 31.860 1.00 43.50  ? 25  SER A CB  1 
ATOM   177  O OG  . SER A 1 25  ? 10.345  39.981 31.929 1.00 50.39  ? 25  SER A OG  1 
ATOM   178  N N   . SER A 1 26  ? 11.131  42.434 34.753 1.00 48.79  ? 26  SER A N   1 
ATOM   179  C CA  . SER A 1 26  ? 10.551  42.484 36.089 1.00 51.70  ? 26  SER A CA  1 
ATOM   180  C C   . SER A 1 26  ? 9.145   41.848 36.094 1.00 53.92  ? 26  SER A C   1 
ATOM   181  O O   . SER A 1 26  ? 8.632   41.460 37.138 1.00 54.81  ? 26  SER A O   1 
ATOM   182  C CB  . SER A 1 26  ? 10.482  43.936 36.585 1.00 46.01  ? 26  SER A CB  1 
ATOM   183  O OG  . SER A 1 26  ? 9.645   44.741 35.762 1.00 36.23  ? 26  SER A OG  1 
ATOM   184  N N   . GLN A 1 27  ? 8.539   41.743 34.913 1.00 55.87  ? 27  GLN A N   1 
ATOM   185  C CA  . GLN A 1 27  ? 7.196   41.189 34.756 1.00 58.85  ? 27  GLN A CA  1 
ATOM   186  C C   . GLN A 1 27  ? 7.191   40.182 33.611 1.00 59.58  ? 27  GLN A C   1 
ATOM   187  O O   . GLN A 1 27  ? 8.094   40.191 32.780 1.00 63.35  ? 27  GLN A O   1 
ATOM   188  C CB  . GLN A 1 27  ? 6.227   42.310 34.418 1.00 63.36  ? 27  GLN A CB  1 
ATOM   189  C CG  . GLN A 1 27  ? 6.269   43.467 35.381 1.00 73.62  ? 27  GLN A CG  1 
ATOM   190  C CD  . GLN A 1 27  ? 5.295   43.282 36.520 1.00 80.66  ? 27  GLN A CD  1 
ATOM   191  O OE1 . GLN A 1 27  ? 4.097   43.467 36.340 1.00 88.55  ? 27  GLN A OE1 1 
ATOM   192  N NE2 . GLN A 1 27  ? 5.796   42.904 37.687 1.00 81.43  ? 27  GLN A NE2 1 
ATOM   193  N N   . SER A 1 28  A 6.189   39.311 33.563 1.00 54.26  ? 27  SER A N   1 
ATOM   194  C CA  . SER A 1 28  A 6.133   38.332 32.489 1.00 47.41  ? 27  SER A CA  1 
ATOM   195  C C   . SER A 1 28  A 5.753   39.021 31.195 1.00 43.96  ? 27  SER A C   1 
ATOM   196  O O   . SER A 1 28  A 4.821   39.840 31.176 1.00 38.75  ? 27  SER A O   1 
ATOM   197  C CB  . SER A 1 28  A 5.135   37.221 32.799 1.00 48.03  ? 27  SER A CB  1 
ATOM   198  O OG  . SER A 1 28  A 5.052   36.304 31.716 1.00 48.00  ? 27  SER A OG  1 
ATOM   199  N N   . LEU A 1 29  B 6.454   38.653 30.120 1.00 42.09  ? 27  LEU A N   1 
ATOM   200  C CA  . LEU A 1 29  B 6.233   39.224 28.790 1.00 46.07  ? 27  LEU A CA  1 
ATOM   201  C C   . LEU A 1 29  B 5.439   38.312 27.869 1.00 46.11  ? 27  LEU A C   1 
ATOM   202  O O   . LEU A 1 29  B 5.403   38.531 26.654 1.00 36.38  ? 27  LEU A O   1 
ATOM   203  C CB  . LEU A 1 29  B 7.567   39.506 28.101 1.00 46.44  ? 27  LEU A CB  1 
ATOM   204  C CG  . LEU A 1 29  B 8.689   40.275 28.786 1.00 44.19  ? 27  LEU A CG  1 
ATOM   205  C CD1 . LEU A 1 29  B 9.866   40.253 27.851 1.00 50.04  ? 27  LEU A CD1 1 
ATOM   206  C CD2 . LEU A 1 29  B 8.285   41.694 29.108 1.00 36.22  ? 27  LEU A CD2 1 
ATOM   207  N N   . LEU A 1 30  C 4.828   37.285 28.454 1.00 52.14  ? 27  LEU A N   1 
ATOM   208  C CA  . LEU A 1 30  C 4.037   36.295 27.721 1.00 52.38  ? 27  LEU A CA  1 
ATOM   209  C C   . LEU A 1 30  C 2.571   36.672 27.581 1.00 52.54  ? 27  LEU A C   1 
ATOM   210  O O   . LEU A 1 30  C 1.849   36.810 28.586 1.00 47.88  ? 27  LEU A O   1 
ATOM   211  C CB  . LEU A 1 30  C 4.144   34.945 28.417 1.00 48.12  ? 27  LEU A CB  1 
ATOM   212  C CG  . LEU A 1 30  C 3.293   33.785 27.913 1.00 47.88  ? 27  LEU A CG  1 
ATOM   213  C CD1 . LEU A 1 30  C 3.668   33.395 26.491 1.00 44.08  ? 27  LEU A CD1 1 
ATOM   214  C CD2 . LEU A 1 30  C 3.541   32.625 28.859 1.00 50.71  ? 27  LEU A CD2 1 
ATOM   215  N N   . ASN A 1 31  D 2.126   36.851 26.343 1.00 52.81  ? 27  ASN A N   1 
ATOM   216  C CA  . ASN A 1 31  D 0.730   37.172 26.167 1.00 62.90  ? 27  ASN A CA  1 
ATOM   217  C C   . ASN A 1 31  D -0.150  35.930 26.182 1.00 67.46  ? 27  ASN A C   1 
ATOM   218  O O   . ASN A 1 31  D -0.166  35.114 25.246 1.00 64.47  ? 27  ASN A O   1 
ATOM   219  C CB  . ASN A 1 31  D 0.446   37.999 24.925 1.00 66.63  ? 27  ASN A CB  1 
ATOM   220  C CG  . ASN A 1 31  D -1.023  38.368 24.822 1.00 73.02  ? 27  ASN A CG  1 
ATOM   221  O OD1 . ASN A 1 31  D -1.708  38.568 25.835 1.00 67.13  ? 27  ASN A OD1 1 
ATOM   222  N ND2 . ASN A 1 31  D -1.540  38.392 23.608 1.00 81.81  ? 27  ASN A ND2 1 
ATOM   223  N N   . ILE A 1 32  E -0.784  35.758 27.329 1.00 72.30  ? 27  ILE A N   1 
ATOM   224  C CA  . ILE A 1 32  E -1.730  34.686 27.613 1.00 71.10  ? 27  ILE A CA  1 
ATOM   225  C C   . ILE A 1 32  E -2.881  35.008 26.664 1.00 69.83  ? 27  ILE A C   1 
ATOM   226  O O   . ILE A 1 32  E -3.786  35.771 27.007 1.00 73.91  ? 27  ILE A O   1 
ATOM   227  C CB  . ILE A 1 32  E -2.207  34.830 29.075 1.00 72.53  ? 27  ILE A CB  1 
ATOM   228  C CG1 . ILE A 1 32  E -2.616  36.300 29.348 1.00 71.56  ? 27  ILE A CG1 1 
ATOM   229  C CG2 . ILE A 1 32  E -1.074  34.441 30.013 1.00 70.86  ? 27  ILE A CG2 1 
ATOM   230  C CD1 . ILE A 1 32  E -3.414  36.567 30.602 1.00 66.33  ? 27  ILE A CD1 1 
ATOM   231  N N   . SER A 1 33  F -2.791  34.521 25.437 1.00 62.46  ? 27  SER A N   1 
ATOM   232  C CA  . SER A 1 33  F -3.812  34.828 24.454 1.00 58.79  ? 27  SER A CA  1 
ATOM   233  C C   . SER A 1 33  F -3.311  34.244 23.148 1.00 59.28  ? 27  SER A C   1 
ATOM   234  O O   . SER A 1 33  F -4.059  33.597 22.420 1.00 62.68  ? 27  SER A O   1 
ATOM   235  C CB  . SER A 1 33  F -3.956  36.359 24.351 1.00 56.53  ? 27  SER A CB  1 
ATOM   236  O OG  . SER A 1 33  F -4.973  36.767 23.468 1.00 57.47  ? 27  SER A OG  1 
ATOM   237  N N   . ASN A 1 34  ? -2.032  34.454 22.859 1.00 57.92  ? 28  ASN A N   1 
ATOM   238  C CA  . ASN A 1 34  ? -1.436  33.913 21.643 1.00 59.56  ? 28  ASN A CA  1 
ATOM   239  C C   . ASN A 1 34  ? -0.214  33.089 22.010 1.00 59.70  ? 28  ASN A C   1 
ATOM   240  O O   . ASN A 1 34  ? 0.436   32.506 21.137 1.00 60.24  ? 28  ASN A O   1 
ATOM   241  C CB  . ASN A 1 34  ? -1.056  35.033 20.665 1.00 62.45  ? 28  ASN A CB  1 
ATOM   242  C CG  . ASN A 1 34  ? 0.029   35.949 21.201 1.00 68.55  ? 28  ASN A CG  1 
ATOM   243  O OD1 . ASN A 1 34  ? 0.168   36.141 22.416 1.00 70.44  ? 28  ASN A OD1 1 
ATOM   244  N ND2 . ASN A 1 34  ? 0.803   36.525 20.296 1.00 66.67  ? 28  ASN A ND2 1 
ATOM   245  N N   . GLN A 1 35  ? 0.072   33.047 23.314 1.00 57.86  ? 29  GLN A N   1 
ATOM   246  C CA  . GLN A 1 35  ? 1.196   32.307 23.901 1.00 58.33  ? 29  GLN A CA  1 
ATOM   247  C C   . GLN A 1 35  ? 2.572   32.677 23.359 1.00 59.49  ? 29  GLN A C   1 
ATOM   248  O O   . GLN A 1 35  ? 3.510   31.869 23.439 1.00 56.14  ? 29  GLN A O   1 
ATOM   249  C CB  . GLN A 1 35  ? 0.977   30.781 23.823 1.00 55.66  ? 29  GLN A CB  1 
ATOM   250  C CG  . GLN A 1 35  ? -0.110  30.242 24.764 1.00 54.05  ? 29  GLN A CG  1 
ATOM   251  C CD  . GLN A 1 35  ? 0.196   30.430 26.255 1.00 56.54  ? 29  GLN A CD  1 
ATOM   252  O OE1 . GLN A 1 35  ? 1.088   29.769 26.804 1.00 55.00  ? 29  GLN A OE1 1 
ATOM   253  N NE2 . GLN A 1 35  ? -0.552  31.315 26.916 1.00 43.93  ? 29  GLN A NE2 1 
ATOM   254  N N   . LYS A 1 36  ? 2.692   33.894 22.823 1.00 58.47  ? 30  LYS A N   1 
ATOM   255  C CA  . LYS A 1 36  ? 3.962   34.390 22.285 1.00 56.26  ? 30  LYS A CA  1 
ATOM   256  C C   . LYS A 1 36  ? 4.646   35.255 23.355 1.00 52.50  ? 30  LYS A C   1 
ATOM   257  O O   . LYS A 1 36  ? 3.963   35.979 24.093 1.00 53.07  ? 30  LYS A O   1 
ATOM   258  C CB  . LYS A 1 36  ? 3.721   35.266 21.052 1.00 55.08  ? 30  LYS A CB  1 
ATOM   259  C CG  . LYS A 1 36  ? 3.125   34.604 19.825 1.00 55.88  ? 30  LYS A CG  1 
ATOM   260  C CD  . LYS A 1 36  ? 3.059   35.662 18.728 1.00 60.48  ? 30  LYS A CD  1 
ATOM   261  C CE  . LYS A 1 36  ? 2.350   35.218 17.458 1.00 61.86  ? 30  LYS A CE  1 
ATOM   262  N NZ  . LYS A 1 36  ? 2.158   36.405 16.548 1.00 63.18  ? 30  LYS A NZ  1 
ATOM   263  N N   . ASN A 1 37  ? 5.965   35.146 23.487 1.00 49.51  ? 31  ASN A N   1 
ATOM   264  C CA  . ASN A 1 37  ? 6.695   35.983 24.451 1.00 50.16  ? 31  ASN A CA  1 
ATOM   265  C C   . ASN A 1 37  ? 7.182   37.215 23.678 1.00 47.77  ? 31  ASN A C   1 
ATOM   266  O O   . ASN A 1 37  ? 7.978   37.074 22.737 1.00 48.19  ? 31  ASN A O   1 
ATOM   267  C CB  . ASN A 1 37  ? 7.921   35.262 25.025 1.00 54.04  ? 31  ASN A CB  1 
ATOM   268  C CG  . ASN A 1 37  ? 7.560   34.101 25.930 1.00 55.71  ? 31  ASN A CG  1 
ATOM   269  O OD1 . ASN A 1 37  ? 7.279   34.284 27.120 1.00 52.93  ? 31  ASN A OD1 1 
ATOM   270  N ND2 . ASN A 1 37  ? 7.625   32.890 25.388 1.00 51.62  ? 31  ASN A ND2 1 
ATOM   271  N N   . TYR A 1 38  ? 6.711   38.408 24.048 1.00 40.81  ? 32  TYR A N   1 
ATOM   272  C CA  . TYR A 1 38  ? 7.116   39.627 23.352 1.00 43.23  ? 32  TYR A CA  1 
ATOM   273  C C   . TYR A 1 38  ? 8.489   40.209 23.792 1.00 42.38  ? 32  TYR A C   1 
ATOM   274  O O   . TYR A 1 38  ? 8.580   41.176 24.572 1.00 37.85  ? 32  TYR A O   1 
ATOM   275  C CB  . TYR A 1 38  ? 6.002   40.663 23.413 1.00 42.25  ? 32  TYR A CB  1 
ATOM   276  C CG  . TYR A 1 38  ? 4.850   40.383 22.472 1.00 46.11  ? 32  TYR A CG  1 
ATOM   277  C CD1 . TYR A 1 38  ? 3.831   39.489 22.817 1.00 57.24  ? 32  TYR A CD1 1 
ATOM   278  C CD2 . TYR A 1 38  ? 4.747   41.046 21.252 1.00 51.82  ? 32  TYR A CD2 1 
ATOM   279  C CE1 . TYR A 1 38  ? 2.719   39.267 21.961 1.00 60.52  ? 32  TYR A CE1 1 
ATOM   280  C CE2 . TYR A 1 38  ? 3.639   40.837 20.390 1.00 57.81  ? 32  TYR A CE2 1 
ATOM   281  C CZ  . TYR A 1 38  ? 2.632   39.947 20.750 1.00 59.88  ? 32  TYR A CZ  1 
ATOM   282  O OH  . TYR A 1 38  ? 1.545   39.750 19.912 1.00 55.54  ? 32  TYR A OH  1 
ATOM   283  N N   . LEU A 1 39  ? 9.545   39.615 23.241 1.00 38.27  ? 33  LEU A N   1 
ATOM   284  C CA  . LEU A 1 39  ? 10.910  39.994 23.535 1.00 36.56  ? 33  LEU A CA  1 
ATOM   285  C C   . LEU A 1 39  ? 11.756  39.863 22.271 1.00 39.27  ? 33  LEU A C   1 
ATOM   286  O O   . LEU A 1 39  ? 11.703  38.838 21.589 1.00 36.16  ? 33  LEU A O   1 
ATOM   287  C CB  . LEU A 1 39  ? 11.488  39.083 24.613 1.00 27.86  ? 33  LEU A CB  1 
ATOM   288  C CG  . LEU A 1 39  ? 12.952  39.425 24.913 1.00 32.91  ? 33  LEU A CG  1 
ATOM   289  C CD1 . LEU A 1 39  ? 13.008  40.250 26.177 1.00 30.12  ? 33  LEU A CD1 1 
ATOM   290  C CD2 . LEU A 1 39  ? 13.824  38.175 25.021 1.00 30.92  ? 33  LEU A CD2 1 
ATOM   291  N N   . ALA A 1 40  ? 12.542  40.897 21.973 1.00 41.37  ? 34  ALA A N   1 
ATOM   292  C CA  . ALA A 1 40  ? 13.407  40.909 20.794 1.00 36.63  ? 34  ALA A CA  1 
ATOM   293  C C   . ALA A 1 40  ? 14.872  41.091 21.194 1.00 37.31  ? 34  ALA A C   1 
ATOM   294  O O   . ALA A 1 40  ? 15.167  41.604 22.273 1.00 38.94  ? 34  ALA A O   1 
ATOM   295  C CB  . ALA A 1 40  ? 12.973  42.028 19.837 1.00 35.41  ? 34  ALA A CB  1 
ATOM   296  N N   . TRP A 1 41  ? 15.778  40.629 20.341 1.00 34.61  ? 35  TRP A N   1 
ATOM   297  C CA  . TRP A 1 41  ? 17.208  40.743 20.565 1.00 37.35  ? 35  TRP A CA  1 
ATOM   298  C C   . TRP A 1 41  ? 17.811  41.552 19.418 1.00 42.58  ? 35  TRP A C   1 
ATOM   299  O O   . TRP A 1 41  ? 17.349  41.453 18.276 1.00 38.72  ? 35  TRP A O   1 
ATOM   300  C CB  . TRP A 1 41  ? 17.873  39.374 20.630 1.00 33.91  ? 35  TRP A CB  1 
ATOM   301  C CG  . TRP A 1 41  ? 17.617  38.657 21.905 1.00 39.89  ? 35  TRP A CG  1 
ATOM   302  C CD1 . TRP A 1 41  ? 16.722  37.661 22.098 1.00 38.35  ? 35  TRP A CD1 1 
ATOM   303  C CD2 . TRP A 1 41  ? 18.345  38.785 23.142 1.00 41.86  ? 35  TRP A CD2 1 
ATOM   304  N NE1 . TRP A 1 41  ? 16.852  37.135 23.360 1.00 40.70  ? 35  TRP A NE1 1 
ATOM   305  C CE2 . TRP A 1 41  ? 17.846  37.802 24.021 1.00 41.40  ? 35  TRP A CE2 1 
ATOM   306  C CE3 . TRP A 1 41  ? 19.381  39.617 23.581 1.00 41.85  ? 35  TRP A CE3 1 
ATOM   307  C CZ2 . TRP A 1 41  ? 18.347  37.625 25.319 1.00 38.87  ? 35  TRP A CZ2 1 
ATOM   308  C CZ3 . TRP A 1 41  ? 19.882  39.438 24.883 1.00 41.18  ? 35  TRP A CZ3 1 
ATOM   309  C CH2 . TRP A 1 41  ? 19.362  38.446 25.727 1.00 38.15  ? 35  TRP A CH2 1 
ATOM   310  N N   . TYR A 1 42  ? 18.852  42.328 19.726 1.00 43.19  ? 36  TYR A N   1 
ATOM   311  C CA  . TYR A 1 42  ? 19.519  43.170 18.743 1.00 40.50  ? 36  TYR A CA  1 
ATOM   312  C C   . TYR A 1 42  ? 21.034  43.108 18.886 1.00 39.75  ? 36  TYR A C   1 
ATOM   313  O O   . TYR A 1 42  ? 21.569  42.765 19.944 1.00 41.98  ? 36  TYR A O   1 
ATOM   314  C CB  . TYR A 1 42  ? 19.050  44.628 18.875 1.00 42.32  ? 36  TYR A CB  1 
ATOM   315  C CG  . TYR A 1 42  ? 17.546  44.794 18.889 1.00 34.24  ? 36  TYR A CG  1 
ATOM   316  C CD1 . TYR A 1 42  ? 16.830  44.712 20.078 1.00 33.68  ? 36  TYR A CD1 1 
ATOM   317  C CD2 . TYR A 1 42  ? 16.844  45.026 17.715 1.00 37.57  ? 36  TYR A CD2 1 
ATOM   318  C CE1 . TYR A 1 42  ? 15.434  44.858 20.100 1.00 36.55  ? 36  TYR A CE1 1 
ATOM   319  C CE2 . TYR A 1 42  ? 15.454  45.168 17.716 1.00 41.47  ? 36  TYR A CE2 1 
ATOM   320  C CZ  . TYR A 1 42  ? 14.761  45.078 18.913 1.00 44.91  ? 36  TYR A CZ  1 
ATOM   321  O OH  . TYR A 1 42  ? 13.396  45.153 18.909 1.00 48.68  ? 36  TYR A OH  1 
ATOM   322  N N   . GLN A 1 43  ? 21.710  43.400 17.781 1.00 39.71  ? 37  GLN A N   1 
ATOM   323  C CA  . GLN A 1 43  ? 23.166  43.410 17.698 1.00 36.34  ? 37  GLN A CA  1 
ATOM   324  C C   . GLN A 1 43  ? 23.520  44.783 17.147 1.00 39.54  ? 37  GLN A C   1 
ATOM   325  O O   . GLN A 1 43  ? 22.848  45.305 16.236 1.00 38.27  ? 37  GLN A O   1 
ATOM   326  C CB  . GLN A 1 43  ? 23.669  42.330 16.732 1.00 33.57  ? 37  GLN A CB  1 
ATOM   327  C CG  . GLN A 1 43  ? 25.154  42.352 16.498 1.00 36.56  ? 37  GLN A CG  1 
ATOM   328  C CD  . GLN A 1 43  ? 25.635  41.255 15.566 1.00 41.70  ? 37  GLN A CD  1 
ATOM   329  O OE1 . GLN A 1 43  ? 25.260  41.196 14.401 1.00 45.79  ? 37  GLN A OE1 1 
ATOM   330  N NE2 . GLN A 1 43  ? 26.483  40.387 16.075 1.00 42.32  ? 37  GLN A NE2 1 
ATOM   331  N N   . GLN A 1 44  ? 24.506  45.411 17.764 1.00 38.63  ? 38  GLN A N   1 
ATOM   332  C CA  . GLN A 1 44  ? 24.954  46.717 17.333 1.00 40.07  ? 38  GLN A CA  1 
ATOM   333  C C   . GLN A 1 44  ? 26.474  46.697 17.212 1.00 43.52  ? 38  GLN A C   1 
ATOM   334  O O   . GLN A 1 44  ? 27.180  46.323 18.166 1.00 41.49  ? 38  GLN A O   1 
ATOM   335  C CB  . GLN A 1 44  ? 24.508  47.787 18.330 1.00 40.51  ? 38  GLN A CB  1 
ATOM   336  C CG  . GLN A 1 44  ? 24.733  49.212 17.844 1.00 40.91  ? 38  GLN A CG  1 
ATOM   337  C CD  . GLN A 1 44  ? 24.187  50.246 18.809 1.00 46.62  ? 38  GLN A CD  1 
ATOM   338  O OE1 . GLN A 1 44  ? 24.453  50.190 20.014 1.00 47.25  ? 38  GLN A OE1 1 
ATOM   339  N NE2 . GLN A 1 44  ? 23.415  51.196 18.289 1.00 42.36  ? 38  GLN A NE2 1 
ATOM   340  N N   . LYS A 1 45  ? 26.963  46.945 15.997 1.00 44.30  ? 39  LYS A N   1 
ATOM   341  C CA  . LYS A 1 45  ? 28.398  46.980 15.763 1.00 44.44  ? 39  LYS A CA  1 
ATOM   342  C C   . LYS A 1 45  ? 28.814  48.448 15.721 1.00 45.23  ? 39  LYS A C   1 
ATOM   343  O O   . LYS A 1 45  ? 27.967  49.331 15.577 1.00 48.85  ? 39  LYS A O   1 
ATOM   344  C CB  . LYS A 1 45  ? 28.772  46.222 14.484 1.00 46.48  ? 39  LYS A CB  1 
ATOM   345  C CG  . LYS A 1 45  ? 28.762  44.702 14.644 1.00 46.87  ? 39  LYS A CG  1 
ATOM   346  C CD  . LYS A 1 45  ? 29.048  44.005 13.316 1.00 57.01  ? 39  LYS A CD  1 
ATOM   347  C CE  . LYS A 1 45  ? 28.675  42.515 13.340 1.00 60.95  ? 39  LYS A CE  1 
ATOM   348  N NZ  . LYS A 1 45  ? 29.135  41.770 12.114 1.00 63.59  ? 39  LYS A NZ  1 
ATOM   349  N N   . PRO A 1 46  ? 30.118  48.736 15.894 1.00 50.18  ? 40  PRO A N   1 
ATOM   350  C CA  . PRO A 1 46  ? 30.648  50.106 15.885 1.00 49.06  ? 40  PRO A CA  1 
ATOM   351  C C   . PRO A 1 46  ? 30.077  51.079 14.842 1.00 46.04  ? 40  PRO A C   1 
ATOM   352  O O   . PRO A 1 46  ? 30.058  50.787 13.649 1.00 46.39  ? 40  PRO A O   1 
ATOM   353  C CB  . PRO A 1 46  ? 32.143  49.879 15.688 1.00 51.04  ? 40  PRO A CB  1 
ATOM   354  C CG  . PRO A 1 46  ? 32.376  48.617 16.488 1.00 50.88  ? 40  PRO A CG  1 
ATOM   355  C CD  . PRO A 1 46  ? 31.220  47.754 16.022 1.00 52.42  ? 40  PRO A CD  1 
ATOM   356  N N   . GLY A 1 47  ? 29.587  52.220 15.312 1.00 45.20  ? 41  GLY A N   1 
ATOM   357  C CA  . GLY A 1 47  ? 29.042  53.230 14.421 1.00 50.31  ? 41  GLY A CA  1 
ATOM   358  C C   . GLY A 1 47  ? 27.997  52.773 13.418 1.00 53.28  ? 41  GLY A C   1 
ATOM   359  O O   . GLY A 1 47  ? 27.957  53.276 12.293 1.00 51.91  ? 41  GLY A O   1 
ATOM   360  N N   . GLN A 1 48  ? 27.186  51.794 13.818 1.00 56.31  ? 42  GLN A N   1 
ATOM   361  C CA  . GLN A 1 48  ? 26.100  51.252 13.000 1.00 48.89  ? 42  GLN A CA  1 
ATOM   362  C C   . GLN A 1 48  ? 24.891  51.184 13.899 1.00 44.45  ? 42  GLN A C   1 
ATOM   363  O O   . GLN A 1 48  ? 25.028  51.061 15.112 1.00 37.21  ? 42  GLN A O   1 
ATOM   364  C CB  . GLN A 1 48  ? 26.406  49.840 12.539 1.00 50.59  ? 42  GLN A CB  1 
ATOM   365  C CG  . GLN A 1 48  ? 27.497  49.698 11.509 1.00 51.21  ? 42  GLN A CG  1 
ATOM   366  C CD  . GLN A 1 48  ? 27.649  48.250 11.076 1.00 55.69  ? 42  GLN A CD  1 
ATOM   367  O OE1 . GLN A 1 48  ? 26.994  47.358 11.625 1.00 56.94  ? 42  GLN A OE1 1 
ATOM   368  N NE2 . GLN A 1 48  ? 28.475  48.010 10.071 1.00 53.94  ? 42  GLN A NE2 1 
ATOM   369  N N   . SER A 1 49  ? 23.704  51.285 13.318 1.00 48.00  ? 43  SER A N   1 
ATOM   370  C CA  . SER A 1 49  ? 22.487  51.211 14.123 1.00 48.41  ? 43  SER A CA  1 
ATOM   371  C C   . SER A 1 49  ? 22.301  49.779 14.600 1.00 43.80  ? 43  SER A C   1 
ATOM   372  O O   . SER A 1 49  ? 23.023  48.857 14.164 1.00 41.51  ? 43  SER A O   1 
ATOM   373  C CB  . SER A 1 49  ? 21.244  51.676 13.332 1.00 53.40  ? 43  SER A CB  1 
ATOM   374  O OG  . SER A 1 49  ? 20.730  50.699 12.444 1.00 51.97  ? 43  SER A OG  1 
ATOM   375  N N   . PRO A 1 50  ? 21.432  49.590 15.598 1.00 39.11  ? 44  PRO A N   1 
ATOM   376  C CA  . PRO A 1 50  ? 21.242  48.219 16.055 1.00 40.58  ? 44  PRO A CA  1 
ATOM   377  C C   . PRO A 1 50  ? 20.430  47.490 14.977 1.00 44.06  ? 44  PRO A C   1 
ATOM   378  O O   . PRO A 1 50  ? 19.657  48.128 14.237 1.00 41.37  ? 44  PRO A O   1 
ATOM   379  C CB  . PRO A 1 50  ? 20.432  48.405 17.355 1.00 41.41  ? 44  PRO A CB  1 
ATOM   380  C CG  . PRO A 1 50  ? 20.716  49.823 17.782 1.00 30.45  ? 44  PRO A CG  1 
ATOM   381  C CD  . PRO A 1 50  ? 20.718  50.539 16.468 1.00 33.96  ? 44  PRO A CD  1 
ATOM   382  N N   . LYS A 1 51  ? 20.627  46.174 14.871 1.00 42.08  ? 45  LYS A N   1 
ATOM   383  C CA  . LYS A 1 51  ? 19.897  45.342 13.913 1.00 41.08  ? 45  LYS A CA  1 
ATOM   384  C C   . LYS A 1 51  ? 19.186  44.252 14.696 1.00 37.32  ? 45  LYS A C   1 
ATOM   385  O O   . LYS A 1 51  ? 19.744  43.725 15.658 1.00 34.01  ? 45  LYS A O   1 
ATOM   386  C CB  . LYS A 1 51  ? 20.872  44.662 12.930 1.00 50.09  ? 45  LYS A CB  1 
ATOM   387  C CG  . LYS A 1 51  ? 21.269  45.502 11.723 1.00 65.07  ? 45  LYS A CG  1 
ATOM   388  C CD  . LYS A 1 51  ? 22.290  46.599 12.073 1.00 73.30  ? 45  LYS A CD  1 
ATOM   389  C CE  . LYS A 1 51  ? 22.414  47.629 10.953 1.00 69.01  ? 45  LYS A CE  1 
ATOM   390  N NZ  . LYS A 1 51  ? 21.099  48.316 10.719 1.00 74.02  ? 45  LYS A NZ  1 
ATOM   391  N N   . LEU A 1 52  ? 17.978  43.883 14.276 1.00 36.22  ? 46  LEU A N   1 
ATOM   392  C CA  . LEU A 1 52  ? 17.233  42.810 14.956 1.00 37.01  ? 46  LEU A CA  1 
ATOM   393  C C   . LEU A 1 52  ? 17.827  41.427 14.651 1.00 36.81  ? 46  LEU A C   1 
ATOM   394  O O   . LEU A 1 52  ? 18.241  41.145 13.535 1.00 39.60  ? 46  LEU A O   1 
ATOM   395  C CB  . LEU A 1 52  ? 15.753  42.836 14.553 1.00 33.83  ? 46  LEU A CB  1 
ATOM   396  C CG  . LEU A 1 52  ? 14.826  41.753 15.132 1.00 38.15  ? 46  LEU A CG  1 
ATOM   397  C CD1 . LEU A 1 52  ? 14.517  42.074 16.558 1.00 36.18  ? 46  LEU A CD1 1 
ATOM   398  C CD2 . LEU A 1 52  ? 13.513  41.665 14.366 1.00 35.47  ? 46  LEU A CD2 1 
ATOM   399  N N   . LEU A 1 53  ? 17.911  40.574 15.659 1.00 39.25  ? 47  LEU A N   1 
ATOM   400  C CA  . LEU A 1 53  ? 18.427  39.233 15.451 1.00 39.45  ? 47  LEU A CA  1 
ATOM   401  C C   . LEU A 1 53  ? 17.292  38.233 15.677 1.00 39.81  ? 47  LEU A C   1 
ATOM   402  O O   . LEU A 1 53  ? 17.056  37.358 14.855 1.00 41.48  ? 47  LEU A O   1 
ATOM   403  C CB  . LEU A 1 53  ? 19.555  38.918 16.435 1.00 37.56  ? 47  LEU A CB  1 
ATOM   404  C CG  . LEU A 1 53  ? 20.890  39.656 16.401 1.00 37.75  ? 47  LEU A CG  1 
ATOM   405  C CD1 . LEU A 1 53  ? 21.596  39.437 17.724 1.00 33.90  ? 47  LEU A CD1 1 
ATOM   406  C CD2 . LEU A 1 53  ? 21.755  39.182 15.251 1.00 37.94  ? 47  LEU A CD2 1 
ATOM   407  N N   . VAL A 1 54  ? 16.529  38.436 16.743 1.00 35.49  ? 48  VAL A N   1 
ATOM   408  C CA  . VAL A 1 54  ? 15.465  37.511 17.116 1.00 36.49  ? 48  VAL A CA  1 
ATOM   409  C C   . VAL A 1 54  ? 14.231  38.182 17.740 1.00 39.59  ? 48  VAL A C   1 
ATOM   410  O O   . VAL A 1 54  ? 14.378  39.093 18.549 1.00 41.52  ? 48  VAL A O   1 
ATOM   411  C CB  . VAL A 1 54  ? 16.023  36.533 18.172 1.00 34.99  ? 48  VAL A CB  1 
ATOM   412  C CG1 . VAL A 1 54  ? 14.915  35.710 18.777 1.00 41.16  ? 48  VAL A CG1 1 
ATOM   413  C CG2 . VAL A 1 54  ? 17.119  35.634 17.560 1.00 34.05  ? 48  VAL A CG2 1 
ATOM   414  N N   . TYR A 1 55  ? 13.023  37.750 17.368 1.00 40.24  ? 49  TYR A N   1 
ATOM   415  C CA  . TYR A 1 55  ? 11.782  38.289 17.964 1.00 41.01  ? 49  TYR A CA  1 
ATOM   416  C C   . TYR A 1 55  ? 10.848  37.177 18.453 1.00 38.27  ? 49  TYR A C   1 
ATOM   417  O O   . TYR A 1 55  ? 10.997  36.004 18.072 1.00 39.04  ? 49  TYR A O   1 
ATOM   418  C CB  . TYR A 1 55  ? 11.041  39.271 17.046 1.00 40.81  ? 49  TYR A CB  1 
ATOM   419  C CG  . TYR A 1 55  ? 10.671  38.728 15.695 1.00 40.59  ? 49  TYR A CG  1 
ATOM   420  C CD1 . TYR A 1 55  ? 11.665  38.376 14.776 1.00 40.74  ? 49  TYR A CD1 1 
ATOM   421  C CD2 . TYR A 1 55  ? 9.328   38.577 15.324 1.00 38.44  ? 49  TYR A CD2 1 
ATOM   422  C CE1 . TYR A 1 55  ? 11.341  37.886 13.523 1.00 44.22  ? 49  TYR A CE1 1 
ATOM   423  C CE2 . TYR A 1 55  ? 8.978   38.088 14.062 1.00 37.03  ? 49  TYR A CE2 1 
ATOM   424  C CZ  . TYR A 1 55  ? 9.995   37.742 13.166 1.00 46.73  ? 49  TYR A CZ  1 
ATOM   425  O OH  . TYR A 1 55  ? 9.697   37.236 11.919 1.00 50.47  ? 49  TYR A OH  1 
ATOM   426  N N   . PHE A 1 56  ? 9.893   37.540 19.297 1.00 36.39  ? 50  PHE A N   1 
ATOM   427  C CA  . PHE A 1 56  ? 8.988   36.547 19.872 1.00 40.54  ? 50  PHE A CA  1 
ATOM   428  C C   . PHE A 1 56  ? 9.845   35.497 20.550 1.00 42.57  ? 50  PHE A C   1 
ATOM   429  O O   . PHE A 1 56  ? 9.574   34.305 20.445 1.00 50.45  ? 50  PHE A O   1 
ATOM   430  C CB  . PHE A 1 56  ? 8.098   35.905 18.805 1.00 41.29  ? 50  PHE A CB  1 
ATOM   431  C CG  . PHE A 1 56  ? 7.173   36.874 18.150 1.00 39.18  ? 50  PHE A CG  1 
ATOM   432  C CD1 . PHE A 1 56  ? 6.517   37.834 18.905 1.00 45.99  ? 50  PHE A CD1 1 
ATOM   433  C CD2 . PHE A 1 56  ? 6.984   36.863 16.787 1.00 45.22  ? 50  PHE A CD2 1 
ATOM   434  C CE1 . PHE A 1 56  ? 5.683   38.780 18.311 1.00 48.87  ? 50  PHE A CE1 1 
ATOM   435  C CE2 . PHE A 1 56  ? 6.150   37.806 16.182 1.00 51.69  ? 50  PHE A CE2 1 
ATOM   436  C CZ  . PHE A 1 56  ? 5.499   38.768 16.955 1.00 50.85  ? 50  PHE A CZ  1 
ATOM   437  N N   . ALA A 1 57  ? 10.963  35.960 21.106 1.00 40.99  ? 51  ALA A N   1 
ATOM   438  C CA  . ALA A 1 57  ? 11.935  35.152 21.845 1.00 38.37  ? 51  ALA A CA  1 
ATOM   439  C C   . ALA A 1 57  ? 12.796  34.131 21.113 1.00 42.75  ? 51  ALA A C   1 
ATOM   440  O O   . ALA A 1 57  ? 13.902  33.798 21.577 1.00 42.99  ? 51  ALA A O   1 
ATOM   441  C CB  . ALA A 1 57  ? 11.256  34.494 23.017 1.00 38.43  ? 51  ALA A CB  1 
ATOM   442  N N   . SER A 1 58  ? 12.328  33.655 19.966 1.00 45.77  ? 52  SER A N   1 
ATOM   443  C CA  . SER A 1 58  ? 13.075  32.636 19.250 1.00 45.85  ? 52  SER A CA  1 
ATOM   444  C C   . SER A 1 58  ? 13.075  32.790 17.745 1.00 47.18  ? 52  SER A C   1 
ATOM   445  O O   . SER A 1 58  ? 13.939  32.223 17.069 1.00 53.44  ? 52  SER A O   1 
ATOM   446  C CB  . SER A 1 58  ? 12.492  31.287 19.595 1.00 44.60  ? 52  SER A CB  1 
ATOM   447  O OG  . SER A 1 58  ? 11.120  31.309 19.238 1.00 46.95  ? 52  SER A OG  1 
ATOM   448  N N   . THR A 1 59  ? 12.123  33.545 17.211 1.00 44.16  ? 53  THR A N   1 
ATOM   449  C CA  . THR A 1 59  ? 12.033  33.748 15.761 1.00 41.50  ? 53  THR A CA  1 
ATOM   450  C C   . THR A 1 59  ? 13.199  34.578 15.178 1.00 41.19  ? 53  THR A C   1 
ATOM   451  O O   . THR A 1 59  ? 13.276  35.784 15.400 1.00 41.92  ? 53  THR A O   1 
ATOM   452  C CB  . THR A 1 59  ? 10.753  34.492 15.434 1.00 40.96  ? 53  THR A CB  1 
ATOM   453  O OG1 . THR A 1 59  ? 9.650   33.883 16.122 1.00 52.14  ? 53  THR A OG1 1 
ATOM   454  C CG2 . THR A 1 59  ? 10.520  34.497 13.951 1.00 34.73  ? 53  THR A CG2 1 
ATOM   455  N N   . ARG A 1 60  ? 14.119  33.947 14.456 1.00 41.05  ? 54  ARG A N   1 
ATOM   456  C CA  . ARG A 1 60  ? 15.227  34.694 13.867 1.00 38.78  ? 54  ARG A CA  1 
ATOM   457  C C   . ARG A 1 60  ? 14.720  35.629 12.782 1.00 41.64  ? 54  ARG A C   1 
ATOM   458  O O   . ARG A 1 60  ? 13.709  35.375 12.128 1.00 40.16  ? 54  ARG A O   1 
ATOM   459  C CB  . ARG A 1 60  ? 16.245  33.773 13.205 1.00 35.42  ? 54  ARG A CB  1 
ATOM   460  C CG  . ARG A 1 60  ? 17.107  32.980 14.110 1.00 40.90  ? 54  ARG A CG  1 
ATOM   461  C CD  . ARG A 1 60  ? 18.192  32.312 13.288 1.00 50.43  ? 54  ARG A CD  1 
ATOM   462  N NE  . ARG A 1 60  ? 18.686  31.092 13.925 1.00 65.37  ? 54  ARG A NE  1 
ATOM   463  C CZ  . ARG A 1 60  ? 18.011  29.945 13.960 1.00 69.80  ? 54  ARG A CZ  1 
ATOM   464  N NH1 . ARG A 1 60  ? 16.809  29.860 13.391 1.00 71.27  ? 54  ARG A NH1 1 
ATOM   465  N NH2 . ARG A 1 60  ? 18.525  28.889 14.579 1.00 69.22  ? 54  ARG A NH2 1 
ATOM   466  N N   . GLU A 1 61  ? 15.416  36.733 12.596 1.00 46.11  ? 55  GLU A N   1 
ATOM   467  C CA  . GLU A 1 61  ? 15.044  37.645 11.541 1.00 47.66  ? 55  GLU A CA  1 
ATOM   468  C C   . GLU A 1 61  ? 15.755  37.125 10.275 1.00 47.97  ? 55  GLU A C   1 
ATOM   469  O O   . GLU A 1 61  ? 16.628  36.252 10.345 1.00 48.72  ? 55  GLU A O   1 
ATOM   470  C CB  . GLU A 1 61  ? 15.491  39.071 11.895 1.00 41.10  ? 55  GLU A CB  1 
ATOM   471  C CG  . GLU A 1 61  ? 15.406  40.068 10.734 1.00 41.97  ? 55  GLU A CG  1 
ATOM   472  C CD  . GLU A 1 61  ? 13.982  40.459 10.326 1.00 46.55  ? 55  GLU A CD  1 
ATOM   473  O OE1 . GLU A 1 61  ? 13.243  39.646 9.729  1.00 52.42  ? 55  GLU A OE1 1 
ATOM   474  O OE2 . GLU A 1 61  ? 13.608  41.622 10.571 1.00 44.82  ? 55  GLU A OE2 1 
ATOM   475  N N   . SER A 1 62  ? 15.345  37.615 9.116  1.00 47.24  ? 56  SER A N   1 
ATOM   476  C CA  . SER A 1 62  ? 15.962  37.227 7.863  1.00 47.95  ? 56  SER A CA  1 
ATOM   477  C C   . SER A 1 62  ? 17.458  37.527 7.871  1.00 49.75  ? 56  SER A C   1 
ATOM   478  O O   . SER A 1 62  ? 17.923  38.499 8.499  1.00 48.88  ? 56  SER A O   1 
ATOM   479  C CB  . SER A 1 62  ? 15.309  37.990 6.723  1.00 48.00  ? 56  SER A CB  1 
ATOM   480  O OG  . SER A 1 62  ? 13.914  37.776 6.773  1.00 52.43  ? 56  SER A OG  1 
ATOM   481  N N   . GLY A 1 63  ? 18.213  36.651 7.213  1.00 46.83  ? 57  GLY A N   1 
ATOM   482  C CA  . GLY A 1 63  ? 19.647  36.828 7.125  1.00 44.36  ? 57  GLY A CA  1 
ATOM   483  C C   . GLY A 1 63  ? 20.398  36.562 8.406  1.00 45.66  ? 57  GLY A C   1 
ATOM   484  O O   . GLY A 1 63  ? 21.624  36.517 8.401  1.00 50.59  ? 57  GLY A O   1 
ATOM   485  N N   . VAL A 1 64  ? 19.688  36.397 9.511  1.00 45.86  ? 58  VAL A N   1 
ATOM   486  C CA  . VAL A 1 64  ? 20.363  36.134 10.757 1.00 41.27  ? 58  VAL A CA  1 
ATOM   487  C C   . VAL A 1 64  ? 20.759  34.692 10.665 1.00 46.17  ? 58  VAL A C   1 
ATOM   488  O O   . VAL A 1 64  ? 19.933  33.854 10.296 1.00 52.30  ? 58  VAL A O   1 
ATOM   489  C CB  . VAL A 1 64  ? 19.443  36.327 11.936 1.00 35.35  ? 58  VAL A CB  1 
ATOM   490  C CG1 . VAL A 1 64  ? 20.203  36.090 13.215 1.00 29.86  ? 58  VAL A CG1 1 
ATOM   491  C CG2 . VAL A 1 64  ? 18.871  37.710 11.899 1.00 31.22  ? 58  VAL A CG2 1 
ATOM   492  N N   . PRO A 1 65  ? 22.049  34.391 10.891 1.00 46.32  ? 59  PRO A N   1 
ATOM   493  C CA  . PRO A 1 65  ? 22.576  33.015 10.834 1.00 49.91  ? 59  PRO A CA  1 
ATOM   494  C C   . PRO A 1 65  ? 22.006  32.015 11.880 1.00 55.54  ? 59  PRO A C   1 
ATOM   495  O O   . PRO A 1 65  ? 21.618  32.400 12.990 1.00 58.87  ? 59  PRO A O   1 
ATOM   496  C CB  . PRO A 1 65  ? 24.078  33.231 11.021 1.00 41.80  ? 59  PRO A CB  1 
ATOM   497  C CG  . PRO A 1 65  ? 24.304  34.559 10.382 1.00 42.09  ? 59  PRO A CG  1 
ATOM   498  C CD  . PRO A 1 65  ? 23.149  35.369 10.917 1.00 38.20  ? 59  PRO A CD  1 
ATOM   499  N N   . ASP A 1 66  ? 22.018  30.723 11.544 1.00 54.43  ? 60  ASP A N   1 
ATOM   500  C CA  . ASP A 1 66  ? 21.537  29.681 12.456 1.00 54.88  ? 60  ASP A CA  1 
ATOM   501  C C   . ASP A 1 66  ? 22.299  29.575 13.794 1.00 52.08  ? 60  ASP A C   1 
ATOM   502  O O   . ASP A 1 66  ? 21.816  28.925 14.721 1.00 45.40  ? 60  ASP A O   1 
ATOM   503  C CB  . ASP A 1 66  ? 21.538  28.310 11.758 1.00 61.87  ? 60  ASP A CB  1 
ATOM   504  C CG  . ASP A 1 66  ? 20.271  28.063 10.947 1.00 66.07  ? 60  ASP A CG  1 
ATOM   505  O OD1 . ASP A 1 66  ? 19.169  28.231 11.503 1.00 69.00  ? 60  ASP A OD1 1 
ATOM   506  O OD2 . ASP A 1 66  ? 20.368  27.689 9.759  1.00 66.90  ? 60  ASP A OD2 1 
ATOM   507  N N   . ARG A 1 67  ? 23.486  30.191 13.888 1.00 45.94  ? 61  ARG A N   1 
ATOM   508  C CA  . ARG A 1 67  ? 24.278  30.157 15.116 1.00 43.36  ? 61  ARG A CA  1 
ATOM   509  C C   . ARG A 1 67  ? 23.714  31.000 16.288 1.00 46.63  ? 61  ARG A C   1 
ATOM   510  O O   . ARG A 1 67  ? 24.040  30.750 17.451 1.00 42.46  ? 61  ARG A O   1 
ATOM   511  C CB  . ARG A 1 67  ? 25.727  30.535 14.836 1.00 43.83  ? 61  ARG A CB  1 
ATOM   512  C CG  . ARG A 1 67  ? 25.975  32.003 14.627 1.00 40.15  ? 61  ARG A CG  1 
ATOM   513  C CD  . ARG A 1 67  ? 27.450  32.280 14.359 1.00 40.20  ? 61  ARG A CD  1 
ATOM   514  N NE  . ARG A 1 67  ? 27.640  33.685 14.020 1.00 45.97  ? 61  ARG A NE  1 
ATOM   515  C CZ  . ARG A 1 67  ? 27.772  34.147 12.783 1.00 45.38  ? 61  ARG A CZ  1 
ATOM   516  N NH1 . ARG A 1 67  ? 27.750  33.320 11.758 1.00 51.34  ? 61  ARG A NH1 1 
ATOM   517  N NH2 . ARG A 1 67  ? 27.861  35.445 12.566 1.00 48.79  ? 61  ARG A NH2 1 
ATOM   518  N N   . PHE A 1 68  ? 22.893  32.004 15.990 1.00 47.74  ? 62  PHE A N   1 
ATOM   519  C CA  . PHE A 1 68  ? 22.273  32.812 17.036 1.00 51.06  ? 62  PHE A CA  1 
ATOM   520  C C   . PHE A 1 68  ? 20.947  32.144 17.412 1.00 55.19  ? 62  PHE A C   1 
ATOM   521  O O   . PHE A 1 68  ? 20.104  31.957 16.529 1.00 59.43  ? 62  PHE A O   1 
ATOM   522  C CB  . PHE A 1 68  ? 21.933  34.214 16.507 1.00 54.66  ? 62  PHE A CB  1 
ATOM   523  C CG  . PHE A 1 68  ? 23.129  35.037 16.117 1.00 60.94  ? 62  PHE A CG  1 
ATOM   524  C CD1 . PHE A 1 68  ? 23.788  35.831 17.069 1.00 58.74  ? 62  PHE A CD1 1 
ATOM   525  C CD2 . PHE A 1 68  ? 23.605  35.016 14.807 1.00 54.60  ? 62  PHE A CD2 1 
ATOM   526  C CE1 . PHE A 1 68  ? 24.902  36.590 16.719 1.00 56.25  ? 62  PHE A CE1 1 
ATOM   527  C CE2 . PHE A 1 68  ? 24.719  35.771 14.450 1.00 57.55  ? 62  PHE A CE2 1 
ATOM   528  C CZ  . PHE A 1 68  ? 25.370  36.560 15.410 1.00 59.44  ? 62  PHE A CZ  1 
ATOM   529  N N   . ILE A 1 69  ? 20.734  31.775 18.679 1.00 50.87  ? 63  ILE A N   1 
ATOM   530  C CA  . ILE A 1 69  ? 19.445  31.181 19.046 1.00 49.43  ? 63  ILE A CA  1 
ATOM   531  C C   . ILE A 1 69  ? 18.815  31.686 20.324 1.00 44.27  ? 63  ILE A C   1 
ATOM   532  O O   . ILE A 1 69  ? 19.369  31.567 21.423 1.00 45.25  ? 63  ILE A O   1 
ATOM   533  C CB  . ILE A 1 69  ? 19.427  29.622 19.004 1.00 54.30  ? 63  ILE A CB  1 
ATOM   534  C CG1 . ILE A 1 69  ? 20.561  29.026 19.832 1.00 57.85  ? 63  ILE A CG1 1 
ATOM   535  C CG2 . ILE A 1 69  ? 19.496  29.142 17.568 1.00 63.78  ? 63  ILE A CG2 1 
ATOM   536  C CD1 . ILE A 1 69  ? 21.458  28.076 19.060 1.00 50.91  ? 63  ILE A CD1 1 
ATOM   537  N N   . GLY A 1 70  ? 17.666  32.314 20.150 1.00 39.48  ? 64  GLY A N   1 
ATOM   538  C CA  . GLY A 1 70  ? 16.949  32.846 21.283 1.00 45.89  ? 64  GLY A CA  1 
ATOM   539  C C   . GLY A 1 70  ? 16.097  31.780 21.934 1.00 49.70  ? 64  GLY A C   1 
ATOM   540  O O   . GLY A 1 70  ? 15.461  30.968 21.243 1.00 49.91  ? 64  GLY A O   1 
ATOM   541  N N   . SER A 1 71  ? 16.078  31.788 23.261 1.00 50.68  ? 65  SER A N   1 
ATOM   542  C CA  . SER A 1 71  ? 15.305  30.822 24.032 1.00 47.62  ? 65  SER A CA  1 
ATOM   543  C C   . SER A 1 71  ? 14.723  31.473 25.276 1.00 46.63  ? 65  SER A C   1 
ATOM   544  O O   . SER A 1 71  ? 14.960  32.647 25.538 1.00 46.50  ? 65  SER A O   1 
ATOM   545  C CB  . SER A 1 71  ? 16.210  29.683 24.469 1.00 43.69  ? 65  SER A CB  1 
ATOM   546  O OG  . SER A 1 71  ? 17.257  30.197 25.255 1.00 48.62  ? 65  SER A OG  1 
ATOM   547  N N   . GLY A 1 72  ? 14.011  30.682 26.070 1.00 46.46  ? 66  GLY A N   1 
ATOM   548  C CA  . GLY A 1 72  ? 13.423  31.186 27.295 1.00 41.72  ? 66  GLY A CA  1 
ATOM   549  C C   . GLY A 1 72  ? 11.983  31.626 27.165 1.00 41.43  ? 66  GLY A C   1 
ATOM   550  O O   . GLY A 1 72  ? 11.415  31.575 26.066 1.00 40.36  ? 66  GLY A O   1 
ATOM   551  N N   . SER A 1 73  ? 11.394  32.030 28.292 1.00 40.06  ? 67  SER A N   1 
ATOM   552  C CA  . SER A 1 73  ? 10.012  32.505 28.342 1.00 44.22  ? 67  SER A CA  1 
ATOM   553  C C   . SER A 1 73  ? 9.595   33.043 29.722 1.00 44.47  ? 67  SER A C   1 
ATOM   554  O O   . SER A 1 73  ? 10.228  32.757 30.752 1.00 43.68  ? 67  SER A O   1 
ATOM   555  C CB  . SER A 1 73  ? 9.027   31.415 27.855 1.00 51.81  ? 67  SER A CB  1 
ATOM   556  O OG  . SER A 1 73  ? 9.202   30.175 28.528 1.00 55.94  ? 67  SER A OG  1 
ATOM   557  N N   . GLY A 1 74  ? 8.540   33.854 29.731 1.00 43.15  ? 68  GLY A N   1 
ATOM   558  C CA  . GLY A 1 74  ? 8.056   34.419 30.977 1.00 43.08  ? 68  GLY A CA  1 
ATOM   559  C C   . GLY A 1 74  ? 8.820   35.673 31.341 1.00 47.40  ? 68  GLY A C   1 
ATOM   560  O O   . GLY A 1 74  ? 8.460   36.773 30.891 1.00 49.22  ? 68  GLY A O   1 
ATOM   561  N N   . THR A 1 75  ? 9.894   35.517 32.107 1.00 43.29  ? 69  THR A N   1 
ATOM   562  C CA  . THR A 1 75  ? 10.684  36.675 32.523 1.00 42.34  ? 69  THR A CA  1 
ATOM   563  C C   . THR A 1 75  ? 12.180  36.481 32.327 1.00 43.62  ? 69  THR A C   1 
ATOM   564  O O   . THR A 1 75  ? 12.966  37.405 32.550 1.00 41.86  ? 69  THR A O   1 
ATOM   565  C CB  . THR A 1 75  ? 10.461  37.011 34.031 1.00 44.42  ? 69  THR A CB  1 
ATOM   566  O OG1 . THR A 1 75  ? 10.742  35.853 34.826 1.00 45.57  ? 69  THR A OG1 1 
ATOM   567  C CG2 . THR A 1 75  ? 9.045   37.469 34.309 1.00 37.44  ? 69  THR A CG2 1 
ATOM   568  N N   . ASP A 1 76  ? 12.583  35.279 31.939 1.00 44.58  ? 70  ASP A N   1 
ATOM   569  C CA  . ASP A 1 76  ? 13.998  34.983 31.791 1.00 47.52  ? 70  ASP A CA  1 
ATOM   570  C C   . ASP A 1 76  ? 14.274  34.458 30.400 1.00 46.53  ? 70  ASP A C   1 
ATOM   571  O O   . ASP A 1 76  ? 13.802  33.387 30.021 1.00 47.54  ? 70  ASP A O   1 
ATOM   572  C CB  . ASP A 1 76  ? 14.414  33.968 32.863 1.00 55.14  ? 70  ASP A CB  1 
ATOM   573  C CG  . ASP A 1 76  ? 13.897  34.349 34.273 1.00 66.92  ? 70  ASP A CG  1 
ATOM   574  O OD1 . ASP A 1 76  ? 13.887  35.555 34.625 1.00 70.99  ? 70  ASP A OD1 1 
ATOM   575  O OD2 . ASP A 1 76  ? 13.477  33.447 35.034 1.00 69.71  ? 70  ASP A OD2 1 
ATOM   576  N N   . PHE A 1 77  ? 15.052  35.220 29.644 1.00 45.41  ? 71  PHE A N   1 
ATOM   577  C CA  . PHE A 1 77  ? 15.376  34.873 28.263 1.00 40.44  ? 71  PHE A CA  1 
ATOM   578  C C   . PHE A 1 77  ? 16.861  34.728 28.034 1.00 35.71  ? 71  PHE A C   1 
ATOM   579  O O   . PHE A 1 77  ? 17.666  35.153 28.858 1.00 35.19  ? 71  PHE A O   1 
ATOM   580  C CB  . PHE A 1 77  ? 14.787  35.913 27.322 1.00 37.77  ? 71  PHE A CB  1 
ATOM   581  C CG  . PHE A 1 77  ? 13.325  36.103 27.509 1.00 37.01  ? 71  PHE A CG  1 
ATOM   582  C CD1 . PHE A 1 77  ? 12.844  36.899 28.540 1.00 35.33  ? 71  PHE A CD1 1 
ATOM   583  C CD2 . PHE A 1 77  ? 12.424  35.450 26.685 1.00 36.23  ? 71  PHE A CD2 1 
ATOM   584  C CE1 . PHE A 1 77  ? 11.481  37.034 28.758 1.00 37.71  ? 71  PHE A CE1 1 
ATOM   585  C CE2 . PHE A 1 77  ? 11.056  35.577 26.890 1.00 39.12  ? 71  PHE A CE2 1 
ATOM   586  C CZ  . PHE A 1 77  ? 10.581  36.373 27.930 1.00 40.35  ? 71  PHE A CZ  1 
ATOM   587  N N   . THR A 1 78  ? 17.215  34.166 26.883 1.00 33.32  ? 72  THR A N   1 
ATOM   588  C CA  . THR A 1 78  ? 18.600  33.912 26.563 1.00 36.67  ? 72  THR A CA  1 
ATOM   589  C C   . THR A 1 78  ? 18.958  33.933 25.091 1.00 41.24  ? 72  THR A C   1 
ATOM   590  O O   . THR A 1 78  ? 18.249  33.384 24.241 1.00 43.56  ? 72  THR A O   1 
ATOM   591  C CB  . THR A 1 78  ? 19.000  32.540 27.085 1.00 36.70  ? 72  THR A CB  1 
ATOM   592  O OG1 . THR A 1 78  ? 18.771  32.492 28.496 1.00 45.51  ? 72  THR A OG1 1 
ATOM   593  C CG2 . THR A 1 78  ? 20.470  32.237 26.782 1.00 39.36  ? 72  THR A CG2 1 
ATOM   594  N N   . LEU A 1 79  ? 20.079  34.578 24.805 1.00 42.31  ? 73  LEU A N   1 
ATOM   595  C CA  . LEU A 1 79  ? 20.592  34.630 23.459 1.00 43.94  ? 73  LEU A CA  1 
ATOM   596  C C   . LEU A 1 79  ? 21.852  33.774 23.486 1.00 44.16  ? 73  LEU A C   1 
ATOM   597  O O   . LEU A 1 79  ? 22.784  34.007 24.268 1.00 44.13  ? 73  LEU A O   1 
ATOM   598  C CB  . LEU A 1 79  ? 20.913  36.064 23.026 1.00 46.58  ? 73  LEU A CB  1 
ATOM   599  C CG  . LEU A 1 79  ? 21.344  36.165 21.553 1.00 43.63  ? 73  LEU A CG  1 
ATOM   600  C CD1 . LEU A 1 79  ? 20.265  35.570 20.677 1.00 39.90  ? 73  LEU A CD1 1 
ATOM   601  C CD2 . LEU A 1 79  ? 21.602  37.600 21.167 1.00 38.11  ? 73  LEU A CD2 1 
ATOM   602  N N   . THR A 1 80  ? 21.856  32.741 22.670 1.00 41.07  ? 74  THR A N   1 
ATOM   603  C CA  . THR A 1 80  ? 22.996  31.864 22.635 1.00 41.05  ? 74  THR A CA  1 
ATOM   604  C C   . THR A 1 80  ? 23.653  31.977 21.265 1.00 44.19  ? 74  THR A C   1 
ATOM   605  O O   . THR A 1 80  ? 22.969  32.239 20.271 1.00 48.73  ? 74  THR A O   1 
ATOM   606  C CB  . THR A 1 80  ? 22.536  30.399 22.870 1.00 41.33  ? 74  THR A CB  1 
ATOM   607  O OG1 . THR A 1 80  ? 21.674  30.329 24.023 1.00 44.31  ? 74  THR A OG1 1 
ATOM   608  C CG2 . THR A 1 80  ? 23.723  29.514 23.083 1.00 33.27  ? 74  THR A CG2 1 
ATOM   609  N N   . ILE A 1 81  ? 24.977  31.901 21.225 1.00 41.99  ? 75  ILE A N   1 
ATOM   610  C CA  . ILE A 1 81  ? 25.687  31.910 19.958 1.00 42.52  ? 75  ILE A CA  1 
ATOM   611  C C   . ILE A 1 81  ? 26.432  30.574 19.995 1.00 48.14  ? 75  ILE A C   1 
ATOM   612  O O   . ILE A 1 81  ? 27.435  30.424 20.705 1.00 43.02  ? 75  ILE A O   1 
ATOM   613  C CB  . ILE A 1 81  ? 26.683  33.091 19.796 1.00 42.83  ? 75  ILE A CB  1 
ATOM   614  C CG1 . ILE A 1 81  ? 25.951  34.423 19.818 1.00 41.05  ? 75  ILE A CG1 1 
ATOM   615  C CG2 . ILE A 1 81  ? 27.384  33.029 18.434 1.00 39.04  ? 75  ILE A CG2 1 
ATOM   616  C CD1 . ILE A 1 81  ? 26.900  35.590 19.735 1.00 45.25  ? 75  ILE A CD1 1 
ATOM   617  N N   . SER A 1 82  ? 25.886  29.596 19.270 1.00 54.19  ? 76  SER A N   1 
ATOM   618  C CA  . SER A 1 82  ? 26.426  28.240 19.196 1.00 58.18  ? 76  SER A CA  1 
ATOM   619  C C   . SER A 1 82  ? 27.940  28.142 19.013 1.00 54.02  ? 76  SER A C   1 
ATOM   620  O O   . SER A 1 82  ? 28.601  27.362 19.707 1.00 51.69  ? 76  SER A O   1 
ATOM   621  C CB  . SER A 1 82  ? 25.715  27.452 18.085 1.00 57.63  ? 76  SER A CB  1 
ATOM   622  O OG  . SER A 1 82  ? 26.064  27.970 16.812 1.00 64.84  ? 76  SER A OG  1 
ATOM   623  N N   . SER A 1 83  ? 28.478  28.897 18.058 1.00 51.51  ? 77  SER A N   1 
ATOM   624  C CA  . SER A 1 83  ? 29.916  28.892 17.787 1.00 58.42  ? 77  SER A CA  1 
ATOM   625  C C   . SER A 1 83  ? 30.285  30.301 17.351 1.00 57.99  ? 77  SER A C   1 
ATOM   626  O O   . SER A 1 83  ? 29.976  30.684 16.223 1.00 67.05  ? 77  SER A O   1 
ATOM   627  C CB  . SER A 1 83  ? 30.229  27.887 16.661 1.00 59.88  ? 77  SER A CB  1 
ATOM   628  O OG  . SER A 1 83  ? 31.616  27.621 16.557 1.00 68.15  ? 77  SER A OG  1 
ATOM   629  N N   . VAL A 1 84  ? 30.924  31.085 18.219 1.00 55.74  ? 78  VAL A N   1 
ATOM   630  C CA  . VAL A 1 84  ? 31.244  32.466 17.832 1.00 54.96  ? 78  VAL A CA  1 
ATOM   631  C C   . VAL A 1 84  ? 32.312  32.662 16.804 1.00 56.03  ? 78  VAL A C   1 
ATOM   632  O O   . VAL A 1 84  ? 33.333  31.981 16.781 1.00 53.58  ? 78  VAL A O   1 
ATOM   633  C CB  . VAL A 1 84  ? 31.621  33.395 18.988 1.00 52.06  ? 78  VAL A CB  1 
ATOM   634  C CG1 . VAL A 1 84  ? 30.399  33.790 19.740 1.00 56.62  ? 78  VAL A CG1 1 
ATOM   635  C CG2 . VAL A 1 84  ? 32.682  32.772 19.873 1.00 50.02  ? 78  VAL A CG2 1 
ATOM   636  N N   . GLN A 1 85  ? 32.080  33.664 15.980 1.00 58.37  ? 79  GLN A N   1 
ATOM   637  C CA  . GLN A 1 85  ? 33.016  34.024 14.949 1.00 58.13  ? 79  GLN A CA  1 
ATOM   638  C C   . GLN A 1 85  ? 33.388  35.452 15.264 1.00 56.64  ? 79  GLN A C   1 
ATOM   639  O O   . GLN A 1 85  ? 32.585  36.195 15.823 1.00 54.16  ? 79  GLN A O   1 
ATOM   640  C CB  . GLN A 1 85  ? 32.368  33.873 13.577 1.00 61.25  ? 79  GLN A CB  1 
ATOM   641  C CG  . GLN A 1 85  ? 32.024  32.419 13.227 1.00 63.36  ? 79  GLN A CG  1 
ATOM   642  C CD  . GLN A 1 85  ? 31.050  32.325 12.075 1.00 63.06  ? 79  GLN A CD  1 
ATOM   643  O OE1 . GLN A 1 85  ? 31.199  33.011 11.070 1.00 65.19  ? 79  GLN A OE1 1 
ATOM   644  N NE2 . GLN A 1 85  ? 30.024  31.503 12.229 1.00 65.83  ? 79  GLN A NE2 1 
ATOM   645  N N   . ALA A 1 86  ? 34.632  35.803 14.956 1.00 58.21  ? 80  ALA A N   1 
ATOM   646  C CA  . ALA A 1 86  ? 35.195  37.124 15.208 1.00 57.53  ? 80  ALA A CA  1 
ATOM   647  C C   . ALA A 1 86  ? 34.263  38.276 14.866 1.00 55.71  ? 80  ALA A C   1 
ATOM   648  O O   . ALA A 1 86  ? 34.077  39.181 15.672 1.00 59.98  ? 80  ALA A O   1 
ATOM   649  C CB  . ALA A 1 86  ? 36.524  37.273 14.475 1.00 55.70  ? 80  ALA A CB  1 
ATOM   650  N N   . GLU A 1 87  ? 33.626  38.210 13.705 1.00 52.10  ? 81  GLU A N   1 
ATOM   651  C CA  . GLU A 1 87  ? 32.723  39.268 13.279 1.00 52.77  ? 81  GLU A CA  1 
ATOM   652  C C   . GLU A 1 87  ? 31.618  39.525 14.299 1.00 50.58  ? 81  GLU A C   1 
ATOM   653  O O   . GLU A 1 87  ? 30.956  40.549 14.239 1.00 53.55  ? 81  GLU A O   1 
ATOM   654  C CB  . GLU A 1 87  ? 32.078  38.893 11.947 1.00 56.11  ? 81  GLU A CB  1 
ATOM   655  C CG  . GLU A 1 87  ? 31.154  37.700 12.095 1.00 72.32  ? 81  GLU A CG  1 
ATOM   656  C CD  . GLU A 1 87  ? 30.578  37.204 10.796 1.00 79.44  ? 81  GLU A CD  1 
ATOM   657  O OE1 . GLU A 1 87  ? 29.742  37.924 10.196 1.00 83.99  ? 81  GLU A OE1 1 
ATOM   658  O OE2 . GLU A 1 87  ? 30.948  36.074 10.397 1.00 80.69  ? 81  GLU A OE2 1 
ATOM   659  N N   . ASP A 1 88  ? 31.422  38.597 15.228 1.00 46.94  ? 82  ASP A N   1 
ATOM   660  C CA  . ASP A 1 88  ? 30.351  38.716 16.208 1.00 46.83  ? 82  ASP A CA  1 
ATOM   661  C C   . ASP A 1 88  ? 30.565  39.690 17.343 1.00 49.55  ? 82  ASP A C   1 
ATOM   662  O O   . ASP A 1 88  ? 29.621  40.013 18.069 1.00 53.66  ? 82  ASP A O   1 
ATOM   663  C CB  . ASP A 1 88  ? 29.996  37.344 16.775 1.00 46.21  ? 82  ASP A CB  1 
ATOM   664  C CG  . ASP A 1 88  ? 29.382  36.432 15.744 1.00 43.63  ? 82  ASP A CG  1 
ATOM   665  O OD1 . ASP A 1 88  ? 28.822  36.960 14.755 1.00 41.42  ? 82  ASP A OD1 1 
ATOM   666  O OD2 . ASP A 1 88  ? 29.471  35.198 15.926 1.00 38.93  ? 82  ASP A OD2 1 
ATOM   667  N N   . GLN A 1 89  ? 31.802  40.128 17.523 1.00 46.03  ? 83  GLN A N   1 
ATOM   668  C CA  . GLN A 1 89  ? 32.116  41.067 18.574 1.00 42.56  ? 83  GLN A CA  1 
ATOM   669  C C   . GLN A 1 89  ? 31.167  42.240 18.369 1.00 46.08  ? 83  GLN A C   1 
ATOM   670  O O   . GLN A 1 89  ? 31.143  42.815 17.277 1.00 50.44  ? 83  GLN A O   1 
ATOM   671  C CB  . GLN A 1 89  ? 33.557  41.510 18.404 1.00 42.31  ? 83  GLN A CB  1 
ATOM   672  C CG  . GLN A 1 89  ? 34.126  42.320 19.519 1.00 42.93  ? 83  GLN A CG  1 
ATOM   673  C CD  . GLN A 1 89  ? 35.639  42.392 19.428 1.00 49.44  ? 83  GLN A CD  1 
ATOM   674  O OE1 . GLN A 1 89  ? 36.352  41.498 19.883 1.00 47.76  ? 83  GLN A OE1 1 
ATOM   675  N NE2 . GLN A 1 89  ? 36.136  43.445 18.820 1.00 55.59  ? 83  GLN A NE2 1 
ATOM   676  N N   . ALA A 1 90  ? 30.323  42.518 19.367 1.00 41.85  ? 84  ALA A N   1 
ATOM   677  C CA  . ALA A 1 90  ? 29.369  43.619 19.291 1.00 37.05  ? 84  ALA A CA  1 
ATOM   678  C C   . ALA A 1 90  ? 28.637  43.782 20.604 1.00 41.71  ? 84  ALA A C   1 
ATOM   679  O O   . ALA A 1 90  ? 28.982  43.125 21.602 1.00 43.31  ? 84  ALA A O   1 
ATOM   680  C CB  . ALA A 1 90  ? 28.359  43.379 18.177 1.00 38.75  ? 84  ALA A CB  1 
ATOM   681  N N   . ASP A 1 91  ? 27.670  44.706 20.601 1.00 41.45  ? 85  ASP A N   1 
ATOM   682  C CA  . ASP A 1 91  ? 26.809  44.983 21.747 1.00 40.32  ? 85  ASP A CA  1 
ATOM   683  C C   . ASP A 1 91  ? 25.478  44.311 21.429 1.00 40.98  ? 85  ASP A C   1 
ATOM   684  O O   . ASP A 1 91  ? 24.940  44.456 20.321 1.00 35.88  ? 85  ASP A O   1 
ATOM   685  C CB  . ASP A 1 91  ? 26.535  46.484 21.932 1.00 47.35  ? 85  ASP A CB  1 
ATOM   686  C CG  . ASP A 1 91  ? 27.756  47.273 22.379 1.00 55.06  ? 85  ASP A CG  1 
ATOM   687  O OD1 . ASP A 1 91  ? 28.567  46.756 23.184 1.00 54.42  ? 85  ASP A OD1 1 
ATOM   688  O OD2 . ASP A 1 91  ? 27.885  48.435 21.918 1.00 57.65  ? 85  ASP A OD2 1 
ATOM   689  N N   . TYR A 1 92  ? 24.921  43.631 22.419 1.00 40.69  ? 86  TYR A N   1 
ATOM   690  C CA  . TYR A 1 92  ? 23.666  42.934 22.241 1.00 39.90  ? 86  TYR A CA  1 
ATOM   691  C C   . TYR A 1 92  ? 22.669  43.398 23.282 1.00 39.72  ? 86  TYR A C   1 
ATOM   692  O O   . TYR A 1 92  ? 22.941  43.325 24.478 1.00 43.05  ? 86  TYR A O   1 
ATOM   693  C CB  . TYR A 1 92  ? 23.915  41.435 22.365 1.00 40.78  ? 86  TYR A CB  1 
ATOM   694  C CG  . TYR A 1 92  ? 24.822  40.884 21.282 1.00 41.73  ? 86  TYR A CG  1 
ATOM   695  C CD1 . TYR A 1 92  ? 26.224  40.991 21.375 1.00 36.24  ? 86  TYR A CD1 1 
ATOM   696  C CD2 . TYR A 1 92  ? 24.280  40.245 20.163 1.00 40.66  ? 86  TYR A CD2 1 
ATOM   697  C CE1 . TYR A 1 92  ? 27.052  40.475 20.375 1.00 31.81  ? 86  TYR A CE1 1 
ATOM   698  C CE2 . TYR A 1 92  ? 25.094  39.726 19.171 1.00 38.16  ? 86  TYR A CE2 1 
ATOM   699  C CZ  . TYR A 1 92  ? 26.468  39.843 19.287 1.00 37.54  ? 86  TYR A CZ  1 
ATOM   700  O OH  . TYR A 1 92  ? 27.236  39.295 18.307 1.00 41.98  ? 86  TYR A OH  1 
ATOM   701  N N   . PHE A 1 93  ? 21.547  43.935 22.824 1.00 36.33  ? 87  PHE A N   1 
ATOM   702  C CA  . PHE A 1 93  ? 20.510  44.411 23.718 1.00 37.72  ? 87  PHE A CA  1 
ATOM   703  C C   . PHE A 1 93  ? 19.284  43.583 23.486 1.00 42.47  ? 87  PHE A C   1 
ATOM   704  O O   . PHE A 1 93  ? 19.149  42.937 22.445 1.00 41.59  ? 87  PHE A O   1 
ATOM   705  C CB  . PHE A 1 93  ? 20.084  45.833 23.378 1.00 41.12  ? 87  PHE A CB  1 
ATOM   706  C CG  . PHE A 1 93  ? 21.195  46.809 23.346 1.00 41.47  ? 87  PHE A CG  1 
ATOM   707  C CD1 . PHE A 1 93  ? 21.928  46.994 22.191 1.00 40.65  ? 87  PHE A CD1 1 
ATOM   708  C CD2 . PHE A 1 93  ? 21.515  47.541 24.473 1.00 40.78  ? 87  PHE A CD2 1 
ATOM   709  C CE1 . PHE A 1 93  ? 22.970  47.889 22.151 1.00 46.41  ? 87  PHE A CE1 1 
ATOM   710  C CE2 . PHE A 1 93  ? 22.562  48.447 24.444 1.00 49.47  ? 87  PHE A CE2 1 
ATOM   711  C CZ  . PHE A 1 93  ? 23.291  48.622 23.283 1.00 45.71  ? 87  PHE A CZ  1 
ATOM   712  N N   . CYS A 1 94  ? 18.353  43.688 24.427 1.00 45.10  ? 88  CYS A N   1 
ATOM   713  C CA  . CYS A 1 94  ? 17.060  43.009 24.364 1.00 47.67  ? 88  CYS A CA  1 
ATOM   714  C C   . CYS A 1 94  ? 16.034  44.110 24.655 1.00 44.67  ? 88  CYS A C   1 
ATOM   715  O O   . CYS A 1 94  ? 16.339  45.087 25.337 1.00 49.02  ? 88  CYS A O   1 
ATOM   716  C CB  . CYS A 1 94  ? 16.961  41.844 25.388 1.00 47.03  ? 88  CYS A CB  1 
ATOM   717  S SG  . CYS A 1 94  ? 16.911  42.310 27.166 1.00 57.37  ? 88  CYS A SG  1 
ATOM   718  N N   . GLN A 1 95  ? 14.866  44.019 24.048 1.00 37.96  ? 89  GLN A N   1 
ATOM   719  C CA  . GLN A 1 95  ? 13.846  45.014 24.280 1.00 34.10  ? 89  GLN A CA  1 
ATOM   720  C C   . GLN A 1 95  ? 12.538  44.267 24.432 1.00 38.67  ? 89  GLN A C   1 
ATOM   721  O O   . GLN A 1 95  ? 12.285  43.303 23.711 1.00 46.25  ? 89  GLN A O   1 
ATOM   722  C CB  . GLN A 1 95  ? 13.765  45.968 23.105 1.00 24.78  ? 89  GLN A CB  1 
ATOM   723  C CG  . GLN A 1 95  ? 12.772  47.090 23.297 1.00 24.73  ? 89  GLN A CG  1 
ATOM   724  C CD  . GLN A 1 95  ? 12.490  47.793 22.008 1.00 24.53  ? 89  GLN A CD  1 
ATOM   725  O OE1 . GLN A 1 95  ? 13.008  47.401 20.971 1.00 29.05  ? 89  GLN A OE1 1 
ATOM   726  N NE2 . GLN A 1 95  ? 11.677  48.831 22.051 1.00 21.33  ? 89  GLN A NE2 1 
ATOM   727  N N   . GLN A 1 96  ? 11.744  44.653 25.422 1.00 42.12  ? 90  GLN A N   1 
ATOM   728  C CA  . GLN A 1 96  ? 10.458  44.019 25.647 1.00 43.82  ? 90  GLN A CA  1 
ATOM   729  C C   . GLN A 1 96  ? 9.430   44.817 24.876 1.00 49.83  ? 90  GLN A C   1 
ATOM   730  O O   . GLN A 1 96  ? 9.435   46.055 24.928 1.00 44.75  ? 90  GLN A O   1 
ATOM   731  C CB  . GLN A 1 96  ? 10.101  44.002 27.139 1.00 45.09  ? 90  GLN A CB  1 
ATOM   732  C CG  . GLN A 1 96  ? 9.828   45.357 27.784 1.00 40.66  ? 90  GLN A CG  1 
ATOM   733  C CD  . GLN A 1 96  ? 8.363   45.756 27.734 1.00 42.19  ? 90  GLN A CD  1 
ATOM   734  O OE1 . GLN A 1 96  ? 7.504   44.985 27.298 1.00 45.77  ? 90  GLN A OE1 1 
ATOM   735  N NE2 . GLN A 1 96  ? 8.067   46.961 28.187 1.00 40.21  ? 90  GLN A NE2 1 
ATOM   736  N N   . HIS A 1 97  ? 8.558   44.110 24.161 1.00 53.36  ? 91  HIS A N   1 
ATOM   737  C CA  . HIS A 1 97  ? 7.508   44.752 23.369 1.00 52.05  ? 91  HIS A CA  1 
ATOM   738  C C   . HIS A 1 97  ? 6.123   44.414 23.889 1.00 53.25  ? 91  HIS A C   1 
ATOM   739  O O   . HIS A 1 97  ? 5.126   44.568 23.163 1.00 54.08  ? 91  HIS A O   1 
ATOM   740  C CB  . HIS A 1 97  ? 7.609   44.348 21.895 1.00 45.12  ? 91  HIS A CB  1 
ATOM   741  C CG  . HIS A 1 97  ? 8.802   44.918 21.197 1.00 42.02  ? 91  HIS A CG  1 
ATOM   742  N ND1 . HIS A 1 97  ? 8.710   46.055 20.437 1.00 38.32  ? 91  HIS A ND1 1 
ATOM   743  C CD2 . HIS A 1 97  ? 10.082  44.467 21.185 1.00 34.90  ? 91  HIS A CD2 1 
ATOM   744  C CE1 . HIS A 1 97  ? 9.928   46.269 19.977 1.00 36.12  ? 91  HIS A CE1 1 
ATOM   745  N NE2 . HIS A 1 97  ? 10.790  45.333 20.405 1.00 29.67  ? 91  HIS A NE2 1 
ATOM   746  N N   . TYR A 1 98  ? 6.062   43.966 25.141 1.00 50.43  ? 92  TYR A N   1 
ATOM   747  C CA  . TYR A 1 98  ? 4.791   43.605 25.755 1.00 50.82  ? 92  TYR A CA  1 
ATOM   748  C C   . TYR A 1 98  ? 3.977   44.843 26.116 1.00 49.06  ? 92  TYR A C   1 
ATOM   749  O O   . TYR A 1 98  ? 2.887   45.070 25.591 1.00 49.27  ? 92  TYR A O   1 
ATOM   750  C CB  . TYR A 1 98  ? 5.037   42.746 26.991 1.00 52.73  ? 92  TYR A CB  1 
ATOM   751  C CG  . TYR A 1 98  ? 3.801   42.144 27.616 1.00 56.70  ? 92  TYR A CG  1 
ATOM   752  C CD1 . TYR A 1 98  ? 2.924   41.363 26.867 1.00 56.57  ? 92  TYR A CD1 1 
ATOM   753  C CD2 . TYR A 1 98  ? 3.531   42.315 28.980 1.00 57.59  ? 92  TYR A CD2 1 
ATOM   754  C CE1 . TYR A 1 98  ? 1.810   40.755 27.471 1.00 62.25  ? 92  TYR A CE1 1 
ATOM   755  C CE2 . TYR A 1 98  ? 2.424   41.707 29.592 1.00 56.98  ? 92  TYR A CE2 1 
ATOM   756  C CZ  . TYR A 1 98  ? 1.570   40.928 28.835 1.00 57.66  ? 92  TYR A CZ  1 
ATOM   757  O OH  . TYR A 1 98  ? 0.516   40.273 29.440 1.00 57.59  ? 92  TYR A OH  1 
ATOM   758  N N   . ARG A 1 99  ? 4.526   45.680 26.979 1.00 49.08  ? 93  ARG A N   1 
ATOM   759  C CA  . ARG A 1 99  ? 3.797   46.858 27.384 1.00 50.38  ? 93  ARG A CA  1 
ATOM   760  C C   . ARG A 1 99  ? 4.559   48.117 27.086 1.00 50.68  ? 93  ARG A C   1 
ATOM   761  O O   . ARG A 1 99  ? 5.791   48.122 27.083 1.00 46.38  ? 93  ARG A O   1 
ATOM   762  C CB  . ARG A 1 99  ? 3.502   46.804 28.882 1.00 56.93  ? 93  ARG A CB  1 
ATOM   763  C CG  . ARG A 1 99  ? 2.527   45.728 29.298 1.00 62.52  ? 93  ARG A CG  1 
ATOM   764  C CD  . ARG A 1 99  ? 1.123   46.062 28.833 1.00 73.50  ? 93  ARG A CD  1 
ATOM   765  N NE  . ARG A 1 99  ? 0.136   45.148 29.403 1.00 78.71  ? 93  ARG A NE  1 
ATOM   766  C CZ  . ARG A 1 99  ? -0.399  44.108 28.765 1.00 82.76  ? 93  ARG A CZ  1 
ATOM   767  N NH1 . ARG A 1 99  ? -0.061  43.824 27.509 1.00 79.13  ? 93  ARG A NH1 1 
ATOM   768  N NH2 . ARG A 1 99  ? -1.257  43.326 29.405 1.00 86.74  ? 93  ARG A NH2 1 
ATOM   769  N N   . ALA A 1 100 ? 3.812   49.184 26.817 1.00 49.03  ? 94  ALA A N   1 
ATOM   770  C CA  . ALA A 1 100 ? 4.399   50.488 26.576 1.00 52.55  ? 94  ALA A CA  1 
ATOM   771  C C   . ALA A 1 100 ? 4.731   50.966 27.977 1.00 56.82  ? 94  ALA A C   1 
ATOM   772  O O   . ALA A 1 100 ? 3.969   50.673 28.900 1.00 61.89  ? 94  ALA A O   1 
ATOM   773  C CB  . ALA A 1 100 ? 3.371   51.404 25.947 1.00 43.80  ? 94  ALA A CB  1 
ATOM   774  N N   . PRO A 1 101 ? 5.916   51.590 28.201 1.00 56.77  ? 95  PRO A N   1 
ATOM   775  C CA  . PRO A 1 101 ? 7.007   51.895 27.278 1.00 50.17  ? 95  PRO A CA  1 
ATOM   776  C C   . PRO A 1 101 ? 7.890   50.691 27.023 1.00 46.25  ? 95  PRO A C   1 
ATOM   777  O O   . PRO A 1 101 ? 8.434   50.104 27.962 1.00 50.11  ? 95  PRO A O   1 
ATOM   778  C CB  . PRO A 1 101 ? 7.788   52.974 28.035 1.00 52.73  ? 95  PRO A CB  1 
ATOM   779  C CG  . PRO A 1 101 ? 7.616   52.590 29.445 1.00 48.99  ? 95  PRO A CG  1 
ATOM   780  C CD  . PRO A 1 101 ? 6.133   52.312 29.470 1.00 54.36  ? 95  PRO A CD  1 
ATOM   781  N N   . ARG A 1 102 ? 8.087   50.369 25.752 1.00 41.36  ? 96  ARG A N   1 
ATOM   782  C CA  . ARG A 1 102 ? 8.904   49.227 25.352 1.00 45.07  ? 96  ARG A CA  1 
ATOM   783  C C   . ARG A 1 102 ? 10.402  49.415 25.663 1.00 43.31  ? 96  ARG A C   1 
ATOM   784  O O   . ARG A 1 102 ? 11.236  49.622 24.791 1.00 49.36  ? 96  ARG A O   1 
ATOM   785  C CB  . ARG A 1 102 ? 8.656   48.923 23.870 1.00 46.99  ? 96  ARG A CB  1 
ATOM   786  C CG  . ARG A 1 102 ? 7.169   48.774 23.515 1.00 47.06  ? 96  ARG A CG  1 
ATOM   787  C CD  . ARG A 1 102 ? 6.944   48.475 22.035 1.00 49.99  ? 96  ARG A CD  1 
ATOM   788  N NE  . ARG A 1 102 ? 5.523   48.292 21.717 1.00 52.20  ? 96  ARG A NE  1 
ATOM   789  C CZ  . ARG A 1 102 ? 5.061   47.578 20.691 1.00 54.85  ? 96  ARG A CZ  1 
ATOM   790  N NH1 . ARG A 1 102 ? 5.889   46.942 19.865 1.00 56.56  ? 96  ARG A NH1 1 
ATOM   791  N NH2 . ARG A 1 102 ? 3.759   47.490 20.491 1.00 57.77  ? 96  ARG A NH2 1 
ATOM   792  N N   . THR A 1 103 ? 10.736  49.255 26.926 1.00 44.13  ? 97  THR A N   1 
ATOM   793  C CA  . THR A 1 103 ? 12.086  49.442 27.425 1.00 41.56  ? 97  THR A CA  1 
ATOM   794  C C   . THR A 1 103 ? 13.153  48.475 26.906 1.00 38.96  ? 97  THR A C   1 
ATOM   795  O O   . THR A 1 103 ? 12.848  47.354 26.513 1.00 35.83  ? 97  THR A O   1 
ATOM   796  C CB  . THR A 1 103 ? 12.048  49.391 28.962 1.00 42.25  ? 97  THR A CB  1 
ATOM   797  O OG1 . THR A 1 103 ? 11.378  48.186 29.365 1.00 42.70  ? 97  THR A OG1 1 
ATOM   798  C CG2 . THR A 1 103 ? 11.271  50.602 29.517 1.00 30.63  ? 97  THR A CG2 1 
ATOM   799  N N   . PHE A 1 104 ? 14.405  48.927 26.929 1.00 37.65  ? 98  PHE A N   1 
ATOM   800  C CA  . PHE A 1 104 ? 15.545  48.132 26.479 1.00 35.61  ? 98  PHE A CA  1 
ATOM   801  C C   . PHE A 1 104 ? 16.368  47.670 27.659 1.00 41.60  ? 98  PHE A C   1 
ATOM   802  O O   . PHE A 1 104 ? 16.371  48.317 28.719 1.00 49.16  ? 98  PHE A O   1 
ATOM   803  C CB  . PHE A 1 104 ? 16.500  48.970 25.632 1.00 29.31  ? 98  PHE A CB  1 
ATOM   804  C CG  . PHE A 1 104 ? 15.914  49.457 24.360 1.00 24.94  ? 98  PHE A CG  1 
ATOM   805  C CD1 . PHE A 1 104 ? 15.031  50.534 24.356 1.00 19.23  ? 98  PHE A CD1 1 
ATOM   806  C CD2 . PHE A 1 104 ? 16.263  48.849 23.151 1.00 22.41  ? 98  PHE A CD2 1 
ATOM   807  C CE1 . PHE A 1 104 ? 14.499  50.997 23.174 1.00 15.69  ? 98  PHE A CE1 1 
ATOM   808  C CE2 . PHE A 1 104 ? 15.739  49.299 21.956 1.00 16.72  ? 98  PHE A CE2 1 
ATOM   809  C CZ  . PHE A 1 104 ? 14.855  50.377 21.969 1.00 23.14  ? 98  PHE A CZ  1 
ATOM   810  N N   . GLY A 1 105 ? 17.125  46.597 27.443 1.00 39.22  ? 99  GLY A N   1 
ATOM   811  C CA  . GLY A 1 105 ? 17.999  46.089 28.471 1.00 37.81  ? 99  GLY A CA  1 
ATOM   812  C C   . GLY A 1 105 ? 19.202  47.009 28.435 1.00 40.34  ? 99  GLY A C   1 
ATOM   813  O O   . GLY A 1 105 ? 19.314  47.819 27.515 1.00 42.42  ? 99  GLY A O   1 
ATOM   814  N N   . GLY A 1 106 ? 20.111  46.884 29.401 1.00 42.92  ? 100 GLY A N   1 
ATOM   815  C CA  . GLY A 1 106 ? 21.289  47.739 29.417 1.00 40.61  ? 100 GLY A CA  1 
ATOM   816  C C   . GLY A 1 106 ? 22.421  47.299 28.494 1.00 40.52  ? 100 GLY A C   1 
ATOM   817  O O   . GLY A 1 106 ? 23.461  47.946 28.392 1.00 44.12  ? 100 GLY A O   1 
ATOM   818  N N   . GLY A 1 107 ? 22.221  46.193 27.809 1.00 38.79  ? 101 GLY A N   1 
ATOM   819  C CA  . GLY A 1 107 ? 23.241  45.711 26.908 1.00 37.87  ? 101 GLY A CA  1 
ATOM   820  C C   . GLY A 1 107 ? 24.310  44.847 27.532 1.00 34.38  ? 101 GLY A C   1 
ATOM   821  O O   . GLY A 1 107 ? 24.513  44.867 28.747 1.00 36.26  ? 101 GLY A O   1 
ATOM   822  N N   . THR A 1 108 ? 24.877  43.985 26.703 1.00 31.32  ? 102 THR A N   1 
ATOM   823  C CA  . THR A 1 108 ? 25.966  43.116 27.101 1.00 35.67  ? 102 THR A CA  1 
ATOM   824  C C   . THR A 1 108 ? 26.992  43.366 26.023 1.00 40.41  ? 102 THR A C   1 
ATOM   825  O O   . THR A 1 108 ? 26.654  43.343 24.846 1.00 47.03  ? 102 THR A O   1 
ATOM   826  C CB  . THR A 1 108 ? 25.592  41.642 27.060 1.00 36.85  ? 102 THR A CB  1 
ATOM   827  O OG1 . THR A 1 108 ? 24.691  41.345 28.128 1.00 46.84  ? 102 THR A OG1 1 
ATOM   828  C CG2 . THR A 1 108 ? 26.834  40.780 27.209 1.00 32.94  ? 102 THR A CG2 1 
ATOM   829  N N   . LYS A 1 109 ? 28.216  43.691 26.428 1.00 44.86  ? 103 LYS A N   1 
ATOM   830  C CA  . LYS A 1 109 ? 29.299  43.971 25.496 1.00 43.38  ? 103 LYS A CA  1 
ATOM   831  C C   . LYS A 1 109 ? 30.145  42.719 25.256 1.00 44.40  ? 103 LYS A C   1 
ATOM   832  O O   . LYS A 1 109 ? 30.913  42.272 26.138 1.00 37.71  ? 103 LYS A O   1 
ATOM   833  C CB  . LYS A 1 109 ? 30.157  45.127 26.030 1.00 48.84  ? 103 LYS A CB  1 
ATOM   834  C CG  . LYS A 1 109 ? 31.264  45.591 25.092 1.00 59.04  ? 103 LYS A CG  1 
ATOM   835  C CD  . LYS A 1 109 ? 32.044  46.789 25.639 1.00 59.52  ? 103 LYS A CD  1 
ATOM   836  C CE  . LYS A 1 109 ? 32.434  47.733 24.482 1.00 69.23  ? 103 LYS A CE  1 
ATOM   837  N NZ  . LYS A 1 109 ? 31.269  48.510 23.916 1.00 61.53  ? 103 LYS A NZ  1 
ATOM   838  N N   . LEU A 1 110 ? 29.984  42.138 24.066 1.00 44.88  ? 104 LEU A N   1 
ATOM   839  C CA  . LEU A 1 110 ? 30.733  40.938 23.715 1.00 45.53  ? 104 LEU A CA  1 
ATOM   840  C C   . LEU A 1 110 ? 32.035  41.285 23.056 1.00 44.22  ? 104 LEU A C   1 
ATOM   841  O O   . LEU A 1 110 ? 32.050  42.018 22.071 1.00 47.15  ? 104 LEU A O   1 
ATOM   842  C CB  . LEU A 1 110 ? 29.937  40.035 22.782 1.00 40.81  ? 104 LEU A CB  1 
ATOM   843  C CG  . LEU A 1 110 ? 30.680  38.755 22.406 1.00 36.55  ? 104 LEU A CG  1 
ATOM   844  C CD1 . LEU A 1 110 ? 31.050  37.948 23.641 1.00 33.90  ? 104 LEU A CD1 1 
ATOM   845  C CD2 . LEU A 1 110 ? 29.798  37.948 21.478 1.00 36.38  ? 104 LEU A CD2 1 
ATOM   846  N N   . GLU A 1 111 ? 33.122  40.764 23.609 1.00 46.96  ? 105 GLU A N   1 
ATOM   847  C CA  . GLU A 1 111 ? 34.458  40.992 23.067 1.00 51.70  ? 105 GLU A CA  1 
ATOM   848  C C   . GLU A 1 111 ? 34.945  39.655 22.578 1.00 45.02  ? 105 GLU A C   1 
ATOM   849  O O   . GLU A 1 111 ? 34.892  38.680 23.313 1.00 46.15  ? 105 GLU A O   1 
ATOM   850  C CB  . GLU A 1 111 ? 35.421  41.528 24.144 1.00 60.91  ? 105 GLU A CB  1 
ATOM   851  C CG  . GLU A 1 111 ? 35.021  42.890 24.754 1.00 75.35  ? 105 GLU A CG  1 
ATOM   852  C CD  . GLU A 1 111 ? 35.032  44.059 23.734 1.00 81.97  ? 105 GLU A CD  1 
ATOM   853  O OE1 . GLU A 1 111 ? 34.016  44.264 23.019 1.00 79.88  ? 105 GLU A OE1 1 
ATOM   854  O OE2 . GLU A 1 111 ? 36.057  44.785 23.659 1.00 86.43  ? 105 GLU A OE2 1 
ATOM   855  N N   . ILE A 1 112 ? 35.324  39.583 21.312 1.00 49.01  ? 106 ILE A N   1 
ATOM   856  C CA  . ILE A 1 112 ? 35.826  38.336 20.729 1.00 52.98  ? 106 ILE A CA  1 
ATOM   857  C C   . ILE A 1 112 ? 37.331  38.471 20.501 1.00 53.81  ? 106 ILE A C   1 
ATOM   858  O O   . ILE A 1 112 ? 37.779  39.444 19.886 1.00 54.74  ? 106 ILE A O   1 
ATOM   859  C CB  . ILE A 1 112 ? 35.124  37.998 19.373 1.00 52.52  ? 106 ILE A CB  1 
ATOM   860  C CG1 . ILE A 1 112 ? 33.598  37.972 19.535 1.00 46.36  ? 106 ILE A CG1 1 
ATOM   861  C CG2 . ILE A 1 112 ? 35.596  36.642 18.859 1.00 53.06  ? 106 ILE A CG2 1 
ATOM   862  C CD1 . ILE A 1 112 ? 33.090  36.929 20.505 1.00 45.50  ? 106 ILE A CD1 1 
ATOM   863  N N   . LYS A 1 113 ? 38.107  37.517 21.019 1.00 53.43  ? 107 LYS A N   1 
ATOM   864  C CA  . LYS A 1 113 ? 39.564  37.546 20.867 1.00 57.55  ? 107 LYS A CA  1 
ATOM   865  C C   . LYS A 1 113 ? 39.961  36.820 19.596 1.00 56.22  ? 107 LYS A C   1 
ATOM   866  O O   . LYS A 1 113 ? 39.237  35.846 19.288 1.00 58.78  ? 107 LYS A O   1 
ATOM   867  C CB  . LYS A 1 113 ? 40.252  36.892 22.073 1.00 61.61  ? 107 LYS A CB  1 
ATOM   868  C CG  . LYS A 1 113 ? 39.804  37.443 23.435 1.00 67.96  ? 107 LYS A CG  1 
ATOM   869  C CD  . LYS A 1 113 ? 40.493  36.730 24.601 1.00 70.35  ? 107 LYS A CD  1 
ATOM   870  C CE  . LYS A 1 113 ? 41.933  37.208 24.763 1.00 75.47  ? 107 LYS A CE  1 
ATOM   871  N NZ  . LYS A 1 113 ? 42.876  36.123 25.193 1.00 79.20  ? 107 LYS A NZ  1 
ATOM   872  N N   . GLY B 2 1   ? 18.451  45.765 -0.722 1.00 65.51  ? 0   GLY B N   1 
ATOM   873  C CA  . GLY B 2 1   ? 18.393  47.155 -0.154 1.00 64.33  ? 0   GLY B CA  1 
ATOM   874  C C   . GLY B 2 1   ? 16.922  47.540 -0.113 1.00 66.14  ? 0   GLY B C   1 
ATOM   875  O O   . GLY B 2 1   ? 16.249  47.324 0.891  1.00 68.21  ? 0   GLY B O   1 
ATOM   876  N N   . GLN B 2 2   ? 16.438  48.093 -1.223 1.00 61.64  ? 1   GLN B N   1 
ATOM   877  C CA  . GLN B 2 2   ? 15.042  48.519 -1.464 1.00 57.95  ? 1   GLN B CA  1 
ATOM   878  C C   . GLN B 2 2   ? 14.144  49.273 -0.438 1.00 52.79  ? 1   GLN B C   1 
ATOM   879  O O   . GLN B 2 2   ? 13.379  50.154 -0.804 1.00 51.84  ? 1   GLN B O   1 
ATOM   880  C CB  . GLN B 2 2   ? 14.249  47.388 -2.136 1.00 54.69  ? 1   GLN B CB  1 
ATOM   881  C CG  . GLN B 2 2   ? 13.140  47.937 -3.051 1.00 66.66  ? 1   GLN B CG  1 
ATOM   882  C CD  . GLN B 2 2   ? 12.473  46.904 -3.941 1.00 67.94  ? 1   GLN B CD  1 
ATOM   883  O OE1 . GLN B 2 2   ? 11.383  46.410 -3.637 1.00 68.42  ? 1   GLN B OE1 1 
ATOM   884  N NE2 . GLN B 2 2   ? 13.090  46.617 -5.076 1.00 66.53  ? 1   GLN B NE2 1 
ATOM   885  N N   . VAL B 2 3   ? 14.232  48.964 0.839  1.00 48.65  ? 2   VAL B N   1 
ATOM   886  C CA  . VAL B 2 3   ? 13.419  49.638 1.830  1.00 38.56  ? 2   VAL B CA  1 
ATOM   887  C C   . VAL B 2 3   ? 14.366  50.440 2.711  1.00 41.14  ? 2   VAL B C   1 
ATOM   888  O O   . VAL B 2 3   ? 15.333  49.891 3.245  1.00 40.29  ? 2   VAL B O   1 
ATOM   889  C CB  . VAL B 2 3   ? 12.667  48.619 2.692  1.00 37.65  ? 2   VAL B CB  1 
ATOM   890  C CG1 . VAL B 2 3   ? 11.943  49.297 3.860  1.00 28.60  ? 2   VAL B CG1 1 
ATOM   891  C CG2 . VAL B 2 3   ? 11.694  47.876 1.829  1.00 38.95  ? 2   VAL B CG2 1 
ATOM   892  N N   . GLN B 2 4   ? 14.132  51.746 2.808  1.00 40.94  ? 3   GLN B N   1 
ATOM   893  C CA  . GLN B 2 4   ? 14.973  52.613 3.630  1.00 38.60  ? 3   GLN B CA  1 
ATOM   894  C C   . GLN B 2 4   ? 14.162  53.565 4.515  1.00 35.04  ? 3   GLN B C   1 
ATOM   895  O O   . GLN B 2 4   ? 13.080  53.989 4.138  1.00 36.47  ? 3   GLN B O   1 
ATOM   896  C CB  . GLN B 2 4   ? 15.909  53.445 2.742  1.00 35.77  ? 3   GLN B CB  1 
ATOM   897  C CG  . GLN B 2 4   ? 16.727  52.663 1.746  1.00 38.08  ? 3   GLN B CG  1 
ATOM   898  C CD  . GLN B 2 4   ? 17.849  51.865 2.383  1.00 41.54  ? 3   GLN B CD  1 
ATOM   899  O OE1 . GLN B 2 4   ? 18.126  51.988 3.577  1.00 35.30  ? 3   GLN B OE1 1 
ATOM   900  N NE2 . GLN B 2 4   ? 18.536  51.080 1.574  1.00 46.31  ? 3   GLN B NE2 1 
ATOM   901  N N   . LEU B 2 5   ? 14.675  53.841 5.712  1.00 35.81  ? 4   LEU B N   1 
ATOM   902  C CA  . LEU B 2 5   ? 14.081  54.783 6.680  1.00 34.55  ? 4   LEU B CA  1 
ATOM   903  C C   . LEU B 2 5   ? 15.197  55.821 6.899  1.00 32.70  ? 4   LEU B C   1 
ATOM   904  O O   . LEU B 2 5   ? 16.254  55.533 7.457  1.00 35.41  ? 4   LEU B O   1 
ATOM   905  C CB  . LEU B 2 5   ? 13.738  54.093 8.019  1.00 32.15  ? 4   LEU B CB  1 
ATOM   906  C CG  . LEU B 2 5   ? 12.369  53.424 8.171  1.00 37.87  ? 4   LEU B CG  1 
ATOM   907  C CD1 . LEU B 2 5   ? 12.199  52.365 7.093  1.00 35.62  ? 4   LEU B CD1 1 
ATOM   908  C CD2 . LEU B 2 5   ? 12.188  52.810 9.581  1.00 33.70  ? 4   LEU B CD2 1 
ATOM   909  N N   . VAL B 2 6   ? 14.993  57.021 6.409  1.00 32.93  ? 5   VAL B N   1 
ATOM   910  C CA  . VAL B 2 6   ? 16.005  58.036 6.545  1.00 29.57  ? 5   VAL B CA  1 
ATOM   911  C C   . VAL B 2 6   ? 15.474  59.138 7.424  1.00 35.36  ? 5   VAL B C   1 
ATOM   912  O O   . VAL B 2 6   ? 14.493  59.827 7.081  1.00 35.65  ? 5   VAL B O   1 
ATOM   913  C CB  . VAL B 2 6   ? 16.343  58.594 5.178  1.00 27.98  ? 5   VAL B CB  1 
ATOM   914  C CG1 . VAL B 2 6   ? 17.413  59.691 5.297  1.00 29.45  ? 5   VAL B CG1 1 
ATOM   915  C CG2 . VAL B 2 6   ? 16.782  57.435 4.267  1.00 25.21  ? 5   VAL B CG2 1 
ATOM   916  N N   . GLU B 2 7   ? 16.084  59.291 8.583  1.00 34.24  ? 6   GLU B N   1 
ATOM   917  C CA  . GLU B 2 7   ? 15.616  60.338 9.453  1.00 39.22  ? 6   GLU B CA  1 
ATOM   918  C C   . GLU B 2 7   ? 16.478  61.594 9.271  1.00 39.12  ? 6   GLU B C   1 
ATOM   919  O O   . GLU B 2 7   ? 17.689  61.503 8.988  1.00 30.82  ? 6   GLU B O   1 
ATOM   920  C CB  . GLU B 2 7   ? 15.486  59.860 10.914 1.00 42.55  ? 6   GLU B CB  1 
ATOM   921  C CG  . GLU B 2 7   ? 16.665  59.072 11.524 1.00 50.19  ? 6   GLU B CG  1 
ATOM   922  C CD  . GLU B 2 7   ? 16.709  57.597 11.147 1.00 47.71  ? 6   GLU B CD  1 
ATOM   923  O OE1 . GLU B 2 7   ? 17.218  57.300 10.051 1.00 54.77  ? 6   GLU B OE1 1 
ATOM   924  O OE2 . GLU B 2 7   ? 16.286  56.734 11.955 1.00 43.32  ? 6   GLU B OE2 1 
ATOM   925  N N   . SER B 2 8   ? 15.802  62.742 9.271  1.00 36.46  ? 7   SER B N   1 
ATOM   926  C CA  . SER B 2 8   ? 16.438  64.036 9.114  1.00 35.21  ? 7   SER B CA  1 
ATOM   927  C C   . SER B 2 8   ? 16.032  65.018 10.222 1.00 41.45  ? 7   SER B C   1 
ATOM   928  O O   . SER B 2 8   ? 14.847  65.276 10.468 1.00 36.40  ? 7   SER B O   1 
ATOM   929  C CB  . SER B 2 8   ? 16.116  64.634 7.745  1.00 34.48  ? 7   SER B CB  1 
ATOM   930  O OG  . SER B 2 8   ? 14.741  64.932 7.639  1.00 38.62  ? 7   SER B OG  1 
ATOM   931  N N   . GLY B 2 9   ? 17.043  65.575 10.879 1.00 47.00  ? 8   GLY B N   1 
ATOM   932  C CA  . GLY B 2 9   ? 16.810  66.520 11.947 1.00 46.71  ? 8   GLY B CA  1 
ATOM   933  C C   . GLY B 2 9   ? 17.657  67.763 11.759 1.00 47.63  ? 8   GLY B C   1 
ATOM   934  O O   . GLY B 2 9   ? 18.189  68.024 10.677 1.00 47.67  ? 8   GLY B O   1 
ATOM   935  N N   . PRO B 2 10  ? 17.767  68.577 12.811 1.00 46.38  ? 9   PRO B N   1 
ATOM   936  C CA  . PRO B 2 10  ? 18.530  69.822 12.837 1.00 41.56  ? 9   PRO B CA  1 
ATOM   937  C C   . PRO B 2 10  ? 20.010  69.730 13.162 1.00 43.19  ? 9   PRO B C   1 
ATOM   938  O O   . PRO B 2 10  ? 20.729  70.707 12.984 1.00 54.57  ? 9   PRO B O   1 
ATOM   939  C CB  . PRO B 2 10  ? 17.816  70.613 13.914 1.00 39.66  ? 9   PRO B CB  1 
ATOM   940  C CG  . PRO B 2 10  ? 17.383  69.531 14.873 1.00 36.29  ? 9   PRO B CG  1 
ATOM   941  C CD  . PRO B 2 10  ? 16.854  68.491 13.966 1.00 41.54  ? 9   PRO B CD  1 
ATOM   942  N N   . GLY B 2 11  ? 20.484  68.592 13.653 1.00 45.95  ? 10  GLY B N   1 
ATOM   943  C CA  . GLY B 2 11  ? 21.890  68.518 14.002 1.00 43.75  ? 10  GLY B CA  1 
ATOM   944  C C   . GLY B 2 11  ? 22.064  69.278 15.303 1.00 43.45  ? 10  GLY B C   1 
ATOM   945  O O   . GLY B 2 11  ? 21.726  68.740 16.352 1.00 51.75  ? 10  GLY B O   1 
ATOM   946  N N   . LEU B 2 12  ? 22.546  70.517 15.277 1.00 43.05  ? 11  LEU B N   1 
ATOM   947  C CA  . LEU B 2 12  ? 22.686  71.254 16.538 1.00 42.37  ? 11  LEU B CA  1 
ATOM   948  C C   . LEU B 2 12  ? 21.478  72.162 16.750 1.00 47.75  ? 11  LEU B C   1 
ATOM   949  O O   . LEU B 2 12  ? 20.986  72.807 15.796 1.00 40.67  ? 11  LEU B O   1 
ATOM   950  C CB  . LEU B 2 12  ? 23.969  72.097 16.603 1.00 45.76  ? 11  LEU B CB  1 
ATOM   951  C CG  . LEU B 2 12  ? 25.324  71.412 16.485 1.00 42.13  ? 11  LEU B CG  1 
ATOM   952  C CD1 . LEU B 2 12  ? 25.574  71.000 15.027 1.00 43.32  ? 11  LEU B CD1 1 
ATOM   953  C CD2 . LEU B 2 12  ? 26.363  72.379 16.941 1.00 32.84  ? 11  LEU B CD2 1 
ATOM   954  N N   . VAL B 2 13  ? 21.027  72.228 18.006 1.00 49.78  ? 12  VAL B N   1 
ATOM   955  C CA  . VAL B 2 13  ? 19.875  73.035 18.399 1.00 49.71  ? 12  VAL B CA  1 
ATOM   956  C C   . VAL B 2 13  ? 20.038  73.647 19.791 1.00 49.82  ? 12  VAL B C   1 
ATOM   957  O O   . VAL B 2 13  ? 20.524  72.996 20.714 1.00 48.96  ? 12  VAL B O   1 
ATOM   958  C CB  . VAL B 2 13  ? 18.572  72.188 18.379 1.00 49.49  ? 12  VAL B CB  1 
ATOM   959  C CG1 . VAL B 2 13  ? 17.438  72.918 19.057 1.00 53.95  ? 12  VAL B CG1 1 
ATOM   960  C CG2 . VAL B 2 13  ? 18.165  71.942 16.979 1.00 55.57  ? 12  VAL B CG2 1 
ATOM   961  N N   . ALA B 2 14  ? 19.568  74.886 19.930 1.00 50.65  ? 13  ALA B N   1 
ATOM   962  C CA  . ALA B 2 14  ? 19.618  75.633 21.178 1.00 48.53  ? 13  ALA B CA  1 
ATOM   963  C C   . ALA B 2 14  ? 18.602  75.017 22.141 1.00 49.45  ? 13  ALA B C   1 
ATOM   964  O O   . ALA B 2 14  ? 17.587  74.493 21.703 1.00 53.97  ? 13  ALA B O   1 
ATOM   965  C CB  . ALA B 2 14  ? 19.260  77.098 20.894 1.00 43.92  ? 13  ALA B CB  1 
ATOM   966  N N   . PRO B 2 15  ? 18.881  75.024 23.458 1.00 47.24  ? 14  PRO B N   1 
ATOM   967  C CA  . PRO B 2 15  ? 17.926  74.452 24.406 1.00 45.41  ? 14  PRO B CA  1 
ATOM   968  C C   . PRO B 2 15  ? 16.570  75.184 24.487 1.00 50.67  ? 14  PRO B C   1 
ATOM   969  O O   . PRO B 2 15  ? 16.385  76.263 23.901 1.00 47.63  ? 14  PRO B O   1 
ATOM   970  C CB  . PRO B 2 15  ? 18.700  74.476 25.719 1.00 39.98  ? 14  PRO B CB  1 
ATOM   971  C CG  . PRO B 2 15  ? 20.098  74.240 25.270 1.00 43.26  ? 14  PRO B CG  1 
ATOM   972  C CD  . PRO B 2 15  ? 20.192  75.211 24.104 1.00 48.61  ? 14  PRO B CD  1 
ATOM   973  N N   . SER B 2 16  ? 15.635  74.562 25.219 1.00 60.98  ? 15  SER B N   1 
ATOM   974  C CA  . SER B 2 16  ? 14.230  74.992 25.421 1.00 71.28  ? 15  SER B CA  1 
ATOM   975  C C   . SER B 2 16  ? 13.505  75.437 24.147 1.00 75.52  ? 15  SER B C   1 
ATOM   976  O O   . SER B 2 16  ? 12.345  75.875 24.183 1.00 76.47  ? 15  SER B O   1 
ATOM   977  C CB  . SER B 2 16  ? 14.008  75.945 26.619 1.00 70.08  ? 15  SER B CB  1 
ATOM   978  O OG  . SER B 2 16  ? 14.680  77.180 26.492 1.00 79.33  ? 15  SER B OG  1 
ATOM   979  N N   . GLN B 2 17  ? 14.197  75.205 23.029 1.00 79.76  ? 16  GLN B N   1 
ATOM   980  C CA  . GLN B 2 17  ? 13.771  75.438 21.650 1.00 77.43  ? 16  GLN B CA  1 
ATOM   981  C C   . GLN B 2 17  ? 13.144  74.052 21.309 1.00 75.90  ? 16  GLN B C   1 
ATOM   982  O O   . GLN B 2 17  ? 13.381  73.067 22.035 1.00 79.65  ? 16  GLN B O   1 
ATOM   983  C CB  . GLN B 2 17  ? 15.031  75.708 20.810 1.00 73.81  ? 16  GLN B CB  1 
ATOM   984  C CG  . GLN B 2 17  ? 14.825  75.752 19.324 1.00 77.33  ? 16  GLN B CG  1 
ATOM   985  C CD  . GLN B 2 17  ? 14.499  77.134 18.825 1.00 75.24  ? 16  GLN B CD  1 
ATOM   986  O OE1 . GLN B 2 17  ? 14.684  78.113 19.534 1.00 75.68  ? 16  GLN B OE1 1 
ATOM   987  N NE2 . GLN B 2 17  ? 14.015  77.224 17.593 1.00 71.72  ? 16  GLN B NE2 1 
ATOM   988  N N   . SER B 2 18  ? 12.330  73.939 20.264 1.00 69.68  ? 17  SER B N   1 
ATOM   989  C CA  . SER B 2 18  ? 11.722  72.630 19.998 1.00 66.99  ? 17  SER B CA  1 
ATOM   990  C C   . SER B 2 18  ? 12.398  71.795 18.914 1.00 63.41  ? 17  SER B C   1 
ATOM   991  O O   . SER B 2 18  ? 12.845  72.324 17.892 1.00 66.06  ? 17  SER B O   1 
ATOM   992  C CB  . SER B 2 18  ? 10.230  72.776 19.700 1.00 62.89  ? 17  SER B CB  1 
ATOM   993  O OG  . SER B 2 18  ? 10.033  73.563 18.537 1.00 72.67  ? 17  SER B OG  1 
ATOM   994  N N   . LEU B 2 19  ? 12.491  70.494 19.159 1.00 53.40  ? 18  LEU B N   1 
ATOM   995  C CA  . LEU B 2 19  ? 13.079  69.566 18.208 1.00 48.35  ? 18  LEU B CA  1 
ATOM   996  C C   . LEU B 2 19  ? 12.023  69.087 17.230 1.00 50.00  ? 18  LEU B C   1 
ATOM   997  O O   . LEU B 2 19  ? 10.844  69.023 17.566 1.00 48.24  ? 18  LEU B O   1 
ATOM   998  C CB  . LEU B 2 19  ? 13.613  68.355 18.941 1.00 48.44  ? 18  LEU B CB  1 
ATOM   999  C CG  . LEU B 2 19  ? 14.136  67.227 18.073 1.00 45.99  ? 18  LEU B CG  1 
ATOM   1000 C CD1 . LEU B 2 19  ? 15.326  67.758 17.311 1.00 50.39  ? 18  LEU B CD1 1 
ATOM   1001 C CD2 . LEU B 2 19  ? 14.533  66.034 18.944 1.00 43.83  ? 18  LEU B CD2 1 
ATOM   1002 N N   . SER B 2 20  ? 12.452  68.752 16.018 1.00 47.96  ? 19  SER B N   1 
ATOM   1003 C CA  . SER B 2 20  ? 11.567  68.234 14.970 1.00 48.88  ? 19  SER B CA  1 
ATOM   1004 C C   . SER B 2 20  ? 12.416  67.295 14.126 1.00 50.56  ? 19  SER B C   1 
ATOM   1005 O O   . SER B 2 20  ? 13.532  67.626 13.737 1.00 57.29  ? 19  SER B O   1 
ATOM   1006 C CB  . SER B 2 20  ? 10.984  69.345 14.100 1.00 43.44  ? 19  SER B CB  1 
ATOM   1007 O OG  . SER B 2 20  ? 10.074  70.136 14.834 1.00 49.99  ? 19  SER B OG  1 
ATOM   1008 N N   . ILE B 2 21  ? 11.926  66.088 13.923 1.00 49.43  ? 20  ILE B N   1 
ATOM   1009 C CA  . ILE B 2 21  ? 12.657  65.109 13.163 1.00 46.26  ? 20  ILE B CA  1 
ATOM   1010 C C   . ILE B 2 21  ? 11.660  64.458 12.232 1.00 46.77  ? 20  ILE B C   1 
ATOM   1011 O O   . ILE B 2 21  ? 10.465  64.398 12.554 1.00 44.78  ? 20  ILE B O   1 
ATOM   1012 C CB  . ILE B 2 21  ? 13.255  64.053 14.096 1.00 46.52  ? 20  ILE B CB  1 
ATOM   1013 C CG1 . ILE B 2 21  ? 14.122  64.707 15.153 1.00 44.28  ? 20  ILE B CG1 1 
ATOM   1014 C CG2 . ILE B 2 21  ? 14.179  63.124 13.329 1.00 57.62  ? 20  ILE B CG2 1 
ATOM   1015 C CD1 . ILE B 2 21  ? 14.593  63.709 16.170 1.00 48.12  ? 20  ILE B CD1 1 
ATOM   1016 N N   . THR B 2 22  ? 12.128  64.060 11.048 1.00 44.36  ? 21  THR B N   1 
ATOM   1017 C CA  . THR B 2 22  ? 11.273  63.388 10.082 1.00 39.38  ? 21  THR B CA  1 
ATOM   1018 C C   . THR B 2 22  ? 11.876  62.081 9.605  1.00 44.09  ? 21  THR B C   1 
ATOM   1019 O O   . THR B 2 22  ? 13.050  62.023 9.187  1.00 44.59  ? 21  THR B O   1 
ATOM   1020 C CB  . THR B 2 22  ? 10.983  64.243 8.855  1.00 34.05  ? 21  THR B CB  1 
ATOM   1021 O OG1 . THR B 2 22  ? 10.432  65.494 9.267  1.00 38.47  ? 21  THR B OG1 1 
ATOM   1022 C CG2 . THR B 2 22  ? 9.968   63.551 7.968  1.00 32.43  ? 21  THR B CG2 1 
ATOM   1023 N N   . CYS B 2 23  ? 11.083  61.019 9.726  1.00 39.91  ? 22  CYS B N   1 
ATOM   1024 C CA  . CYS B 2 23  ? 11.507  59.723 9.265  1.00 38.19  ? 22  CYS B CA  1 
ATOM   1025 C C   . CYS B 2 23  ? 10.906  59.596 7.892  1.00 38.95  ? 22  CYS B C   1 
ATOM   1026 O O   . CYS B 2 23  ? 9.693   59.743 7.751  1.00 40.76  ? 22  CYS B O   1 
ATOM   1027 C CB  . CYS B 2 23  ? 10.934  58.637 10.140 1.00 37.53  ? 22  CYS B CB  1 
ATOM   1028 S SG  . CYS B 2 23  ? 11.423  56.964 9.612  1.00 39.00  ? 22  CYS B SG  1 
ATOM   1029 N N   . THR B 2 24  ? 11.744  59.431 6.869  1.00 37.26  ? 23  THR B N   1 
ATOM   1030 C CA  . THR B 2 24  ? 11.227  59.278 5.520  1.00 37.29  ? 23  THR B CA  1 
ATOM   1031 C C   . THR B 2 24  ? 11.376  57.820 5.159  1.00 37.93  ? 23  THR B C   1 
ATOM   1032 O O   . THR B 2 24  ? 12.482  57.296 5.208  1.00 39.51  ? 23  THR B O   1 
ATOM   1033 C CB  . THR B 2 24  ? 11.968  60.132 4.482  1.00 38.92  ? 23  THR B CB  1 
ATOM   1034 O OG1 . THR B 2 24  ? 11.935  61.514 4.877  1.00 38.77  ? 23  THR B OG1 1 
ATOM   1035 C CG2 . THR B 2 24  ? 11.293  59.962 3.116  1.00 26.93  ? 23  THR B CG2 1 
ATOM   1036 N N   . VAL B 2 25  ? 10.250  57.177 4.840  1.00 42.35  ? 24  VAL B N   1 
ATOM   1037 C CA  . VAL B 2 25  ? 10.182  55.755 4.486  1.00 39.50  ? 24  VAL B CA  1 
ATOM   1038 C C   . VAL B 2 25  ? 10.003  55.473 2.984  1.00 43.72  ? 24  VAL B C   1 
ATOM   1039 O O   . VAL B 2 25  ? 9.300   56.210 2.272  1.00 46.22  ? 24  VAL B O   1 
ATOM   1040 C CB  . VAL B 2 25  ? 9.044   55.059 5.237  1.00 31.24  ? 24  VAL B CB  1 
ATOM   1041 C CG1 . VAL B 2 25  ? 9.200   53.575 5.132  1.00 35.12  ? 24  VAL B CG1 1 
ATOM   1042 C CG2 . VAL B 2 25  ? 9.049   55.466 6.664  1.00 28.09  ? 24  VAL B CG2 1 
ATOM   1043 N N   . SER B 2 26  ? 10.624  54.386 2.523  1.00 44.23  ? 25  SER B N   1 
ATOM   1044 C CA  . SER B 2 26  ? 10.565  53.983 1.121  1.00 43.06  ? 25  SER B CA  1 
ATOM   1045 C C   . SER B 2 26  ? 10.399  52.470 0.960  1.00 43.80  ? 25  SER B C   1 
ATOM   1046 O O   . SER B 2 26  ? 10.904  51.694 1.781  1.00 39.88  ? 25  SER B O   1 
ATOM   1047 C CB  . SER B 2 26  ? 11.857  54.403 0.402  1.00 39.39  ? 25  SER B CB  1 
ATOM   1048 O OG  . SER B 2 26  ? 12.990  53.726 0.944  1.00 31.77  ? 25  SER B OG  1 
ATOM   1049 N N   . GLY B 2 27  ? 9.660   52.066 -0.072 1.00 42.06  ? 26  GLY B N   1 
ATOM   1050 C CA  . GLY B 2 27  ? 9.500   50.654 -0.354 1.00 37.92  ? 26  GLY B CA  1 
ATOM   1051 C C   . GLY B 2 27  ? 8.453   49.867 0.385  1.00 39.56  ? 26  GLY B C   1 
ATOM   1052 O O   . GLY B 2 27  ? 8.316   48.672 0.129  1.00 47.01  ? 26  GLY B O   1 
ATOM   1053 N N   . ILE B 2 28  ? 7.760   50.493 1.326  1.00 35.03  ? 27  ILE B N   1 
ATOM   1054 C CA  . ILE B 2 28  ? 6.714   49.816 2.089  1.00 35.11  ? 27  ILE B CA  1 
ATOM   1055 C C   . ILE B 2 28  ? 5.548   50.767 2.288  1.00 41.33  ? 27  ILE B C   1 
ATOM   1056 O O   . ILE B 2 28  ? 5.671   51.984 2.115  1.00 43.53  ? 27  ILE B O   1 
ATOM   1057 C CB  . ILE B 2 28  ? 7.162   49.391 3.508  1.00 37.24  ? 27  ILE B CB  1 
ATOM   1058 C CG1 . ILE B 2 28  ? 7.595   50.633 4.291  1.00 39.14  ? 27  ILE B CG1 1 
ATOM   1059 C CG2 . ILE B 2 28  ? 8.250   48.301 3.464  1.00 38.92  ? 27  ILE B CG2 1 
ATOM   1060 C CD1 . ILE B 2 28  ? 7.667   50.443 5.762  1.00 32.48  ? 27  ILE B CD1 1 
ATOM   1061 N N   . SER B 2 29  ? 4.428   50.195 2.714  1.00 50.81  ? 28  SER B N   1 
ATOM   1062 C CA  . SER B 2 29  ? 3.196   50.940 2.960  1.00 52.54  ? 28  SER B CA  1 
ATOM   1063 C C   . SER B 2 29  ? 3.042   51.207 4.453  1.00 48.81  ? 28  SER B C   1 
ATOM   1064 O O   . SER B 2 29  ? 2.982   50.266 5.253  1.00 41.14  ? 28  SER B O   1 
ATOM   1065 C CB  . SER B 2 29  ? 1.993   50.144 2.446  1.00 51.99  ? 28  SER B CB  1 
ATOM   1066 O OG  . SER B 2 29  ? 0.779   50.823 2.707  1.00 59.54  ? 28  SER B OG  1 
ATOM   1067 N N   . LEU B 2 30  ? 2.917   52.484 4.810  1.00 46.33  ? 29  LEU B N   1 
ATOM   1068 C CA  . LEU B 2 30  ? 2.780   52.884 6.202  1.00 46.84  ? 29  LEU B CA  1 
ATOM   1069 C C   . LEU B 2 30  ? 1.561   52.362 6.926  1.00 48.89  ? 29  LEU B C   1 
ATOM   1070 O O   . LEU B 2 30  ? 1.557   52.293 8.156  1.00 56.58  ? 29  LEU B O   1 
ATOM   1071 C CB  . LEU B 2 30  ? 2.838   54.396 6.340  1.00 49.23  ? 29  LEU B CB  1 
ATOM   1072 C CG  . LEU B 2 30  ? 4.205   55.037 6.137  1.00 47.53  ? 29  LEU B CG  1 
ATOM   1073 C CD1 . LEU B 2 30  ? 4.137   56.442 6.686  1.00 43.34  ? 29  LEU B CD1 1 
ATOM   1074 C CD2 . LEU B 2 30  ? 5.295   54.226 6.854  1.00 42.36  ? 29  LEU B CD2 1 
ATOM   1075 N N   . SER B 2 31  ? 0.520   52.020 6.176  1.00 47.58  ? 30  SER B N   1 
ATOM   1076 C CA  . SER B 2 31  ? -0.706  51.470 6.758  1.00 48.28  ? 30  SER B CA  1 
ATOM   1077 C C   . SER B 2 31  ? -0.434  50.075 7.311  1.00 47.69  ? 30  SER B C   1 
ATOM   1078 O O   . SER B 2 31  ? -1.008  49.666 8.316  1.00 50.46  ? 30  SER B O   1 
ATOM   1079 C CB  . SER B 2 31  ? -1.783  51.329 5.691  1.00 43.76  ? 30  SER B CB  1 
ATOM   1080 O OG  . SER B 2 31  ? -1.947  52.532 4.985  1.00 53.60  ? 30  SER B OG  1 
ATOM   1081 N N   . ARG B 2 32  ? 0.443   49.353 6.633  1.00 46.18  ? 31  ARG B N   1 
ATOM   1082 C CA  . ARG B 2 32  ? 0.775   47.992 6.997  1.00 45.19  ? 31  ARG B CA  1 
ATOM   1083 C C   . ARG B 2 32  ? 2.003   47.835 7.889  1.00 42.41  ? 31  ARG B C   1 
ATOM   1084 O O   . ARG B 2 32  ? 2.480   46.719 8.100  1.00 45.83  ? 31  ARG B O   1 
ATOM   1085 C CB  . ARG B 2 32  ? 0.961   47.175 5.719  1.00 48.20  ? 31  ARG B CB  1 
ATOM   1086 C CG  . ARG B 2 32  ? -0.224  47.198 4.745  1.00 47.99  ? 31  ARG B CG  1 
ATOM   1087 C CD  . ARG B 2 32  ? 0.008   46.223 3.591  1.00 52.77  ? 31  ARG B CD  1 
ATOM   1088 N NE  . ARG B 2 32  ? 0.331   44.889 4.104  1.00 58.31  ? 31  ARG B NE  1 
ATOM   1089 C CZ  . ARG B 2 32  ? 1.567   44.430 4.307  1.00 59.02  ? 31  ARG B CZ  1 
ATOM   1090 N NH1 . ARG B 2 32  ? 2.632   45.173 4.038  1.00 63.46  ? 31  ARG B NH1 1 
ATOM   1091 N NH2 . ARG B 2 32  ? 1.743   43.249 4.872  1.00 67.76  ? 31  ARG B NH2 1 
ATOM   1092 N N   . TYR B 2 33  ? 2.506   48.938 8.426  1.00 44.77  ? 32  TYR B N   1 
ATOM   1093 C CA  . TYR B 2 33  ? 3.697   48.890 9.271  1.00 41.15  ? 32  TYR B CA  1 
ATOM   1094 C C   . TYR B 2 33  ? 3.622   49.829 10.482 1.00 39.92  ? 32  TYR B C   1 
ATOM   1095 O O   . TYR B 2 33  ? 3.023   50.903 10.431 1.00 39.39  ? 32  TYR B O   1 
ATOM   1096 C CB  . TYR B 2 33  ? 4.944   49.212 8.433  1.00 36.23  ? 32  TYR B CB  1 
ATOM   1097 C CG  . TYR B 2 33  ? 5.497   48.061 7.602  1.00 37.47  ? 32  TYR B CG  1 
ATOM   1098 C CD1 . TYR B 2 33  ? 4.975   47.745 6.334  1.00 35.40  ? 32  TYR B CD1 1 
ATOM   1099 C CD2 . TYR B 2 33  ? 6.571   47.311 8.071  1.00 27.96  ? 32  TYR B CD2 1 
ATOM   1100 C CE1 . TYR B 2 33  ? 5.528   46.701 5.558  1.00 30.47  ? 32  TYR B CE1 1 
ATOM   1101 C CE2 . TYR B 2 33  ? 7.122   46.287 7.315  1.00 35.56  ? 32  TYR B CE2 1 
ATOM   1102 C CZ  . TYR B 2 33  ? 6.605   45.979 6.066  1.00 36.20  ? 32  TYR B CZ  1 
ATOM   1103 O OH  . TYR B 2 33  ? 7.194   44.942 5.365  1.00 44.05  ? 32  TYR B OH  1 
ATOM   1104 N N   . ASN B 2 34  ? 4.255   49.414 11.568 1.00 40.83  ? 33  ASN B N   1 
ATOM   1105 C CA  . ASN B 2 34  ? 4.279   50.183 12.798 1.00 43.74  ? 33  ASN B CA  1 
ATOM   1106 C C   . ASN B 2 34  ? 5.622   50.874 12.956 1.00 45.97  ? 33  ASN B C   1 
ATOM   1107 O O   . ASN B 2 34  ? 6.672   50.213 12.984 1.00 45.84  ? 33  ASN B O   1 
ATOM   1108 C CB  . ASN B 2 34  ? 4.072   49.251 13.982 1.00 49.22  ? 33  ASN B CB  1 
ATOM   1109 C CG  . ASN B 2 34  ? 2.673   48.724 14.072 1.00 41.56  ? 33  ASN B CG  1 
ATOM   1110 O OD1 . ASN B 2 34  ? 1.739   49.282 13.492 1.00 38.69  ? 33  ASN B OD1 1 
ATOM   1111 N ND2 . ASN B 2 34  ? 2.505   47.670 14.849 1.00 41.12  ? 33  ASN B ND2 1 
ATOM   1112 N N   . VAL B 2 35  ? 5.587   52.181 13.160 1.00 45.43  ? 34  VAL B N   1 
ATOM   1113 C CA  . VAL B 2 35  ? 6.823   52.929 13.293 1.00 41.83  ? 34  VAL B CA  1 
ATOM   1114 C C   . VAL B 2 35  ? 7.030   53.485 14.681 1.00 42.48  ? 34  VAL B C   1 
ATOM   1115 O O   . VAL B 2 35  ? 6.175   54.204 15.216 1.00 42.67  ? 34  VAL B O   1 
ATOM   1116 C CB  . VAL B 2 35  ? 6.897   54.072 12.281 1.00 39.54  ? 34  VAL B CB  1 
ATOM   1117 C CG1 . VAL B 2 35  ? 8.279   54.732 12.329 1.00 40.42  ? 34  VAL B CG1 1 
ATOM   1118 C CG2 . VAL B 2 35  ? 6.574   53.551 10.894 1.00 32.58  ? 34  VAL B CG2 1 
ATOM   1119 N N   . HIS B 2 36  ? 8.189   53.163 15.242 1.00 41.75  ? 35  HIS B N   1 
ATOM   1120 C CA  . HIS B 2 36  ? 8.593   53.603 16.567 1.00 39.93  ? 35  HIS B CA  1 
ATOM   1121 C C   . HIS B 2 36  ? 9.665   54.676 16.496 1.00 41.20  ? 35  HIS B C   1 
ATOM   1122 O O   . HIS B 2 36  ? 10.382  54.791 15.494 1.00 40.69  ? 35  HIS B O   1 
ATOM   1123 C CB  . HIS B 2 36  ? 9.208   52.447 17.314 1.00 40.09  ? 35  HIS B CB  1 
ATOM   1124 C CG  . HIS B 2 36  ? 8.297   51.272 17.471 1.00 43.65  ? 35  HIS B CG  1 
ATOM   1125 N ND1 . HIS B 2 36  ? 8.379   50.467 18.565 1.00 45.61  ? 35  HIS B ND1 1 
ATOM   1126 C CD2 . HIS B 2 36  ? 7.436   50.751 16.563 1.00 48.72  ? 35  HIS B CD2 1 
ATOM   1127 C CE1 . HIS B 2 36  ? 7.566   49.453 18.313 1.00 48.46  ? 35  HIS B CE1 1 
ATOM   1128 N NE2 . HIS B 2 36  ? 6.975   49.583 17.116 1.00 50.15  ? 35  HIS B NE2 1 
ATOM   1129 N N   . TRP B 2 37  ? 9.767   55.453 17.567 1.00 41.04  ? 36  TRP B N   1 
ATOM   1130 C CA  . TRP B 2 37  ? 10.785  56.485 17.698 1.00 39.88  ? 36  TRP B CA  1 
ATOM   1131 C C   . TRP B 2 37  ? 11.602  56.052 18.916 1.00 38.78  ? 36  TRP B C   1 
ATOM   1132 O O   . TRP B 2 37  ? 11.044  55.667 19.949 1.00 43.06  ? 36  TRP B O   1 
ATOM   1133 C CB  . TRP B 2 37  ? 10.160  57.857 17.890 1.00 40.40  ? 36  TRP B CB  1 
ATOM   1134 C CG  . TRP B 2 37  ? 9.758   58.536 16.598 1.00 40.80  ? 36  TRP B CG  1 
ATOM   1135 C CD1 . TRP B 2 37  ? 8.489   58.838 16.187 1.00 44.39  ? 36  TRP B CD1 1 
ATOM   1136 C CD2 . TRP B 2 37  ? 10.636  59.049 15.587 1.00 39.97  ? 36  TRP B CD2 1 
ATOM   1137 N NE1 . TRP B 2 37  ? 8.523   59.513 14.985 1.00 43.93  ? 36  TRP B NE1 1 
ATOM   1138 C CE2 . TRP B 2 37  ? 9.825   59.652 14.591 1.00 40.79  ? 36  TRP B CE2 1 
ATOM   1139 C CE3 . TRP B 2 37  ? 12.022  59.065 15.421 1.00 36.32  ? 36  TRP B CE3 1 
ATOM   1140 C CZ2 . TRP B 2 37  ? 10.360  60.256 13.460 1.00 36.09  ? 36  TRP B CZ2 1 
ATOM   1141 C CZ3 . TRP B 2 37  ? 12.549  59.667 14.296 1.00 36.43  ? 36  TRP B CZ3 1 
ATOM   1142 C CH2 . TRP B 2 37  ? 11.722  60.254 13.330 1.00 30.60  ? 36  TRP B CH2 1 
ATOM   1143 N N   . VAL B 2 38  ? 12.918  56.058 18.777 1.00 36.22  ? 37  VAL B N   1 
ATOM   1144 C CA  . VAL B 2 38  ? 13.818  55.599 19.826 1.00 33.82  ? 37  VAL B CA  1 
ATOM   1145 C C   . VAL B 2 38  ? 15.036  56.489 19.751 1.00 38.90  ? 37  VAL B C   1 
ATOM   1146 O O   . VAL B 2 38  ? 15.259  57.112 18.721 1.00 42.87  ? 37  VAL B O   1 
ATOM   1147 C CB  . VAL B 2 38  ? 14.259  54.153 19.504 1.00 28.18  ? 37  VAL B CB  1 
ATOM   1148 C CG1 . VAL B 2 38  ? 15.454  53.736 20.314 1.00 35.64  ? 37  VAL B CG1 1 
ATOM   1149 C CG2 . VAL B 2 38  ? 13.110  53.185 19.728 1.00 32.88  ? 37  VAL B CG2 1 
ATOM   1150 N N   . ARG B 2 39  ? 15.812  56.581 20.823 1.00 41.41  ? 38  ARG B N   1 
ATOM   1151 C CA  . ARG B 2 39  ? 17.021  57.399 20.794 1.00 41.75  ? 38  ARG B CA  1 
ATOM   1152 C C   . ARG B 2 39  ? 18.116  56.693 21.548 1.00 42.50  ? 38  ARG B C   1 
ATOM   1153 O O   . ARG B 2 39  ? 17.853  55.832 22.385 1.00 47.07  ? 38  ARG B O   1 
ATOM   1154 C CB  . ARG B 2 39  ? 16.779  58.786 21.385 1.00 41.45  ? 38  ARG B CB  1 
ATOM   1155 C CG  . ARG B 2 39  ? 16.749  58.862 22.889 1.00 35.73  ? 38  ARG B CG  1 
ATOM   1156 C CD  . ARG B 2 39  ? 16.499  60.294 23.303 1.00 38.43  ? 38  ARG B CD  1 
ATOM   1157 N NE  . ARG B 2 39  ? 16.367  60.396 24.744 1.00 42.09  ? 38  ARG B NE  1 
ATOM   1158 C CZ  . ARG B 2 39  ? 15.878  61.443 25.402 1.00 37.31  ? 38  ARG B CZ  1 
ATOM   1159 N NH1 . ARG B 2 39  ? 15.476  62.524 24.747 1.00 38.41  ? 38  ARG B NH1 1 
ATOM   1160 N NH2 . ARG B 2 39  ? 15.715  61.364 26.717 1.00 33.87  ? 38  ARG B NH2 1 
ATOM   1161 N N   . GLN B 2 40  ? 19.353  57.030 21.252 1.00 38.68  ? 39  GLN B N   1 
ATOM   1162 C CA  . GLN B 2 40  ? 20.423  56.351 21.934 1.00 35.56  ? 39  GLN B CA  1 
ATOM   1163 C C   . GLN B 2 40  ? 21.552  57.308 22.223 1.00 39.15  ? 39  GLN B C   1 
ATOM   1164 O O   . GLN B 2 40  ? 21.881  58.170 21.400 1.00 40.78  ? 39  GLN B O   1 
ATOM   1165 C CB  . GLN B 2 40  ? 20.915  55.198 21.076 1.00 36.19  ? 39  GLN B CB  1 
ATOM   1166 C CG  . GLN B 2 40  ? 21.932  54.294 21.745 1.00 35.65  ? 39  GLN B CG  1 
ATOM   1167 C CD  . GLN B 2 40  ? 22.458  53.261 20.787 1.00 40.59  ? 39  GLN B CD  1 
ATOM   1168 O OE1 . GLN B 2 40  ? 22.444  53.466 19.564 1.00 48.52  ? 39  GLN B OE1 1 
ATOM   1169 N NE2 . GLN B 2 40  ? 22.939  52.148 21.322 1.00 35.68  ? 39  GLN B NE2 1 
ATOM   1170 N N   . SER B 2 41  ? 22.135  57.160 23.405 1.00 38.87  ? 40  SER B N   1 
ATOM   1171 C CA  . SER B 2 41  ? 23.239  57.999 23.825 1.00 42.94  ? 40  SER B CA  1 
ATOM   1172 C C   . SER B 2 41  ? 24.131  57.160 24.702 1.00 46.01  ? 40  SER B C   1 
ATOM   1173 O O   . SER B 2 41  ? 23.688  56.142 25.242 1.00 49.89  ? 40  SER B O   1 
ATOM   1174 C CB  . SER B 2 41  ? 22.711  59.184 24.628 1.00 47.52  ? 40  SER B CB  1 
ATOM   1175 O OG  . SER B 2 41  ? 21.916  58.745 25.712 1.00 51.61  ? 40  SER B OG  1 
ATOM   1176 N N   . PRO B 2 42  ? 25.414  57.544 24.844 1.00 46.62  ? 41  PRO B N   1 
ATOM   1177 C CA  . PRO B 2 42  ? 26.292  56.744 25.697 1.00 47.10  ? 41  PRO B CA  1 
ATOM   1178 C C   . PRO B 2 42  ? 25.845  56.774 27.175 1.00 48.83  ? 41  PRO B C   1 
ATOM   1179 O O   . PRO B 2 42  ? 25.907  55.757 27.867 1.00 46.08  ? 41  PRO B O   1 
ATOM   1180 C CB  . PRO B 2 42  ? 27.653  57.429 25.513 1.00 44.30  ? 41  PRO B CB  1 
ATOM   1181 C CG  . PRO B 2 42  ? 27.574  57.978 24.139 1.00 39.90  ? 41  PRO B CG  1 
ATOM   1182 C CD  . PRO B 2 42  ? 26.187  58.588 24.152 1.00 42.09  ? 41  PRO B CD  1 
ATOM   1183 N N   . GLY B 2 43  ? 25.353  57.933 27.618 1.00 50.20  ? 42  GLY B N   1 
ATOM   1184 C CA  . GLY B 2 43  ? 24.934  58.120 28.996 1.00 47.85  ? 42  GLY B CA  1 
ATOM   1185 C C   . GLY B 2 43  ? 23.603  57.514 29.344 1.00 47.56  ? 42  GLY B C   1 
ATOM   1186 O O   . GLY B 2 43  ? 23.469  56.842 30.363 1.00 50.26  ? 42  GLY B O   1 
ATOM   1187 N N   . LYS B 2 44  ? 22.601  57.793 28.526 1.00 46.81  ? 43  LYS B N   1 
ATOM   1188 C CA  . LYS B 2 44  ? 21.263  57.264 28.750 1.00 48.98  ? 43  LYS B CA  1 
ATOM   1189 C C   . LYS B 2 44  ? 20.953  55.847 28.163 1.00 48.89  ? 43  LYS B C   1 
ATOM   1190 O O   . LYS B 2 44  ? 20.007  55.187 28.627 1.00 46.52  ? 43  LYS B O   1 
ATOM   1191 C CB  . LYS B 2 44  ? 20.239  58.289 28.249 1.00 50.21  ? 43  LYS B CB  1 
ATOM   1192 C CG  . LYS B 2 44  ? 20.260  59.604 29.024 1.00 54.39  ? 43  LYS B CG  1 
ATOM   1193 C CD  . LYS B 2 44  ? 19.356  60.634 28.386 1.00 58.82  ? 43  LYS B CD  1 
ATOM   1194 C CE  . LYS B 2 44  ? 19.959  61.148 27.089 1.00 64.79  ? 43  LYS B CE  1 
ATOM   1195 N NZ  . LYS B 2 44  ? 18.955  61.959 26.338 1.00 68.87  ? 43  LYS B NZ  1 
ATOM   1196 N N   . GLY B 2 45  ? 21.778  55.378 27.210 1.00 47.72  ? 44  GLY B N   1 
ATOM   1197 C CA  . GLY B 2 45  ? 21.578  54.088 26.547 1.00 36.57  ? 44  GLY B CA  1 
ATOM   1198 C C   . GLY B 2 45  ? 20.433  54.193 25.539 1.00 36.41  ? 44  GLY B C   1 
ATOM   1199 O O   . GLY B 2 45  ? 20.179  55.270 24.993 1.00 41.56  ? 44  GLY B O   1 
ATOM   1200 N N   . LEU B 2 46  ? 19.723  53.095 25.300 1.00 35.91  ? 45  LEU B N   1 
ATOM   1201 C CA  . LEU B 2 46  ? 18.598  53.086 24.366 1.00 30.98  ? 45  LEU B CA  1 
ATOM   1202 C C   . LEU B 2 46  ? 17.320  53.402 25.096 1.00 33.65  ? 45  LEU B C   1 
ATOM   1203 O O   . LEU B 2 46  ? 17.061  52.815 26.145 1.00 42.20  ? 45  LEU B O   1 
ATOM   1204 C CB  . LEU B 2 46  ? 18.476  51.730 23.725 1.00 28.99  ? 45  LEU B CB  1 
ATOM   1205 C CG  . LEU B 2 46  ? 19.366  51.543 22.515 1.00 27.01  ? 45  LEU B CG  1 
ATOM   1206 C CD1 . LEU B 2 46  ? 19.886  50.122 22.487 1.00 23.09  ? 45  LEU B CD1 1 
ATOM   1207 C CD2 . LEU B 2 46  ? 18.558  51.921 21.270 1.00 23.68  ? 45  LEU B CD2 1 
ATOM   1208 N N   . GLU B 2 47  ? 16.503  54.287 24.526 1.00 32.40  ? 46  GLU B N   1 
ATOM   1209 C CA  . GLU B 2 47  ? 15.259  54.708 25.149 1.00 34.91  ? 46  GLU B CA  1 
ATOM   1210 C C   . GLU B 2 47  ? 14.135  54.754 24.147 1.00 38.53  ? 46  GLU B C   1 
ATOM   1211 O O   . GLU B 2 47  ? 14.269  55.399 23.109 1.00 42.32  ? 46  GLU B O   1 
ATOM   1212 C CB  . GLU B 2 47  ? 15.412  56.100 25.760 1.00 41.23  ? 46  GLU B CB  1 
ATOM   1213 C CG  . GLU B 2 47  ? 16.611  56.240 26.706 1.00 61.33  ? 46  GLU B CG  1 
ATOM   1214 C CD  . GLU B 2 47  ? 16.695  57.597 27.394 1.00 69.19  ? 46  GLU B CD  1 
ATOM   1215 O OE1 . GLU B 2 47  ? 16.540  58.630 26.715 1.00 67.13  ? 46  GLU B OE1 1 
ATOM   1216 O OE2 . GLU B 2 47  ? 16.927  57.626 28.623 1.00 78.85  ? 46  GLU B OE2 1 
ATOM   1217 N N   . TRP B 2 48  ? 13.028  54.082 24.458 1.00 36.65  ? 47  TRP B N   1 
ATOM   1218 C CA  . TRP B 2 48  ? 11.858  54.055 23.576 1.00 38.78  ? 47  TRP B CA  1 
ATOM   1219 C C   . TRP B 2 48  ? 11.062  55.348 23.767 1.00 35.01  ? 47  TRP B C   1 
ATOM   1220 O O   . TRP B 2 48  ? 10.704  55.678 24.892 1.00 31.51  ? 47  TRP B O   1 
ATOM   1221 C CB  . TRP B 2 48  ? 10.993  52.827 23.898 1.00 43.00  ? 47  TRP B CB  1 
ATOM   1222 C CG  . TRP B 2 48  ? 9.830   52.630 22.980 1.00 35.40  ? 47  TRP B CG  1 
ATOM   1223 C CD1 . TRP B 2 48  ? 9.852   52.055 21.746 1.00 38.61  ? 47  TRP B CD1 1 
ATOM   1224 C CD2 . TRP B 2 48  ? 8.464   52.966 23.247 1.00 39.98  ? 47  TRP B CD2 1 
ATOM   1225 N NE1 . TRP B 2 48  ? 8.577   52.002 21.228 1.00 44.62  ? 47  TRP B NE1 1 
ATOM   1226 C CE2 . TRP B 2 48  ? 7.707   52.553 22.131 1.00 42.88  ? 47  TRP B CE2 1 
ATOM   1227 C CE3 . TRP B 2 48  ? 7.801   53.569 24.328 1.00 40.48  ? 47  TRP B CE3 1 
ATOM   1228 C CZ2 . TRP B 2 48  ? 6.308   52.720 22.068 1.00 46.13  ? 47  TRP B CZ2 1 
ATOM   1229 C CZ3 . TRP B 2 48  ? 6.409   53.733 24.264 1.00 37.73  ? 47  TRP B CZ3 1 
ATOM   1230 C CH2 . TRP B 2 48  ? 5.682   53.311 23.141 1.00 34.00  ? 47  TRP B CH2 1 
ATOM   1231 N N   . LEU B 2 49  ? 10.771  56.062 22.681 1.00 32.77  ? 48  LEU B N   1 
ATOM   1232 C CA  . LEU B 2 49  ? 10.053  57.337 22.774 1.00 37.20  ? 48  LEU B CA  1 
ATOM   1233 C C   . LEU B 2 49  ? 8.582   57.285 22.485 1.00 37.19  ? 48  LEU B C   1 
ATOM   1234 O O   . LEU B 2 49  ? 7.818   58.056 23.052 1.00 46.87  ? 48  LEU B O   1 
ATOM   1235 C CB  . LEU B 2 49  ? 10.675  58.422 21.875 1.00 35.63  ? 48  LEU B CB  1 
ATOM   1236 C CG  . LEU B 2 49  ? 12.185  58.688 21.982 1.00 40.05  ? 48  LEU B CG  1 
ATOM   1237 C CD1 . LEU B 2 49  ? 12.583  59.725 20.959 1.00 36.93  ? 48  LEU B CD1 1 
ATOM   1238 C CD2 . LEU B 2 49  ? 12.572  59.151 23.360 1.00 34.43  ? 48  LEU B CD2 1 
ATOM   1239 N N   . GLY B 2 50  ? 8.178   56.440 21.555 1.00 37.98  ? 49  GLY B N   1 
ATOM   1240 C CA  . GLY B 2 50  ? 6.771   56.348 21.239 1.00 32.15  ? 49  GLY B CA  1 
ATOM   1241 C C   . GLY B 2 50  ? 6.636   55.559 19.978 1.00 34.99  ? 49  GLY B C   1 
ATOM   1242 O O   . GLY B 2 50  ? 7.605   54.974 19.523 1.00 38.54  ? 49  GLY B O   1 
ATOM   1243 N N   . MET B 2 51  ? 5.440   55.528 19.415 1.00 39.75  ? 50  MET B N   1 
ATOM   1244 C CA  . MET B 2 51  ? 5.190   54.792 18.184 1.00 37.87  ? 50  MET B CA  1 
ATOM   1245 C C   . MET B 2 51  ? 3.804   55.136 17.680 1.00 38.01  ? 50  MET B C   1 
ATOM   1246 O O   . MET B 2 51  ? 2.951   55.598 18.440 1.00 39.40  ? 50  MET B O   1 
ATOM   1247 C CB  . MET B 2 51  ? 5.277   53.279 18.417 1.00 36.04  ? 50  MET B CB  1 
ATOM   1248 C CG  . MET B 2 51  ? 4.091   52.726 19.214 1.00 42.29  ? 50  MET B CG  1 
ATOM   1249 S SD  . MET B 2 51  ? 4.039   50.955 19.420 1.00 42.38  ? 50  MET B SD  1 
ATOM   1250 C CE  . MET B 2 51  ? 3.504   50.478 17.854 1.00 45.43  ? 50  MET B CE  1 
ATOM   1251 N N   . ILE B 2 52  ? 3.616   54.984 16.380 1.00 38.99  ? 51  ILE B N   1 
ATOM   1252 C CA  . ILE B 2 52  ? 2.332   55.222 15.760 1.00 39.59  ? 51  ILE B CA  1 
ATOM   1253 C C   . ILE B 2 52  ? 2.065   53.932 14.965 1.00 44.64  ? 51  ILE B C   1 
ATOM   1254 O O   . ILE B 2 52  ? 2.922   53.507 14.182 1.00 49.10  ? 51  ILE B O   1 
ATOM   1255 C CB  . ILE B 2 52  ? 2.366   56.466 14.861 1.00 36.08  ? 51  ILE B CB  1 
ATOM   1256 C CG1 . ILE B 2 52  ? 1.045   56.598 14.122 1.00 39.84  ? 51  ILE B CG1 1 
ATOM   1257 C CG2 . ILE B 2 52  ? 3.506   56.367 13.853 1.00 42.14  ? 51  ILE B CG2 1 
ATOM   1258 C CD1 . ILE B 2 52  ? 0.793   57.958 13.540 1.00 36.96  ? 51  ILE B CD1 1 
ATOM   1259 N N   . TRP B 2 53  ? 0.976   53.232 15.301 1.00 42.36  ? 52  TRP B N   1 
ATOM   1260 C CA  . TRP B 2 53  ? 0.588   51.978 14.644 1.00 40.24  ? 52  TRP B CA  1 
ATOM   1261 C C   . TRP B 2 53  ? 0.130   52.221 13.214 1.00 46.36  ? 52  TRP B C   1 
ATOM   1262 O O   . TRP B 2 53  ? -0.370  53.316 12.901 1.00 51.33  ? 52  TRP B O   1 
ATOM   1263 C CB  . TRP B 2 53  ? -0.579  51.312 15.380 1.00 40.32  ? 52  TRP B CB  1 
ATOM   1264 C CG  . TRP B 2 53  ? -0.289  50.833 16.759 1.00 48.46  ? 52  TRP B CG  1 
ATOM   1265 C CD1 . TRP B 2 53  ? -0.260  51.588 17.896 1.00 54.86  ? 52  TRP B CD1 1 
ATOM   1266 C CD2 . TRP B 2 53  ? 0.039   49.489 17.162 1.00 49.57  ? 52  TRP B CD2 1 
ATOM   1267 N NE1 . TRP B 2 53  ? 0.074   50.805 18.975 1.00 57.55  ? 52  TRP B NE1 1 
ATOM   1268 C CE2 . TRP B 2 53  ? 0.264   49.513 18.555 1.00 51.10  ? 52  TRP B CE2 1 
ATOM   1269 C CE3 . TRP B 2 53  ? 0.167   48.269 16.481 1.00 47.88  ? 52  TRP B CE3 1 
ATOM   1270 C CZ2 . TRP B 2 53  ? 0.621   48.371 19.278 1.00 49.31  ? 52  TRP B CZ2 1 
ATOM   1271 C CZ3 . TRP B 2 53  ? 0.521   47.136 17.198 1.00 45.92  ? 52  TRP B CZ3 1 
ATOM   1272 C CH2 . TRP B 2 53  ? 0.747   47.196 18.583 1.00 47.19  ? 52  TRP B CH2 1 
ATOM   1273 N N   . GLY B 2 54  ? 0.163   51.161 12.399 1.00 46.96  ? 53  GLY B N   1 
ATOM   1274 C CA  . GLY B 2 54  ? -0.263  51.253 11.011 1.00 44.59  ? 53  GLY B CA  1 
ATOM   1275 C C   . GLY B 2 54  ? -1.575  51.998 10.914 1.00 43.78  ? 53  GLY B C   1 
ATOM   1276 O O   . GLY B 2 54  ? -1.733  52.922 10.112 1.00 41.54  ? 53  GLY B O   1 
ATOM   1277 N N   . GLY B 2 55  ? -2.511  51.610 11.778 1.00 45.57  ? 54  GLY B N   1 
ATOM   1278 C CA  . GLY B 2 55  ? -3.802  52.262 11.828 1.00 48.90  ? 54  GLY B CA  1 
ATOM   1279 C C   . GLY B 2 55  ? -3.844  53.294 12.951 1.00 54.32  ? 54  GLY B C   1 
ATOM   1280 O O   . GLY B 2 55  ? -4.113  52.929 14.113 1.00 57.92  ? 54  GLY B O   1 
ATOM   1281 N N   . GLY B 2 56  ? -3.412  54.520 12.619 1.00 54.46  ? 55  GLY B N   1 
ATOM   1282 C CA  . GLY B 2 56  ? -3.400  55.690 13.506 1.00 55.93  ? 55  GLY B CA  1 
ATOM   1283 C C   . GLY B 2 56  ? -2.903  55.808 14.954 1.00 53.56  ? 55  GLY B C   1 
ATOM   1284 O O   . GLY B 2 56  ? -2.230  56.774 15.316 1.00 47.97  ? 55  GLY B O   1 
ATOM   1285 N N   . SER B 2 57  ? -3.290  54.867 15.801 1.00 58.35  ? 56  SER B N   1 
ATOM   1286 C CA  . SER B 2 57  ? -2.941  54.882 17.217 1.00 59.38  ? 56  SER B CA  1 
ATOM   1287 C C   . SER B 2 57  ? -1.516  55.284 17.559 1.00 52.43  ? 56  SER B C   1 
ATOM   1288 O O   . SER B 2 57  ? -0.566  54.739 17.015 1.00 50.95  ? 56  SER B O   1 
ATOM   1289 C CB  . SER B 2 57  ? -3.258  53.523 17.857 1.00 64.92  ? 56  SER B CB  1 
ATOM   1290 O OG  . SER B 2 57  ? -4.640  53.233 17.754 1.00 70.40  ? 56  SER B OG  1 
ATOM   1291 N N   . ILE B 2 58  ? -1.386  56.186 18.522 1.00 48.42  ? 57  ILE B N   1 
ATOM   1292 C CA  . ILE B 2 58  ? -0.085  56.667 18.951 1.00 43.67  ? 57  ILE B CA  1 
ATOM   1293 C C   . ILE B 2 58  ? 0.110   56.445 20.421 1.00 43.01  ? 57  ILE B C   1 
ATOM   1294 O O   . ILE B 2 58  ? -0.769  56.727 21.217 1.00 47.10  ? 57  ILE B O   1 
ATOM   1295 C CB  . ILE B 2 58  ? 0.057   58.149 18.721 1.00 40.00  ? 57  ILE B CB  1 
ATOM   1296 C CG1 . ILE B 2 58  ? -0.289  58.497 17.263 1.00 34.57  ? 57  ILE B CG1 1 
ATOM   1297 C CG2 . ILE B 2 58  ? 1.438   58.579 19.144 1.00 36.77  ? 57  ILE B CG2 1 
ATOM   1298 C CD1 . ILE B 2 58  ? -0.727  59.924 17.101 1.00 24.71  ? 57  ILE B CD1 1 
ATOM   1299 N N   . GLU B 2 59  ? 1.277   55.956 20.784 1.00 44.28  ? 58  GLU B N   1 
ATOM   1300 C CA  . GLU B 2 59  ? 1.583   55.717 22.173 1.00 44.76  ? 58  GLU B CA  1 
ATOM   1301 C C   . GLU B 2 59  ? 2.882   56.428 22.477 1.00 50.04  ? 58  GLU B C   1 
ATOM   1302 O O   . GLU B 2 59  ? 3.800   56.430 21.653 1.00 53.20  ? 58  GLU B O   1 
ATOM   1303 C CB  . GLU B 2 59  ? 1.805   54.244 22.423 1.00 49.35  ? 58  GLU B CB  1 
ATOM   1304 C CG  . GLU B 2 59  ? 0.656   53.335 22.130 1.00 54.26  ? 58  GLU B CG  1 
ATOM   1305 C CD  . GLU B 2 59  ? 0.978   51.919 22.561 1.00 56.84  ? 58  GLU B CD  1 
ATOM   1306 O OE1 . GLU B 2 59  ? 1.299   51.719 23.762 1.00 53.98  ? 58  GLU B OE1 1 
ATOM   1307 O OE2 . GLU B 2 59  ? 0.937   51.015 21.698 1.00 54.35  ? 58  GLU B OE2 1 
ATOM   1308 N N   . TYR B 2 60  ? 2.980   56.988 23.673 1.00 48.18  ? 59  TYR B N   1 
ATOM   1309 C CA  . TYR B 2 60  ? 4.168   57.696 24.090 1.00 48.04  ? 59  TYR B CA  1 
ATOM   1310 C C   . TYR B 2 60  ? 4.730   57.110 25.334 1.00 53.93  ? 59  TYR B C   1 
ATOM   1311 O O   . TYR B 2 60  ? 4.065   56.366 26.070 1.00 58.58  ? 59  TYR B O   1 
ATOM   1312 C CB  . TYR B 2 60  ? 3.861   59.129 24.441 1.00 41.46  ? 59  TYR B CB  1 
ATOM   1313 C CG  . TYR B 2 60  ? 3.347   59.946 23.310 1.00 42.93  ? 59  TYR B CG  1 
ATOM   1314 C CD1 . TYR B 2 60  ? 4.207   60.472 22.363 1.00 42.90  ? 59  TYR B CD1 1 
ATOM   1315 C CD2 . TYR B 2 60  ? 2.003   60.241 23.210 1.00 41.63  ? 59  TYR B CD2 1 
ATOM   1316 C CE1 . TYR B 2 60  ? 3.733   61.273 21.345 1.00 45.37  ? 59  TYR B CE1 1 
ATOM   1317 C CE2 . TYR B 2 60  ? 1.522   61.041 22.199 1.00 44.27  ? 59  TYR B CE2 1 
ATOM   1318 C CZ  . TYR B 2 60  ? 2.386   61.550 21.270 1.00 42.39  ? 59  TYR B CZ  1 
ATOM   1319 O OH  . TYR B 2 60  ? 1.886   62.306 20.240 1.00 54.72  ? 59  TYR B OH  1 
ATOM   1320 N N   . ASN B 2 61  ? 5.957   57.515 25.597 1.00 54.97  ? 60  ASN B N   1 
ATOM   1321 C CA  . ASN B 2 61  ? 6.630   57.107 26.792 1.00 57.80  ? 60  ASN B CA  1 
ATOM   1322 C C   . ASN B 2 61  ? 5.972   58.005 27.844 1.00 67.19  ? 60  ASN B C   1 
ATOM   1323 O O   . ASN B 2 61  ? 5.844   59.221 27.627 1.00 68.92  ? 60  ASN B O   1 
ATOM   1324 C CB  . ASN B 2 61  ? 8.100   57.442 26.678 1.00 47.80  ? 60  ASN B CB  1 
ATOM   1325 C CG  . ASN B 2 61  ? 8.862   57.013 27.876 1.00 47.96  ? 60  ASN B CG  1 
ATOM   1326 O OD1 . ASN B 2 61  ? 8.545   57.402 29.007 1.00 52.75  ? 60  ASN B OD1 1 
ATOM   1327 N ND2 . ASN B 2 61  ? 9.865   56.182 27.661 1.00 46.07  ? 60  ASN B ND2 1 
ATOM   1328 N N   . PRO B 2 62  ? 5.513   57.422 28.974 1.00 72.42  ? 61  PRO B N   1 
ATOM   1329 C CA  . PRO B 2 62  ? 4.866   58.214 30.026 1.00 70.20  ? 61  PRO B CA  1 
ATOM   1330 C C   . PRO B 2 62  ? 5.673   59.398 30.583 1.00 68.77  ? 61  PRO B C   1 
ATOM   1331 O O   . PRO B 2 62  ? 5.084   60.333 31.127 1.00 74.72  ? 61  PRO B O   1 
ATOM   1332 C CB  . PRO B 2 62  ? 4.533   57.161 31.090 1.00 68.91  ? 61  PRO B CB  1 
ATOM   1333 C CG  . PRO B 2 62  ? 5.589   56.111 30.879 1.00 69.18  ? 61  PRO B CG  1 
ATOM   1334 C CD  . PRO B 2 62  ? 5.588   56.005 29.375 1.00 73.16  ? 61  PRO B CD  1 
ATOM   1335 N N   . ALA B 2 63  ? 7.000   59.372 30.473 1.00 64.04  ? 62  ALA B N   1 
ATOM   1336 C CA  . ALA B 2 63  ? 7.802   60.496 30.967 1.00 61.92  ? 62  ALA B CA  1 
ATOM   1337 C C   . ALA B 2 63  ? 7.671   61.665 29.994 1.00 61.50  ? 62  ALA B C   1 
ATOM   1338 O O   . ALA B 2 63  ? 6.919   62.618 30.228 1.00 62.21  ? 62  ALA B O   1 
ATOM   1339 C CB  . ALA B 2 63  ? 9.272   60.096 31.117 1.00 53.24  ? 62  ALA B CB  1 
ATOM   1340 N N   . LEU B 2 64  ? 8.297   61.504 28.838 1.00 59.03  ? 63  LEU B N   1 
ATOM   1341 C CA  . LEU B 2 64  ? 8.320   62.524 27.794 1.00 59.50  ? 63  LEU B CA  1 
ATOM   1342 C C   . LEU B 2 64  ? 6.975   62.855 27.145 1.00 58.78  ? 63  LEU B C   1 
ATOM   1343 O O   . LEU B 2 64  ? 6.869   63.834 26.414 1.00 61.77  ? 63  LEU B O   1 
ATOM   1344 C CB  . LEU B 2 64  ? 9.327   62.113 26.721 1.00 56.60  ? 63  LEU B CB  1 
ATOM   1345 C CG  . LEU B 2 64  ? 10.535  61.365 27.292 1.00 53.79  ? 63  LEU B CG  1 
ATOM   1346 C CD1 . LEU B 2 64  ? 11.089  60.451 26.237 1.00 53.05  ? 63  LEU B CD1 1 
ATOM   1347 C CD2 . LEU B 2 64  ? 11.596  62.325 27.847 1.00 55.61  ? 63  LEU B CD2 1 
ATOM   1348 N N   . LYS B 2 65  ? 5.958   62.045 27.408 1.00 58.18  ? 64  LYS B N   1 
ATOM   1349 C CA  . LYS B 2 65  ? 4.614   62.236 26.856 1.00 60.00  ? 64  LYS B CA  1 
ATOM   1350 C C   . LYS B 2 65  ? 4.106   63.692 26.815 1.00 61.13  ? 64  LYS B C   1 
ATOM   1351 O O   . LYS B 2 65  ? 3.369   64.097 25.890 1.00 59.06  ? 64  LYS B O   1 
ATOM   1352 C CB  . LYS B 2 65  ? 3.638   61.388 27.668 1.00 62.52  ? 64  LYS B CB  1 
ATOM   1353 C CG  . LYS B 2 65  ? 2.200   61.395 27.193 1.00 69.83  ? 64  LYS B CG  1 
ATOM   1354 C CD  . LYS B 2 65  ? 1.417   60.367 27.998 1.00 78.94  ? 64  LYS B CD  1 
ATOM   1355 C CE  . LYS B 2 65  ? -0.029  60.258 27.573 1.00 81.11  ? 64  LYS B CE  1 
ATOM   1356 N NZ  . LYS B 2 65  ? -0.700  59.306 28.501 1.00 86.40  ? 64  LYS B NZ  1 
ATOM   1357 N N   . SER B 2 66  ? 4.488   64.473 27.819 1.00 58.71  ? 65  SER B N   1 
ATOM   1358 C CA  . SER B 2 66  ? 4.042   65.854 27.879 1.00 58.06  ? 65  SER B CA  1 
ATOM   1359 C C   . SER B 2 66  ? 4.780   66.778 26.914 1.00 59.43  ? 65  SER B C   1 
ATOM   1360 O O   . SER B 2 66  ? 4.236   67.812 26.509 1.00 62.68  ? 65  SER B O   1 
ATOM   1361 C CB  . SER B 2 66  ? 4.116   66.385 29.309 1.00 58.20  ? 65  SER B CB  1 
ATOM   1362 O OG  . SER B 2 66  ? 5.440   66.392 29.790 1.00 51.10  ? 65  SER B OG  1 
ATOM   1363 N N   . ARG B 2 67  ? 6.018   66.422 26.568 1.00 55.61  ? 66  ARG B N   1 
ATOM   1364 C CA  . ARG B 2 67  ? 6.834   67.211 25.641 1.00 50.01  ? 66  ARG B CA  1 
ATOM   1365 C C   . ARG B 2 67  ? 6.808   66.594 24.256 1.00 52.98  ? 66  ARG B C   1 
ATOM   1366 O O   . ARG B 2 67  ? 7.352   67.174 23.315 1.00 55.78  ? 66  ARG B O   1 
ATOM   1367 C CB  . ARG B 2 67  ? 8.279   67.221 26.084 1.00 44.32  ? 66  ARG B CB  1 
ATOM   1368 C CG  . ARG B 2 67  ? 8.511   67.842 27.412 1.00 49.53  ? 66  ARG B CG  1 
ATOM   1369 C CD  . ARG B 2 67  ? 9.664   67.142 28.069 1.00 50.92  ? 66  ARG B CD  1 
ATOM   1370 N NE  . ARG B 2 67  ? 10.831  67.211 27.210 1.00 55.93  ? 66  ARG B NE  1 
ATOM   1371 C CZ  . ARG B 2 67  ? 11.985  66.622 27.471 1.00 57.52  ? 66  ARG B CZ  1 
ATOM   1372 N NH1 . ARG B 2 67  ? 12.130  65.900 28.575 1.00 65.25  ? 66  ARG B NH1 1 
ATOM   1373 N NH2 . ARG B 2 67  ? 12.990  66.757 26.626 1.00 54.24  ? 66  ARG B NH2 1 
ATOM   1374 N N   . LEU B 2 68  ? 6.194   65.413 24.138 1.00 53.67  ? 67  LEU B N   1 
ATOM   1375 C CA  . LEU B 2 68  ? 6.134   64.687 22.876 1.00 45.55  ? 67  LEU B CA  1 
ATOM   1376 C C   . LEU B 2 68  ? 4.887   64.787 22.065 1.00 43.42  ? 67  LEU B C   1 
ATOM   1377 O O   . LEU B 2 68  ? 3.776   64.912 22.595 1.00 45.72  ? 67  LEU B O   1 
ATOM   1378 C CB  . LEU B 2 68  ? 6.401   63.202 23.085 1.00 48.68  ? 67  LEU B CB  1 
ATOM   1379 C CG  . LEU B 2 68  ? 7.821   62.743 23.401 1.00 51.06  ? 67  LEU B CG  1 
ATOM   1380 C CD1 . LEU B 2 68  ? 7.833   61.259 23.657 1.00 51.93  ? 67  LEU B CD1 1 
ATOM   1381 C CD2 . LEU B 2 68  ? 8.722   63.083 22.249 1.00 54.37  ? 67  LEU B CD2 1 
ATOM   1382 N N   . SER B 2 69  ? 5.121   64.598 20.768 1.00 45.04  ? 68  SER B N   1 
ATOM   1383 C CA  . SER B 2 69  ? 4.113   64.577 19.707 1.00 45.69  ? 68  SER B CA  1 
ATOM   1384 C C   . SER B 2 69  ? 4.607   63.686 18.526 1.00 43.38  ? 68  SER B C   1 
ATOM   1385 O O   . SER B 2 69  ? 5.727   63.851 18.028 1.00 40.88  ? 68  SER B O   1 
ATOM   1386 C CB  . SER B 2 69  ? 3.810   65.995 19.224 1.00 45.99  ? 68  SER B CB  1 
ATOM   1387 O OG  . SER B 2 69  ? 2.913   65.965 18.125 1.00 54.80  ? 68  SER B OG  1 
ATOM   1388 N N   . ILE B 2 70  ? 3.802   62.699 18.140 1.00 38.94  ? 69  ILE B N   1 
ATOM   1389 C CA  . ILE B 2 70  ? 4.141   61.806 17.040 1.00 37.72  ? 69  ILE B CA  1 
ATOM   1390 C C   . ILE B 2 70  ? 2.962   61.779 16.083 1.00 38.96  ? 69  ILE B C   1 
ATOM   1391 O O   . ILE B 2 70  ? 1.815   61.747 16.521 1.00 42.12  ? 69  ILE B O   1 
ATOM   1392 C CB  . ILE B 2 70  ? 4.448   60.387 17.541 1.00 37.37  ? 69  ILE B CB  1 
ATOM   1393 C CG1 . ILE B 2 70  ? 5.642   60.427 18.489 1.00 34.38  ? 69  ILE B CG1 1 
ATOM   1394 C CG2 . ILE B 2 70  ? 4.778   59.461 16.376 1.00 33.99  ? 69  ILE B CG2 1 
ATOM   1395 C CD1 . ILE B 2 70  ? 5.947   59.111 19.139 1.00 39.32  ? 69  ILE B CD1 1 
ATOM   1396 N N   . SER B 2 71  ? 3.244   61.862 14.788 1.00 39.51  ? 70  SER B N   1 
ATOM   1397 C CA  . SER B 2 71  ? 2.204   61.866 13.760 1.00 41.84  ? 70  SER B CA  1 
ATOM   1398 C C   . SER B 2 71  ? 2.756   61.324 12.439 1.00 44.87  ? 70  SER B C   1 
ATOM   1399 O O   . SER B 2 71  ? 3.932   60.974 12.355 1.00 48.51  ? 70  SER B O   1 
ATOM   1400 C CB  . SER B 2 71  ? 1.649   63.278 13.563 1.00 37.15  ? 70  SER B CB  1 
ATOM   1401 O OG  . SER B 2 71  ? 2.659   64.168 13.120 1.00 44.03  ? 70  SER B OG  1 
ATOM   1402 N N   . LYS B 2 72  ? 1.915   61.231 11.415 1.00 46.40  ? 71  LYS B N   1 
ATOM   1403 C CA  . LYS B 2 72  ? 2.369   60.712 10.132 1.00 46.55  ? 71  LYS B CA  1 
ATOM   1404 C C   . LYS B 2 72  ? 1.522   61.143 8.947  1.00 48.68  ? 71  LYS B C   1 
ATOM   1405 O O   . LYS B 2 72  ? 0.419   61.689 9.095  1.00 50.21  ? 71  LYS B O   1 
ATOM   1406 C CB  . LYS B 2 72  ? 2.479   59.180 10.148 1.00 47.50  ? 71  LYS B CB  1 
ATOM   1407 C CG  . LYS B 2 72  ? 1.142   58.420 10.084 1.00 47.21  ? 71  LYS B CG  1 
ATOM   1408 C CD  . LYS B 2 72  ? 1.356   56.921 9.864  1.00 40.36  ? 71  LYS B CD  1 
ATOM   1409 C CE  . LYS B 2 72  ? 0.045   56.189 9.834  1.00 37.25  ? 71  LYS B CE  1 
ATOM   1410 N NZ  . LYS B 2 72  ? 0.171   54.820 9.298  1.00 36.24  ? 71  LYS B NZ  1 
ATOM   1411 N N   . ASP B 2 73  ? 2.051   60.829 7.770  1.00 47.12  ? 72  ASP B N   1 
ATOM   1412 C CA  . ASP B 2 73  ? 1.446   61.158 6.499  1.00 43.50  ? 72  ASP B CA  1 
ATOM   1413 C C   . ASP B 2 73  ? 1.667   59.942 5.585  1.00 45.11  ? 72  ASP B C   1 
ATOM   1414 O O   . ASP B 2 73  ? 2.720   59.807 4.970  1.00 45.45  ? 72  ASP B O   1 
ATOM   1415 C CB  . ASP B 2 73  ? 2.158   62.397 5.966  1.00 42.32  ? 72  ASP B CB  1 
ATOM   1416 C CG  . ASP B 2 73  ? 1.503   62.981 4.738  1.00 47.14  ? 72  ASP B CG  1 
ATOM   1417 O OD1 . ASP B 2 73  ? 0.706   62.286 4.069  1.00 47.52  ? 72  ASP B OD1 1 
ATOM   1418 O OD2 . ASP B 2 73  ? 1.812   64.153 4.438  1.00 44.14  ? 72  ASP B OD2 1 
ATOM   1419 N N   . ASN B 2 74  ? 0.676   59.053 5.510  1.00 45.46  ? 73  ASN B N   1 
ATOM   1420 C CA  . ASN B 2 74  ? 0.781   57.844 4.703  1.00 44.76  ? 73  ASN B CA  1 
ATOM   1421 C C   . ASN B 2 74  ? 1.007   58.145 3.247  1.00 48.29  ? 73  ASN B C   1 
ATOM   1422 O O   . ASN B 2 74  ? 1.674   57.376 2.550  1.00 49.98  ? 73  ASN B O   1 
ATOM   1423 C CB  . ASN B 2 74  ? -0.456  56.957 4.858  1.00 45.71  ? 73  ASN B CB  1 
ATOM   1424 C CG  . ASN B 2 74  ? -0.579  56.356 6.256  1.00 50.18  ? 73  ASN B CG  1 
ATOM   1425 O OD1 . ASN B 2 74  ? 0.362   55.779 6.787  1.00 56.62  ? 73  ASN B OD1 1 
ATOM   1426 N ND2 . ASN B 2 74  ? -1.752  56.468 6.839  1.00 57.36  ? 73  ASN B ND2 1 
ATOM   1427 N N   . SER B 2 75  ? 0.496   59.282 2.786  1.00 50.41  ? 74  SER B N   1 
ATOM   1428 C CA  . SER B 2 75  ? 0.672   59.643 1.381  1.00 56.40  ? 74  SER B CA  1 
ATOM   1429 C C   . SER B 2 75  ? 2.122   60.005 1.014  1.00 56.64  ? 74  SER B C   1 
ATOM   1430 O O   . SER B 2 75  ? 2.556   59.753 -0.116 1.00 60.13  ? 74  SER B O   1 
ATOM   1431 C CB  . SER B 2 75  ? -0.333  60.738 0.934  1.00 56.89  ? 74  SER B CB  1 
ATOM   1432 O OG  . SER B 2 75  ? -0.257  61.942 1.686  1.00 64.67  ? 74  SER B OG  1 
ATOM   1433 N N   . LYS B 2 76  ? 2.862   60.580 1.969  1.00 54.79  ? 75  LYS B N   1 
ATOM   1434 C CA  . LYS B 2 76  ? 4.267   60.975 1.764  1.00 52.21  ? 75  LYS B CA  1 
ATOM   1435 C C   . LYS B 2 76  ? 5.248   59.955 2.372  1.00 51.31  ? 75  LYS B C   1 
ATOM   1436 O O   . LYS B 2 76  ? 6.483   60.032 2.184  1.00 46.58  ? 75  LYS B O   1 
ATOM   1437 C CB  . LYS B 2 76  ? 4.518   62.366 2.346  1.00 46.09  ? 75  LYS B CB  1 
ATOM   1438 C CG  . LYS B 2 76  ? 3.848   63.490 1.567  1.00 59.96  ? 75  LYS B CG  1 
ATOM   1439 C CD  . LYS B 2 76  ? 4.192   64.848 2.148  1.00 59.75  ? 75  LYS B CD  1 
ATOM   1440 C CE  . LYS B 2 76  ? 4.886   65.744 1.137  1.00 59.36  ? 75  LYS B CE  1 
ATOM   1441 N NZ  . LYS B 2 76  ? 5.576   66.855 1.855  1.00 63.90  ? 75  LYS B NZ  1 
ATOM   1442 N N   . SER B 2 77  ? 4.669   58.972 3.054  1.00 50.26  ? 76  SER B N   1 
ATOM   1443 C CA  . SER B 2 77  ? 5.424   57.927 3.714  1.00 53.27  ? 76  SER B CA  1 
ATOM   1444 C C   . SER B 2 77  ? 6.401   58.527 4.739  1.00 53.75  ? 76  SER B C   1 
ATOM   1445 O O   . SER B 2 77  ? 7.581   58.163 4.788  1.00 54.48  ? 76  SER B O   1 
ATOM   1446 C CB  . SER B 2 77  ? 6.132   57.043 2.680  1.00 53.67  ? 76  SER B CB  1 
ATOM   1447 O OG  . SER B 2 77  ? 5.207   56.170 2.045  1.00 56.13  ? 76  SER B OG  1 
ATOM   1448 N N   . GLN B 2 78  ? 5.883   59.430 5.575  1.00 49.62  ? 77  GLN B N   1 
ATOM   1449 C CA  . GLN B 2 78  ? 6.686   60.086 6.598  1.00 44.52  ? 77  GLN B CA  1 
ATOM   1450 C C   . GLN B 2 78  ? 6.089   60.049 7.999  1.00 42.49  ? 77  GLN B C   1 
ATOM   1451 O O   . GLN B 2 78  ? 4.879   59.987 8.185  1.00 42.35  ? 77  GLN B O   1 
ATOM   1452 C CB  . GLN B 2 78  ? 6.995   61.516 6.178  1.00 41.24  ? 77  GLN B CB  1 
ATOM   1453 C CG  . GLN B 2 78  ? 7.719   61.539 4.851  1.00 39.17  ? 77  GLN B CG  1 
ATOM   1454 C CD  . GLN B 2 78  ? 8.262   62.894 4.480  1.00 43.23  ? 77  GLN B CD  1 
ATOM   1455 O OE1 . GLN B 2 78  ? 7.501   63.802 4.113  1.00 46.33  ? 77  GLN B OE1 1 
ATOM   1456 N NE2 . GLN B 2 78  ? 9.586   63.041 4.542  1.00 28.74  ? 77  GLN B NE2 1 
ATOM   1457 N N   . ILE B 2 79  ? 6.969   60.025 8.982  1.00 43.45  ? 78  ILE B N   1 
ATOM   1458 C CA  . ILE B 2 79  ? 6.589   59.980 10.381 1.00 41.89  ? 78  ILE B CA  1 
ATOM   1459 C C   . ILE B 2 79  ? 7.263   61.186 11.040 1.00 42.01  ? 78  ILE B C   1 
ATOM   1460 O O   . ILE B 2 79  ? 8.378   61.577 10.663 1.00 41.19  ? 78  ILE B O   1 
ATOM   1461 C CB  . ILE B 2 79  ? 7.073   58.663 11.022 1.00 42.96  ? 78  ILE B CB  1 
ATOM   1462 C CG1 . ILE B 2 79  ? 6.564   57.481 10.203 1.00 45.49  ? 78  ILE B CG1 1 
ATOM   1463 C CG2 . ILE B 2 79  ? 6.586   58.529 12.450 1.00 43.19  ? 78  ILE B CG2 1 
ATOM   1464 C CD1 . ILE B 2 79  ? 7.442   57.148 9.027  1.00 44.18  ? 78  ILE B CD1 1 
ATOM   1465 N N   . PHE B 2 80  ? 6.610   61.754 12.046 1.00 41.24  ? 79  PHE B N   1 
ATOM   1466 C CA  . PHE B 2 80  ? 7.134   62.939 12.694 1.00 39.38  ? 79  PHE B CA  1 
ATOM   1467 C C   . PHE B 2 80  ? 7.302   62.845 14.198 1.00 42.51  ? 79  PHE B C   1 
ATOM   1468 O O   . PHE B 2 80  ? 6.471   62.263 14.884 1.00 44.67  ? 79  PHE B O   1 
ATOM   1469 C CB  . PHE B 2 80  ? 6.216   64.120 12.376 1.00 35.63  ? 79  PHE B CB  1 
ATOM   1470 C CG  . PHE B 2 80  ? 6.005   64.331 10.909 1.00 41.31  ? 79  PHE B CG  1 
ATOM   1471 C CD1 . PHE B 2 80  ? 6.999   64.933 10.124 1.00 41.35  ? 79  PHE B CD1 1 
ATOM   1472 C CD2 . PHE B 2 80  ? 4.847   63.884 10.290 1.00 40.72  ? 79  PHE B CD2 1 
ATOM   1473 C CE1 . PHE B 2 80  ? 6.844   65.081 8.749  1.00 35.56  ? 79  PHE B CE1 1 
ATOM   1474 C CE2 . PHE B 2 80  ? 4.677   64.027 8.900  1.00 40.25  ? 79  PHE B CE2 1 
ATOM   1475 C CZ  . PHE B 2 80  ? 5.676   64.624 8.130  1.00 40.58  ? 79  PHE B CZ  1 
ATOM   1476 N N   . LEU B 2 81  ? 8.384   63.436 14.692 1.00 45.34  ? 80  LEU B N   1 
ATOM   1477 C CA  . LEU B 2 81  ? 8.669   63.519 16.119 1.00 45.86  ? 80  LEU B CA  1 
ATOM   1478 C C   . LEU B 2 81  ? 8.877   65.020 16.457 1.00 49.03  ? 80  LEU B C   1 
ATOM   1479 O O   . LEU B 2 81  ? 9.650   65.712 15.790 1.00 45.76  ? 80  LEU B O   1 
ATOM   1480 C CB  . LEU B 2 81  ? 9.920   62.717 16.488 1.00 45.24  ? 80  LEU B CB  1 
ATOM   1481 C CG  . LEU B 2 81  ? 10.187  62.793 17.998 1.00 49.02  ? 80  LEU B CG  1 
ATOM   1482 C CD1 . LEU B 2 81  ? 9.024   62.168 18.716 1.00 56.90  ? 80  LEU B CD1 1 
ATOM   1483 C CD2 . LEU B 2 81  ? 11.452  62.088 18.387 1.00 48.89  ? 80  LEU B CD2 1 
ATOM   1484 N N   . LYS B 2 82  ? 8.116   65.537 17.417 1.00 50.42  ? 81  LYS B N   1 
ATOM   1485 C CA  . LYS B 2 82  ? 8.226   66.929 17.841 1.00 47.54  ? 81  LYS B CA  1 
ATOM   1486 C C   . LYS B 2 82  ? 8.363   66.900 19.370 1.00 47.79  ? 81  LYS B C   1 
ATOM   1487 O O   . LYS B 2 82  ? 7.428   66.529 20.075 1.00 57.25  ? 81  LYS B O   1 
ATOM   1488 C CB  . LYS B 2 82  ? 6.986   67.717 17.388 1.00 50.51  ? 81  LYS B CB  1 
ATOM   1489 C CG  . LYS B 2 82  ? 6.957   69.213 17.762 1.00 62.02  ? 81  LYS B CG  1 
ATOM   1490 C CD  . LYS B 2 82  ? 8.086   70.005 17.097 1.00 73.89  ? 81  LYS B CD  1 
ATOM   1491 C CE  . LYS B 2 82  ? 7.854   71.532 17.099 1.00 79.21  ? 81  LYS B CE  1 
ATOM   1492 N NZ  . LYS B 2 82  ? 6.897   72.006 16.026 1.00 84.15  ? 81  LYS B NZ  1 
ATOM   1493 N N   . MET B 2 83  ? 9.560   67.185 19.865 1.00 43.70  ? 82  MET B N   1 
ATOM   1494 C CA  . MET B 2 83  ? 9.847   67.183 21.291 1.00 39.31  ? 82  MET B CA  1 
ATOM   1495 C C   . MET B 2 83  ? 10.122  68.607 21.773 1.00 46.65  ? 82  MET B C   1 
ATOM   1496 O O   . MET B 2 83  ? 10.922  69.332 21.173 1.00 48.33  ? 82  MET B O   1 
ATOM   1497 C CB  . MET B 2 83  ? 11.043  66.294 21.544 1.00 38.25  ? 82  MET B CB  1 
ATOM   1498 C CG  . MET B 2 83  ? 11.455  66.224 22.971 1.00 44.54  ? 82  MET B CG  1 
ATOM   1499 S SD  . MET B 2 83  ? 12.284  64.650 23.312 1.00 58.03  ? 82  MET B SD  1 
ATOM   1500 C CE  . MET B 2 83  ? 13.907  65.133 23.374 1.00 60.39  ? 82  MET B CE  1 
ATOM   1501 N N   . ASN B 2 84  A 9.456   69.015 22.850 1.00 52.00  ? 82  ASN B N   1 
ATOM   1502 C CA  . ASN B 2 84  A 9.615   70.368 23.382 1.00 49.24  ? 82  ASN B CA  1 
ATOM   1503 C C   . ASN B 2 84  A 10.482  70.428 24.613 1.00 50.09  ? 82  ASN B C   1 
ATOM   1504 O O   . ASN B 2 84  A 10.915  69.386 25.131 1.00 47.69  ? 82  ASN B O   1 
ATOM   1505 C CB  . ASN B 2 84  A 8.263   70.975 23.733 1.00 53.24  ? 82  ASN B CB  1 
ATOM   1506 C CG  . ASN B 2 84  A 7.405   71.246 22.517 1.00 61.99  ? 82  ASN B CG  1 
ATOM   1507 O OD1 . ASN B 2 84  A 7.902   71.503 21.410 1.00 62.84  ? 82  ASN B OD1 1 
ATOM   1508 N ND2 . ASN B 2 84  A 6.094   71.215 22.725 1.00 62.56  ? 82  ASN B ND2 1 
ATOM   1509 N N   . SER B 2 85  B 10.693  71.661 25.090 1.00 49.28  ? 82  SER B N   1 
ATOM   1510 C CA  . SER B 2 85  B 11.489  71.949 26.290 1.00 48.21  ? 82  SER B CA  1 
ATOM   1511 C C   . SER B 2 85  B 12.764  71.143 26.284 1.00 49.25  ? 82  SER B C   1 
ATOM   1512 O O   . SER B 2 85  B 13.037  70.311 27.176 1.00 43.75  ? 82  SER B O   1 
ATOM   1513 C CB  . SER B 2 85  B 10.687  71.696 27.578 1.00 47.38  ? 82  SER B CB  1 
ATOM   1514 O OG  . SER B 2 85  B 9.524   72.508 27.613 1.00 43.56  ? 82  SER B OG  1 
ATOM   1515 N N   . LEU B 2 86  C 13.514  71.364 25.215 1.00 47.58  ? 82  LEU B N   1 
ATOM   1516 C CA  . LEU B 2 86  C 14.767  70.689 25.058 1.00 48.27  ? 82  LEU B CA  1 
ATOM   1517 C C   . LEU B 2 86  C 15.684  71.060 26.217 1.00 47.56  ? 82  LEU B C   1 
ATOM   1518 O O   . LEU B 2 86  C 15.585  72.151 26.785 1.00 46.83  ? 82  LEU B O   1 
ATOM   1519 C CB  . LEU B 2 86  C 15.382  71.053 23.712 1.00 47.92  ? 82  LEU B CB  1 
ATOM   1520 C CG  . LEU B 2 86  C 14.693  70.302 22.574 1.00 49.76  ? 82  LEU B CG  1 
ATOM   1521 C CD1 . LEU B 2 86  C 15.258  70.713 21.231 1.00 45.25  ? 82  LEU B CD1 1 
ATOM   1522 C CD2 . LEU B 2 86  C 14.883  68.808 22.791 1.00 48.02  ? 82  LEU B CD2 1 
ATOM   1523 N N   . GLN B 2 87  ? 16.476  70.090 26.642 1.00 46.05  ? 83  GLN B N   1 
ATOM   1524 C CA  . GLN B 2 87  ? 17.432  70.282 27.710 1.00 47.97  ? 83  GLN B CA  1 
ATOM   1525 C C   . GLN B 2 87  ? 18.652  69.632 27.153 1.00 46.04  ? 83  GLN B C   1 
ATOM   1526 O O   . GLN B 2 87  ? 18.530  68.748 26.336 1.00 50.10  ? 83  GLN B O   1 
ATOM   1527 C CB  . GLN B 2 87  ? 16.970  69.623 29.018 1.00 53.11  ? 83  GLN B CB  1 
ATOM   1528 C CG  . GLN B 2 87  ? 16.354  68.231 28.881 1.00 64.18  ? 83  GLN B CG  1 
ATOM   1529 C CD  . GLN B 2 87  ? 15.369  67.898 30.025 1.00 68.33  ? 83  GLN B CD  1 
ATOM   1530 O OE1 . GLN B 2 87  ? 14.195  68.315 30.009 1.00 63.71  ? 83  GLN B OE1 1 
ATOM   1531 N NE2 . GLN B 2 87  ? 15.844  67.134 31.009 1.00 66.18  ? 83  GLN B NE2 1 
ATOM   1532 N N   . THR B 2 88  ? 19.835  70.057 27.562 1.00 52.33  ? 84  THR B N   1 
ATOM   1533 C CA  . THR B 2 88  ? 21.079  69.482 27.028 1.00 54.37  ? 84  THR B CA  1 
ATOM   1534 C C   . THR B 2 88  ? 21.147  67.969 27.240 1.00 57.79  ? 84  THR B C   1 
ATOM   1535 O O   . THR B 2 88  ? 22.078  67.274 26.796 1.00 59.74  ? 84  THR B O   1 
ATOM   1536 C CB  . THR B 2 88  ? 22.353  70.205 27.618 1.00 51.90  ? 84  THR B CB  1 
ATOM   1537 O OG1 . THR B 2 88  ? 22.569  69.832 28.976 1.00 40.27  ? 84  THR B OG1 1 
ATOM   1538 C CG2 . THR B 2 88  ? 22.154  71.698 27.571 1.00 47.67  ? 84  THR B CG2 1 
ATOM   1539 N N   . ASP B 2 89  ? 20.119  67.463 27.912 1.00 57.81  ? 85  ASP B N   1 
ATOM   1540 C CA  . ASP B 2 89  ? 19.995  66.075 28.249 1.00 53.81  ? 85  ASP B CA  1 
ATOM   1541 C C   . ASP B 2 89  ? 19.469  65.262 27.115 1.00 48.95  ? 85  ASP B C   1 
ATOM   1542 O O   . ASP B 2 89  ? 19.767  64.087 27.013 1.00 50.51  ? 85  ASP B O   1 
ATOM   1543 C CB  . ASP B 2 89  ? 19.081  65.894 29.442 1.00 52.43  ? 85  ASP B CB  1 
ATOM   1544 C CG  . ASP B 2 89  ? 19.682  64.984 30.446 1.00 60.37  ? 85  ASP B CG  1 
ATOM   1545 O OD1 . ASP B 2 89  ? 20.529  64.141 30.059 1.00 68.21  ? 85  ASP B OD1 1 
ATOM   1546 O OD2 . ASP B 2 89  ? 19.364  65.149 31.632 1.00 64.10  ? 85  ASP B OD2 1 
ATOM   1547 N N   . ASP B 2 90  ? 18.666  65.897 26.279 1.00 42.91  ? 86  ASP B N   1 
ATOM   1548 C CA  . ASP B 2 90  ? 18.048  65.274 25.116 1.00 46.32  ? 86  ASP B CA  1 
ATOM   1549 C C   . ASP B 2 90  ? 18.963  64.990 23.912 1.00 46.87  ? 86  ASP B C   1 
ATOM   1550 O O   . ASP B 2 90  ? 18.511  64.496 22.888 1.00 43.72  ? 86  ASP B O   1 
ATOM   1551 C CB  . ASP B 2 90  ? 16.871  66.138 24.669 1.00 43.99  ? 86  ASP B CB  1 
ATOM   1552 C CG  . ASP B 2 90  ? 15.854  66.345 25.764 1.00 46.01  ? 86  ASP B CG  1 
ATOM   1553 O OD1 . ASP B 2 90  ? 15.543  65.367 26.487 1.00 43.95  ? 86  ASP B OD1 1 
ATOM   1554 O OD2 . ASP B 2 90  ? 15.367  67.491 25.876 1.00 46.80  ? 86  ASP B OD2 1 
ATOM   1555 N N   . SER B 2 91  ? 20.233  65.360 24.005 1.00 51.16  ? 87  SER B N   1 
ATOM   1556 C CA  . SER B 2 91  ? 21.165  65.108 22.918 1.00 49.38  ? 87  SER B CA  1 
ATOM   1557 C C   . SER B 2 91  ? 21.257  63.590 22.750 1.00 48.24  ? 87  SER B C   1 
ATOM   1558 O O   . SER B 2 91  ? 21.413  62.860 23.738 1.00 43.22  ? 87  SER B O   1 
ATOM   1559 C CB  . SER B 2 91  ? 22.550  65.698 23.236 1.00 45.76  ? 87  SER B CB  1 
ATOM   1560 O OG  . SER B 2 91  ? 22.482  67.112 23.312 1.00 51.86  ? 87  SER B OG  1 
ATOM   1561 N N   . ALA B 2 92  ? 21.082  63.118 21.516 1.00 45.25  ? 88  ALA B N   1 
ATOM   1562 C CA  . ALA B 2 92  ? 21.162  61.705 21.227 1.00 37.71  ? 88  ALA B CA  1 
ATOM   1563 C C   . ALA B 2 92  ? 21.188  61.467 19.750 1.00 38.75  ? 88  ALA B C   1 
ATOM   1564 O O   . ALA B 2 92  ? 21.194  62.402 18.947 1.00 35.27  ? 88  ALA B O   1 
ATOM   1565 C CB  . ALA B 2 92  ? 19.956  60.987 21.803 1.00 34.60  ? 88  ALA B CB  1 
ATOM   1566 N N   . MET B 2 93  ? 21.256  60.184 19.422 1.00 41.81  ? 89  MET B N   1 
ATOM   1567 C CA  . MET B 2 93  ? 21.202  59.698 18.062 1.00 37.58  ? 89  MET B CA  1 
ATOM   1568 C C   . MET B 2 93  ? 19.763  59.166 18.029 1.00 35.85  ? 89  MET B C   1 
ATOM   1569 O O   . MET B 2 93  ? 19.397  58.270 18.805 1.00 30.89  ? 89  MET B O   1 
ATOM   1570 C CB  . MET B 2 93  ? 22.202  58.560 17.860 1.00 40.24  ? 89  MET B CB  1 
ATOM   1571 C CG  . MET B 2 93  ? 22.185  57.995 16.447 1.00 45.10  ? 89  MET B CG  1 
ATOM   1572 S SD  . MET B 2 93  ? 22.837  59.110 15.192 1.00 44.32  ? 89  MET B SD  1 
ATOM   1573 C CE  . MET B 2 93  ? 24.538  58.510 15.234 1.00 38.35  ? 89  MET B CE  1 
ATOM   1574 N N   . TYR B 2 94  ? 18.917  59.860 17.270 1.00 34.33  ? 90  TYR B N   1 
ATOM   1575 C CA  . TYR B 2 94  ? 17.505  59.528 17.127 1.00 31.74  ? 90  TYR B CA  1 
ATOM   1576 C C   . TYR B 2 94  ? 17.263  58.615 15.962 1.00 35.22  ? 90  TYR B C   1 
ATOM   1577 O O   . TYR B 2 94  ? 17.859  58.821 14.907 1.00 34.15  ? 90  TYR B O   1 
ATOM   1578 C CB  . TYR B 2 94  ? 16.691  60.797 16.951 1.00 34.36  ? 90  TYR B CB  1 
ATOM   1579 C CG  . TYR B 2 94  ? 16.615  61.593 18.214 1.00 39.65  ? 90  TYR B CG  1 
ATOM   1580 C CD1 . TYR B 2 94  ? 17.767  62.086 18.822 1.00 40.38  ? 90  TYR B CD1 1 
ATOM   1581 C CD2 . TYR B 2 94  ? 15.397  61.789 18.851 1.00 43.54  ? 90  TYR B CD2 1 
ATOM   1582 C CE1 . TYR B 2 94  ? 17.707  62.746 20.033 1.00 43.00  ? 90  TYR B CE1 1 
ATOM   1583 C CE2 . TYR B 2 94  ? 15.326  62.451 20.063 1.00 45.45  ? 90  TYR B CE2 1 
ATOM   1584 C CZ  . TYR B 2 94  ? 16.481  62.921 20.645 1.00 43.31  ? 90  TYR B CZ  1 
ATOM   1585 O OH  . TYR B 2 94  ? 16.393  63.549 21.849 1.00 45.86  ? 90  TYR B OH  1 
ATOM   1586 N N   . TYR B 2 95  ? 16.344  57.660 16.130 1.00 38.85  ? 91  TYR B N   1 
ATOM   1587 C CA  . TYR B 2 95  ? 15.988  56.685 15.094 1.00 41.78  ? 91  TYR B CA  1 
ATOM   1588 C C   . TYR B 2 95  ? 14.516  56.358 14.974 1.00 42.06  ? 91  TYR B C   1 
ATOM   1589 O O   . TYR B 2 95  ? 13.795  56.406 15.959 1.00 49.96  ? 91  TYR B O   1 
ATOM   1590 C CB  . TYR B 2 95  ? 16.604  55.318 15.405 1.00 36.33  ? 91  TYR B CB  1 
ATOM   1591 C CG  . TYR B 2 95  ? 18.092  55.261 15.488 1.00 34.44  ? 91  TYR B CG  1 
ATOM   1592 C CD1 . TYR B 2 95  ? 18.851  55.183 14.340 1.00 29.55  ? 91  TYR B CD1 1 
ATOM   1593 C CD2 . TYR B 2 95  ? 18.730  55.106 16.713 1.00 35.10  ? 91  TYR B CD2 1 
ATOM   1594 C CE1 . TYR B 2 95  ? 20.215  54.921 14.397 1.00 33.59  ? 91  TYR B CE1 1 
ATOM   1595 C CE2 . TYR B 2 95  ? 20.099  54.844 16.782 1.00 34.83  ? 91  TYR B CE2 1 
ATOM   1596 C CZ  . TYR B 2 95  ? 20.831  54.739 15.606 1.00 36.13  ? 91  TYR B CZ  1 
ATOM   1597 O OH  . TYR B 2 95  ? 22.144  54.329 15.625 1.00 43.02  ? 91  TYR B OH  1 
ATOM   1598 N N   . CYS B 2 96  ? 14.072  56.030 13.768 1.00 43.19  ? 92  CYS B N   1 
ATOM   1599 C CA  . CYS B 2 96  ? 12.700  55.567 13.596 1.00 40.50  ? 92  CYS B CA  1 
ATOM   1600 C C   . CYS B 2 96  ? 12.951  54.114 13.231 1.00 44.27  ? 92  CYS B C   1 
ATOM   1601 O O   . CYS B 2 96  ? 14.035  53.781 12.687 1.00 42.52  ? 92  CYS B O   1 
ATOM   1602 C CB  . CYS B 2 96  ? 11.960  56.305 12.493 1.00 34.24  ? 92  CYS B CB  1 
ATOM   1603 S SG  . CYS B 2 96  ? 12.863  56.429 10.917 1.00 45.72  ? 92  CYS B SG  1 
ATOM   1604 N N   . VAL B 2 97  ? 12.051  53.234 13.660 1.00 42.95  ? 93  VAL B N   1 
ATOM   1605 C CA  . VAL B 2 97  ? 12.163  51.809 13.375 1.00 40.33  ? 93  VAL B CA  1 
ATOM   1606 C C   . VAL B 2 97  ? 10.787  51.266 13.030 1.00 37.06  ? 93  VAL B C   1 
ATOM   1607 O O   . VAL B 2 97  ? 9.825   51.542 13.723 1.00 37.24  ? 93  VAL B O   1 
ATOM   1608 C CB  . VAL B 2 97  ? 12.688  51.001 14.578 1.00 37.06  ? 93  VAL B CB  1 
ATOM   1609 C CG1 . VAL B 2 97  ? 12.921  49.543 14.146 1.00 25.68  ? 93  VAL B CG1 1 
ATOM   1610 C CG2 . VAL B 2 97  ? 13.965  51.638 15.144 1.00 26.68  ? 93  VAL B CG2 1 
ATOM   1611 N N   . SER B 2 98  ? 10.690  50.483 11.970 1.00 37.44  ? 94  SER B N   1 
ATOM   1612 C CA  . SER B 2 98  ? 9.389   49.955 11.605 1.00 38.42  ? 94  SER B CA  1 
ATOM   1613 C C   . SER B 2 98  ? 9.328   48.464 11.722 1.00 40.19  ? 94  SER B C   1 
ATOM   1614 O O   . SER B 2 98  ? 10.342  47.765 11.551 1.00 39.68  ? 94  SER B O   1 
ATOM   1615 C CB  . SER B 2 98  ? 9.032   50.333 10.185 1.00 36.85  ? 94  SER B CB  1 
ATOM   1616 O OG  . SER B 2 98  ? 9.864   49.610 9.308  1.00 46.64  ? 94  SER B OG  1 
ATOM   1617 N N   . TYR B 2 99  ? 8.116   47.991 11.984 1.00 39.43  ? 95  TYR B N   1 
ATOM   1618 C CA  . TYR B 2 99  ? 7.820   46.577 12.121 1.00 43.00  ? 95  TYR B CA  1 
ATOM   1619 C C   . TYR B 2 99  ? 6.565   46.236 11.298 1.00 46.20  ? 95  TYR B C   1 
ATOM   1620 O O   . TYR B 2 99  ? 5.640   47.047 11.181 1.00 45.31  ? 95  TYR B O   1 
ATOM   1621 C CB  . TYR B 2 99  ? 7.587   46.253 13.588 1.00 39.23  ? 95  TYR B CB  1 
ATOM   1622 C CG  . TYR B 2 99  ? 8.827   46.366 14.406 1.00 36.45  ? 95  TYR B CG  1 
ATOM   1623 C CD1 . TYR B 2 99  ? 9.766   45.346 14.410 1.00 41.25  ? 95  TYR B CD1 1 
ATOM   1624 C CD2 . TYR B 2 99  ? 9.072   47.489 15.183 1.00 35.74  ? 95  TYR B CD2 1 
ATOM   1625 C CE1 . TYR B 2 99  ? 10.926  45.434 15.177 1.00 37.28  ? 95  TYR B CE1 1 
ATOM   1626 C CE2 . TYR B 2 99  ? 10.229  47.594 15.959 1.00 33.09  ? 95  TYR B CE2 1 
ATOM   1627 C CZ  . TYR B 2 99  ? 11.153  46.559 15.956 1.00 38.69  ? 95  TYR B CZ  1 
ATOM   1628 O OH  . TYR B 2 99  ? 12.285  46.626 16.750 1.00 40.65  ? 95  TYR B OH  1 
ATOM   1629 N N   . GLY B 2 100 ? 6.549   45.048 10.713 1.00 44.42  ? 96  GLY B N   1 
ATOM   1630 C CA  . GLY B 2 100 ? 5.412   44.632 9.924  1.00 47.28  ? 96  GLY B CA  1 
ATOM   1631 C C   . GLY B 2 100 ? 5.855   43.451 9.094  1.00 52.10  ? 96  GLY B C   1 
ATOM   1632 O O   . GLY B 2 100 ? 7.052   43.163 9.028  1.00 53.98  ? 96  GLY B O   1 
ATOM   1633 N N   . TYR B 2 101 ? 4.901   42.764 8.465  1.00 56.61  ? 97  TYR B N   1 
ATOM   1634 C CA  . TYR B 2 101 ? 5.199   41.578 7.653  1.00 57.87  ? 97  TYR B CA  1 
ATOM   1635 C C   . TYR B 2 101 ? 4.997   41.848 6.173  1.00 57.44  ? 97  TYR B C   1 
ATOM   1636 O O   . TYR B 2 101 ? 4.344   42.820 5.790  1.00 59.62  ? 97  TYR B O   1 
ATOM   1637 C CB  . TYR B 2 101 ? 4.301   40.390 8.037  1.00 54.43  ? 97  TYR B CB  1 
ATOM   1638 C CG  . TYR B 2 101 ? 4.101   40.156 9.519  1.00 56.13  ? 97  TYR B CG  1 
ATOM   1639 C CD1 . TYR B 2 101 ? 3.183   40.928 10.243 1.00 55.55  ? 97  TYR B CD1 1 
ATOM   1640 C CD2 . TYR B 2 101 ? 4.792   39.135 10.189 1.00 53.13  ? 97  TYR B CD2 1 
ATOM   1641 C CE1 . TYR B 2 101 ? 2.951   40.702 11.592 1.00 63.29  ? 97  TYR B CE1 1 
ATOM   1642 C CE2 . TYR B 2 101 ? 4.571   38.891 11.547 1.00 60.19  ? 97  TYR B CE2 1 
ATOM   1643 C CZ  . TYR B 2 101 ? 3.640   39.682 12.244 1.00 69.39  ? 97  TYR B CZ  1 
ATOM   1644 O OH  . TYR B 2 101 ? 3.380   39.460 13.589 1.00 77.83  ? 97  TYR B OH  1 
ATOM   1645 N N   . GLY B 2 102 ? 5.494   40.934 5.350  1.00 53.89  ? 98  GLY B N   1 
ATOM   1646 C CA  . GLY B 2 102 ? 5.342   41.090 3.928  1.00 55.48  ? 98  GLY B CA  1 
ATOM   1647 C C   . GLY B 2 102 ? 6.612   41.498 3.213  1.00 62.00  ? 98  GLY B C   1 
ATOM   1648 O O   . GLY B 2 102 ? 6.701   41.340 2.002  1.00 68.56  ? 98  GLY B O   1 
ATOM   1649 N N   . GLY B 2 103 ? 7.597   42.036 3.925  1.00 65.33  ? 99  GLY B N   1 
ATOM   1650 C CA  . GLY B 2 103 ? 8.828   42.421 3.250  1.00 62.33  ? 99  GLY B CA  1 
ATOM   1651 C C   . GLY B 2 103 ? 9.891   41.347 3.406  1.00 63.41  ? 99  GLY B C   1 
ATOM   1652 O O   . GLY B 2 103 ? 9.636   40.273 3.976  1.00 61.47  ? 99  GLY B O   1 
ATOM   1653 N N   . ASP B 2 104 ? 11.093  41.621 2.909  1.00 59.56  ? 100 ASP B N   1 
ATOM   1654 C CA  . ASP B 2 104 ? 12.182  40.666 3.057  1.00 60.84  ? 100 ASP B CA  1 
ATOM   1655 C C   . ASP B 2 104 ? 12.713  40.647 4.489  1.00 56.85  ? 100 ASP B C   1 
ATOM   1656 O O   . ASP B 2 104 ? 13.683  39.964 4.789  1.00 58.63  ? 100 ASP B O   1 
ATOM   1657 C CB  . ASP B 2 104 ? 13.312  40.968 2.077  1.00 67.68  ? 100 ASP B CB  1 
ATOM   1658 C CG  . ASP B 2 104 ? 13.147  40.222 0.752  1.00 79.56  ? 100 ASP B CG  1 
ATOM   1659 O OD1 . ASP B 2 104 ? 12.332  39.253 0.687  1.00 77.15  ? 100 ASP B OD1 1 
ATOM   1660 O OD2 . ASP B 2 104 ? 13.844  40.613 -0.220 1.00 79.05  ? 100 ASP B OD2 1 
ATOM   1661 N N   . ARG B 2 105 A 12.094  41.452 5.343  1.00 49.85  ? 100 ARG B N   1 
ATOM   1662 C CA  . ARG B 2 105 A 12.421  41.573 6.751  1.00 42.46  ? 100 ARG B CA  1 
ATOM   1663 C C   . ARG B 2 105 A 11.124  41.965 7.479  1.00 44.11  ? 100 ARG B C   1 
ATOM   1664 O O   . ARG B 2 105 A 10.150  42.452 6.882  1.00 44.57  ? 100 ARG B O   1 
ATOM   1665 C CB  . ARG B 2 105 A 13.463  42.684 7.010  1.00 44.38  ? 100 ARG B CB  1 
ATOM   1666 C CG  . ARG B 2 105 A 14.861  42.496 6.447  1.00 45.35  ? 100 ARG B CG  1 
ATOM   1667 C CD  . ARG B 2 105 A 15.826  43.590 6.962  1.00 56.43  ? 100 ARG B CD  1 
ATOM   1668 N NE  . ARG B 2 105 A 16.257  43.429 8.369  1.00 68.68  ? 100 ARG B NE  1 
ATOM   1669 C CZ  . ARG B 2 105 A 17.201  42.575 8.793  1.00 72.74  ? 100 ARG B CZ  1 
ATOM   1670 N NH1 . ARG B 2 105 A 17.819  41.768 7.919  1.00 79.09  ? 100 ARG B NH1 1 
ATOM   1671 N NH2 . ARG B 2 105 A 17.487  42.462 10.102 1.00 65.56  ? 100 ARG B NH2 1 
ATOM   1672 N N   . PHE B 2 106 B 11.138  41.766 8.785  1.00 44.99  ? 100 PHE B N   1 
ATOM   1673 C CA  . PHE B 2 106 B 10.020  42.102 9.664  1.00 46.71  ? 100 PHE B CA  1 
ATOM   1674 C C   . PHE B 2 106 B 10.317  43.520 10.165 1.00 44.02  ? 100 PHE B C   1 
ATOM   1675 O O   . PHE B 2 106 B 9.404   44.343 10.359 1.00 39.27  ? 100 PHE B O   1 
ATOM   1676 C CB  . PHE B 2 106 B 10.023  41.075 10.830 1.00 52.91  ? 100 PHE B CB  1 
ATOM   1677 C CG  . PHE B 2 106 B 9.035   41.349 11.958 1.00 51.25  ? 100 PHE B CG  1 
ATOM   1678 C CD1 . PHE B 2 106 B 7.665   41.407 11.723 1.00 50.91  ? 100 PHE B CD1 1 
ATOM   1679 C CD2 . PHE B 2 106 B 9.495   41.486 13.281 1.00 53.06  ? 100 PHE B CD2 1 
ATOM   1680 C CE1 . PHE B 2 106 B 6.766   41.592 12.790 1.00 49.80  ? 100 PHE B CE1 1 
ATOM   1681 C CE2 . PHE B 2 106 B 8.603   41.671 14.353 1.00 48.67  ? 100 PHE B CE2 1 
ATOM   1682 C CZ  . PHE B 2 106 B 7.241   41.723 14.106 1.00 48.10  ? 100 PHE B CZ  1 
ATOM   1683 N N   . SER B 2 107 ? 11.612  43.810 10.301 1.00 40.95  ? 101 SER B N   1 
ATOM   1684 C CA  . SER B 2 107 ? 12.065  45.093 10.813 1.00 43.82  ? 101 SER B CA  1 
ATOM   1685 C C   . SER B 2 107 ? 13.085  45.828 9.980  1.00 38.42  ? 101 SER B C   1 
ATOM   1686 O O   . SER B 2 107 ? 14.087  45.259 9.511  1.00 36.84  ? 101 SER B O   1 
ATOM   1687 C CB  . SER B 2 107 ? 12.700  44.909 12.177 1.00 45.90  ? 101 SER B CB  1 
ATOM   1688 O OG  . SER B 2 107 ? 13.960  44.280 11.996 1.00 57.74  ? 101 SER B OG  1 
ATOM   1689 N N   . TYR B 2 108 ? 12.925  47.138 10.019 1.00 35.69  ? 102 TYR B N   1 
ATOM   1690 C CA  . TYR B 2 108 ? 13.797  48.036 9.315  1.00 38.76  ? 102 TYR B CA  1 
ATOM   1691 C C   . TYR B 2 108 ? 14.186  49.141 10.301 1.00 35.74  ? 102 TYR B C   1 
ATOM   1692 O O   . TYR B 2 108 ? 13.340  49.891 10.792 1.00 36.82  ? 102 TYR B O   1 
ATOM   1693 C CB  . TYR B 2 108 ? 13.059  48.592 8.098  1.00 39.49  ? 102 TYR B CB  1 
ATOM   1694 C CG  . TYR B 2 108 ? 12.578  47.516 7.137  1.00 42.83  ? 102 TYR B CG  1 
ATOM   1695 C CD1 . TYR B 2 108 ? 13.471  46.845 6.294  1.00 44.13  ? 102 TYR B CD1 1 
ATOM   1696 C CD2 . TYR B 2 108 ? 11.239  47.160 7.082  1.00 44.88  ? 102 TYR B CD2 1 
ATOM   1697 C CE1 . TYR B 2 108 ? 13.040  45.848 5.424  1.00 40.33  ? 102 TYR B CE1 1 
ATOM   1698 C CE2 . TYR B 2 108 ? 10.796  46.167 6.218  1.00 46.68  ? 102 TYR B CE2 1 
ATOM   1699 C CZ  . TYR B 2 108 ? 11.696  45.515 5.395  1.00 43.48  ? 102 TYR B CZ  1 
ATOM   1700 O OH  . TYR B 2 108 ? 11.230  44.526 4.551  1.00 55.06  ? 102 TYR B OH  1 
ATOM   1701 N N   . TRP B 2 109 ? 15.459  49.175 10.653 1.00 35.07  ? 103 TRP B N   1 
ATOM   1702 C CA  . TRP B 2 109 ? 15.974  50.164 11.590 1.00 37.35  ? 103 TRP B CA  1 
ATOM   1703 C C   . TRP B 2 109 ? 16.688  51.280 10.813 1.00 36.33  ? 103 TRP B C   1 
ATOM   1704 O O   . TRP B 2 109 ? 17.708  51.025 10.171 1.00 38.31  ? 103 TRP B O   1 
ATOM   1705 C CB  . TRP B 2 109 ? 16.946  49.485 12.577 1.00 36.28  ? 103 TRP B CB  1 
ATOM   1706 C CG  . TRP B 2 109 ? 17.209  50.267 13.829 1.00 42.67  ? 103 TRP B CG  1 
ATOM   1707 C CD1 . TRP B 2 109 ? 17.764  51.520 13.931 1.00 44.66  ? 103 TRP B CD1 1 
ATOM   1708 C CD2 . TRP B 2 109 ? 16.855  49.879 15.157 1.00 44.41  ? 103 TRP B CD2 1 
ATOM   1709 N NE1 . TRP B 2 109 ? 17.756  51.937 15.242 1.00 38.25  ? 103 TRP B NE1 1 
ATOM   1710 C CE2 . TRP B 2 109 ? 17.203  50.954 16.015 1.00 42.23  ? 103 TRP B CE2 1 
ATOM   1711 C CE3 . TRP B 2 109 ? 16.272  48.733 15.709 1.00 45.33  ? 103 TRP B CE3 1 
ATOM   1712 C CZ2 . TRP B 2 109 ? 16.988  50.913 17.397 1.00 46.43  ? 103 TRP B CZ2 1 
ATOM   1713 C CZ3 . TRP B 2 109 ? 16.059  48.686 17.092 1.00 48.33  ? 103 TRP B CZ3 1 
ATOM   1714 C CH2 . TRP B 2 109 ? 16.413  49.773 17.917 1.00 50.51  ? 103 TRP B CH2 1 
ATOM   1715 N N   . GLY B 2 110 ? 16.151  52.496 10.868 1.00 34.63  ? 104 GLY B N   1 
ATOM   1716 C CA  . GLY B 2 110 ? 16.767  53.626 10.173 1.00 39.82  ? 104 GLY B CA  1 
ATOM   1717 C C   . GLY B 2 110 ? 18.269  53.895 10.379 1.00 36.67  ? 104 GLY B C   1 
ATOM   1718 O O   . GLY B 2 110 ? 18.967  53.158 11.103 1.00 36.70  ? 104 GLY B O   1 
ATOM   1719 N N   . GLN B 2 111 ? 18.763  54.954 9.735  1.00 33.08  ? 105 GLN B N   1 
ATOM   1720 C CA  . GLN B 2 111 ? 20.181  55.355 9.798  1.00 42.80  ? 105 GLN B CA  1 
ATOM   1721 C C   . GLN B 2 111 ? 20.604  56.013 11.111 1.00 46.07  ? 105 GLN B C   1 
ATOM   1722 O O   . GLN B 2 111 ? 21.756  55.878 11.572 1.00 44.82  ? 105 GLN B O   1 
ATOM   1723 C CB  . GLN B 2 111 ? 20.507  56.390 8.726  1.00 46.11  ? 105 GLN B CB  1 
ATOM   1724 C CG  . GLN B 2 111 ? 20.319  56.020 7.279  1.00 58.14  ? 105 GLN B CG  1 
ATOM   1725 C CD  . GLN B 2 111 ? 20.449  57.265 6.427  1.00 64.45  ? 105 GLN B CD  1 
ATOM   1726 O OE1 . GLN B 2 111 ? 20.097  58.359 6.883  1.00 67.75  ? 105 GLN B OE1 1 
ATOM   1727 N NE2 . GLN B 2 111 ? 20.980  57.126 5.216  1.00 63.38  ? 105 GLN B NE2 1 
ATOM   1728 N N   . GLY B 2 112 ? 19.678  56.789 11.661 1.00 45.52  ? 106 GLY B N   1 
ATOM   1729 C CA  . GLY B 2 112 ? 19.945  57.521 12.867 1.00 43.29  ? 106 GLY B CA  1 
ATOM   1730 C C   . GLY B 2 112 ? 20.146  58.948 12.448 1.00 45.39  ? 106 GLY B C   1 
ATOM   1731 O O   . GLY B 2 112 ? 20.296  59.235 11.255 1.00 47.94  ? 106 GLY B O   1 
ATOM   1732 N N   . THR B 2 113 ? 20.021  59.841 13.414 1.00 42.27  ? 107 THR B N   1 
ATOM   1733 C CA  . THR B 2 113 ? 20.228  61.247 13.180 1.00 36.44  ? 107 THR B CA  1 
ATOM   1734 C C   . THR B 2 113 ? 20.721  61.808 14.491 1.00 33.76  ? 107 THR B C   1 
ATOM   1735 O O   . THR B 2 113 ? 20.175  61.520 15.549 1.00 30.89  ? 107 THR B O   1 
ATOM   1736 C CB  . THR B 2 113 ? 18.949  61.961 12.680 1.00 32.53  ? 107 THR B CB  1 
ATOM   1737 O OG1 . THR B 2 113 ? 19.290  63.253 12.154 1.00 35.99  ? 107 THR B OG1 1 
ATOM   1738 C CG2 . THR B 2 113 ? 17.954  62.129 13.788 1.00 38.01  ? 107 THR B CG2 1 
ATOM   1739 N N   . LEU B 2 114 ? 21.845  62.496 14.428 1.00 35.47  ? 108 LEU B N   1 
ATOM   1740 C CA  . LEU B 2 114 ? 22.418  63.098 15.599 1.00 36.68  ? 108 LEU B CA  1 
ATOM   1741 C C   . LEU B 2 114 ? 21.759  64.453 15.884 1.00 42.04  ? 108 LEU B C   1 
ATOM   1742 O O   . LEU B 2 114 ? 21.481  65.266 14.962 1.00 45.06  ? 108 LEU B O   1 
ATOM   1743 C CB  . LEU B 2 114 ? 23.915  63.244 15.427 1.00 35.53  ? 108 LEU B CB  1 
ATOM   1744 C CG  . LEU B 2 114 ? 24.657  63.309 16.755 1.00 40.06  ? 108 LEU B CG  1 
ATOM   1745 C CD1 . LEU B 2 114 ? 24.407  62.055 17.538 1.00 39.86  ? 108 LEU B CD1 1 
ATOM   1746 C CD2 . LEU B 2 114 ? 26.117  63.450 16.510 1.00 37.41  ? 108 LEU B CD2 1 
ATOM   1747 N N   . VAL B 2 115 ? 21.365  64.604 17.145 1.00 41.56  ? 109 VAL B N   1 
ATOM   1748 C CA  . VAL B 2 115 ? 20.742  65.818 17.642 1.00 38.08  ? 109 VAL B CA  1 
ATOM   1749 C C   . VAL B 2 115 ? 21.668  66.182 18.759 1.00 42.38  ? 109 VAL B C   1 
ATOM   1750 O O   . VAL B 2 115 ? 21.938  65.355 19.634 1.00 45.76  ? 109 VAL B O   1 
ATOM   1751 C CB  . VAL B 2 115 ? 19.346  65.573 18.227 1.00 34.01  ? 109 VAL B CB  1 
ATOM   1752 C CG1 . VAL B 2 115 ? 18.904  66.743 19.042 1.00 28.83  ? 109 VAL B CG1 1 
ATOM   1753 C CG2 . VAL B 2 115 ? 18.359  65.357 17.107 1.00 37.47  ? 109 VAL B CG2 1 
ATOM   1754 N N   . THR B 2 116 ? 22.280  67.353 18.631 1.00 43.63  ? 110 THR B N   1 
ATOM   1755 C CA  . THR B 2 116 ? 23.186  67.873 19.630 1.00 39.23  ? 110 THR B CA  1 
ATOM   1756 C C   . THR B 2 116 ? 22.589  69.181 20.104 1.00 39.23  ? 110 THR B C   1 
ATOM   1757 O O   . THR B 2 116 ? 22.586  70.176 19.377 1.00 40.06  ? 110 THR B O   1 
ATOM   1758 C CB  . THR B 2 116 ? 24.586  68.069 19.069 1.00 36.32  ? 110 THR B CB  1 
ATOM   1759 O OG1 . THR B 2 116 ? 25.137  66.797 18.717 1.00 40.38  ? 110 THR B OG1 1 
ATOM   1760 C CG2 . THR B 2 116 ? 25.475  68.672 20.101 1.00 46.43  ? 110 THR B CG2 1 
ATOM   1761 N N   . VAL B 2 117 ? 21.904  69.086 21.238 1.00 42.67  ? 111 VAL B N   1 
ATOM   1762 C CA  . VAL B 2 117 ? 21.260  70.209 21.889 1.00 46.21  ? 111 VAL B CA  1 
ATOM   1763 C C   . VAL B 2 117 ? 22.367  70.892 22.680 1.00 47.56  ? 111 VAL B C   1 
ATOM   1764 O O   . VAL B 2 117 ? 22.830  70.386 23.710 1.00 45.45  ? 111 VAL B O   1 
ATOM   1765 C CB  . VAL B 2 117 ? 20.152  69.714 22.828 1.00 51.23  ? 111 VAL B CB  1 
ATOM   1766 C CG1 . VAL B 2 117 ? 19.242  70.883 23.224 1.00 54.27  ? 111 VAL B CG1 1 
ATOM   1767 C CG2 . VAL B 2 117 ? 19.344  68.602 22.144 1.00 46.53  ? 111 VAL B CG2 1 
ATOM   1768 N N   . SER B 2 118 ? 22.824  72.015 22.138 1.00 53.39  ? 112 SER B N   1 
ATOM   1769 C CA  . SER B 2 118 ? 23.939  72.783 22.692 1.00 54.57  ? 112 SER B CA  1 
ATOM   1770 C C   . SER B 2 118 ? 23.796  74.294 22.504 1.00 53.66  ? 112 SER B C   1 
ATOM   1771 O O   . SER B 2 118 ? 23.059  74.709 21.583 1.00 56.23  ? 112 SER B O   1 
ATOM   1772 C CB  . SER B 2 118 ? 25.234  72.320 22.013 1.00 51.25  ? 112 SER B CB  1 
ATOM   1773 O OG  . SER B 2 118 ? 25.088  72.281 20.596 1.00 32.40  ? 112 SER B OG  1 
ATOM   1774 O OXT . SER B 2 118 ? 24.465  75.050 23.246 1.00 50.72  ? 112 SER B OXT 1 
ATOM   1775 N N   . ASP C 1 1   ? 46.236  15.257 28.967 1.00 63.91  ? 1   ASP C N   1 
ATOM   1776 C CA  . ASP C 1 1   ? 46.042  15.944 27.671 1.00 64.55  ? 1   ASP C CA  1 
ATOM   1777 C C   . ASP C 1 1   ? 44.561  16.076 27.410 1.00 63.25  ? 1   ASP C C   1 
ATOM   1778 O O   . ASP C 1 1   ? 44.147  16.428 26.319 1.00 65.56  ? 1   ASP C O   1 
ATOM   1779 C CB  . ASP C 1 1   ? 46.701  15.177 26.522 1.00 72.43  ? 1   ASP C CB  1 
ATOM   1780 C CG  . ASP C 1 1   ? 46.650  15.949 25.190 1.00 83.03  ? 1   ASP C CG  1 
ATOM   1781 O OD1 . ASP C 1 1   ? 47.411  16.933 25.034 1.00 87.13  ? 1   ASP C OD1 1 
ATOM   1782 O OD2 . ASP C 1 1   ? 45.836  15.586 24.306 1.00 86.42  ? 1   ASP C OD2 1 
ATOM   1783 N N   . VAL C 1 2   ? 43.744  15.668 28.368 1.00 61.15  ? 2   VAL C N   1 
ATOM   1784 C CA  . VAL C 1 2   ? 42.311  15.856 28.206 1.00 58.63  ? 2   VAL C CA  1 
ATOM   1785 C C   . VAL C 1 2   ? 42.335  17.403 28.221 1.00 57.71  ? 2   VAL C C   1 
ATOM   1786 O O   . VAL C 1 2   ? 43.087  17.987 29.000 1.00 61.65  ? 2   VAL C O   1 
ATOM   1787 C CB  . VAL C 1 2   ? 41.545  15.253 29.421 1.00 58.79  ? 2   VAL C CB  1 
ATOM   1788 C CG1 . VAL C 1 2   ? 40.040  15.297 29.213 1.00 52.68  ? 2   VAL C CG1 1 
ATOM   1789 C CG2 . VAL C 1 2   ? 41.995  13.823 29.642 1.00 54.06  ? 2   VAL C CG2 1 
ATOM   1790 N N   . VAL C 1 3   ? 41.678  18.068 27.275 1.00 53.60  ? 3   VAL C N   1 
ATOM   1791 C CA  . VAL C 1 3   ? 41.742  19.530 27.256 1.00 48.13  ? 3   VAL C CA  1 
ATOM   1792 C C   . VAL C 1 3   ? 40.578  20.272 27.887 1.00 48.56  ? 3   VAL C C   1 
ATOM   1793 O O   . VAL C 1 3   ? 39.448  20.203 27.397 1.00 50.00  ? 3   VAL C O   1 
ATOM   1794 C CB  . VAL C 1 3   ? 42.027  20.071 25.838 1.00 42.88  ? 3   VAL C CB  1 
ATOM   1795 C CG1 . VAL C 1 3   ? 41.738  21.574 25.741 1.00 34.94  ? 3   VAL C CG1 1 
ATOM   1796 C CG2 . VAL C 1 3   ? 43.481  19.822 25.514 1.00 44.20  ? 3   VAL C CG2 1 
ATOM   1797 N N   . MET C 1 4   ? 40.883  21.009 28.957 1.00 45.47  ? 4   MET C N   1 
ATOM   1798 C CA  . MET C 1 4   ? 39.894  21.781 29.700 1.00 44.05  ? 4   MET C CA  1 
ATOM   1799 C C   . MET C 1 4   ? 39.811  23.200 29.154 1.00 42.63  ? 4   MET C C   1 
ATOM   1800 O O   . MET C 1 4   ? 40.824  23.879 28.996 1.00 45.32  ? 4   MET C O   1 
ATOM   1801 C CB  . MET C 1 4   ? 40.241  21.784 31.190 1.00 41.54  ? 4   MET C CB  1 
ATOM   1802 C CG  . MET C 1 4   ? 40.383  20.390 31.809 1.00 37.87  ? 4   MET C CG  1 
ATOM   1803 S SD  . MET C 1 4   ? 38.903  19.322 31.597 1.00 41.47  ? 4   MET C SD  1 
ATOM   1804 C CE  . MET C 1 4   ? 37.563  20.295 32.363 1.00 21.94  ? 4   MET C CE  1 
ATOM   1805 N N   . THR C 1 5   ? 38.596  23.668 28.924 1.00 41.49  ? 5   THR C N   1 
ATOM   1806 C CA  . THR C 1 5   ? 38.388  24.991 28.348 1.00 44.18  ? 5   THR C CA  1 
ATOM   1807 C C   . THR C 1 5   ? 37.280  25.758 29.072 1.00 47.27  ? 5   THR C C   1 
ATOM   1808 O O   . THR C 1 5   ? 36.130  25.278 29.139 1.00 48.55  ? 5   THR C O   1 
ATOM   1809 C CB  . THR C 1 5   ? 38.027  24.823 26.842 1.00 42.00  ? 5   THR C CB  1 
ATOM   1810 O OG1 . THR C 1 5   ? 39.175  24.348 26.135 1.00 38.97  ? 5   THR C OG1 1 
ATOM   1811 C CG2 . THR C 1 5   ? 37.513  26.119 26.221 1.00 40.16  ? 5   THR C CG2 1 
ATOM   1812 N N   . GLN C 1 6   ? 37.610  26.940 29.607 1.00 41.99  ? 6   GLN C N   1 
ATOM   1813 C CA  . GLN C 1 6   ? 36.610  27.722 30.328 1.00 39.30  ? 6   GLN C CA  1 
ATOM   1814 C C   . GLN C 1 6   ? 35.946  28.839 29.563 1.00 37.36  ? 6   GLN C C   1 
ATOM   1815 O O   . GLN C 1 6   ? 36.497  29.379 28.614 1.00 42.93  ? 6   GLN C O   1 
ATOM   1816 C CB  . GLN C 1 6   ? 37.135  28.191 31.683 1.00 33.66  ? 6   GLN C CB  1 
ATOM   1817 C CG  . GLN C 1 6   ? 37.395  27.029 32.621 1.00 35.23  ? 6   GLN C CG  1 
ATOM   1818 C CD  . GLN C 1 6   ? 37.662  27.462 34.031 1.00 38.97  ? 6   GLN C CD  1 
ATOM   1819 O OE1 . GLN C 1 6   ? 38.760  27.236 34.564 1.00 30.17  ? 6   GLN C OE1 1 
ATOM   1820 N NE2 . GLN C 1 6   ? 36.663  28.082 34.661 1.00 35.04  ? 6   GLN C NE2 1 
ATOM   1821 N N   . THR C 1 7   ? 34.764  29.212 30.002 1.00 38.54  ? 7   THR C N   1 
ATOM   1822 C CA  . THR C 1 7   ? 34.034  30.233 29.292 1.00 44.77  ? 7   THR C CA  1 
ATOM   1823 C C   . THR C 1 7   ? 33.064  31.002 30.175 1.00 44.73  ? 7   THR C C   1 
ATOM   1824 O O   . THR C 1 7   ? 32.313  30.422 30.940 1.00 52.00  ? 7   THR C O   1 
ATOM   1825 C CB  . THR C 1 7   ? 33.282  29.568 28.106 1.00 46.43  ? 7   THR C CB  1 
ATOM   1826 O OG1 . THR C 1 7   ? 34.198  29.369 27.026 1.00 56.16  ? 7   THR C OG1 1 
ATOM   1827 C CG2 . THR C 1 7   ? 32.100  30.390 27.642 1.00 46.23  ? 7   THR C CG2 1 
ATOM   1828 N N   . PRO C 1 8   ? 33.118  32.341 30.130 1.00 44.91  ? 8   PRO C N   1 
ATOM   1829 C CA  . PRO C 1 8   ? 34.062  33.083 29.292 1.00 48.11  ? 8   PRO C CA  1 
ATOM   1830 C C   . PRO C 1 8   ? 35.362  33.241 30.071 1.00 46.68  ? 8   PRO C C   1 
ATOM   1831 O O   . PRO C 1 8   ? 35.421  32.847 31.241 1.00 47.52  ? 8   PRO C O   1 
ATOM   1832 C CB  . PRO C 1 8   ? 33.347  34.419 29.108 1.00 49.83  ? 8   PRO C CB  1 
ATOM   1833 C CG  . PRO C 1 8   ? 32.602  34.572 30.397 1.00 45.20  ? 8   PRO C CG  1 
ATOM   1834 C CD  . PRO C 1 8   ? 32.041  33.207 30.621 1.00 41.08  ? 8   PRO C CD  1 
ATOM   1835 N N   . SER C 1 9   ? 36.395  33.779 29.439 1.00 42.19  ? 9   SER C N   1 
ATOM   1836 C CA  . SER C 1 9   ? 37.669  33.980 30.128 1.00 43.35  ? 9   SER C CA  1 
ATOM   1837 C C   . SER C 1 9   ? 37.582  35.085 31.218 1.00 38.78  ? 9   SER C C   1 
ATOM   1838 O O   . SER C 1 9   ? 38.390  35.120 32.152 1.00 44.75  ? 9   SER C O   1 
ATOM   1839 C CB  . SER C 1 9   ? 38.777  34.252 29.112 1.00 40.63  ? 9   SER C CB  1 
ATOM   1840 O OG  . SER C 1 9   ? 38.369  35.262 28.220 1.00 50.34  ? 9   SER C OG  1 
ATOM   1841 N N   . SER C 1 10  ? 36.593  35.965 31.104 1.00 35.34  ? 10  SER C N   1 
ATOM   1842 C CA  . SER C 1 10  ? 36.348  37.026 32.080 1.00 36.08  ? 10  SER C CA  1 
ATOM   1843 C C   . SER C 1 10  ? 34.987  37.678 31.824 1.00 38.18  ? 10  SER C C   1 
ATOM   1844 O O   . SER C 1 10  ? 34.449  37.596 30.702 1.00 36.25  ? 10  SER C O   1 
ATOM   1845 C CB  . SER C 1 10  ? 37.453  38.074 32.031 1.00 40.63  ? 10  SER C CB  1 
ATOM   1846 O OG  . SER C 1 10  ? 37.736  38.419 30.688 1.00 48.69  ? 10  SER C OG  1 
ATOM   1847 N N   . LEU C 1 11  ? 34.397  38.257 32.871 1.00 40.88  ? 11  LEU C N   1 
ATOM   1848 C CA  . LEU C 1 11  ? 33.095  38.915 32.738 1.00 42.67  ? 11  LEU C CA  1 
ATOM   1849 C C   . LEU C 1 11  ? 32.774  39.849 33.901 1.00 46.31  ? 11  LEU C C   1 
ATOM   1850 O O   . LEU C 1 11  ? 33.328  39.720 34.994 1.00 46.43  ? 11  LEU C O   1 
ATOM   1851 C CB  . LEU C 1 11  ? 31.964  37.889 32.584 1.00 41.27  ? 11  LEU C CB  1 
ATOM   1852 C CG  . LEU C 1 11  ? 31.509  37.127 33.833 1.00 40.70  ? 11  LEU C CG  1 
ATOM   1853 C CD1 . LEU C 1 11  ? 30.182  36.484 33.493 1.00 40.62  ? 11  LEU C CD1 1 
ATOM   1854 C CD2 . LEU C 1 11  ? 32.551  36.098 34.323 1.00 29.43  ? 11  LEU C CD2 1 
ATOM   1855 N N   . ALA C 1 12  ? 31.829  40.747 33.655 1.00 48.48  ? 12  ALA C N   1 
ATOM   1856 C CA  . ALA C 1 12  ? 31.397  41.736 34.620 1.00 48.28  ? 12  ALA C CA  1 
ATOM   1857 C C   . ALA C 1 12  ? 29.981  41.449 35.063 1.00 51.38  ? 12  ALA C C   1 
ATOM   1858 O O   . ALA C 1 12  ? 29.066  41.370 34.238 1.00 52.53  ? 12  ALA C O   1 
ATOM   1859 C CB  . ALA C 1 12  ? 31.456  43.115 33.997 1.00 47.26  ? 12  ALA C CB  1 
ATOM   1860 N N   . MET C 1 13  ? 29.800  41.353 36.373 1.00 52.67  ? 13  MET C N   1 
ATOM   1861 C CA  . MET C 1 13  ? 28.505  41.089 36.971 1.00 48.66  ? 13  MET C CA  1 
ATOM   1862 C C   . MET C 1 13  ? 28.219  42.148 38.027 1.00 47.92  ? 13  MET C C   1 
ATOM   1863 O O   . MET C 1 13  ? 29.073  42.966 38.347 1.00 48.49  ? 13  MET C O   1 
ATOM   1864 C CB  . MET C 1 13  ? 28.508  39.702 37.610 1.00 46.71  ? 13  MET C CB  1 
ATOM   1865 C CG  . MET C 1 13  ? 28.471  38.562 36.606 1.00 48.83  ? 13  MET C CG  1 
ATOM   1866 S SD  . MET C 1 13  ? 27.002  38.590 35.506 1.00 51.77  ? 13  MET C SD  1 
ATOM   1867 C CE  . MET C 1 13  ? 25.745  38.063 36.652 1.00 44.99  ? 13  MET C CE  1 
ATOM   1868 N N   . SER C 1 14  ? 27.015  42.119 38.578 1.00 49.79  ? 14  SER C N   1 
ATOM   1869 C CA  . SER C 1 14  ? 26.604  43.074 39.589 1.00 49.27  ? 14  SER C CA  1 
ATOM   1870 C C   . SER C 1 14  ? 26.007  42.314 40.742 1.00 52.22  ? 14  SER C C   1 
ATOM   1871 O O   . SER C 1 14  ? 25.480  41.210 40.563 1.00 50.44  ? 14  SER C O   1 
ATOM   1872 C CB  . SER C 1 14  ? 25.569  44.034 39.028 1.00 49.28  ? 14  SER C CB  1 
ATOM   1873 O OG  . SER C 1 14  ? 26.075  44.697 37.883 1.00 57.04  ? 14  SER C OG  1 
ATOM   1874 N N   . VAL C 1 15  ? 26.087  42.913 41.924 1.00 56.05  ? 15  VAL C N   1 
ATOM   1875 C CA  . VAL C 1 15  ? 25.593  42.280 43.136 1.00 57.51  ? 15  VAL C CA  1 
ATOM   1876 C C   . VAL C 1 15  ? 24.156  41.793 42.986 1.00 59.87  ? 15  VAL C C   1 
ATOM   1877 O O   . VAL C 1 15  ? 23.368  42.425 42.278 1.00 63.78  ? 15  VAL C O   1 
ATOM   1878 C CB  . VAL C 1 15  ? 25.710  43.237 44.335 1.00 55.93  ? 15  VAL C CB  1 
ATOM   1879 C CG1 . VAL C 1 15  ? 25.224  42.544 45.605 1.00 53.49  ? 15  VAL C CG1 1 
ATOM   1880 C CG2 . VAL C 1 15  ? 27.162  43.714 44.484 1.00 52.85  ? 15  VAL C CG2 1 
ATOM   1881 N N   . GLY C 1 16  ? 23.857  40.631 43.577 1.00 55.60  ? 16  GLY C N   1 
ATOM   1882 C CA  . GLY C 1 16  ? 22.514  40.070 43.525 1.00 53.51  ? 16  GLY C CA  1 
ATOM   1883 C C   . GLY C 1 16  ? 22.142  39.276 42.281 1.00 54.49  ? 16  GLY C C   1 
ATOM   1884 O O   . GLY C 1 16  ? 21.165  38.510 42.292 1.00 51.42  ? 16  GLY C O   1 
ATOM   1885 N N   . GLN C 1 17  ? 22.929  39.442 41.220 1.00 52.99  ? 17  GLN C N   1 
ATOM   1886 C CA  . GLN C 1 17  ? 22.697  38.753 39.955 1.00 51.15  ? 17  GLN C CA  1 
ATOM   1887 C C   . GLN C 1 17  ? 23.195  37.294 39.942 1.00 51.99  ? 17  GLN C C   1 
ATOM   1888 O O   . GLN C 1 17  ? 24.102  36.916 40.706 1.00 49.24  ? 17  GLN C O   1 
ATOM   1889 C CB  . GLN C 1 17  ? 23.339  39.545 38.817 1.00 47.29  ? 17  GLN C CB  1 
ATOM   1890 C CG  . GLN C 1 17  ? 22.772  40.946 38.675 1.00 51.26  ? 17  GLN C CG  1 
ATOM   1891 C CD  . GLN C 1 17  ? 23.361  41.700 37.502 1.00 52.55  ? 17  GLN C CD  1 
ATOM   1892 O OE1 . GLN C 1 17  ? 24.481  41.422 37.071 1.00 55.55  ? 17  GLN C OE1 1 
ATOM   1893 N NE2 . GLN C 1 17  ? 22.601  42.635 36.957 1.00 54.82  ? 17  GLN C NE2 1 
ATOM   1894 N N   . LYS C 1 18  ? 22.576  36.484 39.081 1.00 48.60  ? 18  LYS C N   1 
ATOM   1895 C CA  . LYS C 1 18  ? 22.901  35.069 38.931 1.00 44.74  ? 18  LYS C CA  1 
ATOM   1896 C C   . LYS C 1 18  ? 24.040  34.893 37.929 1.00 43.18  ? 18  LYS C C   1 
ATOM   1897 O O   . LYS C 1 18  ? 23.904  35.221 36.750 1.00 40.52  ? 18  LYS C O   1 
ATOM   1898 C CB  . LYS C 1 18  ? 21.648  34.311 38.470 1.00 46.45  ? 18  LYS C CB  1 
ATOM   1899 C CG  . LYS C 1 18  ? 21.822  32.825 38.214 1.00 48.00  ? 18  LYS C CG  1 
ATOM   1900 C CD  . LYS C 1 18  ? 20.559  32.247 37.589 1.00 43.71  ? 18  LYS C CD  1 
ATOM   1901 C CE  . LYS C 1 18  ? 20.854  30.929 36.916 1.00 49.42  ? 18  LYS C CE  1 
ATOM   1902 N NZ  . LYS C 1 18  ? 19.695  30.378 36.187 1.00 49.52  ? 18  LYS C NZ  1 
ATOM   1903 N N   . VAL C 1 19  ? 25.173  34.402 38.416 1.00 45.90  ? 19  VAL C N   1 
ATOM   1904 C CA  . VAL C 1 19  ? 26.350  34.193 37.583 1.00 45.26  ? 19  VAL C CA  1 
ATOM   1905 C C   . VAL C 1 19  ? 26.403  32.759 37.101 1.00 46.14  ? 19  VAL C C   1 
ATOM   1906 O O   . VAL C 1 19  ? 26.109  31.830 37.857 1.00 46.22  ? 19  VAL C O   1 
ATOM   1907 C CB  . VAL C 1 19  ? 27.672  34.453 38.359 1.00 42.90  ? 19  VAL C CB  1 
ATOM   1908 C CG1 . VAL C 1 19  ? 28.845  34.560 37.395 1.00 33.53  ? 19  VAL C CG1 1 
ATOM   1909 C CG2 . VAL C 1 19  ? 27.569  35.693 39.193 1.00 37.63  ? 19  VAL C CG2 1 
ATOM   1910 N N   . THR C 1 20  ? 26.878  32.595 35.873 1.00 45.05  ? 20  THR C N   1 
ATOM   1911 C CA  . THR C 1 20  ? 27.012  31.290 35.243 1.00 46.58  ? 20  THR C CA  1 
ATOM   1912 C C   . THR C 1 20  ? 28.327  31.212 34.446 1.00 46.18  ? 20  THR C C   1 
ATOM   1913 O O   . THR C 1 20  ? 28.595  32.058 33.583 1.00 44.67  ? 20  THR C O   1 
ATOM   1914 C CB  . THR C 1 20  ? 25.836  31.046 34.274 1.00 48.60  ? 20  THR C CB  1 
ATOM   1915 O OG1 . THR C 1 20  ? 24.640  31.598 34.841 1.00 54.31  ? 20  THR C OG1 1 
ATOM   1916 C CG2 . THR C 1 20  ? 25.634  29.555 34.030 1.00 45.58  ? 20  THR C CG2 1 
ATOM   1917 N N   . MET C 1 21  ? 29.171  30.242 34.775 1.00 41.63  ? 21  MET C N   1 
ATOM   1918 C CA  . MET C 1 21  ? 30.429  30.060 34.056 1.00 40.59  ? 21  MET C CA  1 
ATOM   1919 C C   . MET C 1 21  ? 30.579  28.596 33.727 1.00 39.89  ? 21  MET C C   1 
ATOM   1920 O O   . MET C 1 21  ? 30.198  27.727 34.516 1.00 38.61  ? 21  MET C O   1 
ATOM   1921 C CB  . MET C 1 21  ? 31.648  30.618 34.818 1.00 42.15  ? 21  MET C CB  1 
ATOM   1922 C CG  . MET C 1 21  ? 31.814  30.191 36.263 1.00 47.36  ? 21  MET C CG  1 
ATOM   1923 S SD  . MET C 1 21  ? 32.776  31.412 37.215 1.00 45.59  ? 21  MET C SD  1 
ATOM   1924 C CE  . MET C 1 21  ? 31.545  32.509 37.661 1.00 36.07  ? 21  MET C CE  1 
ATOM   1925 N N   . SER C 1 22  ? 31.163  28.327 32.570 1.00 36.50  ? 22  SER C N   1 
ATOM   1926 C CA  . SER C 1 22  ? 31.297  26.966 32.082 1.00 40.70  ? 22  SER C CA  1 
ATOM   1927 C C   . SER C 1 22  ? 32.690  26.416 32.043 1.00 33.29  ? 22  SER C C   1 
ATOM   1928 O O   . SER C 1 22  ? 33.659  27.156 32.137 1.00 42.23  ? 22  SER C O   1 
ATOM   1929 C CB  . SER C 1 22  ? 30.697  26.892 30.676 1.00 50.19  ? 22  SER C CB  1 
ATOM   1930 O OG  . SER C 1 22  ? 29.550  27.733 30.562 1.00 57.59  ? 22  SER C OG  1 
ATOM   1931 N N   . CYS C 1 23  ? 32.773  25.102 31.917 1.00 37.46  ? 23  CYS C N   1 
ATOM   1932 C CA  . CYS C 1 23  ? 34.048  24.378 31.827 1.00 45.16  ? 23  CYS C CA  1 
ATOM   1933 C C   . CYS C 1 23  ? 33.790  23.078 31.041 1.00 50.25  ? 23  CYS C C   1 
ATOM   1934 O O   . CYS C 1 23  ? 32.854  22.332 31.378 1.00 53.67  ? 23  CYS C O   1 
ATOM   1935 C CB  . CYS C 1 23  ? 34.601  24.076 33.206 1.00 34.23  ? 23  CYS C CB  1 
ATOM   1936 S SG  . CYS C 1 23  ? 35.844  22.746 33.221 1.00 44.25  ? 23  CYS C SG  1 
ATOM   1937 N N   . LYS C 1 24  ? 34.556  22.833 29.969 1.00 52.05  ? 24  LYS C N   1 
ATOM   1938 C CA  . LYS C 1 24  ? 34.371  21.630 29.139 1.00 54.05  ? 24  LYS C CA  1 
ATOM   1939 C C   . LYS C 1 24  ? 35.633  20.822 28.888 1.00 54.82  ? 24  LYS C C   1 
ATOM   1940 O O   . LYS C 1 24  ? 36.706  21.394 28.722 1.00 58.76  ? 24  LYS C O   1 
ATOM   1941 C CB  . LYS C 1 24  ? 33.778  22.023 27.782 1.00 55.83  ? 24  LYS C CB  1 
ATOM   1942 C CG  . LYS C 1 24  ? 32.473  22.774 27.912 1.00 62.78  ? 24  LYS C CG  1 
ATOM   1943 C CD  . LYS C 1 24  ? 31.882  23.136 26.575 1.00 69.65  ? 24  LYS C CD  1 
ATOM   1944 C CE  . LYS C 1 24  ? 30.595  23.935 26.777 1.00 78.72  ? 24  LYS C CE  1 
ATOM   1945 N NZ  . LYS C 1 24  ? 30.106  24.539 25.494 1.00 84.76  ? 24  LYS C NZ  1 
ATOM   1946 N N   . SER C 1 25  ? 35.516  19.495 28.914 1.00 52.10  ? 25  SER C N   1 
ATOM   1947 C CA  . SER C 1 25  ? 36.677  18.636 28.661 1.00 51.16  ? 25  SER C CA  1 
ATOM   1948 C C   . SER C 1 25  ? 36.621  18.082 27.257 1.00 51.48  ? 25  SER C C   1 
ATOM   1949 O O   . SER C 1 25  ? 35.535  17.954 26.669 1.00 48.36  ? 25  SER C O   1 
ATOM   1950 C CB  . SER C 1 25  ? 36.751  17.481 29.652 1.00 45.73  ? 25  SER C CB  1 
ATOM   1951 O OG  . SER C 1 25  ? 35.488  16.843 29.759 1.00 55.52  ? 25  SER C OG  1 
ATOM   1952 N N   . SER C 1 26  ? 37.790  17.742 26.722 1.00 52.49  ? 26  SER C N   1 
ATOM   1953 C CA  . SER C 1 26  ? 37.868  17.186 25.381 1.00 56.17  ? 26  SER C CA  1 
ATOM   1954 C C   . SER C 1 26  ? 37.199  15.802 25.348 1.00 59.66  ? 26  SER C C   1 
ATOM   1955 O O   . SER C 1 26  ? 36.675  15.378 24.311 1.00 61.28  ? 26  SER C O   1 
ATOM   1956 C CB  . SER C 1 26  ? 39.333  17.114 24.911 1.00 50.56  ? 26  SER C CB  1 
ATOM   1957 O OG  . SER C 1 26  ? 40.078  16.154 25.644 1.00 48.36  ? 26  SER C OG  1 
ATOM   1958 N N   . GLN C 1 27  ? 37.186  15.124 26.489 1.00 60.11  ? 27  GLN C N   1 
ATOM   1959 C CA  . GLN C 1 27  ? 36.593  13.808 26.602 1.00 59.02  ? 27  GLN C CA  1 
ATOM   1960 C C   . GLN C 1 27  ? 35.762  13.756 27.853 1.00 54.44  ? 27  GLN C C   1 
ATOM   1961 O O   . GLN C 1 27  ? 36.022  14.485 28.795 1.00 56.89  ? 27  GLN C O   1 
ATOM   1962 C CB  . GLN C 1 27  ? 37.674  12.751 26.714 1.00 66.34  ? 27  GLN C CB  1 
ATOM   1963 C CG  . GLN C 1 27  ? 38.725  12.779 25.644 1.00 69.11  ? 27  GLN C CG  1 
ATOM   1964 C CD  . GLN C 1 27  ? 39.830  11.825 25.994 1.00 80.02  ? 27  GLN C CD  1 
ATOM   1965 O OE1 . GLN C 1 27  ? 39.806  11.200 27.063 1.00 81.96  ? 27  GLN C OE1 1 
ATOM   1966 N NE2 . GLN C 1 27  ? 40.805  11.692 25.113 1.00 85.15  ? 27  GLN C NE2 1 
ATOM   1967 N N   . SER C 1 28  A 34.804  12.844 27.873 1.00 48.50  ? 27  SER C N   1 
ATOM   1968 C CA  . SER C 1 28  A 33.914  12.678 29.001 1.00 48.80  ? 27  SER C CA  1 
ATOM   1969 C C   . SER C 1 28  A 34.707  12.351 30.262 1.00 48.48  ? 27  SER C C   1 
ATOM   1970 O O   . SER C 1 28  A 35.685  11.610 30.212 1.00 47.23  ? 27  SER C O   1 
ATOM   1971 C CB  . SER C 1 28  A 32.917  11.559 28.681 1.00 47.68  ? 27  SER C CB  1 
ATOM   1972 O OG  . SER C 1 28  A 31.907  11.429 29.658 1.00 51.30  ? 27  SER C OG  1 
ATOM   1973 N N   . LEU C 1 29  B 34.250  12.889 31.388 1.00 50.94  ? 27  LEU C N   1 
ATOM   1974 C CA  . LEU C 1 29  B 34.877  12.681 32.692 1.00 52.58  ? 27  LEU C CA  1 
ATOM   1975 C C   . LEU C 1 29  B 33.966  11.832 33.595 1.00 58.49  ? 27  LEU C C   1 
ATOM   1976 O O   . LEU C 1 29  B 34.100  11.828 34.831 1.00 60.16  ? 27  LEU C O   1 
ATOM   1977 C CB  . LEU C 1 29  B 35.116  14.030 33.368 1.00 47.34  ? 27  LEU C CB  1 
ATOM   1978 C CG  . LEU C 1 29  B 35.878  15.116 32.609 1.00 43.48  ? 27  LEU C CG  1 
ATOM   1979 C CD1 . LEU C 1 29  B 35.831  16.420 33.406 1.00 32.24  ? 27  LEU C CD1 1 
ATOM   1980 C CD2 . LEU C 1 29  B 37.302  14.635 32.327 1.00 40.59  ? 27  LEU C CD2 1 
ATOM   1981 N N   . LEU C 1 30  C 33.022  11.129 32.983 1.00 60.59  ? 27  LEU C N   1 
ATOM   1982 C CA  . LEU C 1 30  C 32.111  10.291 33.729 1.00 54.50  ? 27  LEU C CA  1 
ATOM   1983 C C   . LEU C 1 30  C 32.655  8.874  33.869 1.00 57.05  ? 27  LEU C C   1 
ATOM   1984 O O   . LEU C 1 30  C 32.850  8.154  32.878 1.00 50.59  ? 27  LEU C O   1 
ATOM   1985 C CB  . LEU C 1 30  C 30.760  10.285 33.049 1.00 50.12  ? 27  LEU C CB  1 
ATOM   1986 C CG  . LEU C 1 30  C 29.648  9.461  33.689 1.00 49.55  ? 27  LEU C CG  1 
ATOM   1987 C CD1 . LEU C 1 30  C 29.566  9.636  35.190 1.00 40.13  ? 27  LEU C CD1 1 
ATOM   1988 C CD2 . LEU C 1 30  C 28.359  9.908  33.037 1.00 53.32  ? 27  LEU C CD2 1 
ATOM   1989 N N   . ASN C 1 31  D 32.934  8.511  35.118 1.00 60.75  ? 27  ASN C N   1 
ATOM   1990 C CA  . ASN C 1 31  D 33.437  7.190  35.464 1.00 63.58  ? 27  ASN C CA  1 
ATOM   1991 C C   . ASN C 1 31  D 32.251  6.224  35.505 1.00 65.86  ? 27  ASN C C   1 
ATOM   1992 O O   . ASN C 1 31  D 31.408  6.289  36.413 1.00 60.86  ? 27  ASN C O   1 
ATOM   1993 C CB  . ASN C 1 31  D 34.113  7.226  36.838 1.00 60.44  ? 27  ASN C CB  1 
ATOM   1994 C CG  . ASN C 1 31  D 34.507  5.841  37.331 1.00 66.39  ? 27  ASN C CG  1 
ATOM   1995 O OD1 . ASN C 1 31  D 35.041  5.031  36.572 1.00 67.12  ? 27  ASN C OD1 1 
ATOM   1996 N ND2 . ASN C 1 31  D 34.247  5.566  38.605 1.00 57.12  ? 27  ASN C ND2 1 
ATOM   1997 N N   . ILE C 1 32  E 32.166  5.354  34.508 1.00 70.48  ? 27  ILE C N   1 
ATOM   1998 C CA  . ILE C 1 32  E 31.086  4.368  34.435 1.00 72.47  ? 27  ILE C CA  1 
ATOM   1999 C C   . ILE C 1 32  E 31.415  3.175  35.331 1.00 76.83  ? 27  ILE C C   1 
ATOM   2000 O O   . ILE C 1 32  E 31.829  2.119  34.853 1.00 81.74  ? 27  ILE C O   1 
ATOM   2001 C CB  . ILE C 1 32  E 30.884  3.876  32.989 1.00 71.01  ? 27  ILE C CB  1 
ATOM   2002 C CG1 . ILE C 1 32  E 32.256  3.571  32.347 1.00 69.44  ? 27  ILE C CG1 1 
ATOM   2003 C CG2 . ILE C 1 32  E 30.033  4.894  32.221 1.00 69.00  ? 27  ILE C CG2 1 
ATOM   2004 C CD1 . ILE C 1 32  E 32.212  3.020  30.940 1.00 67.31  ? 27  ILE C CD1 1 
ATOM   2005 N N   . SER C 1 33  F 31.278  3.385  36.638 1.00 76.96  ? 27  SER C N   1 
ATOM   2006 C CA  . SER C 1 33  F 31.548  2.380  37.671 1.00 73.83  ? 27  SER C CA  1 
ATOM   2007 C C   . SER C 1 33  F 30.744  2.836  38.870 1.00 74.84  ? 27  SER C C   1 
ATOM   2008 O O   . SER C 1 33  F 30.112  2.034  39.566 1.00 80.02  ? 27  SER C O   1 
ATOM   2009 C CB  . SER C 1 33  F 33.025  2.364  38.083 1.00 72.40  ? 27  SER C CB  1 
ATOM   2010 O OG  . SER C 1 33  F 33.844  1.684  37.157 1.00 78.50  ? 27  SER C OG  1 
ATOM   2011 N N   . ASN C 1 34  ? 30.808  4.141  39.120 1.00 70.89  ? 28  ASN C N   1 
ATOM   2012 C CA  . ASN C 1 34  ? 30.098  4.765  40.232 1.00 63.44  ? 28  ASN C CA  1 
ATOM   2013 C C   . ASN C 1 34  ? 29.239  5.928  39.752 1.00 59.61  ? 28  ASN C C   1 
ATOM   2014 O O   . ASN C 1 34  ? 28.563  6.570  40.559 1.00 59.50  ? 28  ASN C O   1 
ATOM   2015 C CB  . ASN C 1 34  ? 31.086  5.238  41.313 1.00 63.36  ? 28  ASN C CB  1 
ATOM   2016 C CG  . ASN C 1 34  ? 32.175  6.174  40.771 1.00 62.51  ? 28  ASN C CG  1 
ATOM   2017 O OD1 . ASN C 1 34  ? 32.140  6.634  39.621 1.00 58.72  ? 28  ASN C OD1 1 
ATOM   2018 N ND2 . ASN C 1 34  ? 33.149  6.459  41.609 1.00 60.28  ? 28  ASN C ND2 1 
ATOM   2019 N N   . GLN C 1 35  ? 29.285  6.199  38.444 1.00 57.43  ? 29  GLN C N   1 
ATOM   2020 C CA  . GLN C 1 35  ? 28.521  7.288  37.814 1.00 54.61  ? 29  GLN C CA  1 
ATOM   2021 C C   . GLN C 1 35  ? 28.828  8.693  38.362 1.00 54.86  ? 29  GLN C C   1 
ATOM   2022 O O   . GLN C 1 35  ? 27.968  9.592  38.345 1.00 45.80  ? 29  GLN C O   1 
ATOM   2023 C CB  . GLN C 1 35  ? 27.016  7.011  37.893 1.00 53.01  ? 29  GLN C CB  1 
ATOM   2024 C CG  . GLN C 1 35  ? 26.539  5.906  36.979 1.00 45.89  ? 29  GLN C CG  1 
ATOM   2025 C CD  . GLN C 1 35  ? 26.350  6.358  35.547 1.00 49.43  ? 29  GLN C CD  1 
ATOM   2026 O OE1 . GLN C 1 35  ? 27.117  5.972  34.650 1.00 53.25  ? 29  GLN C OE1 1 
ATOM   2027 N NE2 . GLN C 1 35  ? 25.305  7.145  35.308 1.00 40.29  ? 29  GLN C NE2 1 
ATOM   2028 N N   . LYS C 1 36  ? 30.054  8.872  38.847 1.00 53.56  ? 30  LYS C N   1 
ATOM   2029 C CA  . LYS C 1 36  ? 30.484  10.153 39.383 1.00 52.59  ? 30  LYS C CA  1 
ATOM   2030 C C   . LYS C 1 36  ? 31.298  10.847 38.313 1.00 50.01  ? 30  LYS C C   1 
ATOM   2031 O O   . LYS C 1 36  ? 32.113  10.206 37.639 1.00 53.22  ? 30  LYS C O   1 
ATOM   2032 C CB  . LYS C 1 36  ? 31.374  9.958  40.612 1.00 55.06  ? 30  LYS C CB  1 
ATOM   2033 C CG  . LYS C 1 36  ? 30.674  9.740  41.942 1.00 51.22  ? 30  LYS C CG  1 
ATOM   2034 C CD  . LYS C 1 36  ? 31.746  9.432  42.954 1.00 60.99  ? 30  LYS C CD  1 
ATOM   2035 C CE  . LYS C 1 36  ? 31.262  9.395  44.386 1.00 65.30  ? 30  LYS C CE  1 
ATOM   2036 N NZ  . LYS C 1 36  ? 32.427  9.023  45.278 1.00 66.78  ? 30  LYS C NZ  1 
ATOM   2037 N N   . ASN C 1 37  ? 31.035  12.133 38.115 1.00 47.93  ? 31  ASN C N   1 
ATOM   2038 C CA  . ASN C 1 37  ? 31.791  12.937 37.152 1.00 47.92  ? 31  ASN C CA  1 
ATOM   2039 C C   . ASN C 1 37  ? 32.987  13.522 37.921 1.00 47.86  ? 31  ASN C C   1 
ATOM   2040 O O   . ASN C 1 37  ? 32.804  14.282 38.884 1.00 44.26  ? 31  ASN C O   1 
ATOM   2041 C CB  . ASN C 1 37  ? 30.940  14.081 36.607 1.00 47.40  ? 31  ASN C CB  1 
ATOM   2042 C CG  . ASN C 1 37  ? 29.880  13.613 35.642 1.00 50.29  ? 31  ASN C CG  1 
ATOM   2043 O OD1 . ASN C 1 37  ? 30.135  13.432 34.444 1.00 45.82  ? 31  ASN C OD1 1 
ATOM   2044 N ND2 . ASN C 1 37  ? 28.676  13.408 36.154 1.00 50.00  ? 31  ASN C ND2 1 
ATOM   2045 N N   . TYR C 1 38  ? 34.196  13.171 37.494 1.00 47.97  ? 32  TYR C N   1 
ATOM   2046 C CA  . TYR C 1 38  ? 35.440  13.625 38.137 1.00 49.60  ? 32  TYR C CA  1 
ATOM   2047 C C   . TYR C 1 38  ? 35.918  15.059 37.797 1.00 46.90  ? 32  TYR C C   1 
ATOM   2048 O O   . TYR C 1 38  ? 36.992  15.274 37.232 1.00 43.67  ? 32  TYR C O   1 
ATOM   2049 C CB  . TYR C 1 38  ? 36.535  12.568 37.907 1.00 47.61  ? 32  TYR C CB  1 
ATOM   2050 C CG  . TYR C 1 38  ? 36.381  11.388 38.833 1.00 48.04  ? 32  TYR C CG  1 
ATOM   2051 C CD1 . TYR C 1 38  ? 35.196  10.656 38.871 1.00 51.91  ? 32  TYR C CD1 1 
ATOM   2052 C CD2 . TYR C 1 38  ? 37.371  11.081 39.759 1.00 55.05  ? 32  TYR C CD2 1 
ATOM   2053 C CE1 . TYR C 1 38  ? 34.997  9.656  39.820 1.00 51.63  ? 32  TYR C CE1 1 
ATOM   2054 C CE2 . TYR C 1 38  ? 37.187  10.086 40.709 1.00 54.79  ? 32  TYR C CE2 1 
ATOM   2055 C CZ  . TYR C 1 38  ? 36.002  9.377  40.738 1.00 55.66  ? 32  TYR C CZ  1 
ATOM   2056 O OH  . TYR C 1 38  ? 35.852  8.377  41.683 1.00 62.25  ? 32  TYR C OH  1 
ATOM   2057 N N   . LEU C 1 39  ? 35.112  16.032 38.201 1.00 45.87  ? 33  LEU C N   1 
ATOM   2058 C CA  . LEU C 1 39  ? 35.376  17.435 37.959 1.00 46.50  ? 33  LEU C CA  1 
ATOM   2059 C C   . LEU C 1 39  ? 35.161  18.255 39.236 1.00 50.91  ? 33  LEU C C   1 
ATOM   2060 O O   . LEU C 1 39  ? 34.163  18.062 39.943 1.00 47.01  ? 33  LEU C O   1 
ATOM   2061 C CB  . LEU C 1 39  ? 34.440  17.967 36.881 1.00 37.21  ? 33  LEU C CB  1 
ATOM   2062 C CG  . LEU C 1 39  ? 34.603  19.474 36.731 1.00 38.89  ? 33  LEU C CG  1 
ATOM   2063 C CD1 . LEU C 1 39  ? 35.360  19.771 35.458 1.00 36.76  ? 33  LEU C CD1 1 
ATOM   2064 C CD2 . LEU C 1 39  ? 33.252  20.146 36.753 1.00 38.63  ? 33  LEU C CD2 1 
ATOM   2065 N N   . ALA C 1 40  ? 36.071  19.206 39.480 1.00 50.92  ? 34  ALA C N   1 
ATOM   2066 C CA  . ALA C 1 40  ? 36.031  20.080 40.652 1.00 43.81  ? 34  ALA C CA  1 
ATOM   2067 C C   . ALA C 1 40  ? 36.179  21.535 40.236 1.00 41.63  ? 34  ALA C C   1 
ATOM   2068 O O   . ALA C 1 40  ? 36.692  21.818 39.159 1.00 47.14  ? 34  ALA C O   1 
ATOM   2069 C CB  . ALA C 1 40  ? 37.156  19.709 41.607 1.00 38.93  ? 34  ALA C CB  1 
ATOM   2070 N N   . TRP C 1 41  ? 35.689  22.451 41.063 1.00 40.71  ? 35  TRP C N   1 
ATOM   2071 C CA  . TRP C 1 41  ? 35.820  23.877 40.798 1.00 42.13  ? 35  TRP C CA  1 
ATOM   2072 C C   . TRP C 1 41  ? 36.536  24.547 41.996 1.00 43.86  ? 35  TRP C C   1 
ATOM   2073 O O   . TRP C 1 41  ? 36.273  24.204 43.164 1.00 36.55  ? 35  TRP C O   1 
ATOM   2074 C CB  . TRP C 1 41  ? 34.462  24.543 40.577 1.00 39.46  ? 35  TRP C CB  1 
ATOM   2075 C CG  . TRP C 1 41  ? 33.733  24.147 39.351 1.00 40.31  ? 35  TRP C CG  1 
ATOM   2076 C CD1 . TRP C 1 41  ? 32.908  23.072 39.213 1.00 43.85  ? 35  TRP C CD1 1 
ATOM   2077 C CD2 . TRP C 1 41  ? 33.604  24.909 38.142 1.00 40.03  ? 35  TRP C CD2 1 
ATOM   2078 N NE1 . TRP C 1 41  ? 32.252  23.134 38.017 1.00 45.29  ? 35  TRP C NE1 1 
ATOM   2079 C CE2 . TRP C 1 41  ? 32.659  24.248 37.335 1.00 40.54  ? 35  TRP C CE2 1 
ATOM   2080 C CE3 . TRP C 1 41  ? 34.191  26.089 37.664 1.00 43.85  ? 35  TRP C CE3 1 
ATOM   2081 C CZ2 . TRP C 1 41  ? 32.279  24.726 36.082 1.00 41.87  ? 35  TRP C CZ2 1 
ATOM   2082 C CZ3 . TRP C 1 41  ? 33.817  26.565 36.417 1.00 36.37  ? 35  TRP C CZ3 1 
ATOM   2083 C CH2 . TRP C 1 41  ? 32.867  25.886 35.643 1.00 43.35  ? 35  TRP C CH2 1 
ATOM   2084 N N   . TYR C 1 42  ? 37.431  25.498 41.694 1.00 42.39  ? 36  TYR C N   1 
ATOM   2085 C CA  . TYR C 1 42  ? 38.217  26.217 42.706 1.00 37.61  ? 36  TYR C CA  1 
ATOM   2086 C C   . TYR C 1 42  ? 38.061  27.712 42.593 1.00 35.01  ? 36  TYR C C   1 
ATOM   2087 O O   . TYR C 1 42  ? 37.772  28.244 41.518 1.00 33.98  ? 36  TYR C O   1 
ATOM   2088 C CB  . TYR C 1 42  ? 39.704  25.859 42.597 1.00 29.63  ? 36  TYR C CB  1 
ATOM   2089 C CG  . TYR C 1 42  ? 39.941  24.367 42.632 1.00 30.43  ? 36  TYR C CG  1 
ATOM   2090 C CD1 . TYR C 1 42  ? 39.557  23.567 41.562 1.00 28.83  ? 36  TYR C CD1 1 
ATOM   2091 C CD2 . TYR C 1 42  ? 40.525  23.747 43.727 1.00 28.60  ? 36  TYR C CD2 1 
ATOM   2092 C CE1 . TYR C 1 42  ? 39.744  22.198 41.580 1.00 27.86  ? 36  TYR C CE1 1 
ATOM   2093 C CE2 . TYR C 1 42  ? 40.717  22.354 43.747 1.00 26.63  ? 36  TYR C CE2 1 
ATOM   2094 C CZ  . TYR C 1 42  ? 40.320  21.598 42.668 1.00 21.27  ? 36  TYR C CZ  1 
ATOM   2095 O OH  . TYR C 1 42  ? 40.473  20.236 42.645 1.00 30.57  ? 36  TYR C OH  1 
ATOM   2096 N N   . GLN C 1 43  ? 38.193  28.384 43.729 1.00 37.58  ? 37  GLN C N   1 
ATOM   2097 C CA  . GLN C 1 43  ? 38.107  29.836 43.776 1.00 42.63  ? 37  GLN C CA  1 
ATOM   2098 C C   . GLN C 1 43  ? 39.474  30.355 44.201 1.00 43.51  ? 37  GLN C C   1 
ATOM   2099 O O   . GLN C 1 43  ? 40.154  29.720 45.026 1.00 44.08  ? 37  GLN C O   1 
ATOM   2100 C CB  . GLN C 1 43  ? 37.075  30.282 44.807 1.00 40.75  ? 37  GLN C CB  1 
ATOM   2101 C CG  . GLN C 1 43  ? 36.735  31.758 44.736 1.00 40.47  ? 37  GLN C CG  1 
ATOM   2102 C CD  . GLN C 1 43  ? 35.929  32.208 45.928 1.00 43.23  ? 37  GLN C CD  1 
ATOM   2103 O OE1 . GLN C 1 43  ? 36.333  31.979 47.061 1.00 44.96  ? 37  GLN C OE1 1 
ATOM   2104 N NE2 . GLN C 1 43  ? 34.793  32.854 45.685 1.00 37.71  ? 37  GLN C NE2 1 
ATOM   2105 N N   . GLN C 1 44  ? 39.924  31.446 43.589 1.00 43.12  ? 38  GLN C N   1 
ATOM   2106 C CA  . GLN C 1 44  ? 41.202  32.025 43.978 1.00 42.95  ? 38  GLN C CA  1 
ATOM   2107 C C   . GLN C 1 44  ? 41.086  33.520 44.034 1.00 45.06  ? 38  GLN C C   1 
ATOM   2108 O O   . GLN C 1 44  ? 40.782  34.173 43.034 1.00 42.75  ? 38  GLN C O   1 
ATOM   2109 C CB  . GLN C 1 44  ? 42.350  31.619 43.051 1.00 44.75  ? 38  GLN C CB  1 
ATOM   2110 C CG  . GLN C 1 44  ? 43.709  32.206 43.461 1.00 38.93  ? 38  GLN C CG  1 
ATOM   2111 C CD  . GLN C 1 44  ? 44.891  31.624 42.679 1.00 40.58  ? 38  GLN C CD  1 
ATOM   2112 O OE1 . GLN C 1 44  ? 44.841  31.505 41.455 1.00 42.31  ? 38  GLN C OE1 1 
ATOM   2113 N NE2 . GLN C 1 44  ? 45.965  31.268 43.387 1.00 35.45  ? 38  GLN C NE2 1 
ATOM   2114 N N   . LYS C 1 45  ? 41.187  34.024 45.259 1.00 53.47  ? 39  LYS C N   1 
ATOM   2115 C CA  . LYS C 1 45  ? 41.148  35.452 45.543 1.00 57.05  ? 39  LYS C CA  1 
ATOM   2116 C C   . LYS C 1 45  ? 42.608  35.889 45.566 1.00 59.49  ? 39  LYS C C   1 
ATOM   2117 O O   . LYS C 1 45  ? 43.489  35.086 45.905 1.00 57.78  ? 39  LYS C O   1 
ATOM   2118 C CB  . LYS C 1 45  ? 40.508  35.719 46.902 1.00 57.61  ? 39  LYS C CB  1 
ATOM   2119 C CG  . LYS C 1 45  ? 39.000  35.678 46.894 1.00 60.28  ? 39  LYS C CG  1 
ATOM   2120 C CD  . LYS C 1 45  ? 38.443  36.114 48.238 1.00 62.05  ? 39  LYS C CD  1 
ATOM   2121 C CE  . LYS C 1 45  ? 36.937  36.067 48.223 1.00 60.40  ? 39  LYS C CE  1 
ATOM   2122 N NZ  . LYS C 1 45  ? 36.385  36.421 49.540 1.00 61.17  ? 39  LYS C NZ  1 
ATOM   2123 N N   . PRO C 1 46  ? 42.880  37.160 45.210 1.00 60.36  ? 40  PRO C N   1 
ATOM   2124 C CA  . PRO C 1 46  ? 44.212  37.789 45.149 1.00 56.83  ? 40  PRO C CA  1 
ATOM   2125 C C   . PRO C 1 46  ? 45.168  37.481 46.319 1.00 54.54  ? 40  PRO C C   1 
ATOM   2126 O O   . PRO C 1 46  ? 44.773  37.555 47.493 1.00 46.39  ? 40  PRO C O   1 
ATOM   2127 C CB  . PRO C 1 46  ? 43.870  39.271 45.072 1.00 58.05  ? 40  PRO C CB  1 
ATOM   2128 C CG  . PRO C 1 46  ? 42.604  39.265 44.258 1.00 65.11  ? 40  PRO C CG  1 
ATOM   2129 C CD  . PRO C 1 46  ? 41.822  38.143 44.901 1.00 61.39  ? 40  PRO C CD  1 
ATOM   2130 N N   . GLY C 1 47  ? 46.410  37.115 45.975 1.00 52.92  ? 41  GLY C N   1 
ATOM   2131 C CA  . GLY C 1 47  ? 47.436  36.782 46.960 1.00 55.96  ? 41  GLY C CA  1 
ATOM   2132 C C   . GLY C 1 47  ? 47.156  35.575 47.847 1.00 58.28  ? 41  GLY C C   1 
ATOM   2133 O O   . GLY C 1 47  ? 47.838  35.365 48.858 1.00 60.12  ? 41  GLY C O   1 
ATOM   2134 N N   . GLN C 1 48  ? 46.188  34.759 47.427 1.00 61.28  ? 42  GLN C N   1 
ATOM   2135 C CA  . GLN C 1 48  ? 45.734  33.565 48.139 1.00 52.13  ? 42  GLN C CA  1 
ATOM   2136 C C   . GLN C 1 48  ? 45.739  32.330 47.219 1.00 48.83  ? 42  GLN C C   1 
ATOM   2137 O O   . GLN C 1 48  ? 45.512  32.432 46.015 1.00 47.51  ? 42  GLN C O   1 
ATOM   2138 C CB  . GLN C 1 48  ? 44.313  33.851 48.637 1.00 53.20  ? 42  GLN C CB  1 
ATOM   2139 C CG  . GLN C 1 48  ? 43.879  33.056 49.844 1.00 65.23  ? 42  GLN C CG  1 
ATOM   2140 C CD  . GLN C 1 48  ? 42.928  33.837 50.754 1.00 70.45  ? 42  GLN C CD  1 
ATOM   2141 O OE1 . GLN C 1 48  ? 42.052  34.586 50.291 1.00 67.61  ? 42  GLN C OE1 1 
ATOM   2142 N NE2 . GLN C 1 48  ? 43.114  33.672 52.069 1.00 75.40  ? 42  GLN C NE2 1 
ATOM   2143 N N   . SER C 1 49  ? 46.005  31.154 47.772 1.00 46.15  ? 43  SER C N   1 
ATOM   2144 C CA  . SER C 1 49  ? 46.011  29.949 46.951 1.00 44.44  ? 43  SER C CA  1 
ATOM   2145 C C   . SER C 1 49  ? 44.585  29.586 46.580 1.00 42.37  ? 43  SER C C   1 
ATOM   2146 O O   . SER C 1 49  ? 43.641  30.237 47.013 1.00 39.76  ? 43  SER C O   1 
ATOM   2147 C CB  . SER C 1 49  ? 46.604  28.791 47.725 1.00 47.32  ? 43  SER C CB  1 
ATOM   2148 O OG  . SER C 1 49  ? 45.727  28.403 48.759 1.00 54.13  ? 43  SER C OG  1 
ATOM   2149 N N   . PRO C 1 50  ? 44.410  28.601 45.696 1.00 43.08  ? 44  PRO C N   1 
ATOM   2150 C CA  . PRO C 1 50  ? 43.026  28.271 45.374 1.00 40.95  ? 44  PRO C CA  1 
ATOM   2151 C C   . PRO C 1 50  ? 42.406  27.496 46.515 1.00 40.44  ? 44  PRO C C   1 
ATOM   2152 O O   . PRO C 1 50  ? 43.110  26.944 47.373 1.00 40.24  ? 44  PRO C O   1 
ATOM   2153 C CB  . PRO C 1 50  ? 43.171  27.387 44.141 1.00 37.25  ? 44  PRO C CB  1 
ATOM   2154 C CG  . PRO C 1 50  ? 44.338  27.937 43.477 1.00 38.50  ? 44  PRO C CG  1 
ATOM   2155 C CD  . PRO C 1 50  ? 45.301  28.087 44.646 1.00 46.20  ? 44  PRO C CD  1 
ATOM   2156 N N   . LYS C 1 51  ? 41.082  27.512 46.556 1.00 42.04  ? 45  LYS C N   1 
ATOM   2157 C CA  . LYS C 1 51  ? 40.345  26.769 47.566 1.00 44.12  ? 45  LYS C CA  1 
ATOM   2158 C C   . LYS C 1 51  ? 39.207  26.064 46.819 1.00 39.65  ? 45  LYS C C   1 
ATOM   2159 O O   . LYS C 1 51  ? 38.611  26.651 45.919 1.00 36.11  ? 45  LYS C O   1 
ATOM   2160 C CB  . LYS C 1 51  ? 39.867  27.682 48.723 1.00 52.03  ? 45  LYS C CB  1 
ATOM   2161 C CG  . LYS C 1 51  ? 38.882  28.816 48.391 1.00 60.68  ? 45  LYS C CG  1 
ATOM   2162 C CD  . LYS C 1 51  ? 38.103  29.287 49.647 1.00 65.44  ? 45  LYS C CD  1 
ATOM   2163 C CE  . LYS C 1 51  ? 36.772  30.004 49.274 1.00 71.72  ? 45  LYS C CE  1 
ATOM   2164 N NZ  . LYS C 1 51  ? 35.699  30.131 50.350 1.00 63.32  ? 45  LYS C NZ  1 
ATOM   2165 N N   . LEU C 1 52  ? 39.025  24.770 47.093 1.00 43.09  ? 46  LEU C N   1 
ATOM   2166 C CA  . LEU C 1 52  ? 38.001  23.915 46.465 1.00 39.85  ? 46  LEU C CA  1 
ATOM   2167 C C   . LEU C 1 52  ? 36.609  24.385 46.805 1.00 41.02  ? 46  LEU C C   1 
ATOM   2168 O O   . LEU C 1 52  ? 36.329  24.762 47.943 1.00 43.78  ? 46  LEU C O   1 
ATOM   2169 C CB  . LEU C 1 52  ? 38.151  22.455 46.911 1.00 30.42  ? 46  LEU C CB  1 
ATOM   2170 C CG  . LEU C 1 52  ? 37.037  21.449 46.581 1.00 37.00  ? 46  LEU C CG  1 
ATOM   2171 C CD1 . LEU C 1 52  ? 36.959  21.191 45.100 1.00 33.46  ? 46  LEU C CD1 1 
ATOM   2172 C CD2 . LEU C 1 52  ? 37.291  20.136 47.312 1.00 35.23  ? 46  LEU C CD2 1 
ATOM   2173 N N   . LEU C 1 53  ? 35.752  24.403 45.797 1.00 44.17  ? 47  LEU C N   1 
ATOM   2174 C CA  . LEU C 1 53  ? 34.372  24.807 45.973 1.00 46.91  ? 47  LEU C CA  1 
ATOM   2175 C C   . LEU C 1 53  ? 33.457  23.591 45.814 1.00 46.92  ? 47  LEU C C   1 
ATOM   2176 O O   . LEU C 1 53  ? 32.720  23.222 46.724 1.00 46.61  ? 47  LEU C O   1 
ATOM   2177 C CB  . LEU C 1 53  ? 33.975  25.870 44.941 1.00 45.70  ? 47  LEU C CB  1 
ATOM   2178 C CG  . LEU C 1 53  ? 34.440  27.314 45.120 1.00 51.78  ? 47  LEU C CG  1 
ATOM   2179 C CD1 . LEU C 1 53  ? 33.772  28.197 44.084 1.00 52.44  ? 47  LEU C CD1 1 
ATOM   2180 C CD2 . LEU C 1 53  ? 34.079  27.822 46.506 1.00 53.07  ? 47  LEU C CD2 1 
ATOM   2181 N N   . VAL C 1 54  ? 33.562  22.929 44.672 1.00 46.31  ? 48  VAL C N   1 
ATOM   2182 C CA  . VAL C 1 54  ? 32.707  21.800 44.377 1.00 43.47  ? 48  VAL C CA  1 
ATOM   2183 C C   . VAL C 1 54  ? 33.517  20.646 43.843 1.00 45.65  ? 48  VAL C C   1 
ATOM   2184 O O   . VAL C 1 54  ? 34.420  20.859 43.039 1.00 47.60  ? 48  VAL C O   1 
ATOM   2185 C CB  . VAL C 1 54  ? 31.688  22.197 43.301 1.00 40.78  ? 48  VAL C CB  1 
ATOM   2186 C CG1 . VAL C 1 54  ? 30.870  20.996 42.867 1.00 33.02  ? 48  VAL C CG1 1 
ATOM   2187 C CG2 . VAL C 1 54  ? 30.806  23.329 43.809 1.00 32.65  ? 48  VAL C CG2 1 
ATOM   2188 N N   . TYR C 1 55  ? 33.280  19.446 44.358 1.00 39.73  ? 49  TYR C N   1 
ATOM   2189 C CA  . TYR C 1 55  ? 33.977  18.294 43.835 1.00 40.28  ? 49  TYR C CA  1 
ATOM   2190 C C   . TYR C 1 55  ? 32.906  17.350 43.364 1.00 45.58  ? 49  TYR C C   1 
ATOM   2191 O O   . TYR C 1 55  ? 31.745  17.441 43.797 1.00 43.89  ? 49  TYR C O   1 
ATOM   2192 C CB  . TYR C 1 55  ? 34.921  17.643 44.837 1.00 40.44  ? 49  TYR C CB  1 
ATOM   2193 C CG  . TYR C 1 55  ? 34.309  17.288 46.154 1.00 40.04  ? 49  TYR C CG  1 
ATOM   2194 C CD1 . TYR C 1 55  ? 33.960  18.271 47.072 1.00 40.53  ? 49  TYR C CD1 1 
ATOM   2195 C CD2 . TYR C 1 55  ? 34.102  15.964 46.502 1.00 42.11  ? 49  TYR C CD2 1 
ATOM   2196 C CE1 . TYR C 1 55  ? 33.413  17.938 48.318 1.00 40.49  ? 49  TYR C CE1 1 
ATOM   2197 C CE2 . TYR C 1 55  ? 33.565  15.619 47.739 1.00 40.18  ? 49  TYR C CE2 1 
ATOM   2198 C CZ  . TYR C 1 55  ? 33.222  16.607 48.638 1.00 38.95  ? 49  TYR C CZ  1 
ATOM   2199 O OH  . TYR C 1 55  ? 32.669  16.250 49.840 1.00 39.11  ? 49  TYR C OH  1 
ATOM   2200 N N   . PHE C 1 56  ? 33.296  16.484 42.435 1.00 46.83  ? 50  PHE C N   1 
ATOM   2201 C CA  . PHE C 1 56  ? 32.393  15.531 41.809 1.00 47.04  ? 50  PHE C CA  1 
ATOM   2202 C C   . PHE C 1 56  ? 31.271  16.229 41.079 1.00 46.35  ? 50  PHE C C   1 
ATOM   2203 O O   . PHE C 1 56  ? 30.129  15.787 41.130 1.00 53.48  ? 50  PHE C O   1 
ATOM   2204 C CB  . PHE C 1 56  ? 31.847  14.527 42.805 1.00 44.30  ? 50  PHE C CB  1 
ATOM   2205 C CG  . PHE C 1 56  ? 32.876  13.574 43.289 1.00 44.83  ? 50  PHE C CG  1 
ATOM   2206 C CD1 . PHE C 1 56  ? 33.789  13.019 42.402 1.00 47.35  ? 50  PHE C CD1 1 
ATOM   2207 C CD2 . PHE C 1 56  ? 32.963  13.251 44.637 1.00 45.19  ? 50  PHE C CD2 1 
ATOM   2208 C CE1 . PHE C 1 56  ? 34.779  12.157 42.852 1.00 47.01  ? 50  PHE C CE1 1 
ATOM   2209 C CE2 . PHE C 1 56  ? 33.945  12.393 45.100 1.00 42.82  ? 50  PHE C CE2 1 
ATOM   2210 C CZ  . PHE C 1 56  ? 34.859  11.843 44.204 1.00 46.43  ? 50  PHE C CZ  1 
ATOM   2211 N N   . ALA C 1 57  ? 31.611  17.351 40.453 1.00 42.67  ? 51  ALA C N   1 
ATOM   2212 C CA  . ALA C 1 57  ? 30.687  18.160 39.669 1.00 40.12  ? 51  ALA C CA  1 
ATOM   2213 C C   . ALA C 1 57  ? 29.569  18.897 40.393 1.00 41.60  ? 51  ALA C C   1 
ATOM   2214 O O   . ALA C 1 57  ? 29.117  19.920 39.896 1.00 43.96  ? 51  ALA C O   1 
ATOM   2215 C CB  . ALA C 1 57  ? 30.119  17.340 38.531 1.00 34.66  ? 51  ALA C CB  1 
ATOM   2216 N N   . SER C 1 58  ? 29.144  18.424 41.568 1.00 44.30  ? 52  SER C N   1 
ATOM   2217 C CA  . SER C 1 58  ? 28.053  19.083 42.292 1.00 43.00  ? 52  SER C CA  1 
ATOM   2218 C C   . SER C 1 58  ? 28.161  19.100 43.818 1.00 44.39  ? 52  SER C C   1 
ATOM   2219 O O   . SER C 1 58  ? 27.400  19.807 44.503 1.00 43.74  ? 52  SER C O   1 
ATOM   2220 C CB  . SER C 1 58  ? 26.723  18.441 41.904 1.00 38.87  ? 52  SER C CB  1 
ATOM   2221 O OG  . SER C 1 58  ? 26.786  17.050 42.158 1.00 44.66  ? 52  SER C OG  1 
ATOM   2222 N N   . THR C 1 59  ? 29.091  18.330 44.362 1.00 42.71  ? 53  THR C N   1 
ATOM   2223 C CA  . THR C 1 59  ? 29.234  18.288 45.807 1.00 41.02  ? 53  THR C CA  1 
ATOM   2224 C C   . THR C 1 59  ? 29.979  19.484 46.382 1.00 42.98  ? 53  THR C C   1 
ATOM   2225 O O   . THR C 1 59  ? 31.170  19.676 46.119 1.00 44.42  ? 53  THR C O   1 
ATOM   2226 C CB  . THR C 1 59  ? 29.924  17.011 46.221 1.00 41.41  ? 53  THR C CB  1 
ATOM   2227 O OG1 . THR C 1 59  ? 29.228  15.906 45.621 1.00 42.71  ? 53  THR C OG1 1 
ATOM   2228 C CG2 . THR C 1 59  ? 29.919  16.884 47.723 1.00 32.77  ? 53  THR C CG2 1 
ATOM   2229 N N   . ARG C 1 60  ? 29.252  20.335 47.092 1.00 39.12  ? 54  ARG C N   1 
ATOM   2230 C CA  . ARG C 1 60  ? 29.855  21.485 47.725 1.00 38.74  ? 54  ARG C CA  1 
ATOM   2231 C C   . ARG C 1 60  ? 30.843  20.994 48.767 1.00 37.64  ? 54  ARG C C   1 
ATOM   2232 O O   . ARG C 1 60  ? 30.667  19.931 49.352 1.00 38.30  ? 54  ARG C O   1 
ATOM   2233 C CB  . ARG C 1 60  ? 28.816  22.340 48.443 1.00 41.47  ? 54  ARG C CB  1 
ATOM   2234 C CG  . ARG C 1 60  ? 27.882  23.116 47.561 1.00 52.48  ? 54  ARG C CG  1 
ATOM   2235 C CD  . ARG C 1 60  ? 27.145  24.202 48.371 1.00 57.22  ? 54  ARG C CD  1 
ATOM   2236 N NE  . ARG C 1 60  ? 25.973  24.716 47.660 1.00 62.16  ? 54  ARG C NE  1 
ATOM   2237 C CZ  . ARG C 1 60  ? 24.885  23.995 47.407 1.00 61.68  ? 54  ARG C CZ  1 
ATOM   2238 N NH1 . ARG C 1 60  ? 24.818  22.730 47.810 1.00 59.96  ? 54  ARG C NH1 1 
ATOM   2239 N NH2 . ARG C 1 60  ? 23.880  24.525 46.725 1.00 64.02  ? 54  ARG C NH2 1 
ATOM   2240 N N   . GLU C 1 61  ? 31.928  21.733 48.932 1.00 39.09  ? 55  GLU C N   1 
ATOM   2241 C CA  . GLU C 1 61  ? 32.928  21.405 49.921 1.00 36.19  ? 55  GLU C CA  1 
ATOM   2242 C C   . GLU C 1 61  ? 32.427  21.982 51.229 1.00 39.08  ? 55  GLU C C   1 
ATOM   2243 O O   . GLU C 1 61  ? 31.618  22.930 51.250 1.00 40.39  ? 55  GLU C O   1 
ATOM   2244 C CB  . GLU C 1 61  ? 34.253  22.069 49.558 1.00 40.15  ? 55  GLU C CB  1 
ATOM   2245 C CG  . GLU C 1 61  ? 35.316  22.067 50.672 1.00 41.48  ? 55  GLU C CG  1 
ATOM   2246 C CD  . GLU C 1 61  ? 35.909  20.696 50.970 1.00 45.99  ? 55  GLU C CD  1 
ATOM   2247 O OE1 . GLU C 1 61  ? 35.167  19.806 51.438 1.00 54.07  ? 55  GLU C OE1 1 
ATOM   2248 O OE2 . GLU C 1 61  ? 37.127  20.511 50.754 1.00 48.66  ? 55  GLU C OE2 1 
ATOM   2249 N N   . SER C 1 62  ? 32.932  21.434 52.322 1.00 39.72  ? 56  SER C N   1 
ATOM   2250 C CA  . SER C 1 62  ? 32.565  21.890 53.648 1.00 45.21  ? 56  SER C CA  1 
ATOM   2251 C C   . SER C 1 62  ? 32.874  23.381 53.805 1.00 48.32  ? 56  SER C C   1 
ATOM   2252 O O   . SER C 1 62  ? 34.019  23.828 53.613 1.00 47.08  ? 56  SER C O   1 
ATOM   2253 C CB  . SER C 1 62  ? 33.325  21.086 54.697 1.00 46.47  ? 56  SER C CB  1 
ATOM   2254 O OG  . SER C 1 62  ? 33.355  19.702 54.355 1.00 57.18  ? 56  SER C OG  1 
ATOM   2255 N N   . GLY C 1 63  ? 31.820  24.157 54.039 1.00 46.10  ? 57  GLY C N   1 
ATOM   2256 C CA  . GLY C 1 63  ? 31.993  25.573 54.246 1.00 39.02  ? 57  GLY C CA  1 
ATOM   2257 C C   . GLY C 1 63  ? 31.669  26.457 53.084 1.00 41.24  ? 57  GLY C C   1 
ATOM   2258 O O   . GLY C 1 63  ? 31.845  27.668 53.193 1.00 45.65  ? 57  GLY C O   1 
ATOM   2259 N N   . VAL C 1 64  ? 31.221  25.893 51.969 1.00 40.57  ? 58  VAL C N   1 
ATOM   2260 C CA  . VAL C 1 64  ? 30.881  26.725 50.817 1.00 40.26  ? 58  VAL C CA  1 
ATOM   2261 C C   . VAL C 1 64  ? 29.424  27.206 50.873 1.00 44.94  ? 58  VAL C C   1 
ATOM   2262 O O   . VAL C 1 64  ? 28.518  26.400 51.063 1.00 49.91  ? 58  VAL C O   1 
ATOM   2263 C CB  . VAL C 1 64  ? 31.134  25.963 49.507 1.00 32.36  ? 58  VAL C CB  1 
ATOM   2264 C CG1 . VAL C 1 64  ? 30.844  26.857 48.328 1.00 27.10  ? 58  VAL C CG1 1 
ATOM   2265 C CG2 . VAL C 1 64  ? 32.562  25.477 49.464 1.00 24.92  ? 58  VAL C CG2 1 
ATOM   2266 N N   . PRO C 1 65  ? 29.181  28.521 50.754 1.00 47.39  ? 59  PRO C N   1 
ATOM   2267 C CA  . PRO C 1 65  ? 27.781  28.980 50.805 1.00 50.14  ? 59  PRO C CA  1 
ATOM   2268 C C   . PRO C 1 65  ? 26.901  28.248 49.784 1.00 56.61  ? 59  PRO C C   1 
ATOM   2269 O O   . PRO C 1 65  ? 27.414  27.664 48.825 1.00 53.69  ? 59  PRO C O   1 
ATOM   2270 C CB  . PRO C 1 65  ? 27.903  30.467 50.489 1.00 45.93  ? 59  PRO C CB  1 
ATOM   2271 C CG  . PRO C 1 65  ? 29.205  30.835 51.121 1.00 49.21  ? 59  PRO C CG  1 
ATOM   2272 C CD  . PRO C 1 65  ? 30.103  29.673 50.711 1.00 48.30  ? 59  PRO C CD  1 
ATOM   2273 N N   . ASP C 1 66  ? 25.578  28.270 50.018 1.00 60.66  ? 60  ASP C N   1 
ATOM   2274 C CA  . ASP C 1 66  ? 24.569  27.623 49.159 1.00 56.89  ? 60  ASP C CA  1 
ATOM   2275 C C   . ASP C 1 66  ? 24.493  28.206 47.762 1.00 53.79  ? 60  ASP C C   1 
ATOM   2276 O O   . ASP C 1 66  ? 24.112  27.521 46.815 1.00 53.39  ? 60  ASP C O   1 
ATOM   2277 C CB  . ASP C 1 66  ? 23.168  27.794 49.746 1.00 63.60  ? 60  ASP C CB  1 
ATOM   2278 C CG  . ASP C 1 66  ? 22.875  26.838 50.867 1.00 70.89  ? 60  ASP C CG  1 
ATOM   2279 O OD1 . ASP C 1 66  ? 22.559  25.662 50.577 1.00 69.35  ? 60  ASP C OD1 1 
ATOM   2280 O OD2 . ASP C 1 66  ? 22.918  27.282 52.039 1.00 80.86  ? 60  ASP C OD2 1 
ATOM   2281 N N   . ARG C 1 67  ? 24.752  29.503 47.655 1.00 47.67  ? 61  ARG C N   1 
ATOM   2282 C CA  . ARG C 1 67  ? 24.677  30.179 46.381 1.00 45.19  ? 61  ARG C CA  1 
ATOM   2283 C C   . ARG C 1 67  ? 25.501  29.565 45.248 1.00 48.36  ? 61  ARG C C   1 
ATOM   2284 O O   . ARG C 1 67  ? 25.181  29.781 44.077 1.00 53.18  ? 61  ARG C O   1 
ATOM   2285 C CB  . ARG C 1 67  ? 24.971  31.671 46.538 1.00 43.60  ? 61  ARG C CB  1 
ATOM   2286 C CG  . ARG C 1 67  ? 26.328  32.028 47.111 1.00 44.19  ? 61  ARG C CG  1 
ATOM   2287 C CD  . ARG C 1 67  ? 26.539  33.543 47.089 1.00 43.13  ? 61  ARG C CD  1 
ATOM   2288 N NE  . ARG C 1 67  ? 27.844  33.911 47.627 1.00 51.33  ? 61  ARG C NE  1 
ATOM   2289 C CZ  . ARG C 1 67  ? 28.172  33.847 48.915 1.00 59.43  ? 61  ARG C CZ  1 
ATOM   2290 N NH1 . ARG C 1 67  ? 27.292  33.429 49.813 1.00 65.42  ? 61  ARG C NH1 1 
ATOM   2291 N NH2 . ARG C 1 67  ? 29.388  34.191 49.307 1.00 65.18  ? 61  ARG C NH2 1 
ATOM   2292 N N   . PHE C 1 68  ? 26.559  28.830 45.583 1.00 47.58  ? 62  PHE C N   1 
ATOM   2293 C CA  . PHE C 1 68  ? 27.413  28.178 44.589 1.00 47.56  ? 62  PHE C CA  1 
ATOM   2294 C C   . PHE C 1 68  ? 26.827  26.799 44.247 1.00 51.42  ? 62  PHE C C   1 
ATOM   2295 O O   . PHE C 1 68  ? 26.655  25.955 45.131 1.00 52.39  ? 62  PHE C O   1 
ATOM   2296 C CB  . PHE C 1 68  ? 28.831  27.994 45.134 1.00 48.96  ? 62  PHE C CB  1 
ATOM   2297 C CG  . PHE C 1 68  ? 29.518  29.281 45.528 1.00 59.71  ? 62  PHE C CG  1 
ATOM   2298 C CD1 . PHE C 1 68  ? 29.244  29.903 46.753 1.00 55.88  ? 62  PHE C CD1 1 
ATOM   2299 C CD2 . PHE C 1 68  ? 30.483  29.851 44.687 1.00 61.79  ? 62  PHE C CD2 1 
ATOM   2300 C CE1 . PHE C 1 68  ? 29.924  31.066 47.130 1.00 54.31  ? 62  PHE C CE1 1 
ATOM   2301 C CE2 . PHE C 1 68  ? 31.167  31.008 45.054 1.00 55.37  ? 62  PHE C CE2 1 
ATOM   2302 C CZ  . PHE C 1 68  ? 30.887  31.616 46.278 1.00 54.97  ? 62  PHE C CZ  1 
ATOM   2303 N N   . ILE C 1 69  ? 26.520  26.561 42.973 1.00 50.69  ? 63  ILE C N   1 
ATOM   2304 C CA  . ILE C 1 69  ? 25.957  25.277 42.570 1.00 45.06  ? 63  ILE C CA  1 
ATOM   2305 C C   . ILE C 1 69  ? 26.674  24.726 41.339 1.00 44.73  ? 63  ILE C C   1 
ATOM   2306 O O   . ILE C 1 69  ? 26.642  25.345 40.263 1.00 41.18  ? 63  ILE C O   1 
ATOM   2307 C CB  . ILE C 1 69  ? 24.461  25.384 42.222 1.00 45.04  ? 63  ILE C CB  1 
ATOM   2308 C CG1 . ILE C 1 69  ? 23.704  26.169 43.296 1.00 44.24  ? 63  ILE C CG1 1 
ATOM   2309 C CG2 . ILE C 1 69  ? 23.863  23.990 42.051 1.00 41.26  ? 63  ILE C CG2 1 
ATOM   2310 C CD1 . ILE C 1 69  ? 22.891  27.319 42.714 1.00 38.25  ? 63  ILE C CD1 1 
ATOM   2311 N N   . GLY C 1 70  ? 27.334  23.581 41.519 1.00 41.77  ? 64  GLY C N   1 
ATOM   2312 C CA  . GLY C 1 70  ? 28.036  22.920 40.436 1.00 38.76  ? 64  GLY C CA  1 
ATOM   2313 C C   . GLY C 1 70  ? 27.088  21.964 39.737 1.00 42.72  ? 64  GLY C C   1 
ATOM   2314 O O   . GLY C 1 70  ? 26.328  21.243 40.393 1.00 47.99  ? 64  GLY C O   1 
ATOM   2315 N N   . SER C 1 71  ? 27.134  21.935 38.413 1.00 43.33  ? 65  SER C N   1 
ATOM   2316 C CA  . SER C 1 71  ? 26.247  21.075 37.654 1.00 41.74  ? 65  SER C CA  1 
ATOM   2317 C C   . SER C 1 71  ? 26.866  20.627 36.344 1.00 41.87  ? 65  SER C C   1 
ATOM   2318 O O   . SER C 1 71  ? 27.939  21.085 35.957 1.00 44.35  ? 65  SER C O   1 
ATOM   2319 C CB  . SER C 1 71  ? 24.974  21.840 37.334 1.00 39.88  ? 65  SER C CB  1 
ATOM   2320 O OG  . SER C 1 71  ? 25.224  22.813 36.331 1.00 45.79  ? 65  SER C OG  1 
ATOM   2321 N N   . GLY C 1 72  ? 26.123  19.806 35.614 1.00 42.48  ? 66  GLY C N   1 
ATOM   2322 C CA  . GLY C 1 72  ? 26.593  19.312 34.334 1.00 43.47  ? 66  GLY C CA  1 
ATOM   2323 C C   . GLY C 1 72  ? 27.096  17.894 34.468 1.00 44.48  ? 66  GLY C C   1 
ATOM   2324 O O   . GLY C 1 72  ? 27.177  17.376 35.589 1.00 40.21  ? 66  GLY C O   1 
ATOM   2325 N N   . SER C 1 73  ? 27.420  17.268 33.334 1.00 46.76  ? 67  SER C N   1 
ATOM   2326 C CA  . SER C 1 73  ? 27.920  15.891 33.312 1.00 50.49  ? 67  SER C CA  1 
ATOM   2327 C C   . SER C 1 73  ? 28.630  15.565 32.004 1.00 50.00  ? 67  SER C C   1 
ATOM   2328 O O   . SER C 1 73  ? 28.368  16.183 30.969 1.00 47.40  ? 67  SER C O   1 
ATOM   2329 C CB  . SER C 1 73  ? 26.771  14.890 33.525 1.00 54.80  ? 67  SER C CB  1 
ATOM   2330 O OG  . SER C 1 73  ? 25.771  14.999 32.519 1.00 60.07  ? 67  SER C OG  1 
ATOM   2331 N N   . GLY C 1 74  ? 29.515  14.576 32.052 1.00 48.92  ? 68  GLY C N   1 
ATOM   2332 C CA  . GLY C 1 74  ? 30.259  14.168 30.877 1.00 50.65  ? 68  GLY C CA  1 
ATOM   2333 C C   . GLY C 1 74  ? 31.375  15.107 30.446 1.00 53.24  ? 68  GLY C C   1 
ATOM   2334 O O   . GLY C 1 74  ? 32.513  14.966 30.900 1.00 50.38  ? 68  GLY C O   1 
ATOM   2335 N N   . THR C 1 75  ? 31.066  16.022 29.525 1.00 52.61  ? 69  THR C N   1 
ATOM   2336 C CA  . THR C 1 75  ? 32.050  16.968 29.021 1.00 51.70  ? 69  THR C CA  1 
ATOM   2337 C C   . THR C 1 75  ? 31.700  18.426 29.321 1.00 56.99  ? 69  THR C C   1 
ATOM   2338 O O   . THR C 1 75  ? 32.581  19.287 29.259 1.00 60.10  ? 69  THR C O   1 
ATOM   2339 C CB  . THR C 1 75  ? 32.227  16.839 27.503 1.00 49.39  ? 69  THR C CB  1 
ATOM   2340 O OG1 . THR C 1 75  ? 30.971  17.107 26.860 1.00 45.59  ? 69  THR C OG1 1 
ATOM   2341 C CG2 . THR C 1 75  ? 32.704  15.446 27.137 1.00 37.59  ? 69  THR C CG2 1 
ATOM   2342 N N   . ASP C 1 76  ? 30.424  18.703 29.610 1.00 55.83  ? 70  ASP C N   1 
ATOM   2343 C CA  . ASP C 1 76  ? 29.961  20.066 29.904 1.00 59.82  ? 70  ASP C CA  1 
ATOM   2344 C C   . ASP C 1 76  ? 29.503  20.304 31.342 1.00 59.81  ? 70  ASP C C   1 
ATOM   2345 O O   . ASP C 1 76  ? 28.525  19.704 31.818 1.00 60.66  ? 70  ASP C O   1 
ATOM   2346 C CB  . ASP C 1 76  ? 28.819  20.481 28.968 1.00 64.25  ? 70  ASP C CB  1 
ATOM   2347 C CG  . ASP C 1 76  ? 29.235  20.541 27.510 1.00 72.06  ? 70  ASP C CG  1 
ATOM   2348 O OD1 . ASP C 1 76  ? 30.394  20.204 27.175 1.00 73.33  ? 70  ASP C OD1 1 
ATOM   2349 O OD2 . ASP C 1 76  ? 28.378  20.920 26.686 1.00 79.83  ? 70  ASP C OD2 1 
ATOM   2350 N N   . PHE C 1 77  ? 30.165  21.233 32.017 1.00 53.34  ? 71  PHE C N   1 
ATOM   2351 C CA  . PHE C 1 77  ? 29.811  21.536 33.384 1.00 43.63  ? 71  PHE C CA  1 
ATOM   2352 C C   . PHE C 1 77  ? 29.630  23.009 33.527 1.00 39.89  ? 71  PHE C C   1 
ATOM   2353 O O   . PHE C 1 77  ? 30.041  23.787 32.657 1.00 37.97  ? 71  PHE C O   1 
ATOM   2354 C CB  . PHE C 1 77  ? 30.886  21.034 34.322 1.00 43.13  ? 71  PHE C CB  1 
ATOM   2355 C CG  . PHE C 1 77  ? 31.250  19.590 34.090 1.00 42.77  ? 71  PHE C CG  1 
ATOM   2356 C CD1 . PHE C 1 77  ? 32.257  19.249 33.188 1.00 40.48  ? 71  PHE C CD1 1 
ATOM   2357 C CD2 . PHE C 1 77  ? 30.606  18.572 34.784 1.00 37.47  ? 71  PHE C CD2 1 
ATOM   2358 C CE1 . PHE C 1 77  ? 32.618  17.928 32.986 1.00 32.71  ? 71  PHE C CE1 1 
ATOM   2359 C CE2 . PHE C 1 77  ? 30.967  17.251 34.581 1.00 36.09  ? 71  PHE C CE2 1 
ATOM   2360 C CZ  . PHE C 1 77  ? 31.978  16.932 33.680 1.00 37.77  ? 71  PHE C CZ  1 
ATOM   2361 N N   . THR C 1 78  ? 29.003  23.381 34.630 1.00 39.65  ? 72  THR C N   1 
ATOM   2362 C CA  . THR C 1 78  ? 28.699  24.771 34.922 1.00 42.61  ? 72  THR C CA  1 
ATOM   2363 C C   . THR C 1 78  ? 28.791  25.101 36.415 1.00 41.91  ? 72  THR C C   1 
ATOM   2364 O O   . THR C 1 78  ? 28.488  24.266 37.268 1.00 36.24  ? 72  THR C O   1 
ATOM   2365 C CB  . THR C 1 78  ? 27.246  25.114 34.467 1.00 38.17  ? 72  THR C CB  1 
ATOM   2366 O OG1 . THR C 1 78  ? 27.108  24.899 33.061 1.00 37.58  ? 72  THR C OG1 1 
ATOM   2367 C CG2 . THR C 1 78  ? 26.898  26.561 34.785 1.00 40.12  ? 72  THR C CG2 1 
ATOM   2368 N N   . LEU C 1 79  ? 29.316  26.285 36.715 1.00 46.80  ? 73  LEU C N   1 
ATOM   2369 C CA  . LEU C 1 79  ? 29.373  26.786 38.080 1.00 41.97  ? 73  LEU C CA  1 
ATOM   2370 C C   . LEU C 1 79  ? 28.396  27.972 38.079 1.00 42.92  ? 73  LEU C C   1 
ATOM   2371 O O   . LEU C 1 79  ? 28.475  28.881 37.243 1.00 38.49  ? 73  LEU C O   1 
ATOM   2372 C CB  . LEU C 1 79  ? 30.767  27.263 38.471 1.00 42.46  ? 73  LEU C CB  1 
ATOM   2373 C CG  . LEU C 1 79  ? 30.837  27.701 39.944 1.00 42.83  ? 73  LEU C CG  1 
ATOM   2374 C CD1 . LEU C 1 79  ? 30.769  26.472 40.825 1.00 46.24  ? 73  LEU C CD1 1 
ATOM   2375 C CD2 . LEU C 1 79  ? 32.099  28.482 40.248 1.00 35.30  ? 73  LEU C CD2 1 
ATOM   2376 N N   . THR C 1 80  ? 27.452  27.944 38.998 1.00 43.46  ? 74  THR C N   1 
ATOM   2377 C CA  . THR C 1 80  ? 26.475  28.998 39.065 1.00 46.81  ? 74  THR C CA  1 
ATOM   2378 C C   . THR C 1 80  ? 26.560  29.636 40.449 1.00 47.97  ? 74  THR C C   1 
ATOM   2379 O O   . THR C 1 80  ? 26.893  28.954 41.415 1.00 49.17  ? 74  THR C O   1 
ATOM   2380 C CB  . THR C 1 80  ? 25.046  28.407 38.823 1.00 52.38  ? 74  THR C CB  1 
ATOM   2381 O OG1 . THR C 1 80  ? 25.083  27.473 37.722 1.00 47.04  ? 74  THR C OG1 1 
ATOM   2382 C CG2 . THR C 1 80  ? 24.049  29.529 38.502 1.00 48.00  ? 74  THR C CG2 1 
ATOM   2383 N N   . ILE C 1 81  ? 26.388  30.951 40.525 1.00 44.75  ? 75  ILE C N   1 
ATOM   2384 C CA  . ILE C 1 81  ? 26.386  31.635 41.807 1.00 44.94  ? 75  ILE C CA  1 
ATOM   2385 C C   . ILE C 1 81  ? 25.039  32.310 41.715 1.00 44.64  ? 75  ILE C C   1 
ATOM   2386 O O   . ILE C 1 81  ? 24.847  33.223 40.923 1.00 41.39  ? 75  ILE C O   1 
ATOM   2387 C CB  . ILE C 1 81  ? 27.527  32.670 41.955 1.00 51.42  ? 75  ILE C CB  1 
ATOM   2388 C CG1 . ILE C 1 81  ? 28.897  32.013 41.698 1.00 56.91  ? 75  ILE C CG1 1 
ATOM   2389 C CG2 . ILE C 1 81  ? 27.528  33.234 43.382 1.00 53.71  ? 75  ILE C CG2 1 
ATOM   2390 C CD1 . ILE C 1 81  ? 30.122  32.936 41.945 1.00 48.37  ? 75  ILE C CD1 1 
ATOM   2391 N N   . SER C 1 82  ? 24.073  31.779 42.450 1.00 47.70  ? 76  SER C N   1 
ATOM   2392 C CA  . SER C 1 82  ? 22.701  32.280 42.394 1.00 55.33  ? 76  SER C CA  1 
ATOM   2393 C C   . SER C 1 82  ? 22.468  33.772 42.636 1.00 55.93  ? 76  SER C C   1 
ATOM   2394 O O   . SER C 1 82  ? 21.742  34.414 41.881 1.00 58.04  ? 76  SER C O   1 
ATOM   2395 C CB  . SER C 1 82  ? 21.759  31.409 43.238 1.00 51.48  ? 76  SER C CB  1 
ATOM   2396 O OG  . SER C 1 82  ? 22.265  31.221 44.545 1.00 62.08  ? 76  SER C OG  1 
ATOM   2397 N N   . SER C 1 83  ? 23.021  34.314 43.708 1.00 55.45  ? 77  SER C N   1 
ATOM   2398 C CA  . SER C 1 83  ? 22.879  35.736 43.977 1.00 54.17  ? 77  SER C CA  1 
ATOM   2399 C C   . SER C 1 83  ? 24.288  36.098 44.392 1.00 54.46  ? 77  SER C C   1 
ATOM   2400 O O   . SER C 1 83  ? 24.688  35.884 45.540 1.00 55.51  ? 77  SER C O   1 
ATOM   2401 C CB  . SER C 1 83  ? 21.862  35.991 45.097 1.00 59.29  ? 77  SER C CB  1 
ATOM   2402 O OG  . SER C 1 83  ? 21.415  37.345 45.135 1.00 60.30  ? 77  SER C OG  1 
ATOM   2403 N N   . VAL C 1 84  ? 25.071  36.540 43.414 1.00 54.08  ? 78  VAL C N   1 
ATOM   2404 C CA  . VAL C 1 84  ? 26.465  36.894 43.640 1.00 52.23  ? 78  VAL C CA  1 
ATOM   2405 C C   . VAL C 1 84  ? 26.699  38.012 44.650 1.00 54.62  ? 78  VAL C C   1 
ATOM   2406 O O   . VAL C 1 84  ? 25.944  38.996 44.707 1.00 53.44  ? 78  VAL C O   1 
ATOM   2407 C CB  . VAL C 1 84  ? 27.181  37.251 42.319 1.00 48.99  ? 78  VAL C CB  1 
ATOM   2408 C CG1 . VAL C 1 84  ? 26.584  38.525 41.701 1.00 37.24  ? 78  VAL C CG1 1 
ATOM   2409 C CG2 . VAL C 1 84  ? 28.699  37.356 42.555 1.00 41.63  ? 78  VAL C CG2 1 
ATOM   2410 N N   . GLN C 1 85  ? 27.742  37.830 45.462 1.00 53.24  ? 79  GLN C N   1 
ATOM   2411 C CA  . GLN C 1 85  ? 28.136  38.803 46.465 1.00 48.44  ? 79  GLN C CA  1 
ATOM   2412 C C   . GLN C 1 85  ? 29.444  39.449 46.100 1.00 48.57  ? 79  GLN C C   1 
ATOM   2413 O O   . GLN C 1 85  ? 30.256  38.874 45.376 1.00 50.01  ? 79  GLN C O   1 
ATOM   2414 C CB  . GLN C 1 85  ? 28.159  38.191 47.846 1.00 43.02  ? 79  GLN C CB  1 
ATOM   2415 C CG  . GLN C 1 85  ? 26.773  38.271 48.419 1.00 47.00  ? 79  GLN C CG  1 
ATOM   2416 C CD  . GLN C 1 85  ? 26.591  37.419 49.616 1.00 49.14  ? 79  GLN C CD  1 
ATOM   2417 O OE1 . GLN C 1 85  ? 27.204  37.657 50.661 1.00 51.44  ? 79  GLN C OE1 1 
ATOM   2418 N NE2 . GLN C 1 85  ? 25.736  36.414 49.490 1.00 43.44  ? 79  GLN C NE2 1 
ATOM   2419 N N   . ALA C 1 86  ? 29.612  40.681 46.557 1.00 47.99  ? 80  ALA C N   1 
ATOM   2420 C CA  . ALA C 1 86  ? 30.790  41.464 46.245 1.00 45.52  ? 80  ALA C CA  1 
ATOM   2421 C C   . ALA C 1 86  ? 32.067  40.730 46.534 1.00 42.25  ? 80  ALA C C   1 
ATOM   2422 O O   . ALA C 1 86  ? 33.028  40.851 45.799 1.00 40.35  ? 80  ALA C O   1 
ATOM   2423 C CB  . ALA C 1 86  ? 30.758  42.758 47.006 1.00 53.72  ? 80  ALA C CB  1 
ATOM   2424 N N   . GLU C 1 87  ? 32.068  39.980 47.624 1.00 42.57  ? 81  GLU C N   1 
ATOM   2425 C CA  . GLU C 1 87  ? 33.224  39.201 48.054 1.00 44.91  ? 81  GLU C CA  1 
ATOM   2426 C C   . GLU C 1 87  ? 33.499  37.981 47.156 1.00 46.09  ? 81  GLU C C   1 
ATOM   2427 O O   . GLU C 1 87  ? 34.348  37.148 47.488 1.00 44.14  ? 81  GLU C O   1 
ATOM   2428 C CB  . GLU C 1 87  ? 32.957  38.712 49.475 1.00 45.70  ? 81  GLU C CB  1 
ATOM   2429 C CG  . GLU C 1 87  ? 31.674  37.908 49.568 1.00 56.01  ? 81  GLU C CG  1 
ATOM   2430 C CD  . GLU C 1 87  ? 31.304  37.577 50.974 1.00 59.97  ? 81  GLU C CD  1 
ATOM   2431 O OE1 . GLU C 1 87  ? 31.408  38.481 51.823 1.00 74.81  ? 81  GLU C OE1 1 
ATOM   2432 O OE2 . GLU C 1 87  ? 30.908  36.424 51.236 1.00 55.85  ? 81  GLU C OE2 1 
ATOM   2433 N N   . ASP C 1 88  ? 32.710  37.827 46.087 1.00 47.65  ? 82  ASP C N   1 
ATOM   2434 C CA  . ASP C 1 88  ? 32.840  36.705 45.151 1.00 47.52  ? 82  ASP C CA  1 
ATOM   2435 C C   . ASP C 1 88  ? 33.658  37.056 43.901 1.00 48.02  ? 82  ASP C C   1 
ATOM   2436 O O   . ASP C 1 88  ? 33.865  36.205 43.026 1.00 47.38  ? 82  ASP C O   1 
ATOM   2437 C CB  . ASP C 1 88  ? 31.464  36.147 44.753 1.00 52.74  ? 82  ASP C CB  1 
ATOM   2438 C CG  . ASP C 1 88  ? 30.720  35.510 45.923 1.00 55.28  ? 82  ASP C CG  1 
ATOM   2439 O OD1 . ASP C 1 88  ? 31.363  34.840 46.766 1.00 53.51  ? 82  ASP C OD1 1 
ATOM   2440 O OD2 . ASP C 1 88  ? 29.486  35.686 45.991 1.00 57.77  ? 82  ASP C OD2 1 
ATOM   2441 N N   . GLN C 1 89  ? 34.069  38.319 43.795 1.00 46.01  ? 83  GLN C N   1 
ATOM   2442 C CA  . GLN C 1 89  ? 34.905  38.771 42.697 1.00 41.29  ? 83  GLN C CA  1 
ATOM   2443 C C   . GLN C 1 89  ? 36.181  37.959 42.880 1.00 40.79  ? 83  GLN C C   1 
ATOM   2444 O O   . GLN C 1 89  ? 36.830  38.045 43.920 1.00 50.49  ? 83  GLN C O   1 
ATOM   2445 C CB  . GLN C 1 89  ? 35.177  40.278 42.835 1.00 45.40  ? 83  GLN C CB  1 
ATOM   2446 C CG  . GLN C 1 89  ? 36.357  40.835 42.011 1.00 53.83  ? 83  GLN C CG  1 
ATOM   2447 C CD  . GLN C 1 89  ? 36.242  42.333 41.697 1.00 57.10  ? 83  GLN C CD  1 
ATOM   2448 O OE1 . GLN C 1 89  ? 35.556  43.090 42.380 1.00 66.44  ? 83  GLN C OE1 1 
ATOM   2449 N NE2 . GLN C 1 89  ? 36.899  42.751 40.635 1.00 65.04  ? 83  GLN C NE2 1 
ATOM   2450 N N   . ALA C 1 90  ? 36.487  37.088 41.933 1.00 35.60  ? 84  ALA C N   1 
ATOM   2451 C CA  . ALA C 1 90  ? 37.678  36.271 42.045 1.00 34.25  ? 84  ALA C CA  1 
ATOM   2452 C C   . ALA C 1 90  ? 37.897  35.463 40.776 1.00 33.17  ? 84  ALA C C   1 
ATOM   2453 O O   . ALA C 1 90  ? 37.244  35.712 39.761 1.00 36.29  ? 84  ALA C O   1 
ATOM   2454 C CB  . ALA C 1 90  ? 37.567  35.360 43.255 1.00 30.88  ? 84  ALA C CB  1 
ATOM   2455 N N   . ASP C 1 91  ? 38.896  34.587 40.801 1.00 41.80  ? 85  ASP C N   1 
ATOM   2456 C CA  . ASP C 1 91  ? 39.209  33.715 39.674 1.00 42.27  ? 85  ASP C CA  1 
ATOM   2457 C C   . ASP C 1 91  ? 38.673  32.341 39.970 1.00 40.57  ? 85  ASP C C   1 
ATOM   2458 O O   . ASP C 1 91  ? 38.889  31.786 41.050 1.00 36.55  ? 85  ASP C O   1 
ATOM   2459 C CB  . ASP C 1 91  ? 40.714  33.623 39.448 1.00 51.95  ? 85  ASP C CB  1 
ATOM   2460 C CG  . ASP C 1 91  ? 41.251  34.805 38.678 1.00 62.68  ? 85  ASP C CG  1 
ATOM   2461 O OD1 . ASP C 1 91  ? 41.567  35.831 39.324 1.00 64.14  ? 85  ASP C OD1 1 
ATOM   2462 O OD2 . ASP C 1 91  ? 41.331  34.709 37.426 1.00 69.75  ? 85  ASP C OD2 1 
ATOM   2463 N N   . TYR C 1 92  ? 37.980  31.789 38.996 1.00 41.23  ? 86  TYR C N   1 
ATOM   2464 C CA  . TYR C 1 92  ? 37.396  30.480 39.154 1.00 42.50  ? 86  TYR C CA  1 
ATOM   2465 C C   . TYR C 1 92  ? 37.989  29.488 38.179 1.00 40.50  ? 86  TYR C C   1 
ATOM   2466 O O   . TYR C 1 92  ? 37.961  29.724 36.978 1.00 44.99  ? 86  TYR C O   1 
ATOM   2467 C CB  . TYR C 1 92  ? 35.911  30.606 38.945 1.00 39.52  ? 86  TYR C CB  1 
ATOM   2468 C CG  . TYR C 1 92  ? 35.291  31.420 40.029 1.00 40.65  ? 86  TYR C CG  1 
ATOM   2469 C CD1 . TYR C 1 92  ? 35.055  30.856 41.269 1.00 45.71  ? 86  TYR C CD1 1 
ATOM   2470 C CD2 . TYR C 1 92  ? 34.948  32.746 39.829 1.00 38.99  ? 86  TYR C CD2 1 
ATOM   2471 C CE1 . TYR C 1 92  ? 34.488  31.582 42.299 1.00 47.36  ? 86  TYR C CE1 1 
ATOM   2472 C CE2 . TYR C 1 92  ? 34.378  33.491 40.859 1.00 47.49  ? 86  TYR C CE2 1 
ATOM   2473 C CZ  . TYR C 1 92  ? 34.151  32.893 42.098 1.00 47.66  ? 86  TYR C CZ  1 
ATOM   2474 O OH  . TYR C 1 92  ? 33.590  33.583 43.149 1.00 46.95  ? 86  TYR C OH  1 
ATOM   2475 N N   . PHE C 1 93  ? 38.561  28.403 38.691 1.00 39.25  ? 87  PHE C N   1 
ATOM   2476 C CA  . PHE C 1 93  ? 39.157  27.378 37.840 1.00 39.50  ? 87  PHE C CA  1 
ATOM   2477 C C   . PHE C 1 93  ? 38.410  26.057 37.977 1.00 43.87  ? 87  PHE C C   1 
ATOM   2478 O O   . PHE C 1 93  ? 37.730  25.822 38.979 1.00 43.13  ? 87  PHE C O   1 
ATOM   2479 C CB  . PHE C 1 93  ? 40.608  27.128 38.226 1.00 40.17  ? 87  PHE C CB  1 
ATOM   2480 C CG  . PHE C 1 93  ? 41.466  28.340 38.174 1.00 48.22  ? 87  PHE C CG  1 
ATOM   2481 C CD1 . PHE C 1 93  ? 42.102  28.703 37.000 1.00 48.29  ? 87  PHE C CD1 1 
ATOM   2482 C CD2 . PHE C 1 93  ? 41.603  29.152 39.292 1.00 43.56  ? 87  PHE C CD2 1 
ATOM   2483 C CE1 . PHE C 1 93  ? 42.865  29.868 36.943 1.00 48.88  ? 87  PHE C CE1 1 
ATOM   2484 C CE2 . PHE C 1 93  ? 42.359  30.312 39.240 1.00 47.52  ? 87  PHE C CE2 1 
ATOM   2485 C CZ  . PHE C 1 93  ? 42.990  30.675 38.065 1.00 41.43  ? 87  PHE C CZ  1 
ATOM   2486 N N   . CYS C 1 94  ? 38.513  25.219 36.952 1.00 42.17  ? 88  CYS C N   1 
ATOM   2487 C CA  . CYS C 1 94  ? 37.913  23.896 36.973 1.00 41.52  ? 88  CYS C CA  1 
ATOM   2488 C C   . CYS C 1 94  ? 39.075  22.929 36.768 1.00 42.74  ? 88  CYS C C   1 
ATOM   2489 O O   . CYS C 1 94  ? 40.054  23.242 36.091 1.00 45.16  ? 88  CYS C O   1 
ATOM   2490 C CB  . CYS C 1 94  ? 36.847  23.736 35.879 1.00 41.82  ? 88  CYS C CB  1 
ATOM   2491 S SG  . CYS C 1 94  ? 37.448  23.583 34.153 1.00 40.16  ? 88  CYS C SG  1 
ATOM   2492 N N   . GLN C 1 95  ? 39.033  21.796 37.438 1.00 39.79  ? 89  GLN C N   1 
ATOM   2493 C CA  . GLN C 1 95  ? 40.107  20.850 37.290 1.00 33.72  ? 89  GLN C CA  1 
ATOM   2494 C C   . GLN C 1 95  ? 39.483  19.480 37.150 1.00 39.21  ? 89  GLN C C   1 
ATOM   2495 O O   . GLN C 1 95  ? 38.519  19.153 37.857 1.00 35.85  ? 89  GLN C O   1 
ATOM   2496 C CB  . GLN C 1 95  ? 41.043  20.903 38.506 1.00 28.66  ? 89  GLN C CB  1 
ATOM   2497 C CG  . GLN C 1 95  ? 42.248  19.979 38.391 1.00 26.10  ? 89  GLN C CG  1 
ATOM   2498 C CD  . GLN C 1 95  ? 43.022  19.809 39.680 1.00 32.96  ? 89  GLN C CD  1 
ATOM   2499 O OE1 . GLN C 1 95  ? 42.684  20.363 40.733 1.00 40.70  ? 89  GLN C OE1 1 
ATOM   2500 N NE2 . GLN C 1 95  ? 44.087  19.049 39.602 1.00 36.03  ? 89  GLN C NE2 1 
ATOM   2501 N N   . GLN C 1 96  ? 39.956  18.736 36.154 1.00 38.96  ? 90  GLN C N   1 
ATOM   2502 C CA  . GLN C 1 96  ? 39.478  17.388 35.932 1.00 38.04  ? 90  GLN C CA  1 
ATOM   2503 C C   . GLN C 1 96  ? 40.384  16.426 36.699 1.00 42.84  ? 90  GLN C C   1 
ATOM   2504 O O   . GLN C 1 96  ? 41.608  16.604 36.753 1.00 38.34  ? 90  GLN C O   1 
ATOM   2505 C CB  . GLN C 1 96  ? 39.393  17.039 34.431 1.00 36.08  ? 90  GLN C CB  1 
ATOM   2506 C CG  . GLN C 1 96  ? 40.700  16.937 33.647 1.00 31.60  ? 90  GLN C CG  1 
ATOM   2507 C CD  . GLN C 1 96  ? 41.410  15.626 33.850 1.00 33.81  ? 90  GLN C CD  1 
ATOM   2508 O OE1 . GLN C 1 96  ? 40.893  14.749 34.515 1.00 43.21  ? 90  GLN C OE1 1 
ATOM   2509 N NE2 . GLN C 1 96  ? 42.600  15.481 33.284 1.00 43.16  ? 90  GLN C NE2 1 
ATOM   2510 N N   . HIS C 1 97  ? 39.752  15.440 37.328 1.00 42.96  ? 91  HIS C N   1 
ATOM   2511 C CA  . HIS C 1 97  ? 40.430  14.436 38.118 1.00 45.29  ? 91  HIS C CA  1 
ATOM   2512 C C   . HIS C 1 97  ? 40.135  13.015 37.625 1.00 53.39  ? 91  HIS C C   1 
ATOM   2513 O O   . HIS C 1 97  ? 40.236  12.044 38.385 1.00 53.35  ? 91  HIS C O   1 
ATOM   2514 C CB  . HIS C 1 97  ? 40.001  14.573 39.563 1.00 43.27  ? 91  HIS C CB  1 
ATOM   2515 C CG  . HIS C 1 97  ? 40.602  15.749 40.253 1.00 41.13  ? 91  HIS C CG  1 
ATOM   2516 N ND1 . HIS C 1 97  ? 41.656  15.598 41.118 1.00 38.27  ? 91  HIS C ND1 1 
ATOM   2517 C CD2 . HIS C 1 97  ? 40.216  17.049 40.231 1.00 41.89  ? 91  HIS C CD2 1 
ATOM   2518 C CE1 . HIS C 1 97  ? 41.886  16.800 41.604 1.00 39.81  ? 91  HIS C CE1 1 
ATOM   2519 N NE2 . HIS C 1 97  ? 41.036  17.713 41.095 1.00 41.30  ? 91  HIS C NE2 1 
ATOM   2520 N N   . TYR C 1 98  ? 39.770  12.913 36.349 1.00 55.20  ? 92  TYR C N   1 
ATOM   2521 C CA  . TYR C 1 98  ? 39.455  11.650 35.701 1.00 51.09  ? 92  TYR C CA  1 
ATOM   2522 C C   . TYR C 1 98  ? 40.770  10.952 35.330 1.00 50.28  ? 92  TYR C C   1 
ATOM   2523 O O   . TYR C 1 98  ? 41.062  9.866  35.810 1.00 51.73  ? 92  TYR C O   1 
ATOM   2524 C CB  . TYR C 1 98  ? 38.599  11.934 34.465 1.00 59.29  ? 92  TYR C CB  1 
ATOM   2525 C CG  . TYR C 1 98  ? 37.992  10.725 33.813 1.00 69.40  ? 92  TYR C CG  1 
ATOM   2526 C CD1 . TYR C 1 98  ? 37.260  9.796  34.558 1.00 71.54  ? 92  TYR C CD1 1 
ATOM   2527 C CD2 . TYR C 1 98  ? 38.188  10.482 32.447 1.00 76.91  ? 92  TYR C CD2 1 
ATOM   2528 C CE1 . TYR C 1 98  ? 36.738  8.637  33.957 1.00 80.70  ? 92  TYR C CE1 1 
ATOM   2529 C CE2 . TYR C 1 98  ? 37.675  9.326  31.832 1.00 82.83  ? 92  TYR C CE2 1 
ATOM   2530 C CZ  . TYR C 1 98  ? 36.951  8.404  32.593 1.00 83.07  ? 92  TYR C CZ  1 
ATOM   2531 O OH  . TYR C 1 98  ? 36.462  7.256  31.992 1.00 84.80  ? 92  TYR C OH  1 
ATOM   2532 N N   . ARG C 1 99  ? 41.587  11.593 34.503 1.00 51.56  ? 93  ARG C N   1 
ATOM   2533 C CA  . ARG C 1 99  ? 42.865  11.012 34.107 1.00 49.00  ? 93  ARG C CA  1 
ATOM   2534 C C   . ARG C 1 99  ? 44.030  11.963 34.374 1.00 47.79  ? 93  ARG C C   1 
ATOM   2535 O O   . ARG C 1 99  ? 43.841  13.191 34.507 1.00 37.32  ? 93  ARG C O   1 
ATOM   2536 C CB  . ARG C 1 99  ? 42.867  10.663 32.620 1.00 54.62  ? 93  ARG C CB  1 
ATOM   2537 C CG  . ARG C 1 99  ? 41.767  9.744  32.169 1.00 60.53  ? 93  ARG C CG  1 
ATOM   2538 C CD  . ARG C 1 99  ? 41.805  8.367  32.814 1.00 64.81  ? 93  ARG C CD  1 
ATOM   2539 N NE  . ARG C 1 99  ? 40.793  7.516  32.188 1.00 80.78  ? 93  ARG C NE  1 
ATOM   2540 C CZ  . ARG C 1 99  ? 40.439  6.308  32.616 1.00 88.42  ? 93  ARG C CZ  1 
ATOM   2541 N NH1 . ARG C 1 99  ? 41.009  5.789  33.694 1.00 92.97  ? 93  ARG C NH1 1 
ATOM   2542 N NH2 . ARG C 1 99  ? 39.547  5.592  31.929 1.00 91.96  ? 93  ARG C NH2 1 
ATOM   2543 N N   . ALA C 1 100 ? 45.226  11.372 34.461 1.00 42.86  ? 94  ALA C N   1 
ATOM   2544 C CA  . ALA C 1 100 ? 46.465  12.120 34.666 1.00 46.92  ? 94  ALA C CA  1 
ATOM   2545 C C   . ALA C 1 100 ? 46.907  12.521 33.260 1.00 50.11  ? 94  ALA C C   1 
ATOM   2546 O O   . ALA C 1 100 ? 46.611  11.802 32.300 1.00 52.59  ? 94  ALA C O   1 
ATOM   2547 C CB  . ALA C 1 100 ? 47.550  11.234 35.325 1.00 37.18  ? 94  ALA C CB  1 
ATOM   2548 N N   . PRO C 1 101 ? 47.461  13.743 33.095 1.00 49.03  ? 95  PRO C N   1 
ATOM   2549 C CA  . PRO C 1 101 ? 47.659  14.723 34.160 1.00 46.46  ? 95  PRO C CA  1 
ATOM   2550 C C   . PRO C 1 101 ? 46.310  15.395 34.409 1.00 41.98  ? 95  PRO C C   1 
ATOM   2551 O O   . PRO C 1 101 ? 45.543  15.630 33.463 1.00 44.79  ? 95  PRO C O   1 
ATOM   2552 C CB  . PRO C 1 101 ? 48.685  15.675 33.542 1.00 47.63  ? 95  PRO C CB  1 
ATOM   2553 C CG  . PRO C 1 101 ? 48.312  15.658 32.105 1.00 44.90  ? 95  PRO C CG  1 
ATOM   2554 C CD  . PRO C 1 101 ? 48.120  14.193 31.857 1.00 43.57  ? 95  PRO C CD  1 
ATOM   2555 N N   . ARG C 1 102 ? 46.016  15.693 35.665 1.00 35.76  ? 96  ARG C N   1 
ATOM   2556 C CA  . ARG C 1 102 ? 44.739  16.283 36.010 1.00 35.62  ? 96  ARG C CA  1 
ATOM   2557 C C   . ARG C 1 102 ? 44.729  17.760 35.673 1.00 37.08  ? 96  ARG C C   1 
ATOM   2558 O O   . ARG C 1 102 ? 44.822  18.649 36.526 1.00 38.70  ? 96  ARG C O   1 
ATOM   2559 C CB  . ARG C 1 102 ? 44.421  16.002 37.463 1.00 32.00  ? 96  ARG C CB  1 
ATOM   2560 C CG  . ARG C 1 102 ? 44.830  14.616 37.860 1.00 33.35  ? 96  ARG C CG  1 
ATOM   2561 C CD  . ARG C 1 102 ? 43.721  13.881 38.502 1.00 42.27  ? 96  ARG C CD  1 
ATOM   2562 N NE  . ARG C 1 102 ? 44.215  12.790 39.337 1.00 49.67  ? 96  ARG C NE  1 
ATOM   2563 C CZ  . ARG C 1 102 ? 43.697  12.463 40.520 1.00 54.31  ? 96  ARG C CZ  1 
ATOM   2564 N NH1 . ARG C 1 102 ? 42.671  13.142 41.028 1.00 53.03  ? 96  ARG C NH1 1 
ATOM   2565 N NH2 . ARG C 1 102 ? 44.173  11.425 41.181 1.00 53.71  ? 96  ARG C NH2 1 
ATOM   2566 N N   . THR C 1 103 ? 44.590  17.987 34.380 1.00 36.87  ? 97  THR C N   1 
ATOM   2567 C CA  . THR C 1 103 ? 44.597  19.297 33.763 1.00 37.75  ? 97  THR C CA  1 
ATOM   2568 C C   . THR C 1 103 ? 43.631  20.324 34.338 1.00 33.42  ? 97  THR C C   1 
ATOM   2569 O O   . THR C 1 103 ? 42.596  19.963 34.876 1.00 35.10  ? 97  THR C O   1 
ATOM   2570 C CB  . THR C 1 103 ? 44.404  19.113 32.246 1.00 38.15  ? 97  THR C CB  1 
ATOM   2571 O OG1 . THR C 1 103 ? 43.470  18.053 32.017 1.00 40.96  ? 97  THR C OG1 1 
ATOM   2572 C CG2 . THR C 1 103 ? 45.708  18.674 31.620 1.00 39.09  ? 97  THR C CG2 1 
ATOM   2573 N N   . PHE C 1 104 ? 44.009  21.599 34.273 1.00 31.44  ? 98  PHE C N   1 
ATOM   2574 C CA  . PHE C 1 104 ? 43.186  22.696 34.779 1.00 34.75  ? 98  PHE C CA  1 
ATOM   2575 C C   . PHE C 1 104 ? 42.614  23.485 33.620 1.00 36.15  ? 98  PHE C C   1 
ATOM   2576 O O   . PHE C 1 104 ? 43.142  23.454 32.510 1.00 42.87  ? 98  PHE C O   1 
ATOM   2577 C CB  . PHE C 1 104 ? 44.014  23.690 35.602 1.00 28.32  ? 98  PHE C CB  1 
ATOM   2578 C CG  . PHE C 1 104 ? 44.500  23.156 36.897 1.00 24.51  ? 98  PHE C CG  1 
ATOM   2579 C CD1 . PHE C 1 104 ? 45.654  22.390 36.960 1.00 26.72  ? 98  PHE C CD1 1 
ATOM   2580 C CD2 . PHE C 1 104 ? 43.820  23.452 38.078 1.00 29.91  ? 98  PHE C CD2 1 
ATOM   2581 C CE1 . PHE C 1 104 ? 46.141  21.911 38.197 1.00 19.58  ? 98  PHE C CE1 1 
ATOM   2582 C CE2 . PHE C 1 104 ? 44.293  22.988 39.316 1.00 20.19  ? 98  PHE C CE2 1 
ATOM   2583 C CZ  . PHE C 1 104 ? 45.462  22.211 39.368 1.00 20.90  ? 98  PHE C CZ  1 
ATOM   2584 N N   . GLY C 1 105 ? 41.542  24.210 33.895 1.00 36.98  ? 99  GLY C N   1 
ATOM   2585 C CA  . GLY C 1 105 ? 40.943  25.052 32.891 1.00 34.48  ? 99  GLY C CA  1 
ATOM   2586 C C   . GLY C 1 105 ? 41.712  26.369 32.865 1.00 40.81  ? 99  GLY C C   1 
ATOM   2587 O O   . GLY C 1 105 ? 42.551  26.657 33.739 1.00 39.74  ? 99  GLY C O   1 
ATOM   2588 N N   . GLY C 1 106 ? 41.439  27.176 31.849 1.00 39.52  ? 100 GLY C N   1 
ATOM   2589 C CA  . GLY C 1 106 ? 42.109  28.445 31.746 1.00 44.07  ? 100 GLY C CA  1 
ATOM   2590 C C   . GLY C 1 106 ? 41.754  29.381 32.893 1.00 43.43  ? 100 GLY C C   1 
ATOM   2591 O O   . GLY C 1 106 ? 42.558  30.245 33.255 1.00 49.62  ? 100 GLY C O   1 
ATOM   2592 N N   . GLY C 1 107 ? 40.586  29.191 33.493 1.00 36.74  ? 101 GLY C N   1 
ATOM   2593 C CA  . GLY C 1 107 ? 40.162  30.061 34.570 1.00 32.09  ? 101 GLY C CA  1 
ATOM   2594 C C   . GLY C 1 107 ? 39.193  31.111 34.059 1.00 36.92  ? 101 GLY C C   1 
ATOM   2595 O O   . GLY C 1 107 ? 39.132  31.378 32.849 1.00 43.02  ? 101 GLY C O   1 
ATOM   2596 N N   . THR C 1 108 ? 38.396  31.670 34.965 1.00 36.50  ? 102 THR C N   1 
ATOM   2597 C CA  . THR C 1 108 ? 37.428  32.695 34.617 1.00 35.02  ? 102 THR C CA  1 
ATOM   2598 C C   . THR C 1 108 ? 37.547  33.789 35.674 1.00 39.13  ? 102 THR C C   1 
ATOM   2599 O O   . THR C 1 108 ? 37.288  33.545 36.860 1.00 43.76  ? 102 THR C O   1 
ATOM   2600 C CB  . THR C 1 108 ? 35.966  32.141 34.598 1.00 37.01  ? 102 THR C CB  1 
ATOM   2601 O OG1 . THR C 1 108 ? 35.835  31.105 33.613 1.00 37.62  ? 102 THR C OG1 1 
ATOM   2602 C CG2 . THR C 1 108 ? 34.968  33.249 34.268 1.00 36.49  ? 102 THR C CG2 1 
ATOM   2603 N N   . LYS C 1 109 ? 37.995  34.966 35.240 1.00 39.03  ? 103 LYS C N   1 
ATOM   2604 C CA  . LYS C 1 109 ? 38.167  36.125 36.095 1.00 40.00  ? 103 LYS C CA  1 
ATOM   2605 C C   . LYS C 1 109 ? 36.813  36.805 36.229 1.00 38.55  ? 103 LYS C C   1 
ATOM   2606 O O   . LYS C 1 109 ? 36.278  37.324 35.249 1.00 38.03  ? 103 LYS C O   1 
ATOM   2607 C CB  . LYS C 1 109 ? 39.169  37.071 35.450 1.00 50.31  ? 103 LYS C CB  1 
ATOM   2608 C CG  . LYS C 1 109 ? 40.073  37.777 36.435 1.00 65.99  ? 103 LYS C CG  1 
ATOM   2609 C CD  . LYS C 1 109 ? 41.375  38.237 35.754 1.00 74.55  ? 103 LYS C CD  1 
ATOM   2610 C CE  . LYS C 1 109 ? 42.331  38.966 36.730 1.00 79.99  ? 103 LYS C CE  1 
ATOM   2611 N NZ  . LYS C 1 109 ? 42.762  38.111 37.891 1.00 79.99  ? 103 LYS C NZ  1 
ATOM   2612 N N   . LEU C 1 110 ? 36.281  36.833 37.445 1.00 38.30  ? 104 LEU C N   1 
ATOM   2613 C CA  . LEU C 1 110 ? 34.954  37.398 37.721 1.00 40.75  ? 104 LEU C CA  1 
ATOM   2614 C C   . LEU C 1 110 ? 34.954  38.773 38.365 1.00 40.55  ? 104 LEU C C   1 
ATOM   2615 O O   . LEU C 1 110 ? 35.310  38.883 39.527 1.00 42.70  ? 104 LEU C O   1 
ATOM   2616 C CB  . LEU C 1 110 ? 34.215  36.444 38.649 1.00 40.56  ? 104 LEU C CB  1 
ATOM   2617 C CG  . LEU C 1 110 ? 32.792  36.798 39.009 1.00 34.68  ? 104 LEU C CG  1 
ATOM   2618 C CD1 . LEU C 1 110 ? 31.974  36.821 37.755 1.00 41.80  ? 104 LEU C CD1 1 
ATOM   2619 C CD2 . LEU C 1 110 ? 32.267  35.749 39.945 1.00 39.93  ? 104 LEU C CD2 1 
ATOM   2620 N N   . GLU C 1 111 ? 34.510  39.803 37.644 1.00 44.21  ? 105 GLU C N   1 
ATOM   2621 C CA  . GLU C 1 111 ? 34.483  41.172 38.173 1.00 47.25  ? 105 GLU C CA  1 
ATOM   2622 C C   . GLU C 1 111 ? 33.096  41.553 38.670 1.00 47.55  ? 105 GLU C C   1 
ATOM   2623 O O   . GLU C 1 111 ? 32.105  41.346 37.973 1.00 44.70  ? 105 GLU C O   1 
ATOM   2624 C CB  . GLU C 1 111 ? 34.940  42.178 37.105 1.00 52.38  ? 105 GLU C CB  1 
ATOM   2625 C CG  . GLU C 1 111 ? 34.786  43.662 37.497 1.00 68.85  ? 105 GLU C CG  1 
ATOM   2626 C CD  . GLU C 1 111 ? 35.083  44.633 36.334 1.00 80.32  ? 105 GLU C CD  1 
ATOM   2627 O OE1 . GLU C 1 111 ? 36.218  44.620 35.806 1.00 87.48  ? 105 GLU C OE1 1 
ATOM   2628 O OE2 . GLU C 1 111 ? 34.183  45.417 35.945 1.00 83.22  ? 105 GLU C OE2 1 
ATOM   2629 N N   . ILE C 1 112 ? 33.025  42.075 39.891 1.00 48.95  ? 106 ILE C N   1 
ATOM   2630 C CA  . ILE C 1 112 ? 31.751  42.487 40.451 1.00 49.12  ? 106 ILE C CA  1 
ATOM   2631 C C   . ILE C 1 112 ? 31.707  43.985 40.642 1.00 56.62  ? 106 ILE C C   1 
ATOM   2632 O O   . ILE C 1 112 ? 32.533  44.547 41.346 1.00 61.71  ? 106 ILE C O   1 
ATOM   2633 C CB  . ILE C 1 112 ? 31.463  41.857 41.817 1.00 43.56  ? 106 ILE C CB  1 
ATOM   2634 C CG1 . ILE C 1 112 ? 31.545  40.340 41.728 1.00 36.73  ? 106 ILE C CG1 1 
ATOM   2635 C CG2 . ILE C 1 112 ? 30.074  42.282 42.290 1.00 34.67  ? 106 ILE C CG2 1 
ATOM   2636 C CD1 . ILE C 1 112 ? 30.607  39.784 40.715 1.00 46.80  ? 106 ILE C CD1 1 
ATOM   2637 N N   . LYS C 1 113 ? 30.768  44.629 39.962 1.00 62.92  ? 107 LYS C N   1 
ATOM   2638 C CA  . LYS C 1 113 ? 30.561  46.063 40.072 1.00 63.20  ? 107 LYS C CA  1 
ATOM   2639 C C   . LYS C 1 113 ? 29.442  46.296 41.080 1.00 62.09  ? 107 LYS C C   1 
ATOM   2640 O O   . LYS C 1 113 ? 29.777  46.546 42.246 1.00 61.40  ? 107 LYS C O   1 
ATOM   2641 C CB  . LYS C 1 113 ? 30.134  46.629 38.722 1.00 69.34  ? 107 LYS C CB  1 
ATOM   2642 C CG  . LYS C 1 113 ? 31.141  46.425 37.614 1.00 79.56  ? 107 LYS C CG  1 
ATOM   2643 C CD  . LYS C 1 113 ? 30.647  47.075 36.331 1.00 85.65  ? 107 LYS C CD  1 
ATOM   2644 C CE  . LYS C 1 113 ? 31.780  47.198 35.314 1.00 91.53  ? 107 LYS C CE  1 
ATOM   2645 N NZ  . LYS C 1 113 ? 31.395  47.906 34.058 1.00 92.58  ? 107 LYS C NZ  1 
ATOM   2646 N N   . GLY D 2 1   ? 41.127  24.922 61.645 1.00 56.94  ? 0   GLY D N   1 
ATOM   2647 C CA  . GLY D 2 1   ? 42.450  25.568 61.332 1.00 56.48  ? 0   GLY D CA  1 
ATOM   2648 C C   . GLY D 2 1   ? 43.617  24.739 61.858 1.00 54.92  ? 0   GLY D C   1 
ATOM   2649 O O   . GLY D 2 1   ? 44.767  25.187 61.858 1.00 50.62  ? 0   GLY D O   1 
ATOM   2650 N N   . GLN D 2 2   ? 43.328  23.531 62.331 1.00 49.90  ? 1   GLN D N   1 
ATOM   2651 C CA  . GLN D 2 2   ? 44.398  22.719 62.834 1.00 45.53  ? 1   GLN D CA  1 
ATOM   2652 C C   . GLN D 2 2   ? 45.101  21.841 61.824 1.00 43.19  ? 1   GLN D C   1 
ATOM   2653 O O   . GLN D 2 2   ? 46.131  21.275 62.143 1.00 43.38  ? 1   GLN D O   1 
ATOM   2654 C CB  . GLN D 2 2   ? 44.012  21.957 64.097 1.00 46.13  ? 1   GLN D CB  1 
ATOM   2655 C CG  . GLN D 2 2   ? 42.719  21.192 64.148 1.00 43.82  ? 1   GLN D CG  1 
ATOM   2656 C CD  . GLN D 2 2   ? 42.527  20.577 65.558 1.00 51.92  ? 1   GLN D CD  1 
ATOM   2657 O OE1 . GLN D 2 2   ? 42.851  21.197 66.586 1.00 48.36  ? 1   GLN D OE1 1 
ATOM   2658 N NE2 . GLN D 2 2   ? 42.003  19.369 65.604 1.00 49.28  ? 1   GLN D NE2 1 
ATOM   2659 N N   . VAL D 2 3   ? 44.554  21.742 60.611 1.00 41.15  ? 2   VAL D N   1 
ATOM   2660 C CA  . VAL D 2 3   ? 45.162  20.952 59.542 1.00 34.72  ? 2   VAL D CA  1 
ATOM   2661 C C   . VAL D 2 3   ? 45.957  21.908 58.682 1.00 38.83  ? 2   VAL D C   1 
ATOM   2662 O O   . VAL D 2 3   ? 45.397  22.869 58.147 1.00 34.01  ? 2   VAL D O   1 
ATOM   2663 C CB  . VAL D 2 3   ? 44.129  20.299 58.626 1.00 33.33  ? 2   VAL D CB  1 
ATOM   2664 C CG1 . VAL D 2 3   ? 44.829  19.494 57.515 1.00 26.90  ? 2   VAL D CG1 1 
ATOM   2665 C CG2 . VAL D 2 3   ? 43.261  19.399 59.423 1.00 26.54  ? 2   VAL D CG2 1 
ATOM   2666 N N   . GLN D 2 4   ? 47.246  21.626 58.533 1.00 42.02  ? 3   GLN D N   1 
ATOM   2667 C CA  . GLN D 2 4   ? 48.138  22.476 57.751 1.00 43.82  ? 3   GLN D CA  1 
ATOM   2668 C C   . GLN D 2 4   ? 49.061  21.702 56.814 1.00 42.66  ? 3   GLN D C   1 
ATOM   2669 O O   . GLN D 2 4   ? 49.595  20.651 57.179 1.00 44.17  ? 3   GLN D O   1 
ATOM   2670 C CB  . GLN D 2 4   ? 49.019  23.327 58.680 1.00 42.02  ? 3   GLN D CB  1 
ATOM   2671 C CG  . GLN D 2 4   ? 48.274  24.191 59.693 1.00 47.92  ? 3   GLN D CG  1 
ATOM   2672 C CD  . GLN D 2 4   ? 47.498  25.316 59.056 1.00 47.29  ? 3   GLN D CD  1 
ATOM   2673 O OE1 . GLN D 2 4   ? 47.630  25.575 57.862 1.00 55.61  ? 3   GLN D OE1 1 
ATOM   2674 N NE2 . GLN D 2 4   ? 46.711  26.013 59.851 1.00 45.46  ? 3   GLN D NE2 1 
ATOM   2675 N N   . LEU D 2 5   ? 49.200  22.216 55.591 1.00 39.30  ? 4   LEU D N   1 
ATOM   2676 C CA  . LEU D 2 5   ? 50.083  21.653 54.577 1.00 36.04  ? 4   LEU D CA  1 
ATOM   2677 C C   . LEU D 2 5   ? 51.130  22.751 54.399 1.00 35.18  ? 4   LEU D C   1 
ATOM   2678 O O   . LEU D 2 5   ? 50.811  23.798 53.841 1.00 32.50  ? 4   LEU D O   1 
ATOM   2679 C CB  . LEU D 2 5   ? 49.336  21.464 53.252 1.00 29.54  ? 4   LEU D CB  1 
ATOM   2680 C CG  . LEU D 2 5   ? 48.246  20.409 53.071 1.00 31.25  ? 4   LEU D CG  1 
ATOM   2681 C CD1 . LEU D 2 5   ? 47.918  20.309 51.606 1.00 26.53  ? 4   LEU D CD1 1 
ATOM   2682 C CD2 . LEU D 2 5   ? 48.715  19.075 53.550 1.00 32.09  ? 4   LEU D CD2 1 
ATOM   2683 N N   . VAL D 2 6   ? 52.368  22.538 54.839 1.00 34.06  ? 5   VAL D N   1 
ATOM   2684 C CA  . VAL D 2 6   ? 53.364  23.598 54.702 1.00 30.61  ? 5   VAL D CA  1 
ATOM   2685 C C   . VAL D 2 6   ? 54.605  23.222 53.895 1.00 34.99  ? 5   VAL D C   1 
ATOM   2686 O O   . VAL D 2 6   ? 55.473  22.440 54.346 1.00 31.92  ? 5   VAL D O   1 
ATOM   2687 C CB  . VAL D 2 6   ? 53.764  24.199 56.072 1.00 31.31  ? 5   VAL D CB  1 
ATOM   2688 C CG1 . VAL D 2 6   ? 54.602  25.449 55.891 1.00 29.84  ? 5   VAL D CG1 1 
ATOM   2689 C CG2 . VAL D 2 6   ? 52.523  24.547 56.866 1.00 23.68  ? 5   VAL D CG2 1 
ATOM   2690 N N   . GLU D 2 7   ? 54.677  23.827 52.705 1.00 34.24  ? 6   GLU D N   1 
ATOM   2691 C CA  . GLU D 2 7   ? 55.749  23.608 51.755 1.00 31.75  ? 6   GLU D CA  1 
ATOM   2692 C C   . GLU D 2 7   ? 57.012  24.397 52.066 1.00 32.97  ? 6   GLU D C   1 
ATOM   2693 O O   . GLU D 2 7   ? 56.982  25.562 52.442 1.00 33.30  ? 6   GLU D O   1 
ATOM   2694 C CB  . GLU D 2 7   ? 55.280  23.877 50.337 1.00 25.66  ? 6   GLU D CB  1 
ATOM   2695 C CG  . GLU D 2 7   ? 53.918  23.251 50.001 1.00 32.06  ? 6   GLU D CG  1 
ATOM   2696 C CD  . GLU D 2 7   ? 52.741  24.228 50.199 1.00 36.60  ? 6   GLU D CD  1 
ATOM   2697 O OE1 . GLU D 2 7   ? 52.880  25.188 50.994 1.00 32.70  ? 6   GLU D OE1 1 
ATOM   2698 O OE2 . GLU D 2 7   ? 51.686  24.049 49.541 1.00 30.26  ? 6   GLU D OE2 1 
ATOM   2699 N N   . SER D 2 8   ? 58.115  23.676 51.991 1.00 37.90  ? 7   SER D N   1 
ATOM   2700 C CA  . SER D 2 8   ? 59.453  24.143 52.262 1.00 36.01  ? 7   SER D CA  1 
ATOM   2701 C C   . SER D 2 8   ? 60.174  24.136 50.883 1.00 37.17  ? 7   SER D C   1 
ATOM   2702 O O   . SER D 2 8   ? 59.968  23.234 50.087 1.00 43.80  ? 7   SER D O   1 
ATOM   2703 C CB  . SER D 2 8   ? 60.057  23.145 53.246 1.00 28.54  ? 7   SER D CB  1 
ATOM   2704 O OG  . SER D 2 8   ? 61.349  23.510 53.620 1.00 51.13  ? 7   SER D OG  1 
ATOM   2705 N N   . GLY D 2 9   ? 60.963  25.157 50.583 1.00 37.76  ? 8   GLY D N   1 
ATOM   2706 C CA  . GLY D 2 9   ? 61.632  25.231 49.299 1.00 37.94  ? 8   GLY D CA  1 
ATOM   2707 C C   . GLY D 2 9   ? 62.948  25.985 49.370 1.00 45.35  ? 8   GLY D C   1 
ATOM   2708 O O   . GLY D 2 9   ? 63.377  26.384 50.450 1.00 49.23  ? 8   GLY D O   1 
ATOM   2709 N N   . PRO D 2 10  ? 63.611  26.211 48.231 1.00 46.48  ? 9   PRO D N   1 
ATOM   2710 C CA  . PRO D 2 10  ? 64.901  26.917 48.159 1.00 41.09  ? 9   PRO D CA  1 
ATOM   2711 C C   . PRO D 2 10  ? 64.879  28.422 47.970 1.00 33.73  ? 9   PRO D C   1 
ATOM   2712 O O   . PRO D 2 10  ? 65.846  29.104 48.318 1.00 37.88  ? 9   PRO D O   1 
ATOM   2713 C CB  . PRO D 2 10  ? 65.570  26.255 46.964 1.00 43.55  ? 9   PRO D CB  1 
ATOM   2714 C CG  . PRO D 2 10  ? 64.420  26.041 46.033 1.00 39.68  ? 9   PRO D CG  1 
ATOM   2715 C CD  . PRO D 2 10  ? 63.307  25.538 46.956 1.00 48.37  ? 9   PRO D CD  1 
ATOM   2716 N N   . GLY D 2 11  ? 63.800  28.936 47.398 1.00 29.96  ? 10  GLY D N   1 
ATOM   2717 C CA  . GLY D 2 11  ? 63.707  30.360 47.145 1.00 32.56  ? 10  GLY D CA  1 
ATOM   2718 C C   . GLY D 2 11  ? 64.255  30.622 45.752 1.00 35.01  ? 10  GLY D C   1 
ATOM   2719 O O   . GLY D 2 11  ? 63.638  30.191 44.779 1.00 32.85  ? 10  GLY D O   1 
ATOM   2720 N N   . LEU D 2 12  ? 65.353  31.369 45.632 1.00 37.06  ? 11  LEU D N   1 
ATOM   2721 C CA  . LEU D 2 12  ? 65.947  31.613 44.318 1.00 31.78  ? 11  LEU D CA  1 
ATOM   2722 C C   . LEU D 2 12  ? 66.921  30.473 44.149 1.00 33.67  ? 11  LEU D C   1 
ATOM   2723 O O   . LEU D 2 12  ? 67.622  30.081 45.107 1.00 33.34  ? 11  LEU D O   1 
ATOM   2724 C CB  . LEU D 2 12  ? 66.686  32.948 44.245 1.00 42.03  ? 11  LEU D CB  1 
ATOM   2725 C CG  . LEU D 2 12  ? 65.891  34.210 44.585 1.00 36.08  ? 11  LEU D CG  1 
ATOM   2726 C CD1 . LEU D 2 12  ? 65.738  34.322 46.078 1.00 38.21  ? 11  LEU D CD1 1 
ATOM   2727 C CD2 . LEU D 2 12  ? 66.616  35.399 44.050 1.00 31.20  ? 11  LEU D CD2 1 
ATOM   2728 N N   . VAL D 2 13  ? 66.955  29.934 42.941 1.00 29.71  ? 12  VAL D N   1 
ATOM   2729 C CA  . VAL D 2 13  ? 67.795  28.792 42.659 1.00 32.53  ? 12  VAL D CA  1 
ATOM   2730 C C   . VAL D 2 13  ? 68.436  28.868 41.266 1.00 33.89  ? 12  VAL D C   1 
ATOM   2731 O O   . VAL D 2 13  ? 67.800  29.246 40.284 1.00 34.68  ? 12  VAL D O   1 
ATOM   2732 C CB  . VAL D 2 13  ? 66.967  27.468 42.866 1.00 32.04  ? 12  VAL D CB  1 
ATOM   2733 C CG1 . VAL D 2 13  ? 65.825  27.394 41.879 1.00 27.30  ? 12  VAL D CG1 1 
ATOM   2734 C CG2 . VAL D 2 13  ? 67.873  26.214 42.798 1.00 33.81  ? 12  VAL D CG2 1 
ATOM   2735 N N   . ALA D 2 14  ? 69.719  28.533 41.206 1.00 39.91  ? 13  ALA D N   1 
ATOM   2736 C CA  . ALA D 2 14  ? 70.474  28.559 39.957 1.00 41.08  ? 13  ALA D CA  1 
ATOM   2737 C C   . ALA D 2 14  ? 69.948  27.499 39.030 1.00 41.27  ? 13  ALA D C   1 
ATOM   2738 O O   . ALA D 2 14  ? 69.704  26.374 39.477 1.00 42.24  ? 13  ALA D O   1 
ATOM   2739 C CB  . ALA D 2 14  ? 71.953  28.291 40.231 1.00 36.81  ? 13  ALA D CB  1 
ATOM   2740 N N   . PRO D 2 15  ? 69.787  27.826 37.726 1.00 41.13  ? 14  PRO D N   1 
ATOM   2741 C CA  . PRO D 2 15  ? 69.296  26.837 36.764 1.00 44.78  ? 14  PRO D CA  1 
ATOM   2742 C C   . PRO D 2 15  ? 70.338  25.719 36.714 1.00 56.56  ? 14  PRO D C   1 
ATOM   2743 O O   . PRO D 2 15  ? 71.451  25.856 37.285 1.00 60.64  ? 14  PRO D O   1 
ATOM   2744 C CB  . PRO D 2 15  ? 69.204  27.629 35.469 1.00 33.94  ? 14  PRO D CB  1 
ATOM   2745 C CG  . PRO D 2 15  ? 70.220  28.682 35.646 1.00 35.41  ? 14  PRO D CG  1 
ATOM   2746 C CD  . PRO D 2 15  ? 70.063  29.105 37.058 1.00 35.97  ? 14  PRO D CD  1 
ATOM   2747 N N   . SER D 2 16  ? 69.974  24.594 36.115 1.00 63.97  ? 15  SER D N   1 
ATOM   2748 C CA  . SER D 2 16  ? 70.874  23.439 36.063 1.00 74.65  ? 15  SER D CA  1 
ATOM   2749 C C   . SER D 2 16  ? 70.851  22.740 37.430 1.00 78.28  ? 15  SER D C   1 
ATOM   2750 O O   . SER D 2 16  ? 71.029  21.526 37.494 1.00 85.35  ? 15  SER D O   1 
ATOM   2751 C CB  . SER D 2 16  ? 72.316  23.841 35.717 1.00 77.12  ? 15  SER D CB  1 
ATOM   2752 O OG  . SER D 2 16  ? 72.411  24.428 34.429 1.00 85.76  ? 15  SER D OG  1 
ATOM   2753 N N   . GLN D 2 17  ? 70.659  23.498 38.513 1.00 76.52  ? 16  GLN D N   1 
ATOM   2754 C CA  . GLN D 2 17  ? 70.581  22.938 39.864 1.00 67.64  ? 16  GLN D CA  1 
ATOM   2755 C C   . GLN D 2 17  ? 69.267  22.169 39.983 1.00 64.76  ? 16  GLN D C   1 
ATOM   2756 O O   . GLN D 2 17  ? 68.367  22.326 39.139 1.00 62.03  ? 16  GLN D O   1 
ATOM   2757 C CB  . GLN D 2 17  ? 70.645  24.062 40.893 1.00 63.30  ? 16  GLN D CB  1 
ATOM   2758 C CG  . GLN D 2 17  ? 71.985  24.773 40.904 1.00 65.40  ? 16  GLN D CG  1 
ATOM   2759 C CD  . GLN D 2 17  ? 73.087  23.944 41.561 1.00 67.93  ? 16  GLN D CD  1 
ATOM   2760 O OE1 . GLN D 2 17  ? 73.107  23.782 42.778 1.00 69.69  ? 16  GLN D OE1 1 
ATOM   2761 N NE2 . GLN D 2 17  ? 74.009  23.432 40.763 1.00 66.30  ? 16  GLN D NE2 1 
ATOM   2762 N N   . SER D 2 18  ? 69.160  21.306 40.988 1.00 61.53  ? 17  SER D N   1 
ATOM   2763 C CA  . SER D 2 18  ? 67.938  20.517 41.154 1.00 61.86  ? 17  SER D CA  1 
ATOM   2764 C C   . SER D 2 18  ? 67.091  20.984 42.329 1.00 59.93  ? 17  SER D C   1 
ATOM   2765 O O   . SER D 2 18  ? 67.592  21.163 43.439 1.00 63.46  ? 17  SER D O   1 
ATOM   2766 C CB  . SER D 2 18  ? 68.254  19.021 41.286 1.00 59.55  ? 17  SER D CB  1 
ATOM   2767 O OG  . SER D 2 18  ? 69.147  18.783 42.361 1.00 64.66  ? 17  SER D OG  1 
ATOM   2768 N N   . LEU D 2 19  ? 65.806  21.162 42.058 1.00 53.96  ? 18  LEU D N   1 
ATOM   2769 C CA  . LEU D 2 19  ? 64.824  21.608 43.030 1.00 44.67  ? 18  LEU D CA  1 
ATOM   2770 C C   . LEU D 2 19  ? 64.429  20.475 43.987 1.00 44.32  ? 18  LEU D C   1 
ATOM   2771 O O   . LEU D 2 19  ? 64.319  19.330 43.565 1.00 51.72  ? 18  LEU D O   1 
ATOM   2772 C CB  . LEU D 2 19  ? 63.594  22.052 42.256 1.00 34.88  ? 18  LEU D CB  1 
ATOM   2773 C CG  . LEU D 2 19  ? 62.431  22.653 43.013 1.00 42.15  ? 18  LEU D CG  1 
ATOM   2774 C CD1 . LEU D 2 19  ? 62.853  23.990 43.539 1.00 41.07  ? 18  LEU D CD1 1 
ATOM   2775 C CD2 . LEU D 2 19  ? 61.222  22.800 42.096 1.00 44.89  ? 18  LEU D CD2 1 
ATOM   2776 N N   . SER D 2 20  ? 64.261  20.773 45.270 1.00 40.14  ? 19  SER D N   1 
ATOM   2777 C CA  . SER D 2 20  ? 63.815  19.767 46.240 1.00 41.20  ? 19  SER D CA  1 
ATOM   2778 C C   . SER D 2 20  ? 62.870  20.513 47.161 1.00 44.17  ? 19  SER D C   1 
ATOM   2779 O O   . SER D 2 20  ? 63.267  21.448 47.844 1.00 45.30  ? 19  SER D O   1 
ATOM   2780 C CB  . SER D 2 20  ? 64.972  19.193 47.052 1.00 38.62  ? 19  SER D CB  1 
ATOM   2781 O OG  . SER D 2 20  ? 66.041  18.814 46.201 1.00 54.58  ? 19  SER D OG  1 
ATOM   2782 N N   . ILE D 2 21  ? 61.595  20.158 47.109 1.00 46.65  ? 20  ILE D N   1 
ATOM   2783 C CA  . ILE D 2 21  ? 60.597  20.809 47.934 1.00 40.56  ? 20  ILE D CA  1 
ATOM   2784 C C   . ILE D 2 21  ? 60.087  19.800 48.952 1.00 44.22  ? 20  ILE D C   1 
ATOM   2785 O O   . ILE D 2 21  ? 60.254  18.590 48.768 1.00 45.98  ? 20  ILE D O   1 
ATOM   2786 C CB  . ILE D 2 21  ? 59.441  21.306 47.084 1.00 34.77  ? 20  ILE D CB  1 
ATOM   2787 C CG1 . ILE D 2 21  ? 59.938  22.258 46.026 1.00 31.08  ? 20  ILE D CG1 1 
ATOM   2788 C CG2 . ILE D 2 21  ? 58.482  22.102 47.916 1.00 38.71  ? 20  ILE D CG2 1 
ATOM   2789 C CD1 . ILE D 2 21  ? 58.828  22.681 45.136 1.00 43.17  ? 20  ILE D CD1 1 
ATOM   2790 N N   . THR D 2 22  ? 59.487  20.292 50.028 1.00 42.92  ? 21  THR D N   1 
ATOM   2791 C CA  . THR D 2 22  ? 58.952  19.427 51.058 1.00 40.35  ? 21  THR D CA  1 
ATOM   2792 C C   . THR D 2 22  ? 57.617  19.912 51.592 1.00 43.93  ? 21  THR D C   1 
ATOM   2793 O O   . THR D 2 22  ? 57.484  21.064 51.994 1.00 46.70  ? 21  THR D O   1 
ATOM   2794 C CB  . THR D 2 22  ? 59.941  19.289 52.217 1.00 40.57  ? 21  THR D CB  1 
ATOM   2795 O OG1 . THR D 2 22  ? 61.164  18.752 51.711 1.00 48.10  ? 21  THR D OG1 1 
ATOM   2796 C CG2 . THR D 2 22  ? 59.406  18.356 53.293 1.00 36.26  ? 21  THR D CG2 1 
ATOM   2797 N N   . CYS D 2 23  ? 56.615  19.040 51.522 1.00 44.19  ? 22  CYS D N   1 
ATOM   2798 C CA  . CYS D 2 23  ? 55.285  19.319 52.034 1.00 40.53  ? 22  CYS D CA  1 
ATOM   2799 C C   . CYS D 2 23  ? 55.146  18.671 53.426 1.00 39.49  ? 22  CYS D C   1 
ATOM   2800 O O   . CYS D 2 23  ? 55.048  17.452 53.565 1.00 37.31  ? 22  CYS D O   1 
ATOM   2801 C CB  . CYS D 2 23  ? 54.235  18.775 51.088 1.00 41.68  ? 22  CYS D CB  1 
ATOM   2802 S SG  . CYS D 2 23  ? 52.538  19.155 51.618 1.00 42.93  ? 22  CYS D SG  1 
ATOM   2803 N N   . THR D 2 24  ? 55.195  19.513 54.448 1.00 39.64  ? 23  THR D N   1 
ATOM   2804 C CA  . THR D 2 24  ? 55.112  19.108 55.837 1.00 35.08  ? 23  THR D CA  1 
ATOM   2805 C C   . THR D 2 24  ? 53.636  19.198 56.227 1.00 33.88  ? 23  THR D C   1 
ATOM   2806 O O   . THR D 2 24  ? 53.065  20.285 56.250 1.00 32.14  ? 23  THR D O   1 
ATOM   2807 C CB  . THR D 2 24  ? 55.973  20.086 56.653 1.00 40.12  ? 23  THR D CB  1 
ATOM   2808 O OG1 . THR D 2 24  ? 57.095  20.488 55.846 1.00 40.45  ? 23  THR D OG1 1 
ATOM   2809 C CG2 . THR D 2 24  ? 56.500  19.446 57.918 1.00 35.48  ? 23  THR D CG2 1 
ATOM   2810 N N   . VAL D 2 25  ? 53.018  18.060 56.511 1.00 36.88  ? 24  VAL D N   1 
ATOM   2811 C CA  . VAL D 2 25  ? 51.584  18.004 56.839 1.00 35.20  ? 24  VAL D CA  1 
ATOM   2812 C C   . VAL D 2 25  ? 51.187  17.836 58.315 1.00 36.27  ? 24  VAL D C   1 
ATOM   2813 O O   . VAL D 2 25  ? 51.855  17.141 59.081 1.00 39.89  ? 24  VAL D O   1 
ATOM   2814 C CB  . VAL D 2 25  ? 50.908  16.877 56.042 1.00 30.19  ? 24  VAL D CB  1 
ATOM   2815 C CG1 . VAL D 2 25  ? 49.468  16.752 56.427 1.00 35.52  ? 24  VAL D CG1 1 
ATOM   2816 C CG2 . VAL D 2 25  ? 51.012  17.149 54.566 1.00 26.28  ? 24  VAL D CG2 1 
ATOM   2817 N N   . SER D 2 26  ? 50.085  18.456 58.712 1.00 36.15  ? 25  SER D N   1 
ATOM   2818 C CA  . SER D 2 26  ? 49.619  18.315 60.082 1.00 36.00  ? 25  SER D CA  1 
ATOM   2819 C C   . SER D 2 26  ? 48.104  18.091 60.190 1.00 35.14  ? 25  SER D C   1 
ATOM   2820 O O   . SER D 2 26  ? 47.337  18.527 59.322 1.00 35.30  ? 25  SER D O   1 
ATOM   2821 C CB  . SER D 2 26  ? 50.026  19.522 60.920 1.00 29.88  ? 25  SER D CB  1 
ATOM   2822 O OG  . SER D 2 26  ? 49.419  20.705 60.452 1.00 34.14  ? 25  SER D OG  1 
ATOM   2823 N N   . GLY D 2 27  ? 47.704  17.313 61.196 1.00 29.45  ? 26  GLY D N   1 
ATOM   2824 C CA  . GLY D 2 27  ? 46.301  17.069 61.447 1.00 29.27  ? 26  GLY D CA  1 
ATOM   2825 C C   . GLY D 2 27  ? 45.575  16.006 60.667 1.00 33.09  ? 26  GLY D C   1 
ATOM   2826 O O   . GLY D 2 27  ? 44.367  15.855 60.837 1.00 36.78  ? 26  GLY D O   1 
ATOM   2827 N N   . ILE D 2 28  ? 46.266  15.301 59.780 1.00 34.16  ? 27  ILE D N   1 
ATOM   2828 C CA  . ILE D 2 28  ? 45.638  14.221 59.019 1.00 33.10  ? 27  ILE D CA  1 
ATOM   2829 C C   . ILE D 2 28  ? 46.658  13.116 58.793 1.00 35.17  ? 27  ILE D C   1 
ATOM   2830 O O   . ILE D 2 28  ? 47.858  13.341 58.929 1.00 38.00  ? 27  ILE D O   1 
ATOM   2831 C CB  . ILE D 2 28  ? 45.100  14.697 57.650 1.00 32.18  ? 27  ILE D CB  1 
ATOM   2832 C CG1 . ILE D 2 28  ? 46.256  15.219 56.790 1.00 32.63  ? 27  ILE D CG1 1 
ATOM   2833 C CG2 . ILE D 2 28  ? 44.020  15.775 57.837 1.00 29.94  ? 27  ILE D CG2 1 
ATOM   2834 C CD1 . ILE D 2 28  ? 45.841  15.759 55.425 1.00 19.56  ? 27  ILE D CD1 1 
ATOM   2835 N N   . SER D 2 29  ? 46.168  11.916 58.501 1.00 39.42  ? 28  SER D N   1 
ATOM   2836 C CA  . SER D 2 29  ? 47.002  10.752 58.248 1.00 36.64  ? 28  SER D CA  1 
ATOM   2837 C C   . SER D 2 29  ? 47.259  10.692 56.750 1.00 39.97  ? 28  SER D C   1 
ATOM   2838 O O   . SER D 2 29  ? 46.318  10.827 55.948 1.00 40.26  ? 28  SER D O   1 
ATOM   2839 C CB  . SER D 2 29  ? 46.272  9.491  58.701 1.00 36.21  ? 28  SER D CB  1 
ATOM   2840 O OG  . SER D 2 29  ? 47.018  8.316  58.426 1.00 49.22  ? 28  SER D OG  1 
ATOM   2841 N N   . LEU D 2 30  ? 48.515  10.462 56.363 1.00 42.34  ? 29  LEU D N   1 
ATOM   2842 C CA  . LEU D 2 30  ? 48.838  10.416 54.935 1.00 43.63  ? 29  LEU D CA  1 
ATOM   2843 C C   . LEU D 2 30  ? 48.316  9.173  54.243 1.00 40.73  ? 29  LEU D C   1 
ATOM   2844 O O   . LEU D 2 30  ? 48.206  9.147  53.026 1.00 39.66  ? 29  LEU D O   1 
ATOM   2845 C CB  . LEU D 2 30  ? 50.342  10.620 54.669 1.00 42.99  ? 29  LEU D CB  1 
ATOM   2846 C CG  . LEU D 2 30  ? 51.022  11.964 55.035 1.00 35.90  ? 29  LEU D CG  1 
ATOM   2847 C CD1 . LEU D 2 30  ? 52.424  12.005 54.454 1.00 36.73  ? 29  LEU D CD1 1 
ATOM   2848 C CD2 . LEU D 2 30  ? 50.236  13.125 54.508 1.00 32.95  ? 29  LEU D CD2 1 
ATOM   2849 N N   . SER D 2 31  ? 47.897  8.200  55.050 1.00 42.49  ? 30  SER D N   1 
ATOM   2850 C CA  . SER D 2 31  ? 47.350  6.933  54.586 1.00 34.63  ? 30  SER D CA  1 
ATOM   2851 C C   . SER D 2 31  ? 45.930  7.123  54.083 1.00 36.83  ? 30  SER D C   1 
ATOM   2852 O O   . SER D 2 31  ? 45.487  6.412  53.192 1.00 39.11  ? 30  SER D O   1 
ATOM   2853 C CB  . SER D 2 31  ? 47.319  5.958  55.742 1.00 41.16  ? 30  SER D CB  1 
ATOM   2854 O OG  . SER D 2 31  ? 48.501  6.048  56.514 1.00 48.19  ? 30  SER D OG  1 
ATOM   2855 N N   . ARG D 2 32  ? 45.198  8.045  54.697 1.00 40.44  ? 31  ARG D N   1 
ATOM   2856 C CA  . ARG D 2 32  ? 43.818  8.333  54.305 1.00 45.76  ? 31  ARG D CA  1 
ATOM   2857 C C   . ARG D 2 32  ? 43.745  9.468  53.272 1.00 48.77  ? 31  ARG D C   1 
ATOM   2858 O O   . ARG D 2 32  ? 42.662  9.812  52.775 1.00 50.22  ? 31  ARG D O   1 
ATOM   2859 C CB  . ARG D 2 32  ? 43.004  8.764  55.528 1.00 43.62  ? 31  ARG D CB  1 
ATOM   2860 C CG  . ARG D 2 32  ? 42.764  7.694  56.556 1.00 48.86  ? 31  ARG D CG  1 
ATOM   2861 C CD  . ARG D 2 32  ? 42.188  8.297  57.827 1.00 55.14  ? 31  ARG D CD  1 
ATOM   2862 N NE  . ARG D 2 32  ? 42.914  7.833  59.019 1.00 69.13  ? 31  ARG D NE  1 
ATOM   2863 C CZ  . ARG D 2 32  ? 42.885  8.433  60.214 1.00 72.57  ? 31  ARG D CZ  1 
ATOM   2864 N NH1 . ARG D 2 32  ? 42.174  9.538  60.383 1.00 75.42  ? 31  ARG D NH1 1 
ATOM   2865 N NH2 . ARG D 2 32  ? 43.533  7.914  61.262 1.00 72.81  ? 31  ARG D NH2 1 
ATOM   2866 N N   . TYR D 2 33  ? 44.883  10.075 52.968 1.00 47.31  ? 32  TYR D N   1 
ATOM   2867 C CA  . TYR D 2 33  ? 44.872  11.186 52.050 1.00 43.33  ? 32  TYR D CA  1 
ATOM   2868 C C   . TYR D 2 33  ? 45.813  11.118 50.861 1.00 44.89  ? 32  TYR D C   1 
ATOM   2869 O O   . TYR D 2 33  ? 46.928  10.595 50.948 1.00 46.91  ? 32  TYR D O   1 
ATOM   2870 C CB  . TYR D 2 33  ? 45.135  12.465 52.822 1.00 34.83  ? 32  TYR D CB  1 
ATOM   2871 C CG  . TYR D 2 33  ? 43.935  13.042 53.511 1.00 35.27  ? 32  TYR D CG  1 
ATOM   2872 C CD1 . TYR D 2 33  ? 43.609  12.676 54.814 1.00 34.50  ? 32  TYR D CD1 1 
ATOM   2873 C CD2 . TYR D 2 33  ? 43.142  14.005 52.871 1.00 38.49  ? 32  TYR D CD2 1 
ATOM   2874 C CE1 . TYR D 2 33  ? 42.509  13.271 55.476 1.00 40.62  ? 32  TYR D CE1 1 
ATOM   2875 C CE2 . TYR D 2 33  ? 42.052  14.606 53.511 1.00 38.74  ? 32  TYR D CE2 1 
ATOM   2876 C CZ  . TYR D 2 33  ? 41.736  14.237 54.811 1.00 40.14  ? 32  TYR D CZ  1 
ATOM   2877 O OH  . TYR D 2 33  ? 40.645  14.825 55.431 1.00 37.29  ? 32  TYR D OH  1 
ATOM   2878 N N   . ASN D 2 34  ? 45.362  11.718 49.763 1.00 46.02  ? 33  ASN D N   1 
ATOM   2879 C CA  . ASN D 2 34  ? 46.122  11.786 48.527 1.00 48.25  ? 33  ASN D CA  1 
ATOM   2880 C C   . ASN D 2 34  ? 46.732  13.177 48.407 1.00 47.05  ? 33  ASN D C   1 
ATOM   2881 O O   . ASN D 2 34  ? 46.004  14.161 48.493 1.00 48.28  ? 33  ASN D O   1 
ATOM   2882 C CB  . ASN D 2 34  ? 45.192  11.573 47.340 1.00 44.67  ? 33  ASN D CB  1 
ATOM   2883 C CG  . ASN D 2 34  ? 44.564  10.213 47.343 1.00 44.70  ? 33  ASN D CG  1 
ATOM   2884 O OD1 . ASN D 2 34  ? 45.154  9.235  47.823 1.00 38.67  ? 33  ASN D OD1 1 
ATOM   2885 N ND2 . ASN D 2 34  ? 43.366  10.130 46.802 1.00 36.45  ? 33  ASN D ND2 1 
ATOM   2886 N N   . VAL D 2 35  ? 48.051  13.255 48.208 1.00 46.10  ? 34  VAL D N   1 
ATOM   2887 C CA  . VAL D 2 35  ? 48.757  14.538 48.059 1.00 41.42  ? 34  VAL D CA  1 
ATOM   2888 C C   . VAL D 2 35  ? 49.197  14.797 46.610 1.00 39.47  ? 34  VAL D C   1 
ATOM   2889 O O   . VAL D 2 35  ? 49.890  13.964 46.006 1.00 39.21  ? 34  VAL D O   1 
ATOM   2890 C CB  . VAL D 2 35  ? 50.004  14.590 48.951 1.00 38.25  ? 34  VAL D CB  1 
ATOM   2891 C CG1 . VAL D 2 35  ? 50.567  16.007 49.012 1.00 40.06  ? 34  VAL D CG1 1 
ATOM   2892 C CG2 . VAL D 2 35  ? 49.657  14.097 50.323 1.00 41.05  ? 34  VAL D CG2 1 
ATOM   2893 N N   . HIS D 2 36  ? 48.774  15.926 46.048 1.00 30.35  ? 35  HIS D N   1 
ATOM   2894 C CA  . HIS D 2 36  ? 49.139  16.287 44.692 1.00 30.35  ? 35  HIS D CA  1 
ATOM   2895 C C   . HIS D 2 36  ? 50.155  17.433 44.738 1.00 37.61  ? 35  HIS D C   1 
ATOM   2896 O O   . HIS D 2 36  ? 50.117  18.253 45.676 1.00 31.59  ? 35  HIS D O   1 
ATOM   2897 C CB  . HIS D 2 36  ? 47.925  16.781 43.935 1.00 26.34  ? 35  HIS D CB  1 
ATOM   2898 C CG  . HIS D 2 36  ? 46.817  15.772 43.823 1.00 37.97  ? 35  HIS D CG  1 
ATOM   2899 N ND1 . HIS D 2 36  ? 45.959  15.787 42.763 1.00 39.23  ? 35  HIS D ND1 1 
ATOM   2900 C CD2 . HIS D 2 36  ? 46.417  14.853 44.739 1.00 33.24  ? 35  HIS D CD2 1 
ATOM   2901 C CE1 . HIS D 2 36  ? 45.039  14.876 43.045 1.00 40.34  ? 35  HIS D CE1 1 
ATOM   2902 N NE2 . HIS D 2 36  ? 45.273  14.289 44.227 1.00 40.07  ? 35  HIS D NE2 1 
ATOM   2903 N N   . TRP D 2 37  ? 51.092  17.453 43.779 1.00 36.27  ? 36  TRP D N   1 
ATOM   2904 C CA  . TRP D 2 37  ? 52.074  18.533 43.657 1.00 27.57  ? 36  TRP D CA  1 
ATOM   2905 C C   . TRP D 2 37  ? 51.552  19.314 42.465 1.00 28.76  ? 36  TRP D C   1 
ATOM   2906 O O   . TRP D 2 37  ? 51.228  18.741 41.432 1.00 29.49  ? 36  TRP D O   1 
ATOM   2907 C CB  . TRP D 2 37  ? 53.458  17.996 43.381 1.00 26.21  ? 36  TRP D CB  1 
ATOM   2908 C CG  . TRP D 2 37  ? 54.216  17.608 44.629 1.00 34.80  ? 36  TRP D CG  1 
ATOM   2909 C CD1 . TRP D 2 37  ? 54.651  16.360 44.968 1.00 32.16  ? 36  TRP D CD1 1 
ATOM   2910 C CD2 . TRP D 2 37  ? 54.660  18.486 45.692 1.00 34.02  ? 36  TRP D CD2 1 
ATOM   2911 N NE1 . TRP D 2 37  ? 55.336  16.398 46.170 1.00 25.29  ? 36  TRP D NE1 1 
ATOM   2912 C CE2 . TRP D 2 37  ? 55.361  17.687 46.630 1.00 29.15  ? 36  TRP D CE2 1 
ATOM   2913 C CE3 . TRP D 2 37  ? 54.541  19.862 45.934 1.00 37.27  ? 36  TRP D CE3 1 
ATOM   2914 C CZ2 . TRP D 2 37  ? 55.930  18.216 47.791 1.00 27.46  ? 36  TRP D CZ2 1 
ATOM   2915 C CZ3 . TRP D 2 37  ? 55.115  20.391 47.103 1.00 30.05  ? 36  TRP D CZ3 1 
ATOM   2916 C CH2 . TRP D 2 37  ? 55.802  19.559 48.011 1.00 22.74  ? 36  TRP D CH2 1 
ATOM   2917 N N   . VAL D 2 38  ? 51.402  20.614 42.641 1.00 31.02  ? 37  VAL D N   1 
ATOM   2918 C CA  . VAL D 2 38  ? 50.861  21.512 41.631 1.00 32.69  ? 37  VAL D CA  1 
ATOM   2919 C C   . VAL D 2 38  ? 51.723  22.778 41.665 1.00 36.63  ? 37  VAL D C   1 
ATOM   2920 O O   . VAL D 2 38  ? 52.474  22.965 42.624 1.00 37.55  ? 37  VAL D O   1 
ATOM   2921 C CB  . VAL D 2 38  ? 49.386  21.837 42.031 1.00 30.11  ? 37  VAL D CB  1 
ATOM   2922 C CG1 . VAL D 2 38  ? 48.882  23.067 41.400 1.00 32.89  ? 37  VAL D CG1 1 
ATOM   2923 C CG2 . VAL D 2 38  ? 48.495  20.701 41.644 1.00 37.16  ? 37  VAL D CG2 1 
ATOM   2924 N N   . ARG D 2 39  ? 51.724  23.562 40.585 1.00 34.74  ? 38  ARG D N   1 
ATOM   2925 C CA  . ARG D 2 39  ? 52.453  24.847 40.553 1.00 37.59  ? 38  ARG D CA  1 
ATOM   2926 C C   . ARG D 2 39  ? 51.612  25.887 39.821 1.00 35.76  ? 38  ARG D C   1 
ATOM   2927 O O   . ARG D 2 39  ? 50.707  25.538 39.061 1.00 44.80  ? 38  ARG D O   1 
ATOM   2928 C CB  . ARG D 2 39  ? 53.857  24.730 39.922 1.00 33.67  ? 38  ARG D CB  1 
ATOM   2929 C CG  . ARG D 2 39  ? 53.957  24.818 38.393 1.00 30.29  ? 38  ARG D CG  1 
ATOM   2930 C CD  . ARG D 2 39  ? 55.373  24.449 37.960 1.00 29.75  ? 38  ARG D CD  1 
ATOM   2931 N NE  . ARG D 2 39  ? 55.486  24.249 36.521 1.00 38.61  ? 38  ARG D NE  1 
ATOM   2932 C CZ  . ARG D 2 39  ? 56.596  23.863 35.888 1.00 42.82  ? 38  ARG D CZ  1 
ATOM   2933 N NH1 . ARG D 2 39  ? 57.726  23.644 36.556 1.00 42.94  ? 38  ARG D NH1 1 
ATOM   2934 N NH2 . ARG D 2 39  ? 56.547  23.583 34.596 1.00 39.47  ? 38  ARG D NH2 1 
ATOM   2935 N N   . GLN D 2 40  ? 51.850  27.157 40.074 1.00 30.76  ? 39  GLN D N   1 
ATOM   2936 C CA  . GLN D 2 40  ? 51.078  28.174 39.379 1.00 31.43  ? 39  GLN D CA  1 
ATOM   2937 C C   . GLN D 2 40  ? 51.948  29.416 39.117 1.00 35.78  ? 39  GLN D C   1 
ATOM   2938 O O   . GLN D 2 40  ? 52.814  29.782 39.932 1.00 29.19  ? 39  GLN D O   1 
ATOM   2939 C CB  . GLN D 2 40  ? 49.835  28.511 40.193 1.00 28.72  ? 39  GLN D CB  1 
ATOM   2940 C CG  . GLN D 2 40  ? 49.018  29.692 39.706 1.00 29.63  ? 39  GLN D CG  1 
ATOM   2941 C CD  . GLN D 2 40  ? 47.824  29.987 40.627 1.00 37.82  ? 39  GLN D CD  1 
ATOM   2942 O OE1 . GLN D 2 40  ? 47.926  29.930 41.865 1.00 39.17  ? 39  GLN D OE1 1 
ATOM   2943 N NE2 . GLN D 2 40  ? 46.696  30.318 40.028 1.00 29.69  ? 39  GLN D NE2 1 
ATOM   2944 N N   . SER D 2 41  ? 51.781  29.990 37.929 1.00 37.79  ? 40  SER D N   1 
ATOM   2945 C CA  . SER D 2 41  ? 52.517  31.187 37.513 1.00 38.32  ? 40  SER D CA  1 
ATOM   2946 C C   . SER D 2 41  ? 51.618  31.973 36.584 1.00 38.43  ? 40  SER D C   1 
ATOM   2947 O O   . SER D 2 41  ? 50.639  31.440 36.059 1.00 36.86  ? 40  SER D O   1 
ATOM   2948 C CB  . SER D 2 41  ? 53.831  30.832 36.810 1.00 29.08  ? 40  SER D CB  1 
ATOM   2949 O OG  . SER D 2 41  ? 53.631  29.907 35.766 1.00 42.97  ? 40  SER D OG  1 
ATOM   2950 N N   . PRO D 2 42  ? 51.892  33.269 36.412 1.00 39.30  ? 41  PRO D N   1 
ATOM   2951 C CA  . PRO D 2 42  ? 51.009  34.016 35.515 1.00 42.98  ? 41  PRO D CA  1 
ATOM   2952 C C   . PRO D 2 42  ? 51.105  33.537 34.069 1.00 47.96  ? 41  PRO D C   1 
ATOM   2953 O O   . PRO D 2 42  ? 50.097  33.299 33.403 1.00 50.27  ? 41  PRO D O   1 
ATOM   2954 C CB  . PRO D 2 42  ? 51.502  35.451 35.681 1.00 40.24  ? 41  PRO D CB  1 
ATOM   2955 C CG  . PRO D 2 42  ? 51.979  35.469 37.104 1.00 31.52  ? 41  PRO D CG  1 
ATOM   2956 C CD  . PRO D 2 42  ? 52.775  34.184 37.153 1.00 37.00  ? 41  PRO D CD  1 
ATOM   2957 N N   . GLY D 2 43  ? 52.326  33.316 33.614 1.00 46.58  ? 42  GLY D N   1 
ATOM   2958 C CA  . GLY D 2 43  ? 52.513  32.880 32.254 1.00 45.74  ? 42  GLY D CA  1 
ATOM   2959 C C   . GLY D 2 43  ? 51.989  31.496 31.980 1.00 45.59  ? 42  GLY D C   1 
ATOM   2960 O O   . GLY D 2 43  ? 51.278  31.306 31.012 1.00 48.82  ? 42  GLY D O   1 
ATOM   2961 N N   . LYS D 2 44  ? 52.272  30.556 32.873 1.00 47.08  ? 43  LYS D N   1 
ATOM   2962 C CA  . LYS D 2 44  ? 51.875  29.158 32.699 1.00 46.53  ? 43  LYS D CA  1 
ATOM   2963 C C   . LYS D 2 44  ? 50.515  28.680 33.262 1.00 45.49  ? 43  LYS D C   1 
ATOM   2964 O O   . LYS D 2 44  ? 50.100  27.551 32.981 1.00 47.06  ? 43  LYS D O   1 
ATOM   2965 C CB  . LYS D 2 44  ? 52.982  28.258 33.266 1.00 46.64  ? 43  LYS D CB  1 
ATOM   2966 C CG  . LYS D 2 44  ? 54.343  28.476 32.643 1.00 47.00  ? 43  LYS D CG  1 
ATOM   2967 C CD  . LYS D 2 44  ? 55.366  27.460 33.145 1.00 53.92  ? 43  LYS D CD  1 
ATOM   2968 C CE  . LYS D 2 44  ? 55.780  27.751 34.572 1.00 59.50  ? 43  LYS D CE  1 
ATOM   2969 N NZ  . LYS D 2 44  ? 56.430  29.100 34.617 1.00 69.22  ? 43  LYS D NZ  1 
ATOM   2970 N N   . GLY D 2 45  ? 49.821  29.517 34.031 1.00 42.48  ? 44  GLY D N   1 
ATOM   2971 C CA  . GLY D 2 45  ? 48.568  29.088 34.635 1.00 34.09  ? 44  GLY D CA  1 
ATOM   2972 C C   . GLY D 2 45  ? 48.878  28.019 35.677 1.00 35.26  ? 44  GLY D C   1 
ATOM   2973 O O   . GLY D 2 45  ? 50.021  27.915 36.181 1.00 32.03  ? 44  GLY D O   1 
ATOM   2974 N N   . LEU D 2 46  ? 47.873  27.213 36.008 1.00 36.55  ? 45  LEU D N   1 
ATOM   2975 C CA  . LEU D 2 46  ? 48.044  26.143 36.992 1.00 30.45  ? 45  LEU D CA  1 
ATOM   2976 C C   . LEU D 2 46  ? 48.442  24.899 36.237 1.00 33.70  ? 45  LEU D C   1 
ATOM   2977 O O   . LEU D 2 46  ? 47.884  24.629 35.170 1.00 37.44  ? 45  LEU D O   1 
ATOM   2978 C CB  . LEU D 2 46  ? 46.734  25.923 37.759 1.00 30.99  ? 45  LEU D CB  1 
ATOM   2979 C CG  . LEU D 2 46  ? 46.501  26.850 38.962 1.00 25.86  ? 45  LEU D CG  1 
ATOM   2980 C CD1 . LEU D 2 46  ? 45.027  27.155 39.273 1.00 21.50  ? 45  LEU D CD1 1 
ATOM   2981 C CD2 . LEU D 2 46  ? 47.176  26.177 40.127 1.00 18.67  ? 45  LEU D CD2 1 
ATOM   2982 N N   . GLU D 2 47  ? 49.422  24.159 36.759 1.00 34.50  ? 46  GLU D N   1 
ATOM   2983 C CA  . GLU D 2 47  ? 49.894  22.935 36.114 1.00 34.27  ? 46  GLU D CA  1 
ATOM   2984 C C   . GLU D 2 47  ? 50.030  21.823 37.122 1.00 37.84  ? 46  GLU D C   1 
ATOM   2985 O O   . GLU D 2 47  ? 50.588  22.028 38.199 1.00 36.21  ? 46  GLU D O   1 
ATOM   2986 C CB  . GLU D 2 47  ? 51.241  23.161 35.449 1.00 44.02  ? 46  GLU D CB  1 
ATOM   2987 C CG  . GLU D 2 47  ? 51.160  24.062 34.237 1.00 57.51  ? 46  GLU D CG  1 
ATOM   2988 C CD  . GLU D 2 47  ? 52.524  24.415 33.665 1.00 65.02  ? 46  GLU D CD  1 
ATOM   2989 O OE1 . GLU D 2 47  ? 53.553  24.204 34.350 1.00 68.06  ? 46  GLU D OE1 1 
ATOM   2990 O OE2 . GLU D 2 47  ? 52.556  24.916 32.519 1.00 70.76  ? 46  GLU D OE2 1 
ATOM   2991 N N   . TRP D 2 48  ? 49.479  20.658 36.778 1.00 38.66  ? 47  TRP D N   1 
ATOM   2992 C CA  . TRP D 2 48  ? 49.514  19.481 37.637 1.00 38.91  ? 47  TRP D CA  1 
ATOM   2993 C C   . TRP D 2 48  ? 50.863  18.801 37.455 1.00 33.60  ? 47  TRP D C   1 
ATOM   2994 O O   . TRP D 2 48  ? 51.239  18.501 36.340 1.00 36.27  ? 47  TRP D O   1 
ATOM   2995 C CB  . TRP D 2 48  ? 48.354  18.518 37.276 1.00 45.09  ? 47  TRP D CB  1 
ATOM   2996 C CG  . TRP D 2 48  ? 48.172  17.367 38.243 1.00 44.63  ? 47  TRP D CG  1 
ATOM   2997 C CD1 . TRP D 2 48  ? 47.650  17.433 39.505 1.00 46.79  ? 47  TRP D CD1 1 
ATOM   2998 C CD2 . TRP D 2 48  ? 48.578  16.003 38.049 1.00 51.14  ? 47  TRP D CD2 1 
ATOM   2999 N NE1 . TRP D 2 48  ? 47.719  16.205 40.112 1.00 50.53  ? 47  TRP D NE1 1 
ATOM   3000 C CE2 . TRP D 2 48  ? 48.286  15.308 39.248 1.00 51.54  ? 47  TRP D CE2 1 
ATOM   3001 C CE3 . TRP D 2 48  ? 49.177  15.303 36.990 1.00 44.53  ? 47  TRP D CE3 1 
ATOM   3002 C CZ2 . TRP D 2 48  ? 48.572  13.941 39.412 1.00 47.43  ? 47  TRP D CZ2 1 
ATOM   3003 C CZ3 . TRP D 2 48  ? 49.462  13.941 37.160 1.00 41.91  ? 47  TRP D CZ3 1 
ATOM   3004 C CH2 . TRP D 2 48  ? 49.163  13.281 38.363 1.00 38.11  ? 47  TRP D CH2 1 
ATOM   3005 N N   . LEU D 2 49  ? 51.585  18.573 38.541 1.00 33.39  ? 48  LEU D N   1 
ATOM   3006 C CA  . LEU D 2 49  ? 52.896  17.950 38.470 1.00 38.64  ? 48  LEU D CA  1 
ATOM   3007 C C   . LEU D 2 49  ? 52.820  16.458 38.729 1.00 43.10  ? 48  LEU D C   1 
ATOM   3008 O O   . LEU D 2 49  ? 53.414  15.670 37.991 1.00 49.56  ? 48  LEU D O   1 
ATOM   3009 C CB  . LEU D 2 49  ? 53.872  18.619 39.454 1.00 42.29  ? 48  LEU D CB  1 
ATOM   3010 C CG  . LEU D 2 49  ? 54.052  20.147 39.301 1.00 41.93  ? 48  LEU D CG  1 
ATOM   3011 C CD1 . LEU D 2 49  ? 54.959  20.708 40.373 1.00 36.69  ? 48  LEU D CD1 1 
ATOM   3012 C CD2 . LEU D 2 49  ? 54.601  20.480 37.930 1.00 37.46  ? 48  LEU D CD2 1 
ATOM   3013 N N   . GLY D 2 50  ? 52.084  16.065 39.762 1.00 43.45  ? 49  GLY D N   1 
ATOM   3014 C CA  . GLY D 2 50  ? 51.946  14.656 40.076 1.00 38.81  ? 49  GLY D CA  1 
ATOM   3015 C C   . GLY D 2 50  ? 51.139  14.410 41.326 1.00 38.93  ? 49  GLY D C   1 
ATOM   3016 O O   . GLY D 2 50  ? 50.462  15.313 41.825 1.00 37.97  ? 49  GLY D O   1 
ATOM   3017 N N   . MET D 2 51  ? 51.211  13.190 41.841 1.00 39.70  ? 50  MET D N   1 
ATOM   3018 C CA  . MET D 2 51  ? 50.478  12.851 43.052 1.00 40.39  ? 50  MET D CA  1 
ATOM   3019 C C   . MET D 2 51  ? 50.963  11.551 43.681 1.00 39.99  ? 50  MET D C   1 
ATOM   3020 O O   . MET D 2 51  ? 51.714  10.787 43.058 1.00 40.72  ? 50  MET D O   1 
ATOM   3021 C CB  . MET D 2 51  ? 48.976  12.762 42.759 1.00 39.30  ? 50  MET D CB  1 
ATOM   3022 C CG  . MET D 2 51  ? 48.543  11.522 42.000 1.00 36.82  ? 50  MET D CG  1 
ATOM   3023 S SD  . MET D 2 51  ? 46.748  11.458 41.959 1.00 43.45  ? 50  MET D SD  1 
ATOM   3024 C CE  . MET D 2 51  ? 46.427  10.933 43.608 1.00 37.59  ? 50  MET D CE  1 
ATOM   3025 N N   . ILE D 2 52  ? 50.569  11.328 44.931 1.00 39.70  ? 51  ILE D N   1 
ATOM   3026 C CA  . ILE D 2 52  ? 50.933  10.102 45.640 1.00 40.52  ? 51  ILE D CA  1 
ATOM   3027 C C   . ILE D 2 52  ? 49.796  9.637  46.577 1.00 44.06  ? 51  ILE D C   1 
ATOM   3028 O O   . ILE D 2 52  ? 49.622  10.187 47.672 1.00 48.69  ? 51  ILE D O   1 
ATOM   3029 C CB  . ILE D 2 52  ? 52.261  10.278 46.396 1.00 32.19  ? 51  ILE D CB  1 
ATOM   3030 C CG1 . ILE D 2 52  ? 52.630  8.995  47.129 1.00 24.58  ? 51  ILE D CG1 1 
ATOM   3031 C CG2 . ILE D 2 52  ? 52.170  11.457 47.345 1.00 35.28  ? 51  ILE D CG2 1 
ATOM   3032 C CD1 . ILE D 2 52  ? 54.107  8.875  47.416 1.00 20.77  ? 51  ILE D CD1 1 
ATOM   3033 N N   . TRP D 2 53  ? 49.016  8.642  46.118 1.00 43.17  ? 52  TRP D N   1 
ATOM   3034 C CA  . TRP D 2 53  ? 47.866  8.086  46.860 1.00 38.58  ? 52  TRP D CA  1 
ATOM   3035 C C   . TRP D 2 53  ? 48.254  7.634  48.265 1.00 38.95  ? 52  TRP D C   1 
ATOM   3036 O O   . TRP D 2 53  ? 49.433  7.353  48.529 1.00 42.18  ? 52  TRP D O   1 
ATOM   3037 C CB  . TRP D 2 53  ? 47.208  6.915  46.094 1.00 37.16  ? 52  TRP D CB  1 
ATOM   3038 C CG  . TRP D 2 53  ? 46.809  7.222  44.648 1.00 42.37  ? 52  TRP D CG  1 
ATOM   3039 C CD1 . TRP D 2 53  ? 47.648  7.314  43.573 1.00 45.28  ? 52  TRP D CD1 1 
ATOM   3040 C CD2 . TRP D 2 53  ? 45.492  7.528  44.139 1.00 44.13  ? 52  TRP D CD2 1 
ATOM   3041 N NE1 . TRP D 2 53  ? 46.952  7.665  42.441 1.00 42.52  ? 52  TRP D NE1 1 
ATOM   3042 C CE2 . TRP D 2 53  ? 45.629  7.802  42.756 1.00 41.77  ? 52  TRP D CE2 1 
ATOM   3043 C CE3 . TRP D 2 53  ? 44.221  7.608  44.713 1.00 48.69  ? 52  TRP D CE3 1 
ATOM   3044 C CZ2 . TRP D 2 53  ? 44.543  8.148  41.945 1.00 46.59  ? 52  TRP D CZ2 1 
ATOM   3045 C CZ3 . TRP D 2 53  ? 43.132  7.963  43.893 1.00 47.03  ? 52  TRP D CZ3 1 
ATOM   3046 C CH2 . TRP D 2 53  ? 43.305  8.228  42.529 1.00 43.61  ? 52  TRP D CH2 1 
ATOM   3047 N N   . GLY D 2 54  ? 47.258  7.547  49.148 1.00 39.49  ? 53  GLY D N   1 
ATOM   3048 C CA  . GLY D 2 54  ? 47.480  7.130  50.530 1.00 35.23  ? 53  GLY D CA  1 
ATOM   3049 C C   . GLY D 2 54  ? 48.289  5.859  50.601 1.00 40.88  ? 53  GLY D C   1 
ATOM   3050 O O   . GLY D 2 54  ? 49.242  5.719  51.388 1.00 38.38  ? 53  GLY D O   1 
ATOM   3051 N N   . GLY D 2 55  ? 47.950  4.941  49.704 1.00 44.46  ? 54  GLY D N   1 
ATOM   3052 C CA  . GLY D 2 55  ? 48.653  3.679  49.644 1.00 49.70  ? 54  GLY D CA  1 
ATOM   3053 C C   . GLY D 2 55  ? 49.801  3.660  48.658 1.00 50.94  ? 54  GLY D C   1 
ATOM   3054 O O   . GLY D 2 55  ? 49.736  2.902  47.700 1.00 59.57  ? 54  GLY D O   1 
ATOM   3055 N N   . GLY D 2 56  ? 50.760  4.575  48.812 1.00 51.51  ? 55  GLY D N   1 
ATOM   3056 C CA  . GLY D 2 56  ? 51.947  4.629  47.952 1.00 51.11  ? 55  GLY D CA  1 
ATOM   3057 C C   . GLY D 2 56  ? 51.945  4.769  46.420 1.00 47.12  ? 55  GLY D C   1 
ATOM   3058 O O   . GLY D 2 56  ? 52.980  5.039  45.827 1.00 44.89  ? 55  GLY D O   1 
ATOM   3059 N N   . SER D 2 57  ? 50.812  4.586  45.760 1.00 49.38  ? 56  SER D N   1 
ATOM   3060 C CA  . SER D 2 57  ? 50.738  4.680  44.297 1.00 52.50  ? 56  SER D CA  1 
ATOM   3061 C C   . SER D 2 57  ? 51.083  6.104  43.793 1.00 51.89  ? 56  SER D C   1 
ATOM   3062 O O   . SER D 2 57  ? 50.370  7.070  44.122 1.00 56.10  ? 56  SER D O   1 
ATOM   3063 C CB  . SER D 2 57  ? 49.328  4.234  43.844 1.00 54.16  ? 56  SER D CB  1 
ATOM   3064 O OG  . SER D 2 57  ? 49.128  4.389  42.455 1.00 52.16  ? 56  SER D OG  1 
ATOM   3065 N N   . ILE D 2 58  ? 52.140  6.222  42.975 1.00 45.16  ? 57  ILE D N   1 
ATOM   3066 C CA  . ILE D 2 58  ? 52.604  7.517  42.456 1.00 43.44  ? 57  ILE D CA  1 
ATOM   3067 C C   . ILE D 2 58  ? 52.329  7.736  40.979 1.00 44.84  ? 57  ILE D C   1 
ATOM   3068 O O   . ILE D 2 58  ? 52.663  6.889  40.146 1.00 46.68  ? 57  ILE D O   1 
ATOM   3069 C CB  . ILE D 2 58  ? 54.127  7.684  42.596 1.00 38.94  ? 57  ILE D CB  1 
ATOM   3070 C CG1 . ILE D 2 58  ? 54.558  7.464  44.039 1.00 30.68  ? 57  ILE D CG1 1 
ATOM   3071 C CG2 . ILE D 2 58  ? 54.554  9.056  42.071 1.00 34.88  ? 57  ILE D CG2 1 
ATOM   3072 C CD1 . ILE D 2 58  ? 56.001  7.110  44.188 1.00 31.17  ? 57  ILE D CD1 1 
ATOM   3073 N N   . GLU D 2 59  ? 51.781  8.902  40.660 1.00 44.08  ? 58  GLU D N   1 
ATOM   3074 C CA  . GLU D 2 59  ? 51.500  9.276  39.283 1.00 49.54  ? 58  GLU D CA  1 
ATOM   3075 C C   . GLU D 2 59  ? 52.260  10.576 38.987 1.00 49.75  ? 58  GLU D C   1 
ATOM   3076 O O   . GLU D 2 59  ? 52.414  11.426 39.870 1.00 53.61  ? 58  GLU D O   1 
ATOM   3077 C CB  . GLU D 2 59  ? 50.000  9.449  39.052 1.00 44.69  ? 58  GLU D CB  1 
ATOM   3078 C CG  . GLU D 2 59  ? 49.274  8.164  38.715 1.00 52.24  ? 58  GLU D CG  1 
ATOM   3079 C CD  . GLU D 2 59  ? 47.760  8.291  38.832 1.00 62.56  ? 58  GLU D CD  1 
ATOM   3080 O OE1 . GLU D 2 59  ? 47.181  9.336  38.437 1.00 70.99  ? 58  GLU D OE1 1 
ATOM   3081 O OE2 . GLU D 2 59  ? 47.141  7.333  39.337 1.00 62.30  ? 58  GLU D OE2 1 
ATOM   3082 N N   . TYR D 2 60  ? 52.736  10.709 37.749 1.00 47.00  ? 59  TYR D N   1 
ATOM   3083 C CA  . TYR D 2 60  ? 53.508  11.870 37.300 1.00 39.38  ? 59  TYR D CA  1 
ATOM   3084 C C   . TYR D 2 60  ? 52.876  12.557 36.117 1.00 38.13  ? 59  TYR D C   1 
ATOM   3085 O O   . TYR D 2 60  ? 52.033  11.976 35.434 1.00 40.58  ? 59  TYR D O   1 
ATOM   3086 C CB  . TYR D 2 60  ? 54.905  11.443 36.889 1.00 29.90  ? 59  TYR D CB  1 
ATOM   3087 C CG  . TYR D 2 60  ? 55.775  11.013 38.026 1.00 30.18  ? 59  TYR D CG  1 
ATOM   3088 C CD1 . TYR D 2 60  ? 56.228  11.919 38.982 1.00 35.28  ? 59  TYR D CD1 1 
ATOM   3089 C CD2 . TYR D 2 60  ? 56.172  9.702  38.138 1.00 34.18  ? 59  TYR D CD2 1 
ATOM   3090 C CE1 . TYR D 2 60  ? 57.074  11.494 40.037 1.00 34.77  ? 59  TYR D CE1 1 
ATOM   3091 C CE2 . TYR D 2 60  ? 56.997  9.283  39.158 1.00 34.80  ? 59  TYR D CE2 1 
ATOM   3092 C CZ  . TYR D 2 60  ? 57.448  10.173 40.105 1.00 28.93  ? 59  TYR D CZ  1 
ATOM   3093 O OH  . TYR D 2 60  ? 58.268  9.741  41.123 1.00 28.89  ? 59  TYR D OH  1 
ATOM   3094 N N   . ASN D 2 61  ? 53.228  13.822 35.903 1.00 40.03  ? 60  ASN D N   1 
ATOM   3095 C CA  . ASN D 2 61  ? 52.708  14.521 34.735 1.00 49.79  ? 60  ASN D CA  1 
ATOM   3096 C C   . ASN D 2 61  ? 53.584  13.992 33.595 1.00 55.11  ? 60  ASN D C   1 
ATOM   3097 O O   . ASN D 2 61  ? 54.794  14.264 33.567 1.00 50.60  ? 60  ASN D O   1 
ATOM   3098 C CB  . ASN D 2 61  ? 52.854  16.046 34.846 1.00 43.18  ? 60  ASN D CB  1 
ATOM   3099 C CG  . ASN D 2 61  ? 52.412  16.757 33.573 1.00 46.45  ? 60  ASN D CG  1 
ATOM   3100 O OD1 . ASN D 2 61  ? 52.783  16.347 32.469 1.00 53.00  ? 60  ASN D OD1 1 
ATOM   3101 N ND2 . ASN D 2 61  ? 51.593  17.796 33.708 1.00 37.13  ? 60  ASN D ND2 1 
ATOM   3102 N N   . PRO D 2 62  ? 52.993  13.214 32.653 1.00 61.53  ? 61  PRO D N   1 
ATOM   3103 C CA  . PRO D 2 62  ? 53.747  12.651 31.525 1.00 59.71  ? 61  PRO D CA  1 
ATOM   3104 C C   . PRO D 2 62  ? 54.832  13.578 30.984 1.00 59.54  ? 61  PRO D C   1 
ATOM   3105 O O   . PRO D 2 62  ? 56.022  13.236 31.052 1.00 61.40  ? 61  PRO D O   1 
ATOM   3106 C CB  . PRO D 2 62  ? 52.660  12.326 30.490 1.00 54.97  ? 61  PRO D CB  1 
ATOM   3107 C CG  . PRO D 2 62  ? 51.433  13.063 30.974 1.00 60.52  ? 61  PRO D CG  1 
ATOM   3108 C CD  . PRO D 2 62  ? 51.550  12.978 32.466 1.00 60.70  ? 61  PRO D CD  1 
ATOM   3109 N N   . ALA D 2 63  ? 54.438  14.778 30.562 1.00 54.23  ? 62  ALA D N   1 
ATOM   3110 C CA  . ALA D 2 63  ? 55.389  15.758 30.029 1.00 50.73  ? 62  ALA D CA  1 
ATOM   3111 C C   . ALA D 2 63  ? 56.623  16.008 30.902 1.00 48.49  ? 62  ALA D C   1 
ATOM   3112 O O   . ALA D 2 63  ? 57.723  16.057 30.376 1.00 53.69  ? 62  ALA D O   1 
ATOM   3113 C CB  . ALA D 2 63  ? 54.696  17.070 29.716 1.00 47.59  ? 62  ALA D CB  1 
ATOM   3114 N N   . LEU D 2 64  ? 56.465  16.139 32.222 1.00 45.95  ? 63  LEU D N   1 
ATOM   3115 C CA  . LEU D 2 64  ? 57.629  16.383 33.093 1.00 41.26  ? 63  LEU D CA  1 
ATOM   3116 C C   . LEU D 2 64  ? 58.135  15.143 33.821 1.00 37.32  ? 63  LEU D C   1 
ATOM   3117 O O   . LEU D 2 64  ? 59.126  15.208 34.547 1.00 29.84  ? 63  LEU D O   1 
ATOM   3118 C CB  . LEU D 2 64  ? 57.304  17.447 34.129 1.00 43.42  ? 63  LEU D CB  1 
ATOM   3119 C CG  . LEU D 2 64  ? 56.487  18.606 33.589 1.00 45.89  ? 63  LEU D CG  1 
ATOM   3120 C CD1 . LEU D 2 64  ? 55.501  19.011 34.630 1.00 49.57  ? 63  LEU D CD1 1 
ATOM   3121 C CD2 . LEU D 2 64  ? 57.390  19.760 33.223 1.00 46.74  ? 63  LEU D CD2 1 
ATOM   3122 N N   . LYS D 2 65  ? 57.453  14.020 33.620 1.00 36.89  ? 64  LYS D N   1 
ATOM   3123 C CA  . LYS D 2 65  ? 57.793  12.757 34.269 1.00 40.62  ? 64  LYS D CA  1 
ATOM   3124 C C   . LYS D 2 65  ? 59.263  12.368 34.238 1.00 43.32  ? 64  LYS D C   1 
ATOM   3125 O O   . LYS D 2 65  ? 59.757  11.717 35.165 1.00 39.42  ? 64  LYS D O   1 
ATOM   3126 C CB  . LYS D 2 65  ? 56.956  11.640 33.668 1.00 41.79  ? 64  LYS D CB  1 
ATOM   3127 C CG  . LYS D 2 65  ? 57.261  10.246 34.170 1.00 36.73  ? 64  LYS D CG  1 
ATOM   3128 C CD  . LYS D 2 65  ? 56.078  9.340  33.796 1.00 50.57  ? 64  LYS D CD  1 
ATOM   3129 C CE  . LYS D 2 65  ? 56.475  7.869  33.589 1.00 57.97  ? 64  LYS D CE  1 
ATOM   3130 N NZ  . LYS D 2 65  ? 55.691  7.230  32.462 1.00 59.56  ? 64  LYS D NZ  1 
ATOM   3131 N N   . SER D 2 66  ? 59.951  12.823 33.191 1.00 46.90  ? 65  SER D N   1 
ATOM   3132 C CA  . SER D 2 66  ? 61.371  12.544 32.942 1.00 49.67  ? 65  SER D CA  1 
ATOM   3133 C C   . SER D 2 66  ? 62.362  13.173 33.914 1.00 50.42  ? 65  SER D C   1 
ATOM   3134 O O   . SER D 2 66  ? 63.472  12.660 34.106 1.00 46.60  ? 65  SER D O   1 
ATOM   3135 C CB  . SER D 2 66  ? 61.723  13.004 31.526 1.00 47.13  ? 65  SER D CB  1 
ATOM   3136 O OG  . SER D 2 66  ? 61.139  14.272 31.274 1.00 48.56  ? 65  SER D OG  1 
ATOM   3137 N N   . ARG D 2 67  ? 61.967  14.305 34.487 1.00 50.83  ? 66  ARG D N   1 
ATOM   3138 C CA  . ARG D 2 67  ? 62.814  15.054 35.412 1.00 50.64  ? 66  ARG D CA  1 
ATOM   3139 C C   . ARG D 2 67  ? 62.248  14.982 36.833 1.00 50.95  ? 66  ARG D C   1 
ATOM   3140 O O   . ARG D 2 67  ? 62.966  15.215 37.815 1.00 53.06  ? 66  ARG D O   1 
ATOM   3141 C CB  . ARG D 2 67  ? 62.859  16.525 34.977 1.00 48.83  ? 66  ARG D CB  1 
ATOM   3142 C CG  . ARG D 2 67  ? 62.776  16.760 33.460 1.00 50.57  ? 66  ARG D CG  1 
ATOM   3143 C CD  . ARG D 2 67  ? 62.106  18.086 33.097 1.00 44.60  ? 66  ARG D CD  1 
ATOM   3144 N NE  . ARG D 2 67  ? 62.706  19.174 33.852 1.00 45.54  ? 66  ARG D NE  1 
ATOM   3145 C CZ  . ARG D 2 67  ? 62.162  20.374 34.032 1.00 43.92  ? 66  ARG D CZ  1 
ATOM   3146 N NH1 . ARG D 2 67  ? 60.981  20.694 33.505 1.00 44.77  ? 66  ARG D NH1 1 
ATOM   3147 N NH2 . ARG D 2 67  ? 62.789  21.243 34.798 1.00 40.53  ? 66  ARG D NH2 1 
ATOM   3148 N N   . LEU D 2 68  ? 60.971  14.639 36.935 1.00 47.68  ? 67  LEU D N   1 
ATOM   3149 C CA  . LEU D 2 68  ? 60.296  14.574 38.217 1.00 45.59  ? 67  LEU D CA  1 
ATOM   3150 C C   . LEU D 2 68  ? 60.489  13.331 39.023 1.00 44.70  ? 67  LEU D C   1 
ATOM   3151 O O   . LEU D 2 68  ? 60.558  12.217 38.484 1.00 44.20  ? 67  LEU D O   1 
ATOM   3152 C CB  . LEU D 2 68  ? 58.803  14.752 38.033 1.00 46.48  ? 67  LEU D CB  1 
ATOM   3153 C CG  . LEU D 2 68  ? 58.369  16.176 37.776 1.00 47.23  ? 67  LEU D CG  1 
ATOM   3154 C CD1 . LEU D 2 68  ? 56.877  16.176 37.560 1.00 40.39  ? 67  LEU D CD1 1 
ATOM   3155 C CD2 . LEU D 2 68  ? 58.792  17.030 38.964 1.00 43.77  ? 67  LEU D CD2 1 
ATOM   3156 N N   . SER D 2 69  ? 60.401  13.542 40.330 1.00 43.53  ? 68  SER D N   1 
ATOM   3157 C CA  . SER D 2 69  ? 60.498  12.488 41.326 1.00 41.98  ? 68  SER D CA  1 
ATOM   3158 C C   . SER D 2 69  ? 59.655  12.886 42.535 1.00 43.48  ? 68  SER D C   1 
ATOM   3159 O O   . SER D 2 69  ? 59.822  13.992 43.087 1.00 46.41  ? 68  SER D O   1 
ATOM   3160 C CB  . SER D 2 69  ? 61.935  12.280 41.750 1.00 34.10  ? 68  SER D CB  1 
ATOM   3161 O OG  . SER D 2 69  ? 61.964  11.313 42.770 1.00 37.61  ? 68  SER D OG  1 
ATOM   3162 N N   . ILE D 2 70  ? 58.807  11.953 42.973 1.00 46.06  ? 69  ILE D N   1 
ATOM   3163 C CA  . ILE D 2 70  ? 57.908  12.190 44.110 1.00 43.00  ? 69  ILE D CA  1 
ATOM   3164 C C   . ILE D 2 70  ? 57.936  11.010 45.079 1.00 37.83  ? 69  ILE D C   1 
ATOM   3165 O O   . ILE D 2 70  ? 57.994  9.860  44.658 1.00 42.13  ? 69  ILE D O   1 
ATOM   3166 C CB  . ILE D 2 70  ? 56.459  12.398 43.623 1.00 40.82  ? 69  ILE D CB  1 
ATOM   3167 C CG1 . ILE D 2 70  ? 56.375  13.640 42.741 1.00 34.30  ? 69  ILE D CG1 1 
ATOM   3168 C CG2 . ILE D 2 70  ? 55.506  12.477 44.801 1.00 42.08  ? 69  ILE D CG2 1 
ATOM   3169 C CD1 . ILE D 2 70  ? 54.992  13.949 42.223 1.00 37.32  ? 69  ILE D CD1 1 
ATOM   3170 N N   . SER D 2 71  ? 57.926  11.302 46.369 1.00 36.89  ? 70  SER D N   1 
ATOM   3171 C CA  . SER D 2 71  ? 57.944  10.268 47.395 1.00 40.01  ? 70  SER D CA  1 
ATOM   3172 C C   . SER D 2 71  ? 57.315  10.840 48.677 1.00 43.81  ? 70  SER D C   1 
ATOM   3173 O O   . SER D 2 71  ? 56.859  11.991 48.686 1.00 45.78  ? 70  SER D O   1 
ATOM   3174 C CB  . SER D 2 71  ? 59.376  9.785  47.639 1.00 29.05  ? 70  SER D CB  1 
ATOM   3175 O OG  . SER D 2 71  ? 60.207  10.828 48.110 1.00 35.04  ? 70  SER D OG  1 
ATOM   3176 N N   . LYS D 2 72  ? 57.218  10.029 49.730 1.00 43.19  ? 71  LYS D N   1 
ATOM   3177 C CA  . LYS D 2 72  ? 56.652  10.491 51.001 1.00 43.51  ? 71  LYS D CA  1 
ATOM   3178 C C   . LYS D 2 72  ? 57.101  9.653  52.178 1.00 40.87  ? 71  LYS D C   1 
ATOM   3179 O O   . LYS D 2 72  ? 57.598  8.550  52.006 1.00 43.37  ? 71  LYS D O   1 
ATOM   3180 C CB  . LYS D 2 72  ? 55.109  10.569 50.963 1.00 42.34  ? 71  LYS D CB  1 
ATOM   3181 C CG  . LYS D 2 72  ? 54.325  9.276  51.230 1.00 38.75  ? 71  LYS D CG  1 
ATOM   3182 C CD  . LYS D 2 72  ? 52.842  9.587  51.029 1.00 42.75  ? 71  LYS D CD  1 
ATOM   3183 C CE  . LYS D 2 72  ? 51.895  8.404  51.245 1.00 43.97  ? 71  LYS D CE  1 
ATOM   3184 N NZ  . LYS D 2 72  ? 50.479  8.856  51.031 1.00 44.08  ? 71  LYS D NZ  1 
ATOM   3185 N N   . ASP D 2 73  ? 56.908  10.195 53.372 1.00 44.57  ? 72  ASP D N   1 
ATOM   3186 C CA  . ASP D 2 73  ? 57.281  9.545  54.613 1.00 39.50  ? 72  ASP D CA  1 
ATOM   3187 C C   . ASP D 2 73  ? 56.114  9.657  55.566 1.00 41.25  ? 72  ASP D C   1 
ATOM   3188 O O   . ASP D 2 73  ? 55.943  10.704 56.196 1.00 39.10  ? 72  ASP D O   1 
ATOM   3189 C CB  . ASP D 2 73  ? 58.460  10.293 55.214 1.00 45.08  ? 72  ASP D CB  1 
ATOM   3190 C CG  . ASP D 2 73  ? 58.977  9.658  56.484 1.00 50.15  ? 72  ASP D CG  1 
ATOM   3191 O OD1 . ASP D 2 73  ? 58.250  8.854  57.114 1.00 54.96  ? 72  ASP D OD1 1 
ATOM   3192 O OD2 . ASP D 2 73  ? 60.128  9.963  56.851 1.00 48.44  ? 72  ASP D OD2 1 
ATOM   3193 N N   . ASN D 2 74  ? 55.367  8.569  55.743 1.00 41.50  ? 73  ASN D N   1 
ATOM   3194 C CA  . ASN D 2 74  ? 54.220  8.595  56.647 1.00 42.82  ? 73  ASN D CA  1 
ATOM   3195 C C   . ASN D 2 74  ? 54.554  8.880  58.105 1.00 43.14  ? 73  ASN D C   1 
ATOM   3196 O O   . ASN D 2 74  ? 53.874  9.671  58.747 1.00 48.67  ? 73  ASN D O   1 
ATOM   3197 C CB  . ASN D 2 74  ? 53.413  7.300  56.559 1.00 46.71  ? 73  ASN D CB  1 
ATOM   3198 C CG  . ASN D 2 74  ? 52.527  7.259  55.343 1.00 57.74  ? 73  ASN D CG  1 
ATOM   3199 O OD1 . ASN D 2 74  ? 51.771  8.186  55.091 1.00 68.37  ? 73  ASN D OD1 1 
ATOM   3200 N ND2 . ASN D 2 74  ? 52.621  6.189  54.572 1.00 67.69  ? 73  ASN D ND2 1 
ATOM   3201 N N   . SER D 2 75  ? 55.617  8.278  58.629 1.00 42.16  ? 74  SER D N   1 
ATOM   3202 C CA  . SER D 2 75  ? 55.965  8.499  60.027 1.00 39.70  ? 74  SER D CA  1 
ATOM   3203 C C   . SER D 2 75  ? 56.199  9.948  60.341 1.00 37.13  ? 74  SER D C   1 
ATOM   3204 O O   . SER D 2 75  ? 56.036  10.375 61.473 1.00 41.16  ? 74  SER D O   1 
ATOM   3205 C CB  . SER D 2 75  ? 57.178  7.648  60.465 1.00 47.61  ? 74  SER D CB  1 
ATOM   3206 O OG  . SER D 2 75  ? 58.238  7.624  59.506 1.00 57.59  ? 74  SER D OG  1 
ATOM   3207 N N   . LYS D 2 76  ? 56.595  10.710 59.331 1.00 37.25  ? 75  LYS D N   1 
ATOM   3208 C CA  . LYS D 2 76  ? 56.862  12.126 59.512 1.00 34.75  ? 75  LYS D CA  1 
ATOM   3209 C C   . LYS D 2 76  ? 55.835  13.017 58.833 1.00 34.47  ? 75  LYS D C   1 
ATOM   3210 O O   . LYS D 2 76  ? 55.913  14.246 58.907 1.00 32.46  ? 75  LYS D O   1 
ATOM   3211 C CB  . LYS D 2 76  ? 58.234  12.458 58.984 1.00 26.17  ? 75  LYS D CB  1 
ATOM   3212 C CG  . LYS D 2 76  ? 59.323  12.055 59.879 1.00 31.09  ? 75  LYS D CG  1 
ATOM   3213 C CD  . LYS D 2 76  ? 60.554  12.782 59.442 1.00 35.10  ? 75  LYS D CD  1 
ATOM   3214 C CE  . LYS D 2 76  ? 61.597  12.780 60.518 1.00 43.99  ? 75  LYS D CE  1 
ATOM   3215 N NZ  . LYS D 2 76  ? 62.684  13.738 60.163 1.00 54.69  ? 75  LYS D NZ  1 
ATOM   3216 N N   . SER D 2 77  ? 54.898  12.390 58.140 1.00 36.82  ? 76  SER D N   1 
ATOM   3217 C CA  . SER D 2 77  ? 53.846  13.105 57.435 1.00 41.16  ? 76  SER D CA  1 
ATOM   3218 C C   . SER D 2 77  ? 54.386  14.186 56.490 1.00 41.70  ? 76  SER D C   1 
ATOM   3219 O O   . SER D 2 77  ? 53.926  15.328 56.503 1.00 42.12  ? 76  SER D O   1 
ATOM   3220 C CB  . SER D 2 77  ? 52.825  13.665 58.430 1.00 40.09  ? 76  SER D CB  1 
ATOM   3221 O OG  . SER D 2 77  ? 51.976  12.637 58.949 1.00 52.44  ? 76  SER D OG  1 
ATOM   3222 N N   . GLN D 2 78  ? 55.355  13.796 55.656 1.00 41.71  ? 77  GLN D N   1 
ATOM   3223 C CA  . GLN D 2 78  ? 55.967  14.695 54.676 1.00 37.01  ? 77  GLN D CA  1 
ATOM   3224 C C   . GLN D 2 78  ? 55.936  14.117 53.276 1.00 36.83  ? 77  GLN D C   1 
ATOM   3225 O O   . GLN D 2 78  ? 56.165  12.928 53.080 1.00 39.70  ? 77  GLN D O   1 
ATOM   3226 C CB  . GLN D 2 78  ? 57.407  15.006 55.054 1.00 31.31  ? 77  GLN D CB  1 
ATOM   3227 C CG  . GLN D 2 78  ? 57.501  15.731 56.357 1.00 35.80  ? 77  GLN D CG  1 
ATOM   3228 C CD  . GLN D 2 78  ? 58.900  16.094 56.744 1.00 34.20  ? 77  GLN D CD  1 
ATOM   3229 O OE1 . GLN D 2 78  ? 59.758  15.231 56.957 1.00 37.52  ? 77  GLN D OE1 1 
ATOM   3230 N NE2 . GLN D 2 78  ? 59.133  17.381 56.880 1.00 33.11  ? 77  GLN D NE2 1 
ATOM   3231 N N   . ILE D 2 79  ? 55.655  14.975 52.308 1.00 39.25  ? 78  ILE D N   1 
ATOM   3232 C CA  . ILE D 2 79  ? 55.606  14.602 50.900 1.00 40.34  ? 78  ILE D CA  1 
ATOM   3233 C C   . ILE D 2 79  ? 56.761  15.348 50.206 1.00 44.44  ? 78  ILE D C   1 
ATOM   3234 O O   . ILE D 2 79  ? 57.040  16.497 50.525 1.00 45.06  ? 78  ILE D O   1 
ATOM   3235 C CB  . ILE D 2 79  ? 54.261  14.994 50.280 1.00 37.62  ? 78  ILE D CB  1 
ATOM   3236 C CG1 . ILE D 2 79  ? 53.106  14.362 51.069 1.00 41.39  ? 78  ILE D CG1 1 
ATOM   3237 C CG2 . ILE D 2 79  ? 54.189  14.528 48.863 1.00 36.47  ? 78  ILE D CG2 1 
ATOM   3238 C CD1 . ILE D 2 79  ? 52.816  15.038 52.408 1.00 41.08  ? 78  ILE D CD1 1 
ATOM   3239 N N   . PHE D 2 80  ? 57.426  14.707 49.251 1.00 47.57  ? 79  PHE D N   1 
ATOM   3240 C CA  . PHE D 2 80  ? 58.576  15.306 48.585 1.00 44.31  ? 79  PHE D CA  1 
ATOM   3241 C C   . PHE D 2 80  ? 58.444  15.488 47.086 1.00 48.57  ? 79  PHE D C   1 
ATOM   3242 O O   . PHE D 2 80  ? 57.609  14.849 46.447 1.00 51.17  ? 79  PHE D O   1 
ATOM   3243 C CB  . PHE D 2 80  ? 59.773  14.424 48.842 1.00 38.87  ? 79  PHE D CB  1 
ATOM   3244 C CG  . PHE D 2 80  ? 59.973  14.110 50.284 1.00 47.46  ? 79  PHE D CG  1 
ATOM   3245 C CD1 . PHE D 2 80  ? 60.413  15.094 51.164 1.00 45.97  ? 79  PHE D CD1 1 
ATOM   3246 C CD2 . PHE D 2 80  ? 59.687  12.841 50.780 1.00 48.58  ? 79  PHE D CD2 1 
ATOM   3247 C CE1 . PHE D 2 80  ? 60.565  14.830 52.518 1.00 46.79  ? 79  PHE D CE1 1 
ATOM   3248 C CE2 . PHE D 2 80  ? 59.836  12.562 52.139 1.00 50.18  ? 79  PHE D CE2 1 
ATOM   3249 C CZ  . PHE D 2 80  ? 60.277  13.560 53.011 1.00 48.24  ? 79  PHE D CZ  1 
ATOM   3250 N N   . LEU D 2 81  ? 59.270  16.368 46.530 1.00 47.84  ? 80  LEU D N   1 
ATOM   3251 C CA  . LEU D 2 81  ? 59.298  16.597 45.088 1.00 43.48  ? 80  LEU D CA  1 
ATOM   3252 C C   . LEU D 2 81  ? 60.710  16.970 44.670 1.00 43.37  ? 80  LEU D C   1 
ATOM   3253 O O   . LEU D 2 81  ? 61.432  17.649 45.404 1.00 40.56  ? 80  LEU D O   1 
ATOM   3254 C CB  . LEU D 2 81  ? 58.335  17.687 44.674 1.00 42.13  ? 80  LEU D CB  1 
ATOM   3255 C CG  . LEU D 2 81  ? 58.490  18.032 43.205 1.00 37.05  ? 80  LEU D CG  1 
ATOM   3256 C CD1 . LEU D 2 81  ? 57.340  17.519 42.388 1.00 31.68  ? 80  LEU D CD1 1 
ATOM   3257 C CD2 . LEU D 2 81  ? 58.549  19.523 43.126 1.00 48.48  ? 80  LEU D CD2 1 
ATOM   3258 N N   . LYS D 2 82  ? 61.120  16.451 43.526 1.00 42.71  ? 81  LYS D N   1 
ATOM   3259 C CA  . LYS D 2 82  ? 62.438  16.716 42.986 1.00 44.20  ? 81  LYS D CA  1 
ATOM   3260 C C   . LYS D 2 82  ? 62.295  16.881 41.471 1.00 42.29  ? 81  LYS D C   1 
ATOM   3261 O O   . LYS D 2 82  ? 61.740  16.011 40.784 1.00 46.95  ? 81  LYS D O   1 
ATOM   3262 C CB  . LYS D 2 82  ? 63.387  15.559 43.311 1.00 49.20  ? 81  LYS D CB  1 
ATOM   3263 C CG  . LYS D 2 82  ? 64.848  15.892 43.069 1.00 64.91  ? 81  LYS D CG  1 
ATOM   3264 C CD  . LYS D 2 82  ? 65.673  14.648 42.727 1.00 76.01  ? 81  LYS D CD  1 
ATOM   3265 C CE  . LYS D 2 82  ? 67.183  14.962 42.636 1.00 75.43  ? 81  LYS D CE  1 
ATOM   3266 N NZ  . LYS D 2 82  ? 67.771  15.320 43.969 1.00 68.63  ? 81  LYS D NZ  1 
ATOM   3267 N N   . MET D 2 83  ? 62.694  18.044 40.971 1.00 39.07  ? 82  MET D N   1 
ATOM   3268 C CA  . MET D 2 83  ? 62.624  18.332 39.550 1.00 37.00  ? 82  MET D CA  1 
ATOM   3269 C C   . MET D 2 83  ? 64.033  18.681 39.116 1.00 45.59  ? 82  MET D C   1 
ATOM   3270 O O   . MET D 2 83  ? 64.618  19.651 39.608 1.00 49.31  ? 82  MET D O   1 
ATOM   3271 C CB  . MET D 2 83  ? 61.691  19.486 39.279 1.00 32.43  ? 82  MET D CB  1 
ATOM   3272 C CG  . MET D 2 83  ? 61.570  19.811 37.820 1.00 39.31  ? 82  MET D CG  1 
ATOM   3273 S SD  . MET D 2 83  ? 60.344  21.096 37.520 1.00 53.69  ? 82  MET D SD  1 
ATOM   3274 C CE  . MET D 2 83  ? 60.969  22.381 38.512 1.00 49.85  ? 82  MET D CE  1 
ATOM   3275 N N   . ASN D 2 84  A 64.586  17.849 38.231 1.00 52.38  ? 82  ASN D N   1 
ATOM   3276 C CA  . ASN D 2 84  A 65.947  17.996 37.725 1.00 50.09  ? 82  ASN D CA  1 
ATOM   3277 C C   . ASN D 2 84  A 66.148  18.912 36.544 1.00 50.81  ? 82  ASN D C   1 
ATOM   3278 O O   . ASN D 2 84  A 65.188  19.285 35.841 1.00 40.95  ? 82  ASN D O   1 
ATOM   3279 C CB  . ASN D 2 84  A 66.562  16.623 37.446 1.00 52.32  ? 82  ASN D CB  1 
ATOM   3280 C CG  . ASN D 2 84  A 66.850  15.867 38.729 1.00 64.49  ? 82  ASN D CG  1 
ATOM   3281 O OD1 . ASN D 2 84  A 67.829  16.154 39.433 1.00 59.82  ? 82  ASN D OD1 1 
ATOM   3282 N ND2 . ASN D 2 84  A 65.940  14.965 39.098 1.00 69.79  ? 82  ASN D ND2 1 
ATOM   3283 N N   . SER D 2 85  B 67.408  19.335 36.407 1.00 52.34  ? 82  SER D N   1 
ATOM   3284 C CA  . SER D 2 85  B 67.854  20.213 35.333 1.00 51.88  ? 82  SER D CA  1 
ATOM   3285 C C   . SER D 2 85  B 66.824  21.315 35.106 1.00 47.13  ? 82  SER D C   1 
ATOM   3286 O O   . SER D 2 85  B 66.088  21.331 34.118 1.00 40.57  ? 82  SER D O   1 
ATOM   3287 C CB  . SER D 2 85  B 68.143  19.380 34.086 1.00 56.52  ? 82  SER D CB  1 
ATOM   3288 O OG  . SER D 2 85  B 68.994  18.285 34.439 1.00 58.01  ? 82  SER D OG  1 
ATOM   3289 N N   . LEU D 2 86  C 66.748  22.191 36.103 1.00 46.59  ? 82  LEU D N   1 
ATOM   3290 C CA  . LEU D 2 86  C 65.828  23.301 36.105 1.00 45.26  ? 82  LEU D CA  1 
ATOM   3291 C C   . LEU D 2 86  C 66.172  24.287 35.032 1.00 47.44  ? 82  LEU D C   1 
ATOM   3292 O O   . LEU D 2 86  C 67.332  24.417 34.648 1.00 54.31  ? 82  LEU D O   1 
ATOM   3293 C CB  . LEU D 2 86  C 65.974  24.081 37.412 1.00 45.35  ? 82  LEU D CB  1 
ATOM   3294 C CG  . LEU D 2 86  C 65.712  23.465 38.766 1.00 45.80  ? 82  LEU D CG  1 
ATOM   3295 C CD1 . LEU D 2 86  C 66.130  24.464 39.793 1.00 41.10  ? 82  LEU D CD1 1 
ATOM   3296 C CD2 . LEU D 2 86  C 64.241  23.146 38.912 1.00 48.55  ? 82  LEU D CD2 1 
ATOM   3297 N N   . GLN D 2 87  ? 65.158  24.999 34.580 1.00 45.58  ? 83  GLN D N   1 
ATOM   3298 C CA  . GLN D 2 87  ? 65.350  26.058 33.630 1.00 49.92  ? 83  GLN D CA  1 
ATOM   3299 C C   . GLN D 2 87  ? 64.527  27.243 34.140 1.00 48.68  ? 83  GLN D C   1 
ATOM   3300 O O   . GLN D 2 87  ? 63.793  27.133 35.113 1.00 49.53  ? 83  GLN D O   1 
ATOM   3301 C CB  . GLN D 2 87  ? 65.023  25.652 32.199 1.00 58.32  ? 83  GLN D CB  1 
ATOM   3302 C CG  . GLN D 2 87  ? 65.531  26.682 31.110 1.00 79.62  ? 83  GLN D CG  1 
ATOM   3303 C CD  . GLN D 2 87  ? 66.868  27.379 31.482 1.00 86.75  ? 83  GLN D CD  1 
ATOM   3304 O OE1 . GLN D 2 87  ? 67.643  26.874 32.296 1.00 91.01  ? 83  GLN D OE1 1 
ATOM   3305 N NE2 . GLN D 2 87  ? 67.123  28.552 30.885 1.00 87.91  ? 83  GLN D NE2 1 
ATOM   3306 N N   . THR D 2 88  ? 64.661  28.385 33.507 1.00 48.18  ? 84  THR D N   1 
ATOM   3307 C CA  . THR D 2 88  ? 63.984  29.575 33.953 1.00 51.24  ? 84  THR D CA  1 
ATOM   3308 C C   . THR D 2 88  ? 62.473  29.606 33.821 1.00 53.18  ? 84  THR D C   1 
ATOM   3309 O O   . THR D 2 88  ? 61.806  30.443 34.447 1.00 50.68  ? 84  THR D O   1 
ATOM   3310 C CB  . THR D 2 88  ? 64.622  30.794 33.286 1.00 57.30  ? 84  THR D CB  1 
ATOM   3311 O OG1 . THR D 2 88  ? 64.626  30.598 31.855 1.00 61.21  ? 84  THR D OG1 1 
ATOM   3312 C CG2 . THR D 2 88  ? 66.083  30.973 33.815 1.00 47.33  ? 84  THR D CG2 1 
ATOM   3313 N N   . ASP D 2 89  ? 61.927  28.706 33.009 1.00 57.83  ? 85  ASP D N   1 
ATOM   3314 C CA  . ASP D 2 89  ? 60.475  28.636 32.815 1.00 60.58  ? 85  ASP D CA  1 
ATOM   3315 C C   . ASP D 2 89  ? 59.844  27.839 33.962 1.00 55.33  ? 85  ASP D C   1 
ATOM   3316 O O   . ASP D 2 89  ? 58.622  27.750 34.071 1.00 55.69  ? 85  ASP D O   1 
ATOM   3317 C CB  . ASP D 2 89  ? 60.138  27.995 31.472 1.00 67.85  ? 85  ASP D CB  1 
ATOM   3318 C CG  . ASP D 2 89  ? 60.812  26.645 31.289 1.00 82.32  ? 85  ASP D CG  1 
ATOM   3319 O OD1 . ASP D 2 89  ? 62.046  26.634 31.079 1.00 91.25  ? 85  ASP D OD1 1 
ATOM   3320 O OD2 . ASP D 2 89  ? 60.112  25.606 31.377 1.00 90.46  ? 85  ASP D OD2 1 
ATOM   3321 N N   . ASP D 2 90  ? 60.696  27.249 34.795 1.00 50.06  ? 86  ASP D N   1 
ATOM   3322 C CA  . ASP D 2 90  ? 60.276  26.460 35.944 1.00 44.50  ? 86  ASP D CA  1 
ATOM   3323 C C   . ASP D 2 90  ? 59.888  27.284 37.163 1.00 41.40  ? 86  ASP D C   1 
ATOM   3324 O O   . ASP D 2 90  ? 59.417  26.733 38.142 1.00 42.62  ? 86  ASP D O   1 
ATOM   3325 C CB  . ASP D 2 90  ? 61.381  25.511 36.356 1.00 42.73  ? 86  ASP D CB  1 
ATOM   3326 C CG  . ASP D 2 90  ? 61.453  24.277 35.492 1.00 50.93  ? 86  ASP D CG  1 
ATOM   3327 O OD1 . ASP D 2 90  ? 60.444  23.894 34.837 1.00 55.62  ? 86  ASP D OD1 1 
ATOM   3328 O OD2 . ASP D 2 90  ? 62.537  23.667 35.512 1.00 49.58  ? 86  ASP D OD2 1 
ATOM   3329 N N   . SER D 2 91  ? 60.190  28.571 37.162 1.00 43.99  ? 87  SER D N   1 
ATOM   3330 C CA  . SER D 2 91  ? 59.800  29.417 38.284 1.00 46.25  ? 87  SER D CA  1 
ATOM   3331 C C   . SER D 2 91  ? 58.268  29.404 38.404 1.00 46.05  ? 87  SER D C   1 
ATOM   3332 O O   . SER D 2 91  ? 57.556  29.528 37.400 1.00 40.93  ? 87  SER D O   1 
ATOM   3333 C CB  . SER D 2 91  ? 60.272  30.860 38.077 1.00 44.63  ? 87  SER D CB  1 
ATOM   3334 O OG  . SER D 2 91  ? 61.678  30.963 38.164 1.00 50.21  ? 87  SER D OG  1 
ATOM   3335 N N   . ALA D 2 92  ? 57.779  29.245 39.634 1.00 43.44  ? 88  ALA D N   1 
ATOM   3336 C CA  . ALA D 2 92  ? 56.350  29.231 39.928 1.00 37.99  ? 88  ALA D CA  1 
ATOM   3337 C C   . ALA D 2 92  ? 56.178  29.043 41.407 1.00 36.53  ? 88  ALA D C   1 
ATOM   3338 O O   . ALA D 2 92  ? 57.141  28.821 42.135 1.00 39.72  ? 88  ALA D O   1 
ATOM   3339 C CB  . ALA D 2 92  ? 55.641  28.089 39.193 1.00 27.26  ? 88  ALA D CB  1 
ATOM   3340 N N   . MET D 2 93  ? 54.940  29.159 41.849 1.00 38.80  ? 89  MET D N   1 
ATOM   3341 C CA  . MET D 2 93  ? 54.604  28.934 43.234 1.00 34.14  ? 89  MET D CA  1 
ATOM   3342 C C   . MET D 2 93  ? 54.235  27.453 43.268 1.00 32.35  ? 89  MET D C   1 
ATOM   3343 O O   . MET D 2 93  ? 53.372  27.015 42.516 1.00 34.07  ? 89  MET D O   1 
ATOM   3344 C CB  . MET D 2 93  ? 53.397  29.777 43.626 1.00 34.57  ? 89  MET D CB  1 
ATOM   3345 C CG  . MET D 2 93  ? 52.975  29.563 45.058 1.00 37.87  ? 89  MET D CG  1 
ATOM   3346 S SD  . MET D 2 93  ? 54.031  30.416 46.243 1.00 34.77  ? 89  MET D SD  1 
ATOM   3347 C CE  . MET D 2 93  ? 53.368  31.984 46.139 1.00 23.80  ? 89  MET D CE  1 
ATOM   3348 N N   . TYR D 2 94  ? 54.987  26.672 44.028 1.00 31.20  ? 90  TYR D N   1 
ATOM   3349 C CA  . TYR D 2 94  ? 54.732  25.247 44.155 1.00 31.94  ? 90  TYR D CA  1 
ATOM   3350 C C   . TYR D 2 94  ? 53.809  24.984 45.336 1.00 33.90  ? 90  TYR D C   1 
ATOM   3351 O O   . TYR D 2 94  ? 53.981  25.567 46.422 1.00 32.18  ? 90  TYR D O   1 
ATOM   3352 C CB  . TYR D 2 94  ? 56.035  24.492 44.307 1.00 32.51  ? 90  TYR D CB  1 
ATOM   3353 C CG  . TYR D 2 94  ? 56.784  24.420 43.021 1.00 33.29  ? 90  TYR D CG  1 
ATOM   3354 C CD1 . TYR D 2 94  ? 57.336  25.559 42.452 1.00 40.73  ? 90  TYR D CD1 1 
ATOM   3355 C CD2 . TYR D 2 94  ? 56.899  23.221 42.340 1.00 37.97  ? 90  TYR D CD2 1 
ATOM   3356 C CE1 . TYR D 2 94  ? 57.986  25.507 41.228 1.00 40.50  ? 90  TYR D CE1 1 
ATOM   3357 C CE2 . TYR D 2 94  ? 57.540  23.152 41.127 1.00 41.66  ? 90  TYR D CE2 1 
ATOM   3358 C CZ  . TYR D 2 94  ? 58.086  24.294 40.574 1.00 45.89  ? 90  TYR D CZ  1 
ATOM   3359 O OH  . TYR D 2 94  ? 58.767  24.204 39.387 1.00 43.65  ? 90  TYR D OH  1 
ATOM   3360 N N   . TYR D 2 95  ? 52.846  24.093 45.122 1.00 35.57  ? 91  TYR D N   1 
ATOM   3361 C CA  . TYR D 2 95  ? 51.859  23.718 46.117 1.00 34.00  ? 91  TYR D CA  1 
ATOM   3362 C C   . TYR D 2 95  ? 51.637  22.205 46.248 1.00 37.04  ? 91  TYR D C   1 
ATOM   3363 O O   . TYR D 2 95  ? 51.835  21.463 45.278 1.00 31.62  ? 91  TYR D O   1 
ATOM   3364 C CB  . TYR D 2 95  ? 50.475  24.244 45.675 1.00 27.95  ? 91  TYR D CB  1 
ATOM   3365 C CG  . TYR D 2 95  ? 50.256  25.729 45.623 1.00 26.10  ? 91  TYR D CG  1 
ATOM   3366 C CD1 . TYR D 2 95  ? 50.084  26.462 46.794 1.00 24.22  ? 91  TYR D CD1 1 
ATOM   3367 C CD2 . TYR D 2 95  ? 50.045  26.373 44.406 1.00 21.22  ? 91  TYR D CD2 1 
ATOM   3368 C CE1 . TYR D 2 95  ? 49.683  27.775 46.746 1.00 25.61  ? 91  TYR D CE1 1 
ATOM   3369 C CE2 . TYR D 2 95  ? 49.647  27.695 44.354 1.00 24.62  ? 91  TYR D CE2 1 
ATOM   3370 C CZ  . TYR D 2 95  ? 49.458  28.385 45.536 1.00 26.08  ? 91  TYR D CZ  1 
ATOM   3371 O OH  . TYR D 2 95  ? 48.990  29.668 45.522 1.00 26.90  ? 91  TYR D OH  1 
ATOM   3372 N N   . CYS D 2 96  ? 51.301  21.758 47.469 1.00 41.48  ? 92  CYS D N   1 
ATOM   3373 C CA  . CYS D 2 96  ? 50.879  20.363 47.689 1.00 39.81  ? 92  CYS D CA  1 
ATOM   3374 C C   . CYS D 2 96  ? 49.408  20.560 48.064 1.00 37.56  ? 92  CYS D C   1 
ATOM   3375 O O   . CYS D 2 96  ? 49.046  21.595 48.650 1.00 29.05  ? 92  CYS D O   1 
ATOM   3376 C CB  . CYS D 2 96  ? 51.657  19.631 48.774 1.00 36.96  ? 92  CYS D CB  1 
ATOM   3377 S SG  . CYS D 2 96  ? 51.849  20.555 50.319 1.00 50.50  ? 92  CYS D SG  1 
ATOM   3378 N N   . VAL D 2 97  ? 48.546  19.682 47.567 1.00 36.73  ? 93  VAL D N   1 
ATOM   3379 C CA  . VAL D 2 97  ? 47.124  19.749 47.836 1.00 35.69  ? 93  VAL D CA  1 
ATOM   3380 C C   . VAL D 2 97  ? 46.738  18.348 48.224 1.00 35.54  ? 93  VAL D C   1 
ATOM   3381 O O   . VAL D 2 97  ? 47.155  17.401 47.572 1.00 35.15  ? 93  VAL D O   1 
ATOM   3382 C CB  . VAL D 2 97  ? 46.329  20.087 46.579 1.00 38.59  ? 93  VAL D CB  1 
ATOM   3383 C CG1 . VAL D 2 97  ? 44.863  20.369 46.945 1.00 42.14  ? 93  VAL D CG1 1 
ATOM   3384 C CG2 . VAL D 2 97  ? 46.960  21.268 45.873 1.00 34.67  ? 93  VAL D CG2 1 
ATOM   3385 N N   . SER D 2 98  ? 45.996  18.203 49.313 1.00 37.08  ? 94  SER D N   1 
ATOM   3386 C CA  . SER D 2 98  ? 45.592  16.870 49.747 1.00 38.78  ? 94  SER D CA  1 
ATOM   3387 C C   . SER D 2 98  ? 44.092  16.718 49.662 1.00 40.27  ? 94  SER D C   1 
ATOM   3388 O O   . SER D 2 98  ? 43.347  17.708 49.795 1.00 37.92  ? 94  SER D O   1 
ATOM   3389 C CB  . SER D 2 98  ? 46.082  16.572 51.158 1.00 33.02  ? 94  SER D CB  1 
ATOM   3390 O OG  . SER D 2 98  ? 45.577  17.534 52.052 1.00 45.24  ? 94  SER D OG  1 
ATOM   3391 N N   . TYR D 2 99  ? 43.675  15.487 49.362 1.00 42.73  ? 95  TYR D N   1 
ATOM   3392 C CA  . TYR D 2 99  ? 42.267  15.108 49.221 1.00 46.39  ? 95  TYR D CA  1 
ATOM   3393 C C   . TYR D 2 99  ? 42.037  13.763 49.919 1.00 46.58  ? 95  TYR D C   1 
ATOM   3394 O O   . TYR D 2 99  ? 42.843  12.842 49.804 1.00 46.97  ? 95  TYR D O   1 
ATOM   3395 C CB  . TYR D 2 99  ? 41.884  14.967 47.742 1.00 44.26  ? 95  TYR D CB  1 
ATOM   3396 C CG  . TYR D 2 99  ? 42.014  16.216 46.876 1.00 46.65  ? 95  TYR D CG  1 
ATOM   3397 C CD1 . TYR D 2 99  ? 40.985  17.148 46.797 1.00 48.73  ? 95  TYR D CD1 1 
ATOM   3398 C CD2 . TYR D 2 99  ? 43.148  16.428 46.090 1.00 48.00  ? 95  TYR D CD2 1 
ATOM   3399 C CE1 . TYR D 2 99  ? 41.076  18.257 45.955 1.00 49.08  ? 95  TYR D CE1 1 
ATOM   3400 C CE2 . TYR D 2 99  ? 43.249  17.519 45.250 1.00 45.93  ? 95  TYR D CE2 1 
ATOM   3401 C CZ  . TYR D 2 99  ? 42.213  18.434 45.184 1.00 50.54  ? 95  TYR D CZ  1 
ATOM   3402 O OH  . TYR D 2 99  ? 42.317  19.508 44.320 1.00 53.80  ? 95  TYR D OH  1 
ATOM   3403 N N   . GLY D 2 100 ? 40.952  13.679 50.682 1.00 51.39  ? 96  GLY D N   1 
ATOM   3404 C CA  . GLY D 2 100 ? 40.605  12.459 51.391 1.00 49.22  ? 96  GLY D CA  1 
ATOM   3405 C C   . GLY D 2 100 ? 39.347  12.654 52.225 1.00 51.16  ? 96  GLY D C   1 
ATOM   3406 O O   . GLY D 2 100 ? 38.832  13.764 52.352 1.00 48.44  ? 96  GLY D O   1 
ATOM   3407 N N   . TYR D 2 101 ? 38.817  11.571 52.770 1.00 56.62  ? 97  TYR D N   1 
ATOM   3408 C CA  . TYR D 2 101 ? 37.628  11.677 53.603 1.00 63.17  ? 97  TYR D CA  1 
ATOM   3409 C C   . TYR D 2 101 ? 38.036  11.525 55.060 1.00 69.19  ? 97  TYR D C   1 
ATOM   3410 O O   . TYR D 2 101 ? 39.072  10.923 55.371 1.00 69.49  ? 97  TYR D O   1 
ATOM   3411 C CB  . TYR D 2 101 ? 36.621  10.590 53.260 1.00 56.49  ? 97  TYR D CB  1 
ATOM   3412 C CG  . TYR D 2 101 ? 36.053  10.680 51.886 1.00 55.14  ? 97  TYR D CG  1 
ATOM   3413 C CD1 . TYR D 2 101 ? 34.892  11.408 51.641 1.00 61.47  ? 97  TYR D CD1 1 
ATOM   3414 C CD2 . TYR D 2 101 ? 36.629  9.981  50.833 1.00 58.74  ? 97  TYR D CD2 1 
ATOM   3415 C CE1 . TYR D 2 101 ? 34.309  11.425 50.369 1.00 66.40  ? 97  TYR D CE1 1 
ATOM   3416 C CE2 . TYR D 2 101 ? 36.062  9.987  49.562 1.00 61.73  ? 97  TYR D CE2 1 
ATOM   3417 C CZ  . TYR D 2 101 ? 34.900  10.706 49.340 1.00 67.27  ? 97  TYR D CZ  1 
ATOM   3418 O OH  . TYR D 2 101 ? 34.308  10.669 48.100 1.00 79.08  ? 97  TYR D OH  1 
ATOM   3419 N N   . GLY D 2 102 ? 37.196  12.019 55.957 1.00 72.90  ? 98  GLY D N   1 
ATOM   3420 C CA  . GLY D 2 102 ? 37.512  11.902 57.364 1.00 80.12  ? 98  GLY D CA  1 
ATOM   3421 C C   . GLY D 2 102 ? 37.521  13.279 57.974 1.00 85.97  ? 98  GLY D C   1 
ATOM   3422 O O   . GLY D 2 102 ? 36.621  13.615 58.750 1.00 91.58  ? 98  GLY D O   1 
ATOM   3423 N N   . GLY D 2 103 ? 38.521  14.083 57.605 1.00 83.86  ? 99  GLY D N   1 
ATOM   3424 C CA  . GLY D 2 103 ? 38.628  15.441 58.108 1.00 75.79  ? 99  GLY D CA  1 
ATOM   3425 C C   . GLY D 2 103 ? 37.343  16.223 57.922 1.00 70.89  ? 99  GLY D C   1 
ATOM   3426 O O   . GLY D 2 103 ? 36.362  15.733 57.358 1.00 70.00  ? 99  GLY D O   1 
ATOM   3427 N N   . ASP D 2 104 ? 37.345  17.465 58.373 1.00 68.94  ? 100 ASP D N   1 
ATOM   3428 C CA  . ASP D 2 104 ? 36.152  18.277 58.253 1.00 68.72  ? 100 ASP D CA  1 
ATOM   3429 C C   . ASP D 2 104 ? 36.046  19.028 56.940 1.00 63.09  ? 100 ASP D C   1 
ATOM   3430 O O   . ASP D 2 104 ? 35.104  19.774 56.704 1.00 65.69  ? 100 ASP D O   1 
ATOM   3431 C CB  . ASP D 2 104 ? 36.015  19.155 59.487 1.00 74.90  ? 100 ASP D CB  1 
ATOM   3432 C CG  . ASP D 2 104 ? 35.794  18.313 60.743 1.00 82.77  ? 100 ASP D CG  1 
ATOM   3433 O OD1 . ASP D 2 104 ? 34.640  17.886 60.979 1.00 84.58  ? 100 ASP D OD1 1 
ATOM   3434 O OD2 . ASP D 2 104 ? 36.781  17.996 61.449 1.00 86.07  ? 100 ASP D OD2 1 
ATOM   3435 N N   . ARG D 2 105 A 36.991  18.730 56.063 1.00 56.43  ? 100 ARG D N   1 
ATOM   3436 C CA  . ARG D 2 105 A 37.069  19.281 54.732 1.00 47.01  ? 100 ARG D CA  1 
ATOM   3437 C C   . ARG D 2 105 A 37.512  18.113 53.878 1.00 46.96  ? 100 ARG D C   1 
ATOM   3438 O O   . ARG D 2 105 A 38.231  17.216 54.344 1.00 43.73  ? 100 ARG D O   1 
ATOM   3439 C CB  . ARG D 2 105 A 38.147  20.355 54.640 1.00 45.95  ? 100 ARG D CB  1 
ATOM   3440 C CG  . ARG D 2 105 A 37.864  21.647 55.337 1.00 40.20  ? 100 ARG D CG  1 
ATOM   3441 C CD  . ARG D 2 105 A 38.959  22.623 54.974 1.00 54.80  ? 100 ARG D CD  1 
ATOM   3442 N NE  . ARG D 2 105 A 39.001  22.910 53.532 1.00 62.31  ? 100 ARG D NE  1 
ATOM   3443 C CZ  . ARG D 2 105 A 38.056  23.590 52.872 1.00 65.64  ? 100 ARG D CZ  1 
ATOM   3444 N NH1 . ARG D 2 105 A 36.981  24.041 53.519 1.00 62.67  ? 100 ARG D NH1 1 
ATOM   3445 N NH2 . ARG D 2 105 A 38.204  23.880 51.577 1.00 57.80  ? 100 ARG D NH2 1 
ATOM   3446 N N   . PHE D 2 106 B 37.084  18.124 52.625 1.00 45.64  ? 100 PHE D N   1 
ATOM   3447 C CA  . PHE D 2 106 B 37.470  17.087 51.685 1.00 47.98  ? 100 PHE D CA  1 
ATOM   3448 C C   . PHE D 2 106 B 38.922  17.292 51.232 1.00 48.06  ? 100 PHE D C   1 
ATOM   3449 O O   . PHE D 2 106 B 39.622  16.338 50.894 1.00 48.91  ? 100 PHE D O   1 
ATOM   3450 C CB  . PHE D 2 106 B 36.559  17.132 50.472 1.00 49.29  ? 100 PHE D CB  1 
ATOM   3451 C CG  . PHE D 2 106 B 36.876  16.092 49.445 1.00 54.26  ? 100 PHE D CG  1 
ATOM   3452 C CD1 . PHE D 2 106 B 36.832  14.745 49.767 1.00 55.13  ? 100 PHE D CD1 1 
ATOM   3453 C CD2 . PHE D 2 106 B 37.195  16.454 48.145 1.00 58.62  ? 100 PHE D CD2 1 
ATOM   3454 C CE1 . PHE D 2 106 B 37.096  13.774 48.811 1.00 54.90  ? 100 PHE D CE1 1 
ATOM   3455 C CE2 . PHE D 2 106 B 37.460  15.489 47.186 1.00 53.75  ? 100 PHE D CE2 1 
ATOM   3456 C CZ  . PHE D 2 106 B 37.409  14.146 47.524 1.00 54.22  ? 100 PHE D CZ  1 
ATOM   3457 N N   . SER D 2 107 ? 39.365  18.544 51.193 1.00 51.31  ? 101 SER D N   1 
ATOM   3458 C CA  . SER D 2 107 ? 40.724  18.857 50.778 1.00 50.26  ? 101 SER D CA  1 
ATOM   3459 C C   . SER D 2 107 ? 41.319  20.035 51.505 1.00 46.93  ? 101 SER D C   1 
ATOM   3460 O O   . SER D 2 107 ? 40.618  20.949 51.980 1.00 41.72  ? 101 SER D O   1 
ATOM   3461 C CB  . SER D 2 107 ? 40.800  19.157 49.281 1.00 49.00  ? 101 SER D CB  1 
ATOM   3462 O OG  . SER D 2 107 ? 40.106  20.349 48.975 1.00 58.15  ? 101 SER D OG  1 
ATOM   3463 N N   . TYR D 2 108 ? 42.640  20.034 51.485 1.00 43.69  ? 102 TYR D N   1 
ATOM   3464 C CA  . TYR D 2 108 ? 43.422  21.077 52.083 1.00 42.93  ? 102 TYR D CA  1 
ATOM   3465 C C   . TYR D 2 108 ? 44.448  21.455 51.024 1.00 42.67  ? 102 TYR D C   1 
ATOM   3466 O O   . TYR D 2 108 ? 45.125  20.583 50.473 1.00 45.12  ? 102 TYR D O   1 
ATOM   3467 C CB  . TYR D 2 108 ? 44.095  20.527 53.328 1.00 47.38  ? 102 TYR D CB  1 
ATOM   3468 C CG  . TYR D 2 108 ? 43.099  20.016 54.344 1.00 57.22  ? 102 TYR D CG  1 
ATOM   3469 C CD1 . TYR D 2 108 ? 42.413  20.908 55.179 1.00 58.66  ? 102 TYR D CD1 1 
ATOM   3470 C CD2 . TYR D 2 108 ? 42.818  18.656 54.459 1.00 54.67  ? 102 TYR D CD2 1 
ATOM   3471 C CE1 . TYR D 2 108 ? 41.476  20.462 56.105 1.00 57.71  ? 102 TYR D CE1 1 
ATOM   3472 C CE2 . TYR D 2 108 ? 41.884  18.201 55.382 1.00 61.92  ? 102 TYR D CE2 1 
ATOM   3473 C CZ  . TYR D 2 108 ? 41.211  19.109 56.206 1.00 60.54  ? 102 TYR D CZ  1 
ATOM   3474 O OH  . TYR D 2 108 ? 40.279  18.670 57.132 1.00 56.70  ? 102 TYR D OH  1 
ATOM   3475 N N   . TRP D 2 109 ? 44.491  22.733 50.664 1.00 37.80  ? 103 TRP D N   1 
ATOM   3476 C CA  . TRP D 2 109 ? 45.437  23.224 49.671 1.00 35.54  ? 103 TRP D CA  1 
ATOM   3477 C C   . TRP D 2 109 ? 46.501  24.039 50.418 1.00 34.66  ? 103 TRP D C   1 
ATOM   3478 O O   . TRP D 2 109 ? 46.174  24.967 51.161 1.00 35.40  ? 103 TRP D O   1 
ATOM   3479 C CB  . TRP D 2 109 ? 44.702  24.088 48.637 1.00 36.66  ? 103 TRP D CB  1 
ATOM   3480 C CG  . TRP D 2 109 ? 45.492  24.447 47.395 1.00 45.52  ? 103 TRP D CG  1 
ATOM   3481 C CD1 . TRP D 2 109 ? 46.658  25.168 47.333 1.00 47.15  ? 103 TRP D CD1 1 
ATOM   3482 C CD2 . TRP D 2 109 ? 45.147  24.139 46.030 1.00 46.78  ? 103 TRP D CD2 1 
ATOM   3483 N NE1 . TRP D 2 109 ? 47.055  25.326 46.027 1.00 46.39  ? 103 TRP D NE1 1 
ATOM   3484 C CE2 . TRP D 2 109 ? 46.150  24.710 45.207 1.00 44.25  ? 103 TRP D CE2 1 
ATOM   3485 C CE3 . TRP D 2 109 ? 44.091  23.450 45.424 1.00 44.84  ? 103 TRP D CE3 1 
ATOM   3486 C CZ2 . TRP D 2 109 ? 46.121  24.609 43.815 1.00 40.67  ? 103 TRP D CZ2 1 
ATOM   3487 C CZ3 . TRP D 2 109 ? 44.065  23.355 44.032 1.00 43.39  ? 103 TRP D CZ3 1 
ATOM   3488 C CH2 . TRP D 2 109 ? 45.073  23.930 43.248 1.00 41.56  ? 103 TRP D CH2 1 
ATOM   3489 N N   . GLY D 2 110 ? 47.767  23.665 50.240 1.00 36.75  ? 104 GLY D N   1 
ATOM   3490 C CA  . GLY D 2 110 ? 48.892  24.352 50.877 1.00 34.86  ? 104 GLY D CA  1 
ATOM   3491 C C   . GLY D 2 110 ? 49.040  25.869 50.731 1.00 36.60  ? 104 GLY D C   1 
ATOM   3492 O O   . GLY D 2 110 ? 48.338  26.530 49.952 1.00 35.32  ? 104 GLY D O   1 
ATOM   3493 N N   . GLN D 2 111 ? 49.997  26.422 51.475 1.00 38.25  ? 105 GLN D N   1 
ATOM   3494 C CA  . GLN D 2 111 ? 50.231  27.862 51.487 1.00 38.80  ? 105 GLN D CA  1 
ATOM   3495 C C   . GLN D 2 111 ? 50.991  28.297 50.240 1.00 39.00  ? 105 GLN D C   1 
ATOM   3496 O O   . GLN D 2 111 ? 50.799  29.409 49.726 1.00 33.40  ? 105 GLN D O   1 
ATOM   3497 C CB  . GLN D 2 111 ? 51.065  28.240 52.703 1.00 43.22  ? 105 GLN D CB  1 
ATOM   3498 C CG  . GLN D 2 111 ? 50.801  27.426 53.943 1.00 49.14  ? 105 GLN D CG  1 
ATOM   3499 C CD  . GLN D 2 111 ? 51.594  27.926 55.157 1.00 60.12  ? 105 GLN D CD  1 
ATOM   3500 O OE1 . GLN D 2 111 ? 51.084  27.916 56.285 1.00 59.39  ? 105 GLN D OE1 1 
ATOM   3501 N NE2 . GLN D 2 111 ? 52.852  28.349 54.931 1.00 50.06  ? 105 GLN D NE2 1 
ATOM   3502 N N   . GLY D 2 112 ? 51.902  27.421 49.822 1.00 39.97  ? 106 GLY D N   1 
ATOM   3503 C CA  . GLY D 2 112 ? 52.749  27.648 48.678 1.00 34.79  ? 106 GLY D CA  1 
ATOM   3504 C C   . GLY D 2 112 ? 54.171  27.971 49.104 1.00 37.27  ? 106 GLY D C   1 
ATOM   3505 O O   . GLY D 2 112 ? 54.455  28.342 50.263 1.00 32.83  ? 106 GLY D O   1 
ATOM   3506 N N   . THR D 2 113 ? 55.080  27.736 48.172 1.00 35.93  ? 107 THR D N   1 
ATOM   3507 C CA  . THR D 2 113 ? 56.492  28.054 48.349 1.00 38.26  ? 107 THR D CA  1 
ATOM   3508 C C   . THR D 2 113 ? 56.944  28.579 46.976 1.00 37.58  ? 107 THR D C   1 
ATOM   3509 O O   . THR D 2 113 ? 56.726  27.931 45.946 1.00 35.71  ? 107 THR D O   1 
ATOM   3510 C CB  . THR D 2 113 ? 57.352  26.841 48.840 1.00 32.36  ? 107 THR D CB  1 
ATOM   3511 O OG1 . THR D 2 113 ? 58.730  27.231 48.981 1.00 35.16  ? 107 THR D OG1 1 
ATOM   3512 C CG2 . THR D 2 113 ? 57.271  25.701 47.879 1.00 42.76  ? 107 THR D CG2 1 
ATOM   3513 N N   . LEU D 2 114 ? 57.461  29.801 46.951 1.00 35.41  ? 108 LEU D N   1 
ATOM   3514 C CA  . LEU D 2 114 ? 57.890  30.382 45.699 1.00 35.64  ? 108 LEU D CA  1 
ATOM   3515 C C   . LEU D 2 114 ? 59.285  29.926 45.320 1.00 34.34  ? 108 LEU D C   1 
ATOM   3516 O O   . LEU D 2 114 ? 60.174  29.852 46.169 1.00 36.82  ? 108 LEU D O   1 
ATOM   3517 C CB  . LEU D 2 114 ? 57.795  31.913 45.748 1.00 34.13  ? 108 LEU D CB  1 
ATOM   3518 C CG  . LEU D 2 114 ? 57.989  32.714 44.449 1.00 32.19  ? 108 LEU D CG  1 
ATOM   3519 C CD1 . LEU D 2 114 ? 56.978  32.281 43.403 1.00 29.57  ? 108 LEU D CD1 1 
ATOM   3520 C CD2 . LEU D 2 114 ? 57.871  34.209 44.731 1.00 32.53  ? 108 LEU D CD2 1 
ATOM   3521 N N   . VAL D 2 115 ? 59.402  29.447 44.084 1.00 38.79  ? 109 VAL D N   1 
ATOM   3522 C CA  . VAL D 2 115 ? 60.677  29.018 43.523 1.00 41.27  ? 109 VAL D CA  1 
ATOM   3523 C C   . VAL D 2 115 ? 60.988  30.025 42.394 1.00 49.69  ? 109 VAL D C   1 
ATOM   3524 O O   . VAL D 2 115 ? 60.159  30.229 41.473 1.00 48.16  ? 109 VAL D O   1 
ATOM   3525 C CB  . VAL D 2 115 ? 60.610  27.558 42.973 1.00 41.40  ? 109 VAL D CB  1 
ATOM   3526 C CG1 . VAL D 2 115 ? 61.875  27.187 42.187 1.00 37.51  ? 109 VAL D CG1 1 
ATOM   3527 C CG2 . VAL D 2 115 ? 60.467  26.589 44.118 1.00 38.61  ? 109 VAL D CG2 1 
ATOM   3528 N N   . THR D 2 116 ? 62.107  30.742 42.539 1.00 47.14  ? 110 THR D N   1 
ATOM   3529 C CA  . THR D 2 116 ? 62.551  31.716 41.543 1.00 40.61  ? 110 THR D CA  1 
ATOM   3530 C C   . THR D 2 116 ? 63.868  31.229 40.953 1.00 37.73  ? 110 THR D C   1 
ATOM   3531 O O   . THR D 2 116 ? 64.905  31.304 41.611 1.00 40.41  ? 110 THR D O   1 
ATOM   3532 C CB  . THR D 2 116 ? 62.761  33.064 42.180 1.00 35.72  ? 110 THR D CB  1 
ATOM   3533 O OG1 . THR D 2 116 ? 61.584  33.413 42.915 1.00 30.68  ? 110 THR D OG1 1 
ATOM   3534 C CG2 . THR D 2 116 ? 63.038  34.101 41.119 1.00 34.17  ? 110 THR D CG2 1 
ATOM   3535 N N   . VAL D 2 117 ? 63.793  30.619 39.771 1.00 37.10  ? 111 VAL D N   1 
ATOM   3536 C CA  . VAL D 2 117 ? 64.948  30.086 39.055 1.00 36.14  ? 111 VAL D CA  1 
ATOM   3537 C C   . VAL D 2 117 ? 65.642  31.253 38.377 1.00 42.18  ? 111 VAL D C   1 
ATOM   3538 O O   . VAL D 2 117 ? 65.090  31.895 37.451 1.00 39.34  ? 111 VAL D O   1 
ATOM   3539 C CB  . VAL D 2 117 ? 64.528  29.040 38.031 1.00 37.84  ? 111 VAL D CB  1 
ATOM   3540 C CG1 . VAL D 2 117 ? 65.747  28.426 37.354 1.00 36.77  ? 111 VAL D CG1 1 
ATOM   3541 C CG2 . VAL D 2 117 ? 63.716  27.957 38.725 1.00 38.15  ? 111 VAL D CG2 1 
ATOM   3542 N N   . SER D 2 118 ? 66.867  31.506 38.841 1.00 45.55  ? 112 SER D N   1 
ATOM   3543 C CA  . SER D 2 118 ? 67.661  32.643 38.397 1.00 47.46  ? 112 SER D CA  1 
ATOM   3544 C C   . SER D 2 118 ? 69.129  32.542 38.833 1.00 45.95  ? 112 SER D C   1 
ATOM   3545 O O   . SER D 2 118 ? 69.381  31.861 39.840 1.00 49.76  ? 112 SER D O   1 
ATOM   3546 C CB  . SER D 2 118 ? 67.028  33.911 38.994 1.00 50.05  ? 112 SER D CB  1 
ATOM   3547 O OG  . SER D 2 118 ? 66.614  33.705 40.356 1.00 48.47  ? 112 SER D OG  1 
ATOM   3548 O OXT . SER D 2 118 ? 70.018  33.157 38.191 1.00 49.18  ? 112 SER D OXT 1 
ATOM   3549 N N   . ASP E 1 1   ? 83.395  45.787 28.573 1.00 75.47  ? 1   ASP E N   1 
ATOM   3550 C CA  . ASP E 1 1   ? 83.418  46.612 29.819 1.00 76.27  ? 1   ASP E CA  1 
ATOM   3551 C C   . ASP E 1 1   ? 84.410  46.048 30.851 1.00 69.44  ? 1   ASP E C   1 
ATOM   3552 O O   . ASP E 1 1   ? 85.163  45.130 30.533 1.00 65.07  ? 1   ASP E O   1 
ATOM   3553 C CB  . ASP E 1 1   ? 81.993  46.836 30.395 1.00 83.82  ? 1   ASP E CB  1 
ATOM   3554 C CG  . ASP E 1 1   ? 81.271  45.534 30.806 1.00 86.52  ? 1   ASP E CG  1 
ATOM   3555 O OD1 . ASP E 1 1   ? 81.830  44.765 31.620 1.00 88.08  ? 1   ASP E OD1 1 
ATOM   3556 O OD2 . ASP E 1 1   ? 80.114  45.313 30.359 1.00 79.27  ? 1   ASP E OD2 1 
ATOM   3557 N N   . VAL E 1 2   ? 84.404  46.571 32.074 1.00 62.80  ? 2   VAL E N   1 
ATOM   3558 C CA  . VAL E 1 2   ? 85.377  46.118 33.062 1.00 57.83  ? 2   VAL E CA  1 
ATOM   3559 C C   . VAL E 1 2   ? 85.002  44.797 33.727 1.00 55.26  ? 2   VAL E C   1 
ATOM   3560 O O   . VAL E 1 2   ? 83.880  44.625 34.161 1.00 56.49  ? 2   VAL E O   1 
ATOM   3561 C CB  . VAL E 1 2   ? 85.684  47.222 34.129 1.00 56.00  ? 2   VAL E CB  1 
ATOM   3562 C CG1 . VAL E 1 2   ? 86.746  46.733 35.066 1.00 60.89  ? 2   VAL E CG1 1 
ATOM   3563 C CG2 . VAL E 1 2   ? 86.188  48.532 33.477 1.00 43.47  ? 2   VAL E CG2 1 
ATOM   3564 N N   . VAL E 1 3   ? 85.937  43.852 33.767 1.00 55.29  ? 3   VAL E N   1 
ATOM   3565 C CA  . VAL E 1 3   ? 85.706  42.537 34.376 1.00 53.49  ? 3   VAL E CA  1 
ATOM   3566 C C   . VAL E 1 3   ? 86.408  42.370 35.733 1.00 56.24  ? 3   VAL E C   1 
ATOM   3567 O O   . VAL E 1 3   ? 87.647  42.346 35.801 1.00 55.53  ? 3   VAL E O   1 
ATOM   3568 C CB  . VAL E 1 3   ? 86.162  41.386 33.419 1.00 52.31  ? 3   VAL E CB  1 
ATOM   3569 C CG1 . VAL E 1 3   ? 86.160  40.031 34.134 1.00 45.74  ? 3   VAL E CG1 1 
ATOM   3570 C CG2 . VAL E 1 3   ? 85.258  41.331 32.184 1.00 50.18  ? 3   VAL E CG2 1 
ATOM   3571 N N   . MET E 1 4   ? 85.610  42.238 36.796 1.00 56.64  ? 4   MET E N   1 
ATOM   3572 C CA  . MET E 1 4   ? 86.108  42.065 38.167 1.00 53.26  ? 4   MET E CA  1 
ATOM   3573 C C   . MET E 1 4   ? 86.227  40.594 38.537 1.00 54.21  ? 4   MET E C   1 
ATOM   3574 O O   . MET E 1 4   ? 85.231  39.869 38.564 1.00 51.84  ? 4   MET E O   1 
ATOM   3575 C CB  . MET E 1 4   ? 85.158  42.723 39.153 1.00 56.51  ? 4   MET E CB  1 
ATOM   3576 C CG  . MET E 1 4   ? 84.873  44.184 38.874 1.00 55.80  ? 4   MET E CG  1 
ATOM   3577 S SD  . MET E 1 4   ? 86.372  45.167 38.941 1.00 57.48  ? 4   MET E SD  1 
ATOM   3578 C CE  . MET E 1 4   ? 87.224  44.457 40.339 1.00 51.34  ? 4   MET E CE  1 
ATOM   3579 N N   . THR E 1 5   ? 87.439  40.175 38.878 1.00 55.47  ? 5   THR E N   1 
ATOM   3580 C CA  . THR E 1 5   ? 87.733  38.795 39.241 1.00 54.51  ? 5   THR E CA  1 
ATOM   3581 C C   . THR E 1 5   ? 88.167  38.669 40.716 1.00 56.85  ? 5   THR E C   1 
ATOM   3582 O O   . THR E 1 5   ? 89.090  39.365 41.154 1.00 55.23  ? 5   THR E O   1 
ATOM   3583 C CB  . THR E 1 5   ? 88.841  38.237 38.283 1.00 57.17  ? 5   THR E CB  1 
ATOM   3584 O OG1 . THR E 1 5   ? 88.283  38.031 36.980 1.00 52.88  ? 5   THR E OG1 1 
ATOM   3585 C CG2 . THR E 1 5   ? 89.455  36.922 38.800 1.00 57.44  ? 5   THR E CG2 1 
ATOM   3586 N N   . GLN E 1 6   ? 87.500  37.788 41.473 1.00 53.52  ? 6   GLN E N   1 
ATOM   3587 C CA  . GLN E 1 6   ? 87.809  37.558 42.894 1.00 51.98  ? 6   GLN E CA  1 
ATOM   3588 C C   . GLN E 1 6   ? 88.446  36.208 43.170 1.00 52.92  ? 6   GLN E C   1 
ATOM   3589 O O   . GLN E 1 6   ? 88.115  35.236 42.503 1.00 49.64  ? 6   GLN E O   1 
ATOM   3590 C CB  . GLN E 1 6   ? 86.557  37.673 43.741 1.00 49.83  ? 6   GLN E CB  1 
ATOM   3591 C CG  . GLN E 1 6   ? 86.028  39.050 43.806 1.00 43.51  ? 6   GLN E CG  1 
ATOM   3592 C CD  . GLN E 1 6   ? 84.989  39.195 44.868 1.00 47.67  ? 6   GLN E CD  1 
ATOM   3593 O OE1 . GLN E 1 6   ? 83.836  39.478 44.566 1.00 52.21  ? 6   GLN E OE1 1 
ATOM   3594 N NE2 . GLN E 1 6   ? 85.380  39.002 46.126 1.00 41.97  ? 6   GLN E NE2 1 
ATOM   3595 N N   . THR E 1 7   ? 89.264  36.122 44.220 1.00 53.74  ? 7   THR E N   1 
ATOM   3596 C CA  . THR E 1 7   ? 89.949  34.864 44.531 1.00 57.64  ? 7   THR E CA  1 
ATOM   3597 C C   . THR E 1 7   ? 90.238  34.689 46.006 1.00 61.91  ? 7   THR E C   1 
ATOM   3598 O O   . THR E 1 7   ? 90.758  35.594 46.642 1.00 66.25  ? 7   THR E O   1 
ATOM   3599 C CB  . THR E 1 7   ? 91.300  34.770 43.787 1.00 55.43  ? 7   THR E CB  1 
ATOM   3600 O OG1 . THR E 1 7   ? 91.074  34.791 42.377 1.00 55.65  ? 7   THR E OG1 1 
ATOM   3601 C CG2 . THR E 1 7   ? 92.011  33.481 44.127 1.00 62.40  ? 7   THR E CG2 1 
ATOM   3602 N N   . PRO E 1 8   ? 89.951  33.487 46.574 1.00 66.25  ? 8   PRO E N   1 
ATOM   3603 C CA  . PRO E 1 8   ? 89.369  32.289 45.960 1.00 67.02  ? 8   PRO E CA  1 
ATOM   3604 C C   . PRO E 1 8   ? 87.829  32.246 46.048 1.00 68.87  ? 8   PRO E C   1 
ATOM   3605 O O   . PRO E 1 8   ? 87.216  33.066 46.732 1.00 67.73  ? 8   PRO E O   1 
ATOM   3606 C CB  . PRO E 1 8   ? 89.996  31.179 46.790 1.00 64.48  ? 8   PRO E CB  1 
ATOM   3607 C CG  . PRO E 1 8   ? 89.946  31.778 48.159 1.00 64.82  ? 8   PRO E CG  1 
ATOM   3608 C CD  . PRO E 1 8   ? 90.444  33.190 47.926 1.00 64.10  ? 8   PRO E CD  1 
ATOM   3609 N N   . SER E 1 9   ? 87.208  31.294 45.355 1.00 71.38  ? 9   SER E N   1 
ATOM   3610 C CA  . SER E 1 9   ? 85.745  31.165 45.357 1.00 69.88  ? 9   SER E CA  1 
ATOM   3611 C C   . SER E 1 9   ? 85.234  31.059 46.784 1.00 66.41  ? 9   SER E C   1 
ATOM   3612 O O   . SER E 1 9   ? 84.167  31.569 47.107 1.00 66.94  ? 9   SER E O   1 
ATOM   3613 C CB  . SER E 1 9   ? 85.299  29.914 44.596 1.00 70.17  ? 9   SER E CB  1 
ATOM   3614 O OG  . SER E 1 9   ? 85.848  29.855 43.298 1.00 72.81  ? 9   SER E OG  1 
ATOM   3615 N N   . SER E 1 10  ? 85.969  30.322 47.603 1.00 64.01  ? 10  SER E N   1 
ATOM   3616 C CA  . SER E 1 10  ? 85.634  30.125 49.003 1.00 64.65  ? 10  SER E CA  1 
ATOM   3617 C C   . SER E 1 10  ? 86.885  29.614 49.684 1.00 63.72  ? 10  SER E C   1 
ATOM   3618 O O   . SER E 1 10  ? 87.843  29.201 49.024 1.00 55.00  ? 10  SER E O   1 
ATOM   3619 C CB  . SER E 1 10  ? 84.494  29.111 49.186 1.00 65.06  ? 10  SER E CB  1 
ATOM   3620 O OG  . SER E 1 10  ? 84.846  27.837 48.671 1.00 64.30  ? 10  SER E OG  1 
ATOM   3621 N N   . LEU E 1 11  ? 86.871  29.665 51.004 1.00 67.98  ? 11  LEU E N   1 
ATOM   3622 C CA  . LEU E 1 11  ? 87.994  29.203 51.791 1.00 74.13  ? 11  LEU E CA  1 
ATOM   3623 C C   . LEU E 1 11  ? 87.461  28.813 53.166 1.00 77.58  ? 11  LEU E C   1 
ATOM   3624 O O   . LEU E 1 11  ? 86.432  29.337 53.609 1.00 76.59  ? 11  LEU E O   1 
ATOM   3625 C CB  . LEU E 1 11  ? 89.069  30.312 51.897 1.00 74.29  ? 11  LEU E CB  1 
ATOM   3626 C CG  . LEU E 1 11  ? 88.698  31.744 52.342 1.00 72.67  ? 11  LEU E CG  1 
ATOM   3627 C CD1 . LEU E 1 11  ? 88.340  31.779 53.798 1.00 71.80  ? 11  LEU E CD1 1 
ATOM   3628 C CD2 . LEU E 1 11  ? 89.862  32.682 52.108 1.00 70.89  ? 11  LEU E CD2 1 
ATOM   3629 N N   . ALA E 1 12  ? 88.134  27.865 53.809 1.00 77.36  ? 12  ALA E N   1 
ATOM   3630 C CA  . ALA E 1 12  ? 87.758  27.425 55.142 1.00 79.82  ? 12  ALA E CA  1 
ATOM   3631 C C   . ALA E 1 12  ? 88.788  28.010 56.101 1.00 79.93  ? 12  ALA E C   1 
ATOM   3632 O O   . ALA E 1 12  ? 89.985  27.832 55.906 1.00 77.29  ? 12  ALA E O   1 
ATOM   3633 C CB  . ALA E 1 12  ? 87.769  25.911 55.214 1.00 84.01  ? 12  ALA E CB  1 
ATOM   3634 N N   . MET E 1 13  ? 88.320  28.693 57.137 1.00 83.74  ? 13  MET E N   1 
ATOM   3635 C CA  . MET E 1 13  ? 89.186  29.330 58.119 1.00 88.33  ? 13  MET E CA  1 
ATOM   3636 C C   . MET E 1 13  ? 88.669  29.173 59.546 1.00 90.42  ? 13  MET E C   1 
ATOM   3637 O O   . MET E 1 13  ? 87.467  29.054 59.785 1.00 90.69  ? 13  MET E O   1 
ATOM   3638 C CB  . MET E 1 13  ? 89.310  30.833 57.823 1.00 93.51  ? 13  MET E CB  1 
ATOM   3639 C CG  . MET E 1 13  ? 90.158  31.200 56.621 1.00 91.76  ? 13  MET E CG  1 
ATOM   3640 S SD  . MET E 1 13  ? 91.864  30.777 56.879 1.00 95.78  ? 13  MET E SD  1 
ATOM   3641 C CE  . MET E 1 13  ? 92.163  29.615 55.496 1.00 92.64  ? 13  MET E CE  1 
ATOM   3642 N N   . SER E 1 14  ? 89.594  29.233 60.496 1.00 94.97  ? 14  SER E N   1 
ATOM   3643 C CA  . SER E 1 14  ? 89.270  29.121 61.913 1.00 94.84  ? 14  SER E CA  1 
ATOM   3644 C C   . SER E 1 14  ? 89.327  30.525 62.521 1.00 93.24  ? 14  SER E C   1 
ATOM   3645 O O   . SER E 1 14  ? 89.955  31.431 61.952 1.00 91.85  ? 14  SER E O   1 
ATOM   3646 C CB  . SER E 1 14  ? 90.304  28.216 62.595 1.00 92.61  ? 14  SER E CB  1 
ATOM   3647 O OG  . SER E 1 14  ? 90.633  27.112 61.760 1.00 90.89  ? 14  SER E OG  1 
ATOM   3648 N N   . VAL E 1 15  ? 88.655  30.716 63.656 1.00 92.14  ? 15  VAL E N   1 
ATOM   3649 C CA  . VAL E 1 15  ? 88.676  32.012 64.339 1.00 91.81  ? 15  VAL E CA  1 
ATOM   3650 C C   . VAL E 1 15  ? 90.142  32.403 64.594 1.00 95.99  ? 15  VAL E C   1 
ATOM   3651 O O   . VAL E 1 15  ? 91.012  31.534 64.679 1.00 100.00 ? 15  VAL E O   1 
ATOM   3652 C CB  . VAL E 1 15  ? 87.951  31.956 65.708 1.00 85.15  ? 15  VAL E CB  1 
ATOM   3653 C CG1 . VAL E 1 15  ? 87.970  33.334 66.370 1.00 76.11  ? 15  VAL E CG1 1 
ATOM   3654 C CG2 . VAL E 1 15  ? 86.526  31.445 65.540 1.00 81.41  ? 15  VAL E CG2 1 
ATOM   3655 N N   . GLY E 1 16  ? 90.426  33.699 64.657 1.00 95.95  ? 16  GLY E N   1 
ATOM   3656 C CA  . GLY E 1 16  ? 91.786  34.135 64.912 1.00 93.66  ? 16  GLY E CA  1 
ATOM   3657 C C   . GLY E 1 16  ? 92.767  33.992 63.761 1.00 92.48  ? 16  GLY E C   1 
ATOM   3658 O O   . GLY E 1 16  ? 93.874  34.518 63.848 1.00 93.25  ? 16  GLY E O   1 
ATOM   3659 N N   . GLN E 1 17  ? 92.397  33.288 62.694 1.00 91.48  ? 17  GLN E N   1 
ATOM   3660 C CA  . GLN E 1 17  ? 93.312  33.152 61.563 1.00 93.92  ? 17  GLN E CA  1 
ATOM   3661 C C   . GLN E 1 17  ? 93.222  34.411 60.692 1.00 94.70  ? 17  GLN E C   1 
ATOM   3662 O O   . GLN E 1 17  ? 92.347  35.259 60.916 1.00 94.86  ? 17  GLN E O   1 
ATOM   3663 C CB  . GLN E 1 17  ? 93.003  31.888 60.740 1.00 94.19  ? 17  GLN E CB  1 
ATOM   3664 C CG  . GLN E 1 17  ? 93.274  30.571 61.468 1.00 92.90  ? 17  GLN E CG  1 
ATOM   3665 C CD  . GLN E 1 17  ? 93.930  29.519 60.574 1.00 94.27  ? 17  GLN E CD  1 
ATOM   3666 O OE1 . GLN E 1 17  ? 95.151  29.359 60.586 1.00 94.42  ? 17  GLN E OE1 1 
ATOM   3667 N NE2 . GLN E 1 17  ? 93.123  28.802 59.801 1.00 88.46  ? 17  GLN E NE2 1 
ATOM   3668 N N   . LYS E 1 18  ? 94.125  34.540 59.718 1.00 92.47  ? 18  LYS E N   1 
ATOM   3669 C CA  . LYS E 1 18  ? 94.138  35.699 58.826 1.00 89.94  ? 18  LYS E CA  1 
ATOM   3670 C C   . LYS E 1 18  ? 93.469  35.439 57.477 1.00 90.27  ? 18  LYS E C   1 
ATOM   3671 O O   . LYS E 1 18  ? 93.882  34.551 56.727 1.00 90.72  ? 18  LYS E O   1 
ATOM   3672 C CB  . LYS E 1 18  ? 95.573  36.164 58.571 1.00 86.10  ? 18  LYS E CB  1 
ATOM   3673 C CG  . LYS E 1 18  ? 95.696  37.279 57.543 1.00 80.83  ? 18  LYS E CG  1 
ATOM   3674 C CD  . LYS E 1 18  ? 97.145  37.581 57.242 1.00 73.68  ? 18  LYS E CD  1 
ATOM   3675 C CE  . LYS E 1 18  ? 97.280  38.947 56.620 1.00 69.00  ? 18  LYS E CE  1 
ATOM   3676 N NZ  . LYS E 1 18  ? 98.693  39.358 56.579 1.00 63.86  ? 18  LYS E NZ  1 
ATOM   3677 N N   . VAL E 1 19  ? 92.445  36.222 57.162 1.00 88.61  ? 19  VAL E N   1 
ATOM   3678 C CA  . VAL E 1 19  ? 91.770  36.070 55.889 1.00 85.41  ? 19  VAL E CA  1 
ATOM   3679 C C   . VAL E 1 19  ? 92.328  37.044 54.861 1.00 81.47  ? 19  VAL E C   1 
ATOM   3680 O O   . VAL E 1 19  ? 92.507  38.233 55.122 1.00 77.11  ? 19  VAL E O   1 
ATOM   3681 C CB  . VAL E 1 19  ? 90.250  36.186 56.041 1.00 85.21  ? 19  VAL E CB  1 
ATOM   3682 C CG1 . VAL E 1 19  ? 89.605  36.414 54.696 1.00 88.49  ? 19  VAL E CG1 1 
ATOM   3683 C CG2 . VAL E 1 19  ? 89.718  34.896 56.634 1.00 85.13  ? 19  VAL E CG2 1 
ATOM   3684 N N   . THR E 1 20  ? 92.543  36.526 53.666 1.00 79.28  ? 20  THR E N   1 
ATOM   3685 C CA  . THR E 1 20  ? 93.118  37.293 52.590 1.00 77.02  ? 20  THR E CA  1 
ATOM   3686 C C   . THR E 1 20  ? 92.345  36.987 51.313 1.00 76.34  ? 20  THR E C   1 
ATOM   3687 O O   . THR E 1 20  ? 92.413  35.864 50.817 1.00 77.44  ? 20  THR E O   1 
ATOM   3688 C CB  . THR E 1 20  ? 94.578  36.837 52.386 1.00 76.08  ? 20  THR E CB  1 
ATOM   3689 O OG1 . THR E 1 20  ? 95.221  36.715 53.659 1.00 74.33  ? 20  THR E OG1 1 
ATOM   3690 C CG2 . THR E 1 20  ? 95.328  37.824 51.503 1.00 73.47  ? 20  THR E CG2 1 
ATOM   3691 N N   . MET E 1 21  ? 91.564  37.945 50.817 1.00 72.59  ? 21  MET E N   1 
ATOM   3692 C CA  . MET E 1 21  ? 90.819  37.743 49.568 1.00 70.08  ? 21  MET E CA  1 
ATOM   3693 C C   . MET E 1 21  ? 91.130  38.869 48.620 1.00 68.75  ? 21  MET E C   1 
ATOM   3694 O O   . MET E 1 21  ? 91.166  40.038 49.000 1.00 69.41  ? 21  MET E O   1 
ATOM   3695 C CB  . MET E 1 21  ? 89.304  37.625 49.786 1.00 70.82  ? 21  MET E CB  1 
ATOM   3696 C CG  . MET E 1 21  ? 88.719  38.676 50.693 1.00 73.90  ? 21  MET E CG  1 
ATOM   3697 S SD  . MET E 1 21  ? 87.226  38.109 51.504 1.00 76.68  ? 21  MET E SD  1 
ATOM   3698 C CE  . MET E 1 21  ? 87.711  36.542 52.069 1.00 71.88  ? 21  MET E CE  1 
ATOM   3699 N N   . SER E 1 22  ? 91.396  38.492 47.385 1.00 68.94  ? 22  SER E N   1 
ATOM   3700 C CA  . SER E 1 22  ? 91.740  39.431 46.343 1.00 69.75  ? 22  SER E CA  1 
ATOM   3701 C C   . SER E 1 22  ? 90.542  39.727 45.448 1.00 71.91  ? 22  SER E C   1 
ATOM   3702 O O   . SER E 1 22  ? 89.482  39.089 45.557 1.00 76.98  ? 22  SER E O   1 
ATOM   3703 C CB  . SER E 1 22  ? 92.873  38.846 45.489 1.00 69.52  ? 22  SER E CB  1 
ATOM   3704 O OG  . SER E 1 22  ? 93.937  38.396 46.309 1.00 66.60  ? 22  SER E OG  1 
ATOM   3705 N N   . CYS E 1 23  ? 90.747  40.698 44.570 1.00 69.02  ? 23  CYS E N   1 
ATOM   3706 C CA  . CYS E 1 23  ? 89.782  41.144 43.576 1.00 64.84  ? 23  CYS E CA  1 
ATOM   3707 C C   . CYS E 1 23  ? 90.698  41.850 42.573 1.00 65.41  ? 23  CYS E C   1 
ATOM   3708 O O   . CYS E 1 23  ? 91.547  42.663 42.957 1.00 65.59  ? 23  CYS E O   1 
ATOM   3709 C CB  . CYS E 1 23  ? 88.755  42.099 44.215 1.00 59.64  ? 23  CYS E CB  1 
ATOM   3710 S SG  . CYS E 1 23  ? 87.744  43.118 43.077 1.00 63.71  ? 23  CYS E SG  1 
ATOM   3711 N N   . LYS E 1 24  ? 90.622  41.455 41.313 1.00 64.33  ? 24  LYS E N   1 
ATOM   3712 C CA  . LYS E 1 24  ? 91.461  42.031 40.281 1.00 61.50  ? 24  LYS E CA  1 
ATOM   3713 C C   . LYS E 1 24  ? 90.611  42.530 39.142 1.00 59.01  ? 24  LYS E C   1 
ATOM   3714 O O   . LYS E 1 24  ? 89.612  41.898 38.780 1.00 57.69  ? 24  LYS E O   1 
ATOM   3715 C CB  . LYS E 1 24  ? 92.472  41.002 39.785 1.00 63.19  ? 24  LYS E CB  1 
ATOM   3716 C CG  . LYS E 1 24  ? 93.413  40.566 40.889 1.00 71.99  ? 24  LYS E CG  1 
ATOM   3717 C CD  . LYS E 1 24  ? 94.537  39.699 40.380 1.00 74.45  ? 24  LYS E CD  1 
ATOM   3718 C CE  . LYS E 1 24  ? 95.621  39.578 41.446 1.00 78.90  ? 24  LYS E CE  1 
ATOM   3719 N NZ  . LYS E 1 24  ? 96.805  38.808 40.969 1.00 81.38  ? 24  LYS E NZ  1 
ATOM   3720 N N   . SER E 1 25  ? 90.973  43.692 38.617 1.00 56.65  ? 25  SER E N   1 
ATOM   3721 C CA  . SER E 1 25  ? 90.241  44.273 37.508 1.00 58.57  ? 25  SER E CA  1 
ATOM   3722 C C   . SER E 1 25  ? 91.024  44.253 36.189 1.00 59.05  ? 25  SER E C   1 
ATOM   3723 O O   . SER E 1 25  ? 92.269  44.335 36.172 1.00 55.19  ? 25  SER E O   1 
ATOM   3724 C CB  . SER E 1 25  ? 89.738  45.685 37.845 1.00 54.53  ? 25  SER E CB  1 
ATOM   3725 O OG  . SER E 1 25  ? 90.741  46.482 38.452 1.00 62.14  ? 25  SER E OG  1 
ATOM   3726 N N   . SER E 1 26  ? 90.273  44.085 35.099 1.00 58.78  ? 26  SER E N   1 
ATOM   3727 C CA  . SER E 1 26  ? 90.804  44.032 33.739 1.00 60.88  ? 26  SER E CA  1 
ATOM   3728 C C   . SER E 1 26  ? 91.488  45.336 33.347 1.00 64.72  ? 26  SER E C   1 
ATOM   3729 O O   . SER E 1 26  ? 92.277  45.375 32.397 1.00 65.12  ? 26  SER E O   1 
ATOM   3730 C CB  . SER E 1 26  ? 89.663  43.741 32.757 1.00 57.57  ? 26  SER E CB  1 
ATOM   3731 O OG  . SER E 1 26  ? 88.556  44.618 32.955 1.00 53.12  ? 26  SER E OG  1 
ATOM   3732 N N   . GLN E 1 27  ? 91.116  46.406 34.049 1.00 67.32  ? 27  GLN E N   1 
ATOM   3733 C CA  . GLN E 1 27  ? 91.645  47.746 33.838 1.00 67.81  ? 27  GLN E CA  1 
ATOM   3734 C C   . GLN E 1 27  ? 91.832  48.451 35.169 1.00 68.44  ? 27  GLN E C   1 
ATOM   3735 O O   . GLN E 1 27  ? 91.189  48.088 36.176 1.00 70.55  ? 27  GLN E O   1 
ATOM   3736 C CB  . GLN E 1 27  ? 90.710  48.565 32.949 1.00 68.02  ? 27  GLN E CB  1 
ATOM   3737 C CG  . GLN E 1 27  ? 90.597  48.008 31.541 1.00 75.95  ? 27  GLN E CG  1 
ATOM   3738 C CD  . GLN E 1 27  ? 89.738  48.854 30.639 1.00 76.19  ? 27  GLN E CD  1 
ATOM   3739 O OE1 . GLN E 1 27  ? 88.705  48.396 30.141 1.00 76.83  ? 27  GLN E OE1 1 
ATOM   3740 N NE2 . GLN E 1 27  ? 90.146  50.106 30.430 1.00 77.11  ? 27  GLN E NE2 1 
ATOM   3741 N N   . SER E 1 28  A 92.768  49.403 35.164 1.00 64.83  ? 27  SER E N   1 
ATOM   3742 C CA  . SER E 1 28  A 93.090  50.208 36.319 1.00 60.26  ? 27  SER E CA  1 
ATOM   3743 C C   . SER E 1 28  A 91.864  51.011 36.754 1.00 60.44  ? 27  SER E C   1 
ATOM   3744 O O   . SER E 1 28  A 91.144  51.581 35.912 1.00 58.84  ? 27  SER E O   1 
ATOM   3745 C CB  . SER E 1 28  A 94.213  51.151 35.930 1.00 60.04  ? 27  SER E CB  1 
ATOM   3746 O OG  . SER E 1 28  A 94.731  51.829 37.044 1.00 72.64  ? 27  SER E OG  1 
ATOM   3747 N N   . LEU E 1 29  B 91.634  51.023 38.068 1.00 55.25  ? 27  LEU E N   1 
ATOM   3748 C CA  . LEU E 1 29  B 90.523  51.716 38.690 1.00 53.55  ? 27  LEU E CA  1 
ATOM   3749 C C   . LEU E 1 29  B 90.883  53.117 39.139 1.00 58.18  ? 27  LEU E C   1 
ATOM   3750 O O   . LEU E 1 29  B 90.000  53.915 39.475 1.00 56.49  ? 27  LEU E O   1 
ATOM   3751 C CB  . LEU E 1 29  B 90.051  50.930 39.900 1.00 45.20  ? 27  LEU E CB  1 
ATOM   3752 C CG  . LEU E 1 29  B 89.347  49.644 39.514 1.00 41.49  ? 27  LEU E CG  1 
ATOM   3753 C CD1 . LEU E 1 29  B 88.571  49.186 40.705 1.00 38.13  ? 27  LEU E CD1 1 
ATOM   3754 C CD2 . LEU E 1 29  B 88.426  49.891 38.323 1.00 34.95  ? 27  LEU E CD2 1 
ATOM   3755 N N   . LEU E 1 30  C 92.189  53.373 39.210 1.00 66.40  ? 27  LEU E N   1 
ATOM   3756 C CA  . LEU E 1 30  C 92.766  54.654 39.625 1.00 68.82  ? 27  LEU E CA  1 
ATOM   3757 C C   . LEU E 1 30  C 92.398  55.856 38.735 1.00 71.73  ? 27  LEU E C   1 
ATOM   3758 O O   . LEU E 1 30  C 92.599  55.828 37.515 1.00 71.39  ? 27  LEU E O   1 
ATOM   3759 C CB  . LEU E 1 30  C 94.283  54.523 39.680 1.00 63.50  ? 27  LEU E CB  1 
ATOM   3760 C CG  . LEU E 1 30  C 95.021  55.744 40.204 1.00 63.26  ? 27  LEU E CG  1 
ATOM   3761 C CD1 . LEU E 1 30  C 94.737  55.920 41.693 1.00 60.04  ? 27  LEU E CD1 1 
ATOM   3762 C CD2 . LEU E 1 30  C 96.494  55.555 39.951 1.00 62.72  ? 27  LEU E CD2 1 
ATOM   3763 N N   . ASN E 1 31  D 91.904  56.919 39.370 1.00 73.04  ? 27  ASN E N   1 
ATOM   3764 C CA  . ASN E 1 31  D 91.515  58.130 38.665 1.00 70.31  ? 27  ASN E CA  1 
ATOM   3765 C C   . ASN E 1 31  D 92.538  59.248 38.897 1.00 72.21  ? 27  ASN E C   1 
ATOM   3766 O O   . ASN E 1 31  D 92.801  59.657 40.042 1.00 68.24  ? 27  ASN E O   1 
ATOM   3767 C CB  . ASN E 1 31  D 90.125  58.569 39.126 1.00 71.75  ? 27  ASN E CB  1 
ATOM   3768 C CG  . ASN E 1 31  D 89.553  59.684 38.280 1.00 76.52  ? 27  ASN E CG  1 
ATOM   3769 O OD1 . ASN E 1 31  D 89.575  59.630 37.054 1.00 80.28  ? 27  ASN E OD1 1 
ATOM   3770 N ND2 . ASN E 1 31  D 89.024  60.701 38.933 1.00 79.76  ? 27  ASN E ND2 1 
ATOM   3771 N N   . ILE E 1 32  E 93.171  59.688 37.810 1.00 73.49  ? 27  ILE E N   1 
ATOM   3772 C CA  . ILE E 1 32  E 94.155  60.774 37.858 1.00 70.29  ? 27  ILE E CA  1 
ATOM   3773 C C   . ILE E 1 32  E 93.353  62.057 37.712 1.00 71.55  ? 27  ILE E C   1 
ATOM   3774 O O   . ILE E 1 32  E 93.064  62.507 36.606 1.00 75.67  ? 27  ILE E O   1 
ATOM   3775 C CB  . ILE E 1 32  E 95.208  60.664 36.721 1.00 67.40  ? 27  ILE E CB  1 
ATOM   3776 C CG1 . ILE E 1 32  E 94.529  60.243 35.407 1.00 64.98  ? 27  ILE E CG1 1 
ATOM   3777 C CG2 . ILE E 1 32  E 96.334  59.698 37.121 1.00 61.99  ? 27  ILE E CG2 1 
ATOM   3778 C CD1 . ILE E 1 32  E 95.476  60.071 34.222 1.00 63.09  ? 27  ILE E CD1 1 
ATOM   3779 N N   . SER E 1 33  F 92.901  62.552 38.855 1.00 69.46  ? 27  SER E N   1 
ATOM   3780 C CA  . SER E 1 33  F 92.092  63.763 39.000 1.00 63.81  ? 27  SER E CA  1 
ATOM   3781 C C   . SER E 1 33  F 91.985  63.923 40.505 1.00 64.74  ? 27  SER E C   1 
ATOM   3782 O O   . SER E 1 33  F 91.775  65.019 41.020 1.00 68.60  ? 27  SER E O   1 
ATOM   3783 C CB  . SER E 1 33  F 90.678  63.574 38.436 1.00 58.29  ? 27  SER E CB  1 
ATOM   3784 O OG  . SER E 1 33  F 90.635  63.728 37.039 1.00 57.94  ? 27  SER E OG  1 
ATOM   3785 N N   . ASN E 1 34  ? 92.127  62.800 41.202 1.00 62.06  ? 28  ASN E N   1 
ATOM   3786 C CA  . ASN E 1 34  ? 92.045  62.772 42.642 1.00 58.99  ? 28  ASN E CA  1 
ATOM   3787 C C   . ASN E 1 34  ? 92.823  61.600 43.213 1.00 57.54  ? 28  ASN E C   1 
ATOM   3788 O O   . ASN E 1 34  ? 92.812  61.380 44.425 1.00 58.94  ? 28  ASN E O   1 
ATOM   3789 C CB  . ASN E 1 34  ? 90.580  62.718 43.078 1.00 62.20  ? 28  ASN E CB  1 
ATOM   3790 C CG  . ASN E 1 34  ? 89.811  61.600 42.407 1.00 62.45  ? 28  ASN E CG  1 
ATOM   3791 O OD1 . ASN E 1 34  ? 90.367  60.815 41.631 1.00 61.29  ? 28  ASN E OD1 1 
ATOM   3792 N ND2 . ASN E 1 34  ? 88.538  61.497 42.731 1.00 61.63  ? 28  ASN E ND2 1 
ATOM   3793 N N   . GLN E 1 35  ? 93.487  60.840 42.345 1.00 57.50  ? 29  GLN E N   1 
ATOM   3794 C CA  . GLN E 1 35  ? 94.303  59.706 42.784 1.00 59.19  ? 29  GLN E CA  1 
ATOM   3795 C C   . GLN E 1 35  ? 93.550  58.662 43.611 1.00 61.03  ? 29  GLN E C   1 
ATOM   3796 O O   . GLN E 1 35  ? 94.168  57.833 44.292 1.00 60.07  ? 29  GLN E O   1 
ATOM   3797 C CB  . GLN E 1 35  ? 95.501  60.212 43.596 1.00 57.50  ? 29  GLN E CB  1 
ATOM   3798 C CG  . GLN E 1 35  ? 96.572  60.852 42.760 1.00 54.64  ? 29  GLN E CG  1 
ATOM   3799 C CD  . GLN E 1 35  ? 97.313  59.838 41.904 1.00 56.53  ? 29  GLN E CD  1 
ATOM   3800 O OE1 . GLN E 1 35  ? 97.924  58.892 42.420 1.00 56.75  ? 29  GLN E OE1 1 
ATOM   3801 N NE2 . GLN E 1 35  ? 97.281  60.039 40.591 1.00 47.25  ? 29  GLN E NE2 1 
ATOM   3802 N N   . LYS E 1 36  ? 92.222  58.727 43.583 1.00 60.65  ? 30  LYS E N   1 
ATOM   3803 C CA  . LYS E 1 36  ? 91.397  57.787 44.332 1.00 59.61  ? 30  LYS E CA  1 
ATOM   3804 C C   . LYS E 1 36  ? 91.135  56.526 43.495 1.00 56.13  ? 30  LYS E C   1 
ATOM   3805 O O   . LYS E 1 36  ? 91.126  56.583 42.262 1.00 50.54  ? 30  LYS E O   1 
ATOM   3806 C CB  . LYS E 1 36  ? 90.078  58.467 44.758 1.00 57.92  ? 30  LYS E CB  1 
ATOM   3807 C CG  . LYS E 1 36  ? 90.232  59.433 45.947 1.00 64.80  ? 30  LYS E CG  1 
ATOM   3808 C CD  . LYS E 1 36  ? 89.190  60.557 45.928 1.00 71.21  ? 30  LYS E CD  1 
ATOM   3809 C CE  . LYS E 1 36  ? 88.110  60.402 47.008 1.00 75.00  ? 30  LYS E CE  1 
ATOM   3810 N NZ  . LYS E 1 36  ? 86.968  61.374 46.835 1.00 66.46  ? 30  LYS E NZ  1 
ATOM   3811 N N   . ASN E 1 37  ? 91.042  55.378 44.163 1.00 55.28  ? 31  ASN E N   1 
ATOM   3812 C CA  . ASN E 1 37  ? 90.748  54.118 43.483 1.00 55.12  ? 31  ASN E CA  1 
ATOM   3813 C C   . ASN E 1 37  ? 89.294  53.759 43.713 1.00 54.29  ? 31  ASN E C   1 
ATOM   3814 O O   . ASN E 1 37  ? 88.870  53.554 44.860 1.00 50.39  ? 31  ASN E O   1 
ATOM   3815 C CB  . ASN E 1 37  ? 91.622  52.988 43.988 1.00 54.54  ? 31  ASN E CB  1 
ATOM   3816 C CG  . ASN E 1 37  ? 93.028  53.149 43.573 1.00 51.61  ? 31  ASN E CG  1 
ATOM   3817 O OD1 . ASN E 1 37  ? 93.482  52.547 42.603 1.00 48.85  ? 31  ASN E OD1 1 
ATOM   3818 N ND2 . ASN E 1 37  ? 93.741  53.982 44.288 1.00 55.54  ? 31  ASN E ND2 1 
ATOM   3819 N N   . TYR E 1 38  ? 88.554  53.630 42.617 1.00 50.07  ? 32  TYR E N   1 
ATOM   3820 C CA  . TYR E 1 38  ? 87.138  53.324 42.678 1.00 51.28  ? 32  TYR E CA  1 
ATOM   3821 C C   . TYR E 1 38  ? 86.768  51.869 42.856 1.00 48.18  ? 32  TYR E C   1 
ATOM   3822 O O   . TYR E 1 38  ? 86.127  51.262 42.011 1.00 47.93  ? 32  TYR E O   1 
ATOM   3823 C CB  . TYR E 1 38  ? 86.442  53.943 41.480 1.00 56.75  ? 32  TYR E CB  1 
ATOM   3824 C CG  . TYR E 1 38  ? 86.352  55.439 41.623 1.00 60.57  ? 32  TYR E CG  1 
ATOM   3825 C CD1 . TYR E 1 38  ? 87.485  56.242 41.486 1.00 58.71  ? 32  TYR E CD1 1 
ATOM   3826 C CD2 . TYR E 1 38  ? 85.142  56.049 41.960 1.00 62.38  ? 32  TYR E CD2 1 
ATOM   3827 C CE1 . TYR E 1 38  ? 87.418  57.614 41.689 1.00 62.58  ? 32  TYR E CE1 1 
ATOM   3828 C CE2 . TYR E 1 38  ? 85.064  57.418 42.164 1.00 67.00  ? 32  TYR E CE2 1 
ATOM   3829 C CZ  . TYR E 1 38  ? 86.209  58.197 42.031 1.00 64.51  ? 32  TYR E CZ  1 
ATOM   3830 O OH  . TYR E 1 38  ? 86.125  59.551 42.266 1.00 64.75  ? 32  TYR E OH  1 
ATOM   3831 N N   . LEU E 1 39  ? 87.170  51.324 43.987 1.00 47.47  ? 33  LEU E N   1 
ATOM   3832 C CA  . LEU E 1 39  ? 86.888  49.946 44.310 1.00 47.45  ? 33  LEU E CA  1 
ATOM   3833 C C   . LEU E 1 39  ? 86.227  49.841 45.692 1.00 53.65  ? 33  LEU E C   1 
ATOM   3834 O O   . LEU E 1 39  ? 86.676  50.473 46.654 1.00 53.10  ? 33  LEU E O   1 
ATOM   3835 C CB  . LEU E 1 39  ? 88.163  49.118 44.293 1.00 32.02  ? 33  LEU E CB  1 
ATOM   3836 C CG  . LEU E 1 39  ? 87.767  47.683 44.601 1.00 31.99  ? 33  LEU E CG  1 
ATOM   3837 C CD1 . LEU E 1 39  ? 87.281  47.003 43.345 1.00 37.70  ? 33  LEU E CD1 1 
ATOM   3838 C CD2 . LEU E 1 39  ? 88.890  46.941 45.198 1.00 32.83  ? 33  LEU E CD2 1 
ATOM   3839 N N   . ALA E 1 40  ? 85.172  49.029 45.782 1.00 54.60  ? 34  ALA E N   1 
ATOM   3840 C CA  . ALA E 1 40  ? 84.447  48.840 47.033 1.00 50.30  ? 34  ALA E CA  1 
ATOM   3841 C C   . ALA E 1 40  ? 84.301  47.362 47.392 1.00 53.37  ? 34  ALA E C   1 
ATOM   3842 O O   . ALA E 1 40  ? 84.342  46.485 46.513 1.00 51.19  ? 34  ALA E O   1 
ATOM   3843 C CB  . ALA E 1 40  ? 83.079  49.486 46.930 1.00 46.96  ? 34  ALA E CB  1 
ATOM   3844 N N   . TRP E 1 41  ? 84.167  47.086 48.685 1.00 49.91  ? 35  TRP E N   1 
ATOM   3845 C CA  . TRP E 1 41  ? 83.973  45.724 49.159 1.00 50.87  ? 35  TRP E CA  1 
ATOM   3846 C C   . TRP E 1 41  ? 82.664  45.702 49.935 1.00 53.44  ? 35  TRP E C   1 
ATOM   3847 O O   . TRP E 1 41  ? 82.318  46.695 50.598 1.00 56.18  ? 35  TRP E O   1 
ATOM   3848 C CB  . TRP E 1 41  ? 85.098  45.292 50.090 1.00 50.73  ? 35  TRP E CB  1 
ATOM   3849 C CG  . TRP E 1 41  ? 86.408  45.192 49.436 1.00 55.43  ? 35  TRP E CG  1 
ATOM   3850 C CD1 . TRP E 1 41  ? 87.335  46.186 49.293 1.00 58.25  ? 35  TRP E CD1 1 
ATOM   3851 C CD2 . TRP E 1 41  ? 86.978  44.025 48.856 1.00 60.37  ? 35  TRP E CD2 1 
ATOM   3852 N NE1 . TRP E 1 41  ? 88.461  45.704 48.663 1.00 55.15  ? 35  TRP E NE1 1 
ATOM   3853 C CE2 . TRP E 1 41  ? 88.268  44.369 48.381 1.00 58.28  ? 35  TRP E CE2 1 
ATOM   3854 C CE3 . TRP E 1 41  ? 86.535  42.700 48.691 1.00 61.54  ? 35  TRP E CE3 1 
ATOM   3855 C CZ2 . TRP E 1 41  ? 89.112  43.455 47.742 1.00 58.02  ? 35  TRP E CZ2 1 
ATOM   3856 C CZ3 . TRP E 1 41  ? 87.374  41.780 48.053 1.00 61.73  ? 35  TRP E CZ3 1 
ATOM   3857 C CH2 . TRP E 1 41  ? 88.651  42.165 47.592 1.00 60.58  ? 35  TRP E CH2 1 
ATOM   3858 N N   . TYR E 1 42  ? 81.920  44.601 49.822 1.00 50.71  ? 36  TYR E N   1 
ATOM   3859 C CA  . TYR E 1 42  ? 80.658  44.440 50.535 1.00 48.92  ? 36  TYR E CA  1 
ATOM   3860 C C   . TYR E 1 42  ? 80.583  43.121 51.285 1.00 52.51  ? 36  TYR E C   1 
ATOM   3861 O O   . TYR E 1 42  ? 81.273  42.136 50.961 1.00 53.44  ? 36  TYR E O   1 
ATOM   3862 C CB  . TYR E 1 42  ? 79.470  44.518 49.592 1.00 44.45  ? 36  TYR E CB  1 
ATOM   3863 C CG  . TYR E 1 42  ? 79.461  45.745 48.749 1.00 45.52  ? 36  TYR E CG  1 
ATOM   3864 C CD1 . TYR E 1 42  ? 80.349  45.867 47.683 1.00 45.64  ? 36  TYR E CD1 1 
ATOM   3865 C CD2 . TYR E 1 42  ? 78.581  46.795 49.014 1.00 41.36  ? 36  TYR E CD2 1 
ATOM   3866 C CE1 . TYR E 1 42  ? 80.375  47.002 46.896 1.00 49.59  ? 36  TYR E CE1 1 
ATOM   3867 C CE2 . TYR E 1 42  ? 78.592  47.947 48.232 1.00 48.97  ? 36  TYR E CE2 1 
ATOM   3868 C CZ  . TYR E 1 42  ? 79.499  48.043 47.171 1.00 56.32  ? 36  TYR E CZ  1 
ATOM   3869 O OH  . TYR E 1 42  ? 79.555  49.171 46.383 1.00 62.41  ? 36  TYR E OH  1 
ATOM   3870 N N   . GLN E 1 43  ? 79.745  43.125 52.311 1.00 55.12  ? 37  GLN E N   1 
ATOM   3871 C CA  . GLN E 1 43  ? 79.515  41.951 53.116 1.00 60.63  ? 37  GLN E CA  1 
ATOM   3872 C C   . GLN E 1 43  ? 78.066  41.498 52.949 1.00 62.48  ? 37  GLN E C   1 
ATOM   3873 O O   . GLN E 1 43  ? 77.131  42.309 52.958 1.00 62.70  ? 37  GLN E O   1 
ATOM   3874 C CB  . GLN E 1 43  ? 79.800  42.243 54.589 1.00 62.58  ? 37  GLN E CB  1 
ATOM   3875 C CG  . GLN E 1 43  ? 79.224  41.201 55.532 1.00 69.03  ? 37  GLN E CG  1 
ATOM   3876 C CD  . GLN E 1 43  ? 79.986  41.114 56.822 1.00 74.00  ? 37  GLN E CD  1 
ATOM   3877 O OE1 . GLN E 1 43  ? 79.919  42.016 57.665 1.00 79.48  ? 37  GLN E OE1 1 
ATOM   3878 N NE2 . GLN E 1 43  ? 80.741  40.028 56.983 1.00 69.90  ? 37  GLN E NE2 1 
ATOM   3879 N N   . GLN E 1 44  ? 77.882  40.207 52.729 1.00 63.80  ? 38  GLN E N   1 
ATOM   3880 C CA  . GLN E 1 44  ? 76.543  39.693 52.616 1.00 61.13  ? 38  GLN E CA  1 
ATOM   3881 C C   . GLN E 1 44  ? 76.370  38.454 53.454 1.00 65.86  ? 38  GLN E C   1 
ATOM   3882 O O   . GLN E 1 44  ? 77.072  37.453 53.261 1.00 66.68  ? 38  GLN E O   1 
ATOM   3883 C CB  . GLN E 1 44  ? 76.193  39.380 51.188 1.00 55.25  ? 38  GLN E CB  1 
ATOM   3884 C CG  . GLN E 1 44  ? 74.770  38.943 51.073 1.00 49.94  ? 38  GLN E CG  1 
ATOM   3885 C CD  . GLN E 1 44  ? 74.330  38.903 49.653 1.00 49.97  ? 38  GLN E CD  1 
ATOM   3886 O OE1 . GLN E 1 44  ? 75.074  38.434 48.775 1.00 43.20  ? 38  GLN E OE1 1 
ATOM   3887 N NE2 . GLN E 1 44  ? 73.127  39.422 49.390 1.00 40.09  ? 38  GLN E NE2 1 
ATOM   3888 N N   . LYS E 1 45  ? 75.498  38.575 54.449 1.00 68.91  ? 39  LYS E N   1 
ATOM   3889 C CA  . LYS E 1 45  ? 75.168  37.477 55.336 1.00 70.53  ? 39  LYS E CA  1 
ATOM   3890 C C   . LYS E 1 45  ? 73.827  36.947 54.831 1.00 74.11  ? 39  LYS E C   1 
ATOM   3891 O O   . LYS E 1 45  ? 73.120  37.633 54.080 1.00 72.65  ? 39  LYS E O   1 
ATOM   3892 C CB  . LYS E 1 45  ? 75.041  37.965 56.781 1.00 68.20  ? 39  LYS E CB  1 
ATOM   3893 C CG  . LYS E 1 45  ? 76.331  38.467 57.379 1.00 69.15  ? 39  LYS E CG  1 
ATOM   3894 C CD  . LYS E 1 45  ? 76.163  38.818 58.855 1.00 67.73  ? 39  LYS E CD  1 
ATOM   3895 C CE  . LYS E 1 45  ? 77.300  39.718 59.310 1.00 64.21  ? 39  LYS E CE  1 
ATOM   3896 N NZ  . LYS E 1 45  ? 77.163  40.161 60.698 1.00 60.28  ? 39  LYS E NZ  1 
ATOM   3897 N N   . PRO E 1 46  ? 73.472  35.710 55.213 1.00 77.74  ? 40  PRO E N   1 
ATOM   3898 C CA  . PRO E 1 46  ? 72.208  35.085 54.793 1.00 77.61  ? 40  PRO E CA  1 
ATOM   3899 C C   . PRO E 1 46  ? 70.966  35.961 55.019 1.00 77.96  ? 40  PRO E C   1 
ATOM   3900 O O   . PRO E 1 46  ? 70.867  36.681 56.013 1.00 74.26  ? 40  PRO E O   1 
ATOM   3901 C CB  . PRO E 1 46  ? 72.159  33.822 55.650 1.00 79.05  ? 40  PRO E CB  1 
ATOM   3902 C CG  . PRO E 1 46  ? 73.619  33.463 55.798 1.00 80.06  ? 40  PRO E CG  1 
ATOM   3903 C CD  . PRO E 1 46  ? 74.259  34.801 56.074 1.00 76.12  ? 40  PRO E CD  1 
ATOM   3904 N N   . GLY E 1 47  ? 70.048  35.935 54.057 1.00 78.99  ? 41  GLY E N   1 
ATOM   3905 C CA  . GLY E 1 47  ? 68.818  36.704 54.167 1.00 76.06  ? 41  GLY E CA  1 
ATOM   3906 C C   . GLY E 1 47  ? 68.987  38.204 54.285 1.00 76.82  ? 41  GLY E C   1 
ATOM   3907 O O   . GLY E 1 47  ? 68.056  38.905 54.694 1.00 78.84  ? 41  GLY E O   1 
ATOM   3908 N N   . GLN E 1 48  ? 70.168  38.703 53.942 1.00 74.97  ? 42  GLN E N   1 
ATOM   3909 C CA  . GLN E 1 48  ? 70.430  40.133 54.003 1.00 74.58  ? 42  GLN E CA  1 
ATOM   3910 C C   . GLN E 1 48  ? 70.943  40.673 52.675 1.00 71.23  ? 42  GLN E C   1 
ATOM   3911 O O   . GLN E 1 48  ? 71.514  39.935 51.867 1.00 71.53  ? 42  GLN E O   1 
ATOM   3912 C CB  . GLN E 1 48  ? 71.494  40.442 55.055 1.00 75.58  ? 42  GLN E CB  1 
ATOM   3913 C CG  . GLN E 1 48  ? 71.030  40.522 56.484 1.00 81.53  ? 42  GLN E CG  1 
ATOM   3914 C CD  . GLN E 1 48  ? 72.173  40.930 57.399 1.00 86.68  ? 42  GLN E CD  1 
ATOM   3915 O OE1 . GLN E 1 48  ? 73.196  40.240 57.492 1.00 91.87  ? 42  GLN E OE1 1 
ATOM   3916 N NE2 . GLN E 1 48  ? 72.030  42.072 58.042 1.00 86.35  ? 42  GLN E NE2 1 
ATOM   3917 N N   . SER E 1 49  ? 70.735  41.967 52.451 1.00 66.69  ? 43  SER E N   1 
ATOM   3918 C CA  . SER E 1 49  ? 71.240  42.620 51.259 1.00 61.72  ? 43  SER E CA  1 
ATOM   3919 C C   . SER E 1 49  ? 72.730  42.818 51.544 1.00 61.17  ? 43  SER E C   1 
ATOM   3920 O O   . SER E 1 49  ? 73.178  42.617 52.682 1.00 63.85  ? 43  SER E O   1 
ATOM   3921 C CB  . SER E 1 49  ? 70.554  43.973 51.073 1.00 58.99  ? 43  SER E CB  1 
ATOM   3922 O OG  . SER E 1 49  ? 70.648  44.769 52.235 1.00 57.14  ? 43  SER E OG  1 
ATOM   3923 N N   . PRO E 1 50  ? 73.542  43.079 50.511 1.00 61.40  ? 44  PRO E N   1 
ATOM   3924 C CA  . PRO E 1 50  ? 74.951  43.265 50.865 1.00 59.97  ? 44  PRO E CA  1 
ATOM   3925 C C   . PRO E 1 50  ? 75.068  44.639 51.515 1.00 60.55  ? 44  PRO E C   1 
ATOM   3926 O O   . PRO E 1 50  ? 74.250  45.529 51.250 1.00 62.21  ? 44  PRO E O   1 
ATOM   3927 C CB  . PRO E 1 50  ? 75.652  43.232 49.508 1.00 55.32  ? 44  PRO E CB  1 
ATOM   3928 C CG  . PRO E 1 50  ? 74.728  42.447 48.654 1.00 54.57  ? 44  PRO E CG  1 
ATOM   3929 C CD  . PRO E 1 50  ? 73.393  42.991 49.053 1.00 58.56  ? 44  PRO E CD  1 
ATOM   3930 N N   . LYS E 1 51  ? 76.056  44.796 52.384 1.00 60.21  ? 45  LYS E N   1 
ATOM   3931 C CA  . LYS E 1 51  ? 76.296  46.054 53.084 1.00 61.10  ? 45  LYS E CA  1 
ATOM   3932 C C   . LYS E 1 51  ? 77.735  46.486 52.800 1.00 55.90  ? 45  LYS E C   1 
ATOM   3933 O O   . LYS E 1 51  ? 78.645  45.653 52.788 1.00 51.79  ? 45  LYS E O   1 
ATOM   3934 C CB  . LYS E 1 51  ? 76.061  45.857 54.596 1.00 67.03  ? 45  LYS E CB  1 
ATOM   3935 C CG  . LYS E 1 51  ? 76.620  44.528 55.165 1.00 73.16  ? 45  LYS E CG  1 
ATOM   3936 C CD  . LYS E 1 51  ? 76.035  44.169 56.544 1.00 78.93  ? 45  LYS E CD  1 
ATOM   3937 C CE  . LYS E 1 51  ? 76.279  42.696 56.928 1.00 74.78  ? 45  LYS E CE  1 
ATOM   3938 N NZ  . LYS E 1 51  ? 75.547  42.345 58.189 1.00 74.15  ? 45  LYS E NZ  1 
ATOM   3939 N N   . LEU E 1 52  ? 77.943  47.778 52.562 1.00 53.77  ? 46  LEU E N   1 
ATOM   3940 C CA  . LEU E 1 52  ? 79.289  48.296 52.264 1.00 53.15  ? 46  LEU E CA  1 
ATOM   3941 C C   . LEU E 1 52  ? 80.316  48.121 53.384 1.00 56.36  ? 46  LEU E C   1 
ATOM   3942 O O   . LEU E 1 52  ? 80.031  48.415 54.552 1.00 59.46  ? 46  LEU E O   1 
ATOM   3943 C CB  . LEU E 1 52  ? 79.208  49.770 51.875 1.00 46.30  ? 46  LEU E CB  1 
ATOM   3944 C CG  . LEU E 1 52  ? 80.439  50.539 51.397 1.00 42.26  ? 46  LEU E CG  1 
ATOM   3945 C CD1 . LEU E 1 52  ? 81.085  49.881 50.211 1.00 40.00  ? 46  LEU E CD1 1 
ATOM   3946 C CD2 . LEU E 1 52  ? 80.004  51.919 51.028 1.00 41.79  ? 46  LEU E CD2 1 
ATOM   3947 N N   . LEU E 1 53  ? 81.485  47.588 53.028 1.00 56.02  ? 47  LEU E N   1 
ATOM   3948 C CA  . LEU E 1 53  ? 82.570  47.399 53.985 1.00 58.81  ? 47  LEU E CA  1 
ATOM   3949 C C   . LEU E 1 53  ? 83.660  48.452 53.794 1.00 61.84  ? 47  LEU E C   1 
ATOM   3950 O O   . LEU E 1 53  ? 84.059  49.119 54.745 1.00 64.87  ? 47  LEU E O   1 
ATOM   3951 C CB  . LEU E 1 53  ? 83.200  46.014 53.866 1.00 56.12  ? 47  LEU E CB  1 
ATOM   3952 C CG  . LEU E 1 53  ? 82.492  44.818 54.501 1.00 57.77  ? 47  LEU E CG  1 
ATOM   3953 C CD1 . LEU E 1 53  ? 83.514  43.709 54.688 1.00 57.02  ? 47  LEU E CD1 1 
ATOM   3954 C CD2 . LEU E 1 53  ? 81.894  45.167 55.839 1.00 53.35  ? 47  LEU E CD2 1 
ATOM   3955 N N   . VAL E 1 54  ? 84.111  48.615 52.556 1.00 59.74  ? 48  VAL E N   1 
ATOM   3956 C CA  . VAL E 1 54  ? 85.155  49.578 52.229 1.00 58.76  ? 48  VAL E CA  1 
ATOM   3957 C C   . VAL E 1 54  ? 84.904  50.235 50.874 1.00 56.73  ? 48  VAL E C   1 
ATOM   3958 O O   . VAL E 1 54  ? 84.286  49.633 49.995 1.00 60.47  ? 48  VAL E O   1 
ATOM   3959 C CB  . VAL E 1 54  ? 86.539  48.872 52.180 1.00 57.08  ? 48  VAL E CB  1 
ATOM   3960 C CG1 . VAL E 1 54  ? 87.533  49.703 51.422 1.00 51.31  ? 48  VAL E CG1 1 
ATOM   3961 C CG2 . VAL E 1 54  ? 87.054  48.617 53.579 1.00 59.53  ? 48  VAL E CG2 1 
ATOM   3962 N N   . TYR E 1 55  ? 85.339  51.482 50.727 1.00 51.66  ? 49  TYR E N   1 
ATOM   3963 C CA  . TYR E 1 55  ? 85.218  52.200 49.461 1.00 51.45  ? 49  TYR E CA  1 
ATOM   3964 C C   . TYR E 1 55  ? 86.509  52.966 49.226 1.00 50.87  ? 49  TYR E C   1 
ATOM   3965 O O   . TYR E 1 55  ? 87.227  53.271 50.180 1.00 50.21  ? 49  TYR E O   1 
ATOM   3966 C CB  . TYR E 1 55  ? 83.997  53.095 49.415 1.00 54.95  ? 49  TYR E CB  1 
ATOM   3967 C CG  . TYR E 1 55  ? 83.868  54.081 50.538 1.00 62.34  ? 49  TYR E CG  1 
ATOM   3968 C CD1 . TYR E 1 55  ? 83.389  53.687 51.785 1.00 63.84  ? 49  TYR E CD1 1 
ATOM   3969 C CD2 . TYR E 1 55  ? 84.129  55.432 50.331 1.00 63.00  ? 49  TYR E CD2 1 
ATOM   3970 C CE1 . TYR E 1 55  ? 83.163  54.619 52.797 1.00 63.23  ? 49  TYR E CE1 1 
ATOM   3971 C CE2 . TYR E 1 55  ? 83.904  56.370 51.330 1.00 62.91  ? 49  TYR E CE2 1 
ATOM   3972 C CZ  . TYR E 1 55  ? 83.418  55.955 52.552 1.00 63.42  ? 49  TYR E CZ  1 
ATOM   3973 O OH  . TYR E 1 55  ? 83.141  56.885 53.512 1.00 69.74  ? 49  TYR E OH  1 
ATOM   3974 N N   . PHE E 1 56  ? 86.840  53.219 47.963 1.00 49.45  ? 50  PHE E N   1 
ATOM   3975 C CA  . PHE E 1 56  ? 88.099  53.876 47.620 1.00 50.74  ? 50  PHE E CA  1 
ATOM   3976 C C   . PHE E 1 56  ? 89.229  52.957 48.060 1.00 51.51  ? 50  PHE E C   1 
ATOM   3977 O O   . PHE E 1 56  ? 90.195  53.377 48.694 1.00 54.86  ? 50  PHE E O   1 
ATOM   3978 C CB  . PHE E 1 56  ? 88.224  55.244 48.273 1.00 45.66  ? 50  PHE E CB  1 
ATOM   3979 C CG  . PHE E 1 56  ? 87.231  56.204 47.775 1.00 41.64  ? 50  PHE E CG  1 
ATOM   3980 C CD1 . PHE E 1 56  ? 87.010  56.322 46.417 1.00 42.78  ? 50  PHE E CD1 1 
ATOM   3981 C CD2 . PHE E 1 56  ? 86.449  56.922 48.643 1.00 42.36  ? 50  PHE E CD2 1 
ATOM   3982 C CE1 . PHE E 1 56  ? 86.010  57.146 45.933 1.00 50.21  ? 50  PHE E CE1 1 
ATOM   3983 C CE2 . PHE E 1 56  ? 85.447  57.749 48.169 1.00 48.76  ? 50  PHE E CE2 1 
ATOM   3984 C CZ  . PHE E 1 56  ? 85.226  57.859 46.810 1.00 44.07  ? 50  PHE E CZ  1 
ATOM   3985 N N   . ALA E 1 57  ? 89.026  51.674 47.797 1.00 51.23  ? 51  ALA E N   1 
ATOM   3986 C CA  . ALA E 1 57  ? 89.971  50.623 48.114 1.00 49.58  ? 51  ALA E CA  1 
ATOM   3987 C C   . ALA E 1 57  ? 90.373  50.427 49.579 1.00 50.53  ? 51  ALA E C   1 
ATOM   3988 O O   . ALA E 1 57  ? 90.678  49.300 49.960 1.00 46.32  ? 51  ALA E O   1 
ATOM   3989 C CB  . ALA E 1 57  ? 91.196  50.774 47.250 1.00 46.37  ? 51  ALA E CB  1 
ATOM   3990 N N   . SER E 1 58  ? 90.278  51.473 50.408 1.00 52.73  ? 52  SER E N   1 
ATOM   3991 C CA  . SER E 1 58  ? 90.698  51.409 51.820 1.00 57.94  ? 52  SER E CA  1 
ATOM   3992 C C   . SER E 1 58  ? 89.781  51.991 52.915 1.00 60.42  ? 52  SER E C   1 
ATOM   3993 O O   . SER E 1 58  ? 89.776  51.487 54.042 1.00 60.24  ? 52  SER E O   1 
ATOM   3994 C CB  . SER E 1 58  ? 92.062  52.076 51.964 1.00 58.10  ? 52  SER E CB  1 
ATOM   3995 O OG  . SER E 1 58  ? 91.990  53.428 51.524 1.00 59.71  ? 52  SER E OG  1 
ATOM   3996 N N   . THR E 1 59  ? 89.061  53.072 52.604 1.00 60.64  ? 53  THR E N   1 
ATOM   3997 C CA  . THR E 1 59  ? 88.157  53.738 53.560 1.00 57.90  ? 53  THR E CA  1 
ATOM   3998 C C   . THR E 1 59  ? 87.079  52.815 54.165 1.00 63.85  ? 53  THR E C   1 
ATOM   3999 O O   . THR E 1 59  ? 86.128  52.405 53.481 1.00 61.28  ? 53  THR E O   1 
ATOM   4000 C CB  . THR E 1 59  ? 87.438  54.954 52.897 1.00 54.48  ? 53  THR E CB  1 
ATOM   4001 O OG1 . THR E 1 59  ? 88.388  55.725 52.155 1.00 49.10  ? 53  THR E OG1 1 
ATOM   4002 C CG2 . THR E 1 59  ? 86.752  55.851 53.942 1.00 41.59  ? 53  THR E CG2 1 
ATOM   4003 N N   . ARG E 1 60  ? 87.245  52.466 55.441 1.00 66.55  ? 54  ARG E N   1 
ATOM   4004 C CA  . ARG E 1 60  ? 86.268  51.625 56.127 1.00 67.78  ? 54  ARG E CA  1 
ATOM   4005 C C   . ARG E 1 60  ? 84.948  52.392 56.206 1.00 67.85  ? 54  ARG E C   1 
ATOM   4006 O O   . ARG E 1 60  ? 84.936  53.622 56.232 1.00 65.10  ? 54  ARG E O   1 
ATOM   4007 C CB  . ARG E 1 60  ? 86.735  51.284 57.553 1.00 72.32  ? 54  ARG E CB  1 
ATOM   4008 C CG  . ARG E 1 60  ? 87.518  49.979 57.702 1.00 72.23  ? 54  ARG E CG  1 
ATOM   4009 C CD  . ARG E 1 60  ? 88.115  49.835 59.111 1.00 77.14  ? 54  ARG E CD  1 
ATOM   4010 N NE  . ARG E 1 60  ? 89.272  50.720 59.318 1.00 84.62  ? 54  ARG E NE  1 
ATOM   4011 C CZ  . ARG E 1 60  ? 90.549  50.331 59.256 1.00 85.78  ? 54  ARG E CZ  1 
ATOM   4012 N NH1 . ARG E 1 60  ? 90.850  49.066 58.997 1.00 84.90  ? 54  ARG E NH1 1 
ATOM   4013 N NH2 . ARG E 1 60  ? 91.530  51.219 59.407 1.00 90.38  ? 54  ARG E NH2 1 
ATOM   4014 N N   . GLU E 1 61  ? 83.837  51.663 56.176 1.00 68.69  ? 55  GLU E N   1 
ATOM   4015 C CA  . GLU E 1 61  ? 82.517  52.273 56.273 1.00 67.43  ? 55  GLU E CA  1 
ATOM   4016 C C   . GLU E 1 61  ? 82.171  52.383 57.762 1.00 65.50  ? 55  GLU E C   1 
ATOM   4017 O O   . GLU E 1 61  ? 82.781  51.711 58.603 1.00 68.50  ? 55  GLU E O   1 
ATOM   4018 C CB  . GLU E 1 61  ? 81.483  51.428 55.507 1.00 66.01  ? 55  GLU E CB  1 
ATOM   4019 C CG  . GLU E 1 61  ? 80.002  51.737 55.806 1.00 66.73  ? 55  GLU E CG  1 
ATOM   4020 C CD  . GLU E 1 61  ? 79.487  53.050 55.209 1.00 70.05  ? 55  GLU E CD  1 
ATOM   4021 O OE1 . GLU E 1 61  ? 79.632  54.112 55.847 1.00 69.80  ? 55  GLU E OE1 1 
ATOM   4022 O OE2 . GLU E 1 61  ? 78.881  53.015 54.117 1.00 74.56  ? 55  GLU E OE2 1 
ATOM   4023 N N   . SER E 1 62  ? 81.230  53.256 58.094 1.00 61.47  ? 56  SER E N   1 
ATOM   4024 C CA  . SER E 1 62  ? 80.816  53.448 59.474 1.00 61.77  ? 56  SER E CA  1 
ATOM   4025 C C   . SER E 1 62  ? 80.486  52.130 60.158 1.00 60.73  ? 56  SER E C   1 
ATOM   4026 O O   . SER E 1 62  ? 79.793  51.275 59.595 1.00 64.68  ? 56  SER E O   1 
ATOM   4027 C CB  . SER E 1 62  ? 79.606  54.363 59.518 1.00 61.89  ? 56  SER E CB  1 
ATOM   4028 O OG  . SER E 1 62  ? 79.867  55.538 58.767 1.00 67.08  ? 56  SER E OG  1 
ATOM   4029 N N   . GLY E 1 63  ? 81.043  51.952 61.349 1.00 57.89  ? 57  GLY E N   1 
ATOM   4030 C CA  . GLY E 1 63  ? 80.803  50.744 62.112 1.00 56.66  ? 57  GLY E CA  1 
ATOM   4031 C C   . GLY E 1 63  ? 81.677  49.559 61.752 1.00 56.89  ? 57  GLY E C   1 
ATOM   4032 O O   . GLY E 1 63  ? 81.788  48.627 62.537 1.00 55.77  ? 57  GLY E O   1 
ATOM   4033 N N   . VAL E 1 64  ? 82.342  49.599 60.609 1.00 57.10  ? 58  VAL E N   1 
ATOM   4034 C CA  . VAL E 1 64  ? 83.166  48.470 60.211 1.00 62.70  ? 58  VAL E CA  1 
ATOM   4035 C C   . VAL E 1 64  ? 84.388  48.234 61.111 1.00 69.19  ? 58  VAL E C   1 
ATOM   4036 O O   . VAL E 1 64  ? 85.258  49.108 61.228 1.00 67.93  ? 58  VAL E O   1 
ATOM   4037 C CB  . VAL E 1 64  ? 83.619  48.597 58.741 1.00 62.84  ? 58  VAL E CB  1 
ATOM   4038 C CG1 . VAL E 1 64  ? 84.377  47.357 58.320 1.00 61.20  ? 58  VAL E CG1 1 
ATOM   4039 C CG2 . VAL E 1 64  ? 82.421  48.795 57.836 1.00 59.67  ? 58  VAL E CG2 1 
ATOM   4040 N N   . PRO E 1 65  ? 84.451  47.053 61.773 1.00 74.12  ? 59  PRO E N   1 
ATOM   4041 C CA  . PRO E 1 65  ? 85.551  46.664 62.669 1.00 75.53  ? 59  PRO E CA  1 
ATOM   4042 C C   . PRO E 1 65  ? 86.915  46.728 61.960 1.00 77.69  ? 59  PRO E C   1 
ATOM   4043 O O   . PRO E 1 65  ? 87.062  46.261 60.827 1.00 78.12  ? 59  PRO E O   1 
ATOM   4044 C CB  . PRO E 1 65  ? 85.183  45.225 63.043 1.00 74.46  ? 59  PRO E CB  1 
ATOM   4045 C CG  . PRO E 1 65  ? 83.693  45.257 63.072 1.00 71.19  ? 59  PRO E CG  1 
ATOM   4046 C CD  . PRO E 1 65  ? 83.392  46.022 61.790 1.00 75.35  ? 59  PRO E CD  1 
ATOM   4047 N N   . ASP E 1 66  ? 87.927  47.217 62.675 1.00 78.35  ? 60  ASP E N   1 
ATOM   4048 C CA  . ASP E 1 66  ? 89.274  47.387 62.123 1.00 75.15  ? 60  ASP E CA  1 
ATOM   4049 C C   . ASP E 1 66  ? 90.051  46.159 61.678 1.00 72.69  ? 60  ASP E C   1 
ATOM   4050 O O   . ASP E 1 66  ? 91.127  46.299 61.108 1.00 73.93  ? 60  ASP E O   1 
ATOM   4051 C CB  . ASP E 1 66  ? 90.145  48.237 63.049 1.00 72.14  ? 60  ASP E CB  1 
ATOM   4052 C CG  . ASP E 1 66  ? 89.630  49.657 63.201 1.00 74.16  ? 60  ASP E CG  1 
ATOM   4053 O OD1 . ASP E 1 66  ? 89.004  50.195 62.256 1.00 74.61  ? 60  ASP E OD1 1 
ATOM   4054 O OD2 . ASP E 1 66  ? 89.858  50.236 64.284 1.00 78.04  ? 60  ASP E OD2 1 
ATOM   4055 N N   . ARG E 1 67  ? 89.550  44.961 61.949 1.00 70.45  ? 61  ARG E N   1 
ATOM   4056 C CA  . ARG E 1 67  ? 90.257  43.775 61.492 1.00 69.24  ? 61  ARG E CA  1 
ATOM   4057 C C   . ARG E 1 67  ? 90.112  43.722 59.973 1.00 70.28  ? 61  ARG E C   1 
ATOM   4058 O O   . ARG E 1 67  ? 90.815  42.966 59.304 1.00 70.46  ? 61  ARG E O   1 
ATOM   4059 C CB  . ARG E 1 67  ? 89.671  42.514 62.115 1.00 70.83  ? 61  ARG E CB  1 
ATOM   4060 C CG  . ARG E 1 67  ? 88.166  42.410 61.967 1.00 76.97  ? 61  ARG E CG  1 
ATOM   4061 C CD  . ARG E 1 67  ? 87.591  41.128 62.568 1.00 75.34  ? 61  ARG E CD  1 
ATOM   4062 N NE  . ARG E 1 67  ? 86.174  41.310 62.880 1.00 73.76  ? 61  ARG E NE  1 
ATOM   4063 C CZ  . ARG E 1 67  ? 85.727  41.916 63.976 1.00 72.44  ? 61  ARG E CZ  1 
ATOM   4064 N NH1 . ARG E 1 67  ? 86.588  42.391 64.870 1.00 70.49  ? 61  ARG E NH1 1 
ATOM   4065 N NH2 . ARG E 1 67  ? 84.422  42.094 64.160 1.00 73.95  ? 61  ARG E NH2 1 
ATOM   4066 N N   . PHE E 1 68  ? 89.194  44.531 59.443 1.00 71.11  ? 62  PHE E N   1 
ATOM   4067 C CA  . PHE E 1 68  ? 88.915  44.603 58.005 1.00 77.89  ? 62  PHE E CA  1 
ATOM   4068 C C   . PHE E 1 68  ? 89.853  45.611 57.310 1.00 81.16  ? 62  PHE E C   1 
ATOM   4069 O O   . PHE E 1 68  ? 89.695  46.825 57.485 1.00 84.93  ? 62  PHE E O   1 
ATOM   4070 C CB  . PHE E 1 68  ? 87.443  45.033 57.751 1.00 79.18  ? 62  PHE E CB  1 
ATOM   4071 C CG  . PHE E 1 68  ? 86.396  44.005 58.163 1.00 74.40  ? 62  PHE E CG  1 
ATOM   4072 C CD1 . PHE E 1 68  ? 86.443  42.702 57.671 1.00 70.15  ? 62  PHE E CD1 1 
ATOM   4073 C CD2 . PHE E 1 68  ? 85.366  44.354 59.042 1.00 70.52  ? 62  PHE E CD2 1 
ATOM   4074 C CE1 . PHE E 1 68  ? 85.491  41.768 58.050 1.00 73.66  ? 62  PHE E CE1 1 
ATOM   4075 C CE2 . PHE E 1 68  ? 84.403  43.426 59.430 1.00 69.94  ? 62  PHE E CE2 1 
ATOM   4076 C CZ  . PHE E 1 68  ? 84.466  42.131 58.935 1.00 73.83  ? 62  PHE E CZ  1 
ATOM   4077 N N   . ILE E 1 69  ? 90.787  45.127 56.490 1.00 81.65  ? 63  ILE E N   1 
ATOM   4078 C CA  . ILE E 1 69  ? 91.737  45.992 55.787 1.00 80.23  ? 63  ILE E CA  1 
ATOM   4079 C C   . ILE E 1 69  ? 91.626  45.980 54.260 1.00 76.50  ? 63  ILE E C   1 
ATOM   4080 O O   . ILE E 1 69  ? 91.822  44.957 53.592 1.00 73.87  ? 63  ILE E O   1 
ATOM   4081 C CB  . ILE E 1 69  ? 93.222  45.679 56.181 1.00 81.83  ? 63  ILE E CB  1 
ATOM   4082 C CG1 . ILE E 1 69  ? 93.440  45.905 57.686 1.00 78.45  ? 63  ILE E CG1 1 
ATOM   4083 C CG2 . ILE E 1 69  ? 94.197  46.544 55.355 1.00 76.81  ? 63  ILE E CG2 1 
ATOM   4084 C CD1 . ILE E 1 69  ? 93.729  44.641 58.477 1.00 77.93  ? 63  ILE E CD1 1 
ATOM   4085 N N   . GLY E 1 70  ? 91.290  47.138 53.718 1.00 74.08  ? 64  GLY E N   1 
ATOM   4086 C CA  . GLY E 1 70  ? 91.196  47.265 52.289 1.00 71.21  ? 64  GLY E CA  1 
ATOM   4087 C C   . GLY E 1 70  ? 92.540  47.747 51.784 1.00 68.62  ? 64  GLY E C   1 
ATOM   4088 O O   . GLY E 1 70  ? 93.020  48.814 52.164 1.00 67.53  ? 64  GLY E O   1 
ATOM   4089 N N   . SER E 1 71  ? 93.176  46.926 50.971 1.00 68.17  ? 65  SER E N   1 
ATOM   4090 C CA  . SER E 1 71  ? 94.456  47.256 50.380 1.00 66.12  ? 65  SER E CA  1 
ATOM   4091 C C   . SER E 1 71  ? 94.175  47.281 48.881 1.00 66.24  ? 65  SER E C   1 
ATOM   4092 O O   . SER E 1 71  ? 93.088  46.868 48.438 1.00 67.06  ? 65  SER E O   1 
ATOM   4093 C CB  . SER E 1 71  ? 95.470  46.152 50.692 1.00 67.11  ? 65  SER E CB  1 
ATOM   4094 O OG  . SER E 1 71  ? 95.438  45.807 52.067 1.00 70.84  ? 65  SER E OG  1 
ATOM   4095 N N   . GLY E 1 72  ? 95.130  47.793 48.108 1.00 66.21  ? 66  GLY E N   1 
ATOM   4096 C CA  . GLY E 1 72  ? 94.975  47.822 46.664 1.00 64.63  ? 66  GLY E CA  1 
ATOM   4097 C C   . GLY E 1 72  ? 95.257  49.121 45.938 1.00 66.07  ? 66  GLY E C   1 
ATOM   4098 O O   . GLY E 1 72  ? 95.336  50.193 46.551 1.00 63.60  ? 66  GLY E O   1 
ATOM   4099 N N   . SER E 1 73  ? 95.404  49.001 44.615 1.00 70.77  ? 67  SER E N   1 
ATOM   4100 C CA  . SER E 1 73  ? 95.668  50.122 43.697 1.00 70.54  ? 67  SER E CA  1 
ATOM   4101 C C   . SER E 1 73  ? 95.704  49.634 42.239 1.00 65.47  ? 67  SER E C   1 
ATOM   4102 O O   . SER E 1 73  ? 96.056  48.475 41.948 1.00 62.33  ? 67  SER E O   1 
ATOM   4103 C CB  . SER E 1 73  ? 96.995  50.810 44.049 1.00 75.88  ? 67  SER E CB  1 
ATOM   4104 O OG  . SER E 1 73  ? 98.021  49.845 44.274 1.00 87.64  ? 67  SER E OG  1 
ATOM   4105 N N   . GLY E 1 74  ? 95.291  50.500 41.324 1.00 59.10  ? 68  GLY E N   1 
ATOM   4106 C CA  . GLY E 1 74  ? 95.305  50.122 39.921 1.00 57.63  ? 68  GLY E CA  1 
ATOM   4107 C C   . GLY E 1 74  ? 94.377  48.978 39.528 1.00 55.97  ? 68  GLY E C   1 
ATOM   4108 O O   . GLY E 1 74  ? 93.194  49.191 39.278 1.00 52.92  ? 68  GLY E O   1 
ATOM   4109 N N   . THR E 1 75  ? 94.899  47.761 39.492 1.00 54.64  ? 69  THR E N   1 
ATOM   4110 C CA  . THR E 1 75  ? 94.086  46.631 39.080 1.00 54.79  ? 69  THR E CA  1 
ATOM   4111 C C   . THR E 1 75  ? 94.014  45.503 40.093 1.00 57.50  ? 69  THR E C   1 
ATOM   4112 O O   . THR E 1 75  ? 93.091  44.696 40.036 1.00 61.16  ? 69  THR E O   1 
ATOM   4113 C CB  . THR E 1 75  ? 94.596  46.018 37.743 1.00 49.42  ? 69  THR E CB  1 
ATOM   4114 O OG1 . THR E 1 75  ? 95.985  45.712 37.869 1.00 45.41  ? 69  THR E OG1 1 
ATOM   4115 C CG2 . THR E 1 75  ? 94.415  46.976 36.590 1.00 40.22  ? 69  THR E CG2 1 
ATOM   4116 N N   . ASP E 1 76  ? 94.951  45.443 41.030 1.00 57.59  ? 70  ASP E N   1 
ATOM   4117 C CA  . ASP E 1 76  ? 94.951  44.335 41.979 1.00 63.01  ? 70  ASP E CA  1 
ATOM   4118 C C   . ASP E 1 76  ? 94.709  44.757 43.425 1.00 66.83  ? 70  ASP E C   1 
ATOM   4119 O O   . ASP E 1 76  ? 95.594  45.342 44.066 1.00 71.96  ? 70  ASP E O   1 
ATOM   4120 C CB  . ASP E 1 76  ? 96.262  43.543 41.859 1.00 68.75  ? 70  ASP E CB  1 
ATOM   4121 C CG  . ASP E 1 76  ? 96.737  43.393 40.403 1.00 71.75  ? 70  ASP E CG  1 
ATOM   4122 O OD1 . ASP E 1 76  ? 96.041  42.752 39.583 1.00 67.38  ? 70  ASP E OD1 1 
ATOM   4123 O OD2 . ASP E 1 76  ? 97.809  43.946 40.077 1.00 79.10  ? 70  ASP E OD2 1 
ATOM   4124 N N   . PHE E 1 77  ? 93.532  44.400 43.952 1.00 65.42  ? 71  PHE E N   1 
ATOM   4125 C CA  . PHE E 1 77  ? 93.127  44.754 45.319 1.00 58.97  ? 71  PHE E CA  1 
ATOM   4126 C C   . PHE E 1 77  ? 93.083  43.602 46.333 1.00 57.26  ? 71  PHE E C   1 
ATOM   4127 O O   . PHE E 1 77  ? 93.220  42.422 45.960 1.00 48.65  ? 71  PHE E O   1 
ATOM   4128 C CB  . PHE E 1 77  ? 91.790  45.491 45.280 1.00 55.70  ? 71  PHE E CB  1 
ATOM   4129 C CG  . PHE E 1 77  ? 91.804  46.727 44.407 1.00 66.39  ? 71  PHE E CG  1 
ATOM   4130 C CD1 . PHE E 1 77  ? 91.717  46.626 43.019 1.00 70.36  ? 71  PHE E CD1 1 
ATOM   4131 C CD2 . PHE E 1 77  ? 91.887  47.999 44.977 1.00 70.45  ? 71  PHE E CD2 1 
ATOM   4132 C CE1 . PHE E 1 77  ? 91.714  47.774 42.208 1.00 72.40  ? 71  PHE E CE1 1 
ATOM   4133 C CE2 . PHE E 1 77  ? 91.884  49.153 44.174 1.00 70.46  ? 71  PHE E CE2 1 
ATOM   4134 C CZ  . PHE E 1 77  ? 91.796  49.042 42.790 1.00 70.41  ? 71  PHE E CZ  1 
ATOM   4135 N N   . THR E 1 78  ? 92.854  43.944 47.607 1.00 56.02  ? 72  THR E N   1 
ATOM   4136 C CA  . THR E 1 78  ? 92.824  42.935 48.673 1.00 54.94  ? 72  THR E CA  1 
ATOM   4137 C C   . THR E 1 78  ? 92.042  43.281 49.931 1.00 52.99  ? 72  THR E C   1 
ATOM   4138 O O   . THR E 1 78  ? 92.314  44.295 50.578 1.00 49.04  ? 72  THR E O   1 
ATOM   4139 C CB  . THR E 1 78  ? 94.256  42.600 49.135 1.00 55.71  ? 72  THR E CB  1 
ATOM   4140 O OG1 . THR E 1 78  ? 95.043  42.248 47.992 1.00 65.20  ? 72  THR E OG1 1 
ATOM   4141 C CG2 . THR E 1 78  ? 94.260  41.444 50.123 1.00 56.25  ? 72  THR E CG2 1 
ATOM   4142 N N   . LEU E 1 79  ? 91.039  42.466 50.247 1.00 52.15  ? 73  LEU E N   1 
ATOM   4143 C CA  . LEU E 1 79  ? 90.307  42.664 51.479 1.00 54.51  ? 73  LEU E CA  1 
ATOM   4144 C C   . LEU E 1 79  ? 91.012  41.713 52.402 1.00 59.01  ? 73  LEU E C   1 
ATOM   4145 O O   . LEU E 1 79  ? 91.315  40.572 52.035 1.00 61.59  ? 73  LEU E O   1 
ATOM   4146 C CB  . LEU E 1 79  ? 88.836  42.285 51.382 1.00 53.76  ? 73  LEU E CB  1 
ATOM   4147 C CG  . LEU E 1 79  ? 88.136  42.587 52.720 1.00 55.99  ? 73  LEU E CG  1 
ATOM   4148 C CD1 . LEU E 1 79  ? 88.554  43.956 53.256 1.00 53.38  ? 73  LEU E CD1 1 
ATOM   4149 C CD2 . LEU E 1 79  ? 86.632  42.526 52.554 1.00 58.85  ? 73  LEU E CD2 1 
ATOM   4150 N N   . THR E 1 80  ? 91.275  42.169 53.606 1.00 63.19  ? 74  THR E N   1 
ATOM   4151 C CA  . THR E 1 80  ? 91.991  41.350 54.554 1.00 66.97  ? 74  THR E CA  1 
ATOM   4152 C C   . THR E 1 80  ? 91.360  41.479 55.918 1.00 67.51  ? 74  THR E C   1 
ATOM   4153 O O   . THR E 1 80  ? 90.859  42.525 56.305 1.00 63.17  ? 74  THR E O   1 
ATOM   4154 C CB  . THR E 1 80  ? 93.462  41.772 54.562 1.00 67.97  ? 74  THR E CB  1 
ATOM   4155 O OG1 . THR E 1 80  ? 93.930  41.806 53.212 1.00 70.56  ? 74  THR E OG1 1 
ATOM   4156 C CG2 . THR E 1 80  ? 94.306  40.789 55.366 1.00 70.04  ? 74  THR E CG2 1 
ATOM   4157 N N   . ILE E 1 81  ? 91.316  40.373 56.623 1.00 70.89  ? 75  ILE E N   1 
ATOM   4158 C CA  . ILE E 1 81  ? 90.716  40.377 57.935 1.00 77.59  ? 75  ILE E CA  1 
ATOM   4159 C C   . ILE E 1 81  ? 91.786  39.780 58.838 1.00 78.66  ? 75  ILE E C   1 
ATOM   4160 O O   . ILE E 1 81  ? 92.239  38.665 58.619 1.00 79.99  ? 75  ILE E O   1 
ATOM   4161 C CB  . ILE E 1 81  ? 89.370  39.586 57.890 1.00 80.51  ? 75  ILE E CB  1 
ATOM   4162 C CG1 . ILE E 1 81  ? 88.586  40.017 56.631 1.00 80.43  ? 75  ILE E CG1 1 
ATOM   4163 C CG2 . ILE E 1 81  ? 88.525  39.907 59.137 1.00 79.88  ? 75  ILE E CG2 1 
ATOM   4164 C CD1 . ILE E 1 81  ? 87.354  39.200 56.301 1.00 77.09  ? 75  ILE E CD1 1 
ATOM   4165 N N   . SER E 1 82  ? 92.316  40.609 59.732 1.00 79.73  ? 76  SER E N   1 
ATOM   4166 C CA  . SER E 1 82  ? 93.373  40.187 60.648 1.00 81.54  ? 76  SER E CA  1 
ATOM   4167 C C   . SER E 1 82  ? 92.962  38.979 61.508 1.00 86.11  ? 76  SER E C   1 
ATOM   4168 O O   . SER E 1 82  ? 93.366  37.843 61.234 1.00 85.26  ? 76  SER E O   1 
ATOM   4169 C CB  . SER E 1 82  ? 93.804  41.374 61.513 1.00 74.97  ? 76  SER E CB  1 
ATOM   4170 O OG  . SER E 1 82  ? 92.680  42.086 61.989 1.00 64.20  ? 76  SER E OG  1 
ATOM   4171 N N   . SER E 1 83  ? 92.198  39.232 62.570 1.00 88.12  ? 77  SER E N   1 
ATOM   4172 C CA  . SER E 1 83  ? 91.726  38.147 63.417 1.00 91.38  ? 77  SER E CA  1 
ATOM   4173 C C   . SER E 1 83  ? 90.249  37.940 63.075 1.00 94.29  ? 77  SER E C   1 
ATOM   4174 O O   . SER E 1 83  ? 89.403  38.819 63.321 1.00 95.98  ? 77  SER E O   1 
ATOM   4175 C CB  . SER E 1 83  ? 91.949  38.445 64.916 1.00 89.84  ? 77  SER E CB  1 
ATOM   4176 O OG  . SER E 1 83  ? 91.161  39.525 65.394 1.00 86.30  ? 77  SER E OG  1 
ATOM   4177 N N   . VAL E 1 84  ? 89.966  36.821 62.413 1.00 93.99  ? 78  VAL E N   1 
ATOM   4178 C CA  . VAL E 1 84  ? 88.602  36.467 62.001 1.00 95.19  ? 78  VAL E CA  1 
ATOM   4179 C C   . VAL E 1 84  ? 87.704  36.087 63.188 1.00 98.15  ? 78  VAL E C   1 
ATOM   4180 O O   . VAL E 1 84  ? 88.105  35.291 64.038 1.00 100.00 ? 78  VAL E O   1 
ATOM   4181 C CB  . VAL E 1 84  ? 88.645  35.291 61.016 1.00 91.30  ? 78  VAL E CB  1 
ATOM   4182 C CG1 . VAL E 1 84  ? 87.243  34.912 60.580 1.00 94.90  ? 78  VAL E CG1 1 
ATOM   4183 C CG2 . VAL E 1 84  ? 89.479  35.657 59.823 1.00 91.62  ? 78  VAL E CG2 1 
ATOM   4184 N N   . GLN E 1 85  ? 86.528  36.705 63.284 1.00 98.53  ? 79  GLN E N   1 
ATOM   4185 C CA  . GLN E 1 85  ? 85.586  36.375 64.362 1.00 99.27  ? 79  GLN E CA  1 
ATOM   4186 C C   . GLN E 1 85  ? 84.377  35.549 63.817 1.00 100.00 ? 79  GLN E C   1 
ATOM   4187 O O   . GLN E 1 85  ? 84.280  35.331 62.611 1.00 100.00 ? 79  GLN E O   1 
ATOM   4188 C CB  . GLN E 1 85  ? 85.203  37.636 65.143 1.00 100.00 ? 79  GLN E CB  1 
ATOM   4189 C CG  . GLN E 1 85  ? 86.431  38.180 65.908 1.00 100.00 ? 79  GLN E CG  1 
ATOM   4190 C CD  . GLN E 1 85  ? 86.258  39.572 66.519 1.00 100.00 ? 79  GLN E CD  1 
ATOM   4191 O OE1 . GLN E 1 85  ? 85.133  40.047 66.771 1.00 94.42  ? 79  GLN E OE1 1 
ATOM   4192 N NE2 . GLN E 1 85  ? 87.384  40.224 66.789 1.00 95.77  ? 79  GLN E NE2 1 
ATOM   4193 N N   . ALA E 1 86  ? 83.428  35.167 64.670 1.00 100.00 ? 80  ALA E N   1 
ATOM   4194 C CA  . ALA E 1 86  ? 82.334  34.293 64.228 1.00 99.40  ? 80  ALA E CA  1 
ATOM   4195 C C   . ALA E 1 86  ? 81.431  34.854 63.122 1.00 98.86  ? 80  ALA E C   1 
ATOM   4196 O O   . ALA E 1 86  ? 81.213  34.233 62.096 1.00 94.91  ? 80  ALA E O   1 
ATOM   4197 C CB  . ALA E 1 86  ? 81.511  33.870 65.425 1.00 100.00 ? 80  ALA E CB  1 
ATOM   4198 N N   . GLU E 1 87  ? 80.809  35.979 63.457 1.00 98.55  ? 81  GLU E N   1 
ATOM   4199 C CA  . GLU E 1 87  ? 79.866  36.723 62.616 1.00 96.93  ? 81  GLU E CA  1 
ATOM   4200 C C   . GLU E 1 87  ? 80.374  36.959 61.200 1.00 97.20  ? 81  GLU E C   1 
ATOM   4201 O O   . GLU E 1 87  ? 79.596  37.027 60.239 1.00 97.93  ? 81  GLU E O   1 
ATOM   4202 C CB  . GLU E 1 87  ? 79.608  38.071 63.276 1.00 95.93  ? 81  GLU E CB  1 
ATOM   4203 C CG  . GLU E 1 87  ? 80.902  38.654 63.804 1.00 97.86  ? 81  GLU E CG  1 
ATOM   4204 C CD  . GLU E 1 87  ? 80.687  39.713 64.845 1.00 100.00 ? 81  GLU E CD  1 
ATOM   4205 O OE1 . GLU E 1 87  ? 79.995  40.711 64.535 1.00 100.00 ? 81  GLU E OE1 1 
ATOM   4206 O OE2 . GLU E 1 87  ? 81.185  39.527 65.980 1.00 97.52  ? 81  GLU E OE2 1 
ATOM   4207 N N   . ASP E 1 88  ? 81.688  37.125 61.094 1.00 94.03  ? 82  ASP E N   1 
ATOM   4208 C CA  . ASP E 1 88  ? 82.341  37.364 59.811 1.00 90.72  ? 82  ASP E CA  1 
ATOM   4209 C C   . ASP E 1 88  ? 82.090  36.289 58.722 1.00 91.61  ? 82  ASP E C   1 
ATOM   4210 O O   . ASP E 1 88  ? 82.415  36.534 57.551 1.00 93.27  ? 82  ASP E O   1 
ATOM   4211 C CB  . ASP E 1 88  ? 83.851  37.597 60.035 1.00 85.19  ? 82  ASP E CB  1 
ATOM   4212 C CG  . ASP E 1 88  ? 84.151  38.847 60.882 1.00 78.94  ? 82  ASP E CG  1 
ATOM   4213 O OD1 . ASP E 1 88  ? 83.246  39.687 61.078 1.00 75.47  ? 82  ASP E OD1 1 
ATOM   4214 O OD2 . ASP E 1 88  ? 85.304  38.983 61.349 1.00 70.90  ? 82  ASP E OD2 1 
ATOM   4215 N N   . GLN E 1 89  ? 81.485  35.151 59.089 1.00 88.91  ? 83  GLN E N   1 
ATOM   4216 C CA  . GLN E 1 89  ? 81.182  34.084 58.117 1.00 83.60  ? 83  GLN E CA  1 
ATOM   4217 C C   . GLN E 1 89  ? 80.135  34.589 57.121 1.00 76.81  ? 83  GLN E C   1 
ATOM   4218 O O   . GLN E 1 89  ? 78.931  34.618 57.402 1.00 73.42  ? 83  GLN E O   1 
ATOM   4219 C CB  . GLN E 1 89  ? 80.680  32.813 58.823 1.00 88.29  ? 83  GLN E CB  1 
ATOM   4220 C CG  . GLN E 1 89  ? 80.386  31.629 57.874 1.00 90.82  ? 83  GLN E CG  1 
ATOM   4221 C CD  . GLN E 1 89  ? 79.946  30.355 58.597 1.00 90.26  ? 83  GLN E CD  1 
ATOM   4222 O OE1 . GLN E 1 89  ? 78.974  30.361 59.351 1.00 87.81  ? 83  GLN E OE1 1 
ATOM   4223 N NE2 . GLN E 1 89  ? 80.650  29.253 58.350 1.00 90.57  ? 83  GLN E NE2 1 
ATOM   4224 N N   . ALA E 1 90  ? 80.608  34.997 55.955 1.00 69.94  ? 84  ALA E N   1 
ATOM   4225 C CA  . ALA E 1 90  ? 79.704  35.519 54.958 1.00 66.52  ? 84  ALA E CA  1 
ATOM   4226 C C   . ALA E 1 90  ? 80.320  35.493 53.581 1.00 64.01  ? 84  ALA E C   1 
ATOM   4227 O O   . ALA E 1 90  ? 81.329  34.808 53.325 1.00 53.65  ? 84  ALA E O   1 
ATOM   4228 C CB  . ALA E 1 90  ? 79.299  36.954 55.324 1.00 63.25  ? 84  ALA E CB  1 
ATOM   4229 N N   . ASP E 1 91  ? 79.652  36.214 52.693 1.00 62.00  ? 85  ASP E N   1 
ATOM   4230 C CA  . ASP E 1 91  ? 80.070  36.349 51.319 1.00 63.40  ? 85  ASP E CA  1 
ATOM   4231 C C   . ASP E 1 91  ? 80.663  37.729 51.154 1.00 63.34  ? 85  ASP E C   1 
ATOM   4232 O O   . ASP E 1 91  ? 80.152  38.702 51.724 1.00 64.84  ? 85  ASP E O   1 
ATOM   4233 C CB  . ASP E 1 91  ? 78.869  36.197 50.391 1.00 64.08  ? 85  ASP E CB  1 
ATOM   4234 C CG  . ASP E 1 91  ? 78.782  34.823 49.786 1.00 65.18  ? 85  ASP E CG  1 
ATOM   4235 O OD1 . ASP E 1 91  ? 79.812  34.125 49.795 1.00 68.93  ? 85  ASP E OD1 1 
ATOM   4236 O OD2 . ASP E 1 91  ? 77.698  34.447 49.286 1.00 60.70  ? 85  ASP E OD2 1 
ATOM   4237 N N   . TYR E 1 92  ? 81.734  37.815 50.373 1.00 61.32  ? 86  TYR E N   1 
ATOM   4238 C CA  . TYR E 1 92  ? 82.394  39.082 50.137 1.00 60.53  ? 86  TYR E CA  1 
ATOM   4239 C C   . TYR E 1 92  ? 82.476  39.360 48.668 1.00 56.13  ? 86  TYR E C   1 
ATOM   4240 O O   . TYR E 1 92  ? 82.934  38.529 47.904 1.00 54.70  ? 86  TYR E O   1 
ATOM   4241 C CB  . TYR E 1 92  ? 83.773  39.068 50.765 1.00 64.48  ? 86  TYR E CB  1 
ATOM   4242 C CG  . TYR E 1 92  ? 83.685  39.077 52.271 1.00 69.87  ? 86  TYR E CG  1 
ATOM   4243 C CD1 . TYR E 1 92  ? 83.260  40.224 52.957 1.00 66.06  ? 86  TYR E CD1 1 
ATOM   4244 C CD2 . TYR E 1 92  ? 83.965  37.928 53.010 1.00 70.65  ? 86  TYR E CD2 1 
ATOM   4245 C CE1 . TYR E 1 92  ? 83.111  40.224 54.334 1.00 64.52  ? 86  TYR E CE1 1 
ATOM   4246 C CE2 . TYR E 1 92  ? 83.817  37.919 54.394 1.00 73.12  ? 86  TYR E CE2 1 
ATOM   4247 C CZ  . TYR E 1 92  ? 83.387  39.069 55.046 1.00 69.04  ? 86  TYR E CZ  1 
ATOM   4248 O OH  . TYR E 1 92  ? 83.213  39.044 56.403 1.00 69.50  ? 86  TYR E OH  1 
ATOM   4249 N N   . PHE E 1 93  ? 81.976  40.516 48.272 1.00 59.07  ? 87  PHE E N   1 
ATOM   4250 C CA  . PHE E 1 93  ? 81.975  40.908 46.876 1.00 63.76  ? 87  PHE E CA  1 
ATOM   4251 C C   . PHE E 1 93  ? 82.673  42.234 46.703 1.00 66.14  ? 87  PHE E C   1 
ATOM   4252 O O   . PHE E 1 93  ? 82.706  43.040 47.635 1.00 71.51  ? 87  PHE E O   1 
ATOM   4253 C CB  . PHE E 1 93  ? 80.541  41.086 46.375 1.00 66.99  ? 87  PHE E CB  1 
ATOM   4254 C CG  . PHE E 1 93  ? 79.722  39.849 46.441 1.00 76.22  ? 87  PHE E CG  1 
ATOM   4255 C CD1 . PHE E 1 93  ? 79.919  38.821 45.523 1.00 79.97  ? 87  PHE E CD1 1 
ATOM   4256 C CD2 . PHE E 1 93  ? 78.751  39.702 47.421 1.00 78.28  ? 87  PHE E CD2 1 
ATOM   4257 C CE1 . PHE E 1 93  ? 79.163  37.662 45.579 1.00 79.15  ? 87  PHE E CE1 1 
ATOM   4258 C CE2 . PHE E 1 93  ? 77.986  38.549 47.488 1.00 81.42  ? 87  PHE E CE2 1 
ATOM   4259 C CZ  . PHE E 1 93  ? 78.194  37.524 46.562 1.00 82.07  ? 87  PHE E CZ  1 
ATOM   4260 N N   . CYS E 1 94  ? 83.195  42.473 45.502 1.00 65.54  ? 88  CYS E N   1 
ATOM   4261 C CA  . CYS E 1 94  ? 83.844  43.740 45.165 1.00 59.39  ? 88  CYS E CA  1 
ATOM   4262 C C   . CYS E 1 94  ? 83.180  44.285 43.901 1.00 53.68  ? 88  CYS E C   1 
ATOM   4263 O O   . CYS E 1 94  ? 82.821  43.529 43.000 1.00 53.93  ? 88  CYS E O   1 
ATOM   4264 C CB  . CYS E 1 94  ? 85.352  43.565 44.945 1.00 55.01  ? 88  CYS E CB  1 
ATOM   4265 S SG  . CYS E 1 94  ? 85.778  42.656 43.426 1.00 55.69  ? 88  CYS E SG  1 
ATOM   4266 N N   . GLN E 1 95  ? 82.916  45.581 43.895 1.00 49.37  ? 89  GLN E N   1 
ATOM   4267 C CA  . GLN E 1 95  ? 82.306  46.234 42.746 1.00 44.88  ? 89  GLN E CA  1 
ATOM   4268 C C   . GLN E 1 95  ? 83.225  47.433 42.390 1.00 47.30  ? 89  GLN E C   1 
ATOM   4269 O O   . GLN E 1 95  ? 83.898  48.011 43.264 1.00 46.27  ? 89  GLN E O   1 
ATOM   4270 C CB  . GLN E 1 95  ? 80.886  46.717 43.108 1.00 32.85  ? 89  GLN E CB  1 
ATOM   4271 C CG  . GLN E 1 95  ? 80.073  47.276 41.936 1.00 28.68  ? 89  GLN E CG  1 
ATOM   4272 C CD  . GLN E 1 95  ? 78.908  48.168 42.377 1.00 30.78  ? 89  GLN E CD  1 
ATOM   4273 O OE1 . GLN E 1 95  ? 78.746  48.473 43.562 1.00 35.33  ? 89  GLN E OE1 1 
ATOM   4274 N NE2 . GLN E 1 95  ? 78.086  48.585 41.425 1.00 29.11  ? 89  GLN E NE2 1 
ATOM   4275 N N   . GLN E 1 96  ? 83.332  47.749 41.108 1.00 44.18  ? 90  GLN E N   1 
ATOM   4276 C CA  . GLN E 1 96  ? 84.129  48.892 40.719 1.00 42.47  ? 90  GLN E CA  1 
ATOM   4277 C C   . GLN E 1 96  ? 83.188  50.058 40.407 1.00 44.72  ? 90  GLN E C   1 
ATOM   4278 O O   . GLN E 1 96  ? 82.072  49.870 39.912 1.00 40.09  ? 90  GLN E O   1 
ATOM   4279 C CB  . GLN E 1 96  ? 85.047  48.556 39.540 1.00 42.21  ? 90  GLN E CB  1 
ATOM   4280 C CG  . GLN E 1 96  ? 84.358  48.120 38.256 1.00 43.30  ? 90  GLN E CG  1 
ATOM   4281 C CD  . GLN E 1 96  ? 83.896  49.293 37.417 1.00 45.98  ? 90  GLN E CD  1 
ATOM   4282 O OE1 . GLN E 1 96  ? 84.291  50.435 37.671 1.00 47.96  ? 90  GLN E OE1 1 
ATOM   4283 N NE2 . GLN E 1 96  ? 83.046  49.027 36.427 1.00 43.31  ? 90  GLN E NE2 1 
ATOM   4284 N N   . HIS E 1 97  ? 83.610  51.262 40.749 1.00 48.77  ? 91  HIS E N   1 
ATOM   4285 C CA  . HIS E 1 97  ? 82.786  52.429 40.488 1.00 52.71  ? 91  HIS E CA  1 
ATOM   4286 C C   . HIS E 1 97  ? 83.473  53.406 39.539 1.00 52.72  ? 91  HIS E C   1 
ATOM   4287 O O   . HIS E 1 97  ? 83.050  54.561 39.414 1.00 45.72  ? 91  HIS E O   1 
ATOM   4288 C CB  . HIS E 1 97  ? 82.398  53.105 41.804 1.00 54.78  ? 91  HIS E CB  1 
ATOM   4289 C CG  . HIS E 1 97  ? 81.568  52.242 42.694 1.00 53.55  ? 91  HIS E CG  1 
ATOM   4290 N ND1 . HIS E 1 97  ? 80.181  52.287 42.653 1.00 50.05  ? 91  HIS E ND1 1 
ATOM   4291 C CD2 . HIS E 1 97  ? 81.947  51.291 43.573 1.00 51.09  ? 91  HIS E CD2 1 
ATOM   4292 C CE1 . HIS E 1 97  ? 79.770  51.372 43.497 1.00 42.39  ? 91  HIS E CE1 1 
ATOM   4293 N NE2 . HIS E 1 97  ? 80.803  50.736 44.085 1.00 52.28  ? 91  HIS E NE2 1 
ATOM   4294 N N   . TYR E 1 98  ? 84.519  52.922 38.862 1.00 54.61  ? 92  TYR E N   1 
ATOM   4295 C CA  . TYR E 1 98  ? 85.276  53.721 37.899 1.00 59.89  ? 92  TYR E CA  1 
ATOM   4296 C C   . TYR E 1 98  ? 84.428  54.006 36.628 1.00 58.26  ? 92  TYR E C   1 
ATOM   4297 O O   . TYR E 1 98  ? 84.072  55.153 36.375 1.00 56.34  ? 92  TYR E O   1 
ATOM   4298 C CB  . TYR E 1 98  ? 86.629  53.035 37.579 1.00 66.87  ? 92  TYR E CB  1 
ATOM   4299 C CG  . TYR E 1 98  ? 87.598  53.805 36.660 1.00 78.04  ? 92  TYR E CG  1 
ATOM   4300 C CD1 . TYR E 1 98  ? 87.943  55.141 36.903 1.00 81.90  ? 92  TYR E CD1 1 
ATOM   4301 C CD2 . TYR E 1 98  ? 88.164  53.186 35.536 1.00 82.04  ? 92  TYR E CD2 1 
ATOM   4302 C CE1 . TYR E 1 98  ? 88.834  55.833 36.045 1.00 87.24  ? 92  TYR E CE1 1 
ATOM   4303 C CE2 . TYR E 1 98  ? 89.053  53.866 34.677 1.00 85.63  ? 92  TYR E CE2 1 
ATOM   4304 C CZ  . TYR E 1 98  ? 89.379  55.185 34.931 1.00 87.98  ? 92  TYR E CZ  1 
ATOM   4305 O OH  . TYR E 1 98  ? 90.237  55.849 34.073 1.00 86.62  ? 92  TYR E OH  1 
ATOM   4306 N N   . ARG E 1 99  ? 84.090  52.982 35.843 1.00 59.48  ? 93  ARG E N   1 
ATOM   4307 C CA  . ARG E 1 99  ? 83.273  53.169 34.624 1.00 59.50  ? 93  ARG E CA  1 
ATOM   4308 C C   . ARG E 1 99  ? 81.950  52.360 34.669 1.00 59.45  ? 93  ARG E C   1 
ATOM   4309 O O   . ARG E 1 99  ? 81.817  51.398 35.433 1.00 54.86  ? 93  ARG E O   1 
ATOM   4310 C CB  . ARG E 1 99  ? 84.057  52.771 33.349 1.00 58.69  ? 93  ARG E CB  1 
ATOM   4311 C CG  . ARG E 1 99  ? 85.222  53.680 32.948 1.00 61.86  ? 93  ARG E CG  1 
ATOM   4312 C CD  . ARG E 1 99  ? 84.765  55.075 32.487 1.00 66.99  ? 93  ARG E CD  1 
ATOM   4313 N NE  . ARG E 1 99  ? 85.869  56.045 32.338 1.00 70.75  ? 93  ARG E NE  1 
ATOM   4314 C CZ  . ARG E 1 99  ? 86.531  56.630 33.344 1.00 67.66  ? 93  ARG E CZ  1 
ATOM   4315 N NH1 . ARG E 1 99  ? 86.234  56.361 34.610 1.00 60.54  ? 93  ARG E NH1 1 
ATOM   4316 N NH2 . ARG E 1 99  ? 87.483  57.516 33.086 1.00 69.31  ? 93  ARG E NH2 1 
ATOM   4317 N N   . ALA E 1 100 ? 80.967  52.795 33.880 1.00 57.92  ? 94  ALA E N   1 
ATOM   4318 C CA  . ALA E 1 100 ? 79.679  52.109 33.764 1.00 55.03  ? 94  ALA E CA  1 
ATOM   4319 C C   . ALA E 1 100 ? 79.900  51.017 32.709 1.00 57.75  ? 94  ALA E C   1 
ATOM   4320 O O   . ALA E 1 100 ? 80.618  51.223 31.720 1.00 56.33  ? 94  ALA E O   1 
ATOM   4321 C CB  . ALA E 1 100 ? 78.567  53.085 33.314 1.00 49.10  ? 94  ALA E CB  1 
ATOM   4322 N N   . PRO E 1 101 ? 79.286  49.834 32.897 1.00 57.02  ? 95  PRO E N   1 
ATOM   4323 C CA  . PRO E 1 101 ? 78.430  49.385 33.995 1.00 50.18  ? 95  PRO E CA  1 
ATOM   4324 C C   . PRO E 1 101 ? 79.311  49.029 35.171 1.00 48.27  ? 95  PRO E C   1 
ATOM   4325 O O   . PRO E 1 101 ? 80.344  48.363 34.996 1.00 46.79  ? 95  PRO E O   1 
ATOM   4326 C CB  . PRO E 1 101 ? 77.793  48.127 33.428 1.00 53.80  ? 95  PRO E CB  1 
ATOM   4327 C CG  . PRO E 1 101 ? 78.182  48.121 31.955 1.00 55.99  ? 95  PRO E CG  1 
ATOM   4328 C CD  . PRO E 1 101 ? 79.506  48.743 31.947 1.00 56.64  ? 95  PRO E CD  1 
ATOM   4329 N N   . ARG E 1 102 ? 78.899  49.447 36.364 1.00 48.74  ? 96  ARG E N   1 
ATOM   4330 C CA  . ARG E 1 102 ? 79.675  49.203 37.586 1.00 50.72  ? 96  ARG E CA  1 
ATOM   4331 C C   . ARG E 1 102 ? 79.623  47.738 38.005 1.00 48.62  ? 96  ARG E C   1 
ATOM   4332 O O   . ARG E 1 102 ? 79.001  47.360 38.992 1.00 50.58  ? 96  ARG E O   1 
ATOM   4333 C CB  . ARG E 1 102 ? 79.206  50.130 38.718 1.00 52.90  ? 96  ARG E CB  1 
ATOM   4334 C CG  . ARG E 1 102 ? 79.321  51.606 38.390 1.00 46.02  ? 96  ARG E CG  1 
ATOM   4335 C CD  . ARG E 1 102 ? 78.918  52.483 39.535 1.00 49.41  ? 96  ARG E CD  1 
ATOM   4336 N NE  . ARG E 1 102 ? 78.797  53.876 39.104 1.00 58.03  ? 96  ARG E NE  1 
ATOM   4337 C CZ  . ARG E 1 102 ? 79.183  54.935 39.819 1.00 62.83  ? 96  ARG E CZ  1 
ATOM   4338 N NH1 . ARG E 1 102 ? 79.733  54.796 41.022 1.00 60.19  ? 96  ARG E NH1 1 
ATOM   4339 N NH2 . ARG E 1 102 ? 78.984  56.152 39.336 1.00 68.80  ? 96  ARG E NH2 1 
ATOM   4340 N N   . THR E 1 103 ? 80.338  46.926 37.250 1.00 49.53  ? 97  THR E N   1 
ATOM   4341 C CA  . THR E 1 103 ? 80.386  45.494 37.454 1.00 48.93  ? 97  THR E CA  1 
ATOM   4342 C C   . THR E 1 103 ? 80.853  44.967 38.820 1.00 49.17  ? 97  THR E C   1 
ATOM   4343 O O   . THR E 1 103 ? 81.673  45.593 39.511 1.00 43.22  ? 97  THR E O   1 
ATOM   4344 C CB  . THR E 1 103 ? 81.224  44.863 36.354 1.00 45.81  ? 97  THR E CB  1 
ATOM   4345 O OG1 . THR E 1 103 ? 82.540  45.427 36.387 1.00 52.61  ? 97  THR E OG1 1 
ATOM   4346 C CG2 . THR E 1 103 ? 80.589  45.141 35.003 1.00 44.52  ? 97  THR E CG2 1 
ATOM   4347 N N   . PHE E 1 104 ? 80.335  43.785 39.166 1.00 45.76  ? 98  PHE E N   1 
ATOM   4348 C CA  . PHE E 1 104 ? 80.647  43.113 40.413 1.00 43.38  ? 98  PHE E CA  1 
ATOM   4349 C C   . PHE E 1 104 ? 81.555  41.925 40.226 1.00 45.74  ? 98  PHE E C   1 
ATOM   4350 O O   . PHE E 1 104 ? 81.727  41.423 39.117 1.00 44.85  ? 98  PHE E O   1 
ATOM   4351 C CB  . PHE E 1 104 ? 79.377  42.609 41.078 1.00 36.46  ? 98  PHE E CB  1 
ATOM   4352 C CG  . PHE E 1 104 ? 78.492  43.688 41.571 1.00 27.68  ? 98  PHE E CG  1 
ATOM   4353 C CD1 . PHE E 1 104 ? 77.591  44.306 40.711 1.00 29.82  ? 98  PHE E CD1 1 
ATOM   4354 C CD2 . PHE E 1 104 ? 78.557  44.096 42.890 1.00 24.84  ? 98  PHE E CD2 1 
ATOM   4355 C CE1 . PHE E 1 104 ? 76.758  45.319 41.156 1.00 28.35  ? 98  PHE E CE1 1 
ATOM   4356 C CE2 . PHE E 1 104 ? 77.740  45.095 43.346 1.00 30.09  ? 98  PHE E CE2 1 
ATOM   4357 C CZ  . PHE E 1 104 ? 76.831  45.718 42.475 1.00 31.09  ? 98  PHE E CZ  1 
ATOM   4358 N N   . GLY E 1 105 ? 82.125  41.487 41.342 1.00 51.96  ? 99  GLY E N   1 
ATOM   4359 C CA  . GLY E 1 105 ? 82.993  40.327 41.366 1.00 53.56  ? 99  GLY E CA  1 
ATOM   4360 C C   . GLY E 1 105 ? 82.113  39.126 41.677 1.00 52.69  ? 99  GLY E C   1 
ATOM   4361 O O   . GLY E 1 105 ? 80.974  39.284 42.145 1.00 51.03  ? 99  GLY E O   1 
ATOM   4362 N N   . GLY E 1 106 ? 82.654  37.932 41.460 1.00 49.23  ? 100 GLY E N   1 
ATOM   4363 C CA  . GLY E 1 106 ? 81.898  36.719 41.684 1.00 50.62  ? 100 GLY E CA  1 
ATOM   4364 C C   . GLY E 1 106 ? 81.744  36.365 43.135 1.00 50.49  ? 100 GLY E C   1 
ATOM   4365 O O   . GLY E 1 106 ? 80.967  35.485 43.475 1.00 52.79  ? 100 GLY E O   1 
ATOM   4366 N N   . GLY E 1 107 ? 82.493  37.051 43.981 1.00 52.68  ? 101 GLY E N   1 
ATOM   4367 C CA  . GLY E 1 107 ? 82.427  36.804 45.404 1.00 53.28  ? 101 GLY E CA  1 
ATOM   4368 C C   . GLY E 1 107 ? 83.327  35.711 45.940 1.00 58.41  ? 101 GLY E C   1 
ATOM   4369 O O   . GLY E 1 107 ? 83.848  34.867 45.194 1.00 54.86  ? 101 GLY E O   1 
ATOM   4370 N N   . THR E 1 108 ? 83.519  35.771 47.254 1.00 63.51  ? 102 THR E N   1 
ATOM   4371 C CA  . THR E 1 108 ? 84.313  34.814 48.005 1.00 69.01  ? 102 THR E CA  1 
ATOM   4372 C C   . THR E 1 108 ? 83.478  34.394 49.227 1.00 72.79  ? 102 THR E C   1 
ATOM   4373 O O   . THR E 1 108 ? 82.959  35.263 49.943 1.00 71.63  ? 102 THR E O   1 
ATOM   4374 C CB  . THR E 1 108 ? 85.628  35.441 48.521 1.00 69.10  ? 102 THR E CB  1 
ATOM   4375 O OG1 . THR E 1 108 ? 86.444  35.884 47.418 1.00 70.88  ? 102 THR E OG1 1 
ATOM   4376 C CG2 . THR E 1 108 ? 86.388  34.420 49.362 1.00 66.63  ? 102 THR E CG2 1 
ATOM   4377 N N   . LYS E 1 109 ? 83.320  33.077 49.427 1.00 79.34  ? 103 LYS E N   1 
ATOM   4378 C CA  . LYS E 1 109 ? 82.573  32.503 50.563 1.00 81.54  ? 103 LYS E CA  1 
ATOM   4379 C C   . LYS E 1 109 ? 83.487  32.180 51.755 1.00 80.46  ? 103 LYS E C   1 
ATOM   4380 O O   . LYS E 1 109 ? 84.346  31.281 51.681 1.00 77.30  ? 103 LYS E O   1 
ATOM   4381 C CB  . LYS E 1 109 ? 81.819  31.225 50.160 1.00 84.88  ? 103 LYS E CB  1 
ATOM   4382 C CG  . LYS E 1 109 ? 80.598  31.435 49.265 1.00 90.05  ? 103 LYS E CG  1 
ATOM   4383 C CD  . LYS E 1 109 ? 79.453  30.464 49.598 1.00 92.02  ? 103 LYS E CD  1 
ATOM   4384 C CE  . LYS E 1 109 ? 78.137  30.850 48.889 1.00 91.53  ? 103 LYS E CE  1 
ATOM   4385 N NZ  . LYS E 1 109 ? 76.997  29.921 49.206 1.00 89.09  ? 103 LYS E NZ  1 
ATOM   4386 N N   . LEU E 1 110 ? 83.284  32.904 52.851 1.00 79.19  ? 104 LEU E N   1 
ATOM   4387 C CA  . LEU E 1 110 ? 84.086  32.717 54.046 1.00 82.10  ? 104 LEU E CA  1 
ATOM   4388 C C   . LEU E 1 110 ? 83.517  31.622 54.948 1.00 85.68  ? 104 LEU E C   1 
ATOM   4389 O O   . LEU E 1 110 ? 82.415  31.764 55.496 1.00 80.34  ? 104 LEU E O   1 
ATOM   4390 C CB  . LEU E 1 110 ? 84.197  34.031 54.822 1.00 79.61  ? 104 LEU E CB  1 
ATOM   4391 C CG  . LEU E 1 110 ? 85.394  34.131 55.771 1.00 75.44  ? 104 LEU E CG  1 
ATOM   4392 C CD1 . LEU E 1 110 ? 86.652  34.107 54.960 1.00 76.43  ? 104 LEU E CD1 1 
ATOM   4393 C CD2 . LEU E 1 110 ? 85.351  35.404 56.565 1.00 73.88  ? 104 LEU E CD2 1 
ATOM   4394 N N   . GLU E 1 111 ? 84.271  30.527 55.077 1.00 91.43  ? 105 GLU E N   1 
ATOM   4395 C CA  . GLU E 1 111 ? 83.890  29.389 55.917 1.00 93.53  ? 105 GLU E CA  1 
ATOM   4396 C C   . GLU E 1 111 ? 84.641  29.439 57.239 1.00 94.67  ? 105 GLU E C   1 
ATOM   4397 O O   . GLU E 1 111 ? 85.856  29.593 57.249 1.00 95.02  ? 105 GLU E O   1 
ATOM   4398 C CB  . GLU E 1 111 ? 84.226  28.048 55.237 1.00 94.51  ? 105 GLU E CB  1 
ATOM   4399 C CG  . GLU E 1 111 ? 83.606  27.820 53.852 1.00 98.26  ? 105 GLU E CG  1 
ATOM   4400 C CD  . GLU E 1 111 ? 82.083  27.949 53.825 1.00 96.80  ? 105 GLU E CD  1 
ATOM   4401 O OE1 . GLU E 1 111 ? 81.444  27.934 54.910 1.00 94.19  ? 105 GLU E OE1 1 
ATOM   4402 O OE2 . GLU E 1 111 ? 81.530  28.069 52.702 1.00 93.49  ? 105 GLU E OE2 1 
ATOM   4403 N N   . ILE E 1 112 ? 83.913  29.342 58.345 1.00 95.92  ? 106 ILE E N   1 
ATOM   4404 C CA  . ILE E 1 112 ? 84.514  29.341 59.671 1.00 94.27  ? 106 ILE E CA  1 
ATOM   4405 C C   . ILE E 1 112 ? 84.401  27.949 60.271 1.00 93.73  ? 106 ILE E C   1 
ATOM   4406 O O   . ILE E 1 112 ? 83.528  27.168 59.885 1.00 91.37  ? 106 ILE E O   1 
ATOM   4407 C CB  . ILE E 1 112 ? 83.841  30.359 60.590 1.00 94.64  ? 106 ILE E CB  1 
ATOM   4408 C CG1 . ILE E 1 112 ? 84.211  31.755 60.121 1.00 96.12  ? 106 ILE E CG1 1 
ATOM   4409 C CG2 . ILE E 1 112 ? 84.286  30.178 62.050 1.00 97.02  ? 106 ILE E CG2 1 
ATOM   4410 C CD1 . ILE E 1 112 ? 83.635  32.815 60.993 1.00 100.00 ? 106 ILE E CD1 1 
ATOM   4411 N N   . LYS E 1 113 ? 85.301  27.642 61.199 1.00 93.24  ? 107 LYS E N   1 
ATOM   4412 C CA  . LYS E 1 113 ? 85.310  26.349 61.861 1.00 91.90  ? 107 LYS E CA  1 
ATOM   4413 C C   . LYS E 1 113 ? 85.205  26.582 63.359 1.00 86.39  ? 107 LYS E C   1 
ATOM   4414 O O   . LYS E 1 113 ? 85.119  27.685 63.859 1.00 15.00  ? 107 LYS E O   1 
ATOM   4415 C CB  . LYS E 1 113 ? 86.594  25.579 61.514 1.00 85.41  ? 107 LYS E CB  1 
ATOM   4416 N N   . GLY F 2 1   ? 68.076  52.401 62.459 1.00 92.88  ? 0   GLY F N   1 
ATOM   4417 C CA  . GLY F 2 1   ? 68.451  53.764 61.975 1.00 92.90  ? 0   GLY F CA  1 
ATOM   4418 C C   . GLY F 2 1   ? 67.459  54.103 60.886 1.00 93.00  ? 0   GLY F C   1 
ATOM   4419 O O   . GLY F 2 1   ? 67.598  53.642 59.758 1.00 93.00  ? 0   GLY F O   1 
ATOM   4420 N N   . GLN F 2 2   ? 66.415  54.836 61.255 1.00 90.38  ? 1   GLN F N   1 
ATOM   4421 C CA  . GLN F 2 2   ? 65.360  55.208 60.332 1.00 90.13  ? 1   GLN F CA  1 
ATOM   4422 C C   . GLN F 2 2   ? 65.815  56.017 59.115 1.00 92.23  ? 1   GLN F C   1 
ATOM   4423 O O   . GLN F 2 2   ? 65.680  57.240 59.053 1.00 94.41  ? 1   GLN F O   1 
ATOM   4424 C CB  . GLN F 2 2   ? 64.262  55.954 61.072 1.00 90.41  ? 1   GLN F CB  1 
ATOM   4425 C CG  . GLN F 2 2   ? 64.769  57.230 61.699 1.00 95.35  ? 1   GLN F CG  1 
ATOM   4426 C CD  . GLN F 2 2   ? 64.165  57.507 63.041 1.00 95.72  ? 1   GLN F CD  1 
ATOM   4427 O OE1 . GLN F 2 2   ? 63.135  56.944 63.405 1.00 97.01  ? 1   GLN F OE1 1 
ATOM   4428 N NE2 . GLN F 2 2   ? 64.810  58.381 63.801 1.00 96.39  ? 1   GLN F NE2 1 
ATOM   4429 N N   . VAL F 2 3   ? 66.423  55.309 58.180 1.00 91.92  ? 2   VAL F N   1 
ATOM   4430 C CA  . VAL F 2 3   ? 66.873  55.834 56.893 1.00 85.72  ? 2   VAL F CA  1 
ATOM   4431 C C   . VAL F 2 3   ? 66.708  54.525 56.181 1.00 80.62  ? 2   VAL F C   1 
ATOM   4432 O O   . VAL F 2 3   ? 67.560  53.637 56.259 1.00 78.62  ? 2   VAL F O   1 
ATOM   4433 C CB  . VAL F 2 3   ? 68.352  56.272 56.858 1.00 85.24  ? 2   VAL F CB  1 
ATOM   4434 C CG1 . VAL F 2 3   ? 68.797  56.448 55.406 1.00 77.03  ? 2   VAL F CG1 1 
ATOM   4435 C CG2 . VAL F 2 3   ? 68.525  57.585 57.598 1.00 81.94  ? 2   VAL F CG2 1 
ATOM   4436 N N   . GLN F 2 4   ? 65.504  54.358 55.662 1.00 75.26  ? 3   GLN F N   1 
ATOM   4437 C CA  . GLN F 2 4   ? 65.121  53.148 55.001 1.00 73.02  ? 3   GLN F CA  1 
ATOM   4438 C C   . GLN F 2 4   ? 64.849  53.309 53.502 1.00 68.98  ? 3   GLN F C   1 
ATOM   4439 O O   . GLN F 2 4   ? 64.344  54.354 53.053 1.00 61.77  ? 3   GLN F O   1 
ATOM   4440 C CB  . GLN F 2 4   ? 63.886  52.608 55.715 1.00 78.12  ? 3   GLN F CB  1 
ATOM   4441 C CG  . GLN F 2 4   ? 63.694  51.104 55.607 1.00 95.73  ? 3   GLN F CG  1 
ATOM   4442 C CD  . GLN F 2 4   ? 62.557  50.580 56.489 1.00 99.14  ? 3   GLN F CD  1 
ATOM   4443 O OE1 . GLN F 2 4   ? 61.376  50.733 56.177 1.00 100.00 ? 3   GLN F OE1 1 
ATOM   4444 N NE2 . GLN F 2 4   ? 62.918  49.917 57.580 1.00 100.00 ? 3   GLN F NE2 1 
ATOM   4445 N N   . LEU F 2 5   ? 65.292  52.314 52.728 1.00 65.77  ? 4   LEU F N   1 
ATOM   4446 C CA  . LEU F 2 5   ? 65.051  52.272 51.276 1.00 63.74  ? 4   LEU F CA  1 
ATOM   4447 C C   . LEU F 2 5   ? 64.182  51.035 51.106 1.00 57.91  ? 4   LEU F C   1 
ATOM   4448 O O   . LEU F 2 5   ? 64.623  49.924 51.404 1.00 53.74  ? 4   LEU F O   1 
ATOM   4449 C CB  . LEU F 2 5   ? 66.341  52.043 50.488 1.00 65.88  ? 4   LEU F CB  1 
ATOM   4450 C CG  . LEU F 2 5   ? 67.552  52.935 50.690 1.00 67.02  ? 4   LEU F CG  1 
ATOM   4451 C CD1 . LEU F 2 5   ? 68.616  52.647 49.634 1.00 62.90  ? 4   LEU F CD1 1 
ATOM   4452 C CD2 . LEU F 2 5   ? 67.099  54.351 50.558 1.00 68.52  ? 4   LEU F CD2 1 
ATOM   4453 N N   . VAL F 2 6   ? 62.969  51.210 50.607 1.00 55.43  ? 5   VAL F N   1 
ATOM   4454 C CA  . VAL F 2 6   ? 62.058  50.079 50.444 1.00 57.14  ? 5   VAL F CA  1 
ATOM   4455 C C   . VAL F 2 6   ? 61.531  49.958 49.009 1.00 55.16  ? 5   VAL F C   1 
ATOM   4456 O O   . VAL F 2 6   ? 60.745  50.788 48.533 1.00 57.67  ? 5   VAL F O   1 
ATOM   4457 C CB  . VAL F 2 6   ? 60.870  50.153 51.465 1.00 60.97  ? 5   VAL F CB  1 
ATOM   4458 C CG1 . VAL F 2 6   ? 59.861  49.043 51.210 1.00 64.72  ? 5   VAL F CG1 1 
ATOM   4459 C CG2 . VAL F 2 6   ? 61.392  50.067 52.913 1.00 54.11  ? 5   VAL F CG2 1 
ATOM   4460 N N   . GLU F 2 7   ? 61.942  48.883 48.348 1.00 52.38  ? 6   GLU F N   1 
ATOM   4461 C CA  . GLU F 2 7   ? 61.561  48.619 46.983 1.00 50.22  ? 6   GLU F CA  1 
ATOM   4462 C C   . GLU F 2 7   ? 60.245  47.871 47.006 1.00 51.77  ? 6   GLU F C   1 
ATOM   4463 O O   . GLU F 2 7   ? 60.055  46.862 47.725 1.00 42.76  ? 6   GLU F O   1 
ATOM   4464 C CB  . GLU F 2 7   ? 62.624  47.816 46.222 1.00 51.54  ? 6   GLU F CB  1 
ATOM   4465 C CG  . GLU F 2 7   ? 64.056  48.330 46.361 1.00 50.92  ? 6   GLU F CG  1 
ATOM   4466 C CD  . GLU F 2 7   ? 64.758  47.887 47.662 1.00 55.44  ? 6   GLU F CD  1 
ATOM   4467 O OE1 . GLU F 2 7   ? 64.073  47.594 48.677 1.00 49.33  ? 6   GLU F OE1 1 
ATOM   4468 O OE2 . GLU F 2 7   ? 66.005  47.826 47.665 1.00 60.62  ? 6   GLU F OE2 1 
ATOM   4469 N N   . SER F 2 8   ? 59.369  48.417 46.171 1.00 54.11  ? 7   SER F N   1 
ATOM   4470 C CA  . SER F 2 8   ? 58.006  48.001 45.909 1.00 51.39  ? 7   SER F CA  1 
ATOM   4471 C C   . SER F 2 8   ? 57.993  47.443 44.453 1.00 49.53  ? 7   SER F C   1 
ATOM   4472 O O   . SER F 2 8   ? 58.485  48.102 43.531 1.00 43.84  ? 7   SER F O   1 
ATOM   4473 C CB  . SER F 2 8   ? 57.132  49.261 46.070 1.00 49.49  ? 7   SER F CB  1 
ATOM   4474 O OG  . SER F 2 8   ? 55.876  49.157 45.440 1.00 61.49  ? 7   SER F OG  1 
ATOM   4475 N N   . GLY F 2 9   ? 57.511  46.207 44.274 1.00 51.60  ? 8   GLY F N   1 
ATOM   4476 C CA  . GLY F 2 9   ? 57.460  45.589 42.949 1.00 51.88  ? 8   GLY F CA  1 
ATOM   4477 C C   . GLY F 2 9   ? 56.207  44.758 42.719 1.00 48.32  ? 8   GLY F C   1 
ATOM   4478 O O   . GLY F 2 9   ? 55.279  44.869 43.514 1.00 46.76  ? 8   GLY F O   1 
ATOM   4479 N N   . PRO F 2 10  ? 56.110  43.980 41.614 1.00 49.85  ? 9   PRO F N   1 
ATOM   4480 C CA  . PRO F 2 10  ? 54.927  43.149 41.332 1.00 45.89  ? 9   PRO F CA  1 
ATOM   4481 C C   . PRO F 2 10  ? 54.962  41.734 41.905 1.00 47.95  ? 9   PRO F C   1 
ATOM   4482 O O   . PRO F 2 10  ? 53.911  41.142 42.137 1.00 54.63  ? 9   PRO F O   1 
ATOM   4483 C CB  . PRO F 2 10  ? 54.864  43.144 39.808 1.00 39.66  ? 9   PRO F CB  1 
ATOM   4484 C CG  . PRO F 2 10  ? 56.277  43.145 39.431 1.00 40.43  ? 9   PRO F CG  1 
ATOM   4485 C CD  . PRO F 2 10  ? 56.916  44.143 40.391 1.00 47.74  ? 9   PRO F CD  1 
ATOM   4486 N N   . GLY F 2 11  ? 56.155  41.202 42.167 1.00 50.06  ? 10  GLY F N   1 
ATOM   4487 C CA  . GLY F 2 11  ? 56.282  39.859 42.712 1.00 44.75  ? 10  GLY F CA  1 
ATOM   4488 C C   . GLY F 2 11  ? 56.417  38.854 41.586 1.00 47.47  ? 10  GLY F C   1 
ATOM   4489 O O   . GLY F 2 11  ? 57.525  38.619 41.122 1.00 47.47  ? 10  GLY F O   1 
ATOM   4490 N N   . LEU F 2 12  ? 55.316  38.199 41.208 1.00 51.53  ? 11  LEU F N   1 
ATOM   4491 C CA  . LEU F 2 12  ? 55.303  37.246 40.087 1.00 48.40  ? 11  LEU F CA  1 
ATOM   4492 C C   . LEU F 2 12  ? 54.774  38.000 38.874 1.00 46.58  ? 11  LEU F C   1 
ATOM   4493 O O   . LEU F 2 12  ? 53.823  38.766 38.976 1.00 46.37  ? 11  LEU F O   1 
ATOM   4494 C CB  . LEU F 2 12  ? 54.465  35.998 40.375 1.00 47.18  ? 11  LEU F CB  1 
ATOM   4495 C CG  . LEU F 2 12  ? 55.183  34.973 41.265 1.00 49.98  ? 11  LEU F CG  1 
ATOM   4496 C CD1 . LEU F 2 12  ? 54.927  35.294 42.741 1.00 45.68  ? 11  LEU F CD1 1 
ATOM   4497 C CD2 . LEU F 2 12  ? 54.723  33.564 40.916 1.00 40.43  ? 11  LEU F CD2 1 
ATOM   4498 N N   . VAL F 2 13  ? 55.404  37.794 37.729 1.00 47.40  ? 12  VAL F N   1 
ATOM   4499 C CA  . VAL F 2 13  ? 55.045  38.525 36.522 1.00 45.73  ? 12  VAL F CA  1 
ATOM   4500 C C   . VAL F 2 13  ? 55.114  37.621 35.303 1.00 45.69  ? 12  VAL F C   1 
ATOM   4501 O O   . VAL F 2 13  ? 56.009  36.780 35.193 1.00 44.71  ? 12  VAL F O   1 
ATOM   4502 C CB  . VAL F 2 13  ? 56.078  39.674 36.284 1.00 43.00  ? 12  VAL F CB  1 
ATOM   4503 C CG1 . VAL F 2 13  ? 55.679  40.519 35.093 1.00 47.28  ? 12  VAL F CG1 1 
ATOM   4504 C CG2 . VAL F 2 13  ? 56.210  40.521 37.511 1.00 41.65  ? 12  VAL F CG2 1 
ATOM   4505 N N   . ALA F 2 14  ? 54.223  37.841 34.347 1.00 42.13  ? 13  ALA F N   1 
ATOM   4506 C CA  . ALA F 2 14  ? 54.256  37.033 33.139 1.00 46.69  ? 13  ALA F CA  1 
ATOM   4507 C C   . ALA F 2 14  ? 55.269  37.646 32.173 1.00 50.64  ? 13  ALA F C   1 
ATOM   4508 O O   . ALA F 2 14  ? 55.517  38.865 32.201 1.00 48.76  ? 13  ALA F O   1 
ATOM   4509 C CB  . ALA F 2 14  ? 52.885  36.977 32.496 1.00 40.98  ? 13  ALA F CB  1 
ATOM   4510 N N   . PRO F 2 15  ? 55.951  36.796 31.385 1.00 50.68  ? 14  PRO F N   1 
ATOM   4511 C CA  . PRO F 2 15  ? 56.940  37.252 30.403 1.00 49.71  ? 14  PRO F CA  1 
ATOM   4512 C C   . PRO F 2 15  ? 56.216  38.093 29.344 1.00 54.32  ? 14  PRO F C   1 
ATOM   4513 O O   . PRO F 2 15  ? 54.982  38.120 29.315 1.00 60.91  ? 14  PRO F O   1 
ATOM   4514 C CB  . PRO F 2 15  ? 57.462  35.941 29.822 1.00 47.53  ? 14  PRO F CB  1 
ATOM   4515 C CG  . PRO F 2 15  ? 57.361  34.990 30.974 1.00 39.71  ? 14  PRO F CG  1 
ATOM   4516 C CD  . PRO F 2 15  ? 56.004  35.328 31.547 1.00 48.08  ? 14  PRO F CD  1 
ATOM   4517 N N   . SER F 2 16  ? 56.963  38.800 28.499 1.00 57.20  ? 15  SER F N   1 
ATOM   4518 C CA  . SER F 2 16  ? 56.370  39.661 27.464 1.00 60.80  ? 15  SER F CA  1 
ATOM   4519 C C   . SER F 2 16  ? 55.655  40.888 28.045 1.00 61.46  ? 15  SER F C   1 
ATOM   4520 O O   . SER F 2 16  ? 55.181  41.744 27.298 1.00 64.27  ? 15  SER F O   1 
ATOM   4521 C CB  . SER F 2 16  ? 55.420  38.873 26.551 1.00 65.75  ? 15  SER F CB  1 
ATOM   4522 O OG  . SER F 2 16  ? 56.125  37.944 25.733 1.00 67.71  ? 15  SER F OG  1 
ATOM   4523 N N   . GLN F 2 17  ? 55.588  40.961 29.373 1.00 62.01  ? 16  GLN F N   1 
ATOM   4524 C CA  . GLN F 2 17  ? 54.979  42.077 30.098 1.00 63.63  ? 16  GLN F CA  1 
ATOM   4525 C C   . GLN F 2 17  ? 56.082  43.045 30.531 1.00 62.56  ? 16  GLN F C   1 
ATOM   4526 O O   . GLN F 2 17  ? 57.266  42.812 30.286 1.00 59.64  ? 16  GLN F O   1 
ATOM   4527 C CB  . GLN F 2 17  ? 54.258  41.571 31.349 1.00 64.89  ? 16  GLN F CB  1 
ATOM   4528 C CG  . GLN F 2 17  ? 53.017  40.765 31.067 1.00 68.78  ? 16  GLN F CG  1 
ATOM   4529 C CD  . GLN F 2 17  ? 51.743  41.565 31.279 1.00 71.81  ? 16  GLN F CD  1 
ATOM   4530 O OE1 . GLN F 2 17  ? 51.668  42.409 32.178 1.00 73.39  ? 16  GLN F OE1 1 
ATOM   4531 N NE2 . GLN F 2 17  ? 50.714  41.267 30.485 1.00 65.80  ? 16  GLN F NE2 1 
ATOM   4532 N N   . SER F 2 18  ? 55.702  44.107 31.222 1.00 64.65  ? 17  SER F N   1 
ATOM   4533 C CA  . SER F 2 18  ? 56.680  45.086 31.671 1.00 65.63  ? 17  SER F CA  1 
ATOM   4534 C C   . SER F 2 18  ? 56.794  45.165 33.186 1.00 64.84  ? 17  SER F C   1 
ATOM   4535 O O   . SER F 2 18  ? 55.816  44.955 33.910 1.00 64.69  ? 17  SER F O   1 
ATOM   4536 C CB  . SER F 2 18  ? 56.355  46.466 31.091 1.00 66.08  ? 17  SER F CB  1 
ATOM   4537 O OG  . SER F 2 18  ? 54.998  46.555 30.670 1.00 73.36  ? 17  SER F OG  1 
ATOM   4538 N N   . LEU F 2 19  ? 58.010  45.415 33.653 1.00 62.19  ? 18  LEU F N   1 
ATOM   4539 C CA  . LEU F 2 19  ? 58.305  45.532 35.071 1.00 57.96  ? 18  LEU F CA  1 
ATOM   4540 C C   . LEU F 2 19  ? 58.263  47.007 35.478 1.00 56.95  ? 18  LEU F C   1 
ATOM   4541 O O   . LEU F 2 19  ? 58.486  47.893 34.646 1.00 57.59  ? 18  LEU F O   1 
ATOM   4542 C CB  . LEU F 2 19  ? 59.690  44.938 35.338 1.00 54.73  ? 18  LEU F CB  1 
ATOM   4543 C CG  . LEU F 2 19  ? 60.197  44.827 36.768 1.00 51.13  ? 18  LEU F CG  1 
ATOM   4544 C CD1 . LEU F 2 19  ? 59.188  44.066 37.565 1.00 56.34  ? 18  LEU F CD1 1 
ATOM   4545 C CD2 . LEU F 2 19  ? 61.519  44.101 36.796 1.00 45.55  ? 18  LEU F CD2 1 
ATOM   4546 N N   . SER F 2 20  ? 57.961  47.259 36.751 1.00 57.39  ? 19  SER F N   1 
ATOM   4547 C CA  . SER F 2 20  ? 57.897  48.610 37.314 1.00 55.62  ? 19  SER F CA  1 
ATOM   4548 C C   . SER F 2 20  ? 58.112  48.563 38.824 1.00 58.00  ? 19  SER F C   1 
ATOM   4549 O O   . SER F 2 20  ? 57.218  48.226 39.607 1.00 57.13  ? 19  SER F O   1 
ATOM   4550 C CB  . SER F 2 20  ? 56.575  49.274 36.990 1.00 51.70  ? 19  SER F CB  1 
ATOM   4551 O OG  . SER F 2 20  ? 56.384  49.275 35.585 1.00 66.86  ? 19  SER F OG  1 
ATOM   4552 N N   . ILE F 2 21  ? 59.346  48.835 39.214 1.00 57.79  ? 20  ILE F N   1 
ATOM   4553 C CA  . ILE F 2 21  ? 59.726  48.816 40.602 1.00 54.04  ? 20  ILE F CA  1 
ATOM   4554 C C   . ILE F 2 21  ? 59.869  50.241 41.083 1.00 53.16  ? 20  ILE F C   1 
ATOM   4555 O O   . ILE F 2 21  ? 60.171  51.138 40.295 1.00 50.02  ? 20  ILE F O   1 
ATOM   4556 C CB  . ILE F 2 21  ? 61.044  48.078 40.772 1.00 53.02  ? 20  ILE F CB  1 
ATOM   4557 C CG1 . ILE F 2 21  ? 60.869  46.633 40.335 1.00 50.01  ? 20  ILE F CG1 1 
ATOM   4558 C CG2 . ILE F 2 21  ? 61.522  48.145 42.210 1.00 57.06  ? 20  ILE F CG2 1 
ATOM   4559 C CD1 . ILE F 2 21  ? 62.123  45.843 40.483 1.00 59.87  ? 20  ILE F CD1 1 
ATOM   4560 N N   . THR F 2 22  ? 59.628  50.440 42.372 1.00 49.97  ? 21  THR F N   1 
ATOM   4561 C CA  . THR F 2 22  ? 59.728  51.745 42.989 1.00 47.29  ? 21  THR F CA  1 
ATOM   4562 C C   . THR F 2 22  ? 60.512  51.656 44.270 1.00 50.07  ? 21  THR F C   1 
ATOM   4563 O O   . THR F 2 22  ? 60.255  50.807 45.126 1.00 47.08  ? 21  THR F O   1 
ATOM   4564 C CB  . THR F 2 22  ? 58.347  52.314 43.320 1.00 47.04  ? 21  THR F CB  1 
ATOM   4565 O OG1 . THR F 2 22  ? 57.624  52.516 42.101 1.00 48.78  ? 21  THR F OG1 1 
ATOM   4566 C CG2 . THR F 2 22  ? 58.465  53.635 44.099 1.00 41.99  ? 21  THR F CG2 1 
ATOM   4567 N N   . CYS F 2 23  ? 61.476  52.547 44.397 1.00 52.36  ? 22  CYS F N   1 
ATOM   4568 C CA  . CYS F 2 23  ? 62.307  52.609 45.578 1.00 56.61  ? 22  CYS F CA  1 
ATOM   4569 C C   . CYS F 2 23  ? 61.904  53.839 46.398 1.00 56.79  ? 22  CYS F C   1 
ATOM   4570 O O   . CYS F 2 23  ? 62.248  54.970 46.054 1.00 56.29  ? 22  CYS F O   1 
ATOM   4571 C CB  . CYS F 2 23  ? 63.769  52.682 45.149 1.00 55.17  ? 22  CYS F CB  1 
ATOM   4572 S SG  . CYS F 2 23  ? 64.960  52.898 46.491 1.00 54.39  ? 22  CYS F SG  1 
ATOM   4573 N N   . THR F 2 24  ? 61.044  53.623 47.383 1.00 58.29  ? 23  THR F N   1 
ATOM   4574 C CA  . THR F 2 24  ? 60.618  54.691 48.249 1.00 62.23  ? 23  THR F CA  1 
ATOM   4575 C C   . THR F 2 24  ? 61.693  54.818 49.297 1.00 69.46  ? 23  THR F C   1 
ATOM   4576 O O   . THR F 2 24  ? 62.027  53.848 49.993 1.00 69.92  ? 23  THR F O   1 
ATOM   4577 C CB  . THR F 2 24  ? 59.292  54.374 48.890 1.00 60.61  ? 23  THR F CB  1 
ATOM   4578 O OG1 . THR F 2 24  ? 58.251  54.695 47.959 1.00 65.54  ? 23  THR F OG1 1 
ATOM   4579 C CG2 . THR F 2 24  ? 59.113  55.163 50.181 1.00 61.46  ? 23  THR F CG2 1 
ATOM   4580 N N   . VAL F 2 25  ? 62.219  56.027 49.423 1.00 75.62  ? 24  VAL F N   1 
ATOM   4581 C CA  . VAL F 2 25  ? 63.310  56.286 50.352 1.00 76.61  ? 24  VAL F CA  1 
ATOM   4582 C C   . VAL F 2 25  ? 62.930  57.257 51.458 1.00 75.39  ? 24  VAL F C   1 
ATOM   4583 O O   . VAL F 2 25  ? 62.312  58.290 51.206 1.00 73.22  ? 24  VAL F O   1 
ATOM   4584 C CB  . VAL F 2 25  ? 64.531  56.826 49.601 1.00 75.66  ? 24  VAL F CB  1 
ATOM   4585 C CG1 . VAL F 2 25  ? 65.611  57.221 50.579 1.00 78.53  ? 24  VAL F CG1 1 
ATOM   4586 C CG2 . VAL F 2 25  ? 65.030  55.791 48.624 1.00 69.14  ? 24  VAL F CG2 1 
ATOM   4587 N N   . SER F 2 26  ? 63.276  56.908 52.690 1.00 73.23  ? 25  SER F N   1 
ATOM   4588 C CA  . SER F 2 26  ? 62.948  57.763 53.812 1.00 74.12  ? 25  SER F CA  1 
ATOM   4589 C C   . SER F 2 26  ? 64.079  57.862 54.818 1.00 70.33  ? 25  SER F C   1 
ATOM   4590 O O   . SER F 2 26  ? 64.552  56.864 55.354 1.00 65.30  ? 25  SER F O   1 
ATOM   4591 C CB  . SER F 2 26  ? 61.613  57.320 54.462 1.00 76.36  ? 25  SER F CB  1 
ATOM   4592 O OG  . SER F 2 26  ? 61.521  55.916 54.629 1.00 82.38  ? 25  SER F OG  1 
ATOM   4593 N N   . GLY F 2 27  ? 64.522  59.094 55.031 1.00 72.96  ? 26  GLY F N   1 
ATOM   4594 C CA  . GLY F 2 27  ? 65.603  59.381 55.952 1.00 74.09  ? 26  GLY F CA  1 
ATOM   4595 C C   . GLY F 2 27  ? 66.601  60.333 55.314 1.00 76.86  ? 26  GLY F C   1 
ATOM   4596 O O   . GLY F 2 27  ? 67.205  61.166 55.994 1.00 79.46  ? 26  GLY F O   1 
ATOM   4597 N N   . ILE F 2 28  ? 66.710  60.265 53.991 1.00 76.81  ? 27  ILE F N   1 
ATOM   4598 C CA  . ILE F 2 28  ? 67.660  61.090 53.247 1.00 75.85  ? 27  ILE F CA  1 
ATOM   4599 C C   . ILE F 2 28  ? 67.005  61.907 52.132 1.00 77.40  ? 27  ILE F C   1 
ATOM   4600 O O   . ILE F 2 28  ? 65.881  61.619 51.720 1.00 76.82  ? 27  ILE F O   1 
ATOM   4601 C CB  . ILE F 2 28  ? 68.771  60.208 52.624 1.00 73.31  ? 27  ILE F CB  1 
ATOM   4602 C CG1 . ILE F 2 28  ? 68.181  59.320 51.533 1.00 70.30  ? 27  ILE F CG1 1 
ATOM   4603 C CG2 . ILE F 2 28  ? 69.421  59.329 53.693 1.00 69.97  ? 27  ILE F CG2 1 
ATOM   4604 C CD1 . ILE F 2 28  ? 69.150  58.316 50.985 1.00 73.43  ? 27  ILE F CD1 1 
ATOM   4605 N N   . SER F 2 29  ? 67.692  62.959 51.691 1.00 80.53  ? 28  SER F N   1 
ATOM   4606 C CA  . SER F 2 29  ? 67.193  63.797 50.604 1.00 83.08  ? 28  SER F CA  1 
ATOM   4607 C C   . SER F 2 29  ? 67.898  63.250 49.376 1.00 81.53  ? 28  SER F C   1 
ATOM   4608 O O   . SER F 2 29  ? 69.108  62.997 49.404 1.00 78.54  ? 28  SER F O   1 
ATOM   4609 C CB  . SER F 2 29  ? 67.540  65.275 50.826 1.00 87.73  ? 28  SER F CB  1 
ATOM   4610 O OG  . SER F 2 29  ? 68.939  65.465 50.969 1.00 96.79  ? 28  SER F OG  1 
ATOM   4611 N N   . LEU F 2 30  ? 67.148  63.089 48.295 1.00 81.49  ? 29  LEU F N   1 
ATOM   4612 C CA  . LEU F 2 30  ? 67.696  62.510 47.076 1.00 81.09  ? 29  LEU F CA  1 
ATOM   4613 C C   . LEU F 2 30  ? 68.683  63.349 46.313 1.00 79.33  ? 29  LEU F C   1 
ATOM   4614 O O   . LEU F 2 30  ? 69.651  62.822 45.778 1.00 80.34  ? 29  LEU F O   1 
ATOM   4615 C CB  . LEU F 2 30  ? 66.580  62.037 46.156 1.00 84.04  ? 29  LEU F CB  1 
ATOM   4616 C CG  . LEU F 2 30  ? 65.661  61.008 46.815 1.00 81.54  ? 29  LEU F CG  1 
ATOM   4617 C CD1 . LEU F 2 30  ? 64.724  60.447 45.761 1.00 80.64  ? 29  LEU F CD1 1 
ATOM   4618 C CD2 . LEU F 2 30  ? 66.490  59.906 47.471 1.00 79.93  ? 29  LEU F CD2 1 
ATOM   4619 N N   . SER F 2 31  ? 68.450  64.651 46.252 1.00 75.45  ? 30  SER F N   1 
ATOM   4620 C CA  . SER F 2 31  ? 69.386  65.522 45.558 1.00 74.78  ? 30  SER F CA  1 
ATOM   4621 C C   . SER F 2 31  ? 70.782  65.337 46.173 1.00 71.46  ? 30  SER F C   1 
ATOM   4622 O O   . SER F 2 31  ? 71.788  65.442 45.490 1.00 72.89  ? 30  SER F O   1 
ATOM   4623 C CB  . SER F 2 31  ? 68.938  66.973 45.705 1.00 74.17  ? 30  SER F CB  1 
ATOM   4624 O OG  . SER F 2 31  ? 68.579  67.231 47.058 1.00 79.83  ? 30  SER F OG  1 
ATOM   4625 N N   . ARG F 2 32  ? 70.820  65.003 47.456 1.00 67.80  ? 31  ARG F N   1 
ATOM   4626 C CA  . ARG F 2 32  ? 72.067  64.802 48.183 1.00 70.67  ? 31  ARG F CA  1 
ATOM   4627 C C   . ARG F 2 32  ? 72.660  63.406 47.906 1.00 72.11  ? 31  ARG F C   1 
ATOM   4628 O O   . ARG F 2 32  ? 73.877  63.197 48.004 1.00 74.35  ? 31  ARG F O   1 
ATOM   4629 C CB  . ARG F 2 32  ? 71.776  64.960 49.682 1.00 75.59  ? 31  ARG F CB  1 
ATOM   4630 C CG  . ARG F 2 32  ? 72.931  65.395 50.579 1.00 81.07  ? 31  ARG F CG  1 
ATOM   4631 C CD  . ARG F 2 32  ? 72.447  65.586 52.032 1.00 88.88  ? 31  ARG F CD  1 
ATOM   4632 N NE  . ARG F 2 32  ? 72.185  64.315 52.735 1.00 99.61  ? 31  ARG F NE  1 
ATOM   4633 C CZ  . ARG F 2 32  ? 71.110  64.041 53.491 1.00 98.42  ? 31  ARG F CZ  1 
ATOM   4634 N NH1 . ARG F 2 32  ? 70.138  64.934 53.668 1.00 93.59  ? 31  ARG F NH1 1 
ATOM   4635 N NH2 . ARG F 2 32  ? 71.026  62.870 54.119 1.00 95.49  ? 31  ARG F NH2 1 
ATOM   4636 N N   . TYR F 2 33  ? 71.800  62.458 47.546 1.00 71.25  ? 32  TYR F N   1 
ATOM   4637 C CA  . TYR F 2 33  ? 72.218  61.081 47.305 1.00 62.97  ? 32  TYR F CA  1 
ATOM   4638 C C   . TYR F 2 33  ? 72.079  60.551 45.892 1.00 58.24  ? 32  TYR F C   1 
ATOM   4639 O O   . TYR F 2 33  ? 71.146  60.887 45.174 1.00 52.08  ? 32  TYR F O   1 
ATOM   4640 C CB  . TYR F 2 33  ? 71.469  60.155 48.259 1.00 63.59  ? 32  TYR F CB  1 
ATOM   4641 C CG  . TYR F 2 33  ? 72.086  60.133 49.630 1.00 70.04  ? 32  TYR F CG  1 
ATOM   4642 C CD1 . TYR F 2 33  ? 71.838  61.150 50.555 1.00 71.70  ? 32  TYR F CD1 1 
ATOM   4643 C CD2 . TYR F 2 33  ? 72.977  59.121 49.983 1.00 72.10  ? 32  TYR F CD2 1 
ATOM   4644 C CE1 . TYR F 2 33  ? 72.483  61.155 51.803 1.00 76.12  ? 32  TYR F CE1 1 
ATOM   4645 C CE2 . TYR F 2 33  ? 73.619  59.113 51.214 1.00 73.29  ? 32  TYR F CE2 1 
ATOM   4646 C CZ  . TYR F 2 33  ? 73.380  60.130 52.119 1.00 75.66  ? 32  TYR F CZ  1 
ATOM   4647 O OH  . TYR F 2 33  ? 74.071  60.119 53.312 1.00 76.05  ? 32  TYR F OH  1 
ATOM   4648 N N   . ASN F 2 34  ? 73.035  59.725 45.491 1.00 58.17  ? 33  ASN F N   1 
ATOM   4649 C CA  . ASN F 2 34  ? 72.996  59.100 44.170 1.00 64.24  ? 33  ASN F CA  1 
ATOM   4650 C C   . ASN F 2 34  ? 72.370  57.710 44.393 1.00 65.01  ? 33  ASN F C   1 
ATOM   4651 O O   . ASN F 2 34  ? 72.832  56.964 45.268 1.00 65.47  ? 33  ASN F O   1 
ATOM   4652 C CB  . ASN F 2 34  ? 74.418  58.937 43.601 1.00 68.72  ? 33  ASN F CB  1 
ATOM   4653 C CG  . ASN F 2 34  ? 75.132  60.271 43.364 1.00 69.90  ? 33  ASN F CG  1 
ATOM   4654 O OD1 . ASN F 2 34  ? 74.568  61.219 42.800 1.00 68.12  ? 33  ASN F OD1 1 
ATOM   4655 N ND2 . ASN F 2 34  ? 76.392  60.331 43.765 1.00 63.40  ? 33  ASN F ND2 1 
ATOM   4656 N N   . VAL F 2 35  ? 71.315  57.372 43.643 1.00 62.88  ? 34  VAL F N   1 
ATOM   4657 C CA  . VAL F 2 35  ? 70.631  56.073 43.786 1.00 56.86  ? 34  VAL F CA  1 
ATOM   4658 C C   . VAL F 2 35  ? 70.823  55.115 42.600 1.00 56.45  ? 34  VAL F C   1 
ATOM   4659 O O   . VAL F 2 35  ? 70.460  55.435 41.457 1.00 52.81  ? 34  VAL F O   1 
ATOM   4660 C CB  . VAL F 2 35  ? 69.116  56.257 44.021 1.00 58.95  ? 34  VAL F CB  1 
ATOM   4661 C CG1 . VAL F 2 35  ? 68.454  54.915 44.316 1.00 61.65  ? 34  VAL F CG1 1 
ATOM   4662 C CG2 . VAL F 2 35  ? 68.873  57.223 45.165 1.00 62.25  ? 34  VAL F CG2 1 
ATOM   4663 N N   . HIS F 2 36  ? 71.386  53.942 42.901 1.00 56.56  ? 35  HIS F N   1 
ATOM   4664 C CA  . HIS F 2 36  ? 71.668  52.869 41.937 1.00 51.57  ? 35  HIS F CA  1 
ATOM   4665 C C   . HIS F 2 36  ? 70.604  51.784 41.919 1.00 49.12  ? 35  HIS F C   1 
ATOM   4666 O O   . HIS F 2 36  ? 70.070  51.418 42.957 1.00 46.20  ? 35  HIS F O   1 
ATOM   4667 C CB  . HIS F 2 36  ? 72.944  52.129 42.326 1.00 56.51  ? 35  HIS F CB  1 
ATOM   4668 C CG  . HIS F 2 36  ? 74.186  52.939 42.177 1.00 66.06  ? 35  HIS F CG  1 
ATOM   4669 N ND1 . HIS F 2 36  ? 75.388  52.346 41.854 1.00 68.08  ? 35  HIS F ND1 1 
ATOM   4670 C CD2 . HIS F 2 36  ? 74.382  54.260 42.391 1.00 61.94  ? 35  HIS F CD2 1 
ATOM   4671 C CE1 . HIS F 2 36  ? 76.278  53.312 41.884 1.00 67.94  ? 35  HIS F CE1 1 
ATOM   4672 N NE2 . HIS F 2 36  ? 75.716  54.493 42.204 1.00 69.15  ? 35  HIS F NE2 1 
ATOM   4673 N N   . TRP F 2 37  ? 70.353  51.228 40.742 1.00 45.37  ? 36  TRP F N   1 
ATOM   4674 C CA  . TRP F 2 37  ? 69.431  50.121 40.592 1.00 37.27  ? 36  TRP F CA  1 
ATOM   4675 C C   . TRP F 2 37  ? 70.273  48.860 40.324 1.00 35.47  ? 36  TRP F C   1 
ATOM   4676 O O   . TRP F 2 37  ? 71.052  48.815 39.370 1.00 34.23  ? 36  TRP F O   1 
ATOM   4677 C CB  . TRP F 2 37  ? 68.477  50.390 39.453 1.00 28.56  ? 36  TRP F CB  1 
ATOM   4678 C CG  . TRP F 2 37  ? 67.284  51.110 39.897 1.00 32.28  ? 36  TRP F CG  1 
ATOM   4679 C CD1 . TRP F 2 37  ? 66.844  52.315 39.444 1.00 41.62  ? 36  TRP F CD1 1 
ATOM   4680 C CD2 . TRP F 2 37  ? 66.295  50.644 40.828 1.00 39.51  ? 36  TRP F CD2 1 
ATOM   4681 N NE1 . TRP F 2 37  ? 65.626  52.631 40.018 1.00 43.71  ? 36  TRP F NE1 1 
ATOM   4682 C CE2 . TRP F 2 37  ? 65.265  51.620 40.870 1.00 40.63  ? 36  TRP F CE2 1 
ATOM   4683 C CE3 . TRP F 2 37  ? 66.168  49.491 41.622 1.00 36.82  ? 36  TRP F CE3 1 
ATOM   4684 C CZ2 . TRP F 2 37  ? 64.134  51.480 41.672 1.00 36.90  ? 36  TRP F CZ2 1 
ATOM   4685 C CZ3 . TRP F 2 37  ? 65.046  49.353 42.418 1.00 39.90  ? 36  TRP F CZ3 1 
ATOM   4686 C CH2 . TRP F 2 37  ? 64.036  50.345 42.435 1.00 42.43  ? 36  TRP F CH2 1 
ATOM   4687 N N   . VAL F 2 38  ? 70.154  47.864 41.196 1.00 34.52  ? 37  VAL F N   1 
ATOM   4688 C CA  . VAL F 2 38  ? 70.900  46.612 41.076 1.00 36.10  ? 37  VAL F CA  1 
ATOM   4689 C C   . VAL F 2 38  ? 69.958  45.392 41.255 1.00 42.33  ? 37  VAL F C   1 
ATOM   4690 O O   . VAL F 2 38  ? 68.804  45.567 41.667 1.00 44.29  ? 37  VAL F O   1 
ATOM   4691 C CB  . VAL F 2 38  ? 72.014  46.586 42.121 1.00 28.36  ? 37  VAL F CB  1 
ATOM   4692 C CG1 . VAL F 2 38  ? 72.768  45.291 42.073 1.00 30.42  ? 37  VAL F CG1 1 
ATOM   4693 C CG2 . VAL F 2 38  ? 72.964  47.722 41.866 1.00 36.44  ? 37  VAL F CG2 1 
ATOM   4694 N N   . ARG F 2 39  ? 70.403  44.193 40.856 1.00 40.99  ? 38  ARG F N   1 
ATOM   4695 C CA  . ARG F 2 39  ? 69.604  42.974 41.007 1.00 43.26  ? 38  ARG F CA  1 
ATOM   4696 C C   . ARG F 2 39  ? 70.475  41.751 41.329 1.00 46.63  ? 38  ARG F C   1 
ATOM   4697 O O   . ARG F 2 39  ? 71.636  41.695 40.926 1.00 46.12  ? 38  ARG F O   1 
ATOM   4698 C CB  . ARG F 2 39  ? 68.756  42.709 39.764 1.00 40.61  ? 38  ARG F CB  1 
ATOM   4699 C CG  . ARG F 2 39  ? 69.493  42.093 38.600 1.00 43.54  ? 38  ARG F CG  1 
ATOM   4700 C CD  . ARG F 2 39  ? 68.536  41.908 37.426 1.00 44.07  ? 38  ARG F CD  1 
ATOM   4701 N NE  . ARG F 2 39  ? 69.222  41.594 36.174 1.00 46.09  ? 38  ARG F NE  1 
ATOM   4702 C CZ  . ARG F 2 39  ? 68.612  41.332 35.020 1.00 47.91  ? 38  ARG F CZ  1 
ATOM   4703 N NH1 . ARG F 2 39  ? 67.287  41.350 34.935 1.00 48.13  ? 38  ARG F NH1 1 
ATOM   4704 N NH2 . ARG F 2 39  ? 69.330  41.073 33.941 1.00 40.44  ? 38  ARG F NH2 1 
ATOM   4705 N N   . GLN F 2 40  ? 69.926  40.778 42.057 1.00 46.09  ? 39  GLN F N   1 
ATOM   4706 C CA  . GLN F 2 40  ? 70.703  39.598 42.423 1.00 42.17  ? 39  GLN F CA  1 
ATOM   4707 C C   . GLN F 2 40  ? 70.029  38.214 42.227 1.00 46.96  ? 39  GLN F C   1 
ATOM   4708 O O   . GLN F 2 40  ? 68.840  38.036 42.531 1.00 47.70  ? 39  GLN F O   1 
ATOM   4709 C CB  . GLN F 2 40  ? 71.192  39.751 43.853 1.00 35.77  ? 39  GLN F CB  1 
ATOM   4710 C CG  . GLN F 2 40  ? 72.258  38.742 44.238 1.00 35.73  ? 39  GLN F CG  1 
ATOM   4711 C CD  . GLN F 2 40  ? 72.781  39.026 45.611 1.00 36.22  ? 39  GLN F CD  1 
ATOM   4712 O OE1 . GLN F 2 40  ? 72.102  39.700 46.395 1.00 37.71  ? 39  GLN F OE1 1 
ATOM   4713 N NE2 . GLN F 2 40  ? 73.997  38.535 45.923 1.00 27.23  ? 39  GLN F NE2 1 
ATOM   4714 N N   . SER F 2 41  ? 70.821  37.250 41.744 1.00 47.43  ? 40  SER F N   1 
ATOM   4715 C CA  . SER F 2 41  ? 70.399  35.874 41.450 1.00 42.75  ? 40  SER F CA  1 
ATOM   4716 C C   . SER F 2 41  ? 71.562  34.929 41.619 1.00 45.92  ? 40  SER F C   1 
ATOM   4717 O O   . SER F 2 41  ? 72.695  35.278 41.318 1.00 53.35  ? 40  SER F O   1 
ATOM   4718 C CB  . SER F 2 41  ? 70.015  35.769 39.995 1.00 41.55  ? 40  SER F CB  1 
ATOM   4719 O OG  . SER F 2 41  ? 69.058  36.742 39.665 1.00 59.79  ? 40  SER F OG  1 
ATOM   4720 N N   . PRO F 2 42  ? 71.313  33.705 42.087 1.00 48.98  ? 41  PRO F N   1 
ATOM   4721 C CA  . PRO F 2 42  ? 72.493  32.837 42.219 1.00 47.68  ? 41  PRO F CA  1 
ATOM   4722 C C   . PRO F 2 42  ? 73.177  32.420 40.897 1.00 45.24  ? 41  PRO F C   1 
ATOM   4723 O O   . PRO F 2 42  ? 74.374  32.118 40.871 1.00 44.31  ? 41  PRO F O   1 
ATOM   4724 C CB  . PRO F 2 42  ? 71.969  31.651 43.047 1.00 47.35  ? 41  PRO F CB  1 
ATOM   4725 C CG  . PRO F 2 42  ? 70.465  31.735 42.906 1.00 46.92  ? 41  PRO F CG  1 
ATOM   4726 C CD  . PRO F 2 42  ? 70.164  33.189 42.853 1.00 44.92  ? 41  PRO F CD  1 
ATOM   4727 N N   . GLY F 2 43  ? 72.434  32.443 39.794 1.00 42.11  ? 42  GLY F N   1 
ATOM   4728 C CA  . GLY F 2 43  ? 73.028  32.067 38.522 1.00 45.62  ? 42  GLY F CA  1 
ATOM   4729 C C   . GLY F 2 43  ? 73.724  33.236 37.841 1.00 49.43  ? 42  GLY F C   1 
ATOM   4730 O O   . GLY F 2 43  ? 74.789  33.080 37.209 1.00 41.55  ? 42  GLY F O   1 
ATOM   4731 N N   . LYS F 2 44  ? 73.094  34.406 37.984 1.00 48.32  ? 43  LYS F N   1 
ATOM   4732 C CA  . LYS F 2 44  ? 73.558  35.663 37.413 1.00 49.65  ? 43  LYS F CA  1 
ATOM   4733 C C   . LYS F 2 44  ? 74.398  36.566 38.334 1.00 52.05  ? 43  LYS F C   1 
ATOM   4734 O O   . LYS F 2 44  ? 74.852  37.632 37.898 1.00 58.77  ? 43  LYS F O   1 
ATOM   4735 C CB  . LYS F 2 44  ? 72.367  36.471 36.898 1.00 43.79  ? 43  LYS F CB  1 
ATOM   4736 C CG  . LYS F 2 44  ? 71.739  35.914 35.657 1.00 42.96  ? 43  LYS F CG  1 
ATOM   4737 C CD  . LYS F 2 44  ? 70.784  36.929 35.026 1.00 46.07  ? 43  LYS F CD  1 
ATOM   4738 C CE  . LYS F 2 44  ? 69.584  37.224 35.916 1.00 47.92  ? 43  LYS F CE  1 
ATOM   4739 N NZ  . LYS F 2 44  ? 68.691  36.029 36.131 1.00 55.84  ? 43  LYS F NZ  1 
ATOM   4740 N N   . GLY F 2 45  ? 74.590  36.165 39.588 1.00 48.44  ? 44  GLY F N   1 
ATOM   4741 C CA  . GLY F 2 45  ? 75.365  36.972 40.515 1.00 44.38  ? 44  GLY F CA  1 
ATOM   4742 C C   . GLY F 2 45  ? 74.815  38.383 40.667 1.00 44.77  ? 44  GLY F C   1 
ATOM   4743 O O   . GLY F 2 45  ? 73.607  38.604 40.479 1.00 38.12  ? 44  GLY F O   1 
ATOM   4744 N N   . LEU F 2 46  ? 75.693  39.326 41.031 1.00 46.37  ? 45  LEU F N   1 
ATOM   4745 C CA  . LEU F 2 46  ? 75.318  40.733 41.212 1.00 39.79  ? 45  LEU F CA  1 
ATOM   4746 C C   . LEU F 2 46  ? 75.414  41.427 39.865 1.00 39.94  ? 45  LEU F C   1 
ATOM   4747 O O   . LEU F 2 46  ? 76.372  41.219 39.115 1.00 44.30  ? 45  LEU F O   1 
ATOM   4748 C CB  . LEU F 2 46  ? 76.222  41.391 42.245 1.00 37.10  ? 45  LEU F CB  1 
ATOM   4749 C CG  . LEU F 2 46  ? 75.835  41.080 43.697 1.00 34.57  ? 45  LEU F CG  1 
ATOM   4750 C CD1 . LEU F 2 46  ? 77.012  41.090 44.651 1.00 24.87  ? 45  LEU F CD1 1 
ATOM   4751 C CD2 . LEU F 2 46  ? 74.794  42.072 44.128 1.00 35.13  ? 45  LEU F CD2 1 
ATOM   4752 N N   . GLU F 2 47  ? 74.404  42.218 39.547 1.00 37.85  ? 46  GLU F N   1 
ATOM   4753 C CA  . GLU F 2 47  ? 74.337  42.892 38.270 1.00 37.82  ? 46  GLU F CA  1 
ATOM   4754 C C   . GLU F 2 47  ? 73.903  44.352 38.421 1.00 39.91  ? 46  GLU F C   1 
ATOM   4755 O O   . GLU F 2 47  ? 72.827  44.644 38.955 1.00 37.91  ? 46  GLU F O   1 
ATOM   4756 C CB  . GLU F 2 47  ? 73.345  42.158 37.340 1.00 40.43  ? 46  GLU F CB  1 
ATOM   4757 C CG  . GLU F 2 47  ? 73.809  40.817 36.735 1.00 44.57  ? 46  GLU F CG  1 
ATOM   4758 C CD  . GLU F 2 47  ? 72.840  40.263 35.651 1.00 54.41  ? 46  GLU F CD  1 
ATOM   4759 O OE1 . GLU F 2 47  ? 71.596  40.403 35.780 1.00 47.25  ? 46  GLU F OE1 1 
ATOM   4760 O OE2 . GLU F 2 47  ? 73.335  39.668 34.663 1.00 55.98  ? 46  GLU F OE2 1 
ATOM   4761 N N   . TRP F 2 48  ? 74.715  45.254 37.878 1.00 39.93  ? 47  TRP F N   1 
ATOM   4762 C CA  . TRP F 2 48  ? 74.448  46.682 37.935 1.00 43.39  ? 47  TRP F CA  1 
ATOM   4763 C C   . TRP F 2 48  ? 73.538  47.101 36.772 1.00 40.93  ? 47  TRP F C   1 
ATOM   4764 O O   . TRP F 2 48  ? 73.889  46.929 35.614 1.00 40.62  ? 47  TRP F O   1 
ATOM   4765 C CB  . TRP F 2 48  ? 75.782  47.446 37.899 1.00 52.08  ? 47  TRP F CB  1 
ATOM   4766 C CG  . TRP F 2 48  ? 75.635  48.909 38.103 1.00 51.52  ? 47  TRP F CG  1 
ATOM   4767 C CD1 . TRP F 2 48  ? 75.543  49.568 39.300 1.00 52.31  ? 47  TRP F CD1 1 
ATOM   4768 C CD2 . TRP F 2 48  ? 75.489  49.894 37.084 1.00 51.90  ? 47  TRP F CD2 1 
ATOM   4769 N NE1 . TRP F 2 48  ? 75.336  50.902 39.081 1.00 52.95  ? 47  TRP F NE1 1 
ATOM   4770 C CE2 . TRP F 2 48  ? 75.302  51.133 37.729 1.00 53.51  ? 47  TRP F CE2 1 
ATOM   4771 C CE3 . TRP F 2 48  ? 75.499  49.853 35.684 1.00 57.22  ? 47  TRP F CE3 1 
ATOM   4772 C CZ2 . TRP F 2 48  ? 75.116  52.329 37.018 1.00 56.47  ? 47  TRP F CZ2 1 
ATOM   4773 C CZ3 . TRP F 2 48  ? 75.313  51.043 34.974 1.00 61.01  ? 47  TRP F CZ3 1 
ATOM   4774 C CH2 . TRP F 2 48  ? 75.127  52.267 35.646 1.00 53.37  ? 47  TRP F CH2 1 
ATOM   4775 N N   . LEU F 2 49  ? 72.396  47.701 37.081 1.00 39.96  ? 48  LEU F N   1 
ATOM   4776 C CA  . LEU F 2 49  ? 71.452  48.104 36.044 1.00 42.03  ? 48  LEU F CA  1 
ATOM   4777 C C   . LEU F 2 49  ? 71.584  49.526 35.570 1.00 44.39  ? 48  LEU F C   1 
ATOM   4778 O O   . LEU F 2 49  ? 71.483  49.804 34.369 1.00 44.29  ? 48  LEU F O   1 
ATOM   4779 C CB  . LEU F 2 49  ? 70.006  47.926 36.522 1.00 44.94  ? 48  LEU F CB  1 
ATOM   4780 C CG  . LEU F 2 49  ? 69.493  46.551 36.929 1.00 42.70  ? 48  LEU F CG  1 
ATOM   4781 C CD1 . LEU F 2 49  ? 68.093  46.686 37.452 1.00 44.22  ? 48  LEU F CD1 1 
ATOM   4782 C CD2 . LEU F 2 49  ? 69.538  45.622 35.751 1.00 44.17  ? 48  LEU F CD2 1 
ATOM   4783 N N   . GLY F 2 50  ? 71.699  50.434 36.528 1.00 44.78  ? 49  GLY F N   1 
ATOM   4784 C CA  . GLY F 2 50  ? 71.795  51.837 36.198 1.00 47.87  ? 49  GLY F CA  1 
ATOM   4785 C C   . GLY F 2 50  ? 71.755  52.667 37.456 1.00 49.64  ? 49  GLY F C   1 
ATOM   4786 O O   . GLY F 2 50  ? 71.810  52.116 38.556 1.00 46.33  ? 49  GLY F O   1 
ATOM   4787 N N   . MET F 2 51  ? 71.662  53.984 37.301 1.00 53.45  ? 50  MET F N   1 
ATOM   4788 C CA  . MET F 2 51  ? 71.616  54.895 38.440 1.00 55.09  ? 50  MET F CA  1 
ATOM   4789 C C   . MET F 2 51  ? 71.116  56.283 38.029 1.00 55.83  ? 50  MET F C   1 
ATOM   4790 O O   . MET F 2 51  ? 70.874  56.554 36.852 1.00 60.57  ? 50  MET F O   1 
ATOM   4791 C CB  . MET F 2 51  ? 73.011  55.030 39.055 1.00 57.25  ? 50  MET F CB  1 
ATOM   4792 C CG  . MET F 2 51  ? 73.970  55.918 38.242 1.00 57.37  ? 50  MET F CG  1 
ATOM   4793 S SD  . MET F 2 51  ? 75.673  55.936 38.879 1.00 60.94  ? 50  MET F SD  1 
ATOM   4794 C CE  . MET F 2 51  ? 75.488  57.071 40.427 1.00 53.37  ? 50  MET F CE  1 
ATOM   4795 N N   . ILE F 2 52  ? 70.924  57.139 39.019 1.00 56.29  ? 51  ILE F N   1 
ATOM   4796 C CA  . ILE F 2 52  ? 70.498  58.509 38.798 1.00 59.33  ? 51  ILE F CA  1 
ATOM   4797 C C   . ILE F 2 52  ? 71.189  59.366 39.879 1.00 66.48  ? 51  ILE F C   1 
ATOM   4798 O O   . ILE F 2 52  ? 71.018  59.134 41.090 1.00 68.97  ? 51  ILE F O   1 
ATOM   4799 C CB  . ILE F 2 52  ? 68.932  58.656 38.807 1.00 55.57  ? 51  ILE F CB  1 
ATOM   4800 C CG1 . ILE F 2 52  ? 68.547  60.137 38.769 1.00 55.18  ? 51  ILE F CG1 1 
ATOM   4801 C CG2 . ILE F 2 52  ? 68.307  57.943 40.012 1.00 47.83  ? 51  ILE F CG2 1 
ATOM   4802 C CD1 . ILE F 2 52  ? 67.076  60.400 38.521 1.00 51.70  ? 51  ILE F CD1 1 
ATOM   4803 N N   . TRP F 2 53  ? 72.076  60.255 39.433 1.00 68.72  ? 52  TRP F N   1 
ATOM   4804 C CA  . TRP F 2 53  ? 72.827  61.140 40.334 1.00 65.93  ? 52  TRP F CA  1 
ATOM   4805 C C   . TRP F 2 53  ? 71.887  62.100 41.049 1.00 64.91  ? 52  TRP F C   1 
ATOM   4806 O O   . TRP F 2 53  ? 70.786  62.371 40.564 1.00 63.81  ? 52  TRP F O   1 
ATOM   4807 C CB  . TRP F 2 53  ? 73.880  61.940 39.548 1.00 61.84  ? 52  TRP F CB  1 
ATOM   4808 C CG  . TRP F 2 53  ? 74.908  61.077 38.905 1.00 53.24  ? 52  TRP F CG  1 
ATOM   4809 C CD1 . TRP F 2 53  ? 74.805  60.448 37.698 1.00 56.67  ? 52  TRP F CD1 1 
ATOM   4810 C CD2 . TRP F 2 53  ? 76.163  60.667 39.465 1.00 54.44  ? 52  TRP F CD2 1 
ATOM   4811 N NE1 . TRP F 2 53  ? 75.907  59.659 37.478 1.00 55.10  ? 52  TRP F NE1 1 
ATOM   4812 C CE2 . TRP F 2 53  ? 76.758  59.771 38.547 1.00 53.63  ? 52  TRP F CE2 1 
ATOM   4813 C CE3 . TRP F 2 53  ? 76.841  60.967 40.657 1.00 55.55  ? 52  TRP F CE3 1 
ATOM   4814 C CZ2 . TRP F 2 53  ? 78.005  59.164 38.784 1.00 55.88  ? 52  TRP F CZ2 1 
ATOM   4815 C CZ3 . TRP F 2 53  ? 78.079  60.363 40.894 1.00 56.52  ? 52  TRP F CZ3 1 
ATOM   4816 C CH2 . TRP F 2 53  ? 78.647  59.471 39.961 1.00 55.65  ? 52  TRP F CH2 1 
ATOM   4817 N N   . GLY F 2 54  ? 72.320  62.627 42.191 1.00 62.63  ? 53  GLY F N   1 
ATOM   4818 C CA  . GLY F 2 54  ? 71.476  63.570 42.900 1.00 62.13  ? 53  GLY F CA  1 
ATOM   4819 C C   . GLY F 2 54  ? 71.146  64.684 41.925 1.00 60.84  ? 53  GLY F C   1 
ATOM   4820 O O   . GLY F 2 54  ? 70.032  65.200 41.892 1.00 56.48  ? 53  GLY F O   1 
ATOM   4821 N N   . GLY F 2 55  ? 72.116  64.982 41.063 1.00 63.68  ? 54  GLY F N   1 
ATOM   4822 C CA  . GLY F 2 55  ? 71.954  66.012 40.062 1.00 68.63  ? 54  GLY F CA  1 
ATOM   4823 C C   . GLY F 2 55  ? 70.947  65.676 38.976 1.00 73.28  ? 54  GLY F C   1 
ATOM   4824 O O   . GLY F 2 55  ? 70.775  66.458 38.045 1.00 79.38  ? 54  GLY F O   1 
ATOM   4825 N N   . GLY F 2 56  ? 70.275  64.533 39.080 1.00 71.34  ? 55  GLY F N   1 
ATOM   4826 C CA  . GLY F 2 56  ? 69.290  64.155 38.078 1.00 66.53  ? 55  GLY F CA  1 
ATOM   4827 C C   . GLY F 2 56  ? 69.823  63.544 36.789 1.00 64.01  ? 55  GLY F C   1 
ATOM   4828 O O   . GLY F 2 56  ? 69.072  63.396 35.824 1.00 60.51  ? 55  GLY F O   1 
ATOM   4829 N N   . SER F 2 57  ? 71.107  63.192 36.761 1.00 64.54  ? 56  SER F N   1 
ATOM   4830 C CA  . SER F 2 57  ? 71.720  62.589 35.577 1.00 66.41  ? 56  SER F CA  1 
ATOM   4831 C C   . SER F 2 57  ? 71.473  61.077 35.624 1.00 63.00  ? 56  SER F C   1 
ATOM   4832 O O   . SER F 2 57  ? 71.596  60.470 36.683 1.00 66.12  ? 56  SER F O   1 
ATOM   4833 C CB  . SER F 2 57  ? 73.225  62.902 35.557 1.00 70.43  ? 56  SER F CB  1 
ATOM   4834 O OG  . SER F 2 57  ? 73.868  62.348 34.420 1.00 74.16  ? 56  SER F OG  1 
ATOM   4835 N N   . ILE F 2 58  ? 71.149  60.471 34.487 1.00 62.37  ? 57  ILE F N   1 
ATOM   4836 C CA  . ILE F 2 58  ? 70.863  59.034 34.436 1.00 58.52  ? 57  ILE F CA  1 
ATOM   4837 C C   . ILE F 2 58  ? 71.830  58.183 33.619 1.00 58.15  ? 57  ILE F C   1 
ATOM   4838 O O   . ILE F 2 58  ? 72.218  58.571 32.519 1.00 61.84  ? 57  ILE F O   1 
ATOM   4839 C CB  . ILE F 2 58  ? 69.493  58.783 33.836 1.00 58.60  ? 57  ILE F CB  1 
ATOM   4840 C CG1 . ILE F 2 58  ? 68.436  59.619 34.551 1.00 60.73  ? 57  ILE F CG1 1 
ATOM   4841 C CG2 . ILE F 2 58  ? 69.166  57.313 33.923 1.00 62.08  ? 57  ILE F CG2 1 
ATOM   4842 C CD1 . ILE F 2 58  ? 67.068  59.506 33.919 1.00 58.44  ? 57  ILE F CD1 1 
ATOM   4843 N N   . GLU F 2 59  ? 72.173  57.001 34.135 1.00 58.98  ? 58  GLU F N   1 
ATOM   4844 C CA  . GLU F 2 59  ? 73.071  56.055 33.440 1.00 58.56  ? 58  GLU F CA  1 
ATOM   4845 C C   . GLU F 2 59  ? 72.476  54.636 33.471 1.00 57.79  ? 58  GLU F C   1 
ATOM   4846 O O   . GLU F 2 59  ? 71.979  54.195 34.516 1.00 58.11  ? 58  GLU F O   1 
ATOM   4847 C CB  . GLU F 2 59  ? 74.457  56.030 34.072 1.00 51.91  ? 58  GLU F CB  1 
ATOM   4848 C CG  . GLU F 2 59  ? 75.166  57.362 34.092 1.00 50.63  ? 58  GLU F CG  1 
ATOM   4849 C CD  . GLU F 2 59  ? 76.557  57.241 34.682 1.00 55.92  ? 58  GLU F CD  1 
ATOM   4850 O OE1 . GLU F 2 59  ? 77.143  56.136 34.615 1.00 57.33  ? 58  GLU F OE1 1 
ATOM   4851 O OE2 . GLU F 2 59  ? 77.068  58.251 35.211 1.00 56.29  ? 58  GLU F OE2 1 
ATOM   4852 N N   . TYR F 2 60  ? 72.495  53.955 32.322 1.00 53.18  ? 59  TYR F N   1 
ATOM   4853 C CA  . TYR F 2 60  ? 71.951  52.603 32.185 1.00 50.47  ? 59  TYR F CA  1 
ATOM   4854 C C   . TYR F 2 60  ? 73.064  51.640 31.810 1.00 52.90  ? 59  TYR F C   1 
ATOM   4855 O O   . TYR F 2 60  ? 74.100  52.054 31.289 1.00 55.50  ? 59  TYR F O   1 
ATOM   4856 C CB  . TYR F 2 60  ? 70.890  52.536 31.075 1.00 44.66  ? 59  TYR F CB  1 
ATOM   4857 C CG  . TYR F 2 60  ? 69.730  53.498 31.221 1.00 50.14  ? 59  TYR F CG  1 
ATOM   4858 C CD1 . TYR F 2 60  ? 68.673  53.220 32.078 1.00 50.31  ? 59  TYR F CD1 1 
ATOM   4859 C CD2 . TYR F 2 60  ? 69.690  54.689 30.509 1.00 54.33  ? 59  TYR F CD2 1 
ATOM   4860 C CE1 . TYR F 2 60  ? 67.610  54.101 32.229 1.00 48.13  ? 59  TYR F CE1 1 
ATOM   4861 C CE2 . TYR F 2 60  ? 68.626  55.584 30.652 1.00 53.73  ? 59  TYR F CE2 1 
ATOM   4862 C CZ  . TYR F 2 60  ? 67.590  55.283 31.515 1.00 53.62  ? 59  TYR F CZ  1 
ATOM   4863 O OH  . TYR F 2 60  ? 66.537  56.169 31.686 1.00 57.31  ? 59  TYR F OH  1 
ATOM   4864 N N   . ASN F 2 61  ? 72.864  50.361 32.114 1.00 54.56  ? 60  ASN F N   1 
ATOM   4865 C CA  . ASN F 2 61  ? 73.824  49.321 31.754 1.00 53.46  ? 60  ASN F CA  1 
ATOM   4866 C C   . ASN F 2 61  ? 73.652  49.272 30.218 1.00 55.52  ? 60  ASN F C   1 
ATOM   4867 O O   . ASN F 2 61  ? 72.520  49.272 29.731 1.00 53.00  ? 60  ASN F O   1 
ATOM   4868 C CB  . ASN F 2 61  ? 73.402  47.986 32.411 1.00 45.52  ? 60  ASN F CB  1 
ATOM   4869 C CG  . ASN F 2 61  ? 74.410  46.842 32.181 1.00 48.45  ? 60  ASN F CG  1 
ATOM   4870 O OD1 . ASN F 2 61  ? 74.939  46.655 31.079 1.00 53.34  ? 60  ASN F OD1 1 
ATOM   4871 N ND2 . ASN F 2 61  ? 74.655  46.063 33.217 1.00 40.77  ? 60  ASN F ND2 1 
ATOM   4872 N N   . PRO F 2 62  ? 74.757  49.292 29.440 1.00 58.49  ? 61  PRO F N   1 
ATOM   4873 C CA  . PRO F 2 62  ? 74.656  49.252 27.973 1.00 58.74  ? 61  PRO F CA  1 
ATOM   4874 C C   . PRO F 2 62  ? 73.770  48.113 27.414 1.00 59.84  ? 61  PRO F C   1 
ATOM   4875 O O   . PRO F 2 62  ? 72.866  48.346 26.587 1.00 56.74  ? 61  PRO F O   1 
ATOM   4876 C CB  . PRO F 2 62  ? 76.124  49.116 27.535 1.00 55.76  ? 61  PRO F CB  1 
ATOM   4877 C CG  . PRO F 2 62  ? 76.791  48.453 28.712 1.00 57.41  ? 61  PRO F CG  1 
ATOM   4878 C CD  . PRO F 2 62  ? 76.168  49.228 29.852 1.00 57.61  ? 61  PRO F CD  1 
ATOM   4879 N N   . ALA F 2 63  ? 73.983  46.902 27.923 1.00 55.58  ? 62  ALA F N   1 
ATOM   4880 C CA  . ALA F 2 63  ? 73.227  45.742 27.488 1.00 56.98  ? 62  ALA F CA  1 
ATOM   4881 C C   . ALA F 2 63  ? 71.709  45.829 27.723 1.00 61.41  ? 62  ALA F C   1 
ATOM   4882 O O   . ALA F 2 63  ? 70.915  45.261 26.967 1.00 70.59  ? 62  ALA F O   1 
ATOM   4883 C CB  . ALA F 2 63  ? 73.781  44.499 28.142 1.00 50.25  ? 62  ALA F CB  1 
ATOM   4884 N N   . LEU F 2 64  ? 71.278  46.527 28.761 1.00 60.09  ? 63  LEU F N   1 
ATOM   4885 C CA  . LEU F 2 64  ? 69.845  46.600 29.010 1.00 58.00  ? 63  LEU F CA  1 
ATOM   4886 C C   . LEU F 2 64  ? 69.353  47.978 28.685 1.00 60.71  ? 63  LEU F C   1 
ATOM   4887 O O   . LEU F 2 64  ? 68.178  48.261 28.847 1.00 61.56  ? 63  LEU F O   1 
ATOM   4888 C CB  . LEU F 2 64  ? 69.555  46.302 30.471 1.00 58.25  ? 63  LEU F CB  1 
ATOM   4889 C CG  . LEU F 2 64  ? 70.424  45.200 31.062 1.00 58.69  ? 63  LEU F CG  1 
ATOM   4890 C CD1 . LEU F 2 64  ? 70.251  45.181 32.541 1.00 60.87  ? 63  LEU F CD1 1 
ATOM   4891 C CD2 . LEU F 2 64  ? 70.064  43.866 30.463 1.00 63.92  ? 63  LEU F CD2 1 
ATOM   4892 N N   . LYS F 2 65  ? 70.255  48.822 28.194 1.00 66.98  ? 64  LYS F N   1 
ATOM   4893 C CA  . LYS F 2 65  ? 69.952  50.217 27.876 1.00 71.10  ? 64  LYS F CA  1 
ATOM   4894 C C   . LYS F 2 65  ? 68.671  50.410 27.099 1.00 71.22  ? 64  LYS F C   1 
ATOM   4895 O O   . LYS F 2 65  ? 67.858  51.271 27.432 1.00 69.61  ? 64  LYS F O   1 
ATOM   4896 C CB  . LYS F 2 65  ? 71.110  50.863 27.114 1.00 76.75  ? 64  LYS F CB  1 
ATOM   4897 C CG  . LYS F 2 65  ? 70.966  52.377 26.936 1.00 80.63  ? 64  LYS F CG  1 
ATOM   4898 C CD  . LYS F 2 65  ? 72.140  52.912 26.131 1.00 87.53  ? 64  LYS F CD  1 
ATOM   4899 C CE  . LYS F 2 65  ? 72.075  54.419 25.975 1.00 86.77  ? 64  LYS F CE  1 
ATOM   4900 N NZ  . LYS F 2 65  ? 73.275  54.931 25.251 1.00 82.21  ? 64  LYS F NZ  1 
ATOM   4901 N N   . SER F 2 66  ? 68.528  49.630 26.031 1.00 74.37  ? 65  SER F N   1 
ATOM   4902 C CA  . SER F 2 66  ? 67.352  49.678 25.161 1.00 74.43  ? 65  SER F CA  1 
ATOM   4903 C C   . SER F 2 66  ? 66.028  49.496 25.910 1.00 73.95  ? 65  SER F C   1 
ATOM   4904 O O   . SER F 2 66  ? 65.087  50.261 25.727 1.00 75.53  ? 65  SER F O   1 
ATOM   4905 C CB  . SER F 2 66  ? 67.482  48.586 24.095 1.00 74.24  ? 65  SER F CB  1 
ATOM   4906 O OG  . SER F 2 66  ? 68.005  47.389 24.651 1.00 74.49  ? 65  SER F OG  1 
ATOM   4907 N N   . ARG F 2 67  ? 66.001  48.492 26.781 1.00 73.74  ? 66  ARG F N   1 
ATOM   4908 C CA  . ARG F 2 67  ? 64.824  48.121 27.559 1.00 67.66  ? 66  ARG F CA  1 
ATOM   4909 C C   . ARG F 2 67  ? 64.627  48.895 28.871 1.00 66.30  ? 66  ARG F C   1 
ATOM   4910 O O   . ARG F 2 67  ? 63.513  48.956 29.389 1.00 63.52  ? 66  ARG F O   1 
ATOM   4911 C CB  . ARG F 2 67  ? 64.880  46.621 27.864 1.00 64.17  ? 66  ARG F CB  1 
ATOM   4912 C CG  . ARG F 2 67  ? 65.287  45.736 26.674 1.00 71.88  ? 66  ARG F CG  1 
ATOM   4913 C CD  . ARG F 2 67  ? 65.910  44.398 27.118 1.00 73.38  ? 66  ARG F CD  1 
ATOM   4914 N NE  . ARG F 2 67  ? 65.061  43.730 28.103 1.00 73.47  ? 66  ARG F NE  1 
ATOM   4915 C CZ  . ARG F 2 67  ? 65.486  42.865 29.019 1.00 68.12  ? 66  ARG F CZ  1 
ATOM   4916 N NH1 . ARG F 2 67  ? 66.766  42.529 29.096 1.00 69.00  ? 66  ARG F NH1 1 
ATOM   4917 N NH2 . ARG F 2 67  ? 64.629  42.407 29.911 1.00 67.00  ? 66  ARG F NH2 1 
ATOM   4918 N N   . LEU F 2 68  ? 65.693  49.467 29.424 1.00 63.74  ? 67  LEU F N   1 
ATOM   4919 C CA  . LEU F 2 68  ? 65.581  50.187 30.693 1.00 58.09  ? 67  LEU F CA  1 
ATOM   4920 C C   . LEU F 2 68  ? 65.094  51.632 30.647 1.00 52.72  ? 67  LEU F C   1 
ATOM   4921 O O   . LEU F 2 68  ? 65.077  52.274 29.596 1.00 56.46  ? 67  LEU F O   1 
ATOM   4922 C CB  . LEU F 2 68  ? 66.895  50.097 31.484 1.00 60.16  ? 67  LEU F CB  1 
ATOM   4923 C CG  . LEU F 2 68  ? 67.122  48.861 32.363 1.00 56.35  ? 67  LEU F CG  1 
ATOM   4924 C CD1 . LEU F 2 68  ? 68.550  48.807 32.898 1.00 54.41  ? 67  LEU F CD1 1 
ATOM   4925 C CD2 . LEU F 2 68  ? 66.132  48.902 33.496 1.00 51.62  ? 67  LEU F CD2 1 
ATOM   4926 N N   . SER F 2 69  ? 64.674  52.114 31.812 1.00 50.95  ? 68  SER F N   1 
ATOM   4927 C CA  . SER F 2 69  ? 64.180  53.472 32.012 1.00 52.87  ? 68  SER F CA  1 
ATOM   4928 C C   . SER F 2 69  ? 64.191  53.770 33.509 1.00 54.28  ? 68  SER F C   1 
ATOM   4929 O O   . SER F 2 69  ? 63.577  53.050 34.297 1.00 54.14  ? 68  SER F O   1 
ATOM   4930 C CB  . SER F 2 69  ? 62.776  53.651 31.462 1.00 49.82  ? 68  SER F CB  1 
ATOM   4931 O OG  . SER F 2 69  ? 62.219  54.842 31.992 1.00 62.25  ? 68  SER F OG  1 
ATOM   4932 N N   . ILE F 2 70  ? 64.905  54.825 33.888 1.00 55.25  ? 69  ILE F N   1 
ATOM   4933 C CA  . ILE F 2 70  ? 65.037  55.218 35.277 1.00 50.63  ? 69  ILE F CA  1 
ATOM   4934 C C   . ILE F 2 70  ? 64.672  56.676 35.461 1.00 54.13  ? 69  ILE F C   1 
ATOM   4935 O O   . ILE F 2 70  ? 65.066  57.529 34.671 1.00 59.84  ? 69  ILE F O   1 
ATOM   4936 C CB  . ILE F 2 70  ? 66.475  55.026 35.738 1.00 44.32  ? 69  ILE F CB  1 
ATOM   4937 C CG1 . ILE F 2 70  ? 66.886  53.568 35.558 1.00 39.08  ? 69  ILE F CG1 1 
ATOM   4938 C CG2 . ILE F 2 70  ? 66.627  55.470 37.182 1.00 48.82  ? 69  ILE F CG2 1 
ATOM   4939 C CD1 . ILE F 2 70  ? 68.343  53.315 35.852 1.00 43.03  ? 69  ILE F CD1 1 
ATOM   4940 N N   . SER F 2 71  ? 63.955  56.969 36.532 1.00 56.30  ? 70  SER F N   1 
ATOM   4941 C CA  . SER F 2 71  ? 63.547  58.339 36.815 1.00 60.42  ? 70  SER F CA  1 
ATOM   4942 C C   . SER F 2 71  ? 63.354  58.511 38.334 1.00 62.62  ? 70  SER F C   1 
ATOM   4943 O O   . SER F 2 71  ? 63.486  57.549 39.091 1.00 57.94  ? 70  SER F O   1 
ATOM   4944 C CB  . SER F 2 71  ? 62.254  58.671 36.053 1.00 57.73  ? 70  SER F CB  1 
ATOM   4945 O OG  . SER F 2 71  ? 61.149  57.921 36.548 1.00 64.23  ? 70  SER F OG  1 
ATOM   4946 N N   . LYS F 2 72  ? 63.107  59.742 38.780 1.00 67.21  ? 71  LYS F N   1 
ATOM   4947 C CA  . LYS F 2 72  ? 62.893  60.018 40.200 1.00 68.25  ? 71  LYS F CA  1 
ATOM   4948 C C   . LYS F 2 72  ? 62.012  61.234 40.434 1.00 66.71  ? 71  LYS F C   1 
ATOM   4949 O O   . LYS F 2 72  ? 61.670  61.968 39.501 1.00 65.12  ? 71  LYS F O   1 
ATOM   4950 C CB  . LYS F 2 72  ? 64.220  60.169 40.965 1.00 74.10  ? 71  LYS F CB  1 
ATOM   4951 C CG  . LYS F 2 72  ? 65.019  61.446 40.693 1.00 73.63  ? 71  LYS F CG  1 
ATOM   4952 C CD  . LYS F 2 72  ? 66.237  61.538 41.626 1.00 73.27  ? 71  LYS F CD  1 
ATOM   4953 C CE  . LYS F 2 72  ? 67.025  62.840 41.462 1.00 65.48  ? 71  LYS F CE  1 
ATOM   4954 N NZ  . LYS F 2 72  ? 67.886  63.053 42.659 1.00 57.90  ? 71  LYS F NZ  1 
ATOM   4955 N N   . ASP F 2 73  ? 61.662  61.446 41.695 1.00 69.27  ? 72  ASP F N   1 
ATOM   4956 C CA  . ASP F 2 73  ? 60.809  62.555 42.098 1.00 73.79  ? 72  ASP F CA  1 
ATOM   4957 C C   . ASP F 2 73  ? 61.200  62.898 43.528 1.00 75.69  ? 72  ASP F C   1 
ATOM   4958 O O   . ASP F 2 73  ? 60.622  62.372 44.477 1.00 78.22  ? 72  ASP F O   1 
ATOM   4959 C CB  . ASP F 2 73  ? 59.343  62.106 42.042 1.00 75.42  ? 72  ASP F CB  1 
ATOM   4960 C CG  . ASP F 2 73  ? 58.371  63.217 42.368 1.00 78.65  ? 72  ASP F CG  1 
ATOM   4961 O OD1 . ASP F 2 73  ? 58.742  64.406 42.233 1.00 82.06  ? 72  ASP F OD1 1 
ATOM   4962 O OD2 . ASP F 2 73  ? 57.227  62.892 42.754 1.00 80.81  ? 72  ASP F OD2 1 
ATOM   4963 N N   . ASN F 2 74  ? 62.189  63.776 43.674 1.00 78.57  ? 73  ASN F N   1 
ATOM   4964 C CA  . ASN F 2 74  ? 62.703  64.184 44.990 1.00 82.65  ? 73  ASN F CA  1 
ATOM   4965 C C   . ASN F 2 74  ? 61.610  64.665 45.944 1.00 85.02  ? 73  ASN F C   1 
ATOM   4966 O O   . ASN F 2 74  ? 61.642  64.347 47.141 1.00 81.41  ? 73  ASN F O   1 
ATOM   4967 C CB  . ASN F 2 74  ? 63.767  65.289 44.853 1.00 84.43  ? 73  ASN F CB  1 
ATOM   4968 C CG  . ASN F 2 74  ? 64.800  64.994 43.767 1.00 86.29  ? 73  ASN F CG  1 
ATOM   4969 O OD1 . ASN F 2 74  ? 65.869  64.430 44.040 1.00 85.23  ? 73  ASN F OD1 1 
ATOM   4970 N ND2 . ASN F 2 74  ? 64.498  65.418 42.533 1.00 82.29  ? 73  ASN F ND2 1 
ATOM   4971 N N   . SER F 2 75  ? 60.641  65.415 45.408 1.00 86.76  ? 74  SER F N   1 
ATOM   4972 C CA  . SER F 2 75  ? 59.537  65.936 46.215 1.00 86.83  ? 74  SER F CA  1 
ATOM   4973 C C   . SER F 2 75  ? 58.838  64.794 46.956 1.00 86.66  ? 74  SER F C   1 
ATOM   4974 O O   . SER F 2 75  ? 58.649  64.870 48.172 1.00 84.53  ? 74  SER F O   1 
ATOM   4975 C CB  . SER F 2 75  ? 58.545  66.739 45.352 1.00 85.48  ? 74  SER F CB  1 
ATOM   4976 O OG  . SER F 2 75  ? 58.023  65.983 44.277 1.00 78.30  ? 74  SER F OG  1 
ATOM   4977 N N   . LYS F 2 76  ? 58.508  63.721 46.228 1.00 88.23  ? 75  LYS F N   1 
ATOM   4978 C CA  . LYS F 2 76  ? 57.857  62.546 46.824 1.00 86.96  ? 75  LYS F CA  1 
ATOM   4979 C C   . LYS F 2 76  ? 58.875  61.529 47.372 1.00 83.72  ? 75  LYS F C   1 
ATOM   4980 O O   . LYS F 2 76  ? 58.510  60.518 47.984 1.00 82.15  ? 75  LYS F O   1 
ATOM   4981 C CB  . LYS F 2 76  ? 56.896  61.868 45.838 1.00 87.06  ? 75  LYS F CB  1 
ATOM   4982 C CG  . LYS F 2 76  ? 55.868  61.014 46.570 1.00 92.82  ? 75  LYS F CG  1 
ATOM   4983 C CD  . LYS F 2 76  ? 54.812  60.408 45.678 1.00 92.34  ? 75  LYS F CD  1 
ATOM   4984 C CE  . LYS F 2 76  ? 53.865  59.583 46.533 1.00 89.27  ? 75  LYS F CE  1 
ATOM   4985 N NZ  . LYS F 2 76  ? 52.866  58.880 45.703 1.00 93.72  ? 75  LYS F NZ  1 
ATOM   4986 N N   . SER F 2 77  ? 60.149  61.794 47.104 1.00 79.47  ? 76  SER F N   1 
ATOM   4987 C CA  . SER F 2 77  ? 61.237  60.964 47.578 1.00 73.22  ? 76  SER F CA  1 
ATOM   4988 C C   . SER F 2 77  ? 61.185  59.534 47.028 1.00 69.67  ? 76  SER F C   1 
ATOM   4989 O O   . SER F 2 77  ? 61.355  58.557 47.765 1.00 69.22  ? 76  SER F O   1 
ATOM   4990 C CB  . SER F 2 77  ? 61.236  60.971 49.106 1.00 73.37  ? 76  SER F CB  1 
ATOM   4991 O OG  . SER F 2 77  ? 62.516  60.656 49.613 1.00 81.46  ? 76  SER F OG  1 
ATOM   4992 N N   . GLN F 2 78  ? 61.007  59.419 45.719 1.00 64.50  ? 77  GLN F N   1 
ATOM   4993 C CA  . GLN F 2 78  ? 60.938  58.121 45.078 1.00 60.45  ? 77  GLN F CA  1 
ATOM   4994 C C   . GLN F 2 78  ? 61.838  57.988 43.867 1.00 58.04  ? 77  GLN F C   1 
ATOM   4995 O O   . GLN F 2 78  ? 62.061  58.952 43.136 1.00 57.66  ? 77  GLN F O   1 
ATOM   4996 C CB  . GLN F 2 78  ? 59.515  57.848 44.640 1.00 64.44  ? 77  GLN F CB  1 
ATOM   4997 C CG  . GLN F 2 78  ? 58.523  57.817 45.762 1.00 70.52  ? 77  GLN F CG  1 
ATOM   4998 C CD  . GLN F 2 78  ? 57.111  57.651 45.257 1.00 73.04  ? 77  GLN F CD  1 
ATOM   4999 O OE1 . GLN F 2 78  ? 56.749  58.185 44.200 1.00 74.65  ? 77  GLN F OE1 1 
ATOM   5000 N NE2 . GLN F 2 78  ? 56.298  56.918 46.008 1.00 69.46  ? 77  GLN F NE2 1 
ATOM   5001 N N   . ILE F 2 79  ? 62.381  56.793 43.682 1.00 56.71  ? 78  ILE F N   1 
ATOM   5002 C CA  . ILE F 2 79  ? 63.222  56.503 42.536 1.00 56.89  ? 78  ILE F CA  1 
ATOM   5003 C C   . ILE F 2 79  ? 62.507  55.354 41.834 1.00 57.68  ? 78  ILE F C   1 
ATOM   5004 O O   . ILE F 2 79  ? 62.132  54.379 42.476 1.00 53.73  ? 78  ILE F O   1 
ATOM   5005 C CB  . ILE F 2 79  ? 64.613  56.003 42.930 1.00 53.58  ? 78  ILE F CB  1 
ATOM   5006 C CG1 . ILE F 2 79  ? 65.240  56.936 43.958 1.00 59.01  ? 78  ILE F CG1 1 
ATOM   5007 C CG2 . ILE F 2 79  ? 65.489  55.900 41.700 1.00 52.20  ? 78  ILE F CG2 1 
ATOM   5008 C CD1 . ILE F 2 79  ? 64.727  56.736 45.363 1.00 53.49  ? 78  ILE F CD1 1 
ATOM   5009 N N   . PHE F 2 80  ? 62.336  55.478 40.525 1.00 59.25  ? 79  PHE F N   1 
ATOM   5010 C CA  . PHE F 2 80  ? 61.656  54.488 39.708 1.00 57.41  ? 79  PHE F CA  1 
ATOM   5011 C C   . PHE F 2 80  ? 62.565  53.726 38.734 1.00 58.50  ? 79  PHE F C   1 
ATOM   5012 O O   . PHE F 2 80  ? 63.636  54.206 38.353 1.00 59.74  ? 79  PHE F O   1 
ATOM   5013 C CB  . PHE F 2 80  ? 60.548  55.184 38.920 1.00 58.15  ? 79  PHE F CB  1 
ATOM   5014 C CG  . PHE F 2 80  ? 59.614  55.971 39.774 1.00 62.31  ? 79  PHE F CG  1 
ATOM   5015 C CD1 . PHE F 2 80  ? 58.627  55.331 40.505 1.00 63.01  ? 79  PHE F CD1 1 
ATOM   5016 C CD2 . PHE F 2 80  ? 59.736  57.347 39.871 1.00 67.20  ? 79  PHE F CD2 1 
ATOM   5017 C CE1 . PHE F 2 80  ? 57.766  56.049 41.337 1.00 67.45  ? 79  PHE F CE1 1 
ATOM   5018 C CE2 . PHE F 2 80  ? 58.875  58.082 40.706 1.00 69.44  ? 79  PHE F CE2 1 
ATOM   5019 C CZ  . PHE F 2 80  ? 57.892  57.430 41.439 1.00 67.53  ? 79  PHE F CZ  1 
ATOM   5020 N N   . LEU F 2 81  ? 62.116  52.529 38.351 1.00 58.02  ? 80  LEU F N   1 
ATOM   5021 C CA  . LEU F 2 81  ? 62.792  51.648 37.391 1.00 54.04  ? 80  LEU F CA  1 
ATOM   5022 C C   . LEU F 2 81  ? 61.690  50.904 36.625 1.00 55.14  ? 80  LEU F C   1 
ATOM   5023 O O   . LEU F 2 81  ? 60.682  50.500 37.221 1.00 53.40  ? 80  LEU F O   1 
ATOM   5024 C CB  . LEU F 2 81  ? 63.683  50.629 38.102 1.00 49.15  ? 80  LEU F CB  1 
ATOM   5025 C CG  . LEU F 2 81  ? 64.190  49.483 37.221 1.00 49.64  ? 80  LEU F CG  1 
ATOM   5026 C CD1 . LEU F 2 81  ? 65.140  50.046 36.195 1.00 52.19  ? 80  LEU F CD1 1 
ATOM   5027 C CD2 . LEU F 2 81  ? 64.865  48.396 38.055 1.00 41.92  ? 80  LEU F CD2 1 
ATOM   5028 N N   . LYS F 2 82  ? 61.895  50.696 35.326 1.00 53.19  ? 81  LYS F N   1 
ATOM   5029 C CA  . LYS F 2 82  ? 60.889  50.032 34.507 1.00 55.05  ? 81  LYS F CA  1 
ATOM   5030 C C   . LYS F 2 82  ? 61.538  49.237 33.395 1.00 56.31  ? 81  LYS F C   1 
ATOM   5031 O O   . LYS F 2 82  ? 62.152  49.819 32.529 1.00 59.58  ? 81  LYS F O   1 
ATOM   5032 C CB  . LYS F 2 82  ? 59.982  51.090 33.888 1.00 56.13  ? 81  LYS F CB  1 
ATOM   5033 C CG  . LYS F 2 82  ? 58.885  50.552 33.002 1.00 72.37  ? 81  LYS F CG  1 
ATOM   5034 C CD  . LYS F 2 82  ? 58.415  51.629 32.014 1.00 83.00  ? 81  LYS F CD  1 
ATOM   5035 C CE  . LYS F 2 82  ? 57.028  51.332 31.372 1.00 85.23  ? 81  LYS F CE  1 
ATOM   5036 N NZ  . LYS F 2 82  ? 56.988  50.133 30.468 1.00 82.38  ? 81  LYS F NZ  1 
ATOM   5037 N N   . MET F 2 83  ? 61.487  47.911 33.452 1.00 63.68  ? 82  MET F N   1 
ATOM   5038 C CA  . MET F 2 83  ? 62.047  47.082 32.377 1.00 70.81  ? 82  MET F CA  1 
ATOM   5039 C C   . MET F 2 83  ? 60.940  46.643 31.414 1.00 76.17  ? 82  MET F C   1 
ATOM   5040 O O   . MET F 2 83  ? 59.812  46.354 31.833 1.00 79.17  ? 82  MET F O   1 
ATOM   5041 C CB  . MET F 2 83  ? 62.740  45.839 32.918 1.00 68.98  ? 82  MET F CB  1 
ATOM   5042 C CG  . MET F 2 83  ? 64.193  46.016 33.149 1.00 70.45  ? 82  MET F CG  1 
ATOM   5043 S SD  . MET F 2 83  ? 64.951  44.453 32.831 1.00 79.42  ? 82  MET F SD  1 
ATOM   5044 C CE  . MET F 2 83  ? 66.194  44.377 34.138 1.00 75.95  ? 82  MET F CE  1 
ATOM   5045 N N   . ASN F 2 84  A 61.281  46.538 30.133 1.00 80.13  ? 82  ASN F N   1 
ATOM   5046 C CA  . ASN F 2 84  A 60.317  46.147 29.109 1.00 81.97  ? 82  ASN F CA  1 
ATOM   5047 C C   . ASN F 2 84  A 60.576  44.764 28.559 1.00 81.97  ? 82  ASN F C   1 
ATOM   5048 O O   . ASN F 2 84  A 61.702  44.253 28.630 1.00 80.55  ? 82  ASN F O   1 
ATOM   5049 C CB  . ASN F 2 84  A 60.292  47.159 27.957 1.00 88.54  ? 82  ASN F CB  1 
ATOM   5050 C CG  . ASN F 2 84  A 59.138  48.137 28.069 1.00 97.02  ? 82  ASN F CG  1 
ATOM   5051 O OD1 . ASN F 2 84  A 59.259  49.198 28.688 1.00 100.00 ? 82  ASN F OD1 1 
ATOM   5052 N ND2 . ASN F 2 84  A 57.997  47.775 27.487 1.00 100.00 ? 82  ASN F ND2 1 
ATOM   5053 N N   . SER F 2 85  B 59.509  44.166 28.032 1.00 81.61  ? 82  SER F N   1 
ATOM   5054 C CA  . SER F 2 85  B 59.563  42.836 27.447 1.00 80.52  ? 82  SER F CA  1 
ATOM   5055 C C   . SER F 2 85  B 60.307  41.891 28.395 1.00 78.21  ? 82  SER F C   1 
ATOM   5056 O O   . SER F 2 85  B 61.397  41.392 28.071 1.00 78.89  ? 82  SER F O   1 
ATOM   5057 C CB  . SER F 2 85  B 60.237  42.908 26.078 1.00 78.72  ? 82  SER F CB  1 
ATOM   5058 O OG  . SER F 2 85  B 59.644  43.963 25.324 1.00 78.13  ? 82  SER F OG  1 
ATOM   5059 N N   . LEU F 2 86  C 59.723  41.701 29.586 1.00 69.94  ? 82  LEU F N   1 
ATOM   5060 C CA  . LEU F 2 86  C 60.286  40.847 30.625 1.00 59.63  ? 82  LEU F CA  1 
ATOM   5061 C C   . LEU F 2 86  C 60.549  39.482 30.050 1.00 58.18  ? 82  LEU F C   1 
ATOM   5062 O O   . LEU F 2 86  C 59.850  39.035 29.148 1.00 59.78  ? 82  LEU F O   1 
ATOM   5063 C CB  . LEU F 2 86  C 59.335  40.753 31.812 1.00 56.33  ? 82  LEU F CB  1 
ATOM   5064 C CG  . LEU F 2 86  C 59.329  41.976 32.730 1.00 53.98  ? 82  LEU F CG  1 
ATOM   5065 C CD1 . LEU F 2 86  C 58.148  41.934 33.630 1.00 51.14  ? 82  LEU F CD1 1 
ATOM   5066 C CD2 . LEU F 2 86  C 60.596  42.014 33.537 1.00 59.18  ? 82  LEU F CD2 1 
ATOM   5067 N N   . GLN F 2 87  ? 61.560  38.823 30.583 1.00 59.89  ? 83  GLN F N   1 
ATOM   5068 C CA  . GLN F 2 87  ? 61.965  37.511 30.104 1.00 63.13  ? 83  GLN F CA  1 
ATOM   5069 C C   . GLN F 2 87  ? 62.304  36.662 31.313 1.00 61.53  ? 83  GLN F C   1 
ATOM   5070 O O   . GLN F 2 87  ? 62.674  37.178 32.365 1.00 63.87  ? 83  GLN F O   1 
ATOM   5071 C CB  . GLN F 2 87  ? 63.164  37.654 29.162 1.00 69.76  ? 83  GLN F CB  1 
ATOM   5072 C CG  . GLN F 2 87  ? 62.861  38.566 27.945 1.00 78.70  ? 83  GLN F CG  1 
ATOM   5073 C CD  . GLN F 2 87  ? 64.094  39.250 27.334 1.00 81.36  ? 83  GLN F CD  1 
ATOM   5074 O OE1 . GLN F 2 87  ? 65.234  38.958 27.726 1.00 78.00  ? 83  GLN F OE1 1 
ATOM   5075 N NE2 . GLN F 2 87  ? 63.866  40.154 26.365 1.00 71.91  ? 83  GLN F NE2 1 
ATOM   5076 N N   . THR F 2 88  ? 62.135  35.358 31.187 1.00 59.37  ? 84  THR F N   1 
ATOM   5077 C CA  . THR F 2 88  ? 62.411  34.455 32.292 1.00 60.37  ? 84  THR F CA  1 
ATOM   5078 C C   . THR F 2 88  ? 63.771  34.714 32.945 1.00 61.43  ? 84  THR F C   1 
ATOM   5079 O O   . THR F 2 88  ? 63.958  34.477 34.147 1.00 60.65  ? 84  THR F O   1 
ATOM   5080 C CB  . THR F 2 88  ? 62.305  33.002 31.835 1.00 62.40  ? 84  THR F CB  1 
ATOM   5081 O OG1 . THR F 2 88  ? 63.001  32.839 30.590 1.00 69.18  ? 84  THR F OG1 1 
ATOM   5082 C CG2 . THR F 2 88  ? 60.849  32.614 31.659 1.00 52.23  ? 84  THR F CG2 1 
ATOM   5083 N N   . ASP F 2 89  ? 64.720  35.216 32.151 1.00 64.20  ? 85  ASP F N   1 
ATOM   5084 C CA  . ASP F 2 89  ? 66.059  35.538 32.648 1.00 62.82  ? 85  ASP F CA  1 
ATOM   5085 C C   . ASP F 2 89  ? 66.064  36.697 33.625 1.00 55.76  ? 85  ASP F C   1 
ATOM   5086 O O   . ASP F 2 89  ? 66.974  36.803 34.429 1.00 50.13  ? 85  ASP F O   1 
ATOM   5087 C CB  . ASP F 2 89  ? 66.987  35.905 31.498 1.00 75.16  ? 85  ASP F CB  1 
ATOM   5088 C CG  . ASP F 2 89  ? 67.472  34.699 30.725 1.00 89.30  ? 85  ASP F CG  1 
ATOM   5089 O OD1 . ASP F 2 89  ? 67.305  33.556 31.211 1.00 96.04  ? 85  ASP F OD1 1 
ATOM   5090 O OD2 . ASP F 2 89  ? 68.043  34.905 29.626 1.00 96.77  ? 85  ASP F OD2 1 
ATOM   5091 N N   . ASP F 2 90  ? 65.058  37.564 33.525 1.00 48.66  ? 86  ASP F N   1 
ATOM   5092 C CA  . ASP F 2 90  ? 64.922  38.744 34.365 1.00 49.06  ? 86  ASP F CA  1 
ATOM   5093 C C   . ASP F 2 90  ? 64.480  38.540 35.789 1.00 51.09  ? 86  ASP F C   1 
ATOM   5094 O O   . ASP F 2 90  ? 64.334  39.495 36.544 1.00 52.71  ? 86  ASP F O   1 
ATOM   5095 C CB  . ASP F 2 90  ? 64.015  39.746 33.692 1.00 45.25  ? 86  ASP F CB  1 
ATOM   5096 C CG  . ASP F 2 90  ? 64.636  40.299 32.452 1.00 56.15  ? 86  ASP F CG  1 
ATOM   5097 O OD1 . ASP F 2 90  ? 65.775  40.815 32.536 1.00 57.74  ? 86  ASP F OD1 1 
ATOM   5098 O OD2 . ASP F 2 90  ? 64.020  40.164 31.380 1.00 61.89  ? 86  ASP F OD2 1 
ATOM   5099 N N   . SER F 2 91  ? 64.235  37.298 36.156 1.00 51.06  ? 87  SER F N   1 
ATOM   5100 C CA  . SER F 2 91  ? 63.822  37.009 37.507 1.00 47.99  ? 87  SER F CA  1 
ATOM   5101 C C   . SER F 2 91  ? 65.047  37.237 38.391 1.00 42.90  ? 87  SER F C   1 
ATOM   5102 O O   . SER F 2 91  ? 66.130  36.773 38.072 1.00 47.32  ? 87  SER F O   1 
ATOM   5103 C CB  . SER F 2 91  ? 63.324  35.551 37.597 1.00 51.66  ? 87  SER F CB  1 
ATOM   5104 O OG  . SER F 2 91  ? 62.081  35.361 36.923 1.00 41.67  ? 87  SER F OG  1 
ATOM   5105 N N   . ALA F 2 92  ? 64.882  37.975 39.479 1.00 41.14  ? 88  ALA F N   1 
ATOM   5106 C CA  . ALA F 2 92  ? 65.982  38.225 40.400 1.00 36.11  ? 88  ALA F CA  1 
ATOM   5107 C C   . ALA F 2 92  ? 65.451  39.016 41.568 1.00 36.24  ? 88  ALA F C   1 
ATOM   5108 O O   . ALA F 2 92  ? 64.268  39.390 41.602 1.00 36.15  ? 88  ALA F O   1 
ATOM   5109 C CB  . ALA F 2 92  ? 67.080  39.046 39.704 1.00 31.93  ? 88  ALA F CB  1 
ATOM   5110 N N   . MET F 2 93  ? 66.347  39.303 42.505 1.00 38.97  ? 89  MET F N   1 
ATOM   5111 C CA  . MET F 2 93  ? 66.034  40.134 43.659 1.00 39.44  ? 89  MET F CA  1 
ATOM   5112 C C   . MET F 2 93  ? 66.521  41.570 43.358 1.00 39.41  ? 89  MET F C   1 
ATOM   5113 O O   . MET F 2 93  ? 67.720  41.840 43.348 1.00 40.07  ? 89  MET F O   1 
ATOM   5114 C CB  . MET F 2 93  ? 66.721  39.599 44.908 1.00 33.81  ? 89  MET F CB  1 
ATOM   5115 C CG  . MET F 2 93  ? 66.513  40.519 46.064 1.00 40.00  ? 89  MET F CG  1 
ATOM   5116 S SD  . MET F 2 93  ? 64.796  40.643 46.512 1.00 42.65  ? 89  MET F SD  1 
ATOM   5117 C CE  . MET F 2 93  ? 64.859  39.595 47.996 1.00 30.51  ? 89  MET F CE  1 
ATOM   5118 N N   . TYR F 2 94  ? 65.574  42.461 43.060 1.00 36.56  ? 90  TYR F N   1 
ATOM   5119 C CA  . TYR F 2 94  ? 65.827  43.867 42.721 1.00 37.54  ? 90  TYR F CA  1 
ATOM   5120 C C   . TYR F 2 94  ? 65.988  44.860 43.882 1.00 43.92  ? 90  TYR F C   1 
ATOM   5121 O O   . TYR F 2 94  ? 65.076  45.042 44.710 1.00 43.37  ? 90  TYR F O   1 
ATOM   5122 C CB  . TYR F 2 94  ? 64.741  44.350 41.793 1.00 36.74  ? 90  TYR F CB  1 
ATOM   5123 C CG  . TYR F 2 94  ? 64.851  43.717 40.440 1.00 47.74  ? 90  TYR F CG  1 
ATOM   5124 C CD1 . TYR F 2 94  ? 64.598  42.368 40.246 1.00 47.04  ? 90  TYR F CD1 1 
ATOM   5125 C CD2 . TYR F 2 94  ? 65.257  44.472 39.350 1.00 55.43  ? 90  TYR F CD2 1 
ATOM   5126 C CE1 . TYR F 2 94  ? 64.749  41.792 38.990 1.00 54.81  ? 90  TYR F CE1 1 
ATOM   5127 C CE2 . TYR F 2 94  ? 65.412  43.916 38.101 1.00 56.18  ? 90  TYR F CE2 1 
ATOM   5128 C CZ  . TYR F 2 94  ? 65.160  42.583 37.915 1.00 59.07  ? 90  TYR F CZ  1 
ATOM   5129 O OH  . TYR F 2 94  ? 65.315  42.072 36.639 1.00 61.17  ? 90  TYR F OH  1 
ATOM   5130 N N   . TYR F 2 95  ? 67.114  45.567 43.892 1.00 44.47  ? 91  TYR F N   1 
ATOM   5131 C CA  . TYR F 2 95  ? 67.383  46.552 44.920 1.00 44.39  ? 91  TYR F CA  1 
ATOM   5132 C C   . TYR F 2 95  ? 67.796  47.892 44.365 1.00 45.01  ? 91  TYR F C   1 
ATOM   5133 O O   . TYR F 2 95  ? 68.252  47.989 43.244 1.00 48.74  ? 91  TYR F O   1 
ATOM   5134 C CB  . TYR F 2 95  ? 68.611  46.166 45.749 1.00 41.16  ? 91  TYR F CB  1 
ATOM   5135 C CG  . TYR F 2 95  ? 68.631  44.824 46.370 1.00 44.20  ? 91  TYR F CG  1 
ATOM   5136 C CD1 . TYR F 2 95  ? 68.096  44.624 47.640 1.00 37.02  ? 91  TYR F CD1 1 
ATOM   5137 C CD2 . TYR F 2 95  ? 69.347  43.789 45.769 1.00 42.52  ? 91  TYR F CD2 1 
ATOM   5138 C CE1 . TYR F 2 95  ? 68.298  43.430 48.308 1.00 38.43  ? 91  TYR F CE1 1 
ATOM   5139 C CE2 . TYR F 2 95  ? 69.555  42.594 46.423 1.00 45.08  ? 91  TYR F CE2 1 
ATOM   5140 C CZ  . TYR F 2 95  ? 69.036  42.420 47.706 1.00 44.79  ? 91  TYR F CZ  1 
ATOM   5141 O OH  . TYR F 2 95  ? 69.320  41.255 48.391 1.00 43.73  ? 91  TYR F OH  1 
ATOM   5142 N N   . CYS F 2 96  ? 67.647  48.908 45.207 1.00 47.67  ? 92  CYS F N   1 
ATOM   5143 C CA  . CYS F 2 96  ? 68.121  50.249 44.908 1.00 50.39  ? 92  CYS F CA  1 
ATOM   5144 C C   . CYS F 2 96  ? 69.171  50.414 46.029 1.00 51.67  ? 92  CYS F C   1 
ATOM   5145 O O   . CYS F 2 96  ? 69.072  49.754 47.086 1.00 48.99  ? 92  CYS F O   1 
ATOM   5146 C CB  . CYS F 2 96  ? 66.996  51.264 44.970 1.00 48.11  ? 92  CYS F CB  1 
ATOM   5147 S SG  . CYS F 2 96  ? 66.072  51.203 46.525 1.00 57.67  ? 92  CYS F SG  1 
ATOM   5148 N N   . VAL F 2 97  ? 70.237  51.165 45.769 1.00 50.78  ? 93  VAL F N   1 
ATOM   5149 C CA  . VAL F 2 97  ? 71.316  51.346 46.734 1.00 46.91  ? 93  VAL F CA  1 
ATOM   5150 C C   . VAL F 2 97  ? 71.755  52.810 46.648 1.00 47.52  ? 93  VAL F C   1 
ATOM   5151 O O   . VAL F 2 97  ? 71.958  53.311 45.552 1.00 49.79  ? 93  VAL F O   1 
ATOM   5152 C CB  . VAL F 2 97  ? 72.511  50.416 46.348 1.00 44.29  ? 93  VAL F CB  1 
ATOM   5153 C CG1 . VAL F 2 97  ? 73.503  50.281 47.485 1.00 39.52  ? 93  VAL F CG1 1 
ATOM   5154 C CG2 . VAL F 2 97  ? 71.998  49.035 45.909 1.00 36.30  ? 93  VAL F CG2 1 
ATOM   5155 N N   . SER F 2 98  ? 71.867  53.504 47.783 1.00 52.47  ? 94  SER F N   1 
ATOM   5156 C CA  . SER F 2 98  ? 72.260  54.927 47.771 1.00 54.87  ? 94  SER F CA  1 
ATOM   5157 C C   . SER F 2 98  ? 73.643  55.239 48.337 1.00 54.51  ? 94  SER F C   1 
ATOM   5158 O O   . SER F 2 98  ? 74.085  54.618 49.303 1.00 51.88  ? 94  SER F O   1 
ATOM   5159 C CB  . SER F 2 98  ? 71.207  55.783 48.494 1.00 55.60  ? 94  SER F CB  1 
ATOM   5160 O OG  . SER F 2 98  ? 71.076  55.422 49.863 1.00 54.18  ? 94  SER F OG  1 
ATOM   5161 N N   . TYR F 2 99  ? 74.327  56.191 47.708 1.00 60.20  ? 95  TYR F N   1 
ATOM   5162 C CA  . TYR F 2 99  ? 75.658  56.637 48.136 1.00 60.21  ? 95  TYR F CA  1 
ATOM   5163 C C   . TYR F 2 99  ? 75.655  58.142 48.210 1.00 64.34  ? 95  TYR F C   1 
ATOM   5164 O O   . TYR F 2 99  ? 75.079  58.829 47.353 1.00 63.14  ? 95  TYR F O   1 
ATOM   5165 C CB  . TYR F 2 99  ? 76.740  56.230 47.153 1.00 52.58  ? 95  TYR F CB  1 
ATOM   5166 C CG  . TYR F 2 99  ? 76.890  54.753 47.014 1.00 53.65  ? 95  TYR F CG  1 
ATOM   5167 C CD1 . TYR F 2 99  ? 76.169  54.051 46.047 1.00 46.65  ? 95  TYR F CD1 1 
ATOM   5168 C CD2 . TYR F 2 99  ? 77.812  54.056 47.792 1.00 61.78  ? 95  TYR F CD2 1 
ATOM   5169 C CE1 . TYR F 2 99  ? 76.342  52.676 45.863 1.00 48.60  ? 95  TYR F CE1 1 
ATOM   5170 C CE2 . TYR F 2 99  ? 77.999  52.668 47.622 1.00 63.49  ? 95  TYR F CE2 1 
ATOM   5171 C CZ  . TYR F 2 99  ? 77.269  51.987 46.642 1.00 59.81  ? 95  TYR F CZ  1 
ATOM   5172 O OH  . TYR F 2 99  ? 77.468  50.630 46.436 1.00 58.03  ? 95  TYR F OH  1 
ATOM   5173 N N   . GLY F 2 100 ? 76.325  58.647 49.232 1.00 71.82  ? 96  GLY F N   1 
ATOM   5174 C CA  . GLY F 2 100 ? 76.418  60.079 49.430 1.00 79.04  ? 96  GLY F CA  1 
ATOM   5175 C C   . GLY F 2 100 ? 76.969  60.339 50.812 1.00 82.71  ? 96  GLY F C   1 
ATOM   5176 O O   . GLY F 2 100 ? 76.987  59.442 51.663 1.00 83.65  ? 96  GLY F O   1 
ATOM   5177 N N   . TYR F 2 101 ? 77.468  61.548 51.026 1.00 86.90  ? 97  TYR F N   1 
ATOM   5178 C CA  . TYR F 2 101 ? 78.018  61.914 52.328 1.00 89.11  ? 97  TYR F CA  1 
ATOM   5179 C C   . TYR F 2 101 ? 76.947  62.689 53.098 1.00 89.94  ? 97  TYR F C   1 
ATOM   5180 O O   . TYR F 2 101 ? 75.926  63.099 52.524 1.00 88.81  ? 97  TYR F O   1 
ATOM   5181 C CB  . TYR F 2 101 ? 79.287  62.766 52.163 1.00 85.13  ? 97  TYR F CB  1 
ATOM   5182 C CG  . TYR F 2 101 ? 80.402  62.114 51.361 1.00 82.78  ? 97  TYR F CG  1 
ATOM   5183 C CD1 . TYR F 2 101 ? 81.348  61.286 51.982 1.00 80.93  ? 97  TYR F CD1 1 
ATOM   5184 C CD2 . TYR F 2 101 ? 80.541  62.365 49.988 1.00 79.93  ? 97  TYR F CD2 1 
ATOM   5185 C CE1 . TYR F 2 101 ? 82.412  60.723 51.255 1.00 80.06  ? 97  TYR F CE1 1 
ATOM   5186 C CE2 . TYR F 2 101 ? 81.599  61.809 49.250 1.00 79.41  ? 97  TYR F CE2 1 
ATOM   5187 C CZ  . TYR F 2 101 ? 82.534  60.995 49.890 1.00 80.18  ? 97  TYR F CZ  1 
ATOM   5188 O OH  . TYR F 2 101 ? 83.595  60.478 49.171 1.00 73.47  ? 97  TYR F OH  1 
ATOM   5189 N N   . GLY F 2 102 ? 77.173  62.866 54.396 1.00 90.05  ? 98  GLY F N   1 
ATOM   5190 C CA  . GLY F 2 102 ? 76.230  63.607 55.217 1.00 90.04  ? 98  GLY F CA  1 
ATOM   5191 C C   . GLY F 2 102 ? 75.361  62.734 56.098 1.00 87.90  ? 98  GLY F C   1 
ATOM   5192 O O   . GLY F 2 102 ? 74.410  63.208 56.719 1.00 87.01  ? 98  GLY F O   1 
ATOM   5193 N N   . GLY F 2 103 ? 75.693  61.455 56.168 1.00 85.70  ? 99  GLY F N   1 
ATOM   5194 C CA  . GLY F 2 103 ? 74.912  60.559 56.986 1.00 83.49  ? 99  GLY F CA  1 
ATOM   5195 C C   . GLY F 2 103 ? 75.848  59.815 57.894 1.00 83.80  ? 99  GLY F C   1 
ATOM   5196 O O   . GLY F 2 103 ? 77.057  60.073 57.904 1.00 80.54  ? 99  GLY F O   1 
ATOM   5197 N N   . ASP F 2 104 ? 75.283  58.899 58.671 1.00 83.42  ? 100 ASP F N   1 
ATOM   5198 C CA  . ASP F 2 104 ? 76.068  58.086 59.592 1.00 82.45  ? 100 ASP F CA  1 
ATOM   5199 C C   . ASP F 2 104 ? 76.629  56.939 58.782 1.00 78.51  ? 100 ASP F C   1 
ATOM   5200 O O   . ASP F 2 104 ? 77.350  56.085 59.300 1.00 76.11  ? 100 ASP F O   1 
ATOM   5201 C CB  . ASP F 2 104 ? 75.170  57.534 60.695 1.00 87.24  ? 100 ASP F CB  1 
ATOM   5202 C CG  . ASP F 2 104 ? 74.267  58.595 61.272 1.00 90.19  ? 100 ASP F CG  1 
ATOM   5203 O OD1 . ASP F 2 104 ? 74.746  59.412 62.086 1.00 94.76  ? 100 ASP F OD1 1 
ATOM   5204 O OD2 . ASP F 2 104 ? 73.086  58.641 60.872 1.00 95.05  ? 100 ASP F OD2 1 
ATOM   5205 N N   . ARG F 2 105 A 76.229  56.901 57.515 1.00 73.28  ? 100 ARG F N   1 
ATOM   5206 C CA  . ARG F 2 105 A 76.642  55.876 56.584 1.00 66.84  ? 100 ARG F CA  1 
ATOM   5207 C C   . ARG F 2 105 A 76.862  56.498 55.198 1.00 62.40  ? 100 ARG F C   1 
ATOM   5208 O O   . ARG F 2 105 A 76.226  57.495 54.833 1.00 53.96  ? 100 ARG F O   1 
ATOM   5209 C CB  . ARG F 2 105 A 75.566  54.768 56.527 1.00 66.79  ? 100 ARG F CB  1 
ATOM   5210 C CG  . ARG F 2 105 A 75.437  53.921 57.809 1.00 67.22  ? 100 ARG F CG  1 
ATOM   5211 C CD  . ARG F 2 105 A 74.668  52.616 57.585 1.00 72.60  ? 100 ARG F CD  1 
ATOM   5212 N NE  . ARG F 2 105 A 75.254  51.785 56.523 1.00 86.18  ? 100 ARG F NE  1 
ATOM   5213 C CZ  . ARG F 2 105 A 76.386  51.082 56.623 1.00 93.37  ? 100 ARG F CZ  1 
ATOM   5214 N NH1 . ARG F 2 105 A 77.088  51.090 57.758 1.00 98.55  ? 100 ARG F NH1 1 
ATOM   5215 N NH2 . ARG F 2 105 A 76.882  50.456 55.546 1.00 94.09  ? 100 ARG F NH2 1 
ATOM   5216 N N   . PHE F 2 106 B 77.808  55.930 54.454 1.00 59.95  ? 100 PHE F N   1 
ATOM   5217 C CA  . PHE F 2 106 B 78.099  56.405 53.109 1.00 64.00  ? 100 PHE F CA  1 
ATOM   5218 C C   . PHE F 2 106 B 77.090  55.783 52.122 1.00 69.21  ? 100 PHE F C   1 
ATOM   5219 O O   . PHE F 2 106 B 76.746  56.395 51.101 1.00 74.08  ? 100 PHE F O   1 
ATOM   5220 C CB  . PHE F 2 106 B 79.552  56.060 52.732 1.00 60.67  ? 100 PHE F CB  1 
ATOM   5221 C CG  . PHE F 2 106 B 79.930  56.397 51.300 1.00 59.08  ? 100 PHE F CG  1 
ATOM   5222 C CD1 . PHE F 2 106 B 79.452  57.539 50.671 1.00 60.05  ? 100 PHE F CD1 1 
ATOM   5223 C CD2 . PHE F 2 106 B 80.757  55.548 50.581 1.00 58.95  ? 100 PHE F CD2 1 
ATOM   5224 C CE1 . PHE F 2 106 B 79.789  57.818 49.356 1.00 58.19  ? 100 PHE F CE1 1 
ATOM   5225 C CE2 . PHE F 2 106 B 81.099  55.821 49.267 1.00 58.51  ? 100 PHE F CE2 1 
ATOM   5226 C CZ  . PHE F 2 106 B 80.614  56.953 48.656 1.00 61.82  ? 100 PHE F CZ  1 
ATOM   5227 N N   . SER F 2 107 ? 76.619  54.571 52.420 1.00 69.77  ? 101 SER F N   1 
ATOM   5228 C CA  . SER F 2 107 ? 75.651  53.905 51.545 1.00 69.35  ? 101 SER F CA  1 
ATOM   5229 C C   . SER F 2 107 ? 74.521  53.225 52.303 1.00 67.49  ? 101 SER F C   1 
ATOM   5230 O O   . SER F 2 107 ? 74.657  52.887 53.477 1.00 66.42  ? 101 SER F O   1 
ATOM   5231 C CB  . SER F 2 107 ? 76.333  52.874 50.630 1.00 65.31  ? 101 SER F CB  1 
ATOM   5232 O OG  . SER F 2 107 ? 76.714  51.706 51.344 1.00 64.01  ? 101 SER F OG  1 
ATOM   5233 N N   . TYR F 2 108 ? 73.422  52.986 51.596 1.00 67.90  ? 102 TYR F N   1 
ATOM   5234 C CA  . TYR F 2 108 ? 72.253  52.325 52.158 1.00 65.98  ? 102 TYR F CA  1 
ATOM   5235 C C   . TYR F 2 108 ? 71.764  51.349 51.115 1.00 62.85  ? 102 TYR F C   1 
ATOM   5236 O O   . TYR F 2 108 ? 71.457  51.742 49.998 1.00 63.62  ? 102 TYR F O   1 
ATOM   5237 C CB  . TYR F 2 108 ? 71.141  53.341 52.469 1.00 71.80  ? 102 TYR F CB  1 
ATOM   5238 C CG  . TYR F 2 108 ? 71.485  54.299 53.590 1.00 79.80  ? 102 TYR F CG  1 
ATOM   5239 C CD1 . TYR F 2 108 ? 71.418  53.893 54.925 1.00 77.63  ? 102 TYR F CD1 1 
ATOM   5240 C CD2 . TYR F 2 108 ? 71.968  55.583 53.310 1.00 80.70  ? 102 TYR F CD2 1 
ATOM   5241 C CE1 . TYR F 2 108 ? 71.837  54.732 55.948 1.00 82.30  ? 102 TYR F CE1 1 
ATOM   5242 C CE2 . TYR F 2 108 ? 72.386  56.431 54.325 1.00 83.45  ? 102 TYR F CE2 1 
ATOM   5243 C CZ  . TYR F 2 108 ? 72.328  56.000 55.642 1.00 85.28  ? 102 TYR F CZ  1 
ATOM   5244 O OH  . TYR F 2 108 ? 72.822  56.814 56.646 1.00 91.13  ? 102 TYR F OH  1 
ATOM   5245 N N   . TRP F 2 109 ? 71.766  50.069 51.450 1.00 59.72  ? 103 TRP F N   1 
ATOM   5246 C CA  . TRP F 2 109 ? 71.295  49.051 50.526 1.00 59.37  ? 103 TRP F CA  1 
ATOM   5247 C C   . TRP F 2 109 ? 69.850  48.755 50.943 1.00 59.59  ? 103 TRP F C   1 
ATOM   5248 O O   . TRP F 2 109 ? 69.589  48.518 52.129 1.00 59.40  ? 103 TRP F O   1 
ATOM   5249 C CB  . TRP F 2 109 ? 72.163  47.804 50.643 1.00 59.53  ? 103 TRP F CB  1 
ATOM   5250 C CG  . TRP F 2 109 ? 72.169  46.986 49.408 1.00 62.82  ? 103 TRP F CG  1 
ATOM   5251 C CD1 . TRP F 2 109 ? 71.107  46.328 48.853 1.00 62.87  ? 103 TRP F CD1 1 
ATOM   5252 C CD2 . TRP F 2 109 ? 73.285  46.755 48.538 1.00 63.34  ? 103 TRP F CD2 1 
ATOM   5253 N NE1 . TRP F 2 109 ? 71.488  45.706 47.691 1.00 64.12  ? 103 TRP F NE1 1 
ATOM   5254 C CE2 . TRP F 2 109 ? 72.821  45.946 47.470 1.00 65.28  ? 103 TRP F CE2 1 
ATOM   5255 C CE3 . TRP F 2 109 ? 74.630  47.149 48.550 1.00 57.43  ? 103 TRP F CE3 1 
ATOM   5256 C CZ2 . TRP F 2 109 ? 73.660  45.529 46.420 1.00 58.37  ? 103 TRP F CZ2 1 
ATOM   5257 C CZ3 . TRP F 2 109 ? 75.461  46.731 47.509 1.00 58.68  ? 103 TRP F CZ3 1 
ATOM   5258 C CH2 . TRP F 2 109 ? 74.970  45.927 46.458 1.00 54.58  ? 103 TRP F CH2 1 
ATOM   5259 N N   . GLY F 2 110 ? 68.921  48.815 49.985 1.00 56.89  ? 104 GLY F N   1 
ATOM   5260 C CA  . GLY F 2 110 ? 67.510  48.578 50.269 1.00 48.17  ? 104 GLY F CA  1 
ATOM   5261 C C   . GLY F 2 110 ? 67.191  47.190 50.781 1.00 51.80  ? 104 GLY F C   1 
ATOM   5262 O O   . GLY F 2 110 ? 68.100  46.377 50.979 1.00 56.85  ? 104 GLY F O   1 
ATOM   5263 N N   . GLN F 2 111 ? 65.908  46.918 51.029 1.00 54.67  ? 105 GLN F N   1 
ATOM   5264 C CA  . GLN F 2 111 ? 65.464  45.603 51.531 1.00 50.95  ? 105 GLN F CA  1 
ATOM   5265 C C   . GLN F 2 111 ? 65.471  44.628 50.365 1.00 47.51  ? 105 GLN F C   1 
ATOM   5266 O O   . GLN F 2 111 ? 65.916  43.476 50.502 1.00 45.66  ? 105 GLN F O   1 
ATOM   5267 C CB  . GLN F 2 111 ? 64.033  45.670 52.080 1.00 54.90  ? 105 GLN F CB  1 
ATOM   5268 C CG  . GLN F 2 111 ? 63.774  46.639 53.242 1.00 62.91  ? 105 GLN F CG  1 
ATOM   5269 C CD  . GLN F 2 111 ? 62.293  46.686 53.608 1.00 70.07  ? 105 GLN F CD  1 
ATOM   5270 O OE1 . GLN F 2 111 ? 61.420  46.405 52.775 1.00 71.26  ? 105 GLN F OE1 1 
ATOM   5271 N NE2 . GLN F 2 111 ? 62.004  47.011 54.856 1.00 72.85  ? 105 GLN F NE2 1 
ATOM   5272 N N   . GLY F 2 112 ? 64.968  45.132 49.233 1.00 40.86  ? 106 GLY F N   1 
ATOM   5273 C CA  . GLY F 2 112 ? 64.865  44.401 47.988 1.00 37.46  ? 106 GLY F CA  1 
ATOM   5274 C C   . GLY F 2 112 ? 63.432  43.978 47.720 1.00 33.72  ? 106 GLY F C   1 
ATOM   5275 O O   . GLY F 2 112 ? 62.601  43.986 48.621 1.00 33.05  ? 106 GLY F O   1 
ATOM   5276 N N   . THR F 2 113 ? 63.152  43.618 46.477 1.00 33.05  ? 107 THR F N   1 
ATOM   5277 C CA  . THR F 2 113 ? 61.836  43.159 46.053 1.00 39.78  ? 107 THR F CA  1 
ATOM   5278 C C   . THR F 2 113 ? 62.174  42.000 45.117 1.00 47.14  ? 107 THR F C   1 
ATOM   5279 O O   . THR F 2 113 ? 63.049  42.139 44.257 1.00 51.15  ? 107 THR F O   1 
ATOM   5280 C CB  . THR F 2 113 ? 61.053  44.289 45.287 1.00 40.94  ? 107 THR F CB  1 
ATOM   5281 O OG1 . THR F 2 113 ? 59.664  43.964 45.217 1.00 44.60  ? 107 THR F OG1 1 
ATOM   5282 C CG2 . THR F 2 113 ? 61.567  44.474 43.860 1.00 44.56  ? 107 THR F CG2 1 
ATOM   5283 N N   . LEU F 2 114 ? 61.581  40.829 45.331 1.00 51.27  ? 108 LEU F N   1 
ATOM   5284 C CA  . LEU F 2 114 ? 61.880  39.702 44.452 1.00 42.32  ? 108 LEU F CA  1 
ATOM   5285 C C   . LEU F 2 114 ? 60.972  39.741 43.246 1.00 40.77  ? 108 LEU F C   1 
ATOM   5286 O O   . LEU F 2 114 ? 59.780  39.979 43.389 1.00 41.72  ? 108 LEU F O   1 
ATOM   5287 C CB  . LEU F 2 114 ? 61.705  38.381 45.185 1.00 43.52  ? 108 LEU F CB  1 
ATOM   5288 C CG  . LEU F 2 114 ? 62.245  37.194 44.392 1.00 46.83  ? 108 LEU F CG  1 
ATOM   5289 C CD1 . LEU F 2 114 ? 63.709  37.417 44.092 1.00 36.03  ? 108 LEU F CD1 1 
ATOM   5290 C CD2 . LEU F 2 114 ? 62.046  35.923 45.170 1.00 40.14  ? 108 LEU F CD2 1 
ATOM   5291 N N   . VAL F 2 115 ? 61.548  39.595 42.056 1.00 48.39  ? 109 VAL F N   1 
ATOM   5292 C CA  . VAL F 2 115 ? 60.764  39.574 40.819 1.00 48.57  ? 109 VAL F CA  1 
ATOM   5293 C C   . VAL F 2 115 ? 60.903  38.196 40.225 1.00 47.61  ? 109 VAL F C   1 
ATOM   5294 O O   . VAL F 2 115 ? 62.015  37.750 39.940 1.00 46.48  ? 109 VAL F O   1 
ATOM   5295 C CB  . VAL F 2 115 ? 61.240  40.578 39.779 1.00 49.18  ? 109 VAL F CB  1 
ATOM   5296 C CG1 . VAL F 2 115 ? 60.363  40.481 38.534 1.00 44.74  ? 109 VAL F CG1 1 
ATOM   5297 C CG2 . VAL F 2 115 ? 61.178  41.965 40.348 1.00 52.95  ? 109 VAL F CG2 1 
ATOM   5298 N N   . THR F 2 116 ? 59.773  37.516 40.083 1.00 46.76  ? 110 THR F N   1 
ATOM   5299 C CA  . THR F 2 116 ? 59.735  36.166 39.563 1.00 44.68  ? 110 THR F CA  1 
ATOM   5300 C C   . THR F 2 116 ? 58.874  36.121 38.282 1.00 45.04  ? 110 THR F C   1 
ATOM   5301 O O   . THR F 2 116 ? 57.641  36.047 38.338 1.00 44.94  ? 110 THR F O   1 
ATOM   5302 C CB  . THR F 2 116 ? 59.208  35.203 40.667 1.00 40.53  ? 110 THR F CB  1 
ATOM   5303 O OG1 . THR F 2 116 ? 59.854  35.511 41.918 1.00 32.42  ? 110 THR F OG1 1 
ATOM   5304 C CG2 . THR F 2 116 ? 59.489  33.762 40.303 1.00 33.30  ? 110 THR F CG2 1 
ATOM   5305 N N   . VAL F 2 117 ? 59.544  36.234 37.135 1.00 43.99  ? 111 VAL F N   1 
ATOM   5306 C CA  . VAL F 2 117 ? 58.894  36.221 35.825 1.00 42.47  ? 111 VAL F CA  1 
ATOM   5307 C C   . VAL F 2 117 ? 58.704  34.775 35.363 1.00 41.38  ? 111 VAL F C   1 
ATOM   5308 O O   . VAL F 2 117 ? 59.659  33.997 35.316 1.00 40.18  ? 111 VAL F O   1 
ATOM   5309 C CB  . VAL F 2 117 ? 59.731  36.975 34.761 1.00 38.75  ? 111 VAL F CB  1 
ATOM   5310 C CG1 . VAL F 2 117 ? 58.865  37.314 33.583 1.00 38.17  ? 111 VAL F CG1 1 
ATOM   5311 C CG2 . VAL F 2 117 ? 60.362  38.231 35.349 1.00 33.99  ? 111 VAL F CG2 1 
ATOM   5312 N N   . SER F 2 118 ? 57.472  34.421 35.030 1.00 46.42  ? 112 SER F N   1 
ATOM   5313 C CA  . SER F 2 118 ? 57.144  33.064 34.597 1.00 51.65  ? 112 SER F CA  1 
ATOM   5314 C C   . SER F 2 118 ? 55.657  32.922 34.324 1.00 53.35  ? 112 SER F C   1 
ATOM   5315 O O   . SER F 2 118 ? 54.897  33.853 34.666 1.00 60.64  ? 112 SER F O   1 
ATOM   5316 C CB  . SER F 2 118 ? 57.528  32.075 35.685 1.00 52.16  ? 112 SER F CB  1 
ATOM   5317 O OG  . SER F 2 118 ? 57.057  32.550 36.944 1.00 62.63  ? 112 SER F OG  1 
ATOM   5318 O OXT . SER F 2 118 ? 55.260  31.864 33.799 1.00 61.25  ? 112 SER F OXT 1 
ATOM   5319 N N   . ASP G 1 1   ? 87.787  31.955 30.454 1.00 62.59  ? 1   ASP G N   1 
ATOM   5320 C CA  . ASP G 1 1   ? 87.425  33.255 31.071 1.00 64.49  ? 1   ASP G CA  1 
ATOM   5321 C C   . ASP G 1 1   ? 87.026  34.347 30.067 1.00 60.20  ? 1   ASP G C   1 
ATOM   5322 O O   . ASP G 1 1   ? 85.974  34.955 30.227 1.00 63.44  ? 1   ASP G O   1 
ATOM   5323 C CB  . ASP G 1 1   ? 88.553  33.749 31.986 1.00 73.06  ? 1   ASP G CB  1 
ATOM   5324 C CG  . ASP G 1 1   ? 88.139  34.950 32.866 1.00 82.59  ? 1   ASP G CG  1 
ATOM   5325 O OD1 . ASP G 1 1   ? 86.934  35.306 32.927 1.00 85.33  ? 1   ASP G OD1 1 
ATOM   5326 O OD2 . ASP G 1 1   ? 89.033  35.537 33.520 1.00 81.90  ? 1   ASP G OD2 1 
ATOM   5327 N N   . VAL G 1 2   ? 87.847  34.642 29.063 1.00 52.72  ? 2   VAL G N   1 
ATOM   5328 C CA  . VAL G 1 2   ? 87.459  35.684 28.111 1.00 47.71  ? 2   VAL G CA  1 
ATOM   5329 C C   . VAL G 1 2   ? 86.246  35.136 27.355 1.00 48.83  ? 2   VAL G C   1 
ATOM   5330 O O   . VAL G 1 2   ? 86.285  34.016 26.853 1.00 49.70  ? 2   VAL G O   1 
ATOM   5331 C CB  . VAL G 1 2   ? 88.610  36.075 27.148 1.00 43.52  ? 2   VAL G CB  1 
ATOM   5332 C CG1 . VAL G 1 2   ? 88.151  37.130 26.213 1.00 36.87  ? 2   VAL G CG1 1 
ATOM   5333 C CG2 . VAL G 1 2   ? 89.800  36.619 27.918 1.00 40.53  ? 2   VAL G CG2 1 
ATOM   5334 N N   . VAL G 1 3   ? 85.144  35.879 27.370 1.00 52.99  ? 3   VAL G N   1 
ATOM   5335 C CA  . VAL G 1 3   ? 83.894  35.449 26.735 1.00 52.70  ? 3   VAL G CA  1 
ATOM   5336 C C   . VAL G 1 3   ? 83.648  36.063 25.359 1.00 52.38  ? 3   VAL G C   1 
ATOM   5337 O O   . VAL G 1 3   ? 83.561  37.288 25.242 1.00 51.86  ? 3   VAL G O   1 
ATOM   5338 C CB  . VAL G 1 3   ? 82.656  35.794 27.649 1.00 53.74  ? 3   VAL G CB  1 
ATOM   5339 C CG1 . VAL G 1 3   ? 81.360  35.337 27.004 1.00 55.40  ? 3   VAL G CG1 1 
ATOM   5340 C CG2 . VAL G 1 3   ? 82.796  35.152 29.022 1.00 48.08  ? 3   VAL G CG2 1 
ATOM   5341 N N   . MET G 1 4   ? 83.459  35.214 24.345 1.00 54.47  ? 4   MET G N   1 
ATOM   5342 C CA  . MET G 1 4   ? 83.201  35.675 22.967 1.00 53.59  ? 4   MET G CA  1 
ATOM   5343 C C   . MET G 1 4   ? 81.702  35.756 22.631 1.00 52.54  ? 4   MET G C   1 
ATOM   5344 O O   . MET G 1 4   ? 80.921  34.843 22.923 1.00 52.59  ? 4   MET G O   1 
ATOM   5345 C CB  . MET G 1 4   ? 83.904  34.774 21.944 1.00 50.48  ? 4   MET G CB  1 
ATOM   5346 C CG  . MET G 1 4   ? 85.396  34.594 22.161 1.00 53.39  ? 4   MET G CG  1 
ATOM   5347 S SD  . MET G 1 4   ? 86.334  36.124 22.106 1.00 50.40  ? 4   MET G SD  1 
ATOM   5348 C CE  . MET G 1 4   ? 85.805  36.747 20.536 1.00 47.23  ? 4   MET G CE  1 
ATOM   5349 N N   . THR G 1 5   ? 81.326  36.806 21.919 1.00 54.45  ? 5   THR G N   1 
ATOM   5350 C CA  . THR G 1 5   ? 79.934  37.004 21.574 1.00 54.85  ? 5   THR G CA  1 
ATOM   5351 C C   . THR G 1 5   ? 79.697  37.423 20.125 1.00 52.71  ? 5   THR G C   1 
ATOM   5352 O O   . THR G 1 5   ? 80.144  38.496 19.688 1.00 52.28  ? 5   THR G O   1 
ATOM   5353 C CB  . THR G 1 5   ? 79.296  37.998 22.573 1.00 59.87  ? 5   THR G CB  1 
ATOM   5354 O OG1 . THR G 1 5   ? 79.476  37.482 23.899 1.00 60.04  ? 5   THR G OG1 1 
ATOM   5355 C CG2 . THR G 1 5   ? 77.798  38.204 22.302 1.00 57.42  ? 5   THR G CG2 1 
ATOM   5356 N N   . GLN G 1 6   ? 79.007  36.564 19.378 1.00 46.97  ? 6   GLN G N   1 
ATOM   5357 C CA  . GLN G 1 6   ? 78.713  36.839 17.978 1.00 48.23  ? 6   GLN G CA  1 
ATOM   5358 C C   . GLN G 1 6   ? 77.286  37.315 17.745 1.00 51.18  ? 6   GLN G C   1 
ATOM   5359 O O   . GLN G 1 6   ? 76.361  36.915 18.441 1.00 56.66  ? 6   GLN G O   1 
ATOM   5360 C CB  . GLN G 1 6   ? 79.051  35.634 17.108 1.00 41.70  ? 6   GLN G CB  1 
ATOM   5361 C CG  . GLN G 1 6   ? 80.501  35.246 17.220 1.00 40.19  ? 6   GLN G CG  1 
ATOM   5362 C CD  . GLN G 1 6   ? 80.949  34.344 16.116 1.00 42.47  ? 6   GLN G CD  1 
ATOM   5363 O OE1 . GLN G 1 6   ? 81.442  33.247 16.370 1.00 47.76  ? 6   GLN G OE1 1 
ATOM   5364 N NE2 . GLN G 1 6   ? 80.773  34.786 14.877 1.00 41.16  ? 6   GLN G NE2 1 
ATOM   5365 N N   . THR G 1 7   ? 77.120  38.172 16.749 1.00 56.58  ? 7   THR G N   1 
ATOM   5366 C CA  . THR G 1 7   ? 75.831  38.750 16.436 1.00 60.69  ? 7   THR G CA  1 
ATOM   5367 C C   . THR G 1 7   ? 75.840  39.250 15.005 1.00 65.61  ? 7   THR G C   1 
ATOM   5368 O O   . THR G 1 7   ? 76.811  39.852 14.562 1.00 68.33  ? 7   THR G O   1 
ATOM   5369 C CB  . THR G 1 7   ? 75.531  39.955 17.380 1.00 58.92  ? 7   THR G CB  1 
ATOM   5370 O OG1 . THR G 1 7   ? 75.154  39.460 18.668 1.00 61.36  ? 7   THR G OG1 1 
ATOM   5371 C CG2 . THR G 1 7   ? 74.420  40.854 16.839 1.00 58.48  ? 7   THR G CG2 1 
ATOM   5372 N N   . PRO G 1 8   ? 74.770  38.966 14.249 1.00 70.11  ? 8   PRO G N   1 
ATOM   5373 C CA  . PRO G 1 8   ? 73.620  38.200 14.752 1.00 71.99  ? 8   PRO G CA  1 
ATOM   5374 C C   . PRO G 1 8   ? 73.872  36.688 14.687 1.00 73.31  ? 8   PRO G C   1 
ATOM   5375 O O   . PRO G 1 8   ? 74.810  36.245 14.025 1.00 74.63  ? 8   PRO G O   1 
ATOM   5376 C CB  . PRO G 1 8   ? 72.490  38.647 13.833 1.00 71.42  ? 8   PRO G CB  1 
ATOM   5377 C CG  . PRO G 1 8   ? 73.205  38.976 12.548 1.00 67.45  ? 8   PRO G CG  1 
ATOM   5378 C CD  . PRO G 1 8   ? 74.417  39.705 13.022 1.00 67.04  ? 8   PRO G CD  1 
ATOM   5379 N N   . SER G 1 9   ? 73.068  35.904 15.401 1.00 73.62  ? 9   SER G N   1 
ATOM   5380 C CA  . SER G 1 9   ? 73.246  34.451 15.399 1.00 73.96  ? 9   SER G CA  1 
ATOM   5381 C C   . SER G 1 9   ? 72.802  33.833 14.076 1.00 75.16  ? 9   SER G C   1 
ATOM   5382 O O   . SER G 1 9   ? 73.103  32.663 13.796 1.00 71.17  ? 9   SER G O   1 
ATOM   5383 C CB  . SER G 1 9   ? 72.497  33.801 16.570 1.00 71.20  ? 9   SER G CB  1 
ATOM   5384 O OG  . SER G 1 9   ? 73.193  33.976 17.800 1.00 70.59  ? 9   SER G OG  1 
ATOM   5385 N N   . SER G 1 10  ? 72.170  34.654 13.237 1.00 76.61  ? 10  SER G N   1 
ATOM   5386 C CA  . SER G 1 10  ? 71.660  34.219 11.937 1.00 79.59  ? 10  SER G CA  1 
ATOM   5387 C C   . SER G 1 10  ? 71.293  35.381 11.012 1.00 76.48  ? 10  SER G C   1 
ATOM   5388 O O   . SER G 1 10  ? 70.905  36.450 11.475 1.00 76.99  ? 10  SER G O   1 
ATOM   5389 C CB  . SER G 1 10  ? 70.408  33.362 12.159 1.00 83.72  ? 10  SER G CB  1 
ATOM   5390 O OG  . SER G 1 10  ? 69.457  34.043 12.980 1.00 85.98  ? 10  SER G OG  1 
ATOM   5391 N N   . LEU G 1 11  ? 71.406  35.165 9.707  1.00 77.87  ? 11  LEU G N   1 
ATOM   5392 C CA  . LEU G 1 11  ? 71.036  36.184 8.728  1.00 83.06  ? 11  LEU G CA  1 
ATOM   5393 C C   . LEU G 1 11  ? 70.870  35.580 7.332  1.00 85.97  ? 11  LEU G C   1 
ATOM   5394 O O   . LEU G 1 11  ? 71.548  34.604 6.992  1.00 86.77  ? 11  LEU G O   1 
ATOM   5395 C CB  . LEU G 1 11  ? 72.032  37.372 8.727  1.00 80.71  ? 11  LEU G CB  1 
ATOM   5396 C CG  . LEU G 1 11  ? 73.540  37.247 8.445  1.00 84.26  ? 11  LEU G CG  1 
ATOM   5397 C CD1 . LEU G 1 11  ? 73.783  37.079 6.975  1.00 85.57  ? 11  LEU G CD1 1 
ATOM   5398 C CD2 . LEU G 1 11  ? 74.266  38.502 8.897  1.00 80.64  ? 11  LEU G CD2 1 
ATOM   5399 N N   . ALA G 1 12  ? 69.896  36.099 6.579  1.00 89.13  ? 12  ALA G N   1 
ATOM   5400 C CA  . ALA G 1 12  ? 69.624  35.651 5.208  1.00 90.92  ? 12  ALA G CA  1 
ATOM   5401 C C   . ALA G 1 12  ? 69.974  36.808 4.271  1.00 93.14  ? 12  ALA G C   1 
ATOM   5402 O O   . ALA G 1 12  ? 69.544  37.944 4.498  1.00 95.36  ? 12  ALA G O   1 
ATOM   5403 C CB  . ALA G 1 12  ? 68.158  35.270 5.047  1.00 87.74  ? 12  ALA G CB  1 
ATOM   5404 N N   . MET G 1 13  ? 70.778  36.537 3.248  1.00 93.61  ? 13  MET G N   1 
ATOM   5405 C CA  . MET G 1 13  ? 71.184  37.577 2.303  1.00 94.91  ? 13  MET G CA  1 
ATOM   5406 C C   . MET G 1 13  ? 71.119  37.005 0.899  1.00 96.29  ? 13  MET G C   1 
ATOM   5407 O O   . MET G 1 13  ? 70.918  35.804 0.736  1.00 100.00 ? 13  MET G O   1 
ATOM   5408 C CB  . MET G 1 13  ? 72.619  38.033 2.592  1.00 98.04  ? 13  MET G CB  1 
ATOM   5409 C CG  . MET G 1 13  ? 72.846  38.633 3.977  1.00 99.57  ? 13  MET G CG  1 
ATOM   5410 S SD  . MET G 1 13  ? 71.937  40.165 4.295  1.00 100.00 ? 13  MET G SD  1 
ATOM   5411 C CE  . MET G 1 13  ? 72.075  40.301 6.088  1.00 100.00 ? 13  MET G CE  1 
ATOM   5412 N N   . SER G 1 14  ? 71.273  37.857 -0.113 1.00 94.04  ? 14  SER G N   1 
ATOM   5413 C CA  . SER G 1 14  ? 71.248  37.406 -1.501 1.00 89.93  ? 14  SER G CA  1 
ATOM   5414 C C   . SER G 1 14  ? 72.539  37.764 -2.221 1.00 90.34  ? 14  SER G C   1 
ATOM   5415 O O   . SER G 1 14  ? 73.149  38.807 -1.941 1.00 87.99  ? 14  SER G O   1 
ATOM   5416 C CB  . SER G 1 14  ? 70.048  37.982 -2.254 1.00 85.73  ? 14  SER G CB  1 
ATOM   5417 O OG  . SER G 1 14  ? 68.843  37.360 -1.838 1.00 81.77  ? 14  SER G OG  1 
ATOM   5418 N N   . VAL G 1 15  ? 72.947  36.878 -3.131 1.00 89.73  ? 15  VAL G N   1 
ATOM   5419 C CA  . VAL G 1 15  ? 74.154  37.029 -3.943 1.00 85.15  ? 15  VAL G CA  1 
ATOM   5420 C C   . VAL G 1 15  ? 74.425  38.474 -4.354 1.00 86.95  ? 15  VAL G C   1 
ATOM   5421 O O   . VAL G 1 15  ? 73.560  39.132 -4.923 1.00 87.16  ? 15  VAL G O   1 
ATOM   5422 C CB  . VAL G 1 15  ? 74.049  36.203 -5.227 1.00 76.57  ? 15  VAL G CB  1 
ATOM   5423 C CG1 . VAL G 1 15  ? 75.388  36.182 -5.944 1.00 74.41  ? 15  VAL G CG1 1 
ATOM   5424 C CG2 . VAL G 1 15  ? 73.552  34.812 -4.910 1.00 68.32  ? 15  VAL G CG2 1 
ATOM   5425 N N   . GLY G 1 16  ? 75.620  38.966 -4.040 1.00 89.24  ? 16  GLY G N   1 
ATOM   5426 C CA  . GLY G 1 16  ? 75.985  40.331 -4.380 1.00 92.12  ? 16  GLY G CA  1 
ATOM   5427 C C   . GLY G 1 16  ? 75.993  41.269 -3.188 1.00 93.93  ? 16  GLY G C   1 
ATOM   5428 O O   . GLY G 1 16  ? 76.819  42.191 -3.134 1.00 94.72  ? 16  GLY G O   1 
ATOM   5429 N N   . GLN G 1 17  ? 75.087  41.030 -2.233 1.00 92.34  ? 17  GLN G N   1 
ATOM   5430 C CA  . GLN G 1 17  ? 74.985  41.854 -1.033 1.00 89.81  ? 17  GLN G CA  1 
ATOM   5431 C C   . GLN G 1 17  ? 76.275  41.851 -0.203 1.00 88.72  ? 17  GLN G C   1 
ATOM   5432 O O   . GLN G 1 17  ? 77.114  40.953 -0.332 1.00 81.99  ? 17  GLN G O   1 
ATOM   5433 C CB  . GLN G 1 17  ? 73.814  41.399 -0.150 1.00 89.94  ? 17  GLN G CB  1 
ATOM   5434 C CG  . GLN G 1 17  ? 72.415  41.625 -0.713 1.00 85.32  ? 17  GLN G CG  1 
ATOM   5435 C CD  . GLN G 1 17  ? 71.323  41.290 0.302  1.00 86.34  ? 17  GLN G CD  1 
ATOM   5436 O OE1 . GLN G 1 17  ? 71.320  41.807 1.420  1.00 87.06  ? 17  GLN G OE1 1 
ATOM   5437 N NE2 . GLN G 1 17  ? 70.405  40.424 -0.077 1.00 83.82  ? 17  GLN G NE2 1 
ATOM   5438 N N   . LYS G 1 18  ? 76.364  42.822 0.699  1.00 88.26  ? 18  LYS G N   1 
ATOM   5439 C CA  . LYS G 1 18  ? 77.510  42.993 1.581  1.00 90.05  ? 18  LYS G CA  1 
ATOM   5440 C C   . LYS G 1 18  ? 77.100  42.437 2.934  1.00 90.29  ? 18  LYS G C   1 
ATOM   5441 O O   . LYS G 1 18  ? 76.065  42.791 3.473  1.00 94.20  ? 18  LYS G O   1 
ATOM   5442 C CB  . LYS G 1 18  ? 77.842  44.496 1.675  1.00 92.54  ? 18  LYS G CB  1 
ATOM   5443 C CG  . LYS G 1 18  ? 79.066  44.854 2.540  1.00 96.83  ? 18  LYS G CG  1 
ATOM   5444 C CD  . LYS G 1 18  ? 78.999  46.332 2.941  1.00 99.34  ? 18  LYS G CD  1 
ATOM   5445 C CE  . LYS G 1 18  ? 80.115  46.743 3.895  1.00 100.00 ? 18  LYS G CE  1 
ATOM   5446 N NZ  . LYS G 1 18  ? 79.870  48.057 4.584  1.00 100.00 ? 18  LYS G NZ  1 
ATOM   5447 N N   . VAL G 1 19  ? 77.882  41.455 3.476  1.00 85.62  ? 19  VAL G N   1 
ATOM   5448 C CA  . VAL G 1 19  ? 77.542  40.902 4.771  1.00 78.85  ? 19  VAL G CA  1 
ATOM   5449 C C   . VAL G 1 19  ? 78.480  41.320 5.900  1.00 77.08  ? 19  VAL G C   1 
ATOM   5450 O O   . VAL G 1 19  ? 79.714  41.359 5.742  1.00 75.30  ? 19  VAL G O   1 
ATOM   5451 C CB  . VAL G 1 19  ? 77.423  39.372 4.722  1.00 78.99  ? 19  VAL G CB  1 
ATOM   5452 C CG1 . VAL G 1 19  ? 77.200  38.800 6.112  1.00 79.96  ? 19  VAL G CG1 1 
ATOM   5453 C CG2 . VAL G 1 19  ? 76.287  38.978 3.824  1.00 78.50  ? 19  VAL G CG2 1 
ATOM   5454 N N   . THR G 1 20  ? 77.874  41.619 7.058  1.00 73.26  ? 20  THR G N   1 
ATOM   5455 C CA  . THR G 1 20  ? 78.613  42.055 8.232  1.00 70.85  ? 20  THR G CA  1 
ATOM   5456 C C   . THR G 1 20  ? 78.176  41.277 9.467  1.00 66.77  ? 20  THR G C   1 
ATOM   5457 O O   . THR G 1 20  ? 76.999  41.271 9.817  1.00 64.62  ? 20  THR G O   1 
ATOM   5458 C CB  . THR G 1 20  ? 78.377  43.545 8.484  1.00 71.14  ? 20  THR G CB  1 
ATOM   5459 O OG1 . THR G 1 20  ? 78.568  44.252 7.250  1.00 75.52  ? 20  THR G OG1 1 
ATOM   5460 C CG2 . THR G 1 20  ? 79.341  44.106 9.528  1.00 65.58  ? 20  THR G CG2 1 
ATOM   5461 N N   . MET G 1 21  ? 79.141  40.619 10.112 1.00 65.81  ? 21  MET G N   1 
ATOM   5462 C CA  . MET G 1 21  ? 78.919  39.842 11.327 1.00 62.06  ? 21  MET G CA  1 
ATOM   5463 C C   . MET G 1 21  ? 80.022  40.190 12.321 1.00 58.05  ? 21  MET G C   1 
ATOM   5464 O O   . MET G 1 21  ? 81.209  40.171 11.976 1.00 54.76  ? 21  MET G O   1 
ATOM   5465 C CB  . MET G 1 21  ? 78.870  38.340 11.026 1.00 60.98  ? 21  MET G CB  1 
ATOM   5466 C CG  . MET G 1 21  ? 79.951  37.841 10.085 1.00 61.05  ? 21  MET G CG  1 
ATOM   5467 S SD  . MET G 1 21  ? 79.650  36.145 9.463  1.00 66.84  ? 21  MET G SD  1 
ATOM   5468 C CE  . MET G 1 21  ? 79.374  36.489 7.747  1.00 62.32  ? 21  MET G CE  1 
ATOM   5469 N N   . SER G 1 22  ? 79.624  40.559 13.536 1.00 56.10  ? 22  SER G N   1 
ATOM   5470 C CA  . SER G 1 22  ? 80.579  40.954 14.560 1.00 61.22  ? 22  SER G CA  1 
ATOM   5471 C C   . SER G 1 22  ? 80.899  39.908 15.602 1.00 60.70  ? 22  SER G C   1 
ATOM   5472 O O   . SER G 1 22  ? 80.147  38.956 15.805 1.00 63.19  ? 22  SER G O   1 
ATOM   5473 C CB  . SER G 1 22  ? 80.125  42.235 15.272 1.00 64.49  ? 22  SER G CB  1 
ATOM   5474 O OG  . SER G 1 22  ? 78.916  42.015 15.966 1.00 70.16  ? 22  SER G OG  1 
ATOM   5475 N N   . CYS G 1 23  ? 82.027  40.127 16.263 1.00 59.38  ? 23  CYS G N   1 
ATOM   5476 C CA  . CYS G 1 23  ? 82.525  39.262 17.309 1.00 58.27  ? 23  CYS G CA  1 
ATOM   5477 C C   . CYS G 1 23  ? 83.047  40.198 18.384 1.00 59.50  ? 23  CYS G C   1 
ATOM   5478 O O   . CYS G 1 23  ? 83.855  41.097 18.103 1.00 62.74  ? 23  CYS G O   1 
ATOM   5479 C CB  . CYS G 1 23  ? 83.661  38.397 16.769 1.00 53.83  ? 23  CYS G CB  1 
ATOM   5480 S SG  . CYS G 1 23  ? 84.574  37.437 18.016 1.00 55.60  ? 23  CYS G SG  1 
ATOM   5481 N N   . LYS G 1 24  ? 82.496  40.070 19.584 1.00 58.11  ? 24  LYS G N   1 
ATOM   5482 C CA  . LYS G 1 24  ? 82.913  40.907 20.689 1.00 56.04  ? 24  LYS G CA  1 
ATOM   5483 C C   . LYS G 1 24  ? 83.590  40.112 21.762 1.00 54.54  ? 24  LYS G C   1 
ATOM   5484 O O   . LYS G 1 24  ? 83.182  39.006 22.114 1.00 55.19  ? 24  LYS G O   1 
ATOM   5485 C CB  . LYS G 1 24  ? 81.752  41.707 21.262 1.00 56.58  ? 24  LYS G CB  1 
ATOM   5486 C CG  . LYS G 1 24  ? 81.314  42.789 20.322 1.00 63.54  ? 24  LYS G CG  1 
ATOM   5487 C CD  . LYS G 1 24  ? 80.364  43.753 20.970 1.00 67.59  ? 24  LYS G CD  1 
ATOM   5488 C CE  . LYS G 1 24  ? 79.889  44.749 19.931 1.00 69.58  ? 24  LYS G CE  1 
ATOM   5489 N NZ  . LYS G 1 24  ? 78.836  45.644 20.473 1.00 71.77  ? 24  LYS G NZ  1 
ATOM   5490 N N   . SER G 1 25  ? 84.675  40.680 22.243 1.00 54.02  ? 25  SER G N   1 
ATOM   5491 C CA  . SER G 1 25  ? 85.474  40.065 23.266 1.00 52.53  ? 25  SER G CA  1 
ATOM   5492 C C   . SER G 1 25  ? 85.122  40.751 24.590 1.00 51.50  ? 25  SER G C   1 
ATOM   5493 O O   . SER G 1 25  ? 84.852  41.946 24.615 1.00 49.36  ? 25  SER G O   1 
ATOM   5494 C CB  . SER G 1 25  ? 86.942  40.278 22.897 1.00 51.58  ? 25  SER G CB  1 
ATOM   5495 O OG  . SER G 1 25  ? 87.770  39.417 23.630 1.00 53.08  ? 25  SER G OG  1 
ATOM   5496 N N   . SER G 1 26  ? 85.041  39.990 25.677 1.00 55.32  ? 26  SER G N   1 
ATOM   5497 C CA  . SER G 1 26  ? 84.733  40.575 26.983 1.00 55.11  ? 26  SER G CA  1 
ATOM   5498 C C   . SER G 1 26  ? 85.945  41.418 27.423 1.00 57.68  ? 26  SER G C   1 
ATOM   5499 O O   . SER G 1 26  ? 85.826  42.415 28.153 1.00 54.57  ? 26  SER G O   1 
ATOM   5500 C CB  . SER G 1 26  ? 84.439  39.468 28.014 1.00 48.75  ? 26  SER G CB  1 
ATOM   5501 O OG  . SER G 1 26  ? 85.565  38.622 28.230 1.00 45.08  ? 26  SER G OG  1 
ATOM   5502 N N   . GLN G 1 27  ? 87.105  41.030 26.916 1.00 58.97  ? 27  GLN G N   1 
ATOM   5503 C CA  . GLN G 1 27  ? 88.342  41.703 27.226 1.00 62.57  ? 27  GLN G CA  1 
ATOM   5504 C C   . GLN G 1 27  ? 89.182  41.987 25.968 1.00 64.43  ? 27  GLN G C   1 
ATOM   5505 O O   . GLN G 1 27  ? 89.046  41.308 24.945 1.00 63.61  ? 27  GLN G O   1 
ATOM   5506 C CB  . GLN G 1 27  ? 89.132  40.866 28.225 1.00 63.22  ? 27  GLN G CB  1 
ATOM   5507 C CG  . GLN G 1 27  ? 88.429  40.651 29.556 1.00 63.68  ? 27  GLN G CG  1 
ATOM   5508 C CD  . GLN G 1 27  ? 89.414  40.315 30.665 1.00 65.87  ? 27  GLN G CD  1 
ATOM   5509 O OE1 . GLN G 1 27  ? 90.555  39.963 30.399 1.00 63.98  ? 27  GLN G OE1 1 
ATOM   5510 N NE2 . GLN G 1 27  ? 89.002  40.496 31.908 1.00 72.38  ? 27  GLN G NE2 1 
ATOM   5511 N N   . SER G 1 28  A 90.022  43.018 26.056 1.00 62.32  ? 27  SER G N   1 
ATOM   5512 C CA  . SER G 1 28  A 90.883  43.432 24.962 1.00 56.54  ? 27  SER G CA  1 
ATOM   5513 C C   . SER G 1 28  A 91.737  42.278 24.487 1.00 57.47  ? 27  SER G C   1 
ATOM   5514 O O   . SER G 1 28  A 92.253  41.507 25.296 1.00 57.94  ? 27  SER G O   1 
ATOM   5515 C CB  . SER G 1 28  A 91.785  44.578 25.423 1.00 58.12  ? 27  SER G CB  1 
ATOM   5516 O OG  . SER G 1 28  A 92.748  44.937 24.441 1.00 55.94  ? 27  SER G OG  1 
ATOM   5517 N N   . LEU G 1 29  B 91.903  42.186 23.173 1.00 59.23  ? 27  LEU G N   1 
ATOM   5518 C CA  . LEU G 1 29  B 92.714  41.146 22.552 1.00 61.53  ? 27  LEU G CA  1 
ATOM   5519 C C   . LEU G 1 29  B 94.008  41.714 21.973 1.00 62.77  ? 27  LEU G C   1 
ATOM   5520 O O   . LEU G 1 29  B 94.824  40.971 21.414 1.00 63.27  ? 27  LEU G O   1 
ATOM   5521 C CB  . LEU G 1 29  B 91.924  40.440 21.448 1.00 63.74  ? 27  LEU G CB  1 
ATOM   5522 C CG  . LEU G 1 29  B 90.670  39.674 21.870 1.00 62.95  ? 27  LEU G CG  1 
ATOM   5523 C CD1 . LEU G 1 29  B 90.033  39.048 20.649 1.00 62.53  ? 27  LEU G CD1 1 
ATOM   5524 C CD2 . LEU G 1 29  B 91.045  38.610 22.891 1.00 57.99  ? 27  LEU G CD2 1 
ATOM   5525 N N   . LEU G 1 30  C 94.179  43.032 22.093 1.00 65.88  ? 27  LEU G N   1 
ATOM   5526 C CA  . LEU G 1 30  C 95.364  43.729 21.600 1.00 64.80  ? 27  LEU G CA  1 
ATOM   5527 C C   . LEU G 1 30  C 96.559  43.499 22.517 1.00 64.59  ? 27  LEU G C   1 
ATOM   5528 O O   . LEU G 1 30  C 96.517  43.796 23.712 1.00 62.34  ? 27  LEU G O   1 
ATOM   5529 C CB  . LEU G 1 30  C 95.089  45.226 21.464 1.00 63.71  ? 27  LEU G CB  1 
ATOM   5530 C CG  . LEU G 1 30  C 96.209  45.953 20.731 1.00 61.76  ? 27  LEU G CG  1 
ATOM   5531 C CD1 . LEU G 1 30  C 96.551  45.196 19.477 1.00 66.08  ? 27  LEU G CD1 1 
ATOM   5532 C CD2 . LEU G 1 30  C 95.777  47.349 20.382 1.00 64.81  ? 27  LEU G CD2 1 
ATOM   5533 N N   . ASN G 1 31  D 97.642  43.006 21.937 1.00 66.41  ? 27  ASN G N   1 
ATOM   5534 C CA  . ASN G 1 31  D 98.840  42.701 22.696 1.00 72.03  ? 27  ASN G CA  1 
ATOM   5535 C C   . ASN G 1 31  D 99.879  43.844 22.776 1.00 77.83  ? 27  ASN G C   1 
ATOM   5536 O O   . ASN G 1 31  D 100.488 44.235 21.764 1.00 82.62  ? 27  ASN G O   1 
ATOM   5537 C CB  . ASN G 1 31  D 99.456  41.423 22.130 1.00 67.52  ? 27  ASN G CB  1 
ATOM   5538 C CG  . ASN G 1 31  D 100.627 40.937 22.940 1.00 70.05  ? 27  ASN G CG  1 
ATOM   5539 O OD1 . ASN G 1 31  D 100.654 41.066 24.176 1.00 70.31  ? 27  ASN G OD1 1 
ATOM   5540 N ND2 . ASN G 1 31  D 101.615 40.374 22.250 1.00 69.44  ? 27  ASN G ND2 1 
ATOM   5541 N N   . ILE G 1 32  E 100.066 44.371 23.989 1.00 76.41  ? 27  ILE G N   1 
ATOM   5542 C CA  . ILE G 1 32  E 101.020 45.456 24.282 1.00 72.05  ? 27  ILE G CA  1 
ATOM   5543 C C   . ILE G 1 32  E 102.452 44.932 24.088 1.00 67.87  ? 27  ILE G C   1 
ATOM   5544 O O   . ILE G 1 32  E 103.108 44.583 25.066 1.00 73.98  ? 27  ILE G O   1 
ATOM   5545 C CB  . ILE G 1 32  E 100.833 45.932 25.782 1.00 71.96  ? 27  ILE G CB  1 
ATOM   5546 C CG1 . ILE G 1 32  E 99.485  46.643 25.964 1.00 76.04  ? 27  ILE G CG1 1 
ATOM   5547 C CG2 . ILE G 1 32  E 101.944 46.869 26.228 1.00 71.27  ? 27  ILE G CG2 1 
ATOM   5548 C CD1 . ILE G 1 32  E 99.355  48.008 25.237 1.00 69.27  ? 27  ILE G CD1 1 
ATOM   5549 N N   . SER G 1 33  F 102.909 44.812 22.842 1.00 58.02  ? 27  SER G N   1 
ATOM   5550 C CA  . SER G 1 33  F 104.256 44.287 22.555 1.00 56.69  ? 27  SER G CA  1 
ATOM   5551 C C   . SER G 1 33  F 104.470 44.274 21.057 1.00 59.44  ? 27  SER G C   1 
ATOM   5552 O O   . SER G 1 33  F 105.548 44.599 20.549 1.00 65.57  ? 27  SER G O   1 
ATOM   5553 C CB  . SER G 1 33  F 104.415 42.823 23.023 1.00 51.46  ? 27  SER G CB  1 
ATOM   5554 O OG  . SER G 1 33  F 104.941 42.684 24.335 1.00 43.49  ? 27  SER G OG  1 
ATOM   5555 N N   . ASN G 1 34  ? 103.473 43.751 20.362 1.00 54.19  ? 28  ASN G N   1 
ATOM   5556 C CA  . ASN G 1 34  ? 103.522 43.662 18.924 1.00 51.65  ? 28  ASN G CA  1 
ATOM   5557 C C   . ASN G 1 34  ? 102.333 44.410 18.411 1.00 54.43  ? 28  ASN G C   1 
ATOM   5558 O O   . ASN G 1 34  ? 102.189 44.591 17.194 1.00 58.54  ? 28  ASN G O   1 
ATOM   5559 C CB  . ASN G 1 34  ? 103.439 42.208 18.473 1.00 60.25  ? 28  ASN G CB  1 
ATOM   5560 C CG  . ASN G 1 34  ? 102.224 41.483 19.035 1.00 64.28  ? 28  ASN G CG  1 
ATOM   5561 O OD1 . ASN G 1 34  ? 101.331 42.090 19.624 1.00 65.12  ? 28  ASN G OD1 1 
ATOM   5562 N ND2 . ASN G 1 34  ? 102.185 40.180 18.845 1.00 67.37  ? 28  ASN G ND2 1 
ATOM   5563 N N   . GLN G 1 35  ? 101.485 44.846 19.347 1.00 50.21  ? 29  GLN G N   1 
ATOM   5564 C CA  . GLN G 1 35  ? 100.268 45.573 19.019 1.00 51.10  ? 29  GLN G CA  1 
ATOM   5565 C C   . GLN G 1 35  ? 99.408  44.724 18.106 1.00 55.56  ? 29  GLN G C   1 
ATOM   5566 O O   . GLN G 1 35  ? 98.724  45.243 17.229 1.00 54.84  ? 29  GLN G O   1 
ATOM   5567 C CB  . GLN G 1 35  ? 100.582 46.893 18.308 1.00 51.88  ? 29  GLN G CB  1 
ATOM   5568 C CG  . GLN G 1 35  ? 101.105 47.982 19.207 1.00 52.03  ? 29  GLN G CG  1 
ATOM   5569 C CD  . GLN G 1 35  ? 100.121 48.334 20.299 1.00 55.69  ? 29  GLN G CD  1 
ATOM   5570 O OE1 . GLN G 1 35  ? 100.313 47.980 21.474 1.00 56.81  ? 29  GLN G OE1 1 
ATOM   5571 N NE2 . GLN G 1 35  ? 99.044  49.017 19.921 1.00 58.42  ? 29  GLN G NE2 1 
ATOM   5572 N N   . LYS G 1 36  ? 99.458  43.414 18.300 1.00 58.36  ? 30  LYS G N   1 
ATOM   5573 C CA  . LYS G 1 36  ? 98.693  42.490 17.485 1.00 55.96  ? 30  LYS G CA  1 
ATOM   5574 C C   . LYS G 1 36  ? 97.461  42.039 18.244 1.00 53.36  ? 30  LYS G C   1 
ATOM   5575 O O   . LYS G 1 36  ? 97.518  41.804 19.452 1.00 52.46  ? 30  LYS G O   1 
ATOM   5576 C CB  . LYS G 1 36  ? 99.533  41.271 17.129 1.00 60.20  ? 30  LYS G CB  1 
ATOM   5577 C CG  . LYS G 1 36  ? 100.411 41.412 15.900 1.00 65.50  ? 30  LYS G CG  1 
ATOM   5578 C CD  . LYS G 1 36  ? 101.189 40.113 15.705 1.00 70.88  ? 30  LYS G CD  1 
ATOM   5579 C CE  . LYS G 1 36  ? 101.632 39.883 14.264 1.00 73.41  ? 30  LYS G CE  1 
ATOM   5580 N NZ  . LYS G 1 36  ? 102.170 38.482 14.108 1.00 77.67  ? 30  LYS G NZ  1 
ATOM   5581 N N   . ASN G 1 37  ? 96.339  41.993 17.537 1.00 47.64  ? 31  ASN G N   1 
ATOM   5582 C CA  . ASN G 1 37  ? 95.079  41.540 18.099 1.00 45.34  ? 31  ASN G CA  1 
ATOM   5583 C C   . ASN G 1 37  ? 94.958  40.045 17.806 1.00 45.66  ? 31  ASN G C   1 
ATOM   5584 O O   . ASN G 1 37  ? 94.887  39.620 16.645 1.00 45.04  ? 31  ASN G O   1 
ATOM   5585 C CB  . ASN G 1 37  ? 93.897  42.244 17.432 1.00 48.16  ? 31  ASN G CB  1 
ATOM   5586 C CG  . ASN G 1 37  ? 93.730  43.668 17.876 1.00 49.41  ? 31  ASN G CG  1 
ATOM   5587 O OD1 . ASN G 1 37  ? 93.357  43.939 19.025 1.00 49.04  ? 31  ASN G OD1 1 
ATOM   5588 N ND2 . ASN G 1 37  ? 93.946  44.597 16.955 1.00 47.06  ? 31  ASN G ND2 1 
ATOM   5589 N N   . TYR G 1 38  ? 94.933  39.236 18.850 1.00 48.06  ? 32  TYR G N   1 
ATOM   5590 C CA  . TYR G 1 38  ? 94.804  37.798 18.650 1.00 49.89  ? 32  TYR G CA  1 
ATOM   5591 C C   . TYR G 1 38  ? 93.365  37.314 18.429 1.00 49.86  ? 32  TYR G C   1 
ATOM   5592 O O   . TYR G 1 38  ? 92.746  36.751 19.332 1.00 46.23  ? 32  TYR G O   1 
ATOM   5593 C CB  . TYR G 1 38  ? 95.464  37.044 19.797 1.00 43.32  ? 32  TYR G CB  1 
ATOM   5594 C CG  . TYR G 1 38  ? 96.958  37.132 19.724 1.00 49.97  ? 32  TYR G CG  1 
ATOM   5595 C CD1 . TYR G 1 38  ? 97.616  38.354 19.913 1.00 54.74  ? 32  TYR G CD1 1 
ATOM   5596 C CD2 . TYR G 1 38  ? 97.726  36.008 19.433 1.00 56.79  ? 32  TYR G CD2 1 
ATOM   5597 C CE1 . TYR G 1 38  ? 99.003  38.455 19.807 1.00 50.11  ? 32  TYR G CE1 1 
ATOM   5598 C CE2 . TYR G 1 38  ? 99.122  36.102 19.329 1.00 57.78  ? 32  TYR G CE2 1 
ATOM   5599 C CZ  . TYR G 1 38  ? 99.745  37.328 19.520 1.00 51.78  ? 32  TYR G CZ  1 
ATOM   5600 O OH  . TYR G 1 38  ? 101.111 37.417 19.442 1.00 52.57  ? 32  TYR G OH  1 
ATOM   5601 N N   . LEU G 1 39  ? 92.822  37.611 17.251 1.00 48.69  ? 33  LEU G N   1 
ATOM   5602 C CA  . LEU G 1 39  ? 91.483  37.176 16.897 1.00 50.10  ? 33  LEU G CA  1 
ATOM   5603 C C   . LEU G 1 39  ? 91.620  36.307 15.663 1.00 54.52  ? 33  LEU G C   1 
ATOM   5604 O O   . LEU G 1 39  ? 92.691  36.300 15.026 1.00 58.94  ? 33  LEU G O   1 
ATOM   5605 C CB  . LEU G 1 39  ? 90.548  38.341 16.583 1.00 43.29  ? 33  LEU G CB  1 
ATOM   5606 C CG  . LEU G 1 39  ? 89.082  37.874 16.486 1.00 43.22  ? 33  LEU G CG  1 
ATOM   5607 C CD1 . LEU G 1 39  ? 88.406  37.826 17.888 1.00 32.03  ? 33  LEU G CD1 1 
ATOM   5608 C CD2 . LEU G 1 39  ? 88.317  38.745 15.505 1.00 32.02  ? 33  LEU G CD2 1 
ATOM   5609 N N   . ALA G 1 40  ? 90.548  35.575 15.342 1.00 53.77  ? 34  ALA G N   1 
ATOM   5610 C CA  . ALA G 1 40  ? 90.501  34.686 14.188 1.00 50.24  ? 34  ALA G CA  1 
ATOM   5611 C C   . ALA G 1 40  ? 89.063  34.398 13.760 1.00 51.19  ? 34  ALA G C   1 
ATOM   5612 O O   . ALA G 1 40  ? 88.129  34.449 14.568 1.00 47.80  ? 34  ALA G O   1 
ATOM   5613 C CB  . ALA G 1 40  ? 91.229  33.380 14.504 1.00 41.95  ? 34  ALA G CB  1 
ATOM   5614 N N   . TRP G 1 41  ? 88.891  34.138 12.472 1.00 54.87  ? 35  TRP G N   1 
ATOM   5615 C CA  . TRP G 1 41  ? 87.583  33.803 11.917 1.00 58.30  ? 35  TRP G CA  1 
ATOM   5616 C C   . TRP G 1 41  ? 87.710  32.479 11.149 1.00 59.04  ? 35  TRP G C   1 
ATOM   5617 O O   . TRP G 1 41  ? 88.670  32.272 10.389 1.00 58.36  ? 35  TRP G O   1 
ATOM   5618 C CB  . TRP G 1 41  ? 87.073  34.901 10.983 1.00 56.34  ? 35  TRP G CB  1 
ATOM   5619 C CG  . TRP G 1 41  ? 86.771  36.183 11.664 1.00 59.34  ? 35  TRP G CG  1 
ATOM   5620 C CD1 . TRP G 1 41  ? 87.621  37.240 11.841 1.00 63.26  ? 35  TRP G CD1 1 
ATOM   5621 C CD2 . TRP G 1 41  ? 85.513  36.592 12.195 1.00 66.18  ? 35  TRP G CD2 1 
ATOM   5622 N NE1 . TRP G 1 41  ? 86.964  38.294 12.436 1.00 62.31  ? 35  TRP G NE1 1 
ATOM   5623 C CE2 . TRP G 1 41  ? 85.667  37.923 12.665 1.00 65.81  ? 35  TRP G CE2 1 
ATOM   5624 C CE3 . TRP G 1 41  ? 84.263  35.971 12.320 1.00 65.19  ? 35  TRP G CE3 1 
ATOM   5625 C CZ2 . TRP G 1 41  ? 84.615  38.638 13.243 1.00 65.48  ? 35  TRP G CZ2 1 
ATOM   5626 C CZ3 . TRP G 1 41  ? 83.218  36.684 12.896 1.00 61.36  ? 35  TRP G CZ3 1 
ATOM   5627 C CH2 . TRP G 1 41  ? 83.402  38.004 13.349 1.00 65.84  ? 35  TRP G CH2 1 
ATOM   5628 N N   . TYR G 1 42  ? 86.756  31.579 11.373 1.00 56.40  ? 36  TYR G N   1 
ATOM   5629 C CA  . TYR G 1 42  ? 86.746  30.282 10.717 1.00 50.66  ? 36  TYR G CA  1 
ATOM   5630 C C   . TYR G 1 42  ? 85.436  30.110 10.001 1.00 49.98  ? 36  TYR G C   1 
ATOM   5631 O O   . TYR G 1 42  ? 84.432  30.693 10.395 1.00 51.36  ? 36  TYR G O   1 
ATOM   5632 C CB  . TYR G 1 42  ? 86.893  29.175 11.747 1.00 46.10  ? 36  TYR G CB  1 
ATOM   5633 C CG  . TYR G 1 42  ? 88.121  29.318 12.589 1.00 38.93  ? 36  TYR G CG  1 
ATOM   5634 C CD1 . TYR G 1 42  ? 88.113  30.127 13.717 1.00 38.54  ? 36  TYR G CD1 1 
ATOM   5635 C CD2 . TYR G 1 42  ? 89.289  28.642 12.262 1.00 36.94  ? 36  TYR G CD2 1 
ATOM   5636 C CE1 . TYR G 1 42  ? 89.235  30.255 14.500 1.00 42.96  ? 36  TYR G CE1 1 
ATOM   5637 C CE2 . TYR G 1 42  ? 90.427  28.759 13.038 1.00 38.88  ? 36  TYR G CE2 1 
ATOM   5638 C CZ  . TYR G 1 42  ? 90.392  29.561 14.159 1.00 47.48  ? 36  TYR G CZ  1 
ATOM   5639 O OH  . TYR G 1 42  ? 91.499  29.644 14.973 1.00 56.08  ? 36  TYR G OH  1 
ATOM   5640 N N   . GLN G 1 43  ? 85.449  29.333 8.931  1.00 56.59  ? 37  GLN G N   1 
ATOM   5641 C CA  . GLN G 1 43  ? 84.231  29.069 8.180  1.00 64.51  ? 37  GLN G CA  1 
ATOM   5642 C C   . GLN G 1 43  ? 83.930  27.591 8.327  1.00 68.42  ? 37  GLN G C   1 
ATOM   5643 O O   . GLN G 1 43  ? 84.858  26.782 8.339  1.00 73.08  ? 37  GLN G O   1 
ATOM   5644 C CB  . GLN G 1 43  ? 84.436  29.392 6.703  1.00 64.51  ? 37  GLN G CB  1 
ATOM   5645 C CG  . GLN G 1 43  ? 83.187  29.224 5.849  1.00 68.65  ? 37  GLN G CG  1 
ATOM   5646 C CD  . GLN G 1 43  ? 83.405  29.629 4.400  1.00 68.80  ? 37  GLN G CD  1 
ATOM   5647 O OE1 . GLN G 1 43  ? 84.309  29.125 3.738  1.00 64.92  ? 37  GLN G OE1 1 
ATOM   5648 N NE2 . GLN G 1 43  ? 82.562  30.517 3.894  1.00 65.75  ? 37  GLN G NE2 1 
ATOM   5649 N N   . GLN G 1 44  ? 82.668  27.234 8.538  1.00 70.18  ? 38  GLN G N   1 
ATOM   5650 C CA  . GLN G 1 44  ? 82.319  25.822 8.641  1.00 72.66  ? 38  GLN G CA  1 
ATOM   5651 C C   . GLN G 1 44  ? 81.167  25.466 7.721  1.00 76.29  ? 38  GLN G C   1 
ATOM   5652 O O   . GLN G 1 44  ? 80.014  25.843 7.971  1.00 76.74  ? 38  GLN G O   1 
ATOM   5653 C CB  . GLN G 1 44  ? 81.993  25.377 10.072 1.00 68.81  ? 38  GLN G CB  1 
ATOM   5654 C CG  . GLN G 1 44  ? 81.790  23.859 10.133 1.00 62.21  ? 38  GLN G CG  1 
ATOM   5655 C CD  . GLN G 1 44  ? 81.757  23.277 11.523 1.00 56.34  ? 38  GLN G CD  1 
ATOM   5656 O OE1 . GLN G 1 44  ? 80.973  23.709 12.367 1.00 55.09  ? 38  GLN G OE1 1 
ATOM   5657 N NE2 . GLN G 1 44  ? 82.558  22.238 11.750 1.00 47.18  ? 38  GLN G NE2 1 
ATOM   5658 N N   . LYS G 1 45  ? 81.502  24.808 6.614  1.00 76.36  ? 39  LYS G N   1 
ATOM   5659 C CA  . LYS G 1 45  ? 80.495  24.379 5.652  1.00 76.49  ? 39  LYS G CA  1 
ATOM   5660 C C   . LYS G 1 45  ? 79.923  23.045 6.130  1.00 78.04  ? 39  LYS G C   1 
ATOM   5661 O O   . LYS G 1 45  ? 80.640  22.232 6.724  1.00 78.79  ? 39  LYS G O   1 
ATOM   5662 C CB  . LYS G 1 45  ? 81.100  24.243 4.250  1.00 72.12  ? 39  LYS G CB  1 
ATOM   5663 C CG  . LYS G 1 45  ? 81.359  25.572 3.578  1.00 73.20  ? 39  LYS G CG  1 
ATOM   5664 C CD  . LYS G 1 45  ? 81.733  25.428 2.115  1.00 72.81  ? 39  LYS G CD  1 
ATOM   5665 C CE  . LYS G 1 45  ? 81.919  26.802 1.492  1.00 75.58  ? 39  LYS G CE  1 
ATOM   5666 N NZ  . LYS G 1 45  ? 82.260  26.775 0.046  1.00 75.30  ? 39  LYS G NZ  1 
ATOM   5667 N N   . PRO G 1 46  ? 78.619  22.806 5.894  1.00 78.72  ? 40  PRO G N   1 
ATOM   5668 C CA  . PRO G 1 46  ? 77.983  21.550 6.315  1.00 76.62  ? 40  PRO G CA  1 
ATOM   5669 C C   . PRO G 1 46  ? 78.719  20.304 5.800  1.00 74.81  ? 40  PRO G C   1 
ATOM   5670 O O   . PRO G 1 46  ? 79.052  20.200 4.615  1.00 73.87  ? 40  PRO G O   1 
ATOM   5671 C CB  . PRO G 1 46  ? 76.575  21.669 5.734  1.00 74.72  ? 40  PRO G CB  1 
ATOM   5672 C CG  . PRO G 1 46  ? 76.762  22.594 4.545  1.00 73.37  ? 40  PRO G CG  1 
ATOM   5673 C CD  . PRO G 1 46  ? 77.680  23.631 5.111  1.00 74.51  ? 40  PRO G CD  1 
ATOM   5674 N N   . GLY G 1 47  ? 79.018  19.392 6.716  1.00 72.96  ? 41  GLY G N   1 
ATOM   5675 C CA  . GLY G 1 47  ? 79.717  18.180 6.347  1.00 71.29  ? 41  GLY G CA  1 
ATOM   5676 C C   . GLY G 1 47  ? 81.220  18.260 6.510  1.00 71.33  ? 41  GLY G C   1 
ATOM   5677 O O   . GLY G 1 47  ? 81.920  17.297 6.188  1.00 73.57  ? 41  GLY G O   1 
ATOM   5678 N N   . GLN G 1 48  ? 81.722  19.394 7.005  1.00 71.92  ? 42  GLN G N   1 
ATOM   5679 C CA  . GLN G 1 48  ? 83.167  19.585 7.207  1.00 67.85  ? 42  GLN G CA  1 
ATOM   5680 C C   . GLN G 1 48  ? 83.579  20.409 8.439  1.00 62.55  ? 42  GLN G C   1 
ATOM   5681 O O   . GLN G 1 48  ? 82.739  21.014 9.113  1.00 59.57  ? 42  GLN G O   1 
ATOM   5682 C CB  . GLN G 1 48  ? 83.826  20.126 5.925  1.00 64.82  ? 42  GLN G CB  1 
ATOM   5683 C CG  . GLN G 1 48  ? 83.041  21.201 5.191  1.00 63.95  ? 42  GLN G CG  1 
ATOM   5684 C CD  . GLN G 1 48  ? 83.512  21.392 3.758  1.00 62.76  ? 42  GLN G CD  1 
ATOM   5685 O OE1 . GLN G 1 48  ? 84.700  21.544 3.496  1.00 63.41  ? 42  GLN G OE1 1 
ATOM   5686 N NE2 . GLN G 1 48  ? 82.577  21.402 2.828  1.00 65.83  ? 42  GLN G NE2 1 
ATOM   5687 N N   . SER G 1 49  ? 84.873  20.381 8.754  1.00 58.81  ? 43  SER G N   1 
ATOM   5688 C CA  . SER G 1 49  ? 85.401  21.100 9.912  1.00 61.76  ? 43  SER G CA  1 
ATOM   5689 C C   . SER G 1 49  ? 85.539  22.599 9.657  1.00 63.13  ? 43  SER G C   1 
ATOM   5690 O O   . SER G 1 49  ? 85.292  23.070 8.539  1.00 67.12  ? 43  SER G O   1 
ATOM   5691 C CB  . SER G 1 49  ? 86.763  20.524 10.316 1.00 58.91  ? 43  SER G CB  1 
ATOM   5692 O OG  . SER G 1 49  ? 87.765  20.829 9.374  1.00 51.13  ? 43  SER G OG  1 
ATOM   5693 N N   . PRO G 1 50  ? 85.807  23.384 10.716 1.00 61.86  ? 44  PRO G N   1 
ATOM   5694 C CA  . PRO G 1 50  ? 85.959  24.822 10.499 1.00 61.06  ? 44  PRO G CA  1 
ATOM   5695 C C   . PRO G 1 50  ? 87.270  25.009 9.736  1.00 62.18  ? 44  PRO G C   1 
ATOM   5696 O O   . PRO G 1 50  ? 88.193  24.185 9.852  1.00 57.95  ? 44  PRO G O   1 
ATOM   5697 C CB  . PRO G 1 50  ? 86.064  25.376 11.924 1.00 59.96  ? 44  PRO G CB  1 
ATOM   5698 C CG  . PRO G 1 50  ? 85.323  24.384 12.734 1.00 58.93  ? 44  PRO G CG  1 
ATOM   5699 C CD  . PRO G 1 50  ? 85.796  23.080 12.155 1.00 59.51  ? 44  PRO G CD  1 
ATOM   5700 N N   . LYS G 1 51  ? 87.362  26.092 8.976  1.00 62.37  ? 45  LYS G N   1 
ATOM   5701 C CA  . LYS G 1 51  ? 88.555  26.365 8.178  1.00 63.96  ? 45  LYS G CA  1 
ATOM   5702 C C   . LYS G 1 51  ? 88.974  27.798 8.437  1.00 59.01  ? 45  LYS G C   1 
ATOM   5703 O O   . LYS G 1 51  ? 88.123  28.693 8.420  1.00 58.43  ? 45  LYS G O   1 
ATOM   5704 C CB  . LYS G 1 51  ? 88.244  26.167 6.676  1.00 73.63  ? 45  LYS G CB  1 
ATOM   5705 C CG  . LYS G 1 51  ? 89.487  25.908 5.823  1.00 80.19  ? 45  LYS G CG  1 
ATOM   5706 C CD  . LYS G 1 51  ? 89.220  25.600 4.347  1.00 81.51  ? 45  LYS G CD  1 
ATOM   5707 C CE  . LYS G 1 51  ? 90.547  25.210 3.656  1.00 77.44  ? 45  LYS G CE  1 
ATOM   5708 N NZ  . LYS G 1 51  ? 90.487  24.987 2.183  1.00 72.33  ? 45  LYS G NZ  1 
ATOM   5709 N N   . LEU G 1 52  ? 90.265  28.022 8.688  1.00 51.04  ? 46  LEU G N   1 
ATOM   5710 C CA  . LEU G 1 52  ? 90.740  29.382 8.954  1.00 53.20  ? 46  LEU G CA  1 
ATOM   5711 C C   . LEU G 1 52  ? 90.505  30.313 7.768  1.00 48.89  ? 46  LEU G C   1 
ATOM   5712 O O   . LEU G 1 52  ? 90.741  29.929 6.633  1.00 53.05  ? 46  LEU G O   1 
ATOM   5713 C CB  . LEU G 1 52  ? 92.230  29.389 9.305  1.00 52.88  ? 46  LEU G CB  1 
ATOM   5714 C CG  . LEU G 1 52  ? 92.809  30.738 9.773  1.00 53.83  ? 46  LEU G CG  1 
ATOM   5715 C CD1 . LEU G 1 52  ? 92.040  31.253 10.990 1.00 42.00  ? 46  LEU G CD1 1 
ATOM   5716 C CD2 . LEU G 1 52  ? 94.287  30.596 10.109 1.00 47.75  ? 46  LEU G CD2 1 
ATOM   5717 N N   . LEU G 1 53  ? 89.972  31.500 8.040  1.00 44.54  ? 47  LEU G N   1 
ATOM   5718 C CA  . LEU G 1 53  ? 89.731  32.516 7.018  1.00 47.62  ? 47  LEU G CA  1 
ATOM   5719 C C   . LEU G 1 53  ? 90.732  33.655 7.221  1.00 49.16  ? 47  LEU G C   1 
ATOM   5720 O O   . LEU G 1 53  ? 91.514  33.996 6.337  1.00 43.77  ? 47  LEU G O   1 
ATOM   5721 C CB  . LEU G 1 53  ? 88.346  33.134 7.186  1.00 47.91  ? 47  LEU G CB  1 
ATOM   5722 C CG  . LEU G 1 53  ? 87.051  32.663 6.537  1.00 48.47  ? 47  LEU G CG  1 
ATOM   5723 C CD1 . LEU G 1 53  ? 85.912  33.458 7.191  1.00 42.87  ? 47  LEU G CD1 1 
ATOM   5724 C CD2 . LEU G 1 53  ? 87.079  32.881 5.028  1.00 44.35  ? 47  LEU G CD2 1 
ATOM   5725 N N   . VAL G 1 54  ? 90.676  34.221 8.424  1.00 52.73  ? 48  VAL G N   1 
ATOM   5726 C CA  . VAL G 1 54  ? 91.479  35.357 8.847  1.00 52.16  ? 48  VAL G CA  1 
ATOM   5727 C C   . VAL G 1 54  ? 92.047  35.162 10.256 1.00 55.76  ? 48  VAL G C   1 
ATOM   5728 O O   . VAL G 1 54  ? 91.459  34.466 11.087 1.00 56.51  ? 48  VAL G O   1 
ATOM   5729 C CB  . VAL G 1 54  ? 90.576  36.603 8.957  1.00 47.09  ? 48  VAL G CB  1 
ATOM   5730 C CG1 . VAL G 1 54  ? 91.402  37.869 8.986  1.00 46.35  ? 48  VAL G CG1 1 
ATOM   5731 C CG2 . VAL G 1 54  ? 89.549  36.626 7.833  1.00 51.14  ? 48  VAL G CG2 1 
ATOM   5732 N N   . TYR G 1 55  ? 93.165  35.828 10.532 1.00 56.59  ? 49  TYR G N   1 
ATOM   5733 C CA  . TYR G 1 55  ? 93.785  35.804 11.850 1.00 53.61  ? 49  TYR G CA  1 
ATOM   5734 C C   . TYR G 1 55  ? 94.421  37.153 12.137 1.00 53.51  ? 49  TYR G C   1 
ATOM   5735 O O   . TYR G 1 55  ? 94.513  38.012 11.252 1.00 54.42  ? 49  TYR G O   1 
ATOM   5736 C CB  . TYR G 1 55  ? 94.783  34.673 12.005 1.00 56.30  ? 49  TYR G CB  1 
ATOM   5737 C CG  . TYR G 1 55  ? 95.854  34.611 10.960 1.00 58.88  ? 49  TYR G CG  1 
ATOM   5738 C CD1 . TYR G 1 55  ? 95.540  34.440 9.606  1.00 60.21  ? 49  TYR G CD1 1 
ATOM   5739 C CD2 . TYR G 1 55  ? 97.186  34.639 11.329 1.00 60.52  ? 49  TYR G CD2 1 
ATOM   5740 C CE1 . TYR G 1 55  ? 96.539  34.285 8.649  1.00 59.31  ? 49  TYR G CE1 1 
ATOM   5741 C CE2 . TYR G 1 55  ? 98.196  34.488 10.388 1.00 62.14  ? 49  TYR G CE2 1 
ATOM   5742 C CZ  . TYR G 1 55  ? 97.870  34.309 9.053  1.00 59.19  ? 49  TYR G CZ  1 
ATOM   5743 O OH  . TYR G 1 55  ? 98.886  34.133 8.149  1.00 50.47  ? 49  TYR G OH  1 
ATOM   5744 N N   . PHE G 1 56  ? 94.823  37.369 13.384 1.00 52.59  ? 50  PHE G N   1 
ATOM   5745 C CA  . PHE G 1 56  ? 95.390  38.658 13.767 1.00 46.95  ? 50  PHE G CA  1 
ATOM   5746 C C   . PHE G 1 56  ? 94.385  39.746 13.383 1.00 51.84  ? 50  PHE G C   1 
ATOM   5747 O O   . PHE G 1 56  ? 94.737  40.879 13.087 1.00 51.64  ? 50  PHE G O   1 
ATOM   5748 C CB  . PHE G 1 56  ? 96.719  38.855 13.082 1.00 34.35  ? 50  PHE G CB  1 
ATOM   5749 C CG  . PHE G 1 56  ? 97.779  37.940 13.594 1.00 39.77  ? 50  PHE G CG  1 
ATOM   5750 C CD1 . PHE G 1 56  ? 98.062  37.884 14.959 1.00 39.45  ? 50  PHE G CD1 1 
ATOM   5751 C CD2 . PHE G 1 56  ? 98.483  37.108 12.731 1.00 38.69  ? 50  PHE G CD2 1 
ATOM   5752 C CE1 . PHE G 1 56  ? 99.033  37.004 15.456 1.00 40.20  ? 50  PHE G CE1 1 
ATOM   5753 C CE2 . PHE G 1 56  ? 99.459  36.220 13.215 1.00 38.53  ? 50  PHE G CE2 1 
ATOM   5754 C CZ  . PHE G 1 56  ? 99.733  36.171 14.579 1.00 37.86  ? 50  PHE G CZ  1 
ATOM   5755 N N   . ALA G 1 57  ? 93.119  39.334 13.365 1.00 56.80  ? 51  ALA G N   1 
ATOM   5756 C CA  . ALA G 1 57  ? 91.958  40.148 13.049 1.00 54.66  ? 51  ALA G CA  1 
ATOM   5757 C C   . ALA G 1 57  ? 91.867  40.700 11.638 1.00 58.67  ? 51  ALA G C   1 
ATOM   5758 O O   . ALA G 1 57  ? 90.771  41.044 11.203 1.00 64.49  ? 51  ALA G O   1 
ATOM   5759 C CB  . ALA G 1 57  ? 91.792  41.262 14.076 1.00 52.52  ? 51  ALA G CB  1 
ATOM   5760 N N   . SER G 1 58  ? 92.972  40.698 10.894 1.00 60.96  ? 52  SER G N   1 
ATOM   5761 C CA  . SER G 1 58  ? 92.985  41.263 9.535  1.00 62.09  ? 52  SER G CA  1 
ATOM   5762 C C   . SER G 1 58  ? 93.510  40.350 8.440  1.00 60.23  ? 52  SER G C   1 
ATOM   5763 O O   . SER G 1 58  ? 92.989  40.348 7.326  1.00 62.16  ? 52  SER G O   1 
ATOM   5764 C CB  . SER G 1 58  ? 93.817  42.550 9.496  1.00 62.84  ? 52  SER G CB  1 
ATOM   5765 O OG  . SER G 1 58  ? 93.235  43.572 10.278 1.00 63.62  ? 52  SER G OG  1 
ATOM   5766 N N   . THR G 1 59  ? 94.570  39.617 8.753  1.00 53.72  ? 53  THR G N   1 
ATOM   5767 C CA  . THR G 1 59  ? 95.229  38.714 7.820  1.00 50.57  ? 53  THR G CA  1 
ATOM   5768 C C   . THR G 1 59  ? 94.435  37.525 7.234  1.00 52.74  ? 53  THR G C   1 
ATOM   5769 O O   . THR G 1 59  ? 93.984  36.640 7.959  1.00 54.41  ? 53  THR G O   1 
ATOM   5770 C CB  . THR G 1 59  ? 96.480  38.171 8.489  1.00 51.68  ? 53  THR G CB  1 
ATOM   5771 O OG1 . THR G 1 59  ? 97.223  39.267 9.035  1.00 48.44  ? 53  THR G OG1 1 
ATOM   5772 C CG2 . THR G 1 59  ? 97.324  37.388 7.507  1.00 46.60  ? 53  THR G CG2 1 
ATOM   5773 N N   . ARG G 1 60  ? 94.325  37.491 5.908  1.00 56.06  ? 54  ARG G N   1 
ATOM   5774 C CA  . ARG G 1 60  ? 93.638  36.420 5.187  1.00 54.76  ? 54  ARG G CA  1 
ATOM   5775 C C   . ARG G 1 60  ? 94.543  35.198 5.109  1.00 56.57  ? 54  ARG G C   1 
ATOM   5776 O O   . ARG G 1 60  ? 95.742  35.302 4.885  1.00 57.83  ? 54  ARG G O   1 
ATOM   5777 C CB  . ARG G 1 60  ? 93.283  36.847 3.754  1.00 53.68  ? 54  ARG G CB  1 
ATOM   5778 C CG  . ARG G 1 60  ? 92.229  37.940 3.633  1.00 57.74  ? 54  ARG G CG  1 
ATOM   5779 C CD  . ARG G 1 60  ? 92.011  38.353 2.182  1.00 56.81  ? 54  ARG G CD  1 
ATOM   5780 N NE  . ARG G 1 60  ? 92.070  39.806 2.051  1.00 60.58  ? 54  ARG G NE  1 
ATOM   5781 C CZ  . ARG G 1 60  ? 91.014  40.596 1.887  1.00 62.73  ? 54  ARG G CZ  1 
ATOM   5782 N NH1 . ARG G 1 60  ? 89.807  40.074 1.820  1.00 67.05  ? 54  ARG G NH1 1 
ATOM   5783 N NH2 . ARG G 1 60  ? 91.159  41.914 1.801  1.00 66.79  ? 54  ARG G NH2 1 
ATOM   5784 N N   . GLU G 1 61  ? 93.946  34.032 5.261  1.00 61.65  ? 55  GLU G N   1 
ATOM   5785 C CA  . GLU G 1 61  ? 94.657  32.776 5.195  1.00 62.91  ? 55  GLU G CA  1 
ATOM   5786 C C   . GLU G 1 61  ? 94.819  32.442 3.701  1.00 63.26  ? 55  GLU G C   1 
ATOM   5787 O O   . GLU G 1 61  ? 94.126  33.012 2.848  1.00 63.44  ? 55  GLU G O   1 
ATOM   5788 C CB  . GLU G 1 61  ? 93.815  31.724 5.932  1.00 64.57  ? 55  GLU G CB  1 
ATOM   5789 C CG  . GLU G 1 61  ? 94.185  30.276 5.705  1.00 60.12  ? 55  GLU G CG  1 
ATOM   5790 C CD  . GLU G 1 61  ? 95.451  29.891 6.394  1.00 58.10  ? 55  GLU G CD  1 
ATOM   5791 O OE1 . GLU G 1 61  ? 96.524  30.332 5.939  1.00 58.53  ? 55  GLU G OE1 1 
ATOM   5792 O OE2 . GLU G 1 61  ? 95.367  29.138 7.383  1.00 57.62  ? 55  GLU G OE2 1 
ATOM   5793 N N   . SER G 1 62  ? 95.744  31.539 3.394  1.00 63.43  ? 56  SER G N   1 
ATOM   5794 C CA  . SER G 1 62  ? 96.013  31.102 2.027  1.00 62.95  ? 56  SER G CA  1 
ATOM   5795 C C   . SER G 1 62  ? 94.776  30.581 1.317  1.00 64.30  ? 56  SER G C   1 
ATOM   5796 O O   . SER G 1 62  ? 94.224  29.544 1.688  1.00 69.43  ? 56  SER G O   1 
ATOM   5797 C CB  . SER G 1 62  ? 97.043  29.979 2.026  1.00 63.13  ? 56  SER G CB  1 
ATOM   5798 O OG  . SER G 1 62  ? 98.195  30.347 2.755  1.00 76.02  ? 56  SER G OG  1 
ATOM   5799 N N   . GLY G 1 63  ? 94.367  31.275 0.267  1.00 65.72  ? 57  GLY G N   1 
ATOM   5800 C CA  . GLY G 1 63  ? 93.215  30.838 -0.488 1.00 62.76  ? 57  GLY G CA  1 
ATOM   5801 C C   . GLY G 1 63  ? 91.989  31.658 -0.191 1.00 62.86  ? 57  GLY G C   1 
ATOM   5802 O O   . GLY G 1 63  ? 90.965  31.490 -0.845 1.00 64.61  ? 57  GLY G O   1 
ATOM   5803 N N   . VAL G 1 64  ? 92.076  32.556 0.776  1.00 60.68  ? 58  VAL G N   1 
ATOM   5804 C CA  . VAL G 1 64  ? 90.916  33.356 1.089  1.00 62.02  ? 58  VAL G CA  1 
ATOM   5805 C C   . VAL G 1 64  ? 90.781  34.521 0.104  1.00 67.99  ? 58  VAL G C   1 
ATOM   5806 O O   . VAL G 1 64  ? 91.749  35.263 -0.150 1.00 68.07  ? 58  VAL G O   1 
ATOM   5807 C CB  . VAL G 1 64  ? 90.943  33.843 2.545  1.00 60.68  ? 58  VAL G CB  1 
ATOM   5808 C CG1 . VAL G 1 64  ? 89.589  34.466 2.915  1.00 55.58  ? 58  VAL G CG1 1 
ATOM   5809 C CG2 . VAL G 1 64  ? 91.275  32.678 3.468  1.00 52.40  ? 58  VAL G CG2 1 
ATOM   5810 N N   . PRO G 1 65  ? 89.617  34.604 -0.572 1.00 69.86  ? 59  PRO G N   1 
ATOM   5811 C CA  . PRO G 1 65  ? 89.324  35.654 -1.539 1.00 71.01  ? 59  PRO G CA  1 
ATOM   5812 C C   . PRO G 1 65  ? 89.296  36.997 -0.834 1.00 74.53  ? 59  PRO G C   1 
ATOM   5813 O O   . PRO G 1 65  ? 89.008  37.080 0.363  1.00 75.11  ? 59  PRO G O   1 
ATOM   5814 C CB  . PRO G 1 65  ? 87.924  35.285 -2.028 1.00 65.76  ? 59  PRO G CB  1 
ATOM   5815 C CG  . PRO G 1 65  ? 87.941  33.820 -1.970 1.00 66.50  ? 59  PRO G CG  1 
ATOM   5816 C CD  . PRO G 1 65  ? 88.557  33.583 -0.610 1.00 68.44  ? 59  PRO G CD  1 
ATOM   5817 N N   . ASP G 1 66  ? 89.514  38.050 -1.609 1.00 78.11  ? 60  ASP G N   1 
ATOM   5818 C CA  . ASP G 1 66  ? 89.521  39.405 -1.092 1.00 74.91  ? 60  ASP G CA  1 
ATOM   5819 C C   . ASP G 1 66  ? 88.146  39.915 -0.681 1.00 73.51  ? 60  ASP G C   1 
ATOM   5820 O O   . ASP G 1 66  ? 88.045  40.991 -0.096 1.00 73.60  ? 60  ASP G O   1 
ATOM   5821 C CB  . ASP G 1 66  ? 90.167  40.355 -2.102 1.00 78.91  ? 60  ASP G CB  1 
ATOM   5822 C CG  . ASP G 1 66  ? 91.589  39.950 -2.455 1.00 84.56  ? 60  ASP G CG  1 
ATOM   5823 O OD1 . ASP G 1 66  ? 92.314  39.453 -1.552 1.00 87.11  ? 60  ASP G OD1 1 
ATOM   5824 O OD2 . ASP G 1 66  ? 91.975  40.118 -3.638 1.00 83.44  ? 60  ASP G OD2 1 
ATOM   5825 N N   . ARG G 1 67  ? 87.082  39.180 -0.993 1.00 70.74  ? 61  ARG G N   1 
ATOM   5826 C CA  . ARG G 1 67  ? 85.767  39.648 -0.578 1.00 70.70  ? 61  ARG G CA  1 
ATOM   5827 C C   . ARG G 1 67  ? 85.591  39.463 0.933  1.00 69.85  ? 61  ARG G C   1 
ATOM   5828 O O   . ARG G 1 67  ? 84.670  40.038 1.530  1.00 66.20  ? 61  ARG G O   1 
ATOM   5829 C CB  . ARG G 1 67  ? 84.632  38.987 -1.368 1.00 72.39  ? 61  ARG G CB  1 
ATOM   5830 C CG  . ARG G 1 67  ? 84.461  37.493 -1.186 1.00 75.48  ? 61  ARG G CG  1 
ATOM   5831 C CD  . ARG G 1 67  ? 83.214  37.053 -1.935 1.00 76.85  ? 61  ARG G CD  1 
ATOM   5832 N NE  . ARG G 1 67  ? 82.966  35.613 -1.914 1.00 73.46  ? 61  ARG G NE  1 
ATOM   5833 C CZ  . ARG G 1 67  ? 83.808  34.681 -2.354 1.00 72.30  ? 61  ARG G CZ  1 
ATOM   5834 N NH1 . ARG G 1 67  ? 84.988  35.018 -2.854 1.00 72.08  ? 61  ARG G NH1 1 
ATOM   5835 N NH2 . ARG G 1 67  ? 83.446  33.407 -2.337 1.00 72.13  ? 61  ARG G NH2 1 
ATOM   5836 N N   . PHE G 1 68  ? 86.507  38.697 1.534  1.00 68.73  ? 62  PHE G N   1 
ATOM   5837 C CA  . PHE G 1 68  ? 86.529  38.418 2.976  1.00 69.60  ? 62  PHE G CA  1 
ATOM   5838 C C   . PHE G 1 68  ? 87.473  39.388 3.703  1.00 70.93  ? 62  PHE G C   1 
ATOM   5839 O O   . PHE G 1 68  ? 88.688  39.208 3.703  1.00 71.62  ? 62  PHE G O   1 
ATOM   5840 C CB  . PHE G 1 68  ? 86.976  36.974 3.231  1.00 68.19  ? 62  PHE G CB  1 
ATOM   5841 C CG  . PHE G 1 68  ? 85.953  35.952 2.855  1.00 68.27  ? 62  PHE G CG  1 
ATOM   5842 C CD1 . PHE G 1 68  ? 84.826  35.766 3.648  1.00 64.91  ? 62  PHE G CD1 1 
ATOM   5843 C CD2 . PHE G 1 68  ? 86.108  35.181 1.708  1.00 67.79  ? 62  PHE G CD2 1 
ATOM   5844 C CE1 . PHE G 1 68  ? 83.858  34.833 3.301  1.00 66.86  ? 62  PHE G CE1 1 
ATOM   5845 C CE2 . PHE G 1 68  ? 85.143  34.241 1.348  1.00 67.09  ? 62  PHE G CE2 1 
ATOM   5846 C CZ  . PHE G 1 68  ? 84.016  34.066 2.147  1.00 66.36  ? 62  PHE G CZ  1 
ATOM   5847 N N   . ILE G 1 69  ? 86.906  40.370 4.394  1.00 69.88  ? 63  ILE G N   1 
ATOM   5848 C CA  . ILE G 1 69  ? 87.716  41.361 5.084  1.00 68.34  ? 63  ILE G CA  1 
ATOM   5849 C C   . ILE G 1 69  ? 87.504  41.371 6.595  1.00 66.70  ? 63  ILE G C   1 
ATOM   5850 O O   . ILE G 1 69  ? 86.378  41.558 7.081  1.00 66.02  ? 63  ILE G O   1 
ATOM   5851 C CB  . ILE G 1 69  ? 87.422  42.782 4.538  1.00 71.87  ? 63  ILE G CB  1 
ATOM   5852 C CG1 . ILE G 1 69  ? 87.356  42.761 3.008  1.00 69.58  ? 63  ILE G CG1 1 
ATOM   5853 C CG2 . ILE G 1 69  ? 88.510  43.759 5.001  1.00 73.59  ? 63  ILE G CG2 1 
ATOM   5854 C CD1 . ILE G 1 69  ? 86.354  43.731 2.421  1.00 62.30  ? 63  ILE G CD1 1 
ATOM   5855 N N   . GLY G 1 70  ? 88.581  41.131 7.334  1.00 62.32  ? 64  GLY G N   1 
ATOM   5856 C CA  . GLY G 1 70  ? 88.487  41.155 8.779  1.00 62.00  ? 64  GLY G CA  1 
ATOM   5857 C C   . GLY G 1 70  ? 88.890  42.535 9.272  1.00 62.19  ? 64  GLY G C   1 
ATOM   5858 O O   . GLY G 1 70  ? 89.922  43.057 8.846  1.00 64.79  ? 64  GLY G O   1 
ATOM   5859 N N   . SER G 1 71  ? 88.078  43.146 10.129 1.00 57.35  ? 65  SER G N   1 
ATOM   5860 C CA  . SER G 1 71  ? 88.395  44.463 10.659 1.00 56.07  ? 65  SER G CA  1 
ATOM   5861 C C   . SER G 1 71  ? 88.205  44.481 12.176 1.00 56.07  ? 65  SER G C   1 
ATOM   5862 O O   . SER G 1 71  ? 88.021  43.424 12.780 1.00 57.92  ? 65  SER G O   1 
ATOM   5863 C CB  . SER G 1 71  ? 87.536  45.535 9.972  1.00 52.74  ? 65  SER G CB  1 
ATOM   5864 O OG  . SER G 1 71  ? 86.148  45.247 10.041 1.00 54.15  ? 65  SER G OG  1 
ATOM   5865 N N   . GLY G 1 72  ? 88.236  45.673 12.775 1.00 57.43  ? 66  GLY G N   1 
ATOM   5866 C CA  . GLY G 1 72  ? 88.066  45.820 14.217 1.00 56.84  ? 66  GLY G CA  1 
ATOM   5867 C C   . GLY G 1 72  ? 89.356  45.782 15.041 1.00 57.92  ? 66  GLY G C   1 
ATOM   5868 O O   . GLY G 1 72  ? 90.431  45.482 14.511 1.00 53.37  ? 66  GLY G O   1 
ATOM   5869 N N   . SER G 1 73  ? 89.258  46.066 16.340 1.00 58.09  ? 67  SER G N   1 
ATOM   5870 C CA  . SER G 1 73  ? 90.435  46.048 17.219 1.00 57.55  ? 67  SER G CA  1 
ATOM   5871 C C   . SER G 1 73  ? 90.054  45.989 18.694 1.00 55.92  ? 67  SER G C   1 
ATOM   5872 O O   . SER G 1 73  ? 88.909  46.294 19.053 1.00 58.38  ? 67  SER G O   1 
ATOM   5873 C CB  . SER G 1 73  ? 91.297  47.288 16.987 1.00 55.87  ? 67  SER G CB  1 
ATOM   5874 O OG  . SER G 1 73  ? 92.336  47.374 17.946 1.00 59.54  ? 67  SER G OG  1 
ATOM   5875 N N   . GLY G 1 74  ? 91.011  45.591 19.536 1.00 48.64  ? 68  GLY G N   1 
ATOM   5876 C CA  . GLY G 1 74  ? 90.779  45.533 20.967 1.00 45.80  ? 68  GLY G CA  1 
ATOM   5877 C C   . GLY G 1 74  ? 89.676  44.587 21.396 1.00 49.96  ? 68  GLY G C   1 
ATOM   5878 O O   . GLY G 1 74  ? 89.976  43.475 21.823 1.00 50.48  ? 68  GLY G O   1 
ATOM   5879 N N   . THR G 1 75  ? 88.417  45.031 21.361 1.00 46.96  ? 69  THR G N   1 
ATOM   5880 C CA  . THR G 1 75  ? 87.304  44.159 21.745 1.00 50.57  ? 69  THR G CA  1 
ATOM   5881 C C   . THR G 1 75  ? 86.218  43.944 20.683 1.00 55.70  ? 69  THR G C   1 
ATOM   5882 O O   . THR G 1 75  ? 85.582  42.880 20.661 1.00 62.74  ? 69  THR G O   1 
ATOM   5883 C CB  . THR G 1 75  ? 86.600  44.625 23.038 1.00 44.06  ? 69  THR G CB  1 
ATOM   5884 O OG1 . THR G 1 75  ? 86.074  45.941 22.852 1.00 45.67  ? 69  THR G OG1 1 
ATOM   5885 C CG2 . THR G 1 75  ? 87.548  44.606 24.206 1.00 41.62  ? 69  THR G CG2 1 
ATOM   5886 N N   . ASP G 1 76  ? 85.993  44.937 19.823 1.00 53.77  ? 70  ASP G N   1 
ATOM   5887 C CA  . ASP G 1 76  ? 84.955  44.838 18.797 1.00 52.03  ? 70  ASP G CA  1 
ATOM   5888 C C   . ASP G 1 76  ? 85.562  44.522 17.441 1.00 49.93  ? 70  ASP G C   1 
ATOM   5889 O O   . ASP G 1 76  ? 86.332  45.319 16.896 1.00 51.12  ? 70  ASP G O   1 
ATOM   5890 C CB  . ASP G 1 76  ? 84.144  46.147 18.693 1.00 55.27  ? 70  ASP G CB  1 
ATOM   5891 C CG  . ASP G 1 76  ? 83.467  46.566 20.023 1.00 63.83  ? 70  ASP G CG  1 
ATOM   5892 O OD1 . ASP G 1 76  ? 83.774  46.010 21.113 1.00 60.86  ? 70  ASP G OD1 1 
ATOM   5893 O OD2 . ASP G 1 76  ? 82.620  47.491 19.971 1.00 64.42  ? 70  ASP G OD2 1 
ATOM   5894 N N   . PHE G 1 77  ? 85.206  43.371 16.888 1.00 50.66  ? 71  PHE G N   1 
ATOM   5895 C CA  . PHE G 1 77  ? 85.717  42.977 15.581 1.00 52.19  ? 71  PHE G CA  1 
ATOM   5896 C C   . PHE G 1 77  ? 84.567  42.730 14.649 1.00 51.91  ? 71  PHE G C   1 
ATOM   5897 O O   . PHE G 1 77  ? 83.459  42.449 15.107 1.00 52.70  ? 71  PHE G O   1 
ATOM   5898 C CB  . PHE G 1 77  ? 86.578  41.731 15.689 1.00 50.17  ? 71  PHE G CB  1 
ATOM   5899 C CG  . PHE G 1 77  ? 87.663  41.863 16.691 1.00 49.83  ? 71  PHE G CG  1 
ATOM   5900 C CD1 . PHE G 1 77  ? 87.401  41.640 18.034 1.00 48.24  ? 71  PHE G CD1 1 
ATOM   5901 C CD2 . PHE G 1 77  ? 88.943  42.241 16.301 1.00 49.69  ? 71  PHE G CD2 1 
ATOM   5902 C CE1 . PHE G 1 77  ? 88.398  41.799 18.985 1.00 55.20  ? 71  PHE G CE1 1 
ATOM   5903 C CE2 . PHE G 1 77  ? 89.956  42.405 17.241 1.00 52.54  ? 71  PHE G CE2 1 
ATOM   5904 C CZ  . PHE G 1 77  ? 89.684  42.181 18.587 1.00 55.95  ? 71  PHE G CZ  1 
ATOM   5905 N N   . THR G 1 78  ? 84.863  42.751 13.352 1.00 54.60  ? 72  THR G N   1 
ATOM   5906 C CA  . THR G 1 78  ? 83.855  42.582 12.313 1.00 55.15  ? 72  THR G CA  1 
ATOM   5907 C C   . THR G 1 78  ? 84.328  41.807 11.106 1.00 54.78  ? 72  THR G C   1 
ATOM   5908 O O   . THR G 1 78  ? 85.391  42.134 10.566 1.00 54.72  ? 72  THR G O   1 
ATOM   5909 C CB  . THR G 1 78  ? 83.447  43.948 11.758 1.00 58.31  ? 72  THR G CB  1 
ATOM   5910 O OG1 . THR G 1 78  ? 82.851  44.731 12.798 1.00 68.27  ? 72  THR G OG1 1 
ATOM   5911 C CG2 . THR G 1 78  ? 82.470  43.794 10.617 1.00 66.03  ? 72  THR G CG2 1 
ATOM   5912 N N   . LEU G 1 79  ? 83.568  40.788 10.688 1.00 54.09  ? 73  LEU G N   1 
ATOM   5913 C CA  . LEU G 1 79  ? 83.914  40.047 9.469  1.00 53.66  ? 73  LEU G CA  1 
ATOM   5914 C C   . LEU G 1 79  ? 82.997  40.558 8.383  1.00 54.83  ? 73  LEU G C   1 
ATOM   5915 O O   . LEU G 1 79  ? 81.770  40.558 8.529  1.00 53.20  ? 73  LEU G O   1 
ATOM   5916 C CB  . LEU G 1 79  ? 83.752  38.539 9.577  1.00 53.83  ? 73  LEU G CB  1 
ATOM   5917 C CG  . LEU G 1 79  ? 84.285  37.934 8.268  1.00 51.45  ? 73  LEU G CG  1 
ATOM   5918 C CD1 . LEU G 1 79  ? 85.729  38.361 8.096  1.00 53.86  ? 73  LEU G CD1 1 
ATOM   5919 C CD2 . LEU G 1 79  ? 84.181  36.414 8.238  1.00 48.27  ? 73  LEU G CD2 1 
ATOM   5920 N N   . THR G 1 80  ? 83.600  40.878 7.249  1.00 58.07  ? 74  THR G N   1 
ATOM   5921 C CA  . THR G 1 80  ? 82.874  41.469 6.147  1.00 60.04  ? 74  THR G CA  1 
ATOM   5922 C C   . THR G 1 80  ? 83.025  40.710 4.842  1.00 61.83  ? 74  THR G C   1 
ATOM   5923 O O   . THR G 1 80  ? 84.097  40.186 4.550  1.00 60.86  ? 74  THR G O   1 
ATOM   5924 C CB  . THR G 1 80  ? 83.417  42.916 5.901  1.00 58.70  ? 74  THR G CB  1 
ATOM   5925 O OG1 . THR G 1 80  ? 83.510  43.635 7.141  1.00 52.82  ? 74  THR G OG1 1 
ATOM   5926 C CG2 . THR G 1 80  ? 82.532  43.678 4.927  1.00 57.76  ? 74  THR G CG2 1 
ATOM   5927 N N   . ILE G 1 81  ? 81.941  40.626 4.078  1.00 67.70  ? 75  ILE G N   1 
ATOM   5928 C CA  . ILE G 1 81  ? 81.980  40.015 2.746  1.00 72.40  ? 75  ILE G CA  1 
ATOM   5929 C C   . ILE G 1 81  ? 81.407  41.133 1.872  1.00 75.68  ? 75  ILE G C   1 
ATOM   5930 O O   . ILE G 1 81  ? 80.206  41.418 1.936  1.00 74.12  ? 75  ILE G O   1 
ATOM   5931 C CB  . ILE G 1 81  ? 81.092  38.746 2.597  1.00 71.23  ? 75  ILE G CB  1 
ATOM   5932 C CG1 . ILE G 1 81  ? 81.311  37.790 3.773  1.00 66.34  ? 75  ILE G CG1 1 
ATOM   5933 C CG2 . ILE G 1 81  ? 81.436  38.032 1.266  1.00 64.49  ? 75  ILE G CG2 1 
ATOM   5934 C CD1 . ILE G 1 81  ? 80.392  36.591 3.758  1.00 63.91  ? 75  ILE G CD1 1 
ATOM   5935 N N   . SER G 1 82  ? 82.283  41.818 1.132  1.00 76.81  ? 76  SER G N   1 
ATOM   5936 C CA  . SER G 1 82  ? 81.885  42.935 0.271  1.00 76.00  ? 76  SER G CA  1 
ATOM   5937 C C   . SER G 1 82  ? 80.669  42.609 -0.615 1.00 78.57  ? 76  SER G C   1 
ATOM   5938 O O   . SER G 1 82  ? 79.756  43.431 -0.758 1.00 75.45  ? 76  SER G O   1 
ATOM   5939 C CB  . SER G 1 82  ? 83.086  43.400 -0.549 1.00 73.38  ? 76  SER G CB  1 
ATOM   5940 O OG  . SER G 1 82  ? 83.836  42.284 -0.985 1.00 72.26  ? 76  SER G OG  1 
ATOM   5941 N N   . SER G 1 83  ? 80.682  41.421 -1.218 1.00 83.07  ? 77  SER G N   1 
ATOM   5942 C CA  . SER G 1 83  ? 79.577  40.932 -2.050 1.00 86.02  ? 77  SER G CA  1 
ATOM   5943 C C   . SER G 1 83  ? 79.556  39.416 -1.859 1.00 86.54  ? 77  SER G C   1 
ATOM   5944 O O   . SER G 1 83  ? 80.600  38.757 -1.930 1.00 89.07  ? 77  SER G O   1 
ATOM   5945 C CB  . SER G 1 83  ? 79.756  41.291 -3.531 1.00 87.38  ? 77  SER G CB  1 
ATOM   5946 O OG  . SER G 1 83  ? 80.698  40.442 -4.170 1.00 95.41  ? 77  SER G OG  1 
ATOM   5947 N N   . VAL G 1 84  ? 78.381  38.870 -1.552 1.00 86.47  ? 78  VAL G N   1 
ATOM   5948 C CA  . VAL G 1 84  ? 78.256  37.439 -1.319 1.00 86.99  ? 78  VAL G CA  1 
ATOM   5949 C C   . VAL G 1 84  ? 78.023  36.572 -2.543 1.00 87.26  ? 78  VAL G C   1 
ATOM   5950 O O   . VAL G 1 84  ? 77.197  36.873 -3.401 1.00 87.57  ? 78  VAL G O   1 
ATOM   5951 C CB  . VAL G 1 84  ? 77.154  37.109 -0.276 1.00 87.19  ? 78  VAL G CB  1 
ATOM   5952 C CG1 . VAL G 1 84  ? 77.495  37.731 1.049  1.00 86.61  ? 78  VAL G CG1 1 
ATOM   5953 C CG2 . VAL G 1 84  ? 75.800  37.591 -0.747 1.00 87.19  ? 78  VAL G CG2 1 
ATOM   5954 N N   . GLN G 1 85  ? 78.809  35.513 -2.642 1.00 89.39  ? 79  GLN G N   1 
ATOM   5955 C CA  . GLN G 1 85  ? 78.656  34.560 -3.718 1.00 91.48  ? 79  GLN G CA  1 
ATOM   5956 C C   . GLN G 1 85  ? 77.935  33.374 -3.079 1.00 94.56  ? 79  GLN G C   1 
ATOM   5957 O O   . GLN G 1 85  ? 77.884  33.265 -1.851 1.00 96.63  ? 79  GLN G O   1 
ATOM   5958 C CB  . GLN G 1 85  ? 80.015  34.137 -4.252 1.00 89.51  ? 79  GLN G CB  1 
ATOM   5959 C CG  . GLN G 1 85  ? 80.771  35.255 -4.926 1.00 92.75  ? 79  GLN G CG  1 
ATOM   5960 C CD  . GLN G 1 85  ? 81.993  34.771 -5.682 1.00 95.92  ? 79  GLN G CD  1 
ATOM   5961 O OE1 . GLN G 1 85  ? 82.617  35.537 -6.412 1.00 100.00 ? 79  GLN G OE1 1 
ATOM   5962 N NE2 . GLN G 1 85  ? 82.332  33.499 -5.529 1.00 96.38  ? 79  GLN G NE2 1 
ATOM   5963 N N   . ALA G 1 86  ? 77.372  32.495 -3.901 1.00 95.84  ? 80  ALA G N   1 
ATOM   5964 C CA  . ALA G 1 86  ? 76.647  31.323 -3.401 1.00 95.23  ? 80  ALA G CA  1 
ATOM   5965 C C   . ALA G 1 86  ? 77.428  30.420 -2.430 1.00 94.87  ? 80  ALA G C   1 
ATOM   5966 O O   . ALA G 1 86  ? 76.918  30.081 -1.362 1.00 95.45  ? 80  ALA G O   1 
ATOM   5967 C CB  . ALA G 1 86  ? 76.112  30.496 -4.567 1.00 94.07  ? 80  ALA G CB  1 
ATOM   5968 N N   . GLU G 1 87  ? 78.667  30.069 -2.784 1.00 92.24  ? 81  GLU G N   1 
ATOM   5969 C CA  . GLU G 1 87  ? 79.512  29.187 -1.963 1.00 89.02  ? 81  GLU G CA  1 
ATOM   5970 C C   . GLU G 1 87  ? 79.875  29.687 -0.553 1.00 87.30  ? 81  GLU G C   1 
ATOM   5971 O O   . GLU G 1 87  ? 80.572  28.999 0.197  1.00 84.15  ? 81  GLU G O   1 
ATOM   5972 C CB  . GLU G 1 87  ? 80.792  28.832 -2.721 1.00 87.77  ? 81  GLU G CB  1 
ATOM   5973 C CG  . GLU G 1 87  ? 81.741  30.003 -2.894 1.00 90.18  ? 81  GLU G CG  1 
ATOM   5974 C CD  . GLU G 1 87  ? 81.936  30.388 -4.341 1.00 91.33  ? 81  GLU G CD  1 
ATOM   5975 O OE1 . GLU G 1 87  ? 80.959  30.854 -4.979 1.00 90.03  ? 81  GLU G OE1 1 
ATOM   5976 O OE2 . GLU G 1 87  ? 83.071  30.222 -4.833 1.00 88.32  ? 81  GLU G OE2 1 
ATOM   5977 N N   . ASP G 1 88  ? 79.401  30.872 -0.192 1.00 86.95  ? 82  ASP G N   1 
ATOM   5978 C CA  . ASP G 1 88  ? 79.695  31.437 1.119  1.00 86.46  ? 82  ASP G CA  1 
ATOM   5979 C C   . ASP G 1 88  ? 78.638  31.091 2.150  1.00 86.21  ? 82  ASP G C   1 
ATOM   5980 O O   . ASP G 1 88  ? 78.733  31.518 3.302  1.00 86.22  ? 82  ASP G O   1 
ATOM   5981 C CB  . ASP G 1 88  ? 79.862  32.959 1.037  1.00 84.98  ? 82  ASP G CB  1 
ATOM   5982 C CG  . ASP G 1 88  ? 80.970  33.374 0.083  1.00 85.61  ? 82  ASP G CG  1 
ATOM   5983 O OD1 . ASP G 1 88  ? 81.983  32.636 -0.042 1.00 80.70  ? 82  ASP G OD1 1 
ATOM   5984 O OD2 . ASP G 1 88  ? 80.813  34.441 -0.547 1.00 85.21  ? 82  ASP G OD2 1 
ATOM   5985 N N   . GLN G 1 89  ? 77.597  30.375 1.730  1.00 85.05  ? 83  GLN G N   1 
ATOM   5986 C CA  . GLN G 1 89  ? 76.559  29.977 2.670  1.00 81.96  ? 83  GLN G CA  1 
ATOM   5987 C C   . GLN G 1 89  ? 77.244  28.988 3.618  1.00 78.84  ? 83  GLN G C   1 
ATOM   5988 O O   . GLN G 1 89  ? 77.820  27.980 3.163  1.00 77.92  ? 83  GLN G O   1 
ATOM   5989 C CB  . GLN G 1 89  ? 75.381  29.303 1.959  1.00 82.66  ? 83  GLN G CB  1 
ATOM   5990 C CG  . GLN G 1 89  ? 74.136  29.143 2.841  1.00 88.13  ? 83  GLN G CG  1 
ATOM   5991 C CD  . GLN G 1 89  ? 73.182  28.058 2.353  1.00 88.65  ? 83  GLN G CD  1 
ATOM   5992 O OE1 . GLN G 1 89  ? 73.318  27.553 1.246  1.00 90.94  ? 83  GLN G OE1 1 
ATOM   5993 N NE2 . GLN G 1 89  ? 72.237  27.676 3.194  1.00 89.91  ? 83  GLN G NE2 1 
ATOM   5994 N N   . ALA G 1 90  ? 77.274  29.345 4.903  1.00 70.61  ? 84  ALA G N   1 
ATOM   5995 C CA  . ALA G 1 90  ? 77.888  28.520 5.947  1.00 65.45  ? 84  ALA G CA  1 
ATOM   5996 C C   . ALA G 1 90  ? 77.805  29.191 7.318  1.00 62.88  ? 84  ALA G C   1 
ATOM   5997 O O   . ALA G 1 90  ? 77.020  30.124 7.527  1.00 57.75  ? 84  ALA G O   1 
ATOM   5998 C CB  . ALA G 1 90  ? 79.360  28.195 5.604  1.00 57.93  ? 84  ALA G CB  1 
ATOM   5999 N N   . ASP G 1 91  ? 78.577  28.657 8.260  1.00 62.47  ? 85  ASP G N   1 
ATOM   6000 C CA  . ASP G 1 91  ? 78.649  29.183 9.613  1.00 62.65  ? 85  ASP G CA  1 
ATOM   6001 C C   . ASP G 1 91  ? 80.027  29.813 9.796  1.00 60.63  ? 85  ASP G C   1 
ATOM   6002 O O   . ASP G 1 91  ? 81.031  29.274 9.312  1.00 54.27  ? 85  ASP G O   1 
ATOM   6003 C CB  . ASP G 1 91  ? 78.471  28.053 10.627 1.00 67.02  ? 85  ASP G CB  1 
ATOM   6004 C CG  . ASP G 1 91  ? 77.107  27.407 10.546 1.00 70.44  ? 85  ASP G CG  1 
ATOM   6005 O OD1 . ASP G 1 91  ? 76.092  28.142 10.510 1.00 68.20  ? 85  ASP G OD1 1 
ATOM   6006 O OD2 . ASP G 1 91  ? 77.059  26.159 10.518 1.00 69.04  ? 85  ASP G OD2 1 
ATOM   6007 N N   . TYR G 1 92  ? 80.065  30.957 10.475 1.00 59.01  ? 86  TYR G N   1 
ATOM   6008 C CA  . TYR G 1 92  ? 81.310  31.683 10.729 1.00 59.97  ? 86  TYR G CA  1 
ATOM   6009 C C   . TYR G 1 92  ? 81.501  31.880 12.232 1.00 60.61  ? 86  TYR G C   1 
ATOM   6010 O O   . TYR G 1 92  ? 80.625  32.431 12.910 1.00 61.72  ? 86  TYR G O   1 
ATOM   6011 C CB  . TYR G 1 92  ? 81.285  33.051 10.015 1.00 60.73  ? 86  TYR G CB  1 
ATOM   6012 C CG  . TYR G 1 92  ? 81.156  32.946 8.510  1.00 62.91  ? 86  TYR G CG  1 
ATOM   6013 C CD1 . TYR G 1 92  ? 82.273  32.682 7.716  1.00 66.10  ? 86  TYR G CD1 1 
ATOM   6014 C CD2 . TYR G 1 92  ? 79.913  33.048 7.882  1.00 63.33  ? 86  TYR G CD2 1 
ATOM   6015 C CE1 . TYR G 1 92  ? 82.160  32.516 6.333  1.00 68.70  ? 86  TYR G CE1 1 
ATOM   6016 C CE2 . TYR G 1 92  ? 79.785  32.882 6.494  1.00 65.29  ? 86  TYR G CE2 1 
ATOM   6017 C CZ  . TYR G 1 92  ? 80.916  32.616 5.727  1.00 69.96  ? 86  TYR G CZ  1 
ATOM   6018 O OH  . TYR G 1 92  ? 80.818  32.453 4.359  1.00 69.69  ? 86  TYR G OH  1 
ATOM   6019 N N   . PHE G 1 93  ? 82.614  31.384 12.764 1.00 60.67  ? 87  PHE G N   1 
ATOM   6020 C CA  . PHE G 1 93  ? 82.914  31.518 14.192 1.00 59.72  ? 87  PHE G CA  1 
ATOM   6021 C C   . PHE G 1 93  ? 84.137  32.401 14.351 1.00 59.81  ? 87  PHE G C   1 
ATOM   6022 O O   . PHE G 1 93  ? 84.924  32.567 13.416 1.00 61.41  ? 87  PHE G O   1 
ATOM   6023 C CB  . PHE G 1 93  ? 83.230  30.157 14.832 1.00 59.05  ? 87  PHE G CB  1 
ATOM   6024 C CG  . PHE G 1 93  ? 82.114  29.169 14.750 1.00 63.68  ? 87  PHE G CG  1 
ATOM   6025 C CD1 . PHE G 1 93  ? 81.840  28.505 13.556 1.00 67.61  ? 87  PHE G CD1 1 
ATOM   6026 C CD2 . PHE G 1 93  ? 81.298  28.927 15.854 1.00 65.93  ? 87  PHE G CD2 1 
ATOM   6027 C CE1 . PHE G 1 93  ? 80.765  27.607 13.463 1.00 68.43  ? 87  PHE G CE1 1 
ATOM   6028 C CE2 . PHE G 1 93  ? 80.220  28.030 15.780 1.00 65.17  ? 87  PHE G CE2 1 
ATOM   6029 C CZ  . PHE G 1 93  ? 79.952  27.375 14.581 1.00 68.45  ? 87  PHE G CZ  1 
ATOM   6030 N N   . CYS G 1 94  ? 84.290  32.982 15.530 1.00 56.90  ? 88  CYS G N   1 
ATOM   6031 C CA  . CYS G 1 94  ? 85.455  33.792 15.812 1.00 51.27  ? 88  CYS G CA  1 
ATOM   6032 C C   . CYS G 1 94  ? 86.000  33.198 17.091 1.00 48.99  ? 88  CYS G C   1 
ATOM   6033 O O   . CYS G 1 94  ? 85.235  32.720 17.925 1.00 51.81  ? 88  CYS G O   1 
ATOM   6034 C CB  . CYS G 1 94  ? 85.062  35.238 16.023 1.00 51.55  ? 88  CYS G CB  1 
ATOM   6035 S SG  . CYS G 1 94  ? 84.108  35.517 17.542 1.00 60.10  ? 88  CYS G SG  1 
ATOM   6036 N N   . GLN G 1 95  ? 87.315  33.114 17.195 1.00 45.48  ? 89  GLN G N   1 
ATOM   6037 C CA  . GLN G 1 95  ? 87.947  32.569 18.380 1.00 38.04  ? 89  GLN G CA  1 
ATOM   6038 C C   . GLN G 1 95  ? 89.080  33.535 18.786 1.00 45.70  ? 89  GLN G C   1 
ATOM   6039 O O   . GLN G 1 95  ? 89.701  34.156 17.911 1.00 49.10  ? 89  GLN G O   1 
ATOM   6040 C CB  . GLN G 1 95  ? 88.514  31.190 18.047 1.00 24.78  ? 89  GLN G CB  1 
ATOM   6041 C CG  . GLN G 1 95  ? 89.223  30.505 19.213 1.00 26.20  ? 89  GLN G CG  1 
ATOM   6042 C CD  . GLN G 1 95  ? 90.188  29.424 18.768 1.00 28.48  ? 89  GLN G CD  1 
ATOM   6043 O OE1 . GLN G 1 95  ? 90.507  29.294 17.575 1.00 33.93  ? 89  GLN G OE1 1 
ATOM   6044 N NE2 . GLN G 1 95  ? 90.687  28.652 19.728 1.00 29.25  ? 89  GLN G NE2 1 
ATOM   6045 N N   . GLN G 1 96  ? 89.327  33.695 20.090 1.00 42.72  ? 90  GLN G N   1 
ATOM   6046 C CA  . GLN G 1 96  ? 90.394  34.576 20.554 1.00 35.26  ? 90  GLN G CA  1 
ATOM   6047 C C   . GLN G 1 96  ? 91.639  33.777 20.880 1.00 41.11  ? 90  GLN G C   1 
ATOM   6048 O O   . GLN G 1 96  ? 91.555  32.648 21.357 1.00 40.75  ? 90  GLN G O   1 
ATOM   6049 C CB  . GLN G 1 96  ? 89.959  35.395 21.767 1.00 32.79  ? 90  GLN G CB  1 
ATOM   6050 C CG  . GLN G 1 96  ? 89.395  34.599 22.945 1.00 40.77  ? 90  GLN G CG  1 
ATOM   6051 C CD  . GLN G 1 96  ? 90.435  34.211 23.983 1.00 42.90  ? 90  GLN G CD  1 
ATOM   6052 O OE1 . GLN G 1 96  ? 91.603  34.572 23.876 1.00 53.02  ? 90  GLN G OE1 1 
ATOM   6053 N NE2 . GLN G 1 96  ? 90.007  33.471 25.003 1.00 48.21  ? 90  GLN G NE2 1 
ATOM   6054 N N   . HIS G 1 97  ? 92.806  34.352 20.618 1.00 43.21  ? 91  HIS G N   1 
ATOM   6055 C CA  . HIS G 1 97  ? 94.039  33.662 20.905 1.00 45.53  ? 91  HIS G CA  1 
ATOM   6056 C C   . HIS G 1 97  ? 94.893  34.380 21.917 1.00 46.95  ? 91  HIS G C   1 
ATOM   6057 O O   . HIS G 1 97  ? 96.067  34.059 22.104 1.00 47.62  ? 91  HIS G O   1 
ATOM   6058 C CB  . HIS G 1 97  ? 94.808  33.393 19.624 1.00 46.06  ? 91  HIS G CB  1 
ATOM   6059 C CG  . HIS G 1 97  ? 94.153  32.371 18.758 1.00 42.92  ? 91  HIS G CG  1 
ATOM   6060 N ND1 . HIS G 1 97  ? 94.566  31.061 18.767 1.00 40.43  ? 91  HIS G ND1 1 
ATOM   6061 C CD2 . HIS G 1 97  ? 93.019  32.487 18.023 1.00 43.49  ? 91  HIS G CD2 1 
ATOM   6062 C CE1 . HIS G 1 97  ? 93.675  30.406 18.051 1.00 44.18  ? 91  HIS G CE1 1 
ATOM   6063 N NE2 . HIS G 1 97  ? 92.718  31.231 17.580 1.00 47.32  ? 91  HIS G NE2 1 
ATOM   6064 N N   . TYR G 1 98  ? 94.272  35.297 22.640 1.00 48.87  ? 92  TYR G N   1 
ATOM   6065 C CA  . TYR G 1 98  ? 94.980  36.059 23.647 1.00 54.37  ? 92  TYR G CA  1 
ATOM   6066 C C   . TYR G 1 98  ? 95.325  35.226 24.884 1.00 58.35  ? 92  TYR G C   1 
ATOM   6067 O O   . TYR G 1 98  ? 96.500  35.048 25.213 1.00 56.50  ? 92  TYR G O   1 
ATOM   6068 C CB  . TYR G 1 98  ? 94.163  37.281 24.055 1.00 54.71  ? 92  TYR G CB  1 
ATOM   6069 C CG  . TYR G 1 98  ? 95.017  38.365 24.635 1.00 58.19  ? 92  TYR G CG  1 
ATOM   6070 C CD1 . TYR G 1 98  ? 95.918  39.048 23.832 1.00 56.02  ? 92  TYR G CD1 1 
ATOM   6071 C CD2 . TYR G 1 98  ? 94.954  38.685 25.990 1.00 60.00  ? 92  TYR G CD2 1 
ATOM   6072 C CE1 . TYR G 1 98  ? 96.741  40.017 24.351 1.00 68.14  ? 92  TYR G CE1 1 
ATOM   6073 C CE2 . TYR G 1 98  ? 95.777  39.662 26.534 1.00 68.87  ? 92  TYR G CE2 1 
ATOM   6074 C CZ  . TYR G 1 98  ? 96.676  40.330 25.709 1.00 73.16  ? 92  TYR G CZ  1 
ATOM   6075 O OH  . TYR G 1 98  ? 97.527  41.302 26.222 1.00 80.44  ? 92  TYR G OH  1 
ATOM   6076 N N   . ARG G 1 99  ? 94.301  34.722 25.572 1.00 62.76  ? 93  ARG G N   1 
ATOM   6077 C CA  . ARG G 1 99  ? 94.497  33.935 26.793 1.00 61.50  ? 93  ARG G CA  1 
ATOM   6078 C C   . ARG G 1 99  ? 93.855  32.560 26.724 1.00 60.22  ? 93  ARG G C   1 
ATOM   6079 O O   . ARG G 1 99  ? 92.924  32.336 25.948 1.00 57.14  ? 93  ARG G O   1 
ATOM   6080 C CB  . ARG G 1 99  ? 93.898  34.654 28.006 1.00 61.65  ? 93  ARG G CB  1 
ATOM   6081 C CG  . ARG G 1 99  ? 94.612  35.903 28.436 1.00 63.90  ? 93  ARG G CG  1 
ATOM   6082 C CD  . ARG G 1 99  ? 95.898  35.610 29.171 1.00 65.51  ? 93  ARG G CD  1 
ATOM   6083 N NE  . ARG G 1 99  ? 96.536  36.870 29.556 1.00 78.82  ? 93  ARG G NE  1 
ATOM   6084 C CZ  . ARG G 1 99  ? 97.512  37.468 28.871 1.00 78.11  ? 93  ARG G CZ  1 
ATOM   6085 N NH1 . ARG G 1 99  ? 97.986  36.927 27.758 1.00 81.81  ? 93  ARG G NH1 1 
ATOM   6086 N NH2 . ARG G 1 99  ? 98.017  38.617 29.296 1.00 75.46  ? 93  ARG G NH2 1 
ATOM   6087 N N   . ALA G 1 100 ? 94.359  31.657 27.570 1.00 58.09  ? 94  ALA G N   1 
ATOM   6088 C CA  . ALA G 1 100 ? 93.841  30.301 27.699 1.00 55.16  ? 94  ALA G CA  1 
ATOM   6089 C C   . ALA G 1 100 ? 92.697  30.362 28.716 1.00 56.28  ? 94  ALA G C   1 
ATOM   6090 O O   . ALA G 1 100 ? 92.786  31.051 29.730 1.00 56.93  ? 94  ALA G O   1 
ATOM   6091 C CB  . ALA G 1 100 ? 94.932  29.335 28.187 1.00 42.27  ? 94  ALA G CB  1 
ATOM   6092 N N   . PRO G 1 101 ? 91.589  29.673 28.430 1.00 59.42  ? 95  PRO G N   1 
ATOM   6093 C CA  . PRO G 1 101 ? 91.457  28.895 27.200 1.00 55.83  ? 95  PRO G CA  1 
ATOM   6094 C C   . PRO G 1 101 ? 91.043  29.791 26.038 1.00 50.88  ? 95  PRO G C   1 
ATOM   6095 O O   . PRO G 1 101 ? 90.325  30.791 26.220 1.00 47.43  ? 95  PRO G O   1 
ATOM   6096 C CB  . PRO G 1 101 ? 90.381  27.883 27.570 1.00 55.08  ? 95  PRO G CB  1 
ATOM   6097 C CG  . PRO G 1 101 ? 89.495  28.664 28.472 1.00 54.12  ? 95  PRO G CG  1 
ATOM   6098 C CD  . PRO G 1 101 ? 90.497  29.359 29.366 1.00 59.99  ? 95  PRO G CD  1 
ATOM   6099 N N   . ARG G 1 102 ? 91.502  29.411 24.850 1.00 47.41  ? 96  ARG G N   1 
ATOM   6100 C CA  . ARG G 1 102 ? 91.223  30.147 23.628 1.00 47.01  ? 96  ARG G CA  1 
ATOM   6101 C C   . ARG G 1 102 ? 89.782  29.883 23.190 1.00 43.47  ? 96  ARG G C   1 
ATOM   6102 O O   . ARG G 1 102 ? 89.496  29.115 22.281 1.00 41.84  ? 96  ARG G O   1 
ATOM   6103 C CB  . ARG G 1 102 ? 92.260  29.749 22.587 1.00 49.69  ? 96  ARG G CB  1 
ATOM   6104 C CG  . ARG G 1 102 ? 93.668  29.979 23.114 1.00 49.73  ? 96  ARG G CG  1 
ATOM   6105 C CD  . ARG G 1 102 ? 94.699  29.416 22.198 1.00 53.51  ? 96  ARG G CD  1 
ATOM   6106 N NE  . ARG G 1 102 ? 96.045  29.839 22.563 1.00 58.22  ? 96  ARG G NE  1 
ATOM   6107 C CZ  . ARG G 1 102 ? 96.924  30.303 21.683 1.00 64.75  ? 96  ARG G CZ  1 
ATOM   6108 N NH1 . ARG G 1 102 ? 96.595  30.410 20.400 1.00 63.45  ? 96  ARG G NH1 1 
ATOM   6109 N NH2 . ARG G 1 102 ? 98.149  30.610 22.070 1.00 72.48  ? 96  ARG G NH2 1 
ATOM   6110 N N   . THR G 1 103 ? 88.886  30.589 23.857 1.00 43.20  ? 97  THR G N   1 
ATOM   6111 C CA  . THR G 1 103 ? 87.458  30.458 23.674 1.00 42.85  ? 97  THR G CA  1 
ATOM   6112 C C   . THR G 1 103 ? 86.941  30.889 22.313 1.00 41.13  ? 97  THR G C   1 
ATOM   6113 O O   . THR G 1 103 ? 87.570  31.722 21.656 1.00 38.70  ? 97  THR G O   1 
ATOM   6114 C CB  . THR G 1 103 ? 86.747  31.256 24.774 1.00 48.14  ? 97  THR G CB  1 
ATOM   6115 O OG1 . THR G 1 103 ? 86.950  32.652 24.539 1.00 52.66  ? 97  THR G OG1 1 
ATOM   6116 C CG2 . THR G 1 103 ? 87.344  30.904 26.165 1.00 41.16  ? 97  THR G CG2 1 
ATOM   6117 N N   . PHE G 1 104 ? 85.794  30.322 21.911 1.00 39.91  ? 98  PHE G N   1 
ATOM   6118 C CA  . PHE G 1 104 ? 85.139  30.636 20.632 1.00 33.84  ? 98  PHE G CA  1 
ATOM   6119 C C   . PHE G 1 104 ? 83.860  31.432 20.864 1.00 38.86  ? 98  PHE G C   1 
ATOM   6120 O O   . PHE G 1 104 ? 83.323  31.470 21.980 1.00 37.26  ? 98  PHE G O   1 
ATOM   6121 C CB  . PHE G 1 104 ? 84.701  29.368 19.877 1.00 33.12  ? 98  PHE G CB  1 
ATOM   6122 C CG  . PHE G 1 104 ? 85.817  28.424 19.522 1.00 26.90  ? 98  PHE G CG  1 
ATOM   6123 C CD1 . PHE G 1 104 ? 86.476  27.696 20.519 1.00 20.52  ? 98  PHE G CD1 1 
ATOM   6124 C CD2 . PHE G 1 104 ? 86.204  28.259 18.185 1.00 23.24  ? 98  PHE G CD2 1 
ATOM   6125 C CE1 . PHE G 1 104 ? 87.515  26.818 20.207 1.00 23.43  ? 98  PHE G CE1 1 
ATOM   6126 C CE2 . PHE G 1 104 ? 87.249  27.378 17.857 1.00 27.77  ? 98  PHE G CE2 1 
ATOM   6127 C CZ  . PHE G 1 104 ? 87.907  26.655 18.878 1.00 23.28  ? 98  PHE G CZ  1 
ATOM   6128 N N   . GLY G 1 105 ? 83.369  32.029 19.785 1.00 40.76  ? 99  GLY G N   1 
ATOM   6129 C CA  . GLY G 1 105 ? 82.130  32.773 19.825 1.00 47.89  ? 99  GLY G CA  1 
ATOM   6130 C C   . GLY G 1 105 ? 81.008  31.790 19.499 1.00 56.32  ? 99  GLY G C   1 
ATOM   6131 O O   . GLY G 1 105 ? 81.270  30.683 19.002 1.00 49.65  ? 99  GLY G O   1 
ATOM   6132 N N   . GLY G 1 106 ? 79.765  32.206 19.746 1.00 58.44  ? 100 GLY G N   1 
ATOM   6133 C CA  . GLY G 1 106 ? 78.606  31.369 19.512 1.00 61.26  ? 100 GLY G CA  1 
ATOM   6134 C C   . GLY G 1 106 ? 78.316  31.039 18.061 1.00 66.10  ? 100 GLY G C   1 
ATOM   6135 O O   . GLY G 1 106 ? 77.584  30.086 17.776 1.00 68.81  ? 100 GLY G O   1 
ATOM   6136 N N   . GLY G 1 107 ? 78.892  31.804 17.141 1.00 67.91  ? 101 GLY G N   1 
ATOM   6137 C CA  . GLY G 1 107 ? 78.680  31.541 15.726 1.00 66.90  ? 101 GLY G CA  1 
ATOM   6138 C C   . GLY G 1 107 ? 77.576  32.358 15.088 1.00 66.67  ? 101 GLY G C   1 
ATOM   6139 O O   . GLY G 1 107 ? 76.704  32.893 15.773 1.00 67.24  ? 101 GLY G O   1 
ATOM   6140 N N   . THR G 1 108 ? 77.661  32.498 13.772 1.00 70.24  ? 102 THR G N   1 
ATOM   6141 C CA  . THR G 1 108 ? 76.686  33.242 12.976 1.00 72.99  ? 102 THR G CA  1 
ATOM   6142 C C   . THR G 1 108 ? 76.371  32.359 11.766 1.00 76.12  ? 102 THR G C   1 
ATOM   6143 O O   . THR G 1 108 ? 77.288  31.909 11.065 1.00 71.41  ? 102 THR G O   1 
ATOM   6144 C CB  . THR G 1 108 ? 77.266  34.605 12.457 1.00 72.80  ? 102 THR G CB  1 
ATOM   6145 O OG1 . THR G 1 108 ? 77.491  35.506 13.555 1.00 71.66  ? 102 THR G OG1 1 
ATOM   6146 C CG2 . THR G 1 108 ? 76.321  35.261 11.440 1.00 71.05  ? 102 THR G CG2 1 
ATOM   6147 N N   . LYS G 1 109 ? 75.090  32.044 11.568 1.00 81.92  ? 103 LYS G N   1 
ATOM   6148 C CA  . LYS G 1 109 ? 74.682  31.224 10.426 1.00 85.05  ? 103 LYS G CA  1 
ATOM   6149 C C   . LYS G 1 109 ? 74.356  32.114 9.222  1.00 82.56  ? 103 LYS G C   1 
ATOM   6150 O O   . LYS G 1 109 ? 73.379  32.872 9.239  1.00 79.85  ? 103 LYS G O   1 
ATOM   6151 C CB  . LYS G 1 109 ? 73.478  30.330 10.774 1.00 88.62  ? 103 LYS G CB  1 
ATOM   6152 C CG  . LYS G 1 109 ? 73.212  29.206 9.758  1.00 94.45  ? 103 LYS G CG  1 
ATOM   6153 C CD  . LYS G 1 109 ? 72.237  28.158 10.314 1.00 100.00 ? 103 LYS G CD  1 
ATOM   6154 C CE  . LYS G 1 109 ? 72.446  26.777 9.665  1.00 100.00 ? 103 LYS G CE  1 
ATOM   6155 N NZ  . LYS G 1 109 ? 73.829  26.240 9.942  1.00 100.00 ? 103 LYS G NZ  1 
ATOM   6156 N N   . LEU G 1 110 ? 75.231  32.095 8.224  1.00 79.81  ? 104 LEU G N   1 
ATOM   6157 C CA  . LEU G 1 110 ? 75.005  32.879 7.024  1.00 83.56  ? 104 LEU G CA  1 
ATOM   6158 C C   . LEU G 1 110 ? 74.303  32.001 5.993  1.00 87.94  ? 104 LEU G C   1 
ATOM   6159 O O   . LEU G 1 110 ? 74.846  30.978 5.546  1.00 87.75  ? 104 LEU G O   1 
ATOM   6160 C CB  . LEU G 1 110 ? 76.318  33.418 6.432  1.00 80.24  ? 104 LEU G CB  1 
ATOM   6161 C CG  . LEU G 1 110 ? 76.202  33.929 4.980  1.00 76.46  ? 104 LEU G CG  1 
ATOM   6162 C CD1 . LEU G 1 110 ? 75.354  35.186 4.890  1.00 73.06  ? 104 LEU G CD1 1 
ATOM   6163 C CD2 . LEU G 1 110 ? 77.555  34.184 4.384  1.00 75.31  ? 104 LEU G CD2 1 
ATOM   6164 N N   . GLU G 1 111 ? 73.082  32.385 5.646  1.00 89.35  ? 105 GLU G N   1 
ATOM   6165 C CA  . GLU G 1 111 ? 72.326  31.660 4.651  1.00 90.08  ? 105 GLU G CA  1 
ATOM   6166 C C   . GLU G 1 111 ? 71.899  32.603 3.552  1.00 89.09  ? 105 GLU G C   1 
ATOM   6167 O O   . GLU G 1 111 ? 71.339  33.670 3.801  1.00 84.56  ? 105 GLU G O   1 
ATOM   6168 C CB  . GLU G 1 111 ? 71.133  30.923 5.267  1.00 94.06  ? 105 GLU G CB  1 
ATOM   6169 C CG  . GLU G 1 111 ? 71.550  29.609 5.944  1.00 98.54  ? 105 GLU G CG  1 
ATOM   6170 C CD  . GLU G 1 111 ? 70.400  28.632 6.179  1.00 100.00 ? 105 GLU G CD  1 
ATOM   6171 O OE1 . GLU G 1 111 ? 69.229  28.966 5.888  1.00 100.00 ? 105 GLU G OE1 1 
ATOM   6172 O OE2 . GLU G 1 111 ? 70.681  27.513 6.660  1.00 100.00 ? 105 GLU G OE2 1 
ATOM   6173 N N   . ILE G 1 112 ? 72.239  32.223 2.331  1.00 90.25  ? 106 ILE G N   1 
ATOM   6174 C CA  . ILE G 1 112 ? 71.914  33.019 1.168  1.00 92.92  ? 106 ILE G CA  1 
ATOM   6175 C C   . ILE G 1 112 ? 70.899  32.313 0.265  1.00 95.77  ? 106 ILE G C   1 
ATOM   6176 O O   . ILE G 1 112 ? 70.935  31.080 0.111  1.00 94.86  ? 106 ILE G O   1 
ATOM   6177 C CB  . ILE G 1 112 ? 73.191  33.390 0.394  1.00 91.25  ? 106 ILE G CB  1 
ATOM   6178 C CG1 . ILE G 1 112 ? 74.018  32.139 0.111  1.00 90.19  ? 106 ILE G CG1 1 
ATOM   6179 C CG2 . ILE G 1 112 ? 74.025  34.382 1.202  1.00 90.10  ? 106 ILE G CG2 1 
ATOM   6180 C CD1 . ILE G 1 112 ? 75.368  32.451 -0.462 1.00 89.64  ? 106 ILE G CD1 1 
ATOM   6181 N N   . LYS G 1 113 ? 69.950  33.103 -0.249 1.00 96.89  ? 107 LYS G N   1 
ATOM   6182 C CA  . LYS G 1 113 ? 68.885  32.627 -1.141 1.00 95.08  ? 107 LYS G CA  1 
ATOM   6183 C C   . LYS G 1 113 ? 69.410  32.556 -2.570 1.00 93.00  ? 107 LYS G C   1 
ATOM   6184 O O   . LYS G 1 113 ? 70.091  33.533 -2.965 1.00 90.44  ? 107 LYS G O   1 
ATOM   6185 C CB  . LYS G 1 113 ? 67.688  33.585 -1.102 1.00 95.53  ? 107 LYS G CB  1 
ATOM   6186 C CG  . LYS G 1 113 ? 67.443  34.234 0.251  1.00 98.80  ? 107 LYS G CG  1 
ATOM   6187 C CD  . LYS G 1 113 ? 66.242  35.164 0.210  1.00 100.00 ? 107 LYS G CD  1 
ATOM   6188 C CE  . LYS G 1 113 ? 66.280  36.165 1.362  1.00 100.00 ? 107 LYS G CE  1 
ATOM   6189 N NZ  . LYS G 1 113 ? 67.327  37.210 1.130  1.00 100.00 ? 107 LYS G NZ  1 
ATOM   6190 N N   . GLY H 2 1   ? 97.450  15.880 -1.899 1.00 100.00 ? 0   GLY H N   1 
ATOM   6191 C CA  . GLY H 2 1   ? 97.193  16.835 -0.771 1.00 99.05  ? 0   GLY H CA  1 
ATOM   6192 C C   . GLY H 2 1   ? 98.328  16.597 0.194  1.00 98.18  ? 0   GLY H C   1 
ATOM   6193 O O   . GLY H 2 1   ? 98.375  15.557 0.843  1.00 97.50  ? 0   GLY H O   1 
ATOM   6194 N N   . GLN H 2 2   ? 99.270  17.527 0.252  1.00 95.23  ? 1   GLN H N   1 
ATOM   6195 C CA  . GLN H 2 2   ? 100.418 17.341 1.112  1.00 93.23  ? 1   GLN H CA  1 
ATOM   6196 C C   . GLN H 2 2   ? 100.093 17.051 2.572  1.00 90.12  ? 1   GLN H C   1 
ATOM   6197 O O   . GLN H 2 2   ? 100.192 15.906 3.010  1.00 90.71  ? 1   GLN H O   1 
ATOM   6198 C CB  . GLN H 2 2   ? 101.390 18.519 1.000  1.00 95.57  ? 1   GLN H CB  1 
ATOM   6199 C CG  . GLN H 2 2   ? 102.844 18.087 1.188  1.00 99.37  ? 1   GLN H CG  1 
ATOM   6200 C CD  . GLN H 2 2   ? 103.307 17.132 0.080  1.00 100.00 ? 1   GLN H CD  1 
ATOM   6201 O OE1 . GLN H 2 2   ? 103.563 17.563 -1.044 1.00 100.00 ? 1   GLN H OE1 1 
ATOM   6202 N NE2 . GLN H 2 2   ? 103.380 15.835 0.384  1.00 100.00 ? 1   GLN H NE2 1 
ATOM   6203 N N   . VAL H 2 3   ? 99.661  18.076 3.303  1.00 87.34  ? 2   VAL H N   1 
ATOM   6204 C CA  . VAL H 2 3   ? 99.361  17.939 4.729  1.00 79.53  ? 2   VAL H CA  1 
ATOM   6205 C C   . VAL H 2 3   ? 97.978  17.388 5.065  1.00 76.41  ? 2   VAL H C   1 
ATOM   6206 O O   . VAL H 2 3   ? 96.981  17.705 4.391  1.00 71.15  ? 2   VAL H O   1 
ATOM   6207 C CB  . VAL H 2 3   ? 99.566  19.280 5.485  1.00 74.45  ? 2   VAL H CB  1 
ATOM   6208 C CG1 . VAL H 2 3   ? 99.585  19.052 6.986  1.00 72.55  ? 2   VAL H CG1 1 
ATOM   6209 C CG2 . VAL H 2 3   ? 100.850 19.937 5.044  1.00 68.79  ? 2   VAL H CG2 1 
ATOM   6210 N N   . GLN H 2 4   ? 97.957  16.512 6.071  1.00 73.79  ? 3   GLN H N   1 
ATOM   6211 C CA  . GLN H 2 4   ? 96.739  15.900 6.584  1.00 70.90  ? 3   GLN H CA  1 
ATOM   6212 C C   . GLN H 2 4   ? 96.982  15.686 8.064  1.00 67.08  ? 3   GLN H C   1 
ATOM   6213 O O   . GLN H 2 4   ? 98.116  15.406 8.487  1.00 62.28  ? 3   GLN H O   1 
ATOM   6214 C CB  . GLN H 2 4   ? 96.455  14.532 5.954  1.00 77.34  ? 3   GLN H CB  1 
ATOM   6215 C CG  . GLN H 2 4   ? 96.362  14.486 4.438  1.00 89.24  ? 3   GLN H CG  1 
ATOM   6216 C CD  . GLN H 2 4   ? 97.376  13.513 3.844  1.00 94.87  ? 3   GLN H CD  1 
ATOM   6217 O OE1 . GLN H 2 4   ? 97.706  12.492 4.456  1.00 100.00 ? 3   GLN H OE1 1 
ATOM   6218 N NE2 . GLN H 2 4   ? 97.880  13.829 2.659  1.00 94.39  ? 3   GLN H NE2 1 
ATOM   6219 N N   . LEU H 2 5   ? 95.929  15.917 8.842  1.00 67.05  ? 4   LEU H N   1 
ATOM   6220 C CA  . LEU H 2 5   ? 95.903  15.721 10.291 1.00 63.82  ? 4   LEU H CA  1 
ATOM   6221 C C   . LEU H 2 5   ? 94.823  14.651 10.482 1.00 58.79  ? 4   LEU H C   1 
ATOM   6222 O O   . LEU H 2 5   ? 93.656  14.893 10.151 1.00 57.82  ? 4   LEU H O   1 
ATOM   6223 C CB  . LEU H 2 5   ? 95.481  17.008 11.038 1.00 61.43  ? 4   LEU H CB  1 
ATOM   6224 C CG  . LEU H 2 5   ? 96.370  18.255 11.060 1.00 55.72  ? 4   LEU H CG  1 
ATOM   6225 C CD1 . LEU H 2 5   ? 95.901  19.199 12.136 1.00 55.91  ? 4   LEU H CD1 1 
ATOM   6226 C CD2 . LEU H 2 5   ? 97.783  17.870 11.365 1.00 56.72  ? 4   LEU H CD2 1 
ATOM   6227 N N   . VAL H 2 6   ? 95.216  13.456 10.910 1.00 58.35  ? 5   VAL H N   1 
ATOM   6228 C CA  . VAL H 2 6   ? 94.249  12.382 11.123 1.00 59.99  ? 5   VAL H CA  1 
ATOM   6229 C C   . VAL H 2 6   ? 94.205  11.855 12.571 1.00 60.38  ? 5   VAL H C   1 
ATOM   6230 O O   . VAL H 2 6   ? 95.148  11.203 13.060 1.00 58.55  ? 5   VAL H O   1 
ATOM   6231 C CB  . VAL H 2 6   ? 94.476  11.158 10.171 1.00 58.46  ? 5   VAL H CB  1 
ATOM   6232 C CG1 . VAL H 2 6   ? 93.278  10.219 10.272 1.00 56.87  ? 5   VAL H CG1 1 
ATOM   6233 C CG2 . VAL H 2 6   ? 94.685  11.597 8.709  1.00 56.27  ? 5   VAL H CG2 1 
ATOM   6234 N N   . GLU H 2 7   ? 93.070  12.080 13.222 1.00 59.12  ? 6   GLU H N   1 
ATOM   6235 C CA  . GLU H 2 7   ? 92.872  11.613 14.581 1.00 55.52  ? 6   GLU H CA  1 
ATOM   6236 C C   . GLU H 2 7   ? 92.000  10.344 14.619 1.00 52.75  ? 6   GLU H C   1 
ATOM   6237 O O   . GLU H 2 7   ? 91.014  10.203 13.860 1.00 44.15  ? 6   GLU H O   1 
ATOM   6238 C CB  . GLU H 2 7   ? 92.350  12.731 15.517 1.00 52.66  ? 6   GLU H CB  1 
ATOM   6239 C CG  . GLU H 2 7   ? 91.084  13.493 15.091 1.00 55.36  ? 6   GLU H CG  1 
ATOM   6240 C CD  . GLU H 2 7   ? 91.304  14.515 13.988 1.00 46.50  ? 6   GLU H CD  1 
ATOM   6241 O OE1 . GLU H 2 7   ? 91.376  14.102 12.817 1.00 46.49  ? 6   GLU H OE1 1 
ATOM   6242 O OE2 . GLU H 2 7   ? 91.333  15.731 14.280 1.00 46.65  ? 6   GLU H OE2 1 
ATOM   6243 N N   . SER H 2 8   ? 92.481  9.381  15.405 1.00 49.30  ? 7   SER H N   1 
ATOM   6244 C CA  . SER H 2 8   ? 91.830  8.102  15.620 1.00 46.63  ? 7   SER H CA  1 
ATOM   6245 C C   . SER H 2 8   ? 91.446  7.999  17.087 1.00 53.12  ? 7   SER H C   1 
ATOM   6246 O O   . SER H 2 8   ? 92.194  8.428  17.968 1.00 55.13  ? 7   SER H O   1 
ATOM   6247 C CB  . SER H 2 8   ? 92.755  6.942  15.236 1.00 37.24  ? 7   SER H CB  1 
ATOM   6248 O OG  . SER H 2 8   ? 94.069  7.145  15.707 1.00 34.88  ? 7   SER H OG  1 
ATOM   6249 N N   . GLY H 2 9   ? 90.278  7.416  17.343 1.00 58.49  ? 8   GLY H N   1 
ATOM   6250 C CA  . GLY H 2 9   ? 89.782  7.269  18.696 1.00 55.75  ? 8   GLY H CA  1 
ATOM   6251 C C   . GLY H 2 9   ? 88.789  6.124  18.787 1.00 57.14  ? 8   GLY H C   1 
ATOM   6252 O O   . GLY H 2 9   ? 88.629  5.380  17.819 1.00 58.43  ? 8   GLY H O   1 
ATOM   6253 N N   . PRO H 2 10  ? 88.054  6.013  19.896 1.00 59.47  ? 9   PRO H N   1 
ATOM   6254 C CA  . PRO H 2 10  ? 87.061  4.936  20.119 1.00 58.47  ? 9   PRO H CA  1 
ATOM   6255 C C   . PRO H 2 10  ? 85.584  5.009  19.625 1.00 56.54  ? 9   PRO H C   1 
ATOM   6256 O O   . PRO H 2 10  ? 84.899  3.997  19.671 1.00 59.68  ? 9   PRO H O   1 
ATOM   6257 C CB  . PRO H 2 10  ? 87.149  4.742  21.627 1.00 53.97  ? 9   PRO H CB  1 
ATOM   6258 C CG  . PRO H 2 10  ? 87.296  6.160  22.121 1.00 51.21  ? 9   PRO H CG  1 
ATOM   6259 C CD  . PRO H 2 10  ? 88.213  6.830  21.116 1.00 54.92  ? 9   PRO H CD  1 
ATOM   6260 N N   . GLY H 2 11  ? 85.096  6.142  19.131 1.00 53.93  ? 10  GLY H N   1 
ATOM   6261 C CA  . GLY H 2 11  ? 83.705  6.214  18.697 1.00 54.99  ? 10  GLY H CA  1 
ATOM   6262 C C   . GLY H 2 11  ? 82.837  6.026  19.927 1.00 58.49  ? 10  GLY H C   1 
ATOM   6263 O O   . GLY H 2 11  ? 82.940  6.828  20.847 1.00 67.73  ? 10  GLY H O   1 
ATOM   6264 N N   . LEU H 2 12  ? 81.995  4.987  19.960 1.00 56.64  ? 11  LEU H N   1 
ATOM   6265 C CA  . LEU H 2 12  ? 81.147  4.679  21.120 1.00 46.69  ? 11  LEU H CA  1 
ATOM   6266 C C   . LEU H 2 12  ? 81.989  4.229  22.306 1.00 46.46  ? 11  LEU H C   1 
ATOM   6267 O O   . LEU H 2 12  ? 82.692  3.219  22.231 1.00 43.00  ? 11  LEU H O   1 
ATOM   6268 C CB  . LEU H 2 12  ? 80.197  3.539  20.809 1.00 45.57  ? 11  LEU H CB  1 
ATOM   6269 C CG  . LEU H 2 12  ? 78.967  3.752  19.949 1.00 47.04  ? 11  LEU H CG  1 
ATOM   6270 C CD1 . LEU H 2 12  ? 78.102  2.490  20.014 1.00 53.35  ? 11  LEU H CD1 1 
ATOM   6271 C CD2 . LEU H 2 12  ? 78.196  4.907  20.505 1.00 52.51  ? 11  LEU H CD2 1 
ATOM   6272 N N   . VAL H 2 13  ? 81.846  4.927  23.423 1.00 47.64  ? 12  VAL H N   1 
ATOM   6273 C CA  . VAL H 2 13  ? 82.580  4.629  24.646 1.00 49.55  ? 12  VAL H CA  1 
ATOM   6274 C C   . VAL H 2 13  ? 81.662  4.865  25.854 1.00 53.03  ? 12  VAL H C   1 
ATOM   6275 O O   . VAL H 2 13  ? 80.887  5.835  25.876 1.00 50.66  ? 12  VAL H O   1 
ATOM   6276 C CB  . VAL H 2 13  ? 83.797  5.533  24.782 1.00 48.66  ? 12  VAL H CB  1 
ATOM   6277 C CG1 . VAL H 2 13  ? 84.490  5.286  26.097 1.00 54.48  ? 12  VAL H CG1 1 
ATOM   6278 C CG2 . VAL H 2 13  ? 84.729  5.267  23.657 1.00 50.82  ? 12  VAL H CG2 1 
ATOM   6279 N N   . ALA H 2 14  ? 81.780  4.001  26.865 1.00 54.76  ? 13  ALA H N   1 
ATOM   6280 C CA  . ALA H 2 14  ? 80.951  4.101  28.069 1.00 55.77  ? 13  ALA H CA  1 
ATOM   6281 C C   . ALA H 2 14  ? 81.505  5.086  29.089 1.00 52.59  ? 13  ALA H C   1 
ATOM   6282 O O   . ALA H 2 14  ? 82.702  5.389  29.085 1.00 58.05  ? 13  ALA H O   1 
ATOM   6283 C CB  . ALA H 2 14  ? 80.773  2.729  28.718 1.00 46.78  ? 13  ALA H CB  1 
ATOM   6284 N N   . PRO H 2 15  ? 80.634  5.636  29.945 1.00 48.76  ? 14  PRO H N   1 
ATOM   6285 C CA  . PRO H 2 15  ? 81.051  6.577  30.970 1.00 46.87  ? 14  PRO H CA  1 
ATOM   6286 C C   . PRO H 2 15  ? 82.011  5.925  31.972 1.00 53.52  ? 14  PRO H C   1 
ATOM   6287 O O   . PRO H 2 15  ? 82.236  4.710  31.932 1.00 51.74  ? 14  PRO H O   1 
ATOM   6288 C CB  . PRO H 2 15  ? 79.729  6.958  31.623 1.00 40.38  ? 14  PRO H CB  1 
ATOM   6289 C CG  . PRO H 2 15  ? 78.776  6.865  30.487 1.00 42.63  ? 14  PRO H CG  1 
ATOM   6290 C CD  . PRO H 2 15  ? 79.167  5.567  29.872 1.00 46.85  ? 14  PRO H CD  1 
ATOM   6291 N N   . SER H 2 16  ? 82.567  6.752  32.855 1.00 63.48  ? 15  SER H N   1 
ATOM   6292 C CA  . SER H 2 16  ? 83.546  6.359  33.882 1.00 70.80  ? 15  SER H CA  1 
ATOM   6293 C C   . SER H 2 16  ? 84.911  5.968  33.275 1.00 72.16  ? 15  SER H C   1 
ATOM   6294 O O   . SER H 2 16  ? 85.968  6.309  33.813 1.00 77.30  ? 15  SER H O   1 
ATOM   6295 C CB  . SER H 2 16  ? 82.985  5.254  34.796 1.00 73.91  ? 15  SER H CB  1 
ATOM   6296 O OG  . SER H 2 16  ? 83.361  3.958  34.350 1.00 81.81  ? 15  SER H OG  1 
ATOM   6297 N N   . GLN H 2 17  ? 84.874  5.349  32.105 1.00 71.70  ? 16  GLN H N   1 
ATOM   6298 C CA  . GLN H 2 17  ? 86.063  4.908  31.401 1.00 74.11  ? 16  GLN H CA  1 
ATOM   6299 C C   . GLN H 2 17  ? 86.882  6.057  30.790 1.00 74.27  ? 16  GLN H C   1 
ATOM   6300 O O   . GLN H 2 17  ? 86.351  7.143  30.522 1.00 71.69  ? 16  GLN H O   1 
ATOM   6301 C CB  . GLN H 2 17  ? 85.636  3.935  30.316 1.00 75.68  ? 16  GLN H CB  1 
ATOM   6302 C CG  . GLN H 2 17  ? 86.756  3.361  29.510 1.00 77.77  ? 16  GLN H CG  1 
ATOM   6303 C CD  . GLN H 2 17  ? 86.208  2.544  28.393 1.00 82.14  ? 16  GLN H CD  1 
ATOM   6304 O OE1 . GLN H 2 17  ? 85.036  2.181  28.418 1.00 88.38  ? 16  GLN H OE1 1 
ATOM   6305 N NE2 . GLN H 2 17  ? 87.025  2.271  27.386 1.00 81.85  ? 16  GLN H NE2 1 
ATOM   6306 N N   . SER H 2 18  ? 88.175  5.790  30.581 1.00 72.12  ? 17  SER H N   1 
ATOM   6307 C CA  . SER H 2 18  ? 89.146  6.734  30.018 1.00 65.35  ? 17  SER H CA  1 
ATOM   6308 C C   . SER H 2 18  ? 88.959  7.000  28.523 1.00 65.80  ? 17  SER H C   1 
ATOM   6309 O O   . SER H 2 18  ? 88.231  6.277  27.837 1.00 67.88  ? 17  SER H O   1 
ATOM   6310 C CB  . SER H 2 18  ? 90.561  6.210  30.269 1.00 62.15  ? 17  SER H CB  1 
ATOM   6311 O OG  . SER H 2 18  ? 90.589  4.785  30.264 1.00 67.30  ? 17  SER H OG  1 
ATOM   6312 N N   . LEU H 2 19  ? 89.618  8.041  28.027 1.00 63.01  ? 18  LEU H N   1 
ATOM   6313 C CA  . LEU H 2 19  ? 89.552  8.406  26.622 1.00 55.60  ? 18  LEU H CA  1 
ATOM   6314 C C   . LEU H 2 19  ? 90.961  8.591  26.117 1.00 56.11  ? 18  LEU H C   1 
ATOM   6315 O O   . LEU H 2 19  ? 91.736  9.307  26.737 1.00 62.37  ? 18  LEU H O   1 
ATOM   6316 C CB  . LEU H 2 19  ? 88.800  9.715  26.446 1.00 52.56  ? 18  LEU H CB  1 
ATOM   6317 C CG  . LEU H 2 19  ? 88.862  10.221 25.006 1.00 55.64  ? 18  LEU H CG  1 
ATOM   6318 C CD1 . LEU H 2 19  ? 88.349  9.141  24.057 1.00 59.81  ? 18  LEU H CD1 1 
ATOM   6319 C CD2 . LEU H 2 19  ? 88.059  11.497 24.840 1.00 54.07  ? 18  LEU H CD2 1 
ATOM   6320 N N   . SER H 2 20  ? 91.288  7.962  24.991 1.00 58.32  ? 19  SER H N   1 
ATOM   6321 C CA  . SER H 2 20  ? 92.616  8.070  24.379 1.00 61.66  ? 19  SER H CA  1 
ATOM   6322 C C   . SER H 2 20  ? 92.414  8.416  22.900 1.00 62.38  ? 19  SER H C   1 
ATOM   6323 O O   . SER H 2 20  ? 91.722  7.689  22.187 1.00 66.87  ? 19  SER H O   1 
ATOM   6324 C CB  . SER H 2 20  ? 93.388  6.744  24.491 1.00 62.18  ? 19  SER H CB  1 
ATOM   6325 O OG  . SER H 2 20  ? 93.518  6.301  25.836 1.00 61.73  ? 19  SER H OG  1 
ATOM   6326 N N   . ILE H 2 21  ? 92.991  9.526  22.446 1.00 60.01  ? 20  ILE H N   1 
ATOM   6327 C CA  . ILE H 2 21  ? 92.854  9.941  21.048 1.00 55.58  ? 20  ILE H CA  1 
ATOM   6328 C C   . ILE H 2 21  ? 94.235  10.183 20.462 1.00 54.42  ? 20  ILE H C   1 
ATOM   6329 O O   . ILE H 2 21  ? 95.152  10.579 21.169 1.00 55.53  ? 20  ILE H O   1 
ATOM   6330 C CB  . ILE H 2 21  ? 92.048  11.243 20.904 1.00 52.97  ? 20  ILE H CB  1 
ATOM   6331 C CG1 . ILE H 2 21  ? 90.625  11.051 21.416 1.00 50.40  ? 20  ILE H CG1 1 
ATOM   6332 C CG2 . ILE H 2 21  ? 91.987  11.667 19.444 1.00 56.78  ? 20  ILE H CG2 1 
ATOM   6333 C CD1 . ILE H 2 21  ? 89.828  12.337 21.447 1.00 47.83  ? 20  ILE H CD1 1 
ATOM   6334 N N   . THR H 2 22  ? 94.383  9.965  19.168 1.00 53.57  ? 21  THR H N   1 
ATOM   6335 C CA  . THR H 2 22  ? 95.670  10.172 18.550 1.00 53.08  ? 21  THR H CA  1 
ATOM   6336 C C   . THR H 2 22  ? 95.598  10.965 17.275 1.00 57.19  ? 21  THR H C   1 
ATOM   6337 O O   . THR H 2 22  ? 94.895  10.591 16.338 1.00 61.50  ? 21  THR H O   1 
ATOM   6338 C CB  . THR H 2 22  ? 96.356  8.831  18.239 1.00 53.21  ? 21  THR H CB  1 
ATOM   6339 O OG1 . THR H 2 22  ? 96.607  8.139  19.472 1.00 53.33  ? 21  THR H OG1 1 
ATOM   6340 C CG2 . THR H 2 22  ? 97.671  9.047  17.448 1.00 41.37  ? 21  THR H CG2 1 
ATOM   6341 N N   . CYS H 2 23  ? 96.258  12.111 17.270 1.00 58.83  ? 22  CYS H N   1 
ATOM   6342 C CA  . CYS H 2 23  ? 96.329  12.907 16.060 1.00 63.11  ? 22  CYS H CA  1 
ATOM   6343 C C   . CYS H 2 23  ? 97.647  12.507 15.344 1.00 65.15  ? 22  CYS H C   1 
ATOM   6344 O O   . CYS H 2 23  ? 98.723  12.527 15.953 1.00 63.22  ? 22  CYS H O   1 
ATOM   6345 C CB  . CYS H 2 23  ? 96.310  14.391 16.407 1.00 59.93  ? 22  CYS H CB  1 
ATOM   6346 S SG  . CYS H 2 23  ? 96.574  15.478 14.975 1.00 59.14  ? 22  CYS H SG  1 
ATOM   6347 N N   . THR H 2 24  ? 97.555  12.039 14.101 1.00 65.83  ? 23  THR H N   1 
ATOM   6348 C CA  . THR H 2 24  ? 98.746  11.653 13.357 1.00 61.88  ? 23  THR H CA  1 
ATOM   6349 C C   . THR H 2 24  ? 98.889  12.661 12.243 1.00 61.05  ? 23  THR H C   1 
ATOM   6350 O O   . THR H 2 24  ? 97.978  12.834 11.437 1.00 62.68  ? 23  THR H O   1 
ATOM   6351 C CB  . THR H 2 24  ? 98.646  10.224 12.796 1.00 61.45  ? 23  THR H CB  1 
ATOM   6352 O OG1 . THR H 2 24  ? 98.431  9.309  13.876 1.00 62.89  ? 23  THR H OG1 1 
ATOM   6353 C CG2 . THR H 2 24  ? 99.944  9.843  12.114 1.00 57.59  ? 23  THR H CG2 1 
ATOM   6354 N N   . VAL H 2 25  ? 100.014 13.366 12.240 1.00 62.70  ? 24  VAL H N   1 
ATOM   6355 C CA  . VAL H 2 25  ? 100.279 14.409 11.252 1.00 66.01  ? 24  VAL H CA  1 
ATOM   6356 C C   . VAL H 2 25  ? 101.112 13.902 10.075 1.00 69.44  ? 24  VAL H C   1 
ATOM   6357 O O   . VAL H 2 25  ? 101.984 13.041 10.230 1.00 66.86  ? 24  VAL H O   1 
ATOM   6358 C CB  . VAL H 2 25  ? 100.983 15.627 11.912 1.00 64.86  ? 24  VAL H CB  1 
ATOM   6359 C CG1 . VAL H 2 25  ? 101.422 16.624 10.874 1.00 62.70  ? 24  VAL H CG1 1 
ATOM   6360 C CG2 . VAL H 2 25  ? 100.052 16.296 12.910 1.00 60.61  ? 24  VAL H CG2 1 
ATOM   6361 N N   . SER H 2 26  ? 100.838 14.447 8.897  1.00 72.12  ? 25  SER H N   1 
ATOM   6362 C CA  . SER H 2 26  ? 101.555 14.058 7.691  1.00 72.07  ? 25  SER H CA  1 
ATOM   6363 C C   . SER H 2 26  ? 101.811 15.303 6.867  1.00 69.93  ? 25  SER H C   1 
ATOM   6364 O O   . SER H 2 26  ? 100.884 16.068 6.594  1.00 66.55  ? 25  SER H O   1 
ATOM   6365 C CB  . SER H 2 26  ? 100.709 13.082 6.877  1.00 74.91  ? 25  SER H CB  1 
ATOM   6366 O OG  . SER H 2 26  ? 99.454  13.670 6.573  1.00 76.89  ? 25  SER H OG  1 
ATOM   6367 N N   . GLY H 2 27  ? 103.076 15.547 6.550  1.00 68.63  ? 26  GLY H N   1 
ATOM   6368 C CA  . GLY H 2 27  ? 103.404 16.691 5.729  1.00 69.43  ? 26  GLY H CA  1 
ATOM   6369 C C   . GLY H 2 27  ? 103.861 17.967 6.395  1.00 70.04  ? 26  GLY H C   1 
ATOM   6370 O O   . GLY H 2 27  ? 104.019 18.964 5.701  1.00 70.28  ? 26  GLY H O   1 
ATOM   6371 N N   . ILE H 2 28  ? 104.027 17.970 7.715  1.00 69.94  ? 27  ILE H N   1 
ATOM   6372 C CA  . ILE H 2 28  ? 104.505 19.158 8.443  1.00 70.12  ? 27  ILE H CA  1 
ATOM   6373 C C   . ILE H 2 28  ? 105.198 18.650 9.695  1.00 69.82  ? 27  ILE H C   1 
ATOM   6374 O O   . ILE H 2 28  ? 104.875 17.555 10.163 1.00 72.18  ? 27  ILE H O   1 
ATOM   6375 C CB  . ILE H 2 28  ? 103.359 20.181 8.860  1.00 69.31  ? 27  ILE H CB  1 
ATOM   6376 C CG1 . ILE H 2 28  ? 102.274 19.505 9.696  1.00 67.32  ? 27  ILE H CG1 1 
ATOM   6377 C CG2 . ILE H 2 28  ? 102.741 20.865 7.644  1.00 66.07  ? 27  ILE H CG2 1 
ATOM   6378 C CD1 . ILE H 2 28  ? 101.178 20.445 10.143 1.00 59.52  ? 27  ILE H CD1 1 
ATOM   6379 N N   . SER H 2 29  ? 106.174 19.401 10.213 1.00 71.47  ? 28  SER H N   1 
ATOM   6380 C CA  . SER H 2 29  ? 106.870 18.967 11.424 1.00 73.52  ? 28  SER H CA  1 
ATOM   6381 C C   . SER H 2 29  ? 106.307 19.622 12.674 1.00 75.43  ? 28  SER H C   1 
ATOM   6382 O O   . SER H 2 29  ? 106.061 20.832 12.694 1.00 75.23  ? 28  SER H O   1 
ATOM   6383 C CB  . SER H 2 29  ? 108.377 19.216 11.341 1.00 74.83  ? 28  SER H CB  1 
ATOM   6384 O OG  . SER H 2 29  ? 109.054 18.443 12.330 1.00 72.21  ? 28  SER H OG  1 
ATOM   6385 N N   . LEU H 2 30  ? 106.111 18.804 13.711 1.00 79.37  ? 29  LEU H N   1 
ATOM   6386 C CA  . LEU H 2 30  ? 105.569 19.241 15.006 1.00 79.86  ? 29  LEU H CA  1 
ATOM   6387 C C   . LEU H 2 30  ? 106.515 20.196 15.695 1.00 79.11  ? 29  LEU H C   1 
ATOM   6388 O O   . LEU H 2 30  ? 106.084 21.175 16.302 1.00 77.54  ? 29  LEU H O   1 
ATOM   6389 C CB  . LEU H 2 30  ? 105.319 18.037 15.921 1.00 78.02  ? 29  LEU H CB  1 
ATOM   6390 C CG  . LEU H 2 30  ? 104.196 17.101 15.469 1.00 75.22  ? 29  LEU H CG  1 
ATOM   6391 C CD1 . LEU H 2 30  ? 104.038 15.964 16.468 1.00 70.66  ? 29  LEU H CD1 1 
ATOM   6392 C CD2 . LEU H 2 30  ? 102.902 17.897 15.317 1.00 72.53  ? 29  LEU H CD2 1 
ATOM   6393 N N   . SER H 2 31  ? 107.808 19.897 15.566 1.00 81.53  ? 30  SER H N   1 
ATOM   6394 C CA  . SER H 2 31  ? 108.894 20.692 16.134 1.00 75.95  ? 30  SER H CA  1 
ATOM   6395 C C   . SER H 2 31  ? 108.609 22.157 15.797 1.00 70.93  ? 30  SER H C   1 
ATOM   6396 O O   . SER H 2 31  ? 108.640 23.039 16.659 1.00 66.16  ? 30  SER H O   1 
ATOM   6397 C CB  . SER H 2 31  ? 110.239 20.268 15.495 1.00 73.63  ? 30  SER H CB  1 
ATOM   6398 O OG  . SER H 2 31  ? 110.263 18.903 15.070 1.00 68.54  ? 30  SER H OG  1 
ATOM   6399 N N   . ARG H 2 32  ? 108.206 22.362 14.551 1.00 69.33  ? 31  ARG H N   1 
ATOM   6400 C CA  . ARG H 2 32  ? 107.917 23.668 14.007 1.00 73.01  ? 31  ARG H CA  1 
ATOM   6401 C C   . ARG H 2 32  ? 106.492 24.172 14.253 1.00 73.81  ? 31  ARG H C   1 
ATOM   6402 O O   . ARG H 2 32  ? 106.298 25.366 14.452 1.00 79.38  ? 31  ARG H O   1 
ATOM   6403 C CB  . ARG H 2 32  ? 108.245 23.657 12.502 1.00 80.49  ? 31  ARG H CB  1 
ATOM   6404 C CG  . ARG H 2 32  ? 108.317 25.028 11.826 1.00 89.24  ? 31  ARG H CG  1 
ATOM   6405 C CD  . ARG H 2 32  ? 109.013 24.931 10.480 1.00 89.93  ? 31  ARG H CD  1 
ATOM   6406 N NE  . ARG H 2 32  ? 110.405 24.507 10.634 1.00 97.28  ? 31  ARG H NE  1 
ATOM   6407 C CZ  . ARG H 2 32  ? 111.336 24.609 9.685  1.00 100.00 ? 31  ARG H CZ  1 
ATOM   6408 N NH1 . ARG H 2 32  ? 111.034 25.126 8.501  1.00 100.00 ? 31  ARG H NH1 1 
ATOM   6409 N NH2 . ARG H 2 32  ? 112.575 24.181 9.913  1.00 100.00 ? 31  ARG H NH2 1 
ATOM   6410 N N   . TYR H 2 33  ? 105.503 23.279 14.267 1.00 73.63  ? 32  TYR H N   1 
ATOM   6411 C CA  . TYR H 2 33  ? 104.097 23.672 14.457 1.00 68.12  ? 32  TYR H CA  1 
ATOM   6412 C C   . TYR H 2 33  ? 103.482 23.556 15.874 1.00 67.95  ? 32  TYR H C   1 
ATOM   6413 O O   . TYR H 2 33  ? 104.006 22.856 16.751 1.00 62.61  ? 32  TYR H O   1 
ATOM   6414 C CB  . TYR H 2 33  ? 103.215 22.913 13.464 1.00 69.99  ? 32  TYR H CB  1 
ATOM   6415 C CG  . TYR H 2 33  ? 103.151 23.476 12.060 1.00 73.45  ? 32  TYR H CG  1 
ATOM   6416 C CD1 . TYR H 2 33  ? 104.270 23.490 11.218 1.00 74.12  ? 32  TYR H CD1 1 
ATOM   6417 C CD2 . TYR H 2 33  ? 101.948 23.963 11.561 1.00 77.10  ? 32  TYR H CD2 1 
ATOM   6418 C CE1 . TYR H 2 33  ? 104.177 23.975 9.898  1.00 79.50  ? 32  TYR H CE1 1 
ATOM   6419 C CE2 . TYR H 2 33  ? 101.838 24.445 10.256 1.00 82.09  ? 32  TYR H CE2 1 
ATOM   6420 C CZ  . TYR H 2 33  ? 102.947 24.456 9.423  1.00 84.69  ? 32  TYR H CZ  1 
ATOM   6421 O OH  . TYR H 2 33  ? 102.789 24.943 8.128  1.00 85.19  ? 32  TYR H OH  1 
ATOM   6422 N N   . ASN H 2 34  ? 102.347 24.237 16.070 1.00 68.06  ? 33  ASN H N   1 
ATOM   6423 C CA  . ASN H 2 34  ? 101.600 24.233 17.342 1.00 68.98  ? 33  ASN H CA  1 
ATOM   6424 C C   . ASN H 2 34  ? 100.231 23.539 17.168 1.00 67.76  ? 33  ASN H C   1 
ATOM   6425 O O   . ASN H 2 34  ? 99.430  23.940 16.321 1.00 63.82  ? 33  ASN H O   1 
ATOM   6426 C CB  . ASN H 2 34  ? 101.412 25.660 17.838 1.00 66.74  ? 33  ASN H CB  1 
ATOM   6427 C CG  . ASN H 2 34  ? 102.729 26.344 18.116 1.00 68.90  ? 33  ASN H CG  1 
ATOM   6428 O OD1 . ASN H 2 34  ? 103.746 25.687 18.347 1.00 64.14  ? 33  ASN H OD1 1 
ATOM   6429 N ND2 . ASN H 2 34  ? 102.723 27.666 18.090 1.00 70.20  ? 33  ASN H ND2 1 
ATOM   6430 N N   . VAL H 2 35  ? 99.965  22.528 17.999 1.00 67.31  ? 34  VAL H N   1 
ATOM   6431 C CA  . VAL H 2 35  ? 98.745  21.721 17.908 1.00 59.03  ? 34  VAL H CA  1 
ATOM   6432 C C   . VAL H 2 35  ? 97.776  21.904 19.054 1.00 55.73  ? 34  VAL H C   1 
ATOM   6433 O O   . VAL H 2 35  ? 98.158  21.808 20.220 1.00 55.00  ? 34  VAL H O   1 
ATOM   6434 C CB  . VAL H 2 35  ? 99.093  20.220 17.831 1.00 59.70  ? 34  VAL H CB  1 
ATOM   6435 C CG1 . VAL H 2 35  ? 97.831  19.382 17.644 1.00 63.08  ? 34  VAL H CG1 1 
ATOM   6436 C CG2 . VAL H 2 35  ? 100.075 19.973 16.701 1.00 60.21  ? 34  VAL H CG2 1 
ATOM   6437 N N   . HIS H 2 36  ? 96.516  22.136 18.704 1.00 52.94  ? 35  HIS H N   1 
ATOM   6438 C CA  . HIS H 2 36  ? 95.436  22.341 19.668 1.00 55.53  ? 35  HIS H CA  1 
ATOM   6439 C C   . HIS H 2 36  ? 94.477  21.151 19.658 1.00 56.70  ? 35  HIS H C   1 
ATOM   6440 O O   . HIS H 2 36  ? 94.438  20.376 18.697 1.00 60.46  ? 35  HIS H O   1 
ATOM   6441 C CB  . HIS H 2 36  ? 94.627  23.598 19.308 1.00 55.42  ? 35  HIS H CB  1 
ATOM   6442 C CG  . HIS H 2 36  ? 95.403  24.873 19.369 1.00 55.36  ? 35  HIS H CG  1 
ATOM   6443 N ND1 . HIS H 2 36  ? 94.793  26.067 19.642 1.00 53.31  ? 35  HIS H ND1 1 
ATOM   6444 C CD2 . HIS H 2 36  ? 96.725  25.094 19.140 1.00 53.73  ? 35  HIS H CD2 1 
ATOM   6445 C CE1 . HIS H 2 36  ? 95.741  26.979 19.577 1.00 54.81  ? 35  HIS H CE1 1 
ATOM   6446 N NE2 . HIS H 2 36  ? 96.927  26.438 19.276 1.00 50.34  ? 35  HIS H NE2 1 
ATOM   6447 N N   . TRP H 2 37  ? 93.716  21.000 20.736 1.00 51.94  ? 36  TRP H N   1 
ATOM   6448 C CA  . TRP H 2 37  ? 92.736  19.939 20.834 1.00 42.42  ? 36  TRP H CA  1 
ATOM   6449 C C   . TRP H 2 37  ? 91.450  20.684 21.057 1.00 41.68  ? 36  TRP H C   1 
ATOM   6450 O O   . TRP H 2 37  ? 91.321  21.480 21.978 1.00 37.77  ? 36  TRP H O   1 
ATOM   6451 C CB  . TRP H 2 37  ? 93.040  18.983 21.982 1.00 39.90  ? 36  TRP H CB  1 
ATOM   6452 C CG  . TRP H 2 37  ? 94.057  17.904 21.634 1.00 39.77  ? 36  TRP H CG  1 
ATOM   6453 C CD1 . TRP H 2 37  ? 95.276  17.706 22.222 1.00 45.68  ? 36  TRP H CD1 1 
ATOM   6454 C CD2 . TRP H 2 37  ? 93.920  16.858 20.656 1.00 42.07  ? 36  TRP H CD2 1 
ATOM   6455 N NE1 . TRP H 2 37  ? 95.904  16.605 21.682 1.00 43.41  ? 36  TRP H NE1 1 
ATOM   6456 C CE2 . TRP H 2 37  ? 95.096  16.065 20.720 1.00 41.34  ? 36  TRP H CE2 1 
ATOM   6457 C CE3 . TRP H 2 37  ? 92.916  16.509 19.744 1.00 42.50  ? 36  TRP H CE3 1 
ATOM   6458 C CZ2 . TRP H 2 37  ? 95.297  14.947 19.909 1.00 41.07  ? 36  TRP H CZ2 1 
ATOM   6459 C CZ3 . TRP H 2 37  ? 93.117  15.396 18.933 1.00 45.11  ? 36  TRP H CZ3 1 
ATOM   6460 C CH2 . TRP H 2 37  ? 94.302  14.625 19.025 1.00 43.56  ? 36  TRP H CH2 1 
ATOM   6461 N N   . VAL H 2 38  ? 90.575  20.566 20.081 1.00 47.04  ? 37  VAL H N   1 
ATOM   6462 C CA  . VAL H 2 38  ? 89.282  21.221 20.113 1.00 48.09  ? 37  VAL H CA  1 
ATOM   6463 C C   . VAL H 2 38  ? 88.241  20.112 19.987 1.00 49.09  ? 37  VAL H C   1 
ATOM   6464 O O   . VAL H 2 38  ? 88.572  18.986 19.596 1.00 46.21  ? 37  VAL H O   1 
ATOM   6465 C CB  . VAL H 2 38  ? 89.158  22.191 18.904 1.00 48.16  ? 37  VAL H CB  1 
ATOM   6466 C CG1 . VAL H 2 38  ? 87.727  22.711 18.738 1.00 51.74  ? 37  VAL H CG1 1 
ATOM   6467 C CG2 . VAL H 2 38  ? 90.131  23.350 19.072 1.00 48.87  ? 37  VAL H CG2 1 
ATOM   6468 N N   . ARG H 2 39  ? 87.015  20.400 20.403 1.00 45.60  ? 38  ARG H N   1 
ATOM   6469 C CA  . ARG H 2 39  ? 85.937  19.437 20.270 1.00 46.55  ? 38  ARG H CA  1 
ATOM   6470 C C   . ARG H 2 39  ? 84.709  20.281 19.991 1.00 45.93  ? 38  ARG H C   1 
ATOM   6471 O O   . ARG H 2 39  ? 84.654  21.449 20.397 1.00 45.53  ? 38  ARG H O   1 
ATOM   6472 C CB  . ARG H 2 39  ? 85.769  18.578 21.534 1.00 43.89  ? 38  ARG H CB  1 
ATOM   6473 C CG  . ARG H 2 39  ? 84.815  19.122 22.575 1.00 39.11  ? 38  ARG H CG  1 
ATOM   6474 C CD  . ARG H 2 39  ? 84.912  18.310 23.845 1.00 34.99  ? 38  ARG H CD  1 
ATOM   6475 N NE  . ARG H 2 39  ? 84.262  18.986 24.964 1.00 38.78  ? 38  ARG H NE  1 
ATOM   6476 C CZ  . ARG H 2 39  ? 84.151  18.491 26.194 1.00 40.62  ? 38  ARG H CZ  1 
ATOM   6477 N NH1 . ARG H 2 39  ? 84.636  17.286 26.500 1.00 48.04  ? 38  ARG H NH1 1 
ATOM   6478 N NH2 . ARG H 2 39  ? 83.591  19.226 27.138 1.00 34.65  ? 38  ARG H NH2 1 
ATOM   6479 N N   . GLN H 2 40  ? 83.767  19.713 19.250 1.00 42.58  ? 39  GLN H N   1 
ATOM   6480 C CA  . GLN H 2 40  ? 82.559  20.424 18.881 1.00 39.61  ? 39  GLN H CA  1 
ATOM   6481 C C   . GLN H 2 40  ? 81.288  19.577 19.034 1.00 43.32  ? 39  GLN H C   1 
ATOM   6482 O O   . GLN H 2 40  ? 81.319  18.347 18.988 1.00 41.59  ? 39  GLN H O   1 
ATOM   6483 C CB  . GLN H 2 40  ? 82.698  20.895 17.440 1.00 37.54  ? 39  GLN H CB  1 
ATOM   6484 C CG  . GLN H 2 40  ? 81.671  21.922 17.011 1.00 38.78  ? 39  GLN H CG  1 
ATOM   6485 C CD  . GLN H 2 40  ? 81.814  22.285 15.558 1.00 39.52  ? 39  GLN H CD  1 
ATOM   6486 O OE1 . GLN H 2 40  ? 82.531  21.608 14.802 1.00 37.95  ? 39  GLN H OE1 1 
ATOM   6487 N NE2 . GLN H 2 40  ? 81.132  23.337 15.147 1.00 33.51  ? 39  GLN H NE2 1 
ATOM   6488 N N   . SER H 2 41  ? 80.160  20.250 19.194 1.00 45.41  ? 40  SER H N   1 
ATOM   6489 C CA  . SER H 2 41  ? 78.881  19.584 19.354 1.00 42.52  ? 40  SER H CA  1 
ATOM   6490 C C   . SER H 2 41  ? 77.831  20.663 19.221 1.00 40.73  ? 40  SER H C   1 
ATOM   6491 O O   . SER H 2 41  ? 78.134  21.849 19.356 1.00 41.76  ? 40  SER H O   1 
ATOM   6492 C CB  . SER H 2 41  ? 78.795  18.873 20.718 1.00 39.42  ? 40  SER H CB  1 
ATOM   6493 O OG  . SER H 2 41  ? 79.127  19.724 21.802 1.00 42.72  ? 40  SER H OG  1 
ATOM   6494 N N   . PRO H 2 42  ? 76.592  20.281 18.907 1.00 38.96  ? 41  PRO H N   1 
ATOM   6495 C CA  . PRO H 2 42  ? 75.548  21.284 18.760 1.00 39.05  ? 41  PRO H CA  1 
ATOM   6496 C C   . PRO H 2 42  ? 75.195  21.858 20.105 1.00 41.69  ? 41  PRO H C   1 
ATOM   6497 O O   . PRO H 2 42  ? 74.632  22.946 20.187 1.00 45.67  ? 41  PRO H O   1 
ATOM   6498 C CB  . PRO H 2 42  ? 74.364  20.473 18.243 1.00 38.92  ? 41  PRO H CB  1 
ATOM   6499 C CG  . PRO H 2 42  ? 74.967  19.227 17.713 1.00 42.24  ? 41  PRO H CG  1 
ATOM   6500 C CD  . PRO H 2 42  ? 76.041  18.937 18.698 1.00 40.49  ? 41  PRO H CD  1 
ATOM   6501 N N   . GLY H 2 43  ? 75.455  21.076 21.147 1.00 43.74  ? 42  GLY H N   1 
ATOM   6502 C CA  . GLY H 2 43  ? 75.119  21.477 22.497 1.00 47.16  ? 42  GLY H CA  1 
ATOM   6503 C C   . GLY H 2 43  ? 76.114  22.345 23.235 1.00 51.71  ? 42  GLY H C   1 
ATOM   6504 O O   . GLY H 2 43  ? 75.753  23.358 23.822 1.00 55.56  ? 42  GLY H O   1 
ATOM   6505 N N   . LYS H 2 44  ? 77.371  21.951 23.249 1.00 51.26  ? 43  LYS H N   1 
ATOM   6506 C CA  . LYS H 2 44  ? 78.360  22.735 23.960 1.00 51.11  ? 43  LYS H CA  1 
ATOM   6507 C C   . LYS H 2 44  ? 79.113  23.730 23.054 1.00 55.23  ? 43  LYS H C   1 
ATOM   6508 O O   . LYS H 2 44  ? 79.815  24.619 23.555 1.00 59.26  ? 43  LYS H O   1 
ATOM   6509 C CB  . LYS H 2 44  ? 79.303  21.771 24.657 1.00 47.61  ? 43  LYS H CB  1 
ATOM   6510 C CG  . LYS H 2 44  ? 78.553  20.759 25.514 1.00 46.79  ? 43  LYS H CG  1 
ATOM   6511 C CD  . LYS H 2 44  ? 79.456  19.642 26.020 1.00 47.46  ? 43  LYS H CD  1 
ATOM   6512 C CE  . LYS H 2 44  ? 79.704  18.606 24.945 1.00 45.59  ? 43  LYS H CE  1 
ATOM   6513 N NZ  . LYS H 2 44  ? 80.887  17.813 25.335 1.00 47.22  ? 43  LYS H NZ  1 
ATOM   6514 N N   . GLY H 2 45  ? 78.871  23.642 21.740 1.00 53.98  ? 44  GLY H N   1 
ATOM   6515 C CA  . GLY H 2 45  ? 79.548  24.487 20.771 1.00 43.89  ? 44  GLY H CA  1 
ATOM   6516 C C   . GLY H 2 45  ? 81.009  24.064 20.609 1.00 45.48  ? 44  GLY H C   1 
ATOM   6517 O O   . GLY H 2 45  ? 81.379  22.896 20.840 1.00 42.78  ? 44  GLY H O   1 
ATOM   6518 N N   . LEU H 2 46  ? 81.841  25.009 20.173 1.00 43.29  ? 45  LEU H N   1 
ATOM   6519 C CA  . LEU H 2 46  ? 83.265  24.756 20.000 1.00 36.67  ? 45  LEU H CA  1 
ATOM   6520 C C   . LEU H 2 46  ? 83.928  24.982 21.353 1.00 36.59  ? 45  LEU H C   1 
ATOM   6521 O O   . LEU H 2 46  ? 83.589  25.919 22.067 1.00 35.21  ? 45  LEU H O   1 
ATOM   6522 C CB  . LEU H 2 46  ? 83.827  25.668 18.922 1.00 36.56  ? 45  LEU H CB  1 
ATOM   6523 C CG  . LEU H 2 46  ? 83.698  25.109 17.493 1.00 37.95  ? 45  LEU H CG  1 
ATOM   6524 C CD1 . LEU H 2 46  ? 83.550  26.210 16.430 1.00 30.29  ? 45  LEU H CD1 1 
ATOM   6525 C CD2 . LEU H 2 46  ? 84.912  24.216 17.221 1.00 32.70  ? 45  LEU H CD2 1 
ATOM   6526 N N   . GLU H 2 47  ? 84.812  24.074 21.742 1.00 41.12  ? 46  GLU H N   1 
ATOM   6527 C CA  . GLU H 2 47  ? 85.461  24.167 23.034 1.00 41.05  ? 46  GLU H CA  1 
ATOM   6528 C C   . GLU H 2 47  ? 86.908  23.872 22.844 1.00 43.37  ? 46  GLU H C   1 
ATOM   6529 O O   . GLU H 2 47  ? 87.242  22.852 22.234 1.00 46.47  ? 46  GLU H O   1 
ATOM   6530 C CB  . GLU H 2 47  ? 84.879  23.133 24.011 1.00 45.00  ? 46  GLU H CB  1 
ATOM   6531 C CG  . GLU H 2 47  ? 83.480  23.470 24.563 1.00 56.63  ? 46  GLU H CG  1 
ATOM   6532 C CD  . GLU H 2 47  ? 82.778  22.276 25.210 1.00 57.47  ? 46  GLU H CD  1 
ATOM   6533 O OE1 . GLU H 2 47  ? 82.379  21.348 24.463 1.00 62.95  ? 46  GLU H OE1 1 
ATOM   6534 O OE2 . GLU H 2 47  ? 82.613  22.275 26.450 1.00 54.94  ? 46  GLU H OE2 1 
ATOM   6535 N N   . TRP H 2 48  ? 87.755  24.790 23.312 1.00 43.65  ? 47  TRP H N   1 
ATOM   6536 C CA  . TRP H 2 48  ? 89.209  24.646 23.237 1.00 45.31  ? 47  TRP H CA  1 
ATOM   6537 C C   . TRP H 2 48  ? 89.593  23.749 24.415 1.00 45.11  ? 47  TRP H C   1 
ATOM   6538 O O   . TRP H 2 48  ? 89.160  23.989 25.549 1.00 45.15  ? 47  TRP H O   1 
ATOM   6539 C CB  . TRP H 2 48  ? 89.885  26.027 23.358 1.00 51.63  ? 47  TRP H CB  1 
ATOM   6540 C CG  . TRP H 2 48  ? 91.395  26.022 23.172 1.00 56.56  ? 47  TRP H CG  1 
ATOM   6541 C CD1 . TRP H 2 48  ? 92.078  25.919 21.987 1.00 56.09  ? 47  TRP H CD1 1 
ATOM   6542 C CD2 . TRP H 2 48  ? 92.395  26.107 24.201 1.00 58.73  ? 47  TRP H CD2 1 
ATOM   6543 N NE1 . TRP H 2 48  ? 93.434  25.920 22.221 1.00 53.98  ? 47  TRP H NE1 1 
ATOM   6544 C CE2 . TRP H 2 48  ? 93.656  26.028 23.569 1.00 57.92  ? 47  TRP H CE2 1 
ATOM   6545 C CE3 . TRP H 2 48  ? 92.345  26.219 25.600 1.00 54.99  ? 47  TRP H CE3 1 
ATOM   6546 C CZ2 . TRP H 2 48  ? 94.860  26.072 24.284 1.00 60.25  ? 47  TRP H CZ2 1 
ATOM   6547 C CZ3 . TRP H 2 48  ? 93.535  26.257 26.311 1.00 56.07  ? 47  TRP H CZ3 1 
ATOM   6548 C CH2 . TRP H 2 48  ? 94.781  26.176 25.650 1.00 60.73  ? 47  TRP H CH2 1 
ATOM   6549 N N   . LEU H 2 49  ? 90.380  22.713 24.159 1.00 41.18  ? 48  LEU H N   1 
ATOM   6550 C CA  . LEU H 2 49  ? 90.773  21.799 25.223 1.00 46.34  ? 48  LEU H CA  1 
ATOM   6551 C C   . LEU H 2 49  ? 92.132  22.071 25.835 1.00 48.91  ? 48  LEU H C   1 
ATOM   6552 O O   . LEU H 2 49  ? 92.314  21.929 27.043 1.00 50.95  ? 48  LEU H O   1 
ATOM   6553 C CB  . LEU H 2 49  ? 90.751  20.350 24.732 1.00 44.04  ? 48  LEU H CB  1 
ATOM   6554 C CG  . LEU H 2 49  ? 89.424  19.771 24.258 1.00 44.43  ? 48  LEU H CG  1 
ATOM   6555 C CD1 . LEU H 2 49  ? 89.681  18.350 23.794 1.00 39.41  ? 48  LEU H CD1 1 
ATOM   6556 C CD2 . LEU H 2 49  ? 88.396  19.818 25.374 1.00 44.36  ? 48  LEU H CD2 1 
ATOM   6557 N N   . GLY H 2 50  ? 93.100  22.381 24.984 1.00 49.37  ? 49  GLY H N   1 
ATOM   6558 C CA  . GLY H 2 50  ? 94.450  22.639 25.441 1.00 51.55  ? 49  GLY H CA  1 
ATOM   6559 C C   . GLY H 2 50  ? 95.308  22.682 24.197 1.00 54.51  ? 49  GLY H C   1 
ATOM   6560 O O   . GLY H 2 50  ? 94.764  22.618 23.094 1.00 55.03  ? 49  GLY H O   1 
ATOM   6561 N N   . MET H 2 51  ? 96.628  22.737 24.350 1.00 58.50  ? 50  MET H N   1 
ATOM   6562 C CA  . MET H 2 51  ? 97.529  22.808 23.191 1.00 58.11  ? 50  MET H CA  1 
ATOM   6563 C C   . MET H 2 51  ? 98.973  22.415 23.529 1.00 57.15  ? 50  MET H C   1 
ATOM   6564 O O   . MET H 2 51  ? 99.351  22.355 24.696 1.00 59.44  ? 50  MET H O   1 
ATOM   6565 C CB  . MET H 2 51  ? 97.528  24.237 22.611 1.00 58.53  ? 50  MET H CB  1 
ATOM   6566 C CG  . MET H 2 51  ? 98.318  25.269 23.447 1.00 56.88  ? 50  MET H CG  1 
ATOM   6567 S SD  . MET H 2 51  ? 98.260  26.966 22.838 1.00 47.85  ? 50  MET H SD  1 
ATOM   6568 C CE  . MET H 2 51  ? 99.093  26.762 21.294 1.00 50.52  ? 50  MET H CE  1 
ATOM   6569 N N   . ILE H 2 52  ? 99.771  22.168 22.499 1.00 57.12  ? 51  ILE H N   1 
ATOM   6570 C CA  . ILE H 2 52  ? 101.173 21.813 22.676 1.00 59.05  ? 51  ILE H CA  1 
ATOM   6571 C C   . ILE H 2 52  ? 102.038 22.544 21.606 1.00 63.59  ? 51  ILE H C   1 
ATOM   6572 O O   . ILE H 2 52  ? 101.946 22.272 20.397 1.00 65.07  ? 51  ILE H O   1 
ATOM   6573 C CB  . ILE H 2 52  ? 101.361 20.259 22.676 1.00 54.55  ? 51  ILE H CB  1 
ATOM   6574 C CG1 . ILE H 2 52  ? 102.720 19.894 23.278 1.00 47.63  ? 51  ILE H CG1 1 
ATOM   6575 C CG2 . ILE H 2 52  ? 101.188 19.672 21.258 1.00 58.56  ? 51  ILE H CG2 1 
ATOM   6576 C CD1 . ILE H 2 52  ? 102.951 18.422 23.460 1.00 36.30  ? 51  ILE H CD1 1 
ATOM   6577 N N   . TRP H 2 53  ? 102.805 23.542 22.057 1.00 64.65  ? 52  TRP H N   1 
ATOM   6578 C CA  . TRP H 2 53  ? 103.653 24.348 21.171 1.00 59.49  ? 52  TRP H CA  1 
ATOM   6579 C C   . TRP H 2 53  ? 104.727 23.477 20.577 1.00 59.40  ? 52  TRP H C   1 
ATOM   6580 O O   . TRP H 2 53  ? 105.082 22.463 21.177 1.00 61.65  ? 52  TRP H O   1 
ATOM   6581 C CB  . TRP H 2 53  ? 104.299 25.500 21.942 1.00 52.82  ? 52  TRP H CB  1 
ATOM   6582 C CG  . TRP H 2 53  ? 103.315 26.351 22.708 1.00 46.73  ? 52  TRP H CG  1 
ATOM   6583 C CD1 . TRP H 2 53  ? 102.761 26.065 23.933 1.00 48.03  ? 52  TRP H CD1 1 
ATOM   6584 C CD2 . TRP H 2 53  ? 102.769 27.619 22.310 1.00 41.57  ? 52  TRP H CD2 1 
ATOM   6585 N NE1 . TRP H 2 53  ? 101.908 27.071 24.318 1.00 46.50  ? 52  TRP H NE1 1 
ATOM   6586 C CE2 . TRP H 2 53  ? 101.891 28.039 23.341 1.00 47.16  ? 52  TRP H CE2 1 
ATOM   6587 C CE3 . TRP H 2 53  ? 102.928 28.437 21.187 1.00 39.04  ? 52  TRP H CE3 1 
ATOM   6588 C CZ2 . TRP H 2 53  ? 101.172 29.253 23.275 1.00 43.55  ? 52  TRP H CZ2 1 
ATOM   6589 C CZ3 . TRP H 2 53  ? 102.216 29.638 21.120 1.00 43.90  ? 52  TRP H CZ3 1 
ATOM   6590 C CH2 . TRP H 2 53  ? 101.349 30.032 22.162 1.00 41.61  ? 52  TRP H CH2 1 
ATOM   6591 N N   . GLY H 2 54  ? 105.283 23.899 19.446 1.00 59.77  ? 53  GLY H N   1 
ATOM   6592 C CA  . GLY H 2 54  ? 106.327 23.128 18.787 1.00 65.04  ? 53  GLY H CA  1 
ATOM   6593 C C   . GLY H 2 54  ? 107.455 22.763 19.739 1.00 67.54  ? 53  GLY H C   1 
ATOM   6594 O O   . GLY H 2 54  ? 107.974 21.639 19.722 1.00 59.05  ? 53  GLY H O   1 
ATOM   6595 N N   . GLY H 2 55  ? 107.799 23.712 20.610 1.00 69.50  ? 54  GLY H N   1 
ATOM   6596 C CA  . GLY H 2 55  ? 108.841 23.489 21.593 1.00 68.76  ? 54  GLY H CA  1 
ATOM   6597 C C   . GLY H 2 55  ? 108.357 22.740 22.827 1.00 69.09  ? 54  GLY H C   1 
ATOM   6598 O O   . GLY H 2 55  ? 108.932 22.881 23.915 1.00 65.24  ? 54  GLY H O   1 
ATOM   6599 N N   . GLY H 2 56  ? 107.250 22.012 22.670 1.00 70.94  ? 55  GLY H N   1 
ATOM   6600 C CA  . GLY H 2 56  ? 106.676 21.207 23.741 1.00 72.81  ? 55  GLY H CA  1 
ATOM   6601 C C   . GLY H 2 56  ? 106.102 21.850 24.991 1.00 71.05  ? 55  GLY H C   1 
ATOM   6602 O O   . GLY H 2 56  ? 106.081 21.225 26.058 1.00 70.61  ? 55  GLY H O   1 
ATOM   6603 N N   . SER H 2 57  ? 105.640 23.088 24.885 1.00 72.55  ? 56  SER H N   1 
ATOM   6604 C CA  . SER H 2 57  ? 105.054 23.764 26.042 1.00 72.29  ? 56  SER H CA  1 
ATOM   6605 C C   . SER H 2 57  ? 103.590 23.319 26.039 1.00 67.80  ? 56  SER H C   1 
ATOM   6606 O O   . SER H 2 57  ? 102.968 23.280 24.974 1.00 64.76  ? 56  SER H O   1 
ATOM   6607 C CB  . SER H 2 57  ? 105.196 25.295 25.895 1.00 75.27  ? 56  SER H CB  1 
ATOM   6608 O OG  . SER H 2 57  ? 104.688 25.988 27.029 1.00 75.73  ? 56  SER H OG  1 
ATOM   6609 N N   . ILE H 2 58  ? 103.038 23.011 27.214 1.00 63.71  ? 57  ILE H N   1 
ATOM   6610 C CA  . ILE H 2 58  ? 101.665 22.520 27.309 1.00 56.41  ? 57  ILE H CA  1 
ATOM   6611 C C   . ILE H 2 58  ? 100.674 23.326 28.135 1.00 54.04  ? 57  ILE H C   1 
ATOM   6612 O O   . ILE H 2 58  ? 100.902 23.587 29.304 1.00 52.58  ? 57  ILE H O   1 
ATOM   6613 C CB  . ILE H 2 58  ? 101.634 21.084 27.847 1.00 56.33  ? 57  ILE H CB  1 
ATOM   6614 C CG1 . ILE H 2 58  ? 102.750 20.259 27.228 1.00 52.34  ? 57  ILE H CG1 1 
ATOM   6615 C CG2 . ILE H 2 58  ? 100.295 20.431 27.491 1.00 62.66  ? 57  ILE H CG2 1 
ATOM   6616 C CD1 . ILE H 2 58  ? 102.690 18.808 27.587 1.00 53.58  ? 57  ILE H CD1 1 
ATOM   6617 N N   . GLU H 2 59  ? 99.546  23.681 27.528 1.00 54.95  ? 58  GLU H N   1 
ATOM   6618 C CA  . GLU H 2 59  ? 98.501  24.431 28.224 1.00 54.43  ? 58  GLU H CA  1 
ATOM   6619 C C   . GLU H 2 59  ? 97.230  23.571 28.220 1.00 55.99  ? 58  GLU H C   1 
ATOM   6620 O O   . GLU H 2 59  ? 97.027  22.741 27.321 1.00 48.66  ? 58  GLU H O   1 
ATOM   6621 C CB  . GLU H 2 59  ? 98.226  25.770 27.525 1.00 57.17  ? 58  GLU H CB  1 
ATOM   6622 C CG  . GLU H 2 59  ? 99.395  26.752 27.469 1.00 56.13  ? 58  GLU H CG  1 
ATOM   6623 C CD  . GLU H 2 59  ? 99.076  28.003 26.649 1.00 64.91  ? 58  GLU H CD  1 
ATOM   6624 O OE1 . GLU H 2 59  ? 97.880  28.362 26.519 1.00 67.21  ? 58  GLU H OE1 1 
ATOM   6625 O OE2 . GLU H 2 59  ? 100.025 28.637 26.128 1.00 68.57  ? 58  GLU H OE2 1 
ATOM   6626 N N   . TYR H 2 60  ? 96.367  23.811 29.207 1.00 53.80  ? 59  TYR H N   1 
ATOM   6627 C CA  . TYR H 2 60  ? 95.111  23.078 29.381 1.00 50.77  ? 59  TYR H CA  1 
ATOM   6628 C C   . TYR H 2 60  ? 93.949  23.985 29.681 1.00 48.58  ? 59  TYR H C   1 
ATOM   6629 O O   . TYR H 2 60  ? 94.124  25.051 30.240 1.00 53.88  ? 59  TYR H O   1 
ATOM   6630 C CB  . TYR H 2 60  ? 95.210  22.136 30.565 1.00 44.33  ? 59  TYR H CB  1 
ATOM   6631 C CG  . TYR H 2 60  ? 96.162  21.011 30.368 1.00 47.53  ? 59  TYR H CG  1 
ATOM   6632 C CD1 . TYR H 2 60  ? 95.830  19.926 29.562 1.00 51.43  ? 59  TYR H CD1 1 
ATOM   6633 C CD2 . TYR H 2 60  ? 97.381  20.996 31.016 1.00 50.54  ? 59  TYR H CD2 1 
ATOM   6634 C CE1 . TYR H 2 60  ? 96.697  18.845 29.414 1.00 52.60  ? 59  TYR H CE1 1 
ATOM   6635 C CE2 . TYR H 2 60  ? 98.247  19.926 30.879 1.00 55.28  ? 59  TYR H CE2 1 
ATOM   6636 C CZ  . TYR H 2 60  ? 97.904  18.857 30.079 1.00 52.79  ? 59  TYR H CZ  1 
ATOM   6637 O OH  . TYR H 2 60  ? 98.797  17.822 29.942 1.00 56.55  ? 59  TYR H OH  1 
ATOM   6638 N N   . ASN H 2 61  ? 92.750  23.556 29.329 1.00 50.20  ? 60  ASN H N   1 
ATOM   6639 C CA  . ASN H 2 61  ? 91.577  24.352 29.649 1.00 51.84  ? 60  ASN H CA  1 
ATOM   6640 C C   . ASN H 2 61  ? 91.479  24.038 31.138 1.00 55.06  ? 60  ASN H C   1 
ATOM   6641 O O   . ASN H 2 61  ? 91.430  22.867 31.508 1.00 56.82  ? 60  ASN H O   1 
ATOM   6642 C CB  . ASN H 2 61  ? 90.332  23.839 28.900 1.00 44.89  ? 60  ASN H CB  1 
ATOM   6643 C CG  . ASN H 2 61  ? 89.091  24.709 29.145 1.00 42.43  ? 60  ASN H CG  1 
ATOM   6644 O OD1 . ASN H 2 61  ? 88.847  25.175 30.271 1.00 37.17  ? 60  ASN H OD1 1 
ATOM   6645 N ND2 . ASN H 2 61  ? 88.307  24.937 28.094 1.00 33.68  ? 60  ASN H ND2 1 
ATOM   6646 N N   . PRO H 2 62  ? 91.538  25.063 32.001 1.00 57.52  ? 61  PRO H N   1 
ATOM   6647 C CA  . PRO H 2 62  ? 91.460  24.892 33.455 1.00 58.58  ? 61  PRO H CA  1 
ATOM   6648 C C   . PRO H 2 62  ? 90.306  23.999 33.886 1.00 60.59  ? 61  PRO H C   1 
ATOM   6649 O O   . PRO H 2 62  ? 90.525  22.996 34.586 1.00 65.07  ? 61  PRO H O   1 
ATOM   6650 C CB  . PRO H 2 62  ? 91.278  26.324 33.956 1.00 60.54  ? 61  PRO H CB  1 
ATOM   6651 C CG  . PRO H 2 62  ? 90.619  27.018 32.790 1.00 62.65  ? 61  PRO H CG  1 
ATOM   6652 C CD  . PRO H 2 62  ? 91.443  26.488 31.652 1.00 61.51  ? 61  PRO H CD  1 
ATOM   6653 N N   . ALA H 2 63  ? 89.101  24.317 33.400 1.00 57.99  ? 62  ALA H N   1 
ATOM   6654 C CA  . ALA H 2 63  ? 87.876  23.566 33.718 1.00 53.93  ? 62  ALA H CA  1 
ATOM   6655 C C   . ALA H 2 63  ? 88.052  22.054 33.579 1.00 52.94  ? 62  ALA H C   1 
ATOM   6656 O O   . ALA H 2 63  ? 87.534  21.275 34.380 1.00 53.73  ? 62  ALA H O   1 
ATOM   6657 C CB  . ALA H 2 63  ? 86.712  24.047 32.835 1.00 44.77  ? 62  ALA H CB  1 
ATOM   6658 N N   . LEU H 2 64  ? 88.841  21.651 32.594 1.00 58.44  ? 63  LEU H N   1 
ATOM   6659 C CA  . LEU H 2 64  ? 89.079  20.245 32.318 1.00 62.06  ? 63  LEU H CA  1 
ATOM   6660 C C   . LEU H 2 64  ? 90.482  19.795 32.676 1.00 64.39  ? 63  LEU H C   1 
ATOM   6661 O O   . LEU H 2 64  ? 90.716  18.596 32.780 1.00 64.31  ? 63  LEU H O   1 
ATOM   6662 C CB  . LEU H 2 64  ? 88.828  19.972 30.834 1.00 63.42  ? 63  LEU H CB  1 
ATOM   6663 C CG  . LEU H 2 64  ? 87.526  20.579 30.288 1.00 69.00  ? 63  LEU H CG  1 
ATOM   6664 C CD1 . LEU H 2 64  ? 87.510  20.533 28.778 1.00 67.76  ? 63  LEU H CD1 1 
ATOM   6665 C CD2 . LEU H 2 64  ? 86.307  19.871 30.882 1.00 73.32  ? 63  LEU H CD2 1 
ATOM   6666 N N   . LYS H 2 65  ? 91.388  20.745 32.925 1.00 68.58  ? 64  LYS H N   1 
ATOM   6667 C CA  . LYS H 2 65  ? 92.798  20.455 33.246 1.00 72.08  ? 64  LYS H CA  1 
ATOM   6668 C C   . LYS H 2 65  ? 92.911  19.314 34.235 1.00 72.13  ? 64  LYS H C   1 
ATOM   6669 O O   . LYS H 2 65  ? 93.858  18.508 34.208 1.00 63.91  ? 64  LYS H O   1 
ATOM   6670 C CB  . LYS H 2 65  ? 93.503  21.697 33.822 1.00 77.29  ? 64  LYS H CB  1 
ATOM   6671 C CG  . LYS H 2 65  ? 95.003  21.465 34.111 1.00 76.81  ? 64  LYS H CG  1 
ATOM   6672 C CD  . LYS H 2 65  ? 95.733  22.710 34.625 1.00 74.01  ? 64  LYS H CD  1 
ATOM   6673 C CE  . LYS H 2 65  ? 97.225  22.426 34.803 1.00 68.59  ? 64  LYS H CE  1 
ATOM   6674 N NZ  . LYS H 2 65  ? 97.960  23.499 35.519 1.00 61.93  ? 64  LYS H NZ  1 
ATOM   6675 N N   . SER H 2 66  ? 91.925  19.307 35.125 1.00 77.49  ? 65  SER H N   1 
ATOM   6676 C CA  . SER H 2 66  ? 91.748  18.321 36.178 1.00 76.95  ? 65  SER H CA  1 
ATOM   6677 C C   . SER H 2 66  ? 91.895  16.880 35.659 1.00 76.04  ? 65  SER H C   1 
ATOM   6678 O O   . SER H 2 66  ? 92.694  16.100 36.193 1.00 72.15  ? 65  SER H O   1 
ATOM   6679 C CB  . SER H 2 66  ? 90.348  18.543 36.784 1.00 74.72  ? 65  SER H CB  1 
ATOM   6680 O OG  . SER H 2 66  ? 89.851  17.414 37.473 1.00 76.31  ? 65  SER H OG  1 
ATOM   6681 N N   . ARG H 2 67  ? 91.181  16.574 34.569 1.00 75.38  ? 66  ARG H N   1 
ATOM   6682 C CA  . ARG H 2 67  ? 91.135  15.231 33.959 1.00 73.04  ? 66  ARG H CA  1 
ATOM   6683 C C   . ARG H 2 67  ? 91.841  15.044 32.611 1.00 71.06  ? 66  ARG H C   1 
ATOM   6684 O O   . ARG H 2 67  ? 91.735  13.974 32.009 1.00 66.14  ? 66  ARG H O   1 
ATOM   6685 C CB  . ARG H 2 67  ? 89.669  14.837 33.753 1.00 69.39  ? 66  ARG H CB  1 
ATOM   6686 C CG  . ARG H 2 67  ? 88.705  15.376 34.807 1.00 69.54  ? 66  ARG H CG  1 
ATOM   6687 C CD  . ARG H 2 67  ? 87.469  15.970 34.165 1.00 62.92  ? 66  ARG H CD  1 
ATOM   6688 N NE  . ARG H 2 67  ? 86.949  15.052 33.170 1.00 56.23  ? 66  ARG H NE  1 
ATOM   6689 C CZ  . ARG H 2 67  ? 85.936  15.316 32.361 1.00 56.69  ? 66  ARG H CZ  1 
ATOM   6690 N NH1 . ARG H 2 67  ? 85.285  16.475 32.420 1.00 48.03  ? 66  ARG H NH1 1 
ATOM   6691 N NH2 . ARG H 2 67  ? 85.638  14.437 31.434 1.00 55.64  ? 66  ARG H NH2 1 
ATOM   6692 N N   . LEU H 2 68  ? 92.568  16.061 32.151 1.00 72.27  ? 67  LEU H N   1 
ATOM   6693 C CA  . LEU H 2 68  ? 93.235  16.024 30.848 1.00 67.14  ? 67  LEU H CA  1 
ATOM   6694 C C   . LEU H 2 68  ? 94.704  15.717 30.861 1.00 65.33  ? 67  LEU H C   1 
ATOM   6695 O O   . LEU H 2 68  ? 95.412  16.000 31.824 1.00 69.34  ? 67  LEU H O   1 
ATOM   6696 C CB  . LEU H 2 68  ? 93.080  17.358 30.127 1.00 65.79  ? 67  LEU H CB  1 
ATOM   6697 C CG  . LEU H 2 68  ? 91.749  17.696 29.476 1.00 63.96  ? 67  LEU H CG  1 
ATOM   6698 C CD1 . LEU H 2 68  ? 91.713  19.179 29.147 1.00 58.43  ? 67  LEU H CD1 1 
ATOM   6699 C CD2 . LEU H 2 68  ? 91.602  16.832 28.233 1.00 67.33  ? 67  LEU H CD2 1 
ATOM   6700 N N   . SER H 2 69  ? 95.164  15.251 29.714 1.00 63.12  ? 68  SER H N   1 
ATOM   6701 C CA  . SER H 2 69  ? 96.558  14.936 29.510 1.00 61.40  ? 68  SER H CA  1 
ATOM   6702 C C   . SER H 2 69  ? 96.847  15.024 28.017 1.00 61.41  ? 68  SER H C   1 
ATOM   6703 O O   . SER H 2 69  ? 96.171  14.398 27.202 1.00 60.06  ? 68  SER H O   1 
ATOM   6704 C CB  . SER H 2 69  ? 96.885  13.548 30.062 1.00 55.15  ? 68  SER H CB  1 
ATOM   6705 O OG  . SER H 2 69  ? 98.136  13.100 29.586 1.00 54.54  ? 68  SER H OG  1 
ATOM   6706 N N   . ILE H 2 70  ? 97.764  15.913 27.669 1.00 61.33  ? 69  ILE H N   1 
ATOM   6707 C CA  . ILE H 2 70  ? 98.193  16.130 26.300 1.00 59.61  ? 69  ILE H CA  1 
ATOM   6708 C C   . ILE H 2 70  ? 99.695  15.882 26.287 1.00 60.18  ? 69  ILE H C   1 
ATOM   6709 O O   . ILE H 2 70  ? 100.400 16.222 27.244 1.00 64.90  ? 69  ILE H O   1 
ATOM   6710 C CB  . ILE H 2 70  ? 97.891  17.573 25.854 1.00 56.95  ? 69  ILE H CB  1 
ATOM   6711 C CG1 . ILE H 2 70  ? 96.378  17.775 25.779 1.00 54.66  ? 69  ILE H CG1 1 
ATOM   6712 C CG2 . ILE H 2 70  ? 98.567  17.887 24.533 1.00 50.98  ? 69  ILE H CG2 1 
ATOM   6713 C CD1 . ILE H 2 70  ? 95.964  19.163 25.430 1.00 54.18  ? 69  ILE H CD1 1 
ATOM   6714 N N   . SER H 2 71  ? 100.175 15.248 25.229 1.00 58.68  ? 70  SER H N   1 
ATOM   6715 C CA  . SER H 2 71  ? 101.597 14.958 25.103 1.00 59.94  ? 70  SER H CA  1 
ATOM   6716 C C   . SER H 2 71  ? 101.897 14.749 23.621 1.00 61.25  ? 70  SER H C   1 
ATOM   6717 O O   . SER H 2 71  ? 100.999 14.915 22.795 1.00 60.85  ? 70  SER H O   1 
ATOM   6718 C CB  . SER H 2 71  ? 101.988 13.730 25.948 1.00 52.93  ? 70  SER H CB  1 
ATOM   6719 O OG  . SER H 2 71  ? 101.250 12.570 25.599 1.00 47.66  ? 70  SER H OG  1 
ATOM   6720 N N   . LYS H 2 72  ? 103.155 14.465 23.278 1.00 62.64  ? 71  LYS H N   1 
ATOM   6721 C CA  . LYS H 2 72  ? 103.534 14.246 21.882 1.00 63.17  ? 71  LYS H CA  1 
ATOM   6722 C C   . LYS H 2 72  ? 104.865 13.530 21.689 1.00 66.21  ? 71  LYS H C   1 
ATOM   6723 O O   . LYS H 2 72  ? 105.654 13.368 22.621 1.00 65.79  ? 71  LYS H O   1 
ATOM   6724 C CB  . LYS H 2 72  ? 103.586 15.577 21.105 1.00 60.96  ? 71  LYS H CB  1 
ATOM   6725 C CG  . LYS H 2 72  ? 104.857 16.429 21.286 1.00 62.04  ? 71  LYS H CG  1 
ATOM   6726 C CD  . LYS H 2 72  ? 104.834 17.641 20.334 1.00 67.30  ? 71  LYS H CD  1 
ATOM   6727 C CE  . LYS H 2 72  ? 106.063 18.567 20.433 1.00 65.52  ? 71  LYS H CE  1 
ATOM   6728 N NZ  . LYS H 2 72  ? 105.940 19.742 19.499 1.00 61.19  ? 71  LYS H NZ  1 
ATOM   6729 N N   . ASP H 2 73  ? 105.081 13.089 20.456 1.00 68.52  ? 72  ASP H N   1 
ATOM   6730 C CA  . ASP H 2 73  ? 106.309 12.439 20.048 1.00 71.00  ? 72  ASP H CA  1 
ATOM   6731 C C   . ASP H 2 73  ? 106.553 12.895 18.626 1.00 70.05  ? 72  ASP H C   1 
ATOM   6732 O O   . ASP H 2 73  ? 105.908 12.416 17.689 1.00 64.80  ? 72  ASP H O   1 
ATOM   6733 C CB  . ASP H 2 73  ? 106.211 10.919 20.077 1.00 78.53  ? 72  ASP H CB  1 
ATOM   6734 C CG  . ASP H 2 73  ? 107.486 10.242 19.542 1.00 87.83  ? 72  ASP H CG  1 
ATOM   6735 O OD1 . ASP H 2 73  ? 108.596 10.813 19.703 1.00 87.69  ? 72  ASP H OD1 1 
ATOM   6736 O OD2 . ASP H 2 73  ? 107.376 9.142  18.956 1.00 91.53  ? 72  ASP H OD2 1 
ATOM   6737 N N   . ASN H 2 74  ? 107.478 13.842 18.486 1.00 74.05  ? 73  ASN H N   1 
ATOM   6738 C CA  . ASN H 2 74  ? 107.854 14.413 17.192 1.00 75.62  ? 73  ASN H CA  1 
ATOM   6739 C C   . ASN H 2 74  ? 108.263 13.337 16.191 1.00 76.13  ? 73  ASN H C   1 
ATOM   6740 O O   . ASN H 2 74  ? 107.805 13.348 15.052 1.00 72.84  ? 73  ASN H O   1 
ATOM   6741 C CB  . ASN H 2 74  ? 108.997 15.421 17.369 1.00 75.50  ? 73  ASN H CB  1 
ATOM   6742 C CG  . ASN H 2 74  ? 108.588 16.645 18.175 1.00 73.58  ? 73  ASN H CG  1 
ATOM   6743 O OD1 . ASN H 2 74  ? 108.239 17.680 17.608 1.00 75.35  ? 73  ASN H OD1 1 
ATOM   6744 N ND2 . ASN H 2 74  ? 108.659 16.542 19.501 1.00 70.10  ? 73  ASN H ND2 1 
ATOM   6745 N N   . SER H 2 75  ? 109.075 12.387 16.665 1.00 80.27  ? 74  SER H N   1 
ATOM   6746 C CA  . SER H 2 75  ? 109.603 11.257 15.877 1.00 81.01  ? 74  SER H CA  1 
ATOM   6747 C C   . SER H 2 75  ? 108.555 10.545 15.008 1.00 82.99  ? 74  SER H C   1 
ATOM   6748 O O   . SER H 2 75  ? 108.641 10.535 13.774 1.00 80.06  ? 74  SER H O   1 
ATOM   6749 C CB  . SER H 2 75  ? 110.231 10.226 16.830 1.00 75.97  ? 74  SER H CB  1 
ATOM   6750 O OG  . SER H 2 75  ? 110.992 10.874 17.833 1.00 76.71  ? 74  SER H OG  1 
ATOM   6751 N N   . LYS H 2 76  ? 107.586 9.929  15.684 1.00 83.32  ? 75  LYS H N   1 
ATOM   6752 C CA  . LYS H 2 76  ? 106.514 9.192  15.031 1.00 81.60  ? 75  LYS H CA  1 
ATOM   6753 C C   . LYS H 2 76  ? 105.505 10.116 14.353 1.00 78.73  ? 75  LYS H C   1 
ATOM   6754 O O   . LYS H 2 76  ? 104.612 9.645  13.638 1.00 75.52  ? 75  LYS H O   1 
ATOM   6755 C CB  . LYS H 2 76  ? 105.818 8.271  16.042 1.00 83.99  ? 75  LYS H CB  1 
ATOM   6756 C CG  . LYS H 2 76  ? 106.776 7.291  16.752 1.00 89.34  ? 75  LYS H CG  1 
ATOM   6757 C CD  . LYS H 2 76  ? 107.252 6.139  15.856 1.00 93.55  ? 75  LYS H CD  1 
ATOM   6758 C CE  . LYS H 2 76  ? 106.164 5.063  15.682 1.00 95.71  ? 75  LYS H CE  1 
ATOM   6759 N NZ  . LYS H 2 76  ? 106.575 3.970  14.749 1.00 93.17  ? 75  LYS H NZ  1 
ATOM   6760 N N   . SER H 2 77  ? 105.653 11.422 14.598 1.00 76.58  ? 76  SER H N   1 
ATOM   6761 C CA  . SER H 2 77  ? 104.784 12.457 14.030 1.00 73.05  ? 76  SER H CA  1 
ATOM   6762 C C   . SER H 2 77  ? 103.353 12.449 14.624 1.00 71.26  ? 76  SER H C   1 
ATOM   6763 O O   . SER H 2 77  ? 102.373 12.596 13.892 1.00 67.85  ? 76  SER H O   1 
ATOM   6764 C CB  . SER H 2 77  ? 104.751 12.291 12.503 1.00 71.15  ? 76  SER H CB  1 
ATOM   6765 O OG  . SER H 2 77  ? 103.991 13.291 11.875 1.00 76.32  ? 76  SER H OG  1 
ATOM   6766 N N   . GLN H 2 78  ? 103.236 12.390 15.954 1.00 70.71  ? 77  GLN H N   1 
ATOM   6767 C CA  . GLN H 2 78  ? 101.910 12.332 16.593 1.00 70.43  ? 77  GLN H CA  1 
ATOM   6768 C C   . GLN H 2 78  ? 101.682 13.023 17.969 1.00 68.22  ? 77  GLN H C   1 
ATOM   6769 O O   . GLN H 2 78  ? 102.523 12.953 18.874 1.00 70.84  ? 77  GLN H O   1 
ATOM   6770 C CB  . GLN H 2 78  ? 101.456 10.861 16.658 1.00 71.54  ? 77  GLN H CB  1 
ATOM   6771 C CG  . GLN H 2 78  ? 102.562 9.888  17.095 1.00 71.66  ? 77  GLN H CG  1 
ATOM   6772 C CD  . GLN H 2 78  ? 102.154 8.430  16.968 1.00 69.80  ? 77  GLN H CD  1 
ATOM   6773 O OE1 . GLN H 2 78  ? 101.235 8.099  16.220 1.00 67.69  ? 77  GLN H OE1 1 
ATOM   6774 N NE2 . GLN H 2 78  ? 102.823 7.552  17.714 1.00 61.96  ? 77  GLN H NE2 1 
ATOM   6775 N N   . ILE H 2 79  ? 100.513 13.647 18.119 1.00 61.63  ? 78  ILE H N   1 
ATOM   6776 C CA  . ILE H 2 79  ? 100.111 14.335 19.345 1.00 57.39  ? 78  ILE H CA  1 
ATOM   6777 C C   . ILE H 2 79  ? 99.060  13.471 20.026 1.00 58.22  ? 78  ILE H C   1 
ATOM   6778 O O   . ILE H 2 79  ? 98.163  12.959 19.364 1.00 60.54  ? 78  ILE H O   1 
ATOM   6779 C CB  . ILE H 2 79  ? 99.434  15.695 19.042 1.00 58.22  ? 78  ILE H CB  1 
ATOM   6780 C CG1 . ILE H 2 79  ? 100.274 16.514 18.055 1.00 52.67  ? 78  ILE H CG1 1 
ATOM   6781 C CG2 . ILE H 2 79  ? 99.162  16.466 20.333 1.00 54.45  ? 78  ILE H CG2 1 
ATOM   6782 C CD1 . ILE H 2 79  ? 99.969  16.208 16.596 1.00 49.63  ? 78  ILE H CD1 1 
ATOM   6783 N N   . PHE H 2 80  ? 99.104  13.388 21.348 1.00 58.99  ? 79  PHE H N   1 
ATOM   6784 C CA  . PHE H 2 80  ? 98.155  12.567 22.084 1.00 57.27  ? 79  PHE H CA  1 
ATOM   6785 C C   . PHE H 2 80  ? 97.266  13.336 23.058 1.00 60.08  ? 79  PHE H C   1 
ATOM   6786 O O   . PHE H 2 80  ? 97.697  14.307 23.679 1.00 63.18  ? 79  PHE H O   1 
ATOM   6787 C CB  . PHE H 2 80  ? 98.907  11.482 22.857 1.00 59.06  ? 79  PHE H CB  1 
ATOM   6788 C CG  . PHE H 2 80  ? 99.910  10.740 22.032 1.00 60.10  ? 79  PHE H CG  1 
ATOM   6789 C CD1 . PHE H 2 80  ? 101.209 11.222 21.899 1.00 65.80  ? 79  PHE H CD1 1 
ATOM   6790 C CD2 . PHE H 2 80  ? 99.560  9.566  21.375 1.00 61.00  ? 79  PHE H CD2 1 
ATOM   6791 C CE1 . PHE H 2 80  ? 102.150 10.541 21.124 1.00 65.97  ? 79  PHE H CE1 1 
ATOM   6792 C CE2 . PHE H 2 80  ? 100.494 8.873  20.593 1.00 60.54  ? 79  PHE H CE2 1 
ATOM   6793 C CZ  . PHE H 2 80  ? 101.788 9.359  20.468 1.00 62.08  ? 79  PHE H CZ  1 
ATOM   6794 N N   . LEU H 2 81  ? 96.003  12.927 23.129 1.00 59.32  ? 80  LEU H N   1 
ATOM   6795 C CA  . LEU H 2 81  ? 95.035  13.496 24.061 1.00 55.27  ? 80  LEU H CA  1 
ATOM   6796 C C   . LEU H 2 81  ? 94.615  12.283 24.878 1.00 60.80  ? 80  LEU H C   1 
ATOM   6797 O O   . LEU H 2 81  ? 94.747  11.135 24.423 1.00 59.78  ? 80  LEU H O   1 
ATOM   6798 C CB  . LEU H 2 81  ? 93.826  14.106 23.363 1.00 45.95  ? 80  LEU H CB  1 
ATOM   6799 C CG  . LEU H 2 81  ? 92.686  14.623 24.254 1.00 41.78  ? 80  LEU H CG  1 
ATOM   6800 C CD1 . LEU H 2 81  ? 93.173  15.554 25.329 1.00 35.62  ? 80  LEU H CD1 1 
ATOM   6801 C CD2 . LEU H 2 81  ? 91.693  15.351 23.387 1.00 46.30  ? 80  LEU H CD2 1 
ATOM   6802 N N   . LYS H 2 82  ? 94.109  12.533 26.076 1.00 66.33  ? 81  LYS H N   1 
ATOM   6803 C CA  . LYS H 2 82  ? 93.726  11.464 26.981 1.00 65.87  ? 81  LYS H CA  1 
ATOM   6804 C C   . LYS H 2 82  ? 93.002  12.067 28.171 1.00 65.42  ? 81  LYS H C   1 
ATOM   6805 O O   . LYS H 2 82  ? 93.573  12.885 28.900 1.00 63.50  ? 81  LYS H O   1 
ATOM   6806 C CB  . LYS H 2 82  ? 95.008  10.774 27.473 1.00 68.11  ? 81  LYS H CB  1 
ATOM   6807 C CG  . LYS H 2 82  ? 94.860  9.361  27.983 1.00 69.46  ? 81  LYS H CG  1 
ATOM   6808 C CD  . LYS H 2 82  ? 96.223  8.661  27.994 1.00 71.25  ? 81  LYS H CD  1 
ATOM   6809 C CE  . LYS H 2 82  ? 96.942  8.721  26.635 1.00 66.73  ? 81  LYS H CE  1 
ATOM   6810 N NZ  . LYS H 2 82  ? 98.171  7.856  26.651 1.00 66.88  ? 81  LYS H NZ  1 
ATOM   6811 N N   . MET H 2 83  ? 91.718  11.771 28.307 1.00 64.64  ? 82  MET H N   1 
ATOM   6812 C CA  . MET H 2 83  ? 91.004  12.282 29.458 1.00 67.93  ? 82  MET H CA  1 
ATOM   6813 C C   . MET H 2 83  ? 90.318  11.172 30.231 1.00 73.75  ? 82  MET H C   1 
ATOM   6814 O O   . MET H 2 83  ? 89.815  10.211 29.644 1.00 78.18  ? 82  MET H O   1 
ATOM   6815 C CB  . MET H 2 83  ? 90.066  13.420 29.107 1.00 61.79  ? 82  MET H CB  1 
ATOM   6816 C CG  . MET H 2 83  ? 88.889  13.099 28.273 1.00 49.86  ? 82  MET H CG  1 
ATOM   6817 S SD  . MET H 2 83  ? 88.009  14.624 28.415 1.00 58.21  ? 82  MET H SD  1 
ATOM   6818 C CE  . MET H 2 83  ? 86.545  14.255 27.654 1.00 63.01  ? 82  MET H CE  1 
ATOM   6819 N N   . ASN H 2 84  A 90.393  11.280 31.557 1.00 79.03  ? 82  ASN H N   1 
ATOM   6820 C CA  . ASN H 2 84  A 89.850  10.299 32.490 1.00 75.17  ? 82  ASN H CA  1 
ATOM   6821 C C   . ASN H 2 84  A 88.459  10.579 32.962 1.00 73.91  ? 82  ASN H C   1 
ATOM   6822 O O   . ASN H 2 84  A 87.962  11.704 32.871 1.00 74.46  ? 82  ASN H O   1 
ATOM   6823 C CB  . ASN H 2 84  A 90.721  10.202 33.741 1.00 77.82  ? 82  ASN H CB  1 
ATOM   6824 C CG  . ASN H 2 84  A 92.064  9.584  33.466 1.00 80.95  ? 82  ASN H CG  1 
ATOM   6825 O OD1 . ASN H 2 84  A 92.154  8.486  32.916 1.00 84.16  ? 82  ASN H OD1 1 
ATOM   6826 N ND2 . ASN H 2 84  A 93.120  10.280 33.856 1.00 78.96  ? 82  ASN H ND2 1 
ATOM   6827 N N   . SER H 2 85  B 87.858  9.540  33.525 1.00 73.29  ? 82  SER H N   1 
ATOM   6828 C CA  . SER H 2 85  B 86.527  9.628  34.077 1.00 74.02  ? 82  SER H CA  1 
ATOM   6829 C C   . SER H 2 85  B 85.577  10.352 33.121 1.00 73.31  ? 82  SER H C   1 
ATOM   6830 O O   . SER H 2 85  B 85.068  11.449 33.422 1.00 70.23  ? 82  SER H O   1 
ATOM   6831 C CB  . SER H 2 85  B 86.626  10.326 35.430 1.00 77.70  ? 82  SER H CB  1 
ATOM   6832 O OG  . SER H 2 85  B 87.735  9.791  36.151 1.00 79.55  ? 82  SER H OG  1 
ATOM   6833 N N   . LEU H 2 86  C 85.391  9.731  31.946 1.00 72.95  ? 82  LEU H N   1 
ATOM   6834 C CA  . LEU H 2 86  C 84.515  10.229 30.879 1.00 66.75  ? 82  LEU H CA  1 
ATOM   6835 C C   . LEU H 2 86  C 83.087  10.342 31.363 1.00 63.33  ? 82  LEU H C   1 
ATOM   6836 O O   . LEU H 2 86  C 82.640  9.582  32.219 1.00 65.90  ? 82  LEU H O   1 
ATOM   6837 C CB  . LEU H 2 86  C 84.538  9.301  29.657 1.00 59.36  ? 82  LEU H CB  1 
ATOM   6838 C CG  . LEU H 2 86  C 85.697  9.414  28.683 1.00 52.32  ? 82  LEU H CG  1 
ATOM   6839 C CD1 . LEU H 2 86  C 85.572  8.333  27.654 1.00 56.90  ? 82  LEU H CD1 1 
ATOM   6840 C CD2 . LEU H 2 86  C 85.661  10.758 28.020 1.00 48.11  ? 82  LEU H CD2 1 
ATOM   6841 N N   . GLN H 2 87  ? 82.353  11.264 30.778 1.00 61.48  ? 83  GLN H N   1 
ATOM   6842 C CA  . GLN H 2 87  ? 80.982  11.467 31.161 1.00 59.55  ? 83  GLN H CA  1 
ATOM   6843 C C   . GLN H 2 87  ? 80.146  11.570 29.922 1.00 57.76  ? 83  GLN H C   1 
ATOM   6844 O O   . GLN H 2 87  ? 80.674  11.860 28.847 1.00 53.38  ? 83  GLN H O   1 
ATOM   6845 C CB  . GLN H 2 87  ? 80.878  12.738 31.989 1.00 59.27  ? 83  GLN H CB  1 
ATOM   6846 C CG  . GLN H 2 87  ? 81.689  12.644 33.271 1.00 67.57  ? 83  GLN H CG  1 
ATOM   6847 C CD  . GLN H 2 87  ? 82.424  13.930 33.610 1.00 73.66  ? 83  GLN H CD  1 
ATOM   6848 O OE1 . GLN H 2 87  ? 82.257  14.964 32.938 1.00 67.58  ? 83  GLN H OE1 1 
ATOM   6849 N NE2 . GLN H 2 87  ? 83.242  13.876 34.669 1.00 73.29  ? 83  GLN H NE2 1 
ATOM   6850 N N   . THR H 2 88  ? 78.846  11.329 30.061 1.00 59.25  ? 84  THR H N   1 
ATOM   6851 C CA  . THR H 2 88  ? 77.934  11.432 28.931 1.00 59.85  ? 84  THR H CA  1 
ATOM   6852 C C   . THR H 2 88  ? 78.079  12.824 28.365 1.00 57.61  ? 84  THR H C   1 
ATOM   6853 O O   . THR H 2 88  ? 77.674  13.111 27.232 1.00 57.13  ? 84  THR H O   1 
ATOM   6854 C CB  . THR H 2 88  ? 76.462  11.204 29.331 1.00 54.43  ? 84  THR H CB  1 
ATOM   6855 O OG1 . THR H 2 88  ? 76.184  11.909 30.545 1.00 57.75  ? 84  THR H OG1 1 
ATOM   6856 C CG2 . THR H 2 88  ? 76.163  9.721  29.488 1.00 53.41  ? 84  THR H CG2 1 
ATOM   6857 N N   . ASP H 2 89  ? 78.682  13.711 29.143 1.00 57.62  ? 85  ASP H N   1 
ATOM   6858 C CA  . ASP H 2 89  ? 78.845  15.037 28.643 1.00 59.61  ? 85  ASP H CA  1 
ATOM   6859 C C   . ASP H 2 89  ? 80.124  15.377 27.941 1.00 56.38  ? 85  ASP H C   1 
ATOM   6860 O O   . ASP H 2 89  ? 80.420  16.525 27.711 1.00 62.24  ? 85  ASP H O   1 
ATOM   6861 C CB  . ASP H 2 89  ? 78.503  16.092 29.658 1.00 60.38  ? 85  ASP H CB  1 
ATOM   6862 C CG  . ASP H 2 89  ? 77.630  17.149 29.046 1.00 71.03  ? 85  ASP H CG  1 
ATOM   6863 O OD1 . ASP H 2 89  ? 77.660  17.297 27.793 1.00 71.76  ? 85  ASP H OD1 1 
ATOM   6864 O OD2 . ASP H 2 89  ? 76.865  17.781 29.793 1.00 75.54  ? 85  ASP H OD2 1 
ATOM   6865 N N   . ASP H 2 90  ? 80.890  14.386 27.567 1.00 54.74  ? 86  ASP H N   1 
ATOM   6866 C CA  . ASP H 2 90  ? 82.097  14.678 26.853 1.00 54.16  ? 86  ASP H CA  1 
ATOM   6867 C C   . ASP H 2 90  ? 81.918  14.264 25.415 1.00 57.56  ? 86  ASP H C   1 
ATOM   6868 O O   . ASP H 2 90  ? 82.860  14.291 24.634 1.00 58.26  ? 86  ASP H O   1 
ATOM   6869 C CB  . ASP H 2 90  ? 83.252  13.962 27.490 1.00 54.09  ? 86  ASP H CB  1 
ATOM   6870 C CG  . ASP H 2 90  ? 83.493  14.431 28.886 1.00 54.67  ? 86  ASP H CG  1 
ATOM   6871 O OD1 . ASP H 2 90  ? 83.055  15.549 29.237 1.00 45.94  ? 86  ASP H OD1 1 
ATOM   6872 O OD2 . ASP H 2 90  ? 84.125  13.650 29.616 1.00 54.10  ? 86  ASP H OD2 1 
ATOM   6873 N N   . SER H 2 91  ? 80.684  13.902 25.080 1.00 57.42  ? 87  SER H N   1 
ATOM   6874 C CA  . SER H 2 91  ? 80.329  13.490 23.734 1.00 55.81  ? 87  SER H CA  1 
ATOM   6875 C C   . SER H 2 91  ? 80.557  14.665 22.775 1.00 52.95  ? 87  SER H C   1 
ATOM   6876 O O   . SER H 2 91  ? 79.980  15.747 22.975 1.00 51.56  ? 87  SER H O   1 
ATOM   6877 C CB  . SER H 2 91  ? 78.854  13.036 23.681 1.00 56.75  ? 87  SER H CB  1 
ATOM   6878 O OG  . SER H 2 91  ? 78.644  11.792 24.334 1.00 53.42  ? 87  SER H OG  1 
ATOM   6879 N N   . ALA H 2 92  ? 81.414  14.454 21.770 1.00 44.88  ? 88  ALA H N   1 
ATOM   6880 C CA  . ALA H 2 92  ? 81.712  15.483 20.783 1.00 41.93  ? 88  ALA H CA  1 
ATOM   6881 C C   . ALA H 2 92  ? 82.642  14.995 19.666 1.00 39.55  ? 88  ALA H C   1 
ATOM   6882 O O   . ALA H 2 92  ? 83.086  13.866 19.671 1.00 39.76  ? 88  ALA H O   1 
ATOM   6883 C CB  . ALA H 2 92  ? 82.319  16.711 21.480 1.00 42.09  ? 88  ALA H CB  1 
ATOM   6884 N N   . MET H 2 93  ? 82.879  15.861 18.690 1.00 41.49  ? 89  MET H N   1 
ATOM   6885 C CA  . MET H 2 93  ? 83.762  15.618 17.560 1.00 40.16  ? 89  MET H CA  1 
ATOM   6886 C C   . MET H 2 93  ? 85.109  16.239 17.947 1.00 39.27  ? 89  MET H C   1 
ATOM   6887 O O   . MET H 2 93  ? 85.238  17.457 18.047 1.00 43.00  ? 89  MET H O   1 
ATOM   6888 C CB  . MET H 2 93  ? 83.207  16.320 16.311 1.00 36.65  ? 89  MET H CB  1 
ATOM   6889 C CG  . MET H 2 93  ? 83.984  16.037 15.051 1.00 37.58  ? 89  MET H CG  1 
ATOM   6890 S SD  . MET H 2 93  ? 83.969  14.311 14.478 1.00 44.60  ? 89  MET H SD  1 
ATOM   6891 C CE  . MET H 2 93  ? 82.399  14.325 13.639 1.00 32.80  ? 89  MET H CE  1 
ATOM   6892 N N   . TYR H 2 94  ? 86.090  15.402 18.235 1.00 44.49  ? 90  TYR H N   1 
ATOM   6893 C CA  . TYR H 2 94  ? 87.411  15.892 18.625 1.00 50.36  ? 90  TYR H CA  1 
ATOM   6894 C C   . TYR H 2 94  ? 88.334  16.122 17.443 1.00 55.43  ? 90  TYR H C   1 
ATOM   6895 O O   . TYR H 2 94  ? 88.422  15.287 16.539 1.00 58.19  ? 90  TYR H O   1 
ATOM   6896 C CB  . TYR H 2 94  ? 88.076  14.945 19.619 1.00 48.34  ? 90  TYR H CB  1 
ATOM   6897 C CG  . TYR H 2 94  ? 87.403  14.904 20.972 1.00 52.08  ? 90  TYR H CG  1 
ATOM   6898 C CD1 . TYR H 2 94  ? 86.100  14.428 21.115 1.00 52.16  ? 90  TYR H CD1 1 
ATOM   6899 C CD2 . TYR H 2 94  ? 88.067  15.341 22.109 1.00 51.22  ? 90  TYR H CD2 1 
ATOM   6900 C CE1 . TYR H 2 94  ? 85.480  14.395 22.346 1.00 50.21  ? 90  TYR H CE1 1 
ATOM   6901 C CE2 . TYR H 2 94  ? 87.455  15.309 23.342 1.00 48.14  ? 90  TYR H CE2 1 
ATOM   6902 C CZ  . TYR H 2 94  ? 86.162  14.840 23.458 1.00 51.49  ? 90  TYR H CZ  1 
ATOM   6903 O OH  . TYR H 2 94  ? 85.545  14.851 24.689 1.00 51.62  ? 90  TYR H OH  1 
ATOM   6904 N N   . TYR H 2 95  ? 89.039  17.247 17.470 1.00 58.97  ? 91  TYR H N   1 
ATOM   6905 C CA  . TYR H 2 95  ? 89.975  17.597 16.424 1.00 54.13  ? 91  TYR H CA  1 
ATOM   6906 C C   . TYR H 2 95  ? 91.288  18.075 16.963 1.00 52.04  ? 91  TYR H C   1 
ATOM   6907 O O   . TYR H 2 95  ? 91.371  18.570 18.084 1.00 49.93  ? 91  TYR H O   1 
ATOM   6908 C CB  . TYR H 2 95  ? 89.473  18.810 15.655 1.00 52.86  ? 91  TYR H CB  1 
ATOM   6909 C CG  . TYR H 2 95  ? 88.198  18.639 14.932 1.00 48.04  ? 91  TYR H CG  1 
ATOM   6910 C CD1 . TYR H 2 95  ? 88.176  18.074 13.654 1.00 50.39  ? 91  TYR H CD1 1 
ATOM   6911 C CD2 . TYR H 2 95  ? 87.022  19.135 15.463 1.00 43.74  ? 91  TYR H CD2 1 
ATOM   6912 C CE1 . TYR H 2 95  ? 86.998  18.019 12.918 1.00 46.86  ? 91  TYR H CE1 1 
ATOM   6913 C CE2 . TYR H 2 95  ? 85.845  19.089 14.734 1.00 52.01  ? 91  TYR H CE2 1 
ATOM   6914 C CZ  . TYR H 2 95  ? 85.848  18.529 13.461 1.00 46.39  ? 91  TYR H CZ  1 
ATOM   6915 O OH  . TYR H 2 95  ? 84.692  18.493 12.742 1.00 51.91  ? 91  TYR H OH  1 
ATOM   6916 N N   . CYS H 2 96  ? 92.292  17.984 16.102 1.00 50.83  ? 92  CYS H N   1 
ATOM   6917 C CA  . CYS H 2 96  ? 93.606  18.518 16.413 1.00 52.24  ? 92  CYS H CA  1 
ATOM   6918 C C   . CYS H 2 96  ? 93.699  19.526 15.277 1.00 49.70  ? 92  CYS H C   1 
ATOM   6919 O O   . CYS H 2 96  ? 93.208  19.272 14.167 1.00 48.21  ? 92  CYS H O   1 
ATOM   6920 C CB  . CYS H 2 96  ? 94.709  17.447 16.387 1.00 52.21  ? 92  CYS H CB  1 
ATOM   6921 S SG  . CYS H 2 96  ? 94.856  16.560 14.801 1.00 68.60  ? 92  CYS H SG  1 
ATOM   6922 N N   . VAL H 2 97  ? 94.120  20.732 15.612 1.00 53.03  ? 93  VAL H N   1 
ATOM   6923 C CA  . VAL H 2 97  ? 94.281  21.816 14.650 1.00 55.28  ? 93  VAL H CA  1 
ATOM   6924 C C   . VAL H 2 97  ? 95.726  22.278 14.811 1.00 57.69  ? 93  VAL H C   1 
ATOM   6925 O O   . VAL H 2 97  ? 96.260  22.229 15.916 1.00 58.12  ? 93  VAL H O   1 
ATOM   6926 C CB  . VAL H 2 97  ? 93.360  23.004 14.991 1.00 52.50  ? 93  VAL H CB  1 
ATOM   6927 C CG1 . VAL H 2 97  ? 93.458  24.090 13.939 1.00 52.71  ? 93  VAL H CG1 1 
ATOM   6928 C CG2 . VAL H 2 97  ? 91.938  22.518 15.124 1.00 54.80  ? 93  VAL H CG2 1 
ATOM   6929 N N   . SER H 2 98  ? 96.378  22.680 13.726 1.00 62.32  ? 94  SER H N   1 
ATOM   6930 C CA  . SER H 2 98  ? 97.763  23.129 13.836 1.00 64.12  ? 94  SER H CA  1 
ATOM   6931 C C   . SER H 2 98  ? 97.957  24.516 13.249 1.00 65.76  ? 94  SER H C   1 
ATOM   6932 O O   . SER H 2 98  ? 97.254  24.914 12.315 1.00 62.43  ? 94  SER H O   1 
ATOM   6933 C CB  . SER H 2 98  ? 98.710  22.139 13.164 1.00 60.07  ? 94  SER H CB  1 
ATOM   6934 O OG  . SER H 2 98  ? 98.536  22.157 11.763 1.00 59.17  ? 94  SER H OG  1 
ATOM   6935 N N   . TYR H 2 99  ? 98.877  25.261 13.856 1.00 70.93  ? 95  TYR H N   1 
ATOM   6936 C CA  . TYR H 2 99  ? 99.243  26.614 13.430 1.00 74.98  ? 95  TYR H CA  1 
ATOM   6937 C C   . TYR H 2 99  ? 100.774 26.699 13.404 1.00 79.04  ? 95  TYR H C   1 
ATOM   6938 O O   . TYR H 2 99  ? 101.454 26.296 14.363 1.00 79.69  ? 95  TYR H O   1 
ATOM   6939 C CB  . TYR H 2 99  ? 98.714  27.673 14.391 1.00 67.98  ? 95  TYR H CB  1 
ATOM   6940 C CG  . TYR H 2 99  ? 97.221  27.687 14.542 1.00 64.91  ? 95  TYR H CG  1 
ATOM   6941 C CD1 . TYR H 2 99  ? 96.414  28.426 13.669 1.00 57.61  ? 95  TYR H CD1 1 
ATOM   6942 C CD2 . TYR H 2 99  ? 96.611  27.016 15.606 1.00 65.21  ? 95  TYR H CD2 1 
ATOM   6943 C CE1 . TYR H 2 99  ? 95.028  28.500 13.857 1.00 55.74  ? 95  TYR H CE1 1 
ATOM   6944 C CE2 . TYR H 2 99  ? 95.233  27.078 15.806 1.00 62.35  ? 95  TYR H CE2 1 
ATOM   6945 C CZ  . TYR H 2 99  ? 94.445  27.825 14.936 1.00 61.06  ? 95  TYR H CZ  1 
ATOM   6946 O OH  . TYR H 2 99  ? 93.089  27.884 15.175 1.00 56.05  ? 95  TYR H OH  1 
ATOM   6947 N N   . GLY H 2 100 ? 101.307 27.212 12.304 1.00 81.16  ? 96  GLY H N   1 
ATOM   6948 C CA  . GLY H 2 100 ? 102.740 27.325 12.165 1.00 83.35  ? 96  GLY H CA  1 
ATOM   6949 C C   . GLY H 2 100 ? 103.082 27.897 10.811 1.00 85.06  ? 96  GLY H C   1 
ATOM   6950 O O   . GLY H 2 100 ? 102.371 27.704 9.814  1.00 81.46  ? 96  GLY H O   1 
ATOM   6951 N N   . TYR H 2 101 ? 104.175 28.638 10.791 1.00 88.58  ? 97  TYR H N   1 
ATOM   6952 C CA  . TYR H 2 101 ? 104.633 29.264 9.572  1.00 90.24  ? 97  TYR H CA  1 
ATOM   6953 C C   . TYR H 2 101 ? 105.542 28.323 8.793  1.00 90.51  ? 97  TYR H C   1 
ATOM   6954 O O   . TYR H 2 101 ? 106.325 27.567 9.382  1.00 89.93  ? 97  TYR H O   1 
ATOM   6955 C CB  . TYR H 2 101 ? 105.357 30.551 9.919  1.00 85.98  ? 97  TYR H CB  1 
ATOM   6956 C CG  . TYR H 2 101 ? 104.475 31.594 10.565 1.00 84.84  ? 97  TYR H CG  1 
ATOM   6957 C CD1 . TYR H 2 101 ? 104.350 31.672 11.956 1.00 87.33  ? 97  TYR H CD1 1 
ATOM   6958 C CD2 . TYR H 2 101 ? 103.866 32.592 9.789  1.00 83.80  ? 97  TYR H CD2 1 
ATOM   6959 C CE1 . TYR H 2 101 ? 103.642 32.739 12.559 1.00 90.55  ? 97  TYR H CE1 1 
ATOM   6960 C CE2 . TYR H 2 101 ? 103.161 33.658 10.375 1.00 82.55  ? 97  TYR H CE2 1 
ATOM   6961 C CZ  . TYR H 2 101 ? 103.064 33.736 11.757 1.00 87.68  ? 97  TYR H CZ  1 
ATOM   6962 O OH  . TYR H 2 101 ? 102.460 34.842 12.323 1.00 78.93  ? 97  TYR H OH  1 
ATOM   6963 N N   . GLY H 2 102 ? 105.403 28.340 7.475  1.00 91.36  ? 98  GLY H N   1 
ATOM   6964 C CA  . GLY H 2 102 ? 106.236 27.483 6.656  1.00 96.20  ? 98  GLY H CA  1 
ATOM   6965 C C   . GLY H 2 102 ? 105.473 26.810 5.536  1.00 97.54  ? 98  GLY H C   1 
ATOM   6966 O O   . GLY H 2 102 ? 105.859 26.923 4.369  1.00 99.80  ? 98  GLY H O   1 
ATOM   6967 N N   . GLY H 2 103 ? 104.416 26.084 5.887  1.00 96.24  ? 99  GLY H N   1 
ATOM   6968 C CA  . GLY H 2 103 ? 103.624 25.424 4.868  1.00 93.00  ? 99  GLY H CA  1 
ATOM   6969 C C   . GLY H 2 103 ? 102.876 26.479 4.070  1.00 89.39  ? 99  GLY H C   1 
ATOM   6970 O O   . GLY H 2 103 ? 102.803 27.639 4.486  1.00 87.21  ? 99  GLY H O   1 
ATOM   6971 N N   . ASP H 2 104 ? 102.273 26.069 2.961  1.00 86.98  ? 100 ASP H N   1 
ATOM   6972 C CA  . ASP H 2 104 ? 101.518 26.982 2.103  1.00 86.79  ? 100 ASP H CA  1 
ATOM   6973 C C   . ASP H 2 104 ? 100.168 27.365 2.695  1.00 85.94  ? 100 ASP H C   1 
ATOM   6974 O O   . ASP H 2 104 ? 99.245  27.754 1.971  1.00 86.18  ? 100 ASP H O   1 
ATOM   6975 C CB  . ASP H 2 104 ? 101.327 26.368 0.717  1.00 90.33  ? 100 ASP H CB  1 
ATOM   6976 C CG  . ASP H 2 104 ? 102.634 26.253 -0.051 1.00 98.22  ? 100 ASP H CG  1 
ATOM   6977 O OD1 . ASP H 2 104 ? 103.619 25.713 0.505  1.00 100.00 ? 100 ASP H OD1 1 
ATOM   6978 O OD2 . ASP H 2 104 ? 102.680 26.716 -1.210 1.00 100.00 ? 100 ASP H OD2 1 
ATOM   6979 N N   . ARG H 2 105 A 100.052 27.205 4.010  1.00 82.51  ? 100 ARG H N   1 
ATOM   6980 C CA  . ARG H 2 105 A 98.852  27.532 4.763  1.00 71.93  ? 100 ARG H CA  1 
ATOM   6981 C C   . ARG H 2 105 A 99.295  27.728 6.218  1.00 67.86  ? 100 ARG H C   1 
ATOM   6982 O O   . ARG H 2 105 A 100.277 27.118 6.674  1.00 67.50  ? 100 ARG H O   1 
ATOM   6983 C CB  . ARG H 2 105 A 97.803  26.414 4.640  1.00 67.33  ? 100 ARG H CB  1 
ATOM   6984 C CG  . ARG H 2 105 A 96.424  26.861 5.024  1.00 73.43  ? 100 ARG H CG  1 
ATOM   6985 C CD  . ARG H 2 105 A 95.354  25.771 4.994  1.00 75.48  ? 100 ARG H CD  1 
ATOM   6986 N NE  . ARG H 2 105 A 94.121  26.289 5.614  1.00 79.12  ? 100 ARG H NE  1 
ATOM   6987 C CZ  . ARG H 2 105 A 93.151  26.897 4.930  1.00 77.15  ? 100 ARG H CZ  1 
ATOM   6988 N NH1 . ARG H 2 105 A 93.285  27.040 3.621  1.00 76.98  ? 100 ARG H NH1 1 
ATOM   6989 N NH2 . ARG H 2 105 A 92.058  27.358 5.536  1.00 70.51  ? 100 ARG H NH2 1 
ATOM   6990 N N   . PHE H 2 106 B 98.640  28.659 6.904  1.00 61.99  ? 100 PHE H N   1 
ATOM   6991 C CA  . PHE H 2 106 B 98.956  28.947 8.290  1.00 60.85  ? 100 PHE H CA  1 
ATOM   6992 C C   . PHE H 2 106 B 98.401  27.871 9.215  1.00 62.15  ? 100 PHE H C   1 
ATOM   6993 O O   . PHE H 2 106 B 99.089  27.425 10.125 1.00 64.57  ? 100 PHE H O   1 
ATOM   6994 C CB  . PHE H 2 106 B 98.394  30.304 8.701  1.00 62.57  ? 100 PHE H CB  1 
ATOM   6995 C CG  . PHE H 2 106 B 98.750  30.705 10.113 1.00 66.98  ? 100 PHE H CG  1 
ATOM   6996 C CD1 . PHE H 2 106 B 100.044 30.498 10.606 1.00 65.32  ? 100 PHE H CD1 1 
ATOM   6997 C CD2 . PHE H 2 106 B 97.794  31.286 10.951 1.00 67.54  ? 100 PHE H CD2 1 
ATOM   6998 C CE1 . PHE H 2 106 B 100.381 30.857 11.902 1.00 64.70  ? 100 PHE H CE1 1 
ATOM   6999 C CE2 . PHE H 2 106 B 98.120  31.652 12.257 1.00 65.61  ? 100 PHE H CE2 1 
ATOM   7000 C CZ  . PHE H 2 106 B 99.415  31.438 12.733 1.00 69.23  ? 100 PHE H CZ  1 
ATOM   7001 N N   . SER H 2 107 ? 97.165  27.443 8.979  1.00 62.25  ? 101 SER H N   1 
ATOM   7002 C CA  . SER H 2 107 ? 96.547  26.428 9.825  1.00 63.44  ? 101 SER H CA  1 
ATOM   7003 C C   . SER H 2 107 ? 96.005  25.219 9.059  1.00 62.44  ? 101 SER H C   1 
ATOM   7004 O O   . SER H 2 107 ? 95.488  25.337 7.954  1.00 55.39  ? 101 SER H O   1 
ATOM   7005 C CB  . SER H 2 107 ? 95.406  27.044 10.633 1.00 68.00  ? 101 SER H CB  1 
ATOM   7006 O OG  . SER H 2 107 ? 94.335  27.416 9.769  1.00 73.18  ? 101 SER H OG  1 
ATOM   7007 N N   . TYR H 2 108 ? 96.062  24.065 9.712  1.00 66.03  ? 102 TYR H N   1 
ATOM   7008 C CA  . TYR H 2 108 ? 95.566  22.808 9.172  1.00 64.56  ? 102 TYR H CA  1 
ATOM   7009 C C   . TYR H 2 108 ? 94.687  22.215 10.270 1.00 64.32  ? 102 TYR H C   1 
ATOM   7010 O O   . TYR H 2 108 ? 95.156  21.987 11.374 1.00 61.33  ? 102 TYR H O   1 
ATOM   7011 C CB  . TYR H 2 108 ? 96.739  21.866 8.859  1.00 68.92  ? 102 TYR H CB  1 
ATOM   7012 C CG  . TYR H 2 108 ? 97.659  22.352 7.746  1.00 74.24  ? 102 TYR H CG  1 
ATOM   7013 C CD1 . TYR H 2 108 ? 97.289  22.212 6.402  1.00 73.49  ? 102 TYR H CD1 1 
ATOM   7014 C CD2 . TYR H 2 108 ? 98.892  22.959 8.032  1.00 69.74  ? 102 TYR H CD2 1 
ATOM   7015 C CE1 . TYR H 2 108 ? 98.112  22.662 5.370  1.00 72.66  ? 102 TYR H CE1 1 
ATOM   7016 C CE2 . TYR H 2 108 ? 99.729  23.415 7.001  1.00 72.35  ? 102 TYR H CE2 1 
ATOM   7017 C CZ  . TYR H 2 108 ? 99.328  23.263 5.670  1.00 74.19  ? 102 TYR H CZ  1 
ATOM   7018 O OH  . TYR H 2 108 ? 100.125 23.717 4.634  1.00 73.04  ? 102 TYR H OH  1 
ATOM   7019 N N   . TRP H 2 109 ? 93.401  22.041 9.976  1.00 66.49  ? 103 TRP H N   1 
ATOM   7020 C CA  . TRP H 2 109 ? 92.400  21.493 10.909 1.00 65.33  ? 103 TRP H CA  1 
ATOM   7021 C C   . TRP H 2 109 ? 92.106  19.997 10.610 1.00 62.34  ? 103 TRP H C   1 
ATOM   7022 O O   . TRP H 2 109 ? 91.852  19.610 9.461  1.00 58.11  ? 103 TRP H O   1 
ATOM   7023 C CB  . TRP H 2 109 ? 91.120  22.333 10.800 1.00 62.97  ? 103 TRP H CB  1 
ATOM   7024 C CG  . TRP H 2 109 ? 90.205  22.243 11.953 1.00 65.79  ? 103 TRP H CG  1 
ATOM   7025 C CD1 . TRP H 2 109 ? 89.699  21.109 12.509 1.00 68.65  ? 103 TRP H CD1 1 
ATOM   7026 C CD2 . TRP H 2 109 ? 89.665  23.335 12.704 1.00 68.84  ? 103 TRP H CD2 1 
ATOM   7027 N NE1 . TRP H 2 109 ? 88.878  21.424 13.566 1.00 70.06  ? 103 TRP H NE1 1 
ATOM   7028 C CE2 . TRP H 2 109 ? 88.839  22.783 13.711 1.00 68.63  ? 103 TRP H CE2 1 
ATOM   7029 C CE3 . TRP H 2 109 ? 89.799  24.728 12.630 1.00 64.45  ? 103 TRP H CE3 1 
ATOM   7030 C CZ2 . TRP H 2 109 ? 88.151  23.572 14.632 1.00 66.34  ? 103 TRP H CZ2 1 
ATOM   7031 C CZ3 . TRP H 2 109 ? 89.110  25.513 13.550 1.00 61.94  ? 103 TRP H CZ3 1 
ATOM   7032 C CH2 . TRP H 2 109 ? 88.299  24.932 14.537 1.00 62.57  ? 103 TRP H CH2 1 
ATOM   7033 N N   . GLY H 2 110 ? 92.155  19.174 11.657 1.00 60.14  ? 104 GLY H N   1 
ATOM   7034 C CA  . GLY H 2 110 ? 91.934  17.747 11.528 1.00 55.95  ? 104 GLY H CA  1 
ATOM   7035 C C   . GLY H 2 110 ? 90.656  17.333 10.845 1.00 54.60  ? 104 GLY H C   1 
ATOM   7036 O O   . GLY H 2 110 ? 89.808  18.158 10.518 1.00 56.58  ? 104 GLY H O   1 
ATOM   7037 N N   . GLN H 2 111 ? 90.540  16.031 10.597 1.00 59.12  ? 105 GLN H N   1 
ATOM   7038 C CA  . GLN H 2 111 ? 89.365  15.439 9.940  1.00 60.90  ? 105 GLN H CA  1 
ATOM   7039 C C   . GLN H 2 111 ? 88.260  15.276 10.970 1.00 55.16  ? 105 GLN H C   1 
ATOM   7040 O O   . GLN H 2 111 ? 87.081  15.513 10.693 1.00 43.91  ? 105 GLN H O   1 
ATOM   7041 C CB  . GLN H 2 111 ? 89.724  14.077 9.306  1.00 63.42  ? 105 GLN H CB  1 
ATOM   7042 C CG  . GLN H 2 111 ? 90.746  14.211 8.164  1.00 77.35  ? 105 GLN H CG  1 
ATOM   7043 C CD  . GLN H 2 111 ? 91.094  12.899 7.482  1.00 82.34  ? 105 GLN H CD  1 
ATOM   7044 O OE1 . GLN H 2 111 ? 91.107  12.816 6.253  1.00 87.01  ? 105 GLN H OE1 1 
ATOM   7045 N NE2 . GLN H 2 111 ? 91.393  11.877 8.270  1.00 88.38  ? 105 GLN H NE2 1 
ATOM   7046 N N   . GLY H 2 112 ? 88.688  14.943 12.182 1.00 55.61  ? 106 GLY H N   1 
ATOM   7047 C CA  . GLY H 2 112 ? 87.787  14.759 13.291 1.00 50.77  ? 106 GLY H CA  1 
ATOM   7048 C C   . GLY H 2 112 ? 87.510  13.319 13.606 1.00 48.83  ? 106 GLY H C   1 
ATOM   7049 O O   . GLY H 2 112 ? 87.527  12.463 12.725 1.00 51.33  ? 106 GLY H O   1 
ATOM   7050 N N   . THR H 2 113 ? 87.359  13.044 14.892 1.00 49.12  ? 107 THR H N   1 
ATOM   7051 C CA  . THR H 2 113 ? 87.018  11.711 15.356 1.00 46.33  ? 107 THR H CA  1 
ATOM   7052 C C   . THR H 2 113 ? 85.852  11.932 16.301 1.00 46.44  ? 107 THR H C   1 
ATOM   7053 O O   . THR H 2 113 ? 85.912  12.801 17.174 1.00 45.77  ? 107 THR H O   1 
ATOM   7054 C CB  . THR H 2 113 ? 88.208  10.978 16.055 1.00 44.74  ? 107 THR H CB  1 
ATOM   7055 O OG1 . THR H 2 113 ? 87.802  9.660  16.444 1.00 44.18  ? 107 THR H OG1 1 
ATOM   7056 C CG2 . THR H 2 113 ? 88.706  11.724 17.265 1.00 42.70  ? 107 THR H CG2 1 
ATOM   7057 N N   . LEU H 2 114 ? 84.747  11.243 16.031 1.00 45.54  ? 108 LEU H N   1 
ATOM   7058 C CA  . LEU H 2 114 ? 83.549  11.351 16.848 1.00 40.40  ? 108 LEU H CA  1 
ATOM   7059 C C   . LEU H 2 114 ? 83.633  10.466 18.081 1.00 43.09  ? 108 LEU H C   1 
ATOM   7060 O O   . LEU H 2 114 ? 83.972  9.290  17.980 1.00 49.02  ? 108 LEU H O   1 
ATOM   7061 C CB  . LEU H 2 114 ? 82.331  10.946 16.035 1.00 35.96  ? 108 LEU H CB  1 
ATOM   7062 C CG  . LEU H 2 114 ? 81.014  11.116 16.773 1.00 34.82  ? 108 LEU H CG  1 
ATOM   7063 C CD1 . LEU H 2 114 ? 80.818  12.588 17.097 1.00 39.37  ? 108 LEU H CD1 1 
ATOM   7064 C CD2 . LEU H 2 114 ? 79.890  10.607 15.914 1.00 26.90  ? 108 LEU H CD2 1 
ATOM   7065 N N   . VAL H 2 115 ? 83.338  11.040 19.241 1.00 45.26  ? 109 VAL H N   1 
ATOM   7066 C CA  . VAL H 2 115 ? 83.347  10.314 20.504 1.00 44.32  ? 109 VAL H CA  1 
ATOM   7067 C C   . VAL H 2 115 ? 81.938  10.366 21.068 1.00 45.14  ? 109 VAL H C   1 
ATOM   7068 O O   . VAL H 2 115 ? 81.395  11.450 21.286 1.00 44.52  ? 109 VAL H O   1 
ATOM   7069 C CB  . VAL H 2 115 ? 84.293  10.936 21.526 1.00 41.33  ? 109 VAL H CB  1 
ATOM   7070 C CG1 . VAL H 2 115 ? 84.104  10.256 22.865 1.00 39.57  ? 109 VAL H CG1 1 
ATOM   7071 C CG2 . VAL H 2 115 ? 85.719  10.774 21.069 1.00 45.63  ? 109 VAL H CG2 1 
ATOM   7072 N N   . THR H 2 116 ? 81.341  9.194  21.278 1.00 48.74  ? 110 THR H N   1 
ATOM   7073 C CA  . THR H 2 116 ? 79.981  9.084  21.806 1.00 44.40  ? 110 THR H CA  1 
ATOM   7074 C C   . THR H 2 116 ? 80.017  8.306  23.138 1.00 46.48  ? 110 THR H C   1 
ATOM   7075 O O   . THR H 2 116 ? 80.467  7.159  23.181 1.00 44.82  ? 110 THR H O   1 
ATOM   7076 C CB  . THR H 2 116 ? 79.074  8.384  20.770 1.00 39.48  ? 110 THR H CB  1 
ATOM   7077 O OG1 . THR H 2 116 ? 79.345  8.908  19.459 1.00 36.72  ? 110 THR H OG1 1 
ATOM   7078 C CG2 . THR H 2 116 ? 77.614  8.620  21.103 1.00 46.56  ? 110 THR H CG2 1 
ATOM   7079 N N   . VAL H 2 117 ? 79.599  8.958  24.224 1.00 49.41  ? 111 VAL H N   1 
ATOM   7080 C CA  . VAL H 2 117 ? 79.607  8.355  25.558 1.00 49.89  ? 111 VAL H CA  1 
ATOM   7081 C C   . VAL H 2 117 ? 78.199  8.020  26.031 1.00 48.54  ? 111 VAL H C   1 
ATOM   7082 O O   . VAL H 2 117 ? 77.321  8.893  26.057 1.00 49.71  ? 111 VAL H O   1 
ATOM   7083 C CB  . VAL H 2 117 ? 80.295  9.281  26.598 1.00 50.39  ? 111 VAL H CB  1 
ATOM   7084 C CG1 . VAL H 2 117 ? 80.751  8.468  27.800 1.00 52.07  ? 111 VAL H CG1 1 
ATOM   7085 C CG2 . VAL H 2 117 ? 81.495  9.987  25.967 1.00 50.86  ? 111 VAL H CG2 1 
ATOM   7086 N N   . SER H 2 118 ? 77.993  6.743  26.360 1.00 53.68  ? 112 SER H N   1 
ATOM   7087 C CA  . SER H 2 118 ? 76.708  6.204  26.834 1.00 56.40  ? 112 SER H CA  1 
ATOM   7088 C C   . SER H 2 118 ? 76.808  4.693  27.045 1.00 54.04  ? 112 SER H C   1 
ATOM   7089 O O   . SER H 2 118 ? 77.909  4.148  26.863 1.00 55.71  ? 112 SER H O   1 
ATOM   7090 C CB  . SER H 2 118 ? 75.604  6.470  25.813 1.00 62.74  ? 112 SER H CB  1 
ATOM   7091 O OG  . SER H 2 118 ? 75.918  5.837  24.577 1.00 69.73  ? 112 SER H OG  1 
ATOM   7092 O OXT . SER H 2 118 ? 75.784  4.050  27.341 1.00 53.70  ? 112 SER H OXT 1 
HETATM 7093 O O   . HOH I 3 .   ? 25.701  30.149 11.689 1.00 27.88  ? 108 HOH A O   1 
HETATM 7094 O O   . HOH I 3 .   ? 11.158  50.185 19.728 1.00 38.04  ? 109 HOH A O   1 
HETATM 7095 O O   . HOH I 3 .   ? 12.726  48.426 18.673 1.00 50.67  ? 110 HOH A O   1 
HETATM 7096 O O   . HOH I 3 .   ? 8.773   40.478 20.159 1.00 22.31  ? 111 HOH A O   1 
HETATM 7097 O O   . HOH I 3 .   ? 15.035  34.909 23.877 1.00 42.30  ? 112 HOH A O   1 
HETATM 7098 O O   . HOH I 3 .   ? 7.491   46.109 36.860 1.00 48.76  ? 113 HOH A O   1 
HETATM 7099 O O   . HOH I 3 .   ? 22.276  40.147 27.682 1.00 38.63  ? 114 HOH A O   1 
HETATM 7100 O O   . HOH I 3 .   ? 6.845   36.198 11.908 1.00 59.30  ? 115 HOH A O   1 
HETATM 7101 O O   . HOH I 3 .   ? 8.020   42.416 18.547 1.00 42.03  ? 116 HOH A O   1 
HETATM 7102 O O   . HOH I 3 .   ? 35.826  34.330 13.136 1.00 47.18  ? 117 HOH A O   1 
HETATM 7103 O O   . HOH I 3 .   ? 36.634  39.803 16.671 1.00 56.84  ? 118 HOH A O   1 
HETATM 7104 O O   . HOH I 3 .   ? 27.347  39.006 13.525 1.00 34.87  ? 119 HOH A O   1 
HETATM 7105 O O   . HOH I 3 .   ? 27.173  33.693 8.692  1.00 46.63  ? 120 HOH A O   1 
HETATM 7106 O O   . HOH I 3 .   ? -1.588  39.008 28.359 1.00 36.94  ? 121 HOH A O   1 
HETATM 7107 O O   . HOH I 3 .   ? 13.918  31.037 13.454 1.00 52.21  ? 122 HOH A O   1 
HETATM 7108 O O   . HOH I 3 .   ? 2.992   49.120 22.673 1.00 65.42  ? 123 HOH A O   1 
HETATM 7109 O O   . HOH I 3 .   ? 23.734  40.962 11.017 1.00 50.59  ? 124 HOH A O   1 
HETATM 7110 O O   . HOH I 3 .   ? 38.954  41.143 17.634 1.00 68.83  ? 125 HOH A O   1 
HETATM 7111 O O   . HOH I 3 .   ? 1.576   39.759 17.104 1.00 46.04  ? 126 HOH A O   1 
HETATM 7112 O O   . HOH I 3 .   ? 24.670  38.870 12.408 1.00 45.46  ? 127 HOH A O   1 
HETATM 7113 O O   . HOH J 3 .   ? 5.153   47.055 16.251 1.00 19.61  ? 113 HOH B O   1 
HETATM 7114 O O   . HOH J 3 .   ? 19.034  76.302 17.327 1.00 32.72  ? 114 HOH B O   1 
HETATM 7115 O O   . HOH J 3 .   ? 3.662   47.317 1.870  1.00 19.78  ? 115 HOH B O   1 
HETATM 7116 O O   . HOH J 3 .   ? 17.631  46.922 10.221 1.00 16.95  ? 116 HOH B O   1 
HETATM 7117 O O   . HOH J 3 .   ? -1.125  61.484 12.617 1.00 32.31  ? 117 HOH B O   1 
HETATM 7118 O O   . HOH J 3 .   ? 4.074   65.143 15.342 1.00 24.25  ? 118 HOH B O   1 
HETATM 7119 O O   . HOH J 3 .   ? 14.413  70.770 15.420 1.00 28.69  ? 119 HOH B O   1 
HETATM 7120 O O   . HOH J 3 .   ? -1.678  60.165 6.529  1.00 40.55  ? 120 HOH B O   1 
HETATM 7121 O O   . HOH J 3 .   ? 9.827   73.988 23.662 1.00 35.94  ? 121 HOH B O   1 
HETATM 7122 O O   . HOH J 3 .   ? 2.320   53.844 10.822 1.00 40.44  ? 122 HOH B O   1 
HETATM 7123 O O   . HOH J 3 .   ? 16.270  45.473 12.554 1.00 40.93  ? 123 HOH B O   1 
HETATM 7124 O O   . HOH J 3 .   ? 14.041  45.672 1.349  1.00 42.84  ? 124 HOH B O   1 
HETATM 7125 O O   . HOH J 3 .   ? 10.069  67.071 6.557  1.00 32.28  ? 125 HOH B O   1 
HETATM 7126 O O   . HOH J 3 .   ? 7.157   44.745 17.258 1.00 41.78  ? 126 HOH B O   1 
HETATM 7127 O O   . HOH J 3 .   ? 18.763  71.717 29.846 1.00 50.80  ? 127 HOH B O   1 
HETATM 7128 O O   . HOH J 3 .   ? 18.687  78.364 24.115 1.00 44.24  ? 128 HOH B O   1 
HETATM 7129 O O   . HOH J 3 .   ? 14.196  52.113 27.305 1.00 41.41  ? 129 HOH B O   1 
HETATM 7130 O O   . HOH J 3 .   ? 0.183   54.056 3.237  1.00 42.12  ? 130 HOH B O   1 
HETATM 7131 O O   . HOH J 3 .   ? 7.486   65.618 31.268 1.00 54.39  ? 131 HOH B O   1 
HETATM 7132 O O   . HOH J 3 .   ? 0.646   57.777 25.503 1.00 42.66  ? 132 HOH B O   1 
HETATM 7133 O O   . HOH J 3 .   ? 23.440  62.158 12.247 1.00 46.13  ? 133 HOH B O   1 
HETATM 7134 O O   . HOH J 3 .   ? 17.383  52.162 6.480  1.00 44.21  ? 134 HOH B O   1 
HETATM 7135 O O   . HOH J 3 .   ? 19.018  65.730 8.544  1.00 33.47  ? 135 HOH B O   1 
HETATM 7136 O O   . HOH J 3 .   ? 20.252  50.541 26.529 1.00 52.36  ? 136 HOH B O   1 
HETATM 7137 O O   . HOH J 3 .   ? 14.886  54.994 -0.568 1.00 63.81  ? 137 HOH B O   1 
HETATM 7138 O O   . HOH J 3 .   ? 25.782  55.773 21.903 1.00 40.28  ? 138 HOH B O   1 
HETATM 7139 O O   . HOH J 3 .   ? 20.701  63.512 9.821  1.00 41.68  ? 139 HOH B O   1 
HETATM 7140 O O   . HOH J 3 .   ? 23.986  67.111 15.888 1.00 41.05  ? 140 HOH B O   1 
HETATM 7141 O O   . HOH J 3 .   ? 13.534  56.089 2.352  1.00 47.35  ? 141 HOH B O   1 
HETATM 7142 O O   . HOH J 3 .   ? 14.912  70.124 11.916 1.00 49.61  ? 142 HOH B O   1 
HETATM 7143 O O   . HOH J 3 .   ? 14.038  67.500 8.652  1.00 56.10  ? 143 HOH B O   1 
HETATM 7144 O O   . HOH K 3 .   ? 33.864  11.672 25.348 1.00 33.56  ? 108 HOH C O   1 
HETATM 7145 O O   . HOH K 3 .   ? 30.109  21.073 37.798 1.00 41.35  ? 109 HOH C O   1 
HETATM 7146 O O   . HOH K 3 .   ? 44.993  19.349 42.394 1.00 32.47  ? 110 HOH C O   1 
HETATM 7147 O O   . HOH K 3 .   ? 28.723  13.603 39.207 1.00 26.36  ? 111 HOH C O   1 
HETATM 7148 O O   . HOH K 3 .   ? 46.539  22.158 33.972 1.00 32.76  ? 112 HOH C O   1 
HETATM 7149 O O   . HOH K 3 .   ? 39.761  37.807 28.775 1.00 44.87  ? 113 HOH C O   1 
HETATM 7150 O O   . HOH K 3 .   ? 25.019  47.465 38.323 1.00 67.27  ? 114 HOH C O   1 
HETATM 7151 O O   . HOH K 3 .   ? 26.518  17.772 30.055 1.00 50.71  ? 115 HOH C O   1 
HETATM 7152 O O   . HOH K 3 .   ? 41.636  31.789 47.416 1.00 26.82  ? 116 HOH C O   1 
HETATM 7153 O O   . HOH K 3 .   ? 20.532  28.912 40.406 1.00 50.16  ? 117 HOH C O   1 
HETATM 7154 O O   . HOH K 3 .   ? 19.522  35.988 42.028 1.00 46.97  ? 118 HOH C O   1 
HETATM 7155 O O   . HOH K 3 .   ? 48.896  13.495 28.090 1.00 37.75  ? 119 HOH C O   1 
HETATM 7156 O O   . HOH K 3 .   ? 26.441  19.979 48.330 1.00 35.18  ? 120 HOH C O   1 
HETATM 7157 O O   . HOH K 3 .   ? 24.685  31.678 49.907 1.00 40.38  ? 121 HOH C O   1 
HETATM 7158 O O   . HOH K 3 .   ? 26.922  35.169 33.976 1.00 59.29  ? 122 HOH C O   1 
HETATM 7159 O O   . HOH K 3 .   ? 38.570  14.579 42.653 1.00 33.70  ? 123 HOH C O   1 
HETATM 7160 O O   . HOH K 3 .   ? 37.666  33.508 50.446 1.00 69.41  ? 124 HOH C O   1 
HETATM 7161 O O   . HOH K 3 .   ? 36.370  15.406 41.616 1.00 30.45  ? 125 HOH C O   1 
HETATM 7162 O O   . HOH K 3 .   ? 41.241  13.889 44.118 1.00 53.58  ? 126 HOH C O   1 
HETATM 7163 O O   . HOH K 3 .   ? 40.436  23.373 49.135 1.00 51.40  ? 127 HOH C O   1 
HETATM 7164 O O   . HOH K 3 .   ? 33.360  33.174 48.494 1.00 50.71  ? 128 HOH C O   1 
HETATM 7165 O O   . HOH L 3 .   ? 42.190  24.566 51.570 1.00 11.08  ? 113 HOH D O   1 
HETATM 7166 O O   . HOH L 3 .   ? 43.129  12.383 45.073 1.00 20.03  ? 114 HOH D O   1 
HETATM 7167 O O   . HOH L 3 .   ? 48.677  20.064 33.928 1.00 21.00  ? 115 HOH D O   1 
HETATM 7168 O O   . HOH L 3 .   ? 43.215  11.589 58.885 1.00 17.93  ? 116 HOH D O   1 
HETATM 7169 O O   . HOH L 3 .   ? 60.996  27.551 52.337 1.00 60.90  ? 117 HOH D O   1 
HETATM 7170 O O   . HOH L 3 .   ? 41.031  13.557 58.483 1.00 55.65  ? 118 HOH D O   1 
HETATM 7171 O O   . HOH L 3 .   ? 61.706  32.341 45.407 1.00 27.78  ? 119 HOH D O   1 
HETATM 7172 O O   . HOH L 3 .   ? 53.069  8.008  36.318 1.00 16.62  ? 120 HOH D O   1 
HETATM 7173 O O   . HOH L 3 .   ? 61.209  12.471 45.780 1.00 26.69  ? 121 HOH D O   1 
HETATM 7174 O O   . HOH L 3 .   ? 47.965  23.333 63.165 1.00 37.22  ? 122 HOH D O   1 
HETATM 7175 O O   . HOH L 3 .   ? 71.168  27.916 43.775 1.00 18.78  ? 123 HOH D O   1 
HETATM 7176 O O   . HOH L 3 .   ? 45.844  23.463 65.853 1.00 48.35  ? 124 HOH D O   1 
HETATM 7177 O O   . HOH L 3 .   ? 66.138  22.962 45.795 1.00 39.87  ? 125 HOH D O   1 
HETATM 7178 O O   . HOH L 3 .   ? 45.625  4.780  48.204 1.00 30.42  ? 126 HOH D O   1 
HETATM 7179 O O   . HOH L 3 .   ? 57.191  7.291  48.682 1.00 33.02  ? 127 HOH D O   1 
HETATM 7180 O O   . HOH L 3 .   ? 62.005  30.015 50.075 1.00 38.11  ? 128 HOH D O   1 
HETATM 7181 O O   . HOH L 3 .   ? 52.028  20.796 58.653 1.00 44.57  ? 129 HOH D O   1 
HETATM 7182 O O   . HOH L 3 .   ? 53.208  31.078 50.365 1.00 57.98  ? 130 HOH D O   1 
HETATM 7183 O O   . HOH L 3 .   ? 50.210  30.920 43.214 1.00 45.90  ? 131 HOH D O   1 
HETATM 7184 O O   . HOH L 3 .   ? 53.836  4.110  42.318 1.00 52.36  ? 132 HOH D O   1 
HETATM 7185 O O   . HOH L 3 .   ? 41.644  18.123 68.213 1.00 36.77  ? 133 HOH D O   1 
HETATM 7186 O O   . HOH L 3 .   ? 61.593  37.866 49.060 1.00 52.37  ? 134 HOH D O   1 
HETATM 7187 O O   . HOH L 3 .   ? 58.787  28.632 51.207 1.00 47.38  ? 135 HOH D O   1 
HETATM 7188 O O   . HOH L 3 .   ? 54.775  16.554 59.245 1.00 25.56  ? 136 HOH D O   1 
HETATM 7189 O O   . HOH L 3 .   ? 57.037  31.461 49.260 1.00 49.96  ? 137 HOH D O   1 
HETATM 7190 O O   . HOH L 3 .   ? 66.122  22.951 48.682 1.00 65.91  ? 138 HOH D O   1 
HETATM 7191 O O   . HOH L 3 .   ? 44.385  5.571  58.050 1.00 55.65  ? 139 HOH D O   1 
HETATM 7192 O O   . HOH L 3 .   ? 55.320  4.174  46.714 1.00 40.85  ? 140 HOH D O   1 
HETATM 7193 O O   . HOH L 3 .   ? 59.015  6.557  53.544 1.00 51.11  ? 141 HOH D O   1 
HETATM 7194 O O   . HOH L 3 .   ? 56.683  6.290  56.729 1.00 48.85  ? 142 HOH D O   1 
HETATM 7195 O O   . HOH L 3 .   ? 49.635  31.478 47.649 1.00 49.17  ? 143 HOH D O   1 
HETATM 7196 O O   . HOH L 3 .   ? 58.616  12.486 30.932 1.00 40.55  ? 144 HOH D O   1 
HETATM 7197 O O   . HOH L 3 .   ? 59.172  35.912 48.156 1.00 40.39  ? 145 HOH D O   1 
HETATM 7198 O O   . HOH L 3 .   ? 55.474  34.429 48.329 1.00 41.25  ? 146 HOH D O   1 
HETATM 7199 O O   . HOH L 3 .   ? 61.272  33.566 47.787 1.00 37.05  ? 147 HOH D O   1 
HETATM 7200 O O   . HOH L 3 .   ? 35.739  24.745 56.426 1.00 58.37  ? 148 HOH D O   1 
HETATM 7201 O O   . HOH L 3 .   ? 44.392  7.093  38.042 1.00 52.00  ? 149 HOH D O   1 
HETATM 7202 O O   . HOH M 3 .   ? 84.643  60.960 44.042 1.00 39.78  ? 144 HOH E O   1 
HETATM 7203 O O   . HOH M 3 .   ? 93.830  49.998 32.643 1.00 52.66  ? 188 HOH E O   1 
HETATM 7204 O O   . HOH M 3 .   ? 88.052  58.491 51.260 1.00 55.37  ? 195 HOH E O   1 
HETATM 7205 O O   . HOH M 3 .   ? 91.451  58.827 35.534 1.00 37.68  ? 307 HOH E O   1 
HETATM 7206 O O   . HOH M 3 .   ? 92.382  54.880 46.470 1.00 43.59  ? 321 HOH E O   1 
HETATM 7207 O O   . HOH M 3 .   ? 81.203  54.630 45.464 1.00 33.87  ? 366 HOH E O   1 
HETATM 7208 O O   . HOH M 3 .   ? 84.149  53.749 45.478 1.00 32.35  ? 377 HOH E O   1 
HETATM 7209 O O   . HOH M 3 .   ? 69.148  43.733 54.451 1.00 70.89  ? 432 HOH E O   1 
HETATM 7210 O O   . HOH M 3 .   ? 95.513  40.788 45.144 1.00 93.04  ? 449 HOH E O   1 
HETATM 7211 O O   . HOH M 3 .   ? 78.911  55.840 43.925 1.00 50.18  ? 454 HOH E O   1 
HETATM 7212 O O   . HOH N 3 .   ? 51.970  39.058 35.009 1.00 27.48  ? 113 HOH F O   1 
HETATM 7213 O O   . HOH N 3 .   ? 76.698  44.693 35.756 1.00 23.19  ? 114 HOH F O   1 
HETATM 7214 O O   . HOH N 3 .   ? 77.022  57.376 43.759 1.00 34.25  ? 115 HOH F O   1 
HETATM 7215 O O   . HOH N 3 .   ? 71.454  34.983 45.190 1.00 21.58  ? 116 HOH F O   1 
HETATM 7216 O O   . HOH N 3 .   ? 75.454  36.767 44.134 1.00 33.83  ? 117 HOH F O   1 
HETATM 7217 O O   . HOH N 3 .   ? 75.947  50.162 43.060 1.00 49.88  ? 118 HOH F O   1 
HETATM 7218 O O   . HOH N 3 .   ? 54.969  53.829 42.630 1.00 55.95  ? 119 HOH F O   1 
HETATM 7219 O O   . HOH N 3 .   ? 69.514  38.794 47.055 1.00 51.25  ? 120 HOH F O   1 
HETATM 7220 O O   . HOH N 3 .   ? 74.000  42.246 32.976 1.00 59.59  ? 121 HOH F O   1 
HETATM 7221 O O   . HOH N 3 .   ? 57.593  44.399 46.992 1.00 52.54  ? 122 HOH F O   1 
HETATM 7222 O O   . HOH N 3 .   ? 69.346  60.696 43.183 1.00 36.86  ? 123 HOH F O   1 
HETATM 7223 O O   . HOH N 3 .   ? 58.418  42.384 42.835 1.00 36.17  ? 124 HOH F O   1 
HETATM 7224 O O   . HOH N 3 .   ? 73.277  55.441 29.711 1.00 39.75  ? 125 HOH F O   1 
HETATM 7225 O O   . HOH N 3 .   ? 53.495  38.386 43.536 1.00 54.75  ? 126 HOH F O   1 
HETATM 7226 O O   . HOH N 3 .   ? 62.045  32.902 36.131 1.00 49.18  ? 127 HOH F O   1 
HETATM 7227 O O   . HOH N 3 .   ? 56.925  37.410 45.683 1.00 66.62  ? 128 HOH F O   1 
HETATM 7228 O O   . HOH N 3 .   ? 73.475  49.233 53.903 1.00 55.10  ? 129 HOH F O   1 
HETATM 7229 O O   . HOH O 3 .   ? 95.188  39.663 3.648  1.00 43.02  ? 124 HOH G O   1 
HETATM 7230 O O   . HOH O 3 .   ? 97.072  32.778 16.372 1.00 62.49  ? 136 HOH G O   1 
HETATM 7231 O O   . HOH O 3 .   ? 78.687  34.303 20.841 1.00 48.37  ? 141 HOH G O   1 
HETATM 7232 O O   . HOH O 3 .   ? 102.292 35.916 17.596 1.00 42.41  ? 161 HOH G O   1 
HETATM 7233 O O   . HOH O 3 .   ? 89.860  32.714 28.613 1.00 44.78  ? 162 HOH G O   1 
HETATM 7234 O O   . HOH O 3 .   ? 95.511  34.877 16.083 1.00 27.24  ? 196 HOH G O   1 
HETATM 7235 O O   . HOH O 3 .   ? 97.012  31.698 28.704 1.00 61.29  ? 205 HOH G O   1 
HETATM 7236 O O   . HOH O 3 .   ? 95.824  43.040 14.783 1.00 34.76  ? 320 HOH G O   1 
HETATM 7237 O O   . HOH O 3 .   ? 97.161  46.394 15.354 1.00 62.46  ? 374 HOH G O   1 
HETATM 7238 O O   . HOH O 3 .   ? 78.476  40.655 19.027 1.00 56.06  ? 456 HOH G O   1 
HETATM 7239 O O   . HOH P 3 .   ? 83.114  1.726  26.312 1.00 31.32  ? 113 HOH H O   1 
HETATM 7240 O O   . HOH P 3 .   ? 99.659  28.345 18.498 1.00 25.27  ? 114 HOH H O   1 
HETATM 7241 O O   . HOH P 3 .   ? 75.920  18.515 26.309 1.00 39.59  ? 115 HOH H O   1 
HETATM 7242 O O   . HOH P 3 .   ? 98.219  29.872 17.048 1.00 53.19  ? 116 HOH H O   1 
HETATM 7243 O O   . HOH P 3 .   ? 98.027  24.395 31.796 1.00 35.58  ? 117 HOH H O   1 
HETATM 7244 O O   . HOH P 3 .   ? 87.008  26.581 25.664 1.00 34.01  ? 118 HOH H O   1 
HETATM 7245 O O   . HOH P 3 .   ? 77.882  10.228 33.018 1.00 44.47  ? 119 HOH H O   1 
HETATM 7246 O O   . HOH P 3 .   ? 92.612  23.270 7.278  1.00 34.24  ? 120 HOH H O   1 
HETATM 7247 O O   . HOH P 3 .   ? 93.724  17.235 7.901  1.00 53.44  ? 121 HOH H O   1 
HETATM 7248 O O   . HOH P 3 .   ? 98.706  12.444 26.858 1.00 41.27  ? 122 HOH H O   1 
HETATM 7249 O O   . HOH P 3 .   ? 79.576  24.186 17.344 1.00 40.45  ? 123 HOH H O   1 
HETATM 7250 O O   . HOH P 3 .   ? 82.868  2.877  18.465 1.00 70.33  ? 124 HOH H O   1 
HETATM 7251 O O   . HOH P 3 .   ? 86.476  8.178  18.198 1.00 37.19  ? 125 HOH H O   1 
HETATM 7252 O O   . HOH P 3 .   ? 92.392  26.777 18.167 1.00 45.78  ? 126 HOH H O   1 
HETATM 7253 O O   . HOH P 3 .   ? 84.029  15.893 10.757 1.00 51.64  ? 127 HOH H O   1 
HETATM 7254 O O   . HOH P 3 .   ? 88.600  7.578  14.910 1.00 41.71  ? 128 HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   MET 4   4   4   MET MET A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  MET 13  13  13  MET MET A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  GLN 17  17  17  GLN GLN A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  CYS 23  23  23  CYS CYS A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  SER 28  27  27  SER SER A A n 
A 1 29  LEU 29  27  27  LEU LEU A B n 
A 1 30  LEU 30  27  27  LEU LEU A C n 
A 1 31  ASN 31  27  27  ASN ASN A D n 
A 1 32  ILE 32  27  27  ILE ILE A E n 
A 1 33  SER 33  27  27  SER SER A F n 
A 1 34  ASN 34  28  28  ASN ASN A . n 
A 1 35  GLN 35  29  29  GLN GLN A . n 
A 1 36  LYS 36  30  30  LYS LYS A . n 
A 1 37  ASN 37  31  31  ASN ASN A . n 
A 1 38  TYR 38  32  32  TYR TYR A . n 
A 1 39  LEU 39  33  33  LEU LEU A . n 
A 1 40  ALA 40  34  34  ALA ALA A . n 
A 1 41  TRP 41  35  35  TRP TRP A . n 
A 1 42  TYR 42  36  36  TYR TYR A . n 
A 1 43  GLN 43  37  37  GLN GLN A . n 
A 1 44  GLN 44  38  38  GLN GLN A . n 
A 1 45  LYS 45  39  39  LYS LYS A . n 
A 1 46  PRO 46  40  40  PRO PRO A . n 
A 1 47  GLY 47  41  41  GLY GLY A . n 
A 1 48  GLN 48  42  42  GLN GLN A . n 
A 1 49  SER 49  43  43  SER SER A . n 
A 1 50  PRO 50  44  44  PRO PRO A . n 
A 1 51  LYS 51  45  45  LYS LYS A . n 
A 1 52  LEU 52  46  46  LEU LEU A . n 
A 1 53  LEU 53  47  47  LEU LEU A . n 
A 1 54  VAL 54  48  48  VAL VAL A . n 
A 1 55  TYR 55  49  49  TYR TYR A . n 
A 1 56  PHE 56  50  50  PHE PHE A . n 
A 1 57  ALA 57  51  51  ALA ALA A . n 
A 1 58  SER 58  52  52  SER SER A . n 
A 1 59  THR 59  53  53  THR THR A . n 
A 1 60  ARG 60  54  54  ARG ARG A . n 
A 1 61  GLU 61  55  55  GLU GLU A . n 
A 1 62  SER 62  56  56  SER SER A . n 
A 1 63  GLY 63  57  57  GLY GLY A . n 
A 1 64  VAL 64  58  58  VAL VAL A . n 
A 1 65  PRO 65  59  59  PRO PRO A . n 
A 1 66  ASP 66  60  60  ASP ASP A . n 
A 1 67  ARG 67  61  61  ARG ARG A . n 
A 1 68  PHE 68  62  62  PHE PHE A . n 
A 1 69  ILE 69  63  63  ILE ILE A . n 
A 1 70  GLY 70  64  64  GLY GLY A . n 
A 1 71  SER 71  65  65  SER SER A . n 
A 1 72  GLY 72  66  66  GLY GLY A . n 
A 1 73  SER 73  67  67  SER SER A . n 
A 1 74  GLY 74  68  68  GLY GLY A . n 
A 1 75  THR 75  69  69  THR THR A . n 
A 1 76  ASP 76  70  70  ASP ASP A . n 
A 1 77  PHE 77  71  71  PHE PHE A . n 
A 1 78  THR 78  72  72  THR THR A . n 
A 1 79  LEU 79  73  73  LEU LEU A . n 
A 1 80  THR 80  74  74  THR THR A . n 
A 1 81  ILE 81  75  75  ILE ILE A . n 
A 1 82  SER 82  76  76  SER SER A . n 
A 1 83  SER 83  77  77  SER SER A . n 
A 1 84  VAL 84  78  78  VAL VAL A . n 
A 1 85  GLN 85  79  79  GLN GLN A . n 
A 1 86  ALA 86  80  80  ALA ALA A . n 
A 1 87  GLU 87  81  81  GLU GLU A . n 
A 1 88  ASP 88  82  82  ASP ASP A . n 
A 1 89  GLN 89  83  83  GLN GLN A . n 
A 1 90  ALA 90  84  84  ALA ALA A . n 
A 1 91  ASP 91  85  85  ASP ASP A . n 
A 1 92  TYR 92  86  86  TYR TYR A . n 
A 1 93  PHE 93  87  87  PHE PHE A . n 
A 1 94  CYS 94  88  88  CYS CYS A . n 
A 1 95  GLN 95  89  89  GLN GLN A . n 
A 1 96  GLN 96  90  90  GLN GLN A . n 
A 1 97  HIS 97  91  91  HIS HIS A . n 
A 1 98  TYR 98  92  92  TYR TYR A . n 
A 1 99  ARG 99  93  93  ARG ARG A . n 
A 1 100 ALA 100 94  94  ALA ALA A . n 
A 1 101 PRO 101 95  95  PRO PRO A . n 
A 1 102 ARG 102 96  96  ARG ARG A . n 
A 1 103 THR 103 97  97  THR THR A . n 
A 1 104 PHE 104 98  98  PHE PHE A . n 
A 1 105 GLY 105 99  99  GLY GLY A . n 
A 1 106 GLY 106 100 100 GLY GLY A . n 
A 1 107 GLY 107 101 101 GLY GLY A . n 
A 1 108 THR 108 102 102 THR THR A . n 
A 1 109 LYS 109 103 103 LYS LYS A . n 
A 1 110 LEU 110 104 104 LEU LEU A . n 
A 1 111 GLU 111 105 105 GLU GLU A . n 
A 1 112 ILE 112 106 106 ILE ILE A . n 
A 1 113 LYS 113 107 107 LYS LYS A . n 
B 2 1   GLY 1   0   0   GLY GLY B . n 
B 2 2   GLN 2   1   1   GLN GLN B . n 
B 2 3   VAL 3   2   2   VAL VAL B . n 
B 2 4   GLN 4   3   3   GLN GLN B . n 
B 2 5   LEU 5   4   4   LEU LEU B . n 
B 2 6   VAL 6   5   5   VAL VAL B . n 
B 2 7   GLU 7   6   6   GLU GLU B . n 
B 2 8   SER 8   7   7   SER SER B . n 
B 2 9   GLY 9   8   8   GLY GLY B . n 
B 2 10  PRO 10  9   9   PRO PRO B . n 
B 2 11  GLY 11  10  10  GLY GLY B . n 
B 2 12  LEU 12  11  11  LEU LEU B . n 
B 2 13  VAL 13  12  12  VAL VAL B . n 
B 2 14  ALA 14  13  13  ALA ALA B . n 
B 2 15  PRO 15  14  14  PRO PRO B . n 
B 2 16  SER 16  15  15  SER SER B . n 
B 2 17  GLN 17  16  16  GLN GLN B . n 
B 2 18  SER 18  17  17  SER SER B . n 
B 2 19  LEU 19  18  18  LEU LEU B . n 
B 2 20  SER 20  19  19  SER SER B . n 
B 2 21  ILE 21  20  20  ILE ILE B . n 
B 2 22  THR 22  21  21  THR THR B . n 
B 2 23  CYS 23  22  22  CYS CYS B . n 
B 2 24  THR 24  23  23  THR THR B . n 
B 2 25  VAL 25  24  24  VAL VAL B . n 
B 2 26  SER 26  25  25  SER SER B . n 
B 2 27  GLY 27  26  26  GLY GLY B . n 
B 2 28  ILE 28  27  27  ILE ILE B . n 
B 2 29  SER 29  28  28  SER SER B . n 
B 2 30  LEU 30  29  29  LEU LEU B . n 
B 2 31  SER 31  30  30  SER SER B . n 
B 2 32  ARG 32  31  31  ARG ARG B . n 
B 2 33  TYR 33  32  32  TYR TYR B . n 
B 2 34  ASN 34  33  33  ASN ASN B . n 
B 2 35  VAL 35  34  34  VAL VAL B . n 
B 2 36  HIS 36  35  35  HIS HIS B . n 
B 2 37  TRP 37  36  36  TRP TRP B . n 
B 2 38  VAL 38  37  37  VAL VAL B . n 
B 2 39  ARG 39  38  38  ARG ARG B . n 
B 2 40  GLN 40  39  39  GLN GLN B . n 
B 2 41  SER 41  40  40  SER SER B . n 
B 2 42  PRO 42  41  41  PRO PRO B . n 
B 2 43  GLY 43  42  42  GLY GLY B . n 
B 2 44  LYS 44  43  43  LYS LYS B . n 
B 2 45  GLY 45  44  44  GLY GLY B . n 
B 2 46  LEU 46  45  45  LEU LEU B . n 
B 2 47  GLU 47  46  46  GLU GLU B . n 
B 2 48  TRP 48  47  47  TRP TRP B . n 
B 2 49  LEU 49  48  48  LEU LEU B . n 
B 2 50  GLY 50  49  49  GLY GLY B . n 
B 2 51  MET 51  50  50  MET MET B . n 
B 2 52  ILE 52  51  51  ILE ILE B . n 
B 2 53  TRP 53  52  52  TRP TRP B . n 
B 2 54  GLY 54  53  53  GLY GLY B . n 
B 2 55  GLY 55  54  54  GLY GLY B . n 
B 2 56  GLY 56  55  55  GLY GLY B . n 
B 2 57  SER 57  56  56  SER SER B . n 
B 2 58  ILE 58  57  57  ILE ILE B . n 
B 2 59  GLU 59  58  58  GLU GLU B . n 
B 2 60  TYR 60  59  59  TYR TYR B . n 
B 2 61  ASN 61  60  60  ASN ASN B . n 
B 2 62  PRO 62  61  61  PRO PRO B . n 
B 2 63  ALA 63  62  62  ALA ALA B . n 
B 2 64  LEU 64  63  63  LEU LEU B . n 
B 2 65  LYS 65  64  64  LYS LYS B . n 
B 2 66  SER 66  65  65  SER SER B . n 
B 2 67  ARG 67  66  66  ARG ARG B . n 
B 2 68  LEU 68  67  67  LEU LEU B . n 
B 2 69  SER 69  68  68  SER SER B . n 
B 2 70  ILE 70  69  69  ILE ILE B . n 
B 2 71  SER 71  70  70  SER SER B . n 
B 2 72  LYS 72  71  71  LYS LYS B . n 
B 2 73  ASP 73  72  72  ASP ASP B . n 
B 2 74  ASN 74  73  73  ASN ASN B . n 
B 2 75  SER 75  74  74  SER SER B . n 
B 2 76  LYS 76  75  75  LYS LYS B . n 
B 2 77  SER 77  76  76  SER SER B . n 
B 2 78  GLN 78  77  77  GLN GLN B . n 
B 2 79  ILE 79  78  78  ILE ILE B . n 
B 2 80  PHE 80  79  79  PHE PHE B . n 
B 2 81  LEU 81  80  80  LEU LEU B . n 
B 2 82  LYS 82  81  81  LYS LYS B . n 
B 2 83  MET 83  82  82  MET MET B . n 
B 2 84  ASN 84  82  82  ASN ASN B A n 
B 2 85  SER 85  82  82  SER SER B B n 
B 2 86  LEU 86  82  82  LEU LEU B C n 
B 2 87  GLN 87  83  83  GLN GLN B . n 
B 2 88  THR 88  84  84  THR THR B . n 
B 2 89  ASP 89  85  85  ASP ASP B . n 
B 2 90  ASP 90  86  86  ASP ASP B . n 
B 2 91  SER 91  87  87  SER SER B . n 
B 2 92  ALA 92  88  88  ALA ALA B . n 
B 2 93  MET 93  89  89  MET MET B . n 
B 2 94  TYR 94  90  90  TYR TYR B . n 
B 2 95  TYR 95  91  91  TYR TYR B . n 
B 2 96  CYS 96  92  92  CYS CYS B . n 
B 2 97  VAL 97  93  93  VAL VAL B . n 
B 2 98  SER 98  94  94  SER SER B . n 
B 2 99  TYR 99  95  95  TYR TYR B . n 
B 2 100 GLY 100 96  96  GLY GLY B . n 
B 2 101 TYR 101 97  97  TYR TYR B . n 
B 2 102 GLY 102 98  98  GLY GLY B . n 
B 2 103 GLY 103 99  99  GLY GLY B . n 
B 2 104 ASP 104 100 100 ASP ASP B . n 
B 2 105 ARG 105 100 100 ARG ARG B A n 
B 2 106 PHE 106 100 100 PHE PHE B B n 
B 2 107 SER 107 101 101 SER SER B . n 
B 2 108 TYR 108 102 102 TYR TYR B . n 
B 2 109 TRP 109 103 103 TRP TRP B . n 
B 2 110 GLY 110 104 104 GLY GLY B . n 
B 2 111 GLN 111 105 105 GLN GLN B . n 
B 2 112 GLY 112 106 106 GLY GLY B . n 
B 2 113 THR 113 107 107 THR THR B . n 
B 2 114 LEU 114 108 108 LEU LEU B . n 
B 2 115 VAL 115 109 109 VAL VAL B . n 
B 2 116 THR 116 110 110 THR THR B . n 
B 2 117 VAL 117 111 111 VAL VAL B . n 
B 2 118 SER 118 112 112 SER SER B . n 
C 1 1   ASP 1   1   1   ASP ASP C . n 
C 1 2   VAL 2   2   2   VAL VAL C . n 
C 1 3   VAL 3   3   3   VAL VAL C . n 
C 1 4   MET 4   4   4   MET MET C . n 
C 1 5   THR 5   5   5   THR THR C . n 
C 1 6   GLN 6   6   6   GLN GLN C . n 
C 1 7   THR 7   7   7   THR THR C . n 
C 1 8   PRO 8   8   8   PRO PRO C . n 
C 1 9   SER 9   9   9   SER SER C . n 
C 1 10  SER 10  10  10  SER SER C . n 
C 1 11  LEU 11  11  11  LEU LEU C . n 
C 1 12  ALA 12  12  12  ALA ALA C . n 
C 1 13  MET 13  13  13  MET MET C . n 
C 1 14  SER 14  14  14  SER SER C . n 
C 1 15  VAL 15  15  15  VAL VAL C . n 
C 1 16  GLY 16  16  16  GLY GLY C . n 
C 1 17  GLN 17  17  17  GLN GLN C . n 
C 1 18  LYS 18  18  18  LYS LYS C . n 
C 1 19  VAL 19  19  19  VAL VAL C . n 
C 1 20  THR 20  20  20  THR THR C . n 
C 1 21  MET 21  21  21  MET MET C . n 
C 1 22  SER 22  22  22  SER SER C . n 
C 1 23  CYS 23  23  23  CYS CYS C . n 
C 1 24  LYS 24  24  24  LYS LYS C . n 
C 1 25  SER 25  25  25  SER SER C . n 
C 1 26  SER 26  26  26  SER SER C . n 
C 1 27  GLN 27  27  27  GLN GLN C . n 
C 1 28  SER 28  27  27  SER SER C A n 
C 1 29  LEU 29  27  27  LEU LEU C B n 
C 1 30  LEU 30  27  27  LEU LEU C C n 
C 1 31  ASN 31  27  27  ASN ASN C D n 
C 1 32  ILE 32  27  27  ILE ILE C E n 
C 1 33  SER 33  27  27  SER SER C F n 
C 1 34  ASN 34  28  28  ASN ASN C . n 
C 1 35  GLN 35  29  29  GLN GLN C . n 
C 1 36  LYS 36  30  30  LYS LYS C . n 
C 1 37  ASN 37  31  31  ASN ASN C . n 
C 1 38  TYR 38  32  32  TYR TYR C . n 
C 1 39  LEU 39  33  33  LEU LEU C . n 
C 1 40  ALA 40  34  34  ALA ALA C . n 
C 1 41  TRP 41  35  35  TRP TRP C . n 
C 1 42  TYR 42  36  36  TYR TYR C . n 
C 1 43  GLN 43  37  37  GLN GLN C . n 
C 1 44  GLN 44  38  38  GLN GLN C . n 
C 1 45  LYS 45  39  39  LYS LYS C . n 
C 1 46  PRO 46  40  40  PRO PRO C . n 
C 1 47  GLY 47  41  41  GLY GLY C . n 
C 1 48  GLN 48  42  42  GLN GLN C . n 
C 1 49  SER 49  43  43  SER SER C . n 
C 1 50  PRO 50  44  44  PRO PRO C . n 
C 1 51  LYS 51  45  45  LYS LYS C . n 
C 1 52  LEU 52  46  46  LEU LEU C . n 
C 1 53  LEU 53  47  47  LEU LEU C . n 
C 1 54  VAL 54  48  48  VAL VAL C . n 
C 1 55  TYR 55  49  49  TYR TYR C . n 
C 1 56  PHE 56  50  50  PHE PHE C . n 
C 1 57  ALA 57  51  51  ALA ALA C . n 
C 1 58  SER 58  52  52  SER SER C . n 
C 1 59  THR 59  53  53  THR THR C . n 
C 1 60  ARG 60  54  54  ARG ARG C . n 
C 1 61  GLU 61  55  55  GLU GLU C . n 
C 1 62  SER 62  56  56  SER SER C . n 
C 1 63  GLY 63  57  57  GLY GLY C . n 
C 1 64  VAL 64  58  58  VAL VAL C . n 
C 1 65  PRO 65  59  59  PRO PRO C . n 
C 1 66  ASP 66  60  60  ASP ASP C . n 
C 1 67  ARG 67  61  61  ARG ARG C . n 
C 1 68  PHE 68  62  62  PHE PHE C . n 
C 1 69  ILE 69  63  63  ILE ILE C . n 
C 1 70  GLY 70  64  64  GLY GLY C . n 
C 1 71  SER 71  65  65  SER SER C . n 
C 1 72  GLY 72  66  66  GLY GLY C . n 
C 1 73  SER 73  67  67  SER SER C . n 
C 1 74  GLY 74  68  68  GLY GLY C . n 
C 1 75  THR 75  69  69  THR THR C . n 
C 1 76  ASP 76  70  70  ASP ASP C . n 
C 1 77  PHE 77  71  71  PHE PHE C . n 
C 1 78  THR 78  72  72  THR THR C . n 
C 1 79  LEU 79  73  73  LEU LEU C . n 
C 1 80  THR 80  74  74  THR THR C . n 
C 1 81  ILE 81  75  75  ILE ILE C . n 
C 1 82  SER 82  76  76  SER SER C . n 
C 1 83  SER 83  77  77  SER SER C . n 
C 1 84  VAL 84  78  78  VAL VAL C . n 
C 1 85  GLN 85  79  79  GLN GLN C . n 
C 1 86  ALA 86  80  80  ALA ALA C . n 
C 1 87  GLU 87  81  81  GLU GLU C . n 
C 1 88  ASP 88  82  82  ASP ASP C . n 
C 1 89  GLN 89  83  83  GLN GLN C . n 
C 1 90  ALA 90  84  84  ALA ALA C . n 
C 1 91  ASP 91  85  85  ASP ASP C . n 
C 1 92  TYR 92  86  86  TYR TYR C . n 
C 1 93  PHE 93  87  87  PHE PHE C . n 
C 1 94  CYS 94  88  88  CYS CYS C . n 
C 1 95  GLN 95  89  89  GLN GLN C . n 
C 1 96  GLN 96  90  90  GLN GLN C . n 
C 1 97  HIS 97  91  91  HIS HIS C . n 
C 1 98  TYR 98  92  92  TYR TYR C . n 
C 1 99  ARG 99  93  93  ARG ARG C . n 
C 1 100 ALA 100 94  94  ALA ALA C . n 
C 1 101 PRO 101 95  95  PRO PRO C . n 
C 1 102 ARG 102 96  96  ARG ARG C . n 
C 1 103 THR 103 97  97  THR THR C . n 
C 1 104 PHE 104 98  98  PHE PHE C . n 
C 1 105 GLY 105 99  99  GLY GLY C . n 
C 1 106 GLY 106 100 100 GLY GLY C . n 
C 1 107 GLY 107 101 101 GLY GLY C . n 
C 1 108 THR 108 102 102 THR THR C . n 
C 1 109 LYS 109 103 103 LYS LYS C . n 
C 1 110 LEU 110 104 104 LEU LEU C . n 
C 1 111 GLU 111 105 105 GLU GLU C . n 
C 1 112 ILE 112 106 106 ILE ILE C . n 
C 1 113 LYS 113 107 107 LYS LYS C . n 
D 2 1   GLY 1   0   0   GLY GLY D . n 
D 2 2   GLN 2   1   1   GLN GLN D . n 
D 2 3   VAL 3   2   2   VAL VAL D . n 
D 2 4   GLN 4   3   3   GLN GLN D . n 
D 2 5   LEU 5   4   4   LEU LEU D . n 
D 2 6   VAL 6   5   5   VAL VAL D . n 
D 2 7   GLU 7   6   6   GLU GLU D . n 
D 2 8   SER 8   7   7   SER SER D . n 
D 2 9   GLY 9   8   8   GLY GLY D . n 
D 2 10  PRO 10  9   9   PRO PRO D . n 
D 2 11  GLY 11  10  10  GLY GLY D . n 
D 2 12  LEU 12  11  11  LEU LEU D . n 
D 2 13  VAL 13  12  12  VAL VAL D . n 
D 2 14  ALA 14  13  13  ALA ALA D . n 
D 2 15  PRO 15  14  14  PRO PRO D . n 
D 2 16  SER 16  15  15  SER SER D . n 
D 2 17  GLN 17  16  16  GLN GLN D . n 
D 2 18  SER 18  17  17  SER SER D . n 
D 2 19  LEU 19  18  18  LEU LEU D . n 
D 2 20  SER 20  19  19  SER SER D . n 
D 2 21  ILE 21  20  20  ILE ILE D . n 
D 2 22  THR 22  21  21  THR THR D . n 
D 2 23  CYS 23  22  22  CYS CYS D . n 
D 2 24  THR 24  23  23  THR THR D . n 
D 2 25  VAL 25  24  24  VAL VAL D . n 
D 2 26  SER 26  25  25  SER SER D . n 
D 2 27  GLY 27  26  26  GLY GLY D . n 
D 2 28  ILE 28  27  27  ILE ILE D . n 
D 2 29  SER 29  28  28  SER SER D . n 
D 2 30  LEU 30  29  29  LEU LEU D . n 
D 2 31  SER 31  30  30  SER SER D . n 
D 2 32  ARG 32  31  31  ARG ARG D . n 
D 2 33  TYR 33  32  32  TYR TYR D . n 
D 2 34  ASN 34  33  33  ASN ASN D . n 
D 2 35  VAL 35  34  34  VAL VAL D . n 
D 2 36  HIS 36  35  35  HIS HIS D . n 
D 2 37  TRP 37  36  36  TRP TRP D . n 
D 2 38  VAL 38  37  37  VAL VAL D . n 
D 2 39  ARG 39  38  38  ARG ARG D . n 
D 2 40  GLN 40  39  39  GLN GLN D . n 
D 2 41  SER 41  40  40  SER SER D . n 
D 2 42  PRO 42  41  41  PRO PRO D . n 
D 2 43  GLY 43  42  42  GLY GLY D . n 
D 2 44  LYS 44  43  43  LYS LYS D . n 
D 2 45  GLY 45  44  44  GLY GLY D . n 
D 2 46  LEU 46  45  45  LEU LEU D . n 
D 2 47  GLU 47  46  46  GLU GLU D . n 
D 2 48  TRP 48  47  47  TRP TRP D . n 
D 2 49  LEU 49  48  48  LEU LEU D . n 
D 2 50  GLY 50  49  49  GLY GLY D . n 
D 2 51  MET 51  50  50  MET MET D . n 
D 2 52  ILE 52  51  51  ILE ILE D . n 
D 2 53  TRP 53  52  52  TRP TRP D . n 
D 2 54  GLY 54  53  53  GLY GLY D . n 
D 2 55  GLY 55  54  54  GLY GLY D . n 
D 2 56  GLY 56  55  55  GLY GLY D . n 
D 2 57  SER 57  56  56  SER SER D . n 
D 2 58  ILE 58  57  57  ILE ILE D . n 
D 2 59  GLU 59  58  58  GLU GLU D . n 
D 2 60  TYR 60  59  59  TYR TYR D . n 
D 2 61  ASN 61  60  60  ASN ASN D . n 
D 2 62  PRO 62  61  61  PRO PRO D . n 
D 2 63  ALA 63  62  62  ALA ALA D . n 
D 2 64  LEU 64  63  63  LEU LEU D . n 
D 2 65  LYS 65  64  64  LYS LYS D . n 
D 2 66  SER 66  65  65  SER SER D . n 
D 2 67  ARG 67  66  66  ARG ARG D . n 
D 2 68  LEU 68  67  67  LEU LEU D . n 
D 2 69  SER 69  68  68  SER SER D . n 
D 2 70  ILE 70  69  69  ILE ILE D . n 
D 2 71  SER 71  70  70  SER SER D . n 
D 2 72  LYS 72  71  71  LYS LYS D . n 
D 2 73  ASP 73  72  72  ASP ASP D . n 
D 2 74  ASN 74  73  73  ASN ASN D . n 
D 2 75  SER 75  74  74  SER SER D . n 
D 2 76  LYS 76  75  75  LYS LYS D . n 
D 2 77  SER 77  76  76  SER SER D . n 
D 2 78  GLN 78  77  77  GLN GLN D . n 
D 2 79  ILE 79  78  78  ILE ILE D . n 
D 2 80  PHE 80  79  79  PHE PHE D . n 
D 2 81  LEU 81  80  80  LEU LEU D . n 
D 2 82  LYS 82  81  81  LYS LYS D . n 
D 2 83  MET 83  82  82  MET MET D . n 
D 2 84  ASN 84  82  82  ASN ASN D A n 
D 2 85  SER 85  82  82  SER SER D B n 
D 2 86  LEU 86  82  82  LEU LEU D C n 
D 2 87  GLN 87  83  83  GLN GLN D . n 
D 2 88  THR 88  84  84  THR THR D . n 
D 2 89  ASP 89  85  85  ASP ASP D . n 
D 2 90  ASP 90  86  86  ASP ASP D . n 
D 2 91  SER 91  87  87  SER SER D . n 
D 2 92  ALA 92  88  88  ALA ALA D . n 
D 2 93  MET 93  89  89  MET MET D . n 
D 2 94  TYR 94  90  90  TYR TYR D . n 
D 2 95  TYR 95  91  91  TYR TYR D . n 
D 2 96  CYS 96  92  92  CYS CYS D . n 
D 2 97  VAL 97  93  93  VAL VAL D . n 
D 2 98  SER 98  94  94  SER SER D . n 
D 2 99  TYR 99  95  95  TYR TYR D . n 
D 2 100 GLY 100 96  96  GLY GLY D . n 
D 2 101 TYR 101 97  97  TYR TYR D . n 
D 2 102 GLY 102 98  98  GLY GLY D . n 
D 2 103 GLY 103 99  99  GLY GLY D . n 
D 2 104 ASP 104 100 100 ASP ASP D . n 
D 2 105 ARG 105 100 100 ARG ARG D A n 
D 2 106 PHE 106 100 100 PHE PHE D B n 
D 2 107 SER 107 101 101 SER SER D . n 
D 2 108 TYR 108 102 102 TYR TYR D . n 
D 2 109 TRP 109 103 103 TRP TRP D . n 
D 2 110 GLY 110 104 104 GLY GLY D . n 
D 2 111 GLN 111 105 105 GLN GLN D . n 
D 2 112 GLY 112 106 106 GLY GLY D . n 
D 2 113 THR 113 107 107 THR THR D . n 
D 2 114 LEU 114 108 108 LEU LEU D . n 
D 2 115 VAL 115 109 109 VAL VAL D . n 
D 2 116 THR 116 110 110 THR THR D . n 
D 2 117 VAL 117 111 111 VAL VAL D . n 
D 2 118 SER 118 112 112 SER SER D . n 
E 1 1   ASP 1   1   1   ASP ASP E . n 
E 1 2   VAL 2   2   2   VAL VAL E . n 
E 1 3   VAL 3   3   3   VAL VAL E . n 
E 1 4   MET 4   4   4   MET MET E . n 
E 1 5   THR 5   5   5   THR THR E . n 
E 1 6   GLN 6   6   6   GLN GLN E . n 
E 1 7   THR 7   7   7   THR THR E . n 
E 1 8   PRO 8   8   8   PRO PRO E . n 
E 1 9   SER 9   9   9   SER SER E . n 
E 1 10  SER 10  10  10  SER SER E . n 
E 1 11  LEU 11  11  11  LEU LEU E . n 
E 1 12  ALA 12  12  12  ALA ALA E . n 
E 1 13  MET 13  13  13  MET MET E . n 
E 1 14  SER 14  14  14  SER SER E . n 
E 1 15  VAL 15  15  15  VAL VAL E . n 
E 1 16  GLY 16  16  16  GLY GLY E . n 
E 1 17  GLN 17  17  17  GLN GLN E . n 
E 1 18  LYS 18  18  18  LYS LYS E . n 
E 1 19  VAL 19  19  19  VAL VAL E . n 
E 1 20  THR 20  20  20  THR THR E . n 
E 1 21  MET 21  21  21  MET MET E . n 
E 1 22  SER 22  22  22  SER SER E . n 
E 1 23  CYS 23  23  23  CYS CYS E . n 
E 1 24  LYS 24  24  24  LYS LYS E . n 
E 1 25  SER 25  25  25  SER SER E . n 
E 1 26  SER 26  26  26  SER SER E . n 
E 1 27  GLN 27  27  27  GLN GLN E . n 
E 1 28  SER 28  27  27  SER SER E A n 
E 1 29  LEU 29  27  27  LEU LEU E B n 
E 1 30  LEU 30  27  27  LEU LEU E C n 
E 1 31  ASN 31  27  27  ASN ASN E D n 
E 1 32  ILE 32  27  27  ILE ILE E E n 
E 1 33  SER 33  27  27  SER SER E F n 
E 1 34  ASN 34  28  28  ASN ASN E . n 
E 1 35  GLN 35  29  29  GLN GLN E . n 
E 1 36  LYS 36  30  30  LYS LYS E . n 
E 1 37  ASN 37  31  31  ASN ASN E . n 
E 1 38  TYR 38  32  32  TYR TYR E . n 
E 1 39  LEU 39  33  33  LEU LEU E . n 
E 1 40  ALA 40  34  34  ALA ALA E . n 
E 1 41  TRP 41  35  35  TRP TRP E . n 
E 1 42  TYR 42  36  36  TYR TYR E . n 
E 1 43  GLN 43  37  37  GLN GLN E . n 
E 1 44  GLN 44  38  38  GLN GLN E . n 
E 1 45  LYS 45  39  39  LYS LYS E . n 
E 1 46  PRO 46  40  40  PRO PRO E . n 
E 1 47  GLY 47  41  41  GLY GLY E . n 
E 1 48  GLN 48  42  42  GLN GLN E . n 
E 1 49  SER 49  43  43  SER SER E . n 
E 1 50  PRO 50  44  44  PRO PRO E . n 
E 1 51  LYS 51  45  45  LYS LYS E . n 
E 1 52  LEU 52  46  46  LEU LEU E . n 
E 1 53  LEU 53  47  47  LEU LEU E . n 
E 1 54  VAL 54  48  48  VAL VAL E . n 
E 1 55  TYR 55  49  49  TYR TYR E . n 
E 1 56  PHE 56  50  50  PHE PHE E . n 
E 1 57  ALA 57  51  51  ALA ALA E . n 
E 1 58  SER 58  52  52  SER SER E . n 
E 1 59  THR 59  53  53  THR THR E . n 
E 1 60  ARG 60  54  54  ARG ARG E . n 
E 1 61  GLU 61  55  55  GLU GLU E . n 
E 1 62  SER 62  56  56  SER SER E . n 
E 1 63  GLY 63  57  57  GLY GLY E . n 
E 1 64  VAL 64  58  58  VAL VAL E . n 
E 1 65  PRO 65  59  59  PRO PRO E . n 
E 1 66  ASP 66  60  60  ASP ASP E . n 
E 1 67  ARG 67  61  61  ARG ARG E . n 
E 1 68  PHE 68  62  62  PHE PHE E . n 
E 1 69  ILE 69  63  63  ILE ILE E . n 
E 1 70  GLY 70  64  64  GLY GLY E . n 
E 1 71  SER 71  65  65  SER SER E . n 
E 1 72  GLY 72  66  66  GLY GLY E . n 
E 1 73  SER 73  67  67  SER SER E . n 
E 1 74  GLY 74  68  68  GLY GLY E . n 
E 1 75  THR 75  69  69  THR THR E . n 
E 1 76  ASP 76  70  70  ASP ASP E . n 
E 1 77  PHE 77  71  71  PHE PHE E . n 
E 1 78  THR 78  72  72  THR THR E . n 
E 1 79  LEU 79  73  73  LEU LEU E . n 
E 1 80  THR 80  74  74  THR THR E . n 
E 1 81  ILE 81  75  75  ILE ILE E . n 
E 1 82  SER 82  76  76  SER SER E . n 
E 1 83  SER 83  77  77  SER SER E . n 
E 1 84  VAL 84  78  78  VAL VAL E . n 
E 1 85  GLN 85  79  79  GLN GLN E . n 
E 1 86  ALA 86  80  80  ALA ALA E . n 
E 1 87  GLU 87  81  81  GLU GLU E . n 
E 1 88  ASP 88  82  82  ASP ASP E . n 
E 1 89  GLN 89  83  83  GLN GLN E . n 
E 1 90  ALA 90  84  84  ALA ALA E . n 
E 1 91  ASP 91  85  85  ASP ASP E . n 
E 1 92  TYR 92  86  86  TYR TYR E . n 
E 1 93  PHE 93  87  87  PHE PHE E . n 
E 1 94  CYS 94  88  88  CYS CYS E . n 
E 1 95  GLN 95  89  89  GLN GLN E . n 
E 1 96  GLN 96  90  90  GLN GLN E . n 
E 1 97  HIS 97  91  91  HIS HIS E . n 
E 1 98  TYR 98  92  92  TYR TYR E . n 
E 1 99  ARG 99  93  93  ARG ARG E . n 
E 1 100 ALA 100 94  94  ALA ALA E . n 
E 1 101 PRO 101 95  95  PRO PRO E . n 
E 1 102 ARG 102 96  96  ARG ARG E . n 
E 1 103 THR 103 97  97  THR THR E . n 
E 1 104 PHE 104 98  98  PHE PHE E . n 
E 1 105 GLY 105 99  99  GLY GLY E . n 
E 1 106 GLY 106 100 100 GLY GLY E . n 
E 1 107 GLY 107 101 101 GLY GLY E . n 
E 1 108 THR 108 102 102 THR THR E . n 
E 1 109 LYS 109 103 103 LYS LYS E . n 
E 1 110 LEU 110 104 104 LEU LEU E . n 
E 1 111 GLU 111 105 105 GLU GLU E . n 
E 1 112 ILE 112 106 106 ILE ILE E . n 
E 1 113 LYS 113 107 107 LYS LYS E . n 
F 2 1   GLY 1   0   0   GLY GLY F . n 
F 2 2   GLN 2   1   1   GLN GLN F . n 
F 2 3   VAL 3   2   2   VAL VAL F . n 
F 2 4   GLN 4   3   3   GLN GLN F . n 
F 2 5   LEU 5   4   4   LEU LEU F . n 
F 2 6   VAL 6   5   5   VAL VAL F . n 
F 2 7   GLU 7   6   6   GLU GLU F . n 
F 2 8   SER 8   7   7   SER SER F . n 
F 2 9   GLY 9   8   8   GLY GLY F . n 
F 2 10  PRO 10  9   9   PRO PRO F . n 
F 2 11  GLY 11  10  10  GLY GLY F . n 
F 2 12  LEU 12  11  11  LEU LEU F . n 
F 2 13  VAL 13  12  12  VAL VAL F . n 
F 2 14  ALA 14  13  13  ALA ALA F . n 
F 2 15  PRO 15  14  14  PRO PRO F . n 
F 2 16  SER 16  15  15  SER SER F . n 
F 2 17  GLN 17  16  16  GLN GLN F . n 
F 2 18  SER 18  17  17  SER SER F . n 
F 2 19  LEU 19  18  18  LEU LEU F . n 
F 2 20  SER 20  19  19  SER SER F . n 
F 2 21  ILE 21  20  20  ILE ILE F . n 
F 2 22  THR 22  21  21  THR THR F . n 
F 2 23  CYS 23  22  22  CYS CYS F . n 
F 2 24  THR 24  23  23  THR THR F . n 
F 2 25  VAL 25  24  24  VAL VAL F . n 
F 2 26  SER 26  25  25  SER SER F . n 
F 2 27  GLY 27  26  26  GLY GLY F . n 
F 2 28  ILE 28  27  27  ILE ILE F . n 
F 2 29  SER 29  28  28  SER SER F . n 
F 2 30  LEU 30  29  29  LEU LEU F . n 
F 2 31  SER 31  30  30  SER SER F . n 
F 2 32  ARG 32  31  31  ARG ARG F . n 
F 2 33  TYR 33  32  32  TYR TYR F . n 
F 2 34  ASN 34  33  33  ASN ASN F . n 
F 2 35  VAL 35  34  34  VAL VAL F . n 
F 2 36  HIS 36  35  35  HIS HIS F . n 
F 2 37  TRP 37  36  36  TRP TRP F . n 
F 2 38  VAL 38  37  37  VAL VAL F . n 
F 2 39  ARG 39  38  38  ARG ARG F . n 
F 2 40  GLN 40  39  39  GLN GLN F . n 
F 2 41  SER 41  40  40  SER SER F . n 
F 2 42  PRO 42  41  41  PRO PRO F . n 
F 2 43  GLY 43  42  42  GLY GLY F . n 
F 2 44  LYS 44  43  43  LYS LYS F . n 
F 2 45  GLY 45  44  44  GLY GLY F . n 
F 2 46  LEU 46  45  45  LEU LEU F . n 
F 2 47  GLU 47  46  46  GLU GLU F . n 
F 2 48  TRP 48  47  47  TRP TRP F . n 
F 2 49  LEU 49  48  48  LEU LEU F . n 
F 2 50  GLY 50  49  49  GLY GLY F . n 
F 2 51  MET 51  50  50  MET MET F . n 
F 2 52  ILE 52  51  51  ILE ILE F . n 
F 2 53  TRP 53  52  52  TRP TRP F . n 
F 2 54  GLY 54  53  53  GLY GLY F . n 
F 2 55  GLY 55  54  54  GLY GLY F . n 
F 2 56  GLY 56  55  55  GLY GLY F . n 
F 2 57  SER 57  56  56  SER SER F . n 
F 2 58  ILE 58  57  57  ILE ILE F . n 
F 2 59  GLU 59  58  58  GLU GLU F . n 
F 2 60  TYR 60  59  59  TYR TYR F . n 
F 2 61  ASN 61  60  60  ASN ASN F . n 
F 2 62  PRO 62  61  61  PRO PRO F . n 
F 2 63  ALA 63  62  62  ALA ALA F . n 
F 2 64  LEU 64  63  63  LEU LEU F . n 
F 2 65  LYS 65  64  64  LYS LYS F . n 
F 2 66  SER 66  65  65  SER SER F . n 
F 2 67  ARG 67  66  66  ARG ARG F . n 
F 2 68  LEU 68  67  67  LEU LEU F . n 
F 2 69  SER 69  68  68  SER SER F . n 
F 2 70  ILE 70  69  69  ILE ILE F . n 
F 2 71  SER 71  70  70  SER SER F . n 
F 2 72  LYS 72  71  71  LYS LYS F . n 
F 2 73  ASP 73  72  72  ASP ASP F . n 
F 2 74  ASN 74  73  73  ASN ASN F . n 
F 2 75  SER 75  74  74  SER SER F . n 
F 2 76  LYS 76  75  75  LYS LYS F . n 
F 2 77  SER 77  76  76  SER SER F . n 
F 2 78  GLN 78  77  77  GLN GLN F . n 
F 2 79  ILE 79  78  78  ILE ILE F . n 
F 2 80  PHE 80  79  79  PHE PHE F . n 
F 2 81  LEU 81  80  80  LEU LEU F . n 
F 2 82  LYS 82  81  81  LYS LYS F . n 
F 2 83  MET 83  82  82  MET MET F . n 
F 2 84  ASN 84  82  82  ASN ASN F A n 
F 2 85  SER 85  82  82  SER SER F B n 
F 2 86  LEU 86  82  82  LEU LEU F C n 
F 2 87  GLN 87  83  83  GLN GLN F . n 
F 2 88  THR 88  84  84  THR THR F . n 
F 2 89  ASP 89  85  85  ASP ASP F . n 
F 2 90  ASP 90  86  86  ASP ASP F . n 
F 2 91  SER 91  87  87  SER SER F . n 
F 2 92  ALA 92  88  88  ALA ALA F . n 
F 2 93  MET 93  89  89  MET MET F . n 
F 2 94  TYR 94  90  90  TYR TYR F . n 
F 2 95  TYR 95  91  91  TYR TYR F . n 
F 2 96  CYS 96  92  92  CYS CYS F . n 
F 2 97  VAL 97  93  93  VAL VAL F . n 
F 2 98  SER 98  94  94  SER SER F . n 
F 2 99  TYR 99  95  95  TYR TYR F . n 
F 2 100 GLY 100 96  96  GLY GLY F . n 
F 2 101 TYR 101 97  97  TYR TYR F . n 
F 2 102 GLY 102 98  98  GLY GLY F . n 
F 2 103 GLY 103 99  99  GLY GLY F . n 
F 2 104 ASP 104 100 100 ASP ASP F . n 
F 2 105 ARG 105 100 100 ARG ARG F A n 
F 2 106 PHE 106 100 100 PHE PHE F B n 
F 2 107 SER 107 101 101 SER SER F . n 
F 2 108 TYR 108 102 102 TYR TYR F . n 
F 2 109 TRP 109 103 103 TRP TRP F . n 
F 2 110 GLY 110 104 104 GLY GLY F . n 
F 2 111 GLN 111 105 105 GLN GLN F . n 
F 2 112 GLY 112 106 106 GLY GLY F . n 
F 2 113 THR 113 107 107 THR THR F . n 
F 2 114 LEU 114 108 108 LEU LEU F . n 
F 2 115 VAL 115 109 109 VAL VAL F . n 
F 2 116 THR 116 110 110 THR THR F . n 
F 2 117 VAL 117 111 111 VAL VAL F . n 
F 2 118 SER 118 112 112 SER SER F . n 
G 1 1   ASP 1   1   1   ASP ASP G . n 
G 1 2   VAL 2   2   2   VAL VAL G . n 
G 1 3   VAL 3   3   3   VAL VAL G . n 
G 1 4   MET 4   4   4   MET MET G . n 
G 1 5   THR 5   5   5   THR THR G . n 
G 1 6   GLN 6   6   6   GLN GLN G . n 
G 1 7   THR 7   7   7   THR THR G . n 
G 1 8   PRO 8   8   8   PRO PRO G . n 
G 1 9   SER 9   9   9   SER SER G . n 
G 1 10  SER 10  10  10  SER SER G . n 
G 1 11  LEU 11  11  11  LEU LEU G . n 
G 1 12  ALA 12  12  12  ALA ALA G . n 
G 1 13  MET 13  13  13  MET MET G . n 
G 1 14  SER 14  14  14  SER SER G . n 
G 1 15  VAL 15  15  15  VAL VAL G . n 
G 1 16  GLY 16  16  16  GLY GLY G . n 
G 1 17  GLN 17  17  17  GLN GLN G . n 
G 1 18  LYS 18  18  18  LYS LYS G . n 
G 1 19  VAL 19  19  19  VAL VAL G . n 
G 1 20  THR 20  20  20  THR THR G . n 
G 1 21  MET 21  21  21  MET MET G . n 
G 1 22  SER 22  22  22  SER SER G . n 
G 1 23  CYS 23  23  23  CYS CYS G . n 
G 1 24  LYS 24  24  24  LYS LYS G . n 
G 1 25  SER 25  25  25  SER SER G . n 
G 1 26  SER 26  26  26  SER SER G . n 
G 1 27  GLN 27  27  27  GLN GLN G . n 
G 1 28  SER 28  27  27  SER SER G A n 
G 1 29  LEU 29  27  27  LEU LEU G B n 
G 1 30  LEU 30  27  27  LEU LEU G C n 
G 1 31  ASN 31  27  27  ASN ASN G D n 
G 1 32  ILE 32  27  27  ILE ILE G E n 
G 1 33  SER 33  27  27  SER SER G F n 
G 1 34  ASN 34  28  28  ASN ASN G . n 
G 1 35  GLN 35  29  29  GLN GLN G . n 
G 1 36  LYS 36  30  30  LYS LYS G . n 
G 1 37  ASN 37  31  31  ASN ASN G . n 
G 1 38  TYR 38  32  32  TYR TYR G . n 
G 1 39  LEU 39  33  33  LEU LEU G . n 
G 1 40  ALA 40  34  34  ALA ALA G . n 
G 1 41  TRP 41  35  35  TRP TRP G . n 
G 1 42  TYR 42  36  36  TYR TYR G . n 
G 1 43  GLN 43  37  37  GLN GLN G . n 
G 1 44  GLN 44  38  38  GLN GLN G . n 
G 1 45  LYS 45  39  39  LYS LYS G . n 
G 1 46  PRO 46  40  40  PRO PRO G . n 
G 1 47  GLY 47  41  41  GLY GLY G . n 
G 1 48  GLN 48  42  42  GLN GLN G . n 
G 1 49  SER 49  43  43  SER SER G . n 
G 1 50  PRO 50  44  44  PRO PRO G . n 
G 1 51  LYS 51  45  45  LYS LYS G . n 
G 1 52  LEU 52  46  46  LEU LEU G . n 
G 1 53  LEU 53  47  47  LEU LEU G . n 
G 1 54  VAL 54  48  48  VAL VAL G . n 
G 1 55  TYR 55  49  49  TYR TYR G . n 
G 1 56  PHE 56  50  50  PHE PHE G . n 
G 1 57  ALA 57  51  51  ALA ALA G . n 
G 1 58  SER 58  52  52  SER SER G . n 
G 1 59  THR 59  53  53  THR THR G . n 
G 1 60  ARG 60  54  54  ARG ARG G . n 
G 1 61  GLU 61  55  55  GLU GLU G . n 
G 1 62  SER 62  56  56  SER SER G . n 
G 1 63  GLY 63  57  57  GLY GLY G . n 
G 1 64  VAL 64  58  58  VAL VAL G . n 
G 1 65  PRO 65  59  59  PRO PRO G . n 
G 1 66  ASP 66  60  60  ASP ASP G . n 
G 1 67  ARG 67  61  61  ARG ARG G . n 
G 1 68  PHE 68  62  62  PHE PHE G . n 
G 1 69  ILE 69  63  63  ILE ILE G . n 
G 1 70  GLY 70  64  64  GLY GLY G . n 
G 1 71  SER 71  65  65  SER SER G . n 
G 1 72  GLY 72  66  66  GLY GLY G . n 
G 1 73  SER 73  67  67  SER SER G . n 
G 1 74  GLY 74  68  68  GLY GLY G . n 
G 1 75  THR 75  69  69  THR THR G . n 
G 1 76  ASP 76  70  70  ASP ASP G . n 
G 1 77  PHE 77  71  71  PHE PHE G . n 
G 1 78  THR 78  72  72  THR THR G . n 
G 1 79  LEU 79  73  73  LEU LEU G . n 
G 1 80  THR 80  74  74  THR THR G . n 
G 1 81  ILE 81  75  75  ILE ILE G . n 
G 1 82  SER 82  76  76  SER SER G . n 
G 1 83  SER 83  77  77  SER SER G . n 
G 1 84  VAL 84  78  78  VAL VAL G . n 
G 1 85  GLN 85  79  79  GLN GLN G . n 
G 1 86  ALA 86  80  80  ALA ALA G . n 
G 1 87  GLU 87  81  81  GLU GLU G . n 
G 1 88  ASP 88  82  82  ASP ASP G . n 
G 1 89  GLN 89  83  83  GLN GLN G . n 
G 1 90  ALA 90  84  84  ALA ALA G . n 
G 1 91  ASP 91  85  85  ASP ASP G . n 
G 1 92  TYR 92  86  86  TYR TYR G . n 
G 1 93  PHE 93  87  87  PHE PHE G . n 
G 1 94  CYS 94  88  88  CYS CYS G . n 
G 1 95  GLN 95  89  89  GLN GLN G . n 
G 1 96  GLN 96  90  90  GLN GLN G . n 
G 1 97  HIS 97  91  91  HIS HIS G . n 
G 1 98  TYR 98  92  92  TYR TYR G . n 
G 1 99  ARG 99  93  93  ARG ARG G . n 
G 1 100 ALA 100 94  94  ALA ALA G . n 
G 1 101 PRO 101 95  95  PRO PRO G . n 
G 1 102 ARG 102 96  96  ARG ARG G . n 
G 1 103 THR 103 97  97  THR THR G . n 
G 1 104 PHE 104 98  98  PHE PHE G . n 
G 1 105 GLY 105 99  99  GLY GLY G . n 
G 1 106 GLY 106 100 100 GLY GLY G . n 
G 1 107 GLY 107 101 101 GLY GLY G . n 
G 1 108 THR 108 102 102 THR THR G . n 
G 1 109 LYS 109 103 103 LYS LYS G . n 
G 1 110 LEU 110 104 104 LEU LEU G . n 
G 1 111 GLU 111 105 105 GLU GLU G . n 
G 1 112 ILE 112 106 106 ILE ILE G . n 
G 1 113 LYS 113 107 107 LYS LYS G . n 
H 2 1   GLY 1   0   0   GLY GLY H . n 
H 2 2   GLN 2   1   1   GLN GLN H . n 
H 2 3   VAL 3   2   2   VAL VAL H . n 
H 2 4   GLN 4   3   3   GLN GLN H . n 
H 2 5   LEU 5   4   4   LEU LEU H . n 
H 2 6   VAL 6   5   5   VAL VAL H . n 
H 2 7   GLU 7   6   6   GLU GLU H . n 
H 2 8   SER 8   7   7   SER SER H . n 
H 2 9   GLY 9   8   8   GLY GLY H . n 
H 2 10  PRO 10  9   9   PRO PRO H . n 
H 2 11  GLY 11  10  10  GLY GLY H . n 
H 2 12  LEU 12  11  11  LEU LEU H . n 
H 2 13  VAL 13  12  12  VAL VAL H . n 
H 2 14  ALA 14  13  13  ALA ALA H . n 
H 2 15  PRO 15  14  14  PRO PRO H . n 
H 2 16  SER 16  15  15  SER SER H . n 
H 2 17  GLN 17  16  16  GLN GLN H . n 
H 2 18  SER 18  17  17  SER SER H . n 
H 2 19  LEU 19  18  18  LEU LEU H . n 
H 2 20  SER 20  19  19  SER SER H . n 
H 2 21  ILE 21  20  20  ILE ILE H . n 
H 2 22  THR 22  21  21  THR THR H . n 
H 2 23  CYS 23  22  22  CYS CYS H . n 
H 2 24  THR 24  23  23  THR THR H . n 
H 2 25  VAL 25  24  24  VAL VAL H . n 
H 2 26  SER 26  25  25  SER SER H . n 
H 2 27  GLY 27  26  26  GLY GLY H . n 
H 2 28  ILE 28  27  27  ILE ILE H . n 
H 2 29  SER 29  28  28  SER SER H . n 
H 2 30  LEU 30  29  29  LEU LEU H . n 
H 2 31  SER 31  30  30  SER SER H . n 
H 2 32  ARG 32  31  31  ARG ARG H . n 
H 2 33  TYR 33  32  32  TYR TYR H . n 
H 2 34  ASN 34  33  33  ASN ASN H . n 
H 2 35  VAL 35  34  34  VAL VAL H . n 
H 2 36  HIS 36  35  35  HIS HIS H . n 
H 2 37  TRP 37  36  36  TRP TRP H . n 
H 2 38  VAL 38  37  37  VAL VAL H . n 
H 2 39  ARG 39  38  38  ARG ARG H . n 
H 2 40  GLN 40  39  39  GLN GLN H . n 
H 2 41  SER 41  40  40  SER SER H . n 
H 2 42  PRO 42  41  41  PRO PRO H . n 
H 2 43  GLY 43  42  42  GLY GLY H . n 
H 2 44  LYS 44  43  43  LYS LYS H . n 
H 2 45  GLY 45  44  44  GLY GLY H . n 
H 2 46  LEU 46  45  45  LEU LEU H . n 
H 2 47  GLU 47  46  46  GLU GLU H . n 
H 2 48  TRP 48  47  47  TRP TRP H . n 
H 2 49  LEU 49  48  48  LEU LEU H . n 
H 2 50  GLY 50  49  49  GLY GLY H . n 
H 2 51  MET 51  50  50  MET MET H . n 
H 2 52  ILE 52  51  51  ILE ILE H . n 
H 2 53  TRP 53  52  52  TRP TRP H . n 
H 2 54  GLY 54  53  53  GLY GLY H . n 
H 2 55  GLY 55  54  54  GLY GLY H . n 
H 2 56  GLY 56  55  55  GLY GLY H . n 
H 2 57  SER 57  56  56  SER SER H . n 
H 2 58  ILE 58  57  57  ILE ILE H . n 
H 2 59  GLU 59  58  58  GLU GLU H . n 
H 2 60  TYR 60  59  59  TYR TYR H . n 
H 2 61  ASN 61  60  60  ASN ASN H . n 
H 2 62  PRO 62  61  61  PRO PRO H . n 
H 2 63  ALA 63  62  62  ALA ALA H . n 
H 2 64  LEU 64  63  63  LEU LEU H . n 
H 2 65  LYS 65  64  64  LYS LYS H . n 
H 2 66  SER 66  65  65  SER SER H . n 
H 2 67  ARG 67  66  66  ARG ARG H . n 
H 2 68  LEU 68  67  67  LEU LEU H . n 
H 2 69  SER 69  68  68  SER SER H . n 
H 2 70  ILE 70  69  69  ILE ILE H . n 
H 2 71  SER 71  70  70  SER SER H . n 
H 2 72  LYS 72  71  71  LYS LYS H . n 
H 2 73  ASP 73  72  72  ASP ASP H . n 
H 2 74  ASN 74  73  73  ASN ASN H . n 
H 2 75  SER 75  74  74  SER SER H . n 
H 2 76  LYS 76  75  75  LYS LYS H . n 
H 2 77  SER 77  76  76  SER SER H . n 
H 2 78  GLN 78  77  77  GLN GLN H . n 
H 2 79  ILE 79  78  78  ILE ILE H . n 
H 2 80  PHE 80  79  79  PHE PHE H . n 
H 2 81  LEU 81  80  80  LEU LEU H . n 
H 2 82  LYS 82  81  81  LYS LYS H . n 
H 2 83  MET 83  82  82  MET MET H . n 
H 2 84  ASN 84  82  82  ASN ASN H A n 
H 2 85  SER 85  82  82  SER SER H B n 
H 2 86  LEU 86  82  82  LEU LEU H C n 
H 2 87  GLN 87  83  83  GLN GLN H . n 
H 2 88  THR 88  84  84  THR THR H . n 
H 2 89  ASP 89  85  85  ASP ASP H . n 
H 2 90  ASP 90  86  86  ASP ASP H . n 
H 2 91  SER 91  87  87  SER SER H . n 
H 2 92  ALA 92  88  88  ALA ALA H . n 
H 2 93  MET 93  89  89  MET MET H . n 
H 2 94  TYR 94  90  90  TYR TYR H . n 
H 2 95  TYR 95  91  91  TYR TYR H . n 
H 2 96  CYS 96  92  92  CYS CYS H . n 
H 2 97  VAL 97  93  93  VAL VAL H . n 
H 2 98  SER 98  94  94  SER SER H . n 
H 2 99  TYR 99  95  95  TYR TYR H . n 
H 2 100 GLY 100 96  96  GLY GLY H . n 
H 2 101 TYR 101 97  97  TYR TYR H . n 
H 2 102 GLY 102 98  98  GLY GLY H . n 
H 2 103 GLY 103 99  99  GLY GLY H . n 
H 2 104 ASP 104 100 100 ASP ASP H . n 
H 2 105 ARG 105 100 100 ARG ARG H A n 
H 2 106 PHE 106 100 100 PHE PHE H B n 
H 2 107 SER 107 101 101 SER SER H . n 
H 2 108 TYR 108 102 102 TYR TYR H . n 
H 2 109 TRP 109 103 103 TRP TRP H . n 
H 2 110 GLY 110 104 104 GLY GLY H . n 
H 2 111 GLN 111 105 105 GLN GLN H . n 
H 2 112 GLY 112 106 106 GLY GLY H . n 
H 2 113 THR 113 107 107 THR THR H . n 
H 2 114 LEU 114 108 108 LEU LEU H . n 
H 2 115 VAL 115 109 109 VAL VAL H . n 
H 2 116 THR 116 110 110 THR THR H . n 
H 2 117 VAL 117 111 111 VAL VAL H . n 
H 2 118 SER 118 112 112 SER SER H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 3 HOH 1  108 11  HOH HOH A . 
I 3 HOH 2  109 19  HOH HOH A . 
I 3 HOH 3  110 21  HOH HOH A . 
I 3 HOH 4  111 26  HOH HOH A . 
I 3 HOH 5  112 32  HOH HOH A . 
I 3 HOH 6  113 103 HOH HOH A . 
I 3 HOH 7  114 109 HOH HOH A . 
I 3 HOH 8  115 123 HOH HOH A . 
I 3 HOH 9  116 142 HOH HOH A . 
I 3 HOH 10 117 168 HOH HOH A . 
I 3 HOH 11 118 204 HOH HOH A . 
I 3 HOH 12 119 309 HOH HOH A . 
I 3 HOH 13 120 316 HOH HOH A . 
I 3 HOH 14 121 328 HOH HOH A . 
I 3 HOH 15 122 356 HOH HOH A . 
I 3 HOH 16 123 394 HOH HOH A . 
I 3 HOH 17 124 395 HOH HOH A . 
I 3 HOH 18 125 413 HOH HOH A . 
I 3 HOH 19 126 426 HOH HOH A . 
I 3 HOH 20 127 472 HOH HOH A . 
J 3 HOH 1  113 2   HOH HOH B . 
J 3 HOH 2  114 4   HOH HOH B . 
J 3 HOH 3  115 8   HOH HOH B . 
J 3 HOH 4  116 14  HOH HOH B . 
J 3 HOH 5  117 16  HOH HOH B . 
J 3 HOH 6  118 23  HOH HOH B . 
J 3 HOH 7  119 106 HOH HOH B . 
J 3 HOH 8  120 114 HOH HOH B . 
J 3 HOH 9  121 121 HOH HOH B . 
J 3 HOH 10 122 125 HOH HOH B . 
J 3 HOH 11 123 127 HOH HOH B . 
J 3 HOH 12 124 129 HOH HOH B . 
J 3 HOH 13 125 130 HOH HOH B . 
J 3 HOH 14 126 140 HOH HOH B . 
J 3 HOH 15 127 155 HOH HOH B . 
J 3 HOH 16 128 160 HOH HOH B . 
J 3 HOH 17 129 172 HOH HOH B . 
J 3 HOH 18 130 175 HOH HOH B . 
J 3 HOH 19 131 177 HOH HOH B . 
J 3 HOH 20 132 197 HOH HOH B . 
J 3 HOH 21 133 206 HOH HOH B . 
J 3 HOH 22 134 315 HOH HOH B . 
J 3 HOH 23 135 330 HOH HOH B . 
J 3 HOH 24 136 376 HOH HOH B . 
J 3 HOH 25 137 379 HOH HOH B . 
J 3 HOH 26 138 384 HOH HOH B . 
J 3 HOH 27 139 388 HOH HOH B . 
J 3 HOH 28 140 397 HOH HOH B . 
J 3 HOH 29 141 412 HOH HOH B . 
J 3 HOH 30 142 414 HOH HOH B . 
J 3 HOH 31 143 463 HOH HOH B . 
K 3 HOH 1  108 102 HOH HOH C . 
K 3 HOH 2  109 104 HOH HOH C . 
K 3 HOH 3  110 108 HOH HOH C . 
K 3 HOH 4  111 118 HOH HOH C . 
K 3 HOH 5  112 135 HOH HOH C . 
K 3 HOH 6  113 137 HOH HOH C . 
K 3 HOH 7  114 139 HOH HOH C . 
K 3 HOH 8  115 151 HOH HOH C . 
K 3 HOH 9  116 181 HOH HOH C . 
K 3 HOH 10 117 183 HOH HOH C . 
K 3 HOH 11 118 184 HOH HOH C . 
K 3 HOH 12 119 185 HOH HOH C . 
K 3 HOH 13 120 191 HOH HOH C . 
K 3 HOH 14 121 311 HOH HOH C . 
K 3 HOH 15 122 317 HOH HOH C . 
K 3 HOH 16 123 380 HOH HOH C . 
K 3 HOH 17 124 383 HOH HOH C . 
K 3 HOH 18 125 385 HOH HOH C . 
K 3 HOH 19 126 391 HOH HOH C . 
K 3 HOH 20 127 422 HOH HOH C . 
K 3 HOH 21 128 425 HOH HOH C . 
L 3 HOH 1  113 1   HOH HOH D . 
L 3 HOH 2  114 3   HOH HOH D . 
L 3 HOH 3  115 5   HOH HOH D . 
L 3 HOH 4  116 6   HOH HOH D . 
L 3 HOH 5  117 9   HOH HOH D . 
L 3 HOH 6  118 10  HOH HOH D . 
L 3 HOH 7  119 12  HOH HOH D . 
L 3 HOH 8  120 13  HOH HOH D . 
L 3 HOH 9  121 18  HOH HOH D . 
L 3 HOH 10 122 20  HOH HOH D . 
L 3 HOH 11 123 45  HOH HOH D . 
L 3 HOH 12 124 117 HOH HOH D . 
L 3 HOH 13 125 128 HOH HOH D . 
L 3 HOH 14 126 132 HOH HOH D . 
L 3 HOH 15 127 134 HOH HOH D . 
L 3 HOH 16 128 143 HOH HOH D . 
L 3 HOH 17 129 146 HOH HOH D . 
L 3 HOH 18 130 147 HOH HOH D . 
L 3 HOH 19 131 149 HOH HOH D . 
L 3 HOH 20 132 178 HOH HOH D . 
L 3 HOH 21 133 180 HOH HOH D . 
L 3 HOH 22 134 186 HOH HOH D . 
L 3 HOH 23 135 193 HOH HOH D . 
L 3 HOH 24 136 308 HOH HOH D . 
L 3 HOH 25 137 329 HOH HOH D . 
L 3 HOH 26 138 336 HOH HOH D . 
L 3 HOH 27 139 344 HOH HOH D . 
L 3 HOH 28 140 348 HOH HOH D . 
L 3 HOH 29 141 350 HOH HOH D . 
L 3 HOH 30 142 361 HOH HOH D . 
L 3 HOH 31 143 369 HOH HOH D . 
L 3 HOH 32 144 375 HOH HOH D . 
L 3 HOH 33 145 381 HOH HOH D . 
L 3 HOH 34 146 382 HOH HOH D . 
L 3 HOH 35 147 387 HOH HOH D . 
L 3 HOH 36 148 392 HOH HOH D . 
L 3 HOH 37 149 469 HOH HOH D . 
M 3 HOH 1  144 144 HOH HOH E . 
M 3 HOH 2  188 188 HOH HOH E . 
M 3 HOH 3  195 195 HOH HOH E . 
M 3 HOH 4  307 307 HOH HOH E . 
M 3 HOH 5  321 321 HOH HOH E . 
M 3 HOH 6  366 366 HOH HOH E . 
M 3 HOH 7  377 377 HOH HOH E . 
M 3 HOH 8  432 432 HOH HOH E . 
M 3 HOH 9  449 449 HOH HOH E . 
M 3 HOH 10 454 454 HOH HOH E . 
N 3 HOH 1  113 7   HOH HOH F . 
N 3 HOH 2  114 17  HOH HOH F . 
N 3 HOH 3  115 105 HOH HOH F . 
N 3 HOH 4  116 119 HOH HOH F . 
N 3 HOH 5  117 122 HOH HOH F . 
N 3 HOH 6  118 131 HOH HOH F . 
N 3 HOH 7  119 152 HOH HOH F . 
N 3 HOH 8  120 158 HOH HOH F . 
N 3 HOH 9  121 169 HOH HOH F . 
N 3 HOH 10 122 176 HOH HOH F . 
N 3 HOH 11 123 187 HOH HOH F . 
N 3 HOH 12 124 203 HOH HOH F . 
N 3 HOH 13 125 306 HOH HOH F . 
N 3 HOH 14 126 337 HOH HOH F . 
N 3 HOH 15 127 342 HOH HOH F . 
N 3 HOH 16 128 427 HOH HOH F . 
N 3 HOH 17 129 440 HOH HOH F . 
O 3 HOH 1  124 124 HOH HOH G . 
O 3 HOH 2  136 136 HOH HOH G . 
O 3 HOH 3  141 141 HOH HOH G . 
O 3 HOH 4  161 161 HOH HOH G . 
O 3 HOH 5  162 162 HOH HOH G . 
O 3 HOH 6  196 196 HOH HOH G . 
O 3 HOH 7  205 205 HOH HOH G . 
O 3 HOH 8  320 320 HOH HOH G . 
O 3 HOH 9  374 374 HOH HOH G . 
O 3 HOH 10 456 456 HOH HOH G . 
P 3 HOH 1  113 31  HOH HOH H . 
P 3 HOH 2  114 120 HOH HOH H . 
P 3 HOH 3  115 126 HOH HOH H . 
P 3 HOH 4  116 133 HOH HOH H . 
P 3 HOH 5  117 150 HOH HOH H . 
P 3 HOH 6  118 179 HOH HOH H . 
P 3 HOH 7  119 182 HOH HOH H . 
P 3 HOH 8  120 189 HOH HOH H . 
P 3 HOH 9  121 319 HOH HOH H . 
P 3 HOH 10 122 335 HOH HOH H . 
P 3 HOH 11 123 343 HOH HOH H . 
P 3 HOH 12 124 349 HOH HOH H . 
P 3 HOH 13 125 351 HOH HOH H . 
P 3 HOH 14 126 370 HOH HOH H . 
P 3 HOH 15 127 424 HOH HOH H . 
P 3 HOH 16 128 429 HOH HOH H . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
3 author_defined_assembly ? dimeric 2 
4 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,I,J 
2 1 C,D,K,L 
3 1 E,F,M,N 
4 1 G,H,O,P 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-08-18 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-11-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.page_last'               
2 4 'Structure model' '_citation.pdbx_database_id_DOI'    
3 4 'Structure model' '_citation.pdbx_database_id_PubMed' 
4 4 'Structure model' '_citation.title'                   
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
X-PLOR    refinement       3.8 ? 3 
# 
_pdbx_entry_details.entry_id             43C9 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE FV FRAGMENT IS NUMBERED BY THE CONVENTION OF E. KABAT,
E. A. KABAT, T. T. WU, H. M. PERRY, K. S. GOTTESMAN, C.
FOELLER, SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST,
FIFTH EDITION, (1991), U.S. DEPARTMENT OF HEALTH AND HUMAN
SERVICES, WASHINGTON,
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N B GLY 55 ? ? CA B GLY 55 ? ? C B GLY 55 ? ? 129.32 113.10 16.22  2.50 N 
2 1 N F VAL 2  ? ? CA F VAL 2  ? ? C F VAL 2  ? ? 94.05  111.00 -16.95 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 2   ? ? -53.95  100.58  
2  1 SER A 10  ? ? -178.38 143.47  
3  1 ILE A 27  E ? -65.74  86.75   
4  1 SER A 27  F ? 173.87  -44.31  
5  1 ALA A 51  ? ? 69.39   -24.15  
6  1 SER A 52  ? ? -141.32 -19.29  
7  1 ALA A 84  ? ? -174.65 -175.35 
8  1 ARG A 96  ? ? -68.13  76.59   
9  1 GLN B 1   ? ? 42.44   -37.20  
10 1 SER B 15  ? ? 45.29   8.17    
11 1 ALA B 62  ? ? -75.04  -71.90  
12 1 THR B 84  ? ? -57.20  -2.97   
13 1 SER C 27  F ? -157.36 -43.48  
14 1 ALA C 51  ? ? 68.11   -24.96  
15 1 SER C 52  ? ? -144.08 -11.36  
16 1 ALA C 84  ? ? -173.87 -174.41 
17 1 SER D 15  ? ? 77.47   -31.88  
18 1 SER E 27  F ? -174.63 -24.83  
19 1 ASN E 28  ? ? -154.42 2.85    
20 1 GLN E 29  ? ? 56.55   14.80   
21 1 ALA E 51  ? ? 59.49   -25.12  
22 1 SER E 52  ? ? -134.22 -34.06  
23 1 THR E 53  ? ? -56.31  107.28  
24 1 SER E 67  ? ? -176.94 148.46  
25 1 SER E 76  ? ? -57.25  -80.05  
26 1 GLN E 83  ? ? -66.20  99.59   
27 1 ALA E 84  ? ? -160.84 -166.42 
28 1 GLN F 1   ? ? -59.19  76.01   
29 1 VAL F 2   ? ? -150.67 89.49   
30 1 SER F 15  ? ? 68.65   -4.35   
31 1 ASP F 72  ? ? -151.55 88.20   
32 1 VAL G 15  ? ? -36.33  125.10  
33 1 ILE G 27  E ? -67.26  77.33   
34 1 SER G 27  F ? 179.89  -47.47  
35 1 ALA G 51  ? ? 64.44   -16.37  
36 1 ALA G 84  ? ? 178.65  -166.26 
37 1 GLN H 1   ? ? -54.45  -74.15  
38 1 SER H 15  ? ? 69.27   -35.18  
39 1 SER H 76  ? ? 70.49   47.73   
40 1 LYS H 81  ? ? -171.83 113.62  
41 1 ASP H 100 ? ? -74.76  20.99   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR B 91 ? ? 0.088 'SIDE CHAIN' 
2 1 TYR D 91 ? ? 0.070 'SIDE CHAIN' 
3 1 TYR F 91 ? ? 0.074 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 E LYS 107 ? CG ? E LYS 113 CG 
2 1 Y 1 E LYS 107 ? CD ? E LYS 113 CD 
3 1 Y 1 E LYS 107 ? CE ? E LYS 113 CE 
4 1 Y 1 E LYS 107 ? NZ ? E LYS 113 NZ 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#