data_4A12
# 
_entry.id   4A12 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4A12         
PDBE  EBI-49623    
WWPDB D_1290049623 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4A0Y unspecified 'STRUCTURE OF THE GLOBAL TRANSCRIPTION REGULATOR FAPR FROM STAPHYLOCOCCUS AUREUS'                             
PDB 4A0X unspecified 'STRUCTURE OF THE GLOBAL TRANSCRIPTION REGULATOR FAPR FROM STAPHYLOCOCCUS AUREUS'                             
PDB 4A0Z unspecified 'STRUCTURE OF THE GLOBAL TRANSCRIPTION REGULATOR FAPR FROM STAPHYLOCOCCUS AUREUS IN COMPLEX WITH MALONYL-COA' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4A12 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-09-13 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Albanesi, D.'   1 
'Guerin, M.E.'   2 
'Buschiazzo, A.' 3 
'de Mendoza, D.' 4 
'Alzari, P.M.'   5 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis for Feed-Forward Transcriptional Regulation of Membrane Lipid Homeostasis in Staphylococcus Aureus.' 
_citation.journal_abbrev            'Plos Pathog.' 
_citation.journal_volume            9 
_citation.page_first                3108 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1553-7366 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23300457 
_citation.pdbx_database_id_DOI      10.1371/JOURNAL.PPAT.1003108 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Albanesi, D.'     1 
primary 'Reh, G.'          2 
primary 'Guerin, M.E.'     3 
primary 'Schaeffer, F.'    4 
primary 'Debarbouille, M.' 5 
primary 'Buschiazzo, A.'   6 
primary 'Schujman, G.E.'   7 
primary 'De Mendoza, D.'   8 
primary 'Alzari, P.M.'     9 
# 
_cell.entry_id           4A12 
_cell.length_a           114.690 
_cell.length_b           249.940 
_cell.length_c           179.210 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4A12 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'TRANSCRIPTION FACTOR FAPR' 22120.135 4 ? ? ? ? 
2 polymer syn 'FAPR PROMOTER'             12195.875 1 ? ? ? ? 
3 polymer syn 'FAPR PROMOTER'             12423.036 1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'FATTY ACID AND PHOSPHOLIPID BIOSYNTHESIS REGULATOR, REPRESSOR FACTOR FAPR' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no yes 
;(MSE)RGETLKLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIKLVAEKNYDQISSIEEQ
EFIGDLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANSLCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARV
VNQTAKHYYVEVKSYVKHTLVFKGNFK(MSE)FYDKRG
;
;MRGETLKLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIKLVAEKNYDQISSIEEQEFIG
DLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANSLCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARVVNQT
AKHYYVEVKSYVKHTLVFKGNFKMFYDKRG
;
A,B,C,D ? 
2 polydeoxyribonucleotide no no  
;(DG)(DC)(DC)(DA)(DA)(DT)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DT)(DA)(DC)(DT)(DA)(DT)(DT)
(DA)(DG)(DT)(DA)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DT)(DA)(DA)(DT)(DT)(DC)(DC)(DG)
;
GCCAATTATATACTACTATTAGTACCTAGTCTTAATTCCG F       ? 
3 polydeoxyribonucleotide no no  
;(DC)(DG)(DG)(DA)(DA)(DT)(DT)(DA)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DT)(DA)(DC)(DT)
(DA)(DA)(DT)(DA)(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DA)(DT)(DT)(DG)(DG)(DC)
;
CGGAATTAAGACTAGGTACTAATAGTAGTATATAATTGGC G       ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   ARG n 
1 3   GLY n 
1 4   GLU n 
1 5   THR n 
1 6   LEU n 
1 7   LYS n 
1 8   LEU n 
1 9   LYS n 
1 10  LYS n 
1 11  ASP n 
1 12  LYS n 
1 13  ARG n 
1 14  ARG n 
1 15  GLU n 
1 16  ALA n 
1 17  ILE n 
1 18  ARG n 
1 19  GLN n 
1 20  GLN n 
1 21  ILE n 
1 22  ASP n 
1 23  SER n 
1 24  ASN n 
1 25  PRO n 
1 26  PHE n 
1 27  ILE n 
1 28  THR n 
1 29  ASP n 
1 30  HIS n 
1 31  GLU n 
1 32  LEU n 
1 33  SER n 
1 34  ASP n 
1 35  LEU n 
1 36  PHE n 
1 37  GLN n 
1 38  VAL n 
1 39  SER n 
1 40  ILE n 
1 41  GLN n 
1 42  THR n 
1 43  ILE n 
1 44  ARG n 
1 45  LEU n 
1 46  ASP n 
1 47  ARG n 
1 48  THR n 
1 49  TYR n 
1 50  LEU n 
1 51  ASN n 
1 52  ILE n 
1 53  PRO n 
1 54  GLU n 
1 55  LEU n 
1 56  ARG n 
1 57  LYS n 
1 58  ARG n 
1 59  ILE n 
1 60  LYS n 
1 61  LEU n 
1 62  VAL n 
1 63  ALA n 
1 64  GLU n 
1 65  LYS n 
1 66  ASN n 
1 67  TYR n 
1 68  ASP n 
1 69  GLN n 
1 70  ILE n 
1 71  SER n 
1 72  SER n 
1 73  ILE n 
1 74  GLU n 
1 75  GLU n 
1 76  GLN n 
1 77  GLU n 
1 78  PHE n 
1 79  ILE n 
1 80  GLY n 
1 81  ASP n 
1 82  LEU n 
1 83  ILE n 
1 84  GLN n 
1 85  VAL n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  VAL n 
1 90  LYS n 
1 91  ALA n 
1 92  GLN n 
1 93  SER n 
1 94  ILE n 
1 95  LEU n 
1 96  ASP n 
1 97  ILE n 
1 98  THR n 
1 99  SER n 
1 100 ASP n 
1 101 SER n 
1 102 VAL n 
1 103 PHE n 
1 104 HIS n 
1 105 LYS n 
1 106 THR n 
1 107 GLY n 
1 108 ILE n 
1 109 ALA n 
1 110 ARG n 
1 111 GLY n 
1 112 HIS n 
1 113 VAL n 
1 114 LEU n 
1 115 PHE n 
1 116 ALA n 
1 117 GLN n 
1 118 ALA n 
1 119 ASN n 
1 120 SER n 
1 121 LEU n 
1 122 CYS n 
1 123 VAL n 
1 124 ALA n 
1 125 LEU n 
1 126 ILE n 
1 127 LYS n 
1 128 GLN n 
1 129 PRO n 
1 130 THR n 
1 131 VAL n 
1 132 LEU n 
1 133 THR n 
1 134 HIS n 
1 135 GLU n 
1 136 SER n 
1 137 SER n 
1 138 ILE n 
1 139 GLN n 
1 140 PHE n 
1 141 ILE n 
1 142 GLU n 
1 143 LYS n 
1 144 VAL n 
1 145 LYS n 
1 146 LEU n 
1 147 ASN n 
1 148 ASP n 
1 149 THR n 
1 150 VAL n 
1 151 ARG n 
1 152 ALA n 
1 153 GLU n 
1 154 ALA n 
1 155 ARG n 
1 156 VAL n 
1 157 VAL n 
1 158 ASN n 
1 159 GLN n 
1 160 THR n 
1 161 ALA n 
1 162 LYS n 
1 163 HIS n 
1 164 TYR n 
1 165 TYR n 
1 166 VAL n 
1 167 GLU n 
1 168 VAL n 
1 169 LYS n 
1 170 SER n 
1 171 TYR n 
1 172 VAL n 
1 173 LYS n 
1 174 HIS n 
1 175 THR n 
1 176 LEU n 
1 177 VAL n 
1 178 PHE n 
1 179 LYS n 
1 180 GLY n 
1 181 ASN n 
1 182 PHE n 
1 183 LYS n 
1 184 MSE n 
1 185 PHE n 
1 186 TYR n 
1 187 ASP n 
1 188 LYS n 
1 189 ARG n 
1 190 GLY n 
2 1   DG  n 
2 2   DC  n 
2 3   DC  n 
2 4   DA  n 
2 5   DA  n 
2 6   DT  n 
2 7   DT  n 
2 8   DA  n 
2 9   DT  n 
2 10  DA  n 
2 11  DT  n 
2 12  DA  n 
2 13  DC  n 
2 14  DT  n 
2 15  DA  n 
2 16  DC  n 
2 17  DT  n 
2 18  DA  n 
2 19  DT  n 
2 20  DT  n 
2 21  DA  n 
2 22  DG  n 
2 23  DT  n 
2 24  DA  n 
2 25  DC  n 
2 26  DC  n 
2 27  DT  n 
2 28  DA  n 
2 29  DG  n 
2 30  DT  n 
2 31  DC  n 
2 32  DT  n 
2 33  DT  n 
2 34  DA  n 
2 35  DA  n 
2 36  DT  n 
2 37  DT  n 
2 38  DC  n 
2 39  DC  n 
2 40  DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DG  n 
3 4   DA  n 
3 5   DA  n 
3 6   DT  n 
3 7   DT  n 
3 8   DA  n 
3 9   DA  n 
3 10  DG  n 
3 11  DA  n 
3 12  DC  n 
3 13  DT  n 
3 14  DA  n 
3 15  DG  n 
3 16  DG  n 
3 17  DT  n 
3 18  DA  n 
3 19  DC  n 
3 20  DT  n 
3 21  DA  n 
3 22  DA  n 
3 23  DT  n 
3 24  DA  n 
3 25  DG  n 
3 26  DT  n 
3 27  DA  n 
3 28  DG  n 
3 29  DT  n 
3 30  DA  n 
3 31  DT  n 
3 32  DA  n 
3 33  DT  n 
3 34  DA  n 
3 35  DA  n 
3 36  DT  n 
3 37  DT  n 
3 38  DG  n 
3 39  DG  n 
3 40  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'STAPHYLOCOCCUS AUREUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1280 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              PLYSS 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PET15B 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'BACILLUS SUBTILIS' ? 1423 ? 
3 1 sample ? ? 'BACILLUS SUBTILIS' ? 1423 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP D6UB50_STAAU 1 ? ? D6UB50    ? 
2 GB  CP002468     2 ? ? 320017650 ? 
3 GB  CP002468     3 ? ? 320017650 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4A12 A 1 ? 190 ? D6UB50    1       ? 190     ? 1 190 
2 1 4A12 B 1 ? 190 ? D6UB50    1       ? 190     ? 1 190 
3 1 4A12 C 1 ? 190 ? D6UB50    1       ? 190     ? 1 190 
4 1 4A12 D 1 ? 190 ? D6UB50    1       ? 190     ? 1 190 
5 2 4A12 F 4 ? 37  ? 320017650 3872403 ? 3872436 ? 4 37  
6 3 4A12 G 4 ? 37  ? 320017650 3872436 ? 3872403 ? 4 37  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
5 4A12 DG F 1  ? GB 320017650 ? ? 'cloning artifact' 1  1  
5 4A12 DC F 2  ? GB 320017650 ? ? 'cloning artifact' 2  2  
5 4A12 DC F 3  ? GB 320017650 ? ? 'cloning artifact' 3  3  
5 4A12 DC F 38 ? GB 320017650 ? ? 'cloning artifact' 38 4  
5 4A12 DC F 39 ? GB 320017650 ? ? 'cloning artifact' 39 5  
5 4A12 DG F 40 ? GB 320017650 ? ? 'cloning artifact' 40 6  
6 4A12 DC G 1  ? GB 320017650 ? ? 'cloning artifact' 1  7  
6 4A12 DG G 2  ? GB 320017650 ? ? 'cloning artifact' 2  8  
6 4A12 DG G 3  ? GB 320017650 ? ? 'cloning artifact' 3  9  
6 4A12 DG G 38 ? GB 320017650 ? ? 'cloning artifact' 38 10 
6 4A12 DG G 39 ? GB 320017650 ? ? 'cloning artifact' 39 11 
6 4A12 DC G 40 ? GB 320017650 ? ? 'cloning artifact' 40 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE                     ? 'C5 H11 N O2 Se'  196.106 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4A12 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.7 
_exptl_crystal.density_percent_sol   75 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '3.2 M SODIUM FORMATE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2008-03-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9786 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 1' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 1' 
_diffrn_source.pdbx_wavelength             0.9786 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4A12 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.00 
_reflns.d_resolution_high            3.15 
_reflns.number_obs                   44060 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            0.10 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.30 
_reflns.B_iso_Wilson_estimate        83.11 
_reflns.pdbx_redundancy              16.0 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.15 
_reflns_shell.d_res_low              3.32 
_reflns_shell.percent_possible_all   93.7 
_reflns_shell.Rmerge_I_obs           0.57 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.40 
_reflns_shell.pdbx_redundancy        4.9 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4A12 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     44024 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             31.75 
_refine.ls_d_res_high                            3.15 
_refine.ls_percent_reflns_obs                    98.14 
_refine.ls_R_factor_obs                          0.1870 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1862 
_refine.ls_R_factor_R_free                       0.2014 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.08 
_refine.ls_number_reflns_R_free                  2237 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9360 
_refine.correlation_coeff_Fo_to_Fc_free          0.9228 
_refine.B_iso_mean                               114.42 
_refine.aniso_B[1][1]                            -17.3220 
_refine.aniso_B[2][2]                            6.8283 
_refine.aniso_B[3][3]                            10.4938 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4A0X' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.445 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.265 
_refine.pdbx_overall_SU_R_Blow_DPI               0.429 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.259 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4A12 
_refine_analyze.Luzzati_coordinate_error_obs    0.745 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6040 
_refine_hist.pdbx_number_atoms_nucleic_acid   1634 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7674 
_refine_hist.d_res_high                       3.15 
_refine_hist.d_res_low                        31.75 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.007 ? 2.00  7968  'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.14  ? 2.00  11092 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  3228  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  176   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  942   'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 7968  'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_omega_torsion           2.15  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_other_torsion           19.58 ? ?     ?     'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  1072  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  8527  'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.15 
_refine_ls_shell.d_res_low                        3.23 
_refine_ls_shell.number_reflns_R_work             2946 
_refine_ls_shell.R_factor_R_work                  0.2409 
_refine_ls_shell.percent_reflns_obs               98.14 
_refine_ls_shell.R_factor_R_free                  0.2241 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.94 
_refine_ls_shell.number_reflns_R_free             153 
_refine_ls_shell.number_reflns_all                3099 
_refine_ls_shell.R_factor_all                     0.2400 
# 
_struct.entry_id                  4A12 
_struct.title                     
'Structure of the global transcription regulator FapR from Staphylococcus aureus in complex with DNA operator' 
_struct.pdbx_descriptor           'TRANSCRIPTION FACTOR FAPR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4A12 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'TRANSCRIPTION, LIPID HOMEOSTASIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 9   ? ASN A 24  ? LYS A 9   ASN A 24  1 ? 16 
HELX_P HELX_P2  2  THR A 28  ? GLN A 37  ? THR A 28  GLN A 37  1 ? 10 
HELX_P HELX_P3  3  SER A 39  ? LEU A 50  ? SER A 39  LEU A 50  1 ? 12 
HELX_P HELX_P4  4  GLU A 54  ? ASN A 66  ? GLU A 54  ASN A 66  1 ? 13 
HELX_P HELX_P5  5  SER A 72  ? GLN A 76  ? SER A 72  GLN A 76  5 ? 5  
HELX_P HELX_P6  6  ARG A 110 ? ILE A 126 ? ARG A 110 ILE A 126 1 ? 17 
HELX_P HELX_P7  7  LYS B 9   ? ASN B 24  ? LYS B 9   ASN B 24  1 ? 16 
HELX_P HELX_P8  8  THR B 28  ? GLN B 37  ? THR B 28  GLN B 37  1 ? 10 
HELX_P HELX_P9  9  SER B 39  ? LEU B 50  ? SER B 39  LEU B 50  1 ? 12 
HELX_P HELX_P10 10 GLU B 54  ? ASP B 68  ? GLU B 54  ASP B 68  1 ? 15 
HELX_P HELX_P11 11 SER B 72  ? GLU B 77  ? SER B 72  GLU B 77  1 ? 6  
HELX_P HELX_P12 12 ARG B 110 ? ILE B 126 ? ARG B 110 ILE B 126 1 ? 17 
HELX_P HELX_P13 13 LYS C 9   ? ASN C 24  ? LYS C 9   ASN C 24  1 ? 16 
HELX_P HELX_P14 14 THR C 28  ? GLN C 37  ? THR C 28  GLN C 37  1 ? 10 
HELX_P HELX_P15 15 SER C 39  ? LEU C 50  ? SER C 39  LEU C 50  1 ? 12 
HELX_P HELX_P16 16 GLU C 54  ? ASP C 68  ? GLU C 54  ASP C 68  1 ? 15 
HELX_P HELX_P17 17 SER C 72  ? GLU C 77  ? SER C 72  GLU C 77  1 ? 6  
HELX_P HELX_P18 18 ARG C 110 ? ILE C 126 ? ARG C 110 ILE C 126 1 ? 17 
HELX_P HELX_P19 19 LYS D 9   ? ASN D 24  ? LYS D 9   ASN D 24  1 ? 16 
HELX_P HELX_P20 20 THR D 28  ? GLN D 37  ? THR D 28  GLN D 37  1 ? 10 
HELX_P HELX_P21 21 SER D 39  ? LEU D 50  ? SER D 39  LEU D 50  1 ? 12 
HELX_P HELX_P22 22 GLU D 54  ? ASN D 66  ? GLU D 54  ASN D 66  1 ? 13 
HELX_P HELX_P23 23 SER D 72  ? GLN D 76  ? SER D 72  GLN D 76  5 ? 5  
HELX_P HELX_P24 24 ARG D 110 ? ILE D 126 ? ARG D 110 ILE D 126 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A LYS 183 C  ? ? ? 1_555 A MSE 184 N  ? ? A LYS 183 A MSE 184 1_555 ? ? ? ? ? ? ?            1.333 ? 
covale2  covale ? ? A MSE 184 C  ? ? ? 1_555 A PHE 185 N  ? ? A MSE 184 A PHE 185 1_555 ? ? ? ? ? ? ?            1.334 ? 
covale3  covale ? ? B LYS 183 C  ? ? ? 1_555 B MSE 184 N  ? ? B LYS 183 B MSE 184 1_555 ? ? ? ? ? ? ?            1.337 ? 
covale4  covale ? ? B MSE 184 C  ? ? ? 1_555 B PHE 185 N  ? ? B MSE 184 B PHE 185 1_555 ? ? ? ? ? ? ?            1.339 ? 
covale5  covale ? ? C LYS 183 C  ? ? ? 1_555 C MSE 184 N  ? ? C LYS 183 C MSE 184 1_555 ? ? ? ? ? ? ?            1.335 ? 
covale6  covale ? ? C MSE 184 C  ? ? ? 1_555 C PHE 185 N  ? ? C MSE 184 C PHE 185 1_555 ? ? ? ? ? ? ?            1.335 ? 
covale7  covale ? ? D LYS 183 C  ? ? ? 1_555 D MSE 184 N  ? ? D LYS 183 D MSE 184 1_555 ? ? ? ? ? ? ?            1.335 ? 
covale8  covale ? ? D MSE 184 C  ? ? ? 1_555 D PHE 185 N  ? ? D MSE 184 D PHE 185 1_555 ? ? ? ? ? ? ?            1.334 ? 
hydrog1  hydrog ? ? E DG  1   N1 ? ? ? 1_555 F DC  40  N3 ? ? F DG  1   G DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? E DG  1   N2 ? ? ? 1_555 F DC  40  O2 ? ? F DG  1   G DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? E DG  1   O6 ? ? ? 1_555 F DC  40  N4 ? ? F DG  1   G DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? E DC  2   N3 ? ? ? 1_555 F DG  39  N1 ? ? F DC  2   G DG  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? E DC  2   N4 ? ? ? 1_555 F DG  39  O6 ? ? F DC  2   G DG  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? E DC  2   O2 ? ? ? 1_555 F DG  39  N2 ? ? F DC  2   G DG  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? E DC  3   N3 ? ? ? 1_555 F DG  38  N1 ? ? F DC  3   G DG  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? E DC  3   N4 ? ? ? 1_555 F DG  38  O6 ? ? F DC  3   G DG  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? E DC  3   O2 ? ? ? 1_555 F DG  38  N2 ? ? F DC  3   G DG  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? E DA  4   N1 ? ? ? 1_555 F DT  37  N3 ? ? F DA  4   G DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? E DA  4   N6 ? ? ? 1_555 F DT  37  O4 ? ? F DA  4   G DT  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? E DA  5   N1 ? ? ? 1_555 F DT  36  N3 ? ? F DA  5   G DT  36  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog13 hydrog ? ? E DT  6   N3 ? ? ? 1_555 F DA  35  N1 ? ? F DT  6   G DA  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? E DT  6   O4 ? ? ? 1_555 F DA  35  N6 ? ? F DT  6   G DA  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? E DT  7   N3 ? ? ? 1_555 F DA  34  N1 ? ? F DT  7   G DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? E DT  7   O4 ? ? ? 1_555 F DA  34  N6 ? ? F DT  7   G DA  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? E DA  8   N1 ? ? ? 1_555 F DT  33  N3 ? ? F DA  8   G DT  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? E DA  8   N6 ? ? ? 1_555 F DT  33  O4 ? ? F DA  8   G DT  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? E DT  9   N3 ? ? ? 1_555 F DA  32  N1 ? ? F DT  9   G DA  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? E DT  9   O4 ? ? ? 1_555 F DA  32  N6 ? ? F DT  9   G DA  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? E DA  10  N1 ? ? ? 1_555 F DT  31  N3 ? ? F DA  10  G DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? E DA  10  N6 ? ? ? 1_555 F DT  31  O4 ? ? F DA  10  G DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? E DT  11  N3 ? ? ? 1_555 F DA  30  N1 ? ? F DT  11  G DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? E DT  11  O4 ? ? ? 1_555 F DA  30  N6 ? ? F DT  11  G DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? E DA  12  N1 ? ? ? 1_555 F DT  29  N3 ? ? F DA  12  G DT  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? E DA  12  N6 ? ? ? 1_555 F DT  29  O4 ? ? F DA  12  G DT  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? E DC  13  N3 ? ? ? 1_555 F DG  28  N1 ? ? F DC  13  G DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? E DC  13  N4 ? ? ? 1_555 F DG  28  O6 ? ? F DC  13  G DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? E DC  13  O2 ? ? ? 1_555 F DG  28  N2 ? ? F DC  13  G DG  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? E DT  14  N3 ? ? ? 1_555 F DA  27  N1 ? ? F DT  14  G DA  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? E DT  14  O4 ? ? ? 1_555 F DA  27  N6 ? ? F DT  14  G DA  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? E DA  15  N1 ? ? ? 1_555 F DT  26  N3 ? ? F DA  15  G DT  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DA  15  N6 ? ? ? 1_555 F DT  26  O4 ? ? F DA  15  G DT  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DC  16  N3 ? ? ? 1_555 F DG  25  N1 ? ? F DC  16  G DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E DC  16  N4 ? ? ? 1_555 F DG  25  O6 ? ? F DC  16  G DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DC  16  O2 ? ? ? 1_555 F DG  25  N2 ? ? F DC  16  G DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DT  17  N3 ? ? ? 1_555 F DA  24  N1 ? ? F DT  17  G DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DT  17  O4 ? ? ? 1_555 F DA  24  N6 ? ? F DT  17  G DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DA  18  N1 ? ? ? 1_555 F DT  23  N3 ? ? F DA  18  G DT  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DA  18  N6 ? ? ? 1_555 F DT  23  O4 ? ? F DA  18  G DT  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DT  19  N3 ? ? ? 1_555 F DA  22  N1 ? ? F DT  19  G DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DT  19  O4 ? ? ? 1_555 F DA  22  N6 ? ? F DT  19  G DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DT  20  N3 ? ? ? 1_555 F DA  21  N1 ? ? F DT  20  G DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? E DT  20  O4 ? ? ? 1_555 F DA  21  N6 ? ? F DT  20  G DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? E DA  21  N1 ? ? ? 1_555 F DT  20  N3 ? ? F DA  21  G DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? E DA  21  N6 ? ? ? 1_555 F DT  20  O4 ? ? F DA  21  G DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DG  22  N1 ? ? ? 1_555 F DC  19  N3 ? ? F DG  22  G DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DG  22  N2 ? ? ? 1_555 F DC  19  O2 ? ? F DG  22  G DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E DG  22  O6 ? ? ? 1_555 F DC  19  N4 ? ? F DG  22  G DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? E DT  23  N3 ? ? ? 1_555 F DA  18  N1 ? ? F DT  23  G DA  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? E DT  23  O4 ? ? ? 1_555 F DA  18  N6 ? ? F DT  23  G DA  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? E DA  24  N1 ? ? ? 1_555 F DT  17  N3 ? ? F DA  24  G DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? E DA  24  N6 ? ? ? 1_555 F DT  17  O4 ? ? F DA  24  G DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? E DC  25  N3 ? ? ? 1_555 F DG  16  N1 ? ? F DC  25  G DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? E DC  25  N4 ? ? ? 1_555 F DG  16  O6 ? ? F DC  25  G DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? E DC  25  O2 ? ? ? 1_555 F DG  16  N2 ? ? F DC  25  G DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? E DC  26  N3 ? ? ? 1_555 F DG  15  N1 ? ? F DC  26  G DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? E DC  26  N4 ? ? ? 1_555 F DG  15  O6 ? ? F DC  26  G DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? E DC  26  O2 ? ? ? 1_555 F DG  15  N2 ? ? F DC  26  G DG  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? E DT  27  N3 ? ? ? 1_555 F DA  14  N1 ? ? F DT  27  G DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? E DT  27  O4 ? ? ? 1_555 F DA  14  N6 ? ? F DT  27  G DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? E DA  28  N1 ? ? ? 1_555 F DT  13  N3 ? ? F DA  28  G DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? E DA  28  N6 ? ? ? 1_555 F DT  13  O4 ? ? F DA  28  G DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? E DG  29  N1 ? ? ? 1_555 F DC  12  N3 ? ? F DG  29  G DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? E DG  29  N2 ? ? ? 1_555 F DC  12  O2 ? ? F DG  29  G DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? E DG  29  O6 ? ? ? 1_555 F DC  12  N4 ? ? F DG  29  G DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? E DT  30  N3 ? ? ? 1_555 F DA  11  N1 ? ? F DT  30  G DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ? ? E DT  30  O4 ? ? ? 1_555 F DA  11  N6 ? ? F DT  30  G DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ? ? E DC  31  N3 ? ? ? 1_555 F DG  10  N1 ? ? F DC  31  G DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ? ? E DC  31  N4 ? ? ? 1_555 F DG  10  O6 ? ? F DC  31  G DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71 hydrog ? ? E DC  31  O2 ? ? ? 1_555 F DG  10  N2 ? ? F DC  31  G DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72 hydrog ? ? E DT  32  N3 ? ? ? 1_555 F DA  9   N1 ? ? F DT  32  G DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73 hydrog ? ? E DT  32  O4 ? ? ? 1_555 F DA  9   N6 ? ? F DT  32  G DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74 hydrog ? ? E DT  33  N3 ? ? ? 1_555 F DA  8   N1 ? ? F DT  33  G DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75 hydrog ? ? E DT  33  O4 ? ? ? 1_555 F DA  8   N6 ? ? F DT  33  G DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76 hydrog ? ? E DA  34  N1 ? ? ? 1_555 F DT  7   N3 ? ? F DA  34  G DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77 hydrog ? ? E DA  34  N6 ? ? ? 1_555 F DT  7   O4 ? ? F DA  34  G DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78 hydrog ? ? E DA  35  N1 ? ? ? 1_555 F DT  6   N3 ? ? F DA  35  G DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79 hydrog ? ? E DA  35  N6 ? ? ? 1_555 F DT  6   O4 ? ? F DA  35  G DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80 hydrog ? ? E DT  36  N3 ? ? ? 1_555 F DA  5   N1 ? ? F DT  36  G DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81 hydrog ? ? E DT  36  O4 ? ? ? 1_555 F DA  5   N6 ? ? F DT  36  G DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82 hydrog ? ? E DT  37  N3 ? ? ? 1_555 F DA  4   N1 ? ? F DT  37  G DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83 hydrog ? ? E DT  37  O4 ? ? ? 1_555 F DA  4   N6 ? ? F DT  37  G DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84 hydrog ? ? E DC  38  N3 ? ? ? 1_555 F DG  3   N1 ? ? F DC  38  G DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85 hydrog ? ? E DC  38  N4 ? ? ? 1_555 F DG  3   O6 ? ? F DC  38  G DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86 hydrog ? ? E DC  38  O2 ? ? ? 1_555 F DG  3   N2 ? ? F DC  38  G DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87 hydrog ? ? E DC  39  N3 ? ? ? 1_555 F DG  2   N1 ? ? F DC  39  G DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88 hydrog ? ? E DC  39  N4 ? ? ? 1_555 F DG  2   O6 ? ? F DC  39  G DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89 hydrog ? ? E DC  39  O2 ? ? ? 1_555 F DG  2   N2 ? ? F DC  39  G DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90 hydrog ? ? E DG  40  N2 ? ? ? 1_555 F DC  1   N3 ? ? F DG  40  G DC  1   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 12 ? 
CA ? 12 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? anti-parallel 
AA 3  4  ? anti-parallel 
AA 4  5  ? anti-parallel 
AA 5  6  ? anti-parallel 
AA 6  7  ? anti-parallel 
AA 7  8  ? anti-parallel 
AA 8  9  ? anti-parallel 
AA 9  10 ? anti-parallel 
AA 10 11 ? anti-parallel 
AA 11 12 ? anti-parallel 
CA 1  2  ? anti-parallel 
CA 2  3  ? anti-parallel 
CA 3  4  ? anti-parallel 
CA 4  5  ? anti-parallel 
CA 5  6  ? anti-parallel 
CA 6  7  ? anti-parallel 
CA 7  8  ? anti-parallel 
CA 8  9  ? anti-parallel 
CA 9  10 ? anti-parallel 
CA 10 11 ? anti-parallel 
CA 11 12 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  ASP A 81  ? ASN A 86  ? ASP A 81  ASN A 86  
AA 2  LYS A 90  ? ASP A 96  ? LYS A 90  ASP A 96  
AA 3  THR A 149 ? GLN A 159 ? THR A 149 GLN A 159 
AA 4  HIS A 163 ? TYR A 171 ? HIS A 163 TYR A 171 
AA 5  LEU A 176 ? ASP A 187 ? LEU A 176 ASP A 187 
AA 6  THR A 130 ? GLN A 139 ? THR A 130 GLN A 139 
AA 7  THR B 130 ? GLN B 139 ? THR B 130 GLN B 139 
AA 8  LEU B 176 ? ASP B 187 ? LEU B 176 ASP B 187 
AA 9  HIS B 163 ? TYR B 171 ? HIS B 163 TYR B 171 
AA 10 THR B 149 ? GLN B 159 ? THR B 149 GLN B 159 
AA 11 LYS B 90  ? ASP B 96  ? LYS B 90  ASP B 96  
AA 12 ASP B 81  ? ASN B 86  ? ASP B 81  ASN B 86  
CA 1  ASP C 81  ? ASN C 86  ? ASP C 81  ASN C 86  
CA 2  LYS C 90  ? ASP C 96  ? LYS C 90  ASP C 96  
CA 3  THR C 149 ? GLN C 159 ? THR C 149 GLN C 159 
CA 4  HIS C 163 ? TYR C 171 ? HIS C 163 TYR C 171 
CA 5  LEU C 176 ? ASP C 187 ? LEU C 176 ASP C 187 
CA 6  THR C 130 ? GLN C 139 ? THR C 130 GLN C 139 
CA 7  THR D 130 ? GLN D 139 ? THR D 130 GLN D 139 
CA 8  LEU D 176 ? ASP D 187 ? LEU D 176 ASP D 187 
CA 9  HIS D 163 ? TYR D 171 ? HIS D 163 TYR D 171 
CA 10 THR D 149 ? GLN D 159 ? THR D 149 GLN D 159 
CA 11 LYS D 90  ? ASP D 96  ? LYS D 90  ASP D 96  
CA 12 ASP D 81  ? ASN D 86  ? ASP D 81  ASN D 86  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N ASN A 86  ? N ASN A 86  O LYS A 90  ? O LYS A 90  
AA 2  3  N LEU A 95  ? N LEU A 95  O VAL A 150 ? O VAL A 150 
AA 3  4  N VAL A 157 ? N VAL A 157 O TYR A 165 ? O TYR A 165 
AA 4  5  O SER A 170 ? O SER A 170 N VAL A 177 ? N VAL A 177 
AA 5  6  N ASP A 187 ? N ASP A 187 O THR A 130 ? O THR A 130 
AA 6  7  N ILE A 138 ? N ILE A 138 O SER B 136 ? O SER B 136 
AA 7  8  N GLN B 139 ? N GLN B 139 O LYS B 179 ? O LYS B 179 
AA 8  9  N MSE B 184 ? N MSE B 184 O TYR B 164 ? O TYR B 164 
AA 9  10 N TYR B 171 ? N TYR B 171 O ARG B 151 ? O ARG B 151 
AA 10 11 N ALA B 154 ? N ALA B 154 O ALA B 91  ? O ALA B 91  
AA 11 12 N ILE B 94  ? N ILE B 94  O ASP B 81  ? O ASP B 81  
CA 1  2  N ASN C 86  ? N ASN C 86  O LYS C 90  ? O LYS C 90  
CA 2  3  N LEU C 95  ? N LEU C 95  O VAL C 150 ? O VAL C 150 
CA 3  4  N VAL C 157 ? N VAL C 157 O TYR C 165 ? O TYR C 165 
CA 4  5  O SER C 170 ? O SER C 170 N VAL C 177 ? N VAL C 177 
CA 5  6  N ASP C 187 ? N ASP C 187 O THR C 130 ? O THR C 130 
CA 6  7  N ILE C 138 ? N ILE C 138 O SER D 136 ? O SER D 136 
CA 7  8  N GLN D 139 ? N GLN D 139 O LYS D 179 ? O LYS D 179 
CA 8  9  N MSE D 184 ? N MSE D 184 O TYR D 164 ? O TYR D 164 
CA 9  10 N TYR D 171 ? N TYR D 171 O ARG D 151 ? O ARG D 151 
CA 10 11 N ALA D 154 ? N ALA D 154 O ALA D 91  ? O ALA D 91  
CA 11 12 N ILE D 94  ? N ILE D 94  O ASP D 81  ? O ASP D 81  
# 
_database_PDB_matrix.entry_id          4A12 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4A12 
_atom_sites.fract_transf_matrix[1][1]   0.008719 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004001 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005580 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LYS A 1 7   ? 11.973  104.180 -39.705  1.00 193.58 ?  7   LYS A N     1 
ATOM   2    C  CA    . LYS A 1 7   ? 10.871  104.793 -38.962  1.00 194.44 ?  7   LYS A CA    1 
ATOM   3    C  C     . LYS A 1 7   ? 10.922  104.533 -37.444  1.00 196.66 ?  7   LYS A C     1 
ATOM   4    O  O     . LYS A 1 7   ? 10.600  105.434 -36.664  1.00 197.72 ?  7   LYS A O     1 
ATOM   5    C  CB    . LYS A 1 7   ? 9.515   104.356 -39.541  1.00 195.52 ?  7   LYS A CB    1 
ATOM   6    C  CG    . LYS A 1 7   ? 9.107   105.101 -40.803  1.00 203.64 ?  7   LYS A CG    1 
ATOM   7    C  CD    . LYS A 1 7   ? 8.423   106.429 -40.497  1.00 199.76 ?  7   LYS A CD    1 
ATOM   8    C  CE    . LYS A 1 7   ? 7.921   107.112 -41.741  1.00 212.58 ?  7   LYS A CE    1 
ATOM   9    N  NZ    . LYS A 1 7   ? 7.307   108.426 -41.430  1.00 227.98 ?  7   LYS A NZ    1 
ATOM   10   N  N     . LEU A 1 8   ? 11.319  103.313 -37.029  1.00 192.75 ?  8   LEU A N     1 
ATOM   11   C  CA    . LEU A 1 8   ? 11.383  102.932 -35.614  1.00 192.43 ?  8   LEU A CA    1 
ATOM   12   C  C     . LEU A 1 8   ? 12.771  103.074 -34.985  1.00 194.50 ?  8   LEU A C     1 
ATOM   13   O  O     . LEU A 1 8   ? 13.734  102.458 -35.452  1.00 193.20 ?  8   LEU A O     1 
ATOM   14   C  CB    . LEU A 1 8   ? 10.833  101.507 -35.398  1.00 190.86 ?  8   LEU A CB    1 
ATOM   15   C  CG    . LEU A 1 8   ? 9.336   101.291 -35.626  1.00 193.92 ?  8   LEU A CG    1 
ATOM   16   C  CD1   . LEU A 1 8   ? 9.020   99.818  -35.747  1.00 192.04 ?  8   LEU A CD1   1 
ATOM   17   C  CD2   . LEU A 1 8   ? 8.508   101.909 -34.507  1.00 196.94 ?  8   LEU A CD2   1 
ATOM   18   N  N     . LYS A 1 9   ? 12.859  103.867 -33.905  1.00 193.10 ?  9   LYS A N     1 
ATOM   19   C  CA    . LYS A 1 9   ? 14.099  104.067 -33.149  1.00 193.12 ?  9   LYS A CA    1 
ATOM   20   C  C     . LYS A 1 9   ? 14.290  102.889 -32.171  1.00 194.14 ?  9   LYS A C     1 
ATOM   21   O  O     . LYS A 1 9   ? 13.341  102.136 -31.937  1.00 193.23 ?  9   LYS A O     1 
ATOM   22   C  CB    . LYS A 1 9   ? 14.079  105.412 -32.405  1.00 196.50 ?  9   LYS A CB    1 
ATOM   23   C  CG    . LYS A 1 9   ? 13.994  106.623 -33.326  1.00 198.32 ?  9   LYS A CG    1 
ATOM   24   C  CD    . LYS A 1 9   ? 13.910  107.898 -32.528  1.00 205.66 ?  9   LYS A CD    1 
ATOM   25   C  CE    . LYS A 1 9   ? 15.218  108.650 -32.488  1.00 219.81 ?  9   LYS A CE    1 
ATOM   26   N  NZ    . LYS A 1 9   ? 15.124  109.864 -31.640  1.00 230.37 ?  9   LYS A NZ    1 
ATOM   27   N  N     . LYS A 1 10  ? 15.515  102.722 -31.626  1.00 191.31 ?  10  LYS A N     1 
ATOM   28   C  CA    . LYS A 1 10  ? 15.922  101.659 -30.689  1.00 189.82 ?  10  LYS A CA    1 
ATOM   29   C  C     . LYS A 1 10  ? 14.832  101.212 -29.696  1.00 191.45 ?  10  LYS A C     1 
ATOM   30   O  O     . LYS A 1 10  ? 14.411  100.060 -29.751  1.00 189.52 ?  10  LYS A O     1 
ATOM   31   C  CB    . LYS A 1 10  ? 17.230  102.052 -29.980  1.00 192.19 ?  10  LYS A CB    1 
ATOM   32   C  CG    . LYS A 1 10  ? 17.777  101.039 -28.993  1.00 200.43 ?  10  LYS A CG    1 
ATOM   33   C  CD    . LYS A 1 10  ? 18.884  101.681 -28.200  1.00 208.62 ?  10  LYS A CD    1 
ATOM   34   C  CE    . LYS A 1 10  ? 19.745  100.658 -27.563  1.00 214.95 ?  10  LYS A CE    1 
ATOM   35   N  NZ    . LYS A 1 10  ? 19.931  100.933 -26.114  1.00 217.11 ?  10  LYS A NZ    1 
ATOM   36   N  N     . ASP A 1 11  ? 14.359  102.127 -28.830  1.00 190.21 ?  11  ASP A N     1 
ATOM   37   C  CA    . ASP A 1 11  ? 13.334  101.838 -27.822  1.00 189.92 ?  11  ASP A CA    1 
ATOM   38   C  C     . ASP A 1 11  ? 11.977  101.450 -28.410  1.00 190.97 ?  11  ASP A C     1 
ATOM   39   O  O     . ASP A 1 11  ? 11.365  100.498 -27.924  1.00 189.43 ?  11  ASP A O     1 
ATOM   40   C  CB    . ASP A 1 11  ? 13.197  102.997 -26.817  1.00 193.09 ?  11  ASP A CB    1 
ATOM   41   C  CG    . ASP A 1 11  ? 14.333  103.123 -25.812  1.00 200.17 ?  11  ASP A CG    1 
ATOM   42   O  OD1   . ASP A 1 11  ? 15.092  102.135 -25.637  1.00 199.45 ?  11  ASP A OD1   1 
ATOM   43   O  OD2   . ASP A 1 11  ? 14.450  104.199 -25.181  1.00 203.29 -1 11  ASP A OD2   1 
ATOM   44   N  N     . LYS A 1 12  ? 11.519  102.174 -29.452  1.00 188.78 ?  12  LYS A N     1 
ATOM   45   C  CA    . LYS A 1 12  ? 10.240  101.927 -30.132  1.00 187.98 ?  12  LYS A CA    1 
ATOM   46   C  C     . LYS A 1 12  ? 10.229  100.576 -30.846  1.00 187.48 ?  12  LYS A C     1 
ATOM   47   O  O     . LYS A 1 12  ? 9.219   99.872  -30.789  1.00 186.39 ?  12  LYS A O     1 
ATOM   48   C  CB    . LYS A 1 12  ? 9.896   103.064 -31.112  1.00 190.78 ?  12  LYS A CB    1 
ATOM   49   C  CG    . LYS A 1 12  ? 9.509   104.369 -30.422  1.00 200.42 ?  12  LYS A CG    1 
ATOM   50   C  CD    . LYS A 1 12  ? 8.197   104.937 -30.947  1.00 205.82 ?  12  LYS A CD    1 
ATOM   51   C  CE    . LYS A 1 12  ? 7.747   106.119 -30.127  1.00 216.91 ?  12  LYS A CE    1 
ATOM   52   N  NZ    . LYS A 1 12  ? 6.402   106.597 -30.539  1.00 224.60 ?  12  LYS A NZ    1 
ATOM   53   N  N     . ARG A 1 13  ? 11.356  100.215 -31.499  1.00 183.36 ?  13  ARG A N     1 
ATOM   54   C  CA    . ARG A 1 13  ? 11.535  98.951  -32.219  1.00 180.67 ?  13  ARG A CA    1 
ATOM   55   C  C     . ARG A 1 13  ? 11.468  97.775  -31.253  1.00 181.66 ?  13  ARG A C     1 
ATOM   56   O  O     . ARG A 1 13  ? 10.766  96.805  -31.533  1.00 180.81 ?  13  ARG A O     1 
ATOM   57   C  CB    . ARG A 1 13  ? 12.879  98.932  -32.969  1.00 179.81 ?  13  ARG A CB    1 
ATOM   58   C  CG    . ARG A 1 13  ? 13.033  97.744  -33.922  1.00 182.24 ?  13  ARG A CG    1 
ATOM   59   C  CD    . ARG A 1 13  ? 14.452  97.351  -34.342  1.00 184.15 ?  13  ARG A CD    1 
ATOM   60   N  NE    . ARG A 1 13  ? 15.503  98.340  -34.104  1.00 187.25 ?  13  ARG A NE    1 
ATOM   61   C  CZ    . ARG A 1 13  ? 16.286  98.363  -33.031  1.00 195.89 ?  13  ARG A CZ    1 
ATOM   62   N  NH1   . ARG A 1 13  ? 16.102  97.496  -32.048  1.00 184.52 ?  13  ARG A NH1   1 
ATOM   63   N  NH2   . ARG A 1 13  ? 17.229  99.284  -32.913  1.00 188.34 ?  13  ARG A NH2   1 
ATOM   64   N  N     . ARG A 1 14  ? 12.187  97.874  -30.118  1.00 179.43 ?  14  ARG A N     1 
ATOM   65   C  CA    . ARG A 1 14  ? 12.236  96.843  -29.080  1.00 177.97 ?  14  ARG A CA    1 
ATOM   66   C  C     . ARG A 1 14  ? 10.863  96.553  -28.494  1.00 181.31 ?  14  ARG A C     1 
ATOM   67   O  O     . ARG A 1 14  ? 10.520  95.386  -28.308  1.00 176.30 ?  14  ARG A O     1 
ATOM   68   C  CB    . ARG A 1 14  ? 13.241  97.210  -27.990  1.00 178.76 ?  14  ARG A CB    1 
ATOM   69   C  CG    . ARG A 1 14  ? 14.674  96.979  -28.427  1.00 182.35 ?  14  ARG A CG    1 
ATOM   70   C  CD    . ARG A 1 14  ? 15.655  97.594  -27.461  1.00 187.91 ?  14  ARG A CD    1 
ATOM   71   N  NE    . ARG A 1 14  ? 17.028  97.208  -27.785  1.00 192.19 ?  14  ARG A NE    1 
ATOM   72   C  CZ    . ARG A 1 14  ? 18.082  97.517  -27.041  1.00 203.38 ?  14  ARG A CZ    1 
ATOM   73   N  NH1   . ARG A 1 14  ? 17.933  98.216  -25.921  1.00 197.57 ?  14  ARG A NH1   1 
ATOM   74   N  NH2   . ARG A 1 14  ? 19.296  97.133  -27.409  1.00 192.73 ?  14  ARG A NH2   1 
ATOM   75   N  N     . GLU A 1 15  ? 10.072  97.619  -28.247  1.00 179.59 ?  15  GLU A N     1 
ATOM   76   C  CA    . GLU A 1 15  ? 8.696   97.593  -27.743  1.00 179.83 ?  15  GLU A CA    1 
ATOM   77   C  C     . GLU A 1 15  ? 7.811   96.797  -28.718  1.00 180.87 ?  15  GLU A C     1 
ATOM   78   O  O     . GLU A 1 15  ? 7.005   95.975  -28.280  1.00 179.86 ?  15  GLU A O     1 
ATOM   79   C  CB    . GLU A 1 15  ? 8.186   99.047  -27.586  1.00 183.07 ?  15  GLU A CB    1 
ATOM   80   C  CG    . GLU A 1 15  ? 6.705   99.215  -27.273  1.00 192.59 ?  15  GLU A CG    1 
ATOM   81   C  CD    . GLU A 1 15  ? 6.320   99.066  -25.815  1.00 208.99 ?  15  GLU A CD    1 
ATOM   82   O  OE1   . GLU A 1 15  ? 6.285   97.915  -25.322  1.00 205.56 -1 15  GLU A OE1   1 
ATOM   83   O  OE2   . GLU A 1 15  ? 6.028   100.100 -25.171  1.00 203.71 ?  15  GLU A OE2   1 
ATOM   84   N  N     . ALA A 1 16  ? 7.988   97.034  -30.033  1.00 177.97 ?  16  ALA A N     1 
ATOM   85   C  CA    . ALA A 1 16  ? 7.249   96.362  -31.096  1.00 174.99 ?  16  ALA A CA    1 
ATOM   86   C  C     . ALA A 1 16  ? 7.713   94.916  -31.280  1.00 171.62 ?  16  ALA A C     1 
ATOM   87   O  O     . ALA A 1 16  ? 6.878   94.055  -31.561  1.00 168.13 ?  16  ALA A O     1 
ATOM   88   C  CB    . ALA A 1 16  ? 7.378   97.136  -32.394  1.00 177.39 ?  16  ALA A CB    1 
ATOM   89   N  N     . ILE A 1 17  ? 9.035   94.647  -31.110  1.00 165.70 ?  17  ILE A N     1 
ATOM   90   C  CA    . ILE A 1 17  ? 9.632   93.306  -31.200  1.00 158.87 ?  17  ILE A CA    1 
ATOM   91   C  C     . ILE A 1 17  ? 9.058   92.424  -30.086  1.00 160.04 ?  17  ILE A C     1 
ATOM   92   O  O     . ILE A 1 17  ? 8.618   91.308  -30.365  1.00 155.11 ?  17  ILE A O     1 
ATOM   93   C  CB    . ILE A 1 17  ? 11.191  93.365  -31.192  1.00 161.34 ?  17  ILE A CB    1 
ATOM   94   C  CG1   . ILE A 1 17  ? 11.721  93.796  -32.570  1.00 162.66 ?  17  ILE A CG1   1 
ATOM   95   C  CG2   . ILE A 1 17  ? 11.824  92.024  -30.772  1.00 156.33 ?  17  ILE A CG2   1 
ATOM   96   C  CD1   . ILE A 1 17  ? 13.179  94.199  -32.596  1.00 172.22 ?  17  ILE A CD1   1 
ATOM   97   N  N     . ARG A 1 18  ? 9.047   92.942  -28.836  1.00 159.68 ?  18  ARG A N     1 
ATOM   98   C  CA    . ARG A 1 18  ? 8.510   92.284  -27.641  1.00 158.11 ?  18  ARG A CA    1 
ATOM   99   C  C     . ARG A 1 18  ? 7.046   91.877  -27.862  1.00 161.03 ?  18  ARG A C     1 
ATOM   100  O  O     . ARG A 1 18  ? 6.680   90.737  -27.565  1.00 156.79 ?  18  ARG A O     1 
ATOM   101  C  CB    . ARG A 1 18  ? 8.681   93.205  -26.405  1.00 163.69 ?  18  ARG A CB    1 
ATOM   102  C  CG    . ARG A 1 18  ? 7.716   92.986  -25.224  1.00 176.14 ?  18  ARG A CG    1 
ATOM   103  C  CD    . ARG A 1 18  ? 7.994   91.737  -24.392  1.00 183.65 ?  18  ARG A CD    1 
ATOM   104  N  NE    . ARG A 1 18  ? 9.314   91.758  -23.756  1.00 195.54 ?  18  ARG A NE    1 
ATOM   105  C  CZ    . ARG A 1 18  ? 9.574   92.315  -22.579  1.00 205.74 ?  18  ARG A CZ    1 
ATOM   106  N  NH1   . ARG A 1 18  ? 8.611   92.918  -21.890  1.00 198.22 ?  18  ARG A NH1   1 
ATOM   107  N  NH2   . ARG A 1 18  ? 10.803  92.282  -22.080  1.00 199.74 ?  18  ARG A NH2   1 
ATOM   108  N  N     . GLN A 1 19  ? 6.235   92.797  -28.416  1.00 161.46 ?  19  GLN A N     1 
ATOM   109  C  CA    . GLN A 1 19  ? 4.826   92.565  -28.718  1.00 161.68 ?  19  GLN A CA    1 
ATOM   110  C  C     . GLN A 1 19  ? 4.636   91.544  -29.839  1.00 160.76 ?  19  GLN A C     1 
ATOM   111  O  O     . GLN A 1 19  ? 3.713   90.736  -29.756  1.00 158.23 ?  19  GLN A O     1 
ATOM   112  C  CB    . GLN A 1 19  ? 4.117   93.883  -29.036  1.00 169.40 ?  19  GLN A CB    1 
ATOM   113  C  CG    . GLN A 1 19  ? 3.688   94.630  -27.778  1.00 186.06 ?  19  GLN A CG    1 
ATOM   114  C  CD    . GLN A 1 19  ? 3.215   96.029  -28.063  1.00 199.29 ?  19  GLN A CD    1 
ATOM   115  O  OE1   . GLN A 1 19  ? 2.203   96.254  -28.736  1.00 196.19 ?  19  GLN A OE1   1 
ATOM   116  N  NE2   . GLN A 1 19  ? 3.921   97.003  -27.518  1.00 194.48 ?  19  GLN A NE2   1 
ATOM   117  N  N     . GLN A 1 20  ? 5.516   91.564  -30.864  1.00 156.13 ?  20  GLN A N     1 
ATOM   118  C  CA    . GLN A 1 20  ? 5.478   90.635  -31.997  1.00 151.74 ?  20  GLN A CA    1 
ATOM   119  C  C     . GLN A 1 20  ? 5.790   89.199  -31.550  1.00 150.38 ?  20  GLN A C     1 
ATOM   120  O  O     . GLN A 1 20  ? 5.117   88.265  -31.994  1.00 146.95 ?  20  GLN A O     1 
ATOM   121  C  CB    . GLN A 1 20  ? 6.428   91.091  -33.119  1.00 153.35 ?  20  GLN A CB    1 
ATOM   122  C  CG    . GLN A 1 20  ? 6.312   90.314  -34.439  1.00 168.45 ?  20  GLN A CG    1 
ATOM   123  C  CD    . GLN A 1 20  ? 4.933   90.344  -35.056  1.00 189.17 ?  20  GLN A CD    1 
ATOM   124  O  OE1   . GLN A 1 20  ? 4.523   91.325  -35.694  1.00 188.29 ?  20  GLN A OE1   1 
ATOM   125  N  NE2   . GLN A 1 20  ? 4.234   89.225  -34.974  1.00 178.54 ?  20  GLN A NE2   1 
ATOM   126  N  N     . ILE A 1 21  ? 6.799   89.034  -30.668  1.00 145.85 ?  21  ILE A N     1 
ATOM   127  C  CA    . ILE A 1 21  ? 7.199   87.741  -30.106  1.00 140.67 ?  21  ILE A CA    1 
ATOM   128  C  C     . ILE A 1 21  ? 6.097   87.230  -29.160  1.00 144.78 ?  21  ILE A C     1 
ATOM   129  O  O     . ILE A 1 21  ? 5.830   86.029  -29.134  1.00 140.08 ?  21  ILE A O     1 
ATOM   130  C  CB    . ILE A 1 21  ? 8.613   87.818  -29.458  1.00 143.24 ?  21  ILE A CB    1 
ATOM   131  C  CG1   . ILE A 1 21  ? 9.709   87.908  -30.551  1.00 142.31 ?  21  ILE A CG1   1 
ATOM   132  C  CG2   . ILE A 1 21  ? 8.876   86.638  -28.520  1.00 140.33 ?  21  ILE A CG2   1 
ATOM   133  C  CD1   . ILE A 1 21  ? 11.105  88.337  -30.076  1.00 149.91 ?  21  ILE A CD1   1 
ATOM   134  N  N     . ASP A 1 22  ? 5.430   88.146  -28.426  1.00 146.59 ?  22  ASP A N     1 
ATOM   135  C  CA    . ASP A 1 22  ? 4.319   87.803  -27.540  1.00 147.49 ?  22  ASP A CA    1 
ATOM   136  C  C     . ASP A 1 22  ? 3.128   87.301  -28.367  1.00 150.65 ?  22  ASP A C     1 
ATOM   137  O  O     . ASP A 1 22  ? 2.520   86.290  -28.010  1.00 147.99 ?  22  ASP A O     1 
ATOM   138  C  CB    . ASP A 1 22  ? 3.910   89.010  -26.678  1.00 155.26 ?  22  ASP A CB    1 
ATOM   139  C  CG    . ASP A 1 22  ? 2.822   88.721  -25.655  1.00 166.01 ?  22  ASP A CG    1 
ATOM   140  O  OD1   . ASP A 1 22  ? 2.367   87.555  -25.577  1.00 162.87 ?  22  ASP A OD1   1 
ATOM   141  O  OD2   . ASP A 1 22  ? 2.435   89.658  -24.915  1.00 176.42 -1 22  ASP A OD2   1 
ATOM   142  N  N     . SER A 1 23  ? 2.836   87.979  -29.494  1.00 149.07 ?  23  SER A N     1 
ATOM   143  C  CA    . SER A 1 23  ? 1.741   87.628  -30.400  1.00 148.46 ?  23  SER A CA    1 
ATOM   144  C  C     . SER A 1 23  ? 2.013   86.350  -31.202  1.00 146.06 ?  23  SER A C     1 
ATOM   145  O  O     . SER A 1 23  ? 1.065   85.657  -31.573  1.00 144.64 ?  23  SER A O     1 
ATOM   146  C  CB    . SER A 1 23  ? 1.420   88.792  -31.334  1.00 156.59 ?  23  SER A CB    1 
ATOM   147  O  OG    . SER A 1 23  ? 0.519   88.396  -32.354  1.00 165.61 ?  23  SER A OG    1 
ATOM   148  N  N     . ASN A 1 24  ? 3.293   86.069  -31.500  1.00 138.61 ?  24  ASN A N     1 
ATOM   149  C  CA    . ASN A 1 24  ? 3.722   84.883  -32.236  1.00 132.80 ?  24  ASN A CA    1 
ATOM   150  C  C     . ASN A 1 24  ? 5.099   84.437  -31.735  1.00 133.23 ?  24  ASN A C     1 
ATOM   151  O  O     . ASN A 1 24  ? 6.112   84.971  -32.191  1.00 133.43 ?  24  ASN A O     1 
ATOM   152  C  CB    . ASN A 1 24  ? 3.720   85.126  -33.756  1.00 132.19 ?  24  ASN A CB    1 
ATOM   153  C  CG    . ASN A 1 24  ? 4.211   83.952  -34.579  1.00 145.38 ?  24  ASN A CG    1 
ATOM   154  O  OD1   . ASN A 1 24  ? 4.061   82.776  -34.214  1.00 134.49 ?  24  ASN A OD1   1 
ATOM   155  N  ND2   . ASN A 1 24  ? 4.804   84.253  -35.722  1.00 137.10 ?  24  ASN A ND2   1 
ATOM   156  N  N     . PRO A 1 25  ? 5.168   83.476  -30.783  1.00 126.50 ?  25  PRO A N     1 
ATOM   157  C  CA    . PRO A 1 25  ? 6.483   83.035  -30.280  1.00 123.59 ?  25  PRO A CA    1 
ATOM   158  C  C     . PRO A 1 25  ? 7.257   82.185  -31.280  1.00 122.29 ?  25  PRO A C     1 
ATOM   159  O  O     . PRO A 1 25  ? 8.472   82.010  -31.134  1.00 120.37 ?  25  PRO A O     1 
ATOM   160  C  CB    . PRO A 1 25  ? 6.139   82.243  -29.006  1.00 124.49 ?  25  PRO A CB    1 
ATOM   161  C  CG    . PRO A 1 25  ? 4.661   82.451  -28.775  1.00 131.50 ?  25  PRO A CG    1 
ATOM   162  C  CD    . PRO A 1 25  ? 4.077   82.746  -30.114  1.00 127.49 ?  25  PRO A CD    1 
ATOM   163  N  N     . PHE A 1 26  ? 6.548   81.674  -32.303  1.00 116.83 ?  26  PHE A N     1 
ATOM   164  C  CA    . PHE A 1 26  ? 7.080   80.819  -33.363  1.00 112.84 ?  26  PHE A CA    1 
ATOM   165  C  C     . PHE A 1 26  ? 7.851   81.595  -34.441  1.00 117.03 ?  26  PHE A C     1 
ATOM   166  O  O     . PHE A 1 26  ? 8.408   80.975  -35.353  1.00 113.89 ?  26  PHE A O     1 
ATOM   167  C  CB    . PHE A 1 26  ? 5.956   79.960  -33.973  1.00 113.07 ?  26  PHE A CB    1 
ATOM   168  C  CG    . PHE A 1 26  ? 5.281   79.034  -32.985  1.00 113.51 ?  26  PHE A CG    1 
ATOM   169  C  CD1   . PHE A 1 26  ? 4.173   79.454  -32.255  1.00 119.63 ?  26  PHE A CD1   1 
ATOM   170  C  CD2   . PHE A 1 26  ? 5.748   77.741  -32.789  1.00 112.11 ?  26  PHE A CD2   1 
ATOM   171  C  CE1   . PHE A 1 26  ? 3.565   78.603  -31.321  1.00 119.84 ?  26  PHE A CE1   1 
ATOM   172  C  CE2   . PHE A 1 26  ? 5.125   76.887  -31.873  1.00 114.33 ?  26  PHE A CE2   1 
ATOM   173  C  CZ    . PHE A 1 26  ? 4.044   77.327  -31.139  1.00 115.37 ?  26  PHE A CZ    1 
ATOM   174  N  N     . ILE A 1 27  ? 7.913   82.941  -34.321  1.00 117.07 ?  27  ILE A N     1 
ATOM   175  C  CA    . ILE A 1 27  ? 8.637   83.812  -35.252  1.00 118.29 ?  27  ILE A CA    1 
ATOM   176  C  C     . ILE A 1 27  ? 10.150  83.594  -35.131  1.00 120.13 ?  27  ILE A C     1 
ATOM   177  O  O     . ILE A 1 27  ? 10.638  83.330  -34.032  1.00 119.02 ?  27  ILE A O     1 
ATOM   178  C  CB    . ILE A 1 27  ? 8.216   85.306  -35.087  1.00 126.72 ?  27  ILE A CB    1 
ATOM   179  C  CG1   . ILE A 1 27  ? 8.515   86.119  -36.358  1.00 129.38 ?  27  ILE A CG1   1 
ATOM   180  C  CG2   . ILE A 1 27  ? 8.800   85.973  -33.819  1.00 129.78 ?  27  ILE A CG2   1 
ATOM   181  C  CD1   . ILE A 1 27  ? 7.587   87.283  -36.598  1.00 141.96 ?  27  ILE A CD1   1 
ATOM   182  N  N     . THR A 1 28  ? 10.879  83.670  -36.254  1.00 116.09 ?  28  THR A N     1 
ATOM   183  C  CA    . THR A 1 28  ? 12.339  83.510  -36.267  1.00 114.78 ?  28  THR A CA    1 
ATOM   184  C  C     . THR A 1 28  ? 13.004  84.880  -36.211  1.00 124.34 ?  28  THR A C     1 
ATOM   185  O  O     . THR A 1 28  ? 12.344  85.887  -36.487  1.00 127.58 ?  28  THR A O     1 
ATOM   186  C  CB    . THR A 1 28  ? 12.807  82.738  -37.509  1.00 117.00 ?  28  THR A CB    1 
ATOM   187  O  OG1   . THR A 1 28  ? 12.283  83.360  -38.672  1.00 118.19 ?  28  THR A OG1   1 
ATOM   188  C  CG2   . THR A 1 28  ? 12.394  81.287  -37.493  1.00 111.37 ?  28  THR A CG2   1 
ATOM   189  N  N     . ASP A 1 29  ? 14.312  84.924  -35.880  1.00 121.83 ?  29  ASP A N     1 
ATOM   190  C  CA    . ASP A 1 29  ? 15.080  86.172  -35.851  1.00 126.21 ?  29  ASP A CA    1 
ATOM   191  C  C     . ASP A 1 29  ? 15.208  86.728  -37.270  1.00 133.12 ?  29  ASP A C     1 
ATOM   192  O  O     . ASP A 1 29  ? 15.222  87.945  -37.452  1.00 137.18 ?  29  ASP A O     1 
ATOM   193  C  CB    . ASP A 1 29  ? 16.465  85.948  -35.226  1.00 127.29 ?  29  ASP A CB    1 
ATOM   194  C  CG    . ASP A 1 29  ? 16.508  85.952  -33.707  1.00 135.94 ?  29  ASP A CG    1 
ATOM   195  O  OD1   . ASP A 1 29  ? 15.428  85.844  -33.073  1.00 141.33 -1 29  ASP A OD1   1 
ATOM   196  O  OD2   . ASP A 1 29  ? 17.618  86.062  -33.150  1.00 136.84 ?  29  ASP A OD2   1 
ATOM   197  N  N     . HIS A 1 30  ? 15.253  85.826  -38.274  1.00 127.61 ?  30  HIS A N     1 
ATOM   198  C  CA    . HIS A 1 30  ? 15.323  86.177  -39.688  1.00 129.16 ?  30  HIS A CA    1 
ATOM   199  C  C     . HIS A 1 30  ? 14.054  86.904  -40.132  1.00 134.12 ?  30  HIS A C     1 
ATOM   200  O  O     . HIS A 1 30  ? 14.159  87.909  -40.829  1.00 137.82 ?  30  HIS A O     1 
ATOM   201  C  CB    . HIS A 1 30  ? 15.569  84.933  -40.557  1.00 126.44 ?  30  HIS A CB    1 
ATOM   202  C  CG    . HIS A 1 30  ? 15.695  85.257  -42.010  1.00 131.92 ?  30  HIS A CG    1 
ATOM   203  N  ND1   . HIS A 1 30  ? 16.868  85.762  -42.533  1.00 135.92 ?  30  HIS A ND1   1 
ATOM   204  C  CD2   . HIS A 1 30  ? 14.770  85.183  -42.996  1.00 134.40 ?  30  HIS A CD2   1 
ATOM   205  C  CE1   . HIS A 1 30  ? 16.628  85.965  -43.818  1.00 136.78 ?  30  HIS A CE1   1 
ATOM   206  N  NE2   . HIS A 1 30  ? 15.379  85.632  -44.142  1.00 136.20 ?  30  HIS A NE2   1 
ATOM   207  N  N     . GLU A 1 31  ? 12.868  86.408  -39.707  1.00 127.74 ?  31  GLU A N     1 
ATOM   208  C  CA    . GLU A 1 31  ? 11.549  86.979  -40.009  1.00 129.62 ?  31  GLU A CA    1 
ATOM   209  C  C     . GLU A 1 31  ? 11.390  88.363  -39.388  1.00 137.53 ?  31  GLU A C     1 
ATOM   210  O  O     . GLU A 1 31  ? 10.775  89.242  -39.994  1.00 140.89 ?  31  GLU A O     1 
ATOM   211  C  CB    . GLU A 1 31  ? 10.431  86.052  -39.515  1.00 128.26 ?  31  GLU A CB    1 
ATOM   212  C  CG    . GLU A 1 31  ? 10.037  84.973  -40.507  1.00 136.70 ?  31  GLU A CG    1 
ATOM   213  C  CD    . GLU A 1 31  ? 9.385   83.753  -39.885  1.00 155.92 ?  31  GLU A CD    1 
ATOM   214  O  OE1   . GLU A 1 31  ? 8.279   83.888  -39.313  1.00 153.66 ?  31  GLU A OE1   1 
ATOM   215  O  OE2   . GLU A 1 31  ? 9.985   82.657  -39.969  1.00 146.76 -1 31  GLU A OE2   1 
ATOM   216  N  N     . LEU A 1 32  ? 11.945  88.548  -38.179  1.00 133.64 ?  32  LEU A N     1 
ATOM   217  C  CA    . LEU A 1 32  ? 11.932  89.811  -37.453  1.00 138.06 ?  32  LEU A CA    1 
ATOM   218  C  C     . LEU A 1 32  ? 12.862  90.816  -38.131  1.00 145.85 ?  32  LEU A C     1 
ATOM   219  O  O     . LEU A 1 32  ? 12.500  91.990  -38.234  1.00 150.68 ?  32  LEU A O     1 
ATOM   220  C  CB    . LEU A 1 32  ? 12.326  89.614  -35.977  1.00 137.23 ?  32  LEU A CB    1 
ATOM   221  C  CG    . LEU A 1 32  ? 11.318  88.890  -35.078  1.00 139.37 ?  32  LEU A CG    1 
ATOM   222  C  CD1   . LEU A 1 32  ? 11.993  88.340  -33.845  1.00 137.60 ?  32  LEU A CD1   1 
ATOM   223  C  CD2   . LEU A 1 32  ? 10.163  89.796  -34.676  1.00 145.67 ?  32  LEU A CD2   1 
ATOM   224  N  N     . SER A 1 33  ? 14.037  90.352  -38.632  1.00 139.90 ?  33  SER A N     1 
ATOM   225  C  CA    . SER A 1 33  ? 15.015  91.196  -39.330  1.00 143.01 ?  33  SER A CA    1 
ATOM   226  C  C     . SER A 1 33  ? 14.427  91.799  -40.616  1.00 150.68 ?  33  SER A C     1 
ATOM   227  O  O     . SER A 1 33  ? 14.670  92.975  -40.899  1.00 155.58 ?  33  SER A O     1 
ATOM   228  C  CB    . SER A 1 33  ? 16.311  90.435  -39.602  1.00 142.44 ?  33  SER A CB    1 
ATOM   229  O  OG    . SER A 1 33  ? 16.353  89.846  -40.891  1.00 148.42 ?  33  SER A OG    1 
ATOM   230  N  N     . ASP A 1 34  ? 13.623  91.005  -41.361  1.00 144.73 ?  34  ASP A N     1 
ATOM   231  C  CA    . ASP A 1 34  ? 12.944  91.448  -42.582  1.00 147.16 ?  34  ASP A CA    1 
ATOM   232  C  C     . ASP A 1 34  ? 11.779  92.387  -42.255  1.00 155.97 ?  34  ASP A C     1 
ATOM   233  O  O     . ASP A 1 34  ? 11.622  93.412  -42.920  1.00 160.53 ?  34  ASP A O     1 
ATOM   234  C  CB    . ASP A 1 34  ? 12.450  90.248  -43.413  1.00 144.38 ?  34  ASP A CB    1 
ATOM   235  C  CG    . ASP A 1 34  ? 13.535  89.478  -44.151  1.00 152.34 ?  34  ASP A CG    1 
ATOM   236  O  OD1   . ASP A 1 34  ? 14.552  90.102  -44.539  1.00 163.61 -1 34  ASP A OD1   1 
ATOM   237  O  OD2   . ASP A 1 34  ? 13.352  88.257  -44.373  1.00 147.19 ?  34  ASP A OD2   1 
ATOM   238  N  N     . LEU A 1 35  ? 10.975  92.044  -41.226  1.00 151.33 ?  35  LEU A N     1 
ATOM   239  C  CA    . LEU A 1 35  ? 9.818   92.833  -40.795  1.00 155.20 ?  35  LEU A CA    1 
ATOM   240  C  C     . LEU A 1 35  ? 10.222  94.214  -40.288  1.00 164.98 ?  35  LEU A C     1 
ATOM   241  O  O     . LEU A 1 35  ? 9.565   95.199  -40.621  1.00 169.68 ?  35  LEU A O     1 
ATOM   242  C  CB    . LEU A 1 35  ? 9.025   92.078  -39.704  1.00 152.43 ?  35  LEU A CB    1 
ATOM   243  C  CG    . LEU A 1 35  ? 7.587   92.543  -39.385  1.00 160.49 ?  35  LEU A CG    1 
ATOM   244  C  CD1   . LEU A 1 35  ? 6.613   92.197  -40.511  1.00 159.93 ?  35  LEU A CD1   1 
ATOM   245  C  CD2   . LEU A 1 35  ? 7.064   91.868  -38.137  1.00 160.56 ?  35  LEU A CD2   1 
ATOM   246  N  N     . PHE A 1 36  ? 11.303  94.287  -39.500  1.00 161.68 ?  36  PHE A N     1 
ATOM   247  C  CA    . PHE A 1 36  ? 11.751  95.535  -38.893  1.00 167.28 ?  36  PHE A CA    1 
ATOM   248  C  C     . PHE A 1 36  ? 12.826  96.281  -39.681  1.00 173.44 ?  36  PHE A C     1 
ATOM   249  O  O     . PHE A 1 36  ? 13.188  97.397  -39.297  1.00 174.85 ?  36  PHE A O     1 
ATOM   250  C  CB    . PHE A 1 36  ? 12.136  95.304  -37.422  1.00 168.24 ?  36  PHE A CB    1 
ATOM   251  C  CG    . PHE A 1 36  ? 10.952  94.929  -36.554  1.00 169.46 ?  36  PHE A CG    1 
ATOM   252  C  CD1   . PHE A 1 36  ? 10.386  93.660  -36.624  1.00 167.37 ?  36  PHE A CD1   1 
ATOM   253  C  CD2   . PHE A 1 36  ? 10.406  95.843  -35.664  1.00 176.80 ?  36  PHE A CD2   1 
ATOM   254  C  CE1   . PHE A 1 36  ? 9.285   93.323  -35.833  1.00 168.03 ?  36  PHE A CE1   1 
ATOM   255  C  CE2   . PHE A 1 36  ? 9.315   95.498  -34.866  1.00 179.12 ?  36  PHE A CE2   1 
ATOM   256  C  CZ    . PHE A 1 36  ? 8.753   94.249  -34.966  1.00 172.04 ?  36  PHE A CZ    1 
ATOM   257  N  N     . GLN A 1 37  ? 13.284  95.696  -40.817  1.00 166.91 ?  37  GLN A N     1 
ATOM   258  C  CA    . GLN A 1 37  ? 14.308  96.253  -41.715  1.00 169.26 ?  37  GLN A CA    1 
ATOM   259  C  C     . GLN A 1 37  ? 15.571  96.645  -40.948  1.00 172.76 ?  37  GLN A C     1 
ATOM   260  O  O     . GLN A 1 37  ? 16.064  97.770  -41.038  1.00 173.88 ?  37  GLN A O     1 
ATOM   261  C  CB    . GLN A 1 37  ? 13.748  97.394  -42.594  1.00 172.91 ?  37  GLN A CB    1 
ATOM   262  C  CG    . GLN A 1 37  ? 12.757  96.937  -43.664  1.00 184.64 ?  37  GLN A CG    1 
ATOM   263  C  CD    . GLN A 1 37  ? 13.414  96.125  -44.752  1.00 196.58 ?  37  GLN A CD    1 
ATOM   264  O  OE1   . GLN A 1 37  ? 13.582  94.907  -44.641  1.00 192.08 ?  37  GLN A OE1   1 
ATOM   265  N  NE2   . GLN A 1 37  ? 13.792  96.785  -45.836  1.00 192.89 ?  37  GLN A NE2   1 
ATOM   266  N  N     . VAL A 1 38  ? 16.052  95.694  -40.147  1.00 164.00 ?  38  VAL A N     1 
ATOM   267  C  CA    . VAL A 1 38  ? 17.214  95.820  -39.283  1.00 163.93 ?  38  VAL A CA    1 
ATOM   268  C  C     . VAL A 1 38  ? 18.027  94.513  -39.395  1.00 160.56 ?  38  VAL A C     1 
ATOM   269  O  O     . VAL A 1 38  ? 17.489  93.519  -39.882  1.00 155.13 ?  38  VAL A O     1 
ATOM   270  C  CB    . VAL A 1 38  ? 16.725  96.174  -37.846  1.00 169.41 ?  38  VAL A CB    1 
ATOM   271  C  CG1   . VAL A 1 38  ? 17.854  96.212  -36.826  1.00 164.08 ?  38  VAL A CG1   1 
ATOM   272  C  CG2   . VAL A 1 38  ? 15.916  97.462  -37.823  1.00 172.88 ?  38  VAL A CG2   1 
ATOM   273  N  N     . SER A 1 39  ? 19.314  94.523  -39.001  1.00 157.21 ?  39  SER A N     1 
ATOM   274  C  CA    . SER A 1 39  ? 20.171  93.336  -39.078  1.00 152.11 ?  39  SER A CA    1 
ATOM   275  C  C     . SER A 1 39  ? 19.787  92.267  -38.058  1.00 150.08 ?  39  SER A C     1 
ATOM   276  O  O     . SER A 1 39  ? 19.192  92.584  -37.026  1.00 151.41 ?  39  SER A O     1 
ATOM   277  C  CB    . SER A 1 39  ? 21.635  93.714  -38.889  1.00 159.03 ?  39  SER A CB    1 
ATOM   278  O  OG    . SER A 1 39  ? 22.473  92.591  -39.105  1.00 164.46 ?  39  SER A OG    1 
ATOM   279  N  N     . ILE A 1 40  ? 20.168  91.004  -38.332  1.00 139.62 ?  40  ILE A N     1 
ATOM   280  C  CA    . ILE A 1 40  ? 19.917  89.877  -37.433  1.00 133.99 ?  40  ILE A CA    1 
ATOM   281  C  C     . ILE A 1 40  ? 20.666  90.051  -36.095  1.00 137.38 ?  40  ILE A C     1 
ATOM   282  O  O     . ILE A 1 40  ? 20.130  89.693  -35.047  1.00 135.18 ?  40  ILE A O     1 
ATOM   283  C  CB    . ILE A 1 40  ? 20.159  88.508  -38.138  1.00 131.68 ?  40  ILE A CB    1 
ATOM   284  C  CG1   . ILE A 1 40  ? 19.372  87.383  -37.458  1.00 127.27 ?  40  ILE A CG1   1 
ATOM   285  C  CG2   . ILE A 1 40  ? 21.651  88.162  -38.317  1.00 132.25 ?  40  ILE A CG2   1 
ATOM   286  C  CD1   . ILE A 1 40  ? 18.856  86.335  -38.393  1.00 131.26 ?  40  ILE A CD1   1 
ATOM   287  N  N     . GLN A 1 41  ? 21.875  90.659  -36.147  1.00 136.55 ?  41  GLN A N     1 
ATOM   288  C  CA    . GLN A 1 41  ? 22.749  90.967  -35.009  1.00 138.31 ?  41  GLN A CA    1 
ATOM   289  C  C     . GLN A 1 41  ? 22.041  91.915  -34.040  1.00 143.83 ?  41  GLN A C     1 
ATOM   290  O  O     . GLN A 1 41  ? 22.156  91.753  -32.820  1.00 142.78 ?  41  GLN A O     1 
ATOM   291  C  CB    . GLN A 1 41  ? 24.067  91.599  -35.504  1.00 143.52 ?  41  GLN A CB    1 
ATOM   292  C  CG    . GLN A 1 41  ? 25.077  90.599  -36.085  1.00 155.67 ?  41  GLN A CG    1 
ATOM   293  C  CD    . GLN A 1 41  ? 24.855  90.185  -37.532  1.00 166.34 ?  41  GLN A CD    1 
ATOM   294  O  OE1   . GLN A 1 41  ? 23.986  90.696  -38.248  1.00 162.09 ?  41  GLN A OE1   1 
ATOM   295  N  NE2   . GLN A 1 41  ? 25.668  89.250  -38.005  1.00 151.06 ?  41  GLN A NE2   1 
ATOM   296  N  N     . THR A 1 42  ? 21.284  92.886  -34.602  1.00 143.15 ?  42  THR A N     1 
ATOM   297  C  CA    . THR A 1 42  ? 20.490  93.871  -33.865  1.00 146.64 ?  42  THR A CA    1 
ATOM   298  C  C     . THR A 1 42  ? 19.343  93.137  -33.156  1.00 146.17 ?  42  THR A C     1 
ATOM   299  O  O     . THR A 1 42  ? 19.201  93.285  -31.945  1.00 146.34 ?  42  THR A O     1 
ATOM   300  C  CB    . THR A 1 42  ? 20.013  95.013  -34.795  1.00 157.46 ?  42  THR A CB    1 
ATOM   301  O  OG1   . THR A 1 42  ? 21.036  95.335  -35.741  1.00 157.81 ?  42  THR A OG1   1 
ATOM   302  C  CG2   . THR A 1 42  ? 19.603  96.268  -34.026  1.00 161.34 ?  42  THR A CG2   1 
ATOM   303  N  N     . ILE A 1 43  ? 18.584  92.291  -33.899  1.00 138.28 ?  43  ILE A N     1 
ATOM   304  C  CA    . ILE A 1 43  ? 17.475  91.469  -33.385  1.00 134.19 ?  43  ILE A CA    1 
ATOM   305  C  C     . ILE A 1 43  ? 17.957  90.638  -32.186  1.00 134.45 ?  43  ILE A C     1 
ATOM   306  O  O     . ILE A 1 43  ? 17.276  90.590  -31.159  1.00 134.24 ?  43  ILE A O     1 
ATOM   307  C  CB    . ILE A 1 43  ? 16.853  90.586  -34.515  1.00 133.22 ?  43  ILE A CB    1 
ATOM   308  C  CG1   . ILE A 1 43  ? 16.264  91.431  -35.682  1.00 136.92 ?  43  ILE A CG1   1 
ATOM   309  C  CG2   . ILE A 1 43  ? 15.837  89.560  -33.978  1.00 129.87 ?  43  ILE A CG2   1 
ATOM   310  C  CD1   . ILE A 1 43  ? 14.950  92.277  -35.389  1.00 148.25 ?  43  ILE A CD1   1 
ATOM   311  N  N     . ARG A 1 44  ? 19.154  90.031  -32.315  1.00 128.48 ?  44  ARG A N     1 
ATOM   312  C  CA    . ARG A 1 44  ? 19.796  89.234  -31.272  1.00 125.96 ?  44  ARG A CA    1 
ATOM   313  C  C     . ARG A 1 44  ? 20.113  90.078  -30.038  1.00 133.89 ?  44  ARG A C     1 
ATOM   314  O  O     . ARG A 1 44  ? 19.886  89.616  -28.919  1.00 131.86 ?  44  ARG A O     1 
ATOM   315  C  CB    . ARG A 1 44  ? 21.044  88.525  -31.817  1.00 123.98 ?  44  ARG A CB    1 
ATOM   316  C  CG    . ARG A 1 44  ? 20.746  87.106  -32.277  1.00 127.41 ?  44  ARG A CG    1 
ATOM   317  C  CD    . ARG A 1 44  ? 21.152  86.822  -33.706  1.00 134.52 ?  44  ARG A CD    1 
ATOM   318  N  NE    . ARG A 1 44  ? 20.392  85.698  -34.262  1.00 135.63 ?  44  ARG A NE    1 
ATOM   319  C  CZ    . ARG A 1 44  ? 20.781  84.967  -35.303  1.00 146.25 ?  44  ARG A CZ    1 
ATOM   320  N  NH1   . ARG A 1 44  ? 21.932  85.223  -35.913  1.00 137.64 ?  44  ARG A NH1   1 
ATOM   321  N  NH2   . ARG A 1 44  ? 20.021  83.972  -35.743  1.00 124.80 ?  44  ARG A NH2   1 
ATOM   322  N  N     . LEU A 1 45  ? 20.584  91.329  -30.247  1.00 136.17 ?  45  LEU A N     1 
ATOM   323  C  CA    . LEU A 1 45  ? 20.881  92.277  -29.172  1.00 141.31 ?  45  LEU A CA    1 
ATOM   324  C  C     . LEU A 1 45  ? 19.595  92.748  -28.494  1.00 147.33 ?  45  LEU A C     1 
ATOM   325  O  O     . LEU A 1 45  ? 19.580  92.927  -27.274  1.00 148.90 ?  45  LEU A O     1 
ATOM   326  C  CB    . LEU A 1 45  ? 21.665  93.492  -29.696  1.00 146.82 ?  45  LEU A CB    1 
ATOM   327  C  CG    . LEU A 1 45  ? 23.178  93.339  -29.837  1.00 152.46 ?  45  LEU A CG    1 
ATOM   328  C  CD1   . LEU A 1 45  ? 23.773  94.533  -30.559  1.00 157.79 ?  45  LEU A CD1   1 
ATOM   329  C  CD2   . LEU A 1 45  ? 23.852  93.188  -28.481  1.00 156.58 ?  45  LEU A CD2   1 
ATOM   330  N  N     . ASP A 1 46  ? 18.516  92.934  -29.285  1.00 143.59 ?  46  ASP A N     1 
ATOM   331  C  CA    . ASP A 1 46  ? 17.205  93.379  -28.805  1.00 145.25 ?  46  ASP A CA    1 
ATOM   332  C  C     . ASP A 1 46  ? 16.576  92.362  -27.869  1.00 144.24 ?  46  ASP A C     1 
ATOM   333  O  O     . ASP A 1 46  ? 16.189  92.724  -26.757  1.00 146.05 ?  46  ASP A O     1 
ATOM   334  C  CB    . ASP A 1 46  ? 16.262  93.696  -29.976  1.00 147.77 ?  46  ASP A CB    1 
ATOM   335  C  CG    . ASP A 1 46  ? 16.751  94.807  -30.881  1.00 166.10 ?  46  ASP A CG    1 
ATOM   336  O  OD1   . ASP A 1 46  ? 17.262  95.831  -30.353  1.00 171.69 ?  46  ASP A OD1   1 
ATOM   337  O  OD2   . ASP A 1 46  ? 16.600  94.673  -32.115  1.00 172.42 -1 46  ASP A OD2   1 
ATOM   338  N  N     . ARG A 1 47  ? 16.520  91.084  -28.302  1.00 134.44 ?  47  ARG A N     1 
ATOM   339  C  CA    . ARG A 1 47  ? 15.985  89.977  -27.506  1.00 130.12 ?  47  ARG A CA    1 
ATOM   340  C  C     . ARG A 1 47  ? 16.766  89.819  -26.208  1.00 135.47 ?  47  ARG A C     1 
ATOM   341  O  O     . ARG A 1 47  ? 16.165  89.515  -25.177  1.00 135.28 ?  47  ARG A O     1 
ATOM   342  C  CB    . ARG A 1 47  ? 16.056  88.665  -28.279  1.00 122.53 ?  47  ARG A CB    1 
ATOM   343  C  CG    . ARG A 1 47  ? 14.886  88.387  -29.215  1.00 124.01 ?  47  ARG A CG    1 
ATOM   344  C  CD    . ARG A 1 47  ? 14.864  86.935  -29.672  1.00 116.26 ?  47  ARG A CD    1 
ATOM   345  N  NE    . ARG A 1 47  ? 16.096  86.539  -30.363  1.00 112.10 ?  47  ARG A NE    1 
ATOM   346  C  CZ    . ARG A 1 47  ? 17.092  85.852  -29.800  1.00 119.28 ?  47  ARG A CZ    1 
ATOM   347  N  NH1   . ARG A 1 47  ? 17.011  85.475  -28.530  1.00 103.79 ?  47  ARG A NH1   1 
ATOM   348  N  NH2   . ARG A 1 47  ? 18.174  85.552  -30.501  1.00 102.98 ?  47  ARG A NH2   1 
ATOM   349  N  N     . THR A 1 48  ? 18.103  90.031  -26.262  1.00 133.18 ?  48  THR A N     1 
ATOM   350  C  CA    . THR A 1 48  ? 18.998  89.943  -25.107  1.00 134.31 ?  48  THR A CA    1 
ATOM   351  C  C     . THR A 1 48  ? 18.600  90.966  -24.043  1.00 143.40 ?  48  THR A C     1 
ATOM   352  O  O     . THR A 1 48  ? 18.399  90.588  -22.887  1.00 142.77 ?  48  THR A O     1 
ATOM   353  C  CB    . THR A 1 48  ? 20.464  90.043  -25.554  1.00 143.26 ?  48  THR A CB    1 
ATOM   354  O  OG1   . THR A 1 48  ? 20.753  88.954  -26.434  1.00 139.20 ?  48  THR A OG1   1 
ATOM   355  C  CG2   . THR A 1 48  ? 21.443  90.026  -24.382  1.00 143.03 ?  48  THR A CG2   1 
ATOM   356  N  N     . TYR A 1 49  ? 18.449  92.244  -24.445  1.00 145.14 ?  49  TYR A N     1 
ATOM   357  C  CA    . TYR A 1 49  ? 18.057  93.335  -23.554  1.00 150.65 ?  49  TYR A CA    1 
ATOM   358  C  C     . TYR A 1 49  ? 16.637  93.131  -23.017  1.00 154.26 ?  49  TYR A C     1 
ATOM   359  O  O     . TYR A 1 49  ? 16.388  93.414  -21.843  1.00 156.80 ?  49  TYR A O     1 
ATOM   360  C  CB    . TYR A 1 49  ? 18.197  94.696  -24.256  1.00 156.98 ?  49  TYR A CB    1 
ATOM   361  C  CG    . TYR A 1 49  ? 18.090  95.879  -23.315  1.00 165.53 ?  49  TYR A CG    1 
ATOM   362  C  CD1   . TYR A 1 49  ? 19.192  96.321  -22.589  1.00 171.07 ?  49  TYR A CD1   1 
ATOM   363  C  CD2   . TYR A 1 49  ? 16.887  96.562  -23.155  1.00 169.25 ?  49  TYR A CD2   1 
ATOM   364  C  CE1   . TYR A 1 49  ? 19.098  97.406  -21.717  1.00 173.29 ?  49  TYR A CE1   1 
ATOM   365  C  CE2   . TYR A 1 49  ? 16.780  97.646  -22.284  1.00 172.53 ?  49  TYR A CE2   1 
ATOM   366  C  CZ    . TYR A 1 49  ? 17.889  98.068  -21.570  1.00 178.16 ?  49  TYR A CZ    1 
ATOM   367  O  OH    . TYR A 1 49  ? 17.791  99.141  -20.716  1.00 180.70 ?  49  TYR A OH    1 
ATOM   368  N  N     . LEU A 1 50  ? 15.721  92.608  -23.865  1.00 147.18 ?  50  LEU A N     1 
ATOM   369  C  CA    . LEU A 1 50  ? 14.322  92.343  -23.505  1.00 146.19 ?  50  LEU A CA    1 
ATOM   370  C  C     . LEU A 1 50  ? 14.155  91.010  -22.747  1.00 145.00 ?  50  LEU A C     1 
ATOM   371  O  O     . LEU A 1 50  ? 13.032  90.654  -22.375  1.00 143.72 ?  50  LEU A O     1 
ATOM   372  C  CB    . LEU A 1 50  ? 13.422  92.344  -24.761  1.00 144.77 ?  50  LEU A CB    1 
ATOM   373  C  CG    . LEU A 1 50  ? 13.248  93.654  -25.540  1.00 154.25 ?  50  LEU A CG    1 
ATOM   374  C  CD1   . LEU A 1 50  ? 12.875  93.383  -26.972  1.00 151.65 ?  50  LEU A CD1   1 
ATOM   375  C  CD2   . LEU A 1 50  ? 12.197  94.563  -24.913  1.00 162.14 ?  50  LEU A CD2   1 
ATOM   376  N  N     . ASN A 1 51  ? 15.275  90.283  -22.525  1.00 138.50 ?  51  ASN A N     1 
ATOM   377  C  CA    . ASN A 1 51  ? 15.348  88.981  -21.850  1.00 134.06 ?  51  ASN A CA    1 
ATOM   378  C  C     . ASN A 1 51  ? 14.440  87.899  -22.461  1.00 132.12 ?  51  ASN A C     1 
ATOM   379  O  O     . ASN A 1 51  ? 13.896  87.043  -21.757  1.00 130.24 ?  51  ASN A O     1 
ATOM   380  C  CB    . ASN A 1 51  ? 15.255  89.106  -20.321  1.00 137.78 ?  51  ASN A CB    1 
ATOM   381  C  CG    . ASN A 1 51  ? 16.570  89.506  -19.692  1.00 164.36 ?  51  ASN A CG    1 
ATOM   382  O  OD1   . ASN A 1 51  ? 17.558  88.762  -19.729  1.00 157.11 ?  51  ASN A OD1   1 
ATOM   383  N  ND2   . ASN A 1 51  ? 16.618  90.697  -19.110  1.00 161.79 ?  51  ASN A ND2   1 
ATOM   384  N  N     . ILE A 1 52  ? 14.306  87.950  -23.796  1.00 125.24 ?  52  ILE A N     1 
ATOM   385  C  CA    . ILE A 1 52  ? 13.533  87.017  -24.606  1.00 119.76 ?  52  ILE A CA    1 
ATOM   386  C  C     . ILE A 1 52  ? 14.494  85.910  -25.049  1.00 117.06 ?  52  ILE A C     1 
ATOM   387  O  O     . ILE A 1 52  ? 15.522  86.221  -25.664  1.00 116.62 ?  52  ILE A O     1 
ATOM   388  C  CB    . ILE A 1 52  ? 12.876  87.732  -25.825  1.00 124.09 ?  52  ILE A CB    1 
ATOM   389  C  CG1   . ILE A 1 52  ? 11.852  88.797  -25.373  1.00 129.24 ?  52  ILE A CG1   1 
ATOM   390  C  CG2   . ILE A 1 52  ? 12.241  86.715  -26.788  1.00 120.39 ?  52  ILE A CG2   1 
ATOM   391  C  CD1   . ILE A 1 52  ? 11.386  89.772  -26.458  1.00 139.34 ?  52  ILE A CD1   1 
ATOM   392  N  N     . PRO A 1 53  ? 14.190  84.619  -24.762  1.00 108.50 ?  53  PRO A N     1 
ATOM   393  C  CA    . PRO A 1 53  ? 15.091  83.546  -25.213  1.00 103.59 ?  53  PRO A CA    1 
ATOM   394  C  C     . PRO A 1 53  ? 14.932  83.270  -26.705  1.00 102.80 ?  53  PRO A C     1 
ATOM   395  O  O     . PRO A 1 53  ? 14.024  83.812  -27.336  1.00 103.07 ?  53  PRO A O     1 
ATOM   396  C  CB    . PRO A 1 53  ? 14.667  82.348  -24.362  1.00 102.76 ?  53  PRO A CB    1 
ATOM   397  C  CG    . PRO A 1 53  ? 13.229  82.571  -24.096  1.00 108.61 ?  53  PRO A CG    1 
ATOM   398  C  CD    . PRO A 1 53  ? 13.012  84.069  -24.054  1.00 109.19 ?  53  PRO A CD    1 
ATOM   399  N  N     . GLU A 1 54  ? 15.814  82.434  -27.267  1.00 95.35  ?  54  GLU A N     1 
ATOM   400  C  CA    . GLU A 1 54  ? 15.761  82.066  -28.681  1.00 92.61  ?  54  GLU A CA    1 
ATOM   401  C  C     . GLU A 1 54  ? 14.522  81.225  -29.014  1.00 93.92  ?  54  GLU A C     1 
ATOM   402  O  O     . GLU A 1 54  ? 13.933  80.628  -28.114  1.00 92.98  ?  54  GLU A O     1 
ATOM   403  C  CB    . GLU A 1 54  ? 17.049  81.353  -29.109  1.00 91.65  ?  54  GLU A CB    1 
ATOM   404  C  CG    . GLU A 1 54  ? 17.300  80.016  -28.444  1.00 98.74  ?  54  GLU A CG    1 
ATOM   405  C  CD    . GLU A 1 54  ? 18.214  79.128  -29.256  1.00 116.63 ?  54  GLU A CD    1 
ATOM   406  O  OE1   . GLU A 1 54  ? 17.805  78.694  -30.360  1.00 110.08 ?  54  GLU A OE1   1 
ATOM   407  O  OE2   . GLU A 1 54  ? 19.349  78.875  -28.790  1.00 110.82 -1 54  GLU A OE2   1 
ATOM   408  N  N     . LEU A 1 55  ? 14.142  81.179  -30.307  1.00 89.22  ?  55  LEU A N     1 
ATOM   409  C  CA    . LEU A 1 55  ? 12.987  80.449  -30.844  1.00 86.45  ?  55  LEU A CA    1 
ATOM   410  C  C     . LEU A 1 55  ? 12.782  79.076  -30.222  1.00 87.02  ?  55  LEU A C     1 
ATOM   411  O  O     . LEU A 1 55  ? 11.706  78.795  -29.687  1.00 86.88  ?  55  LEU A O     1 
ATOM   412  C  CB    . LEU A 1 55  ? 13.108  80.320  -32.371  1.00 84.83  ?  55  LEU A CB    1 
ATOM   413  C  CG    . LEU A 1 55  ? 12.070  79.440  -33.068  1.00 86.54  ?  55  LEU A CG    1 
ATOM   414  C  CD1   . LEU A 1 55  ? 10.736  80.120  -33.128  1.00 88.79  ?  55  LEU A CD1   1 
ATOM   415  C  CD2   . LEU A 1 55  ? 12.517  79.062  -34.453  1.00 87.37  ?  55  LEU A CD2   1 
ATOM   416  N  N     . ARG A 1 56  ? 13.815  78.225  -30.296  1.00 80.44  ?  56  ARG A N     1 
ATOM   417  C  CA    . ARG A 1 56  ? 13.781  76.863  -29.776  1.00 76.98  ?  56  ARG A CA    1 
ATOM   418  C  C     . ARG A 1 56  ? 13.470  76.805  -28.287  1.00 83.14  ?  56  ARG A C     1 
ATOM   419  O  O     . ARG A 1 56  ? 12.729  75.924  -27.859  1.00 82.12  ?  56  ARG A O     1 
ATOM   420  C  CB    . ARG A 1 56  ? 15.065  76.111  -30.132  1.00 72.41  ?  56  ARG A CB    1 
ATOM   421  C  CG    . ARG A 1 56  ? 15.136  75.774  -31.610  1.00 74.74  ?  56  ARG A CG    1 
ATOM   422  C  CD    . ARG A 1 56  ? 16.485  75.231  -31.987  1.00 77.78  ?  56  ARG A CD    1 
ATOM   423  N  NE    . ARG A 1 56  ? 16.521  74.840  -33.390  1.00 79.72  ?  56  ARG A NE    1 
ATOM   424  C  CZ    . ARG A 1 56  ? 17.613  74.877  -34.140  1.00 93.24  ?  56  ARG A CZ    1 
ATOM   425  N  NH1   . ARG A 1 56  ? 18.763  75.308  -33.633  1.00 79.22  ?  56  ARG A NH1   1 
ATOM   426  N  NH2   . ARG A 1 56  ? 17.564  74.495  -35.409  1.00 81.44  ?  56  ARG A NH2   1 
ATOM   427  N  N     . LYS A 1 57  ? 13.989  77.768  -27.516  1.00 82.38  ?  57  LYS A N     1 
ATOM   428  C  CA    . LYS A 1 57  ? 13.739  77.848  -26.082  1.00 84.15  ?  57  LYS A CA    1 
ATOM   429  C  C     . LYS A 1 57  ? 12.312  78.312  -25.818  1.00 91.52  ?  57  LYS A C     1 
ATOM   430  O  O     . LYS A 1 57  ? 11.684  77.807  -24.888  1.00 91.68  ?  57  LYS A O     1 
ATOM   431  C  CB    . LYS A 1 57  ? 14.772  78.746  -25.384  1.00 88.82  ?  57  LYS A CB    1 
ATOM   432  C  CG    . LYS A 1 57  ? 16.150  78.103  -25.291  1.00 95.54  ?  57  LYS A CG    1 
ATOM   433  C  CD    . LYS A 1 57  ? 17.152  78.963  -24.550  1.00 106.48 ?  57  LYS A CD    1 
ATOM   434  C  CE    . LYS A 1 57  ? 18.491  78.273  -24.423  1.00 114.14 ?  57  LYS A CE    1 
ATOM   435  N  NZ    . LYS A 1 57  ? 18.500  77.267  -23.324  1.00 121.78 ?  57  LYS A NZ    1 
ATOM   436  N  N     . ARG A 1 58  ? 11.794  79.242  -26.659  1.00 90.34  ?  58  ARG A N     1 
ATOM   437  C  CA    . ARG A 1 58  ? 10.431  79.786  -26.586  1.00 92.32  ?  58  ARG A CA    1 
ATOM   438  C  C     . ARG A 1 58  ? 9.402   78.696  -26.895  1.00 95.26  ?  58  ARG A C     1 
ATOM   439  O  O     . ARG A 1 58  ? 8.439   78.553  -26.144  1.00 96.00  ?  58  ARG A O     1 
ATOM   440  C  CB    . ARG A 1 58  ? 10.241  80.971  -27.550  1.00 92.80  ?  58  ARG A CB    1 
ATOM   441  C  CG    . ARG A 1 58  ? 11.088  82.199  -27.241  1.00 101.20 ?  58  ARG A CG    1 
ATOM   442  C  CD    . ARG A 1 58  ? 10.593  83.445  -27.961  1.00 106.19 ?  58  ARG A CD    1 
ATOM   443  N  NE    . ARG A 1 58  ? 10.597  83.305  -29.422  1.00 105.83 ?  58  ARG A NE    1 
ATOM   444  C  CZ    . ARG A 1 58  ? 11.610  83.652  -30.210  1.00 114.83 ?  58  ARG A CZ    1 
ATOM   445  N  NH1   . ARG A 1 58  ? 12.721  84.162  -29.694  1.00 104.35 ?  58  ARG A NH1   1 
ATOM   446  N  NH2   . ARG A 1 58  ? 11.524  83.480  -31.522  1.00 93.66  ?  58  ARG A NH2   1 
ATOM   447  N  N     . ILE A 1 59  ? 9.622   77.914  -27.981  1.00 89.68  ?  59  ILE A N     1 
ATOM   448  C  CA    . ILE A 1 59  ? 8.745   76.811  -28.387  1.00 87.50  ?  59  ILE A CA    1 
ATOM   449  C  C     . ILE A 1 59  ? 8.696   75.720  -27.307  1.00 88.70  ?  59  ILE A C     1 
ATOM   450  O  O     . ILE A 1 59  ? 7.620   75.187  -27.031  1.00 88.93  ?  59  ILE A O     1 
ATOM   451  C  CB    . ILE A 1 59  ? 9.068   76.251  -29.810  1.00 88.45  ?  59  ILE A CB    1 
ATOM   452  C  CG1   . ILE A 1 59  ? 10.447  75.594  -29.902  1.00 87.63  ?  59  ILE A CG1   1 
ATOM   453  C  CG2   . ILE A 1 59  ? 8.913   77.327  -30.891  1.00 90.76  ?  59  ILE A CG2   1 
ATOM   454  C  CD1   . ILE A 1 59  ? 10.610  74.533  -31.000  1.00 96.81  ?  59  ILE A CD1   1 
ATOM   455  N  N     . LYS A 1 60  ? 9.855   75.432  -26.665  1.00 82.90  ?  60  LYS A N     1 
ATOM   456  C  CA    . LYS A 1 60  ? 9.958   74.429  -25.608  1.00 81.03  ?  60  LYS A CA    1 
ATOM   457  C  C     . LYS A 1 60  ? 9.092   74.807  -24.424  1.00 88.21  ?  60  LYS A C     1 
ATOM   458  O  O     . LYS A 1 60  ? 8.320   73.968  -23.965  1.00 87.71  ?  60  LYS A O     1 
ATOM   459  C  CB    . LYS A 1 60  ? 11.412  74.198  -25.174  1.00 81.67  ?  60  LYS A CB    1 
ATOM   460  C  CG    . LYS A 1 60  ? 11.620  72.851  -24.484  1.00 80.95  ?  60  LYS A CG    1 
ATOM   461  C  CD    . LYS A 1 60  ? 12.927  72.823  -23.727  1.00 88.66  ?  60  LYS A CD    1 
ATOM   462  C  CE    . LYS A 1 60  ? 13.198  71.472  -23.124  1.00 95.48  ?  60  LYS A CE    1 
ATOM   463  N  NZ    . LYS A 1 60  ? 14.481  71.465  -22.374  1.00 105.92 ?  60  LYS A NZ    1 
ATOM   464  N  N     . LEU A 1 61  ? 9.176   76.076  -23.972  1.00 87.95  ?  61  LEU A N     1 
ATOM   465  C  CA    . LEU A 1 61  ? 8.398   76.603  -22.854  1.00 91.51  ?  61  LEU A CA    1 
ATOM   466  C  C     . LEU A 1 61  ? 6.892   76.526  -23.103  1.00 95.90  ?  61  LEU A C     1 
ATOM   467  O  O     . LEU A 1 61  ? 6.149   76.258  -22.163  1.00 96.75  ?  61  LEU A O     1 
ATOM   468  C  CB    . LEU A 1 61  ? 8.812   78.041  -22.528  1.00 95.57  ?  61  LEU A CB    1 
ATOM   469  C  CG    . LEU A 1 61  ? 10.162  78.217  -21.831  1.00 101.58 ?  61  LEU A CG    1 
ATOM   470  C  CD1   . LEU A 1 61  ? 10.760  79.583  -22.153  1.00 104.47 ?  61  LEU A CD1   1 
ATOM   471  C  CD2   . LEU A 1 61  ? 10.043  78.023  -20.317  1.00 107.07 ?  61  LEU A CD2   1 
ATOM   472  N  N     . VAL A 1 62  ? 6.450   76.737  -24.366  1.00 91.74  ?  62  VAL A N     1 
ATOM   473  C  CA    . VAL A 1 62  ? 5.041   76.661  -24.776  1.00 92.34  ?  62  VAL A CA    1 
ATOM   474  C  C     . VAL A 1 62  ? 4.586   75.199  -24.651  1.00 94.25  ?  62  VAL A C     1 
ATOM   475  O  O     . VAL A 1 62  ? 3.533   74.932  -24.067  1.00 95.76  ?  62  VAL A O     1 
ATOM   476  C  CB    . VAL A 1 62  ? 4.802   77.248  -26.205  1.00 96.09  ?  62  VAL A CB    1 
ATOM   477  C  CG1   . VAL A 1 62  ? 3.356   77.055  -26.662  1.00 96.73  ?  62  VAL A CG1   1 
ATOM   478  C  CG2   . VAL A 1 62  ? 5.186   78.729  -26.276  1.00 99.10  ?  62  VAL A CG2   1 
ATOM   479  N  N     . ALA A 1 63  ? 5.413   74.263  -25.163  1.00 87.73  ?  63  ALA A N     1 
ATOM   480  C  CA    . ALA A 1 63  ? 5.170   72.821  -25.126  1.00 85.44  ?  63  ALA A CA    1 
ATOM   481  C  C     . ALA A 1 63  ? 5.156   72.277  -23.682  1.00 93.15  ?  63  ALA A C     1 
ATOM   482  O  O     . ALA A 1 63  ? 4.260   71.502  -23.324  1.00 93.37  ?  63  ALA A O     1 
ATOM   483  C  CB    . ALA A 1 63  ? 6.221   72.099  -25.954  1.00 82.30  ?  63  ALA A CB    1 
ATOM   484  N  N     . GLU A 1 64  ? 6.132   72.711  -22.856  1.00 91.73  ?  64  GLU A N     1 
ATOM   485  C  CA    . GLU A 1 64  ? 6.290   72.298  -21.463  1.00 93.24  ?  64  GLU A CA    1 
ATOM   486  C  C     . GLU A 1 64  ? 5.123   72.704  -20.579  1.00 104.31 ?  64  GLU A C     1 
ATOM   487  O  O     . GLU A 1 64  ? 4.778   71.943  -19.677  1.00 104.82 ?  64  GLU A O     1 
ATOM   488  C  CB    . GLU A 1 64  ? 7.607   72.819  -20.874  1.00 95.00  ?  64  GLU A CB    1 
ATOM   489  C  CG    . GLU A 1 64  ? 8.834   72.060  -21.347  1.00 99.38  ?  64  GLU A CG    1 
ATOM   490  C  CD    . GLU A 1 64  ? 10.160  72.473  -20.732  1.00 117.98 ?  64  GLU A CD    1 
ATOM   491  O  OE1   . GLU A 1 64  ? 10.417  73.692  -20.593  1.00 114.87 -1 64  GLU A OE1   1 
ATOM   492  O  OE2   . GLU A 1 64  ? 10.957  71.563  -20.408  1.00 104.07 ?  64  GLU A OE2   1 
ATOM   493  N  N     . LYS A 1 65  ? 4.525   73.896  -20.822  1.00 106.46 ?  65  LYS A N     1 
ATOM   494  C  CA    . LYS A 1 65  ? 3.393   74.416  -20.044  1.00 111.46 ?  65  LYS A CA    1 
ATOM   495  C  C     . LYS A 1 65  ? 2.187   73.492  -20.099  1.00 119.04 ?  65  LYS A C     1 
ATOM   496  O  O     . LYS A 1 65  ? 1.703   73.078  -19.039  1.00 120.09 ?  65  LYS A O     1 
ATOM   497  C  CB    . LYS A 1 65  ? 3.034   75.856  -20.439  1.00 116.60 ?  65  LYS A CB    1 
ATOM   498  C  CG    . LYS A 1 65  ? 3.907   76.896  -19.749  1.00 132.62 ?  65  LYS A CG    1 
ATOM   499  C  CD    . LYS A 1 65  ? 3.678   78.294  -20.310  1.00 144.94 ?  65  LYS A CD    1 
ATOM   500  C  CE    . LYS A 1 65  ? 4.629   79.309  -19.724  1.00 156.47 ?  65  LYS A CE    1 
ATOM   501  N  NZ    . LYS A 1 65  ? 4.429   80.658  -20.316  1.00 166.76 ?  65  LYS A NZ    1 
ATOM   502  N  N     . ASN A 1 66  ? 1.703   73.145  -21.302  1.00 117.05 ?  66  ASN A N     1 
ATOM   503  C  CA    . ASN A 1 66  ? 0.583   72.211  -21.381  1.00 118.31 ?  66  ASN A CA    1 
ATOM   504  C  C     . ASN A 1 66  ? 1.121   70.808  -21.681  1.00 119.56 ?  66  ASN A C     1 
ATOM   505  O  O     . ASN A 1 66  ? 1.073   70.308  -22.814  1.00 116.45 ?  66  ASN A O     1 
ATOM   506  C  CB    . ASN A 1 66  ? -0.548  72.693  -22.301  1.00 123.86 ?  66  ASN A CB    1 
ATOM   507  C  CG    . ASN A 1 66  ? -1.118  74.046  -21.924  1.00 159.48 ?  66  ASN A CG    1 
ATOM   508  O  OD1   . ASN A 1 66  ? -0.879  75.055  -22.599  1.00 156.70 ?  66  ASN A OD1   1 
ATOM   509  N  ND2   . ASN A 1 66  ? -1.888  74.102  -20.838  1.00 154.29 ?  66  ASN A ND2   1 
ATOM   510  N  N     . TYR A 1 67  ? 1.725   70.229  -20.618  1.00 116.39 ?  67  TYR A N     1 
ATOM   511  C  CA    . TYR A 1 67  ? 2.364   68.912  -20.513  1.00 112.96 ?  67  TYR A CA    1 
ATOM   512  C  C     . TYR A 1 67  ? 2.520   68.592  -19.008  1.00 118.21 ?  67  TYR A C     1 
ATOM   513  O  O     . TYR A 1 67  ? 2.169   69.433  -18.171  1.00 120.47 ?  67  TYR A O     1 
ATOM   514  C  CB    . TYR A 1 67  ? 3.736   68.916  -21.238  1.00 110.35 ?  67  TYR A CB    1 
ATOM   515  C  CG    . TYR A 1 67  ? 4.303   67.537  -21.499  1.00 108.42 ?  67  TYR A CG    1 
ATOM   516  C  CD1   . TYR A 1 67  ? 3.825   66.750  -22.543  1.00 108.15 ?  67  TYR A CD1   1 
ATOM   517  C  CD2   . TYR A 1 67  ? 5.331   67.024  -20.713  1.00 108.71 ?  67  TYR A CD2   1 
ATOM   518  C  CE1   . TYR A 1 67  ? 4.333   65.472  -22.778  1.00 106.39 ?  67  TYR A CE1   1 
ATOM   519  C  CE2   . TYR A 1 67  ? 5.842   65.746  -20.932  1.00 107.36 ?  67  TYR A CE2   1 
ATOM   520  C  CZ    . TYR A 1 67  ? 5.344   64.975  -21.970  1.00 113.41 ?  67  TYR A CZ    1 
ATOM   521  O  OH    . TYR A 1 67  ? 5.852   63.716  -22.181  1.00 113.63 ?  67  TYR A OH    1 
ATOM   522  N  N     . ASP A 1 68  ? 3.016   67.373  -18.679  1.00 113.39 ?  68  ASP A N     1 
ATOM   523  C  CA    . ASP A 1 68  ? 3.276   66.843  -17.332  1.00 115.06 ?  68  ASP A CA    1 
ATOM   524  C  C     . ASP A 1 68  ? 2.004   66.755  -16.493  1.00 121.85 ?  68  ASP A C     1 
ATOM   525  O  O     . ASP A 1 68  ? 1.902   67.371  -15.426  1.00 124.89 ?  68  ASP A O     1 
ATOM   526  C  CB    . ASP A 1 68  ? 4.417   67.610  -16.617  1.00 118.02 ?  68  ASP A CB    1 
ATOM   527  C  CG    . ASP A 1 68  ? 5.723   66.845  -16.486  1.00 127.49 ?  68  ASP A CG    1 
ATOM   528  O  OD1   . ASP A 1 68  ? 6.151   66.216  -17.485  1.00 124.69 ?  68  ASP A OD1   1 
ATOM   529  O  OD2   . ASP A 1 68  ? 6.346   66.919  -15.405  1.00 136.01 -1 68  ASP A OD2   1 
ATOM   530  N  N     . GLN A 1 69  ? 1.028   65.979  -16.991  1.00 117.18 ?  69  GLN A N     1 
ATOM   531  C  CA    . GLN A 1 69  ? -0.259  65.817  -16.328  1.00 120.05 ?  69  GLN A CA    1 
ATOM   532  C  C     . GLN A 1 69  ? -0.357  64.645  -15.348  1.00 124.25 ?  69  GLN A C     1 
ATOM   533  O  O     . GLN A 1 69  ? -0.086  63.500  -15.716  1.00 121.23 ?  69  GLN A O     1 
ATOM   534  C  CB    . GLN A 1 69  ? -1.418  65.836  -17.340  1.00 121.20 ?  69  GLN A CB    1 
ATOM   535  C  CG    . GLN A 1 69  ? -1.970  67.243  -17.612  1.00 136.28 ?  69  GLN A CG    1 
ATOM   536  C  CD    . GLN A 1 69  ? -2.602  67.923  -16.403  1.00 158.71 ?  69  GLN A CD    1 
ATOM   537  O  OE1   . GLN A 1 69  ? -3.333  67.315  -15.605  1.00 155.61 ?  69  GLN A OE1   1 
ATOM   538  N  NE2   . GLN A 1 69  ? -2.348  69.215  -16.258  1.00 151.21 ?  69  GLN A NE2   1 
ATOM   539  N  N     . ILE A 1 70  ? -0.750  64.949  -14.092  1.00 104.47 ?  70  ILE A N     1 
ATOM   540  C  CA    . ILE A 1 70  ? -0.948  63.958  -13.028  1.00 103.17 ?  70  ILE A CA    1 
ATOM   541  C  C     . ILE A 1 70  ? -2.296  63.250  -13.214  1.00 102.95 ?  70  ILE A C     1 
ATOM   542  O  O     . ILE A 1 70  ? -3.230  63.853  -13.757  1.00 101.30 ?  70  ILE A O     1 
ATOM   543  C  CB    . ILE A 1 70  ? -0.762  64.547  -11.596  1.00 108.51 ?  70  ILE A CB    1 
ATOM   544  C  CG1   . ILE A 1 70  ? -1.731  65.718  -11.293  1.00 108.96 ?  70  ILE A CG1   1 
ATOM   545  C  CG2   . ILE A 1 70  ? 0.694   64.935  -11.334  1.00 113.05 ?  70  ILE A CG2   1 
ATOM   546  C  CD1   . ILE A 1 70  ? -2.939  65.345  -10.383  1.00 114.12 ?  70  ILE A CD1   1 
ATOM   547  N  N     . SER A 1 71  ? -2.394  61.977  -12.767  1.00 97.70  ?  71  SER A N     1 
ATOM   548  C  CA    . SER A 1 71  ? -3.605  61.155  -12.898  1.00 94.19  ?  71  SER A CA    1 
ATOM   549  C  C     . SER A 1 71  ? -4.839  61.780  -12.250  1.00 95.11  ?  71  SER A C     1 
ATOM   550  O  O     . SER A 1 71  ? -4.770  62.270  -11.119  1.00 96.09  ?  71  SER A O     1 
ATOM   551  C  CB    . SER A 1 71  ? -3.372  59.735  -12.383  1.00 97.89  ?  71  SER A CB    1 
ATOM   552  O  OG    . SER A 1 71  ? -2.997  59.720  -11.016  1.00 108.33 ?  71  SER A OG    1 
ATOM   553  N  N     . SER A 1 72  ? -5.954  61.800  -13.002  1.00 87.95  ?  72  SER A N     1 
ATOM   554  C  CA    . SER A 1 72  ? -7.236  62.350  -12.557  1.00 85.94  ?  72  SER A CA    1 
ATOM   555  C  C     . SER A 1 72  ? -7.835  61.486  -11.468  1.00 87.50  ?  72  SER A C     1 
ATOM   556  O  O     . SER A 1 72  ? -7.598  60.278  -11.441  1.00 86.76  ?  72  SER A O     1 
ATOM   557  C  CB    . SER A 1 72  ? -8.203  62.483  -13.725  1.00 87.70  ?  72  SER A CB    1 
ATOM   558  O  OG    . SER A 1 72  ? -8.252  61.293  -14.492  1.00 95.88  ?  72  SER A OG    1 
ATOM   559  N  N     . ILE A 1 73  ? -8.601  62.111  -10.564  1.00 83.16  ?  73  ILE A N     1 
ATOM   560  C  CA    . ILE A 1 73  ? -9.223  61.487  -9.394   1.00 82.54  ?  73  ILE A CA    1 
ATOM   561  C  C     . ILE A 1 73  ? -9.737  60.047  -9.585   1.00 84.43  ?  73  ILE A C     1 
ATOM   562  O  O     . ILE A 1 73  ? -9.580  59.226  -8.677   1.00 85.95  ?  73  ILE A O     1 
ATOM   563  C  CB    . ILE A 1 73  ? -10.234 62.445  -8.708   1.00 85.67  ?  73  ILE A CB    1 
ATOM   564  C  CG1   . ILE A 1 73  ? -10.267 62.250  -7.195   1.00 88.05  ?  73  ILE A CG1   1 
ATOM   565  C  CG2   . ILE A 1 73  ? -11.623 62.366  -9.318   1.00 84.59  ?  73  ILE A CG2   1 
ATOM   566  C  CD1   . ILE A 1 73  ? -9.451  63.231  -6.439   1.00 100.83 ?  73  ILE A CD1   1 
ATOM   567  N  N     . GLU A 1 74  ? -10.302 59.735  -10.774  1.00 77.45  ?  74  GLU A N     1 
ATOM   568  C  CA    . GLU A 1 74  ? -10.839 58.407  -11.071  1.00 75.66  ?  74  GLU A CA    1 
ATOM   569  C  C     . GLU A 1 74  ? -9.759  57.328  -11.235  1.00 79.13  ?  74  GLU A C     1 
ATOM   570  O  O     . GLU A 1 74  ? -10.066 56.135  -11.172  1.00 79.13  ?  74  GLU A O     1 
ATOM   571  C  CB    . GLU A 1 74  ? -11.891 58.450  -12.205  1.00 74.88  ?  74  GLU A CB    1 
ATOM   572  C  CG    . GLU A 1 74  ? -11.441 57.954  -13.569  1.00 81.29  ?  74  GLU A CG    1 
ATOM   573  C  CD    . GLU A 1 74  ? -10.617 58.917  -14.398  1.00 93.93  ?  74  GLU A CD    1 
ATOM   574  O  OE1   . GLU A 1 74  ? -10.580 60.122  -14.058  1.00 85.64  -1 74  GLU A OE1   1 
ATOM   575  O  OE2   . GLU A 1 74  ? -10.035 58.470  -15.414  1.00 81.53  ?  74  GLU A OE2   1 
ATOM   576  N  N     . GLU A 1 75  ? -8.497  57.759  -11.389  1.00 75.53  ?  75  GLU A N     1 
ATOM   577  C  CA    . GLU A 1 75  ? -7.336  56.886  -11.535  1.00 76.56  ?  75  GLU A CA    1 
ATOM   578  C  C     . GLU A 1 75  ? -6.479  56.848  -10.251  1.00 82.21  ?  75  GLU A C     1 
ATOM   579  O  O     . GLU A 1 75  ? -5.399  56.246  -10.247  1.00 83.59  ?  75  GLU A O     1 
ATOM   580  C  CB    . GLU A 1 75  ? -6.515  57.304  -12.761  1.00 77.88  ?  75  GLU A CB    1 
ATOM   581  C  CG    . GLU A 1 75  ? -7.188  56.957  -14.081  1.00 89.59  ?  75  GLU A CG    1 
ATOM   582  C  CD    . GLU A 1 75  ? -6.563  57.541  -15.335  1.00 113.40 ?  75  GLU A CD    1 
ATOM   583  O  OE1   . GLU A 1 75  ? -5.896  58.599  -15.241  1.00 106.82 ?  75  GLU A OE1   1 
ATOM   584  O  OE2   . GLU A 1 75  ? -6.783  56.961  -16.424  1.00 107.47 -1 75  GLU A OE2   1 
ATOM   585  N  N     . GLN A 1 76  ? -6.993  57.452  -9.153   1.00 78.50  ?  76  GLN A N     1 
ATOM   586  C  CA    . GLN A 1 76  ? -6.347  57.512  -7.834   1.00 80.21  ?  76  GLN A CA    1 
ATOM   587  C  C     . GLN A 1 76  ? -6.992  56.527  -6.843   1.00 86.05  ?  76  GLN A C     1 
ATOM   588  O  O     . GLN A 1 76  ? -8.224  56.428  -6.799   1.00 85.12  ?  76  GLN A O     1 
ATOM   589  C  CB    . GLN A 1 76  ? -6.410  58.941  -7.270   1.00 81.51  ?  76  GLN A CB    1 
ATOM   590  C  CG    . GLN A 1 76  ? -5.665  59.977  -8.109   1.00 89.62  ?  76  GLN A CG    1 
ATOM   591  C  CD    . GLN A 1 76  ? -5.755  61.382  -7.561   1.00 104.63 ?  76  GLN A CD    1 
ATOM   592  O  OE1   . GLN A 1 76  ? -5.910  61.612  -6.354   1.00 100.26 ?  76  GLN A OE1   1 
ATOM   593  N  NE2   . GLN A 1 76  ? -5.608  62.362  -8.440   1.00 94.80  ?  76  GLN A NE2   1 
ATOM   594  N  N     . GLU A 1 77  ? -6.157  55.808  -6.048   1.00 85.27  ?  77  GLU A N     1 
ATOM   595  C  CA    . GLU A 1 77  ? -6.592  54.832  -5.032   1.00 87.32  ?  77  GLU A CA    1 
ATOM   596  C  C     . GLU A 1 77  ? -7.060  55.562  -3.761   1.00 93.36  ?  77  GLU A C     1 
ATOM   597  O  O     . GLU A 1 77  ? -8.230  55.935  -3.695   1.00 90.97  ?  77  GLU A O     1 
ATOM   598  C  CB    . GLU A 1 77  ? -5.487  53.808  -4.708   1.00 91.52  ?  77  GLU A CB    1 
ATOM   599  C  CG    . GLU A 1 77  ? -5.043  52.943  -5.874   1.00 101.19 ?  77  GLU A CG    1 
ATOM   600  C  CD    . GLU A 1 77  ? -3.809  52.091  -5.636   1.00 123.31 ?  77  GLU A CD    1 
ATOM   601  O  OE1   . GLU A 1 77  ? -3.621  51.587  -4.503   1.00 109.96 ?  77  GLU A OE1   1 
ATOM   602  O  OE2   . GLU A 1 77  ? -3.027  51.922  -6.599   1.00 119.91 -1 77  GLU A OE2   1 
ATOM   603  N  N     . PHE A 1 78  ? -6.168  55.779  -2.758   1.00 94.62  ?  78  PHE A N     1 
ATOM   604  C  CA    . PHE A 1 78  ? -6.601  56.528  -1.576   1.00 96.63  ?  78  PHE A CA    1 
ATOM   605  C  C     . PHE A 1 78  ? -6.478  58.028  -1.811   1.00 99.87  ?  78  PHE A C     1 
ATOM   606  O  O     . PHE A 1 78  ? -5.375  58.536  -2.058   1.00 100.53 ?  78  PHE A O     1 
ATOM   607  C  CB    . PHE A 1 78  ? -5.911  56.100  -0.260   1.00 102.80 ?  78  PHE A CB    1 
ATOM   608  C  CG    . PHE A 1 78  ? -6.555  56.696  0.979    1.00 106.85 ?  78  PHE A CG    1 
ATOM   609  C  CD1   . PHE A 1 78  ? -7.651  56.085  1.576    1.00 111.13 ?  78  PHE A CD1   1 
ATOM   610  C  CD2   . PHE A 1 78  ? -6.059  57.865  1.551    1.00 111.43 ?  78  PHE A CD2   1 
ATOM   611  C  CE1   . PHE A 1 78  ? -8.252  56.639  2.713    1.00 114.89 ?  78  PHE A CE1   1 
ATOM   612  C  CE2   . PHE A 1 78  ? -6.664  58.421  2.687    1.00 117.05 ?  78  PHE A CE2   1 
ATOM   613  C  CZ    . PHE A 1 78  ? -7.761  57.806  3.258    1.00 115.98 ?  78  PHE A CZ    1 
ATOM   614  N  N     . ILE A 1 79  ? -7.618  58.730  -1.725   1.00 95.10  ?  79  ILE A N     1 
ATOM   615  C  CA    . ILE A 1 79  ? -7.673  60.179  -1.886   1.00 94.54  ?  79  ILE A CA    1 
ATOM   616  C  C     . ILE A 1 79  ? -7.449  60.823  -0.514   1.00 104.04 ?  79  ILE A C     1 
ATOM   617  O  O     . ILE A 1 79  ? -8.188  60.560  0.440    1.00 105.66 ?  79  ILE A O     1 
ATOM   618  C  CB    . ILE A 1 79  ? -8.949  60.677  -2.629   1.00 94.42  ?  79  ILE A CB    1 
ATOM   619  C  CG1   . ILE A 1 79  ? -8.940  60.257  -4.095   1.00 91.66  ?  79  ILE A CG1   1 
ATOM   620  C  CG2   . ILE A 1 79  ? -9.060  62.191  -2.602   1.00 95.22  ?  79  ILE A CG2   1 
ATOM   621  C  CD1   . ILE A 1 79  ? -9.615  59.106  -4.398   1.00 99.36  ?  79  ILE A CD1   1 
ATOM   622  N  N     . GLY A 1 80  ? -6.399  61.627  -0.435   1.00 103.04 ?  80  GLY A N     1 
ATOM   623  C  CA    . GLY A 1 80  ? -5.997  62.302  0.787    1.00 106.87 ?  80  GLY A CA    1 
ATOM   624  C  C     . GLY A 1 80  ? -4.905  61.549  1.509    1.00 115.23 ?  80  GLY A C     1 
ATOM   625  O  O     . GLY A 1 80  ? -4.320  60.605  0.964    1.00 114.79 ?  80  GLY A O     1 
ATOM   626  N  N     . ASP A 1 81  ? -4.606  61.990  2.733    1.00 115.78 ?  81  ASP A N     1 
ATOM   627  C  CA    . ASP A 1 81  ? -3.602  61.379  3.594    1.00 119.18 ?  81  ASP A CA    1 
ATOM   628  C  C     . ASP A 1 81  ? -4.320  60.870  4.824    1.00 123.30 ?  81  ASP A C     1 
ATOM   629  O  O     . ASP A 1 81  ? -4.975  61.646  5.518    1.00 124.14 ?  81  ASP A O     1 
ATOM   630  C  CB    . ASP A 1 81  ? -2.510  62.396  3.975    1.00 124.85 ?  81  ASP A CB    1 
ATOM   631  C  CG    . ASP A 1 81  ? -1.103  61.826  3.956    1.00 143.92 ?  81  ASP A CG    1 
ATOM   632  O  OD1   . ASP A 1 81  ? -0.642  61.416  2.863    1.00 150.66 -1 81  ASP A OD1   1 
ATOM   633  O  OD2   . ASP A 1 81  ? -0.464  61.784  5.034    1.00 149.06 ?  81  ASP A OD2   1 
ATOM   634  N  N     . LEU A 1 82  ? -4.225  59.567  5.076    1.00 119.47 ?  82  LEU A N     1 
ATOM   635  C  CA    . LEU A 1 82  ? -4.872  58.956  6.227    1.00 121.64 ?  82  LEU A CA    1 
ATOM   636  C  C     . LEU A 1 82  ? -4.112  59.308  7.510    1.00 130.03 ?  82  LEU A C     1 
ATOM   637  O  O     . LEU A 1 82  ? -2.927  58.983  7.645    1.00 131.25 ?  82  LEU A O     1 
ATOM   638  C  CB    . LEU A 1 82  ? -4.991  57.442  6.011    1.00 121.31 ?  82  LEU A CB    1 
ATOM   639  C  CG    . LEU A 1 82  ? -5.896  56.676  6.955    1.00 128.49 ?  82  LEU A CG    1 
ATOM   640  C  CD1   . LEU A 1 82  ? -7.312  57.228  6.934    1.00 126.98 ?  82  LEU A CD1   1 
ATOM   641  C  CD2   . LEU A 1 82  ? -5.913  55.215  6.578    1.00 130.90 ?  82  LEU A CD2   1 
ATOM   642  N  N     . ILE A 1 83  ? -4.788  60.049  8.411    1.00 128.12 ?  83  ILE A N     1 
ATOM   643  C  CA    . ILE A 1 83  ? -4.239  60.526  9.687    1.00 132.76 ?  83  ILE A CA    1 
ATOM   644  C  C     . ILE A 1 83  ? -4.338  59.458  10.775   1.00 139.47 ?  83  ILE A C     1 
ATOM   645  O  O     . ILE A 1 83  ? -3.316  59.028  11.313   1.00 143.04 ?  83  ILE A O     1 
ATOM   646  C  CB    . ILE A 1 83  ? -4.928  61.858  10.156   1.00 137.04 ?  83  ILE A CB    1 
ATOM   647  C  CG1   . ILE A 1 83  ? -4.574  63.055  9.253    1.00 135.02 ?  83  ILE A CG1   1 
ATOM   648  C  CG2   . ILE A 1 83  ? -4.642  62.177  11.647   1.00 143.83 ?  83  ILE A CG2   1 
ATOM   649  C  CD1   . ILE A 1 83  ? -5.419  64.326  9.553    1.00 143.18 ?  83  ILE A CD1   1 
ATOM   650  N  N     . GLN A 1 84  ? -5.578  59.072  11.124   1.00 134.87 ?  84  GLN A N     1 
ATOM   651  C  CA    . GLN A 1 84  ? -5.889  58.184  12.235   1.00 138.60 ?  84  GLN A CA    1 
ATOM   652  C  C     . GLN A 1 84  ? -6.983  57.202  11.834   1.00 139.16 ?  84  GLN A C     1 
ATOM   653  O  O     . GLN A 1 84  ? -7.910  57.591  11.128   1.00 134.96 ?  84  GLN A O     1 
ATOM   654  C  CB    . GLN A 1 84  ? -6.345  59.074  13.422   1.00 144.09 ?  84  GLN A CB    1 
ATOM   655  C  CG    . GLN A 1 84  ? -6.930  58.378  14.658   1.00 156.14 ?  84  GLN A CG    1 
ATOM   656  C  CD    . GLN A 1 84  ? -8.431  58.134  14.588   1.00 163.29 ?  84  GLN A CD    1 
ATOM   657  O  OE1   . GLN A 1 84  ? -9.233  59.013  14.233   1.00 156.84 ?  84  GLN A OE1   1 
ATOM   658  N  NE2   . GLN A 1 84  ? -8.842  56.922  14.919   1.00 157.22 ?  84  GLN A NE2   1 
ATOM   659  N  N     . VAL A 1 85  ? -6.881  55.939  12.299   1.00 138.14 ?  85  VAL A N     1 
ATOM   660  C  CA    . VAL A 1 85  ? -7.862  54.878  12.050   1.00 137.01 ?  85  VAL A CA    1 
ATOM   661  C  C     . VAL A 1 85  ? -8.096  54.033  13.299   1.00 146.41 ?  85  VAL A C     1 
ATOM   662  O  O     . VAL A 1 85  ? -7.143  53.523  13.896   1.00 150.08 ?  85  VAL A O     1 
ATOM   663  C  CB    . VAL A 1 85  ? -7.513  53.997  10.811   1.00 137.21 ?  85  VAL A CB    1 
ATOM   664  C  CG1   . VAL A 1 85  ? -8.201  52.629  10.856   1.00 138.26 ?  85  VAL A CG1   1 
ATOM   665  C  CG2   . VAL A 1 85  ? -7.875  54.705  9.525    1.00 131.09 ?  85  VAL A CG2   1 
ATOM   666  N  N     . ASN A 1 86  ? -9.375  53.894  13.678   1.00 143.35 ?  86  ASN A N     1 
ATOM   667  C  CA    . ASN A 1 86  ? -9.850  53.027  14.747   1.00 148.22 ?  86  ASN A CA    1 
ATOM   668  C  C     . ASN A 1 86  ? -10.775 52.073  13.983   1.00 150.61 ?  86  ASN A C     1 
ATOM   669  O  O     . ASN A 1 86  ? -11.872 52.488  13.591   1.00 147.72 ?  86  ASN A O     1 
ATOM   670  C  CB    . ASN A 1 86  ? -10.599 53.813  15.829   1.00 146.77 ?  86  ASN A CB    1 
ATOM   671  C  CG    . ASN A 1 86  ? -10.904 53.030  17.086   1.00 155.85 ?  86  ASN A CG    1 
ATOM   672  O  OD1   . ASN A 1 86  ? -10.836 51.794  17.135   1.00 148.98 ?  86  ASN A OD1   1 
ATOM   673  N  ND2   . ASN A 1 86  ? -11.282 53.744  18.133   1.00 147.35 ?  86  ASN A ND2   1 
ATOM   674  N  N     . PRO A 1 87  ? -10.289 50.855  13.628   1.00 148.31 ?  87  PRO A N     1 
ATOM   675  C  CA    . PRO A 1 87  ? -11.090 49.949  12.786   1.00 146.25 ?  87  PRO A CA    1 
ATOM   676  C  C     . PRO A 1 87  ? -12.550 49.772  13.176   1.00 152.55 ?  87  PRO A C     1 
ATOM   677  O  O     . PRO A 1 87  ? -12.862 49.451  14.326   1.00 155.01 ?  87  PRO A O     1 
ATOM   678  C  CB    . PRO A 1 87  ? -10.304 48.643  12.821   1.00 151.13 ?  87  PRO A CB    1 
ATOM   679  C  CG    . PRO A 1 87  ? -8.911  49.061  13.027   1.00 155.83 ?  87  PRO A CG    1 
ATOM   680  C  CD    . PRO A 1 87  ? -8.979  50.250  13.947   1.00 152.74 ?  87  PRO A CD    1 
ATOM   681  N  N     . ASN A 1 88  ? -13.439 50.054  12.204   1.00 143.96 ?  88  ASN A N     1 
ATOM   682  C  CA    . ASN A 1 88  ? -14.898 49.977  12.301   1.00 144.53 ?  88  ASN A CA    1 
ATOM   683  C  C     . ASN A 1 88  ? -15.486 50.921  13.375   1.00 151.99 ?  88  ASN A C     1 
ATOM   684  O  O     . ASN A 1 88  ? -16.608 50.697  13.839   1.00 152.73 ?  88  ASN A O     1 
ATOM   685  C  CB    . ASN A 1 88  ? -15.367 48.514  12.476   1.00 147.54 ?  88  ASN A CB    1 
ATOM   686  C  CG    . ASN A 1 88  ? -14.649 47.510  11.597   1.00 157.81 ?  88  ASN A CG    1 
ATOM   687  O  OD1   . ASN A 1 88  ? -14.733 47.543  10.366   1.00 147.96 ?  88  ASN A OD1   1 
ATOM   688  N  ND2   . ASN A 1 88  ? -13.937 46.584  12.214   1.00 149.22 ?  88  ASN A ND2   1 
ATOM   689  N  N     . VAL A 1 89  ? -14.738 51.988  13.753   1.00 147.53 ?  89  VAL A N     1 
ATOM   690  C  CA    . VAL A 1 89  ? -15.166 52.964  14.768   1.00 148.61 ?  89  VAL A CA    1 
ATOM   691  C  C     . VAL A 1 89  ? -15.134 54.405  14.219   1.00 148.64 ?  89  VAL A C     1 
ATOM   692  O  O     . VAL A 1 89  ? -16.189 54.956  13.899   1.00 146.63 ?  89  VAL A O     1 
ATOM   693  C  CB    . VAL A 1 89  ? -14.404 52.827  16.125   1.00 153.30 ?  89  VAL A CB    1 
ATOM   694  C  CG1   . VAL A 1 89  ? -14.947 53.801  17.169   1.00 153.35 ?  89  VAL A CG1   1 
ATOM   695  C  CG2   . VAL A 1 89  ? -14.446 51.398  16.661   1.00 155.39 ?  89  VAL A CG2   1 
ATOM   696  N  N     . LYS A 1 90  ? -13.930 55.012  14.140   1.00 142.82 ?  90  LYS A N     1 
ATOM   697  C  CA    . LYS A 1 90  ? -13.705 56.385  13.683   1.00 138.77 ?  90  LYS A CA    1 
ATOM   698  C  C     . LYS A 1 90  ? -12.382 56.478  12.922   1.00 140.31 ?  90  LYS A C     1 
ATOM   699  O  O     . LYS A 1 90  ? -11.403 55.826  13.293   1.00 142.65 ?  90  LYS A O     1 
ATOM   700  C  CB    . LYS A 1 90  ? -13.708 57.358  14.881   1.00 145.18 ?  90  LYS A CB    1 
ATOM   701  C  CG    . LYS A 1 90  ? -13.604 58.843  14.514   1.00 149.54 ?  90  LYS A CG    1 
ATOM   702  C  CD    . LYS A 1 90  ? -13.111 59.689  15.685   1.00 153.17 ?  90  LYS A CD    1 
ATOM   703  C  CE    . LYS A 1 90  ? -12.701 61.080  15.261   1.00 155.86 ?  90  LYS A CE    1 
ATOM   704  N  NZ    . LYS A 1 90  ? -12.000 61.803  16.356   1.00 159.32 ?  90  LYS A NZ    1 
ATOM   705  N  N     . ALA A 1 91  ? -12.361 57.287  11.851   1.00 132.01 ?  91  ALA A N     1 
ATOM   706  C  CA    . ALA A 1 91  ? -11.176 57.508  11.027   1.00 128.55 ?  91  ALA A CA    1 
ATOM   707  C  C     . ALA A 1 91  ? -11.102 58.949  10.533   1.00 129.62 ?  91  ALA A C     1 
ATOM   708  O  O     . ALA A 1 91  ? -12.133 59.601  10.347   1.00 128.38 ?  91  ALA A O     1 
ATOM   709  C  CB    . ALA A 1 91  ? -11.162 56.545  9.856    1.00 125.40 ?  91  ALA A CB    1 
ATOM   710  N  N     . GLN A 1 92  ? -9.873  59.450  10.355   1.00 125.30 ?  92  GLN A N     1 
ATOM   711  C  CA    . GLN A 1 92  ? -9.626  60.816  9.904    1.00 123.20 ?  92  GLN A CA    1 
ATOM   712  C  C     . GLN A 1 92  ? -8.603  60.867  8.780    1.00 123.47 ?  92  GLN A C     1 
ATOM   713  O  O     . GLN A 1 92  ? -7.606  60.141  8.815    1.00 124.45 ?  92  GLN A O     1 
ATOM   714  C  CB    . GLN A 1 92  ? -9.164  61.705  11.071   1.00 129.35 ?  92  GLN A CB    1 
ATOM   715  C  CG    . GLN A 1 92  ? -10.214 61.925  12.155   1.00 143.57 ?  92  GLN A CG    1 
ATOM   716  C  CD    . GLN A 1 92  ? -10.065 63.272  12.808   1.00 159.93 ?  92  GLN A CD    1 
ATOM   717  O  OE1   . GLN A 1 92  ? -10.494 64.302  12.272   1.00 152.14 ?  92  GLN A OE1   1 
ATOM   718  N  NE2   . GLN A 1 92  ? -9.457  63.293  13.984   1.00 153.34 ?  92  GLN A NE2   1 
ATOM   719  N  N     . SER A 1 93  ? -8.846  61.737  7.790    1.00 115.62 ?  93  SER A N     1 
ATOM   720  C  CA    . SER A 1 93  ? -7.931  61.947  6.669    1.00 111.89 ?  93  SER A CA    1 
ATOM   721  C  C     . SER A 1 93  ? -7.792  63.427  6.333    1.00 114.06 ?  93  SER A C     1 
ATOM   722  O  O     . SER A 1 93  ? -8.725  64.203  6.552    1.00 113.93 ?  93  SER A O     1 
ATOM   723  C  CB    . SER A 1 93  ? -8.333  61.123  5.445    1.00 110.89 ?  93  SER A CB    1 
ATOM   724  O  OG    . SER A 1 93  ? -9.374  61.694  4.668    1.00 115.29 ?  93  SER A OG    1 
ATOM   725  N  N     . ILE A 1 94  ? -6.621  63.818  5.824    1.00 110.01 ?  94  ILE A N     1 
ATOM   726  C  CA    . ILE A 1 94  ? -6.344  65.201  5.452    1.00 110.02 ?  94  ILE A CA    1 
ATOM   727  C  C     . ILE A 1 94  ? -6.117  65.372  3.941    1.00 110.08 ?  94  ILE A C     1 
ATOM   728  O  O     . ILE A 1 94  ? -5.461  64.533  3.317    1.00 107.74 ?  94  ILE A O     1 
ATOM   729  C  CB    . ILE A 1 94  ? -5.228  65.808  6.347    1.00 117.72 ?  94  ILE A CB    1 
ATOM   730  C  CG1   . ILE A 1 94  ? -5.404  67.308  6.554    1.00 120.18 ?  94  ILE A CG1   1 
ATOM   731  C  CG2   . ILE A 1 94  ? -3.803  65.423  5.933    1.00 118.71 ?  94  ILE A CG2   1 
ATOM   732  C  CD1   . ILE A 1 94  ? -6.146  67.685  7.798    1.00 130.41 ?  94  ILE A CD1   1 
ATOM   733  N  N     . LEU A 1 95  ? -6.686  66.437  3.353    1.00 105.81 ?  95  LEU A N     1 
ATOM   734  C  CA    . LEU A 1 95  ? -6.523  66.682  1.925    1.00 102.59 ?  95  LEU A CA    1 
ATOM   735  C  C     . LEU A 1 95  ? -6.191  68.138  1.654    1.00 109.26 ?  95  LEU A C     1 
ATOM   736  O  O     . LEU A 1 95  ? -7.027  69.012  1.890    1.00 109.47 ?  95  LEU A O     1 
ATOM   737  C  CB    . LEU A 1 95  ? -7.759  66.210  1.119    1.00 98.54  ?  95  LEU A CB    1 
ATOM   738  C  CG    . LEU A 1 95  ? -7.743  66.413  -0.406   1.00 99.52  ?  95  LEU A CG    1 
ATOM   739  C  CD1   . LEU A 1 95  ? -6.790  65.454  -1.082   1.00 98.34  ?  95  LEU A CD1   1 
ATOM   740  C  CD2   . LEU A 1 95  ? -9.135  66.236  -0.996   1.00 98.81  ?  95  LEU A CD2   1 
ATOM   741  N  N     . ASP A 1 96  ? -4.962  68.399  1.166    1.00 107.73 ?  96  ASP A N     1 
ATOM   742  C  CA    . ASP A 1 96  ? -4.528  69.747  0.809    1.00 110.14 ?  96  ASP A CA    1 
ATOM   743  C  C     . ASP A 1 96  ? -5.053  70.048  -0.586   1.00 111.35 ?  96  ASP A C     1 
ATOM   744  O  O     . ASP A 1 96  ? -4.753  69.315  -1.535   1.00 108.12 ?  96  ASP A O     1 
ATOM   745  C  CB    . ASP A 1 96  ? -3.000  69.887  0.871    1.00 115.17 ?  96  ASP A CB    1 
ATOM   746  C  CG    . ASP A 1 96  ? -2.470  70.059  2.277    1.00 132.94 ?  96  ASP A CG    1 
ATOM   747  O  OD1   . ASP A 1 96  ? -2.256  69.035  2.958    1.00 140.56 -1 96  ASP A OD1   1 
ATOM   748  O  OD2   . ASP A 1 96  ? -2.279  71.219  2.701    1.00 137.47 ?  96  ASP A OD2   1 
ATOM   749  N  N     . ILE A 1 97  ? -5.889  71.089  -0.697   1.00 108.96 ?  97  ILE A N     1 
ATOM   750  C  CA    . ILE A 1 97  ? -6.494  71.471  -1.966   1.00 106.40 ?  97  ILE A CA    1 
ATOM   751  C  C     . ILE A 1 97  ? -5.483  72.194  -2.843   1.00 113.85 ?  97  ILE A C     1 
ATOM   752  O  O     . ILE A 1 97  ? -5.158  73.361  -2.607   1.00 117.50 ?  97  ILE A O     1 
ATOM   753  C  CB    . ILE A 1 97  ? -7.852  72.203  -1.789   1.00 109.46 ?  97  ILE A CB    1 
ATOM   754  C  CG1   . ILE A 1 97  ? -8.841  71.396  -0.907   1.00 108.57 ?  97  ILE A CG1   1 
ATOM   755  C  CG2   . ILE A 1 97  ? -8.474  72.579  -3.127   1.00 107.77 ?  97  ILE A CG2   1 
ATOM   756  C  CD1   . ILE A 1 97  ? -9.356  70.002  -1.444   1.00 110.10 ?  97  ILE A CD1   1 
ATOM   757  N  N     . THR A 1 98  ? -4.958  71.459  -3.827   1.00 108.98 ?  98  THR A N     1 
ATOM   758  C  CA    . THR A 1 98  ? -3.978  71.919  -4.806   1.00 110.14 ?  98  THR A CA    1 
ATOM   759  C  C     . THR A 1 98  ? -4.692  72.460  -6.051   1.00 112.25 ?  98  THR A C     1 
ATOM   760  O  O     . THR A 1 98  ? -5.906  72.296  -6.180   1.00 109.23 ?  98  THR A O     1 
ATOM   761  C  CB    . THR A 1 98  ? -3.005  70.774  -5.133   1.00 120.49 ?  98  THR A CB    1 
ATOM   762  O  OG1   . THR A 1 98  ? -2.039  71.223  -6.073   1.00 126.50 ?  98  THR A OG1   1 
ATOM   763  C  CG2   . THR A 1 98  ? -3.713  69.503  -5.622   1.00 114.24 ?  98  THR A CG2   1 
ATOM   764  N  N     . SER A 1 99  ? -3.931  73.085  -6.971   1.00 110.57 ?  99  SER A N     1 
ATOM   765  C  CA    . SER A 1 99  ? -4.424  73.646  -8.233   1.00 109.33 ?  99  SER A CA    1 
ATOM   766  C  C     . SER A 1 99  ? -5.119  72.603  -9.116   1.00 108.02 ?  99  SER A C     1 
ATOM   767  O  O     . SER A 1 99  ? -5.985  72.953  -9.919   1.00 106.62 ?  99  SER A O     1 
ATOM   768  C  CB    . SER A 1 99  ? -3.285  74.319  -8.994   1.00 116.02 ?  99  SER A CB    1 
ATOM   769  O  OG    . SER A 1 99  ? -2.136  73.490  -9.091   1.00 124.27 ?  99  SER A OG    1 
ATOM   770  N  N     . ASP A 1 100 ? -4.761  71.321  -8.925   1.00 101.92 ?  100 ASP A N     1 
ATOM   771  C  CA    . ASP A 1 100 ? -5.302  70.179  -9.662   1.00 97.61  ?  100 ASP A CA    1 
ATOM   772  C  C     . ASP A 1 100 ? -6.699  69.783  -9.196   1.00 98.23  ?  100 ASP A C     1 
ATOM   773  O  O     . ASP A 1 100 ? -7.405  69.079  -9.919   1.00 94.37  ?  100 ASP A O     1 
ATOM   774  C  CB    . ASP A 1 100 ? -4.345  68.980  -9.552   1.00 99.25  ?  100 ASP A CB    1 
ATOM   775  C  CG    . ASP A 1 100 ? -2.892  69.320  -9.834   1.00 118.58 ?  100 ASP A CG    1 
ATOM   776  O  OD1   . ASP A 1 100 ? -2.606  69.851  -10.937  1.00 120.57 ?  100 ASP A OD1   1 
ATOM   777  O  OD2   . ASP A 1 100 ? -2.038  69.042  -8.962   1.00 128.72 -1 100 ASP A OD2   1 
ATOM   778  N  N     . SER A 1 101 ? -7.096  70.229  -7.994   1.00 96.87  ?  101 SER A N     1 
ATOM   779  C  CA    . SER A 1 101 ? -8.394  69.915  -7.386   1.00 95.18  ?  101 SER A CA    1 
ATOM   780  C  C     . SER A 1 101 ? -9.462  71.005  -7.594   1.00 99.14  ?  101 SER A C     1 
ATOM   781  O  O     . SER A 1 101 ? -10.652 70.718  -7.476   1.00 96.05  ?  101 SER A O     1 
ATOM   782  C  CB    . SER A 1 101 ? -8.223  69.623  -5.898   1.00 100.51 ?  101 SER A CB    1 
ATOM   783  O  OG    . SER A 1 101 ? -7.127  68.760  -5.634   1.00 110.21 ?  101 SER A OG    1 
ATOM   784  N  N     . VAL A 1 102 ? -9.037  72.239  -7.912   1.00 99.47  ?  102 VAL A N     1 
ATOM   785  C  CA    . VAL A 1 102 ? -9.922  73.394  -8.112   1.00 101.34 ?  102 VAL A CA    1 
ATOM   786  C  C     . VAL A 1 102 ? -10.256 73.682  -9.576   1.00 106.02 ?  102 VAL A C     1 
ATOM   787  O  O     . VAL A 1 102 ? -9.466  73.350  -10.465  1.00 104.79 ?  102 VAL A O     1 
ATOM   788  C  CB    . VAL A 1 102 ? -9.384  74.681  -7.421   1.00 109.82 ?  102 VAL A CB    1 
ATOM   789  C  CG1   . VAL A 1 102 ? -9.388  74.550  -5.909   1.00 111.35 ?  102 VAL A CG1   1 
ATOM   790  C  CG2   . VAL A 1 102 ? -7.997  75.071  -7.932   1.00 111.71 ?  102 VAL A CG2   1 
ATOM   791  N  N     . PHE A 1 103 ? -11.405 74.358  -9.814   1.00 104.71 ?  103 PHE A N     1 
ATOM   792  C  CA    . PHE A 1 103 ? -11.815 74.828  -11.137  1.00 105.21 ?  103 PHE A CA    1 
ATOM   793  C  C     . PHE A 1 103 ? -10.932 76.038  -11.420  1.00 114.13 ?  103 PHE A C     1 
ATOM   794  O  O     . PHE A 1 103 ? -10.945 77.003  -10.644  1.00 117.59 ?  103 PHE A O     1 
ATOM   795  C  CB    . PHE A 1 103 ? -13.289 75.264  -11.150  1.00 107.66 ?  103 PHE A CB    1 
ATOM   796  C  CG    . PHE A 1 103 ? -14.334 74.178  -11.115  1.00 106.40 ?  103 PHE A CG    1 
ATOM   797  C  CD1   . PHE A 1 103 ? -14.480 73.295  -12.184  1.00 106.97 ?  103 PHE A CD1   1 
ATOM   798  C  CD2   . PHE A 1 103 ? -15.236 74.093  -10.057  1.00 109.62 ?  103 PHE A CD2   1 
ATOM   799  C  CE1   . PHE A 1 103 ? -15.468 72.305  -12.167  1.00 105.42 ?  103 PHE A CE1   1 
ATOM   800  C  CE2   . PHE A 1 103 ? -16.229 73.110  -10.043  1.00 110.13 ?  103 PHE A CE2   1 
ATOM   801  C  CZ    . PHE A 1 103 ? -16.335 72.219  -11.097  1.00 105.34 ?  103 PHE A CZ    1 
ATOM   802  N  N     . HIS A 1 104 ? -10.118 75.948  -12.485  1.00 110.62 ?  104 HIS A N     1 
ATOM   803  C  CA    . HIS A 1 104 ? -9.151  76.963  -12.899  1.00 114.69 ?  104 HIS A CA    1 
ATOM   804  C  C     . HIS A 1 104 ? -9.641  78.408  -12.806  1.00 121.42 ?  104 HIS A C     1 
ATOM   805  O  O     . HIS A 1 104 ? -8.930  79.255  -12.263  1.00 125.01 ?  104 HIS A O     1 
ATOM   806  C  CB    . HIS A 1 104 ? -8.607  76.638  -14.299  1.00 115.10 ?  104 HIS A CB    1 
ATOM   807  C  CG    . HIS A 1 104 ? -7.898  77.774  -14.970  1.00 123.75 ?  104 HIS A CG    1 
ATOM   808  N  ND1   . HIS A 1 104 ? -6.762  78.350  -14.417  1.00 129.66 ?  104 HIS A ND1   1 
ATOM   809  C  CD2   . HIS A 1 104 ? -8.185  78.402  -16.133  1.00 127.63 ?  104 HIS A CD2   1 
ATOM   810  C  CE1   . HIS A 1 104 ? -6.404  79.311  -15.254  1.00 133.27 ?  104 HIS A CE1   1 
ATOM   811  N  NE2   . HIS A 1 104 ? -7.226  79.378  -16.303  1.00 132.57 ?  104 HIS A NE2   1 
ATOM   812  N  N     . LYS A 1 105 ? -10.850 78.677  -13.321  1.00 116.66 ?  105 LYS A N     1 
ATOM   813  C  CA    . LYS A 1 105 ? -11.451 80.011  -13.360  1.00 120.36 ?  105 LYS A CA    1 
ATOM   814  C  C     . LYS A 1 105 ? -11.947 80.546  -12.014  1.00 124.32 ?  105 LYS A C     1 
ATOM   815  O  O     . LYS A 1 105 ? -11.668 81.704  -11.695  1.00 128.80 ?  105 LYS A O     1 
ATOM   816  C  CB    . LYS A 1 105 ? -12.535 80.093  -14.449  1.00 122.27 ?  105 LYS A CB    1 
ATOM   817  C  CG    . LYS A 1 105 ? -11.959 80.038  -15.868  1.00 140.24 ?  105 LYS A CG    1 
ATOM   818  C  CD    . LYS A 1 105 ? -13.024 79.859  -16.940  1.00 149.16 ?  105 LYS A CD    1 
ATOM   819  C  CE    . LYS A 1 105 ? -12.435 79.953  -18.327  1.00 160.06 ?  105 LYS A CE    1 
ATOM   820  N  NZ    . LYS A 1 105 ? -13.442 79.654  -19.379  1.00 166.34 ?  105 LYS A NZ    1 
ATOM   821  N  N     . THR A 1 106 ? -12.670 79.717  -11.229  1.00 116.17 ?  106 THR A N     1 
ATOM   822  C  CA    . THR A 1 106 ? -13.229 80.113  -9.924   1.00 117.28 ?  106 THR A CA    1 
ATOM   823  C  C     . THR A 1 106 ? -12.283 79.944  -8.735   1.00 120.23 ?  106 THR A C     1 
ATOM   824  O  O     . THR A 1 106 ? -12.325 80.755  -7.808   1.00 123.64 ?  106 THR A O     1 
ATOM   825  C  CB    . THR A 1 106 ? -14.577 79.427  -9.652   1.00 122.70 ?  106 THR A CB    1 
ATOM   826  O  OG1   . THR A 1 106 ? -14.401 78.012  -9.619   1.00 115.61 ?  106 THR A OG1   1 
ATOM   827  C  CG2   . THR A 1 106 ? -15.656 79.806  -10.657  1.00 122.39 ?  106 THR A CG2   1 
ATOM   828  N  N     . GLY A 1 107 ? -11.474 78.887  -8.758   1.00 112.21 ?  107 GLY A N     1 
ATOM   829  C  CA    . GLY A 1 107 ? -10.543 78.562  -7.684   1.00 112.47 ?  107 GLY A CA    1 
ATOM   830  C  C     . GLY A 1 107 ? -11.192 77.768  -6.570   1.00 113.11 ?  107 GLY A C     1 
ATOM   831  O  O     . GLY A 1 107 ? -10.636 77.667  -5.474   1.00 113.88 ?  107 GLY A O     1 
ATOM   832  N  N     . ILE A 1 108 ? -12.378 77.198  -6.848   1.00 106.31 ?  108 ILE A N     1 
ATOM   833  C  CA    . ILE A 1 108 ? -13.170 76.388  -5.919   1.00 104.15 ?  108 ILE A CA    1 
ATOM   834  C  C     . ILE A 1 108 ? -12.986 74.918  -6.275   1.00 103.05 ?  108 ILE A C     1 
ATOM   835  O  O     . ILE A 1 108 ? -13.017 74.567  -7.457   1.00 100.25 ?  108 ILE A O     1 
ATOM   836  C  CB    . ILE A 1 108 ? -14.674 76.797  -5.950   1.00 107.70 ?  108 ILE A CB    1 
ATOM   837  C  CG1   . ILE A 1 108 ? -14.853 78.321  -5.779   1.00 113.32 ?  108 ILE A CG1   1 
ATOM   838  C  CG2   . ILE A 1 108 ? -15.498 76.020  -4.904   1.00 107.42 ?  108 ILE A CG2   1 
ATOM   839  C  CD1   . ILE A 1 108 ? -16.127 78.879  -6.384   1.00 122.23 ?  108 ILE A CD1   1 
ATOM   840  N  N     . ALA A 1 109 ? -12.810 74.063  -5.249   1.00 98.73  ?  109 ALA A N     1 
ATOM   841  C  CA    . ALA A 1 109 ? -12.637 72.615  -5.396   1.00 94.79  ?  109 ALA A CA    1 
ATOM   842  C  C     . ALA A 1 109 ? -13.829 71.976  -6.098   1.00 95.37  ?  109 ALA A C     1 
ATOM   843  O  O     . ALA A 1 109 ? -14.972 72.373  -5.859   1.00 95.79  ?  109 ALA A O     1 
ATOM   844  C  CB    . ALA A 1 109 ? -12.426 71.969  -4.037   1.00 96.43  ?  109 ALA A CB    1 
ATOM   845  N  N     . ARG A 1 110 ? -13.554 71.008  -6.983   1.00 88.60  ?  110 ARG A N     1 
ATOM   846  C  CA    . ARG A 1 110 ? -14.582 70.290  -7.729   1.00 85.63  ?  110 ARG A CA    1 
ATOM   847  C  C     . ARG A 1 110 ? -15.345 69.357  -6.801   1.00 89.52  ?  110 ARG A C     1 
ATOM   848  O  O     . ARG A 1 110 ? -14.761 68.829  -5.860   1.00 89.58  ?  110 ARG A O     1 
ATOM   849  C  CB    . ARG A 1 110 ? -13.969 69.528  -8.912   1.00 83.39  ?  110 ARG A CB    1 
ATOM   850  C  CG    . ARG A 1 110 ? -13.307 70.449  -9.925   1.00 95.86  ?  110 ARG A CG    1 
ATOM   851  C  CD    . ARG A 1 110 ? -12.880 69.754  -11.207  1.00 103.79 ?  110 ARG A CD    1 
ATOM   852  N  NE    . ARG A 1 110 ? -11.442 69.467  -11.248  1.00 109.91 ?  110 ARG A NE    1 
ATOM   853  C  CZ    . ARG A 1 110 ? -10.516 70.339  -11.631  1.00 125.63 ?  110 ARG A CZ    1 
ATOM   854  N  NH1   . ARG A 1 110 ? -10.863 71.563  -12.007  1.00 122.40 ?  110 ARG A NH1   1 
ATOM   855  N  NH2   . ARG A 1 110 ? -9.238  69.991  -11.650  1.00 105.10 ?  110 ARG A NH2   1 
ATOM   856  N  N     . GLY A 1 111 ? -16.644 69.202  -7.050   1.00 86.17  ?  111 GLY A N     1 
ATOM   857  C  CA    . GLY A 1 111 ? -17.539 68.375  -6.246   1.00 86.22  ?  111 GLY A CA    1 
ATOM   858  C  C     . GLY A 1 111 ? -17.026 66.985  -5.921   1.00 88.62  ?  111 GLY A C     1 
ATOM   859  O  O     . GLY A 1 111 ? -17.019 66.580  -4.756   1.00 89.14  ?  111 GLY A O     1 
ATOM   860  N  N     . HIS A 1 112 ? -16.555 66.267  -6.951   1.00 83.23  ?  112 HIS A N     1 
ATOM   861  C  CA    . HIS A 1 112 ? -16.042 64.904  -6.841   1.00 82.11  ?  112 HIS A CA    1 
ATOM   862  C  C     . HIS A 1 112 ? -14.769 64.761  -6.027   1.00 87.54  ?  112 HIS A C     1 
ATOM   863  O  O     . HIS A 1 112 ? -14.502 63.668  -5.536   1.00 87.37  ?  112 HIS A O     1 
ATOM   864  C  CB    . HIS A 1 112 ? -15.897 64.260  -8.219   1.00 80.59  ?  112 HIS A CB    1 
ATOM   865  C  CG    . HIS A 1 112 ? -15.037 65.033  -9.157   1.00 83.81  ?  112 HIS A CG    1 
ATOM   866  N  ND1   . HIS A 1 112 ? -15.575 65.940  -10.054  1.00 85.34  ?  112 HIS A ND1   1 
ATOM   867  C  CD2   . HIS A 1 112 ? -13.695 65.006  -9.310   1.00 86.41  ?  112 HIS A CD2   1 
ATOM   868  C  CE1   . HIS A 1 112 ? -14.546 66.429  -10.726  1.00 85.27  ?  112 HIS A CE1   1 
ATOM   869  N  NE2   . HIS A 1 112 ? -13.393 65.895  -10.313  1.00 86.07  ?  112 HIS A NE2   1 
ATOM   870  N  N     . VAL A 1 113 ? -13.996 65.852  -5.867   1.00 85.62  ?  113 VAL A N     1 
ATOM   871  C  CA    . VAL A 1 113 ? -12.758 65.872  -5.075   1.00 87.21  ?  113 VAL A CA    1 
ATOM   872  C  C     . VAL A 1 113 ? -13.068 65.570  -3.600   1.00 93.68  ?  113 VAL A C     1 
ATOM   873  O  O     . VAL A 1 113 ? -12.442 64.684  -3.021   1.00 94.00  ?  113 VAL A O     1 
ATOM   874  C  CB    . VAL A 1 113 ? -11.998 67.211  -5.217   1.00 92.86  ?  113 VAL A CB    1 
ATOM   875  C  CG1   . VAL A 1 113 ? -10.723 67.224  -4.372   1.00 94.97  ?  113 VAL A CG1   1 
ATOM   876  C  CG2   . VAL A 1 113 ? -11.688 67.514  -6.678   1.00 91.07  ?  113 VAL A CG2   1 
ATOM   877  N  N     . LEU A 1 114 ? -14.036 66.290  -3.007   1.00 91.55  ?  114 LEU A N     1 
ATOM   878  C  CA    . LEU A 1 114 ? -14.422 66.110  -1.614   1.00 93.87  ?  114 LEU A CA    1 
ATOM   879  C  C     . LEU A 1 114 ? -15.127 64.794  -1.357   1.00 95.55  ?  114 LEU A C     1 
ATOM   880  O  O     . LEU A 1 114 ? -14.948 64.220  -0.280   1.00 97.82  ?  114 LEU A O     1 
ATOM   881  C  CB    . LEU A 1 114 ? -15.242 67.291  -1.119   1.00 96.53  ?  114 LEU A CB    1 
ATOM   882  C  CG    . LEU A 1 114 ? -14.424 68.550  -0.895   1.00 104.30 ?  114 LEU A CG    1 
ATOM   883  C  CD1   . LEU A 1 114 ? -15.001 69.709  -1.669   1.00 104.63 ?  114 LEU A CD1   1 
ATOM   884  C  CD2   . LEU A 1 114 ? -14.295 68.859  0.579    1.00 111.42 ?  114 LEU A CD2   1 
ATOM   885  N  N     . PHE A 1 115 ? -15.907 64.299  -2.340   1.00 87.80  ?  115 PHE A N     1 
ATOM   886  C  CA    . PHE A 1 115 ? -16.588 63.012  -2.223   1.00 86.62  ?  115 PHE A CA    1 
ATOM   887  C  C     . PHE A 1 115 ? -15.558 61.890  -2.245   1.00 89.21  ?  115 PHE A C     1 
ATOM   888  O  O     . PHE A 1 115 ? -15.705 60.920  -1.507   1.00 90.10  ?  115 PHE A O     1 
ATOM   889  C  CB    . PHE A 1 115 ? -17.629 62.813  -3.338   1.00 86.10  ?  115 PHE A CB    1 
ATOM   890  C  CG    . PHE A 1 115 ? -18.294 61.457  -3.290   1.00 87.48  ?  115 PHE A CG    1 
ATOM   891  C  CD1   . PHE A 1 115 ? -19.360 61.220  -2.435   1.00 92.59  ?  115 PHE A CD1   1 
ATOM   892  C  CD2   . PHE A 1 115 ? -17.819 60.402  -4.061   1.00 87.95  ?  115 PHE A CD2   1 
ATOM   893  C  CE1   . PHE A 1 115 ? -19.949 59.958  -2.363   1.00 94.04  ?  115 PHE A CE1   1 
ATOM   894  C  CE2   . PHE A 1 115 ? -18.401 59.138  -3.978   1.00 91.19  ?  115 PHE A CE2   1 
ATOM   895  C  CZ    . PHE A 1 115 ? -19.458 58.923  -3.125   1.00 91.46  ?  115 PHE A CZ    1 
ATOM   896  N  N     . ALA A 1 116 ? -14.523 62.028  -3.097   1.00 83.88  ?  116 ALA A N     1 
ATOM   897  C  CA    . ALA A 1 116 ? -13.441 61.057  -3.246   1.00 83.26  ?  116 ALA A CA    1 
ATOM   898  C  C     . ALA A 1 116 ? -12.711 60.832  -1.937   1.00 89.30  ?  116 ALA A C     1 
ATOM   899  O  O     . ALA A 1 116 ? -12.469 59.682  -1.582   1.00 89.29  ?  116 ALA A O     1 
ATOM   900  C  CB    . ALA A 1 116 ? -12.472 61.508  -4.322   1.00 82.35  ?  116 ALA A CB    1 
ATOM   901  N  N     . GLN A 1 117 ? -12.408 61.922  -1.199   1.00 88.03  ?  117 GLN A N     1 
ATOM   902  C  CA    . GLN A 1 117 ? -11.744 61.864  0.105    1.00 91.38  ?  117 GLN A CA    1 
ATOM   903  C  C     . GLN A 1 117 ? -12.646 61.150  1.113    1.00 96.02  ?  117 GLN A C     1 
ATOM   904  O  O     . GLN A 1 117 ? -12.164 60.291  1.850    1.00 98.21  ?  117 GLN A O     1 
ATOM   905  C  CB    . GLN A 1 117 ? -11.388 63.278  0.602    1.00 94.70  ?  117 GLN A CB    1 
ATOM   906  C  CG    . GLN A 1 117 ? -10.603 63.295  1.918    1.00 101.87 ?  117 GLN A CG    1 
ATOM   907  C  CD    . GLN A 1 117 ? -10.623 64.634  2.603    1.00 114.05 ?  117 GLN A CD    1 
ATOM   908  O  OE1   . GLN A 1 117 ? -11.398 65.535  2.266    1.00 106.80 ?  117 GLN A OE1   1 
ATOM   909  N  NE2   . GLN A 1 117 ? -9.781  64.783  3.612    1.00 108.31 ?  117 GLN A NE2   1 
ATOM   910  N  N     . ALA A 1 118 ? -13.950 61.494  1.113    1.00 90.46  ?  118 ALA A N     1 
ATOM   911  C  CA    . ALA A 1 118 ? -14.966 60.921  1.990    1.00 91.96  ?  118 ALA A CA    1 
ATOM   912  C  C     . ALA A 1 118 ? -15.138 59.424  1.757    1.00 94.96  ?  118 ALA A C     1 
ATOM   913  O  O     . ALA A 1 118 ? -15.042 58.648  2.703    1.00 96.77  ?  118 ALA A O     1 
ATOM   914  C  CB    . ALA A 1 118 ? -16.289 61.642  1.793    1.00 92.13  ?  118 ALA A CB    1 
ATOM   915  N  N     . ASN A 1 119 ? -15.351 59.019  0.496    1.00 89.45  ?  119 ASN A N     1 
ATOM   916  C  CA    . ASN A 1 119 ? -15.520 57.621  0.100    1.00 89.12  ?  119 ASN A CA    1 
ATOM   917  C  C     . ASN A 1 119 ? -14.282 56.804  0.469    1.00 95.27  ?  119 ASN A C     1 
ATOM   918  O  O     . ASN A 1 119 ? -14.422 55.755  1.098    1.00 97.33  ?  119 ASN A O     1 
ATOM   919  C  CB    . ASN A 1 119 ? -15.817 57.510  -1.398   1.00 84.37  ?  119 ASN A CB    1 
ATOM   920  C  CG    . ASN A 1 119 ? -16.300 56.149  -1.808   1.00 102.68 ?  119 ASN A CG    1 
ATOM   921  O  OD1   . ASN A 1 119 ? -17.429 55.758  -1.513   1.00 97.87  ?  119 ASN A OD1   1 
ATOM   922  N  ND2   . ASN A 1 119 ? -15.453 55.396  -2.492   1.00 92.97  ?  119 ASN A ND2   1 
ATOM   923  N  N     . SER A 1 120 ? -13.073 57.315  0.127    1.00 91.03  ?  120 SER A N     1 
ATOM   924  C  CA    . SER A 1 120 ? -11.789 56.673  0.419    1.00 92.16  ?  120 SER A CA    1 
ATOM   925  C  C     . SER A 1 120 ? -11.645 56.388  1.902    1.00 99.79  ?  120 SER A C     1 
ATOM   926  O  O     . SER A 1 120 ? -11.229 55.291  2.271    1.00 101.53 ?  120 SER A O     1 
ATOM   927  C  CB    . SER A 1 120 ? -10.628 57.539  -0.059   1.00 94.15  ?  120 SER A CB    1 
ATOM   928  O  OG    . SER A 1 120 ? -10.366 57.344  -1.439   1.00 99.33  ?  120 SER A OG    1 
ATOM   929  N  N     . LEU A 1 121 ? -12.025 57.369  2.745    1.00 97.67  ?  121 LEU A N     1 
ATOM   930  C  CA    . LEU A 1 121 ? -11.968 57.300  4.205    1.00 101.63 ?  121 LEU A CA    1 
ATOM   931  C  C     . LEU A 1 121 ? -12.854 56.186  4.755    1.00 107.57 ?  121 LEU A C     1 
ATOM   932  O  O     . LEU A 1 121 ? -12.448 55.511  5.699    1.00 110.78 ?  121 LEU A O     1 
ATOM   933  C  CB    . LEU A 1 121 ? -12.350 58.666  4.807    1.00 102.52 ?  121 LEU A CB    1 
ATOM   934  C  CG    . LEU A 1 121 ? -12.160 58.899  6.307    1.00 111.65 ?  121 LEU A CG    1 
ATOM   935  C  CD1   . LEU A 1 121 ? -10.736 58.642  6.747    1.00 114.10 ?  121 LEU A CD1   1 
ATOM   936  C  CD2   . LEU A 1 121 ? -12.529 60.315  6.670    1.00 114.19 ?  121 LEU A CD2   1 
ATOM   937  N  N     . CYS A 1 122 ? -14.037 55.974  4.143    1.00 102.00 ?  122 CYS A N     1 
ATOM   938  C  CA    . CYS A 1 122 ? -14.986 54.936  4.533    1.00 103.93 ?  122 CYS A CA    1 
ATOM   939  C  C     . CYS A 1 122 ? -14.440 53.540  4.285    1.00 109.44 ?  122 CYS A C     1 
ATOM   940  O  O     . CYS A 1 122 ? -14.552 52.693  5.164    1.00 113.13 ?  122 CYS A O     1 
ATOM   941  C  CB    . CYS A 1 122 ? -16.332 55.145  3.852    1.00 102.01 ?  122 CYS A CB    1 
ATOM   942  S  SG    . CYS A 1 122 ? -17.184 56.659  4.356    1.00 106.31 ?  122 CYS A SG    1 
ATOM   943  N  N     . VAL A 1 123 ? -13.810 53.312  3.116    1.00 103.44 ?  123 VAL A N     1 
ATOM   944  C  CA    . VAL A 1 123 ? -13.194 52.031  2.738    1.00 104.30 ?  123 VAL A CA    1 
ATOM   945  C  C     . VAL A 1 123 ? -12.043 51.697  3.717    1.00 111.98 ?  123 VAL A C     1 
ATOM   946  O  O     . VAL A 1 123 ? -11.874 50.537  4.112    1.00 114.91 ?  123 VAL A O     1 
ATOM   947  C  CB    . VAL A 1 123 ? -12.723 52.040  1.257    1.00 104.03 ?  123 VAL A CB    1 
ATOM   948  C  CG1   . VAL A 1 123 ? -12.261 50.657  0.807    1.00 105.23 ?  123 VAL A CG1   1 
ATOM   949  C  CG2   . VAL A 1 123 ? -13.820 52.557  0.330    1.00 100.32 ?  123 VAL A CG2   1 
ATOM   950  N  N     . ALA A 1 124 ? -11.288 52.731  4.129    1.00 108.42 ?  124 ALA A N     1 
ATOM   951  C  CA    . ALA A 1 124 ? -10.179 52.621  5.071    1.00 111.81 ?  124 ALA A CA    1 
ATOM   952  C  C     . ALA A 1 124 ? -10.686 52.326  6.479    1.00 121.12 ?  124 ALA A C     1 
ATOM   953  O  O     . ALA A 1 124 ? -10.065 51.544  7.201    1.00 124.74 ?  124 ALA A O     1 
ATOM   954  C  CB    . ALA A 1 124 ? -9.368  53.907  5.069    1.00 111.10 ?  124 ALA A CB    1 
ATOM   955  N  N     . LEU A 1 125 ? -11.818 52.947  6.860    1.00 118.39 ?  125 LEU A N     1 
ATOM   956  C  CA    . LEU A 1 125 ? -12.444 52.800  8.174    1.00 123.33 ?  125 LEU A CA    1 
ATOM   957  C  C     . LEU A 1 125 ? -12.945 51.378  8.434    1.00 130.96 ?  125 LEU A C     1 
ATOM   958  O  O     . LEU A 1 125 ? -12.708 50.846  9.518    1.00 135.36 ?  125 LEU A O     1 
ATOM   959  C  CB    . LEU A 1 125 ? -13.572 53.843  8.341    1.00 122.34 ?  125 LEU A CB    1 
ATOM   960  C  CG    . LEU A 1 125 ? -14.482 53.787  9.571    1.00 131.52 ?  125 LEU A CG    1 
ATOM   961  C  CD1   . LEU A 1 125 ? -13.688 53.858  10.866   1.00 136.64 ?  125 LEU A CD1   1 
ATOM   962  C  CD2   . LEU A 1 125 ? -15.486 54.908  9.532    1.00 131.79 ?  125 LEU A CD2   1 
ATOM   963  N  N     . ILE A 1 126 ? -13.622 50.768  7.449    1.00 125.33 ?  126 ILE A N     1 
ATOM   964  C  CA    . ILE A 1 126 ? -14.158 49.418  7.586    1.00 128.51 ?  126 ILE A CA    1 
ATOM   965  C  C     . ILE A 1 126 ? -13.090 48.345  7.342    1.00 135.03 ?  126 ILE A C     1 
ATOM   966  O  O     . ILE A 1 126 ? -12.597 48.191  6.219    1.00 131.36 ?  126 ILE A O     1 
ATOM   967  C  CB    . ILE A 1 126 ? -15.480 49.227  6.792    1.00 129.15 ?  126 ILE A CB    1 
ATOM   968  C  CG1   . ILE A 1 126 ? -16.575 50.143  7.360    1.00 129.69 ?  126 ILE A CG1   1 
ATOM   969  C  CG2   . ILE A 1 126 ? -15.956 47.779  6.824    1.00 133.75 ?  126 ILE A CG2   1 
ATOM   970  C  CD1   . ILE A 1 126 ? -17.115 51.078  6.418    1.00 129.66 ?  126 ILE A CD1   1 
ATOM   971  N  N     . LYS A 1 127 ? -12.723 47.628  8.422    1.00 137.81 ?  127 LYS A N     1 
ATOM   972  C  CA    . LYS A 1 127 ? -11.734 46.551  8.421    1.00 140.68 ?  127 LYS A CA    1 
ATOM   973  C  C     . LYS A 1 127 ? -12.460 45.228  8.136    1.00 148.59 ?  127 LYS A C     1 
ATOM   974  O  O     . LYS A 1 127 ? -12.807 44.476  9.054    1.00 154.38 ?  127 LYS A O     1 
ATOM   975  C  CB    . LYS A 1 127 ? -10.959 46.524  9.757    1.00 148.03 ?  127 LYS A CB    1 
ATOM   976  C  CG    . LYS A 1 127 ? -9.743  45.597  9.783    1.00 158.40 ?  127 LYS A CG    1 
ATOM   977  C  CD    . LYS A 1 127 ? -9.156  45.514  11.187   1.00 167.74 ?  127 LYS A CD    1 
ATOM   978  C  CE    . LYS A 1 127 ? -8.216  44.355  11.403   1.00 173.26 ?  127 LYS A CE    1 
ATOM   979  N  NZ    . LYS A 1 127 ? -7.648  44.356  12.775   1.00 178.38 ?  127 LYS A NZ    1 
ATOM   980  N  N     . GLN A 1 128 ? -12.739 44.990  6.845    1.00 142.39 ?  128 GLN A N     1 
ATOM   981  C  CA    . GLN A 1 128 ? -13.418 43.800  6.327    1.00 144.87 ?  128 GLN A CA    1 
ATOM   982  C  C     . GLN A 1 128 ? -12.768 43.371  4.996    1.00 147.29 ?  128 GLN A C     1 
ATOM   983  O  O     . GLN A 1 128 ? -12.206 44.235  4.311    1.00 141.98 ?  128 GLN A O     1 
ATOM   984  C  CB    . GLN A 1 128 ? -14.924 44.073  6.127    1.00 144.95 ?  128 GLN A CB    1 
ATOM   985  C  CG    . GLN A 1 128 ? -15.753 44.149  7.418    1.00 160.05 ?  128 GLN A CG    1 
ATOM   986  C  CD    . GLN A 1 128 ? -15.740 42.892  8.253    1.00 176.74 ?  128 GLN A CD    1 
ATOM   987  O  OE1   . GLN A 1 128 ? -15.790 41.764  7.745    1.00 174.79 ?  128 GLN A OE1   1 
ATOM   988  N  NE2   . GLN A 1 128 ? -15.696 43.068  9.564    1.00 170.97 ?  128 GLN A NE2   1 
ATOM   989  N  N     . PRO A 1 129 ? -12.824 42.068  4.599    1.00 147.77 ?  129 PRO A N     1 
ATOM   990  C  CA    . PRO A 1 129 ? -12.195 41.660  3.323    1.00 145.27 ?  129 PRO A CA    1 
ATOM   991  C  C     . PRO A 1 129 ? -12.713 42.426  2.104    1.00 142.88 ?  129 PRO A C     1 
ATOM   992  O  O     . PRO A 1 129 ? -11.915 43.022  1.377    1.00 138.06 ?  129 PRO A O     1 
ATOM   993  C  CB    . PRO A 1 129 ? -12.502 40.160  3.232    1.00 152.23 ?  129 PRO A CB    1 
ATOM   994  C  CG    . PRO A 1 129 ? -12.770 39.740  4.630    1.00 162.26 ?  129 PRO A CG    1 
ATOM   995  C  CD    . PRO A 1 129 ? -13.428 40.909  5.289    1.00 155.54 ?  129 PRO A CD    1 
ATOM   996  N  N     . THR A 1 130 ? -14.043 42.449  1.915    1.00 138.93 ?  130 THR A N     1 
ATOM   997  C  CA    . THR A 1 130 ? -14.689 43.148  0.803    1.00 133.09 ?  130 THR A CA    1 
ATOM   998  C  C     . THR A 1 130 ? -15.596 44.268  1.304    1.00 133.82 ?  130 THR A C     1 
ATOM   999  O  O     . THR A 1 130 ? -16.520 44.020  2.083    1.00 136.92 ?  130 THR A O     1 
ATOM   1000 C  CB    . THR A 1 130 ? -15.379 42.164  -0.157   1.00 144.32 ?  130 THR A CB    1 
ATOM   1001 O  OG1   . THR A 1 130 ? -16.036 41.141  0.596    1.00 151.42 ?  130 THR A OG1   1 
ATOM   1002 C  CG2   . THR A 1 130 ? -14.405 41.530  -1.134   1.00 142.14 ?  130 THR A CG2   1 
ATOM   1003 N  N     . VAL A 1 131 ? -15.287 45.510  0.894    1.00 124.58 ?  131 VAL A N     1 
ATOM   1004 C  CA    . VAL A 1 131 ? -16.021 46.726  1.260    1.00 121.95 ?  131 VAL A CA    1 
ATOM   1005 C  C     . VAL A 1 131 ? -16.382 47.480  -0.031   1.00 119.12 ?  131 VAL A C     1 
ATOM   1006 O  O     . VAL A 1 131 ? -15.494 47.770  -0.841   1.00 115.92 ?  131 VAL A O     1 
ATOM   1007 C  CB    . VAL A 1 131 ? -15.223 47.620  2.253    1.00 126.34 ?  131 VAL A CB    1 
ATOM   1008 C  CG1   . VAL A 1 131 ? -16.039 48.833  2.691    1.00 124.67 ?  131 VAL A CG1   1 
ATOM   1009 C  CG2   . VAL A 1 131 ? -14.747 46.830  3.471    1.00 131.99 ?  131 VAL A CG2   1 
ATOM   1010 N  N     . LEU A 1 132 ? -17.685 47.761  -0.233   1.00 113.25 ?  132 LEU A N     1 
ATOM   1011 C  CA    . LEU A 1 132 ? -18.194 48.459  -1.416   1.00 107.72 ?  132 LEU A CA    1 
ATOM   1012 C  C     . LEU A 1 132 ? -19.257 49.479  -1.036   1.00 110.24 ?  132 LEU A C     1 
ATOM   1013 O  O     . LEU A 1 132 ? -20.135 49.172  -0.235   1.00 113.66 ?  132 LEU A O     1 
ATOM   1014 C  CB    . LEU A 1 132 ? -18.796 47.466  -2.435   1.00 107.89 ?  132 LEU A CB    1 
ATOM   1015 C  CG    . LEU A 1 132 ? -17.911 46.346  -2.990   1.00 113.39 ?  132 LEU A CG    1 
ATOM   1016 C  CD1   . LEU A 1 132 ? -18.753 45.298  -3.690   1.00 115.11 ?  132 LEU A CD1   1 
ATOM   1017 C  CD2   . LEU A 1 132 ? -16.835 46.886  -3.930   1.00 112.12 ?  132 LEU A CD2   1 
ATOM   1018 N  N     . THR A 1 133 ? -19.205 50.674  -1.634   1.00 102.45 ?  133 THR A N     1 
ATOM   1019 C  CA    . THR A 1 133 ? -20.196 51.726  -1.400   1.00 101.59 ?  133 THR A CA    1 
ATOM   1020 C  C     . THR A 1 133 ? -21.459 51.352  -2.164   1.00 106.20 ?  133 THR A C     1 
ATOM   1021 O  O     . THR A 1 133 ? -21.392 51.066  -3.363   1.00 103.62 ?  133 THR A O     1 
ATOM   1022 C  CB    . THR A 1 133 ? -19.668 53.096  -1.844   1.00 105.29 ?  133 THR A CB    1 
ATOM   1023 O  OG1   . THR A 1 133 ? -18.303 53.238  -1.448   1.00 106.87 ?  133 THR A OG1   1 
ATOM   1024 C  CG2   . THR A 1 133 ? -20.502 54.246  -1.300   1.00 102.63 ?  133 THR A CG2   1 
ATOM   1025 N  N     . HIS A 1 134 ? -22.597 51.319  -1.460   1.00 106.30 ?  134 HIS A N     1 
ATOM   1026 C  CA    . HIS A 1 134 ? -23.889 50.973  -2.043   1.00 107.12 ?  134 HIS A CA    1 
ATOM   1027 C  C     . HIS A 1 134 ? -24.771 52.190  -2.260   1.00 108.37 ?  134 HIS A C     1 
ATOM   1028 O  O     . HIS A 1 134 ? -25.418 52.290  -3.300   1.00 106.80 ?  134 HIS A O     1 
ATOM   1029 C  CB    . HIS A 1 134 ? -24.594 49.898  -1.208   1.00 113.70 ?  134 HIS A CB    1 
ATOM   1030 C  CG    . HIS A 1 134 ? -24.317 48.497  -1.672   1.00 119.21 ?  134 HIS A CG    1 
ATOM   1031 N  ND1   . HIS A 1 134 ? -25.208 47.467  -1.420   1.00 125.78 ?  134 HIS A ND1   1 
ATOM   1032 C  CD2   . HIS A 1 134 ? -23.269 48.003  -2.379   1.00 119.23 ?  134 HIS A CD2   1 
ATOM   1033 C  CE1   . HIS A 1 134 ? -24.671 46.386  -1.963   1.00 126.04 ?  134 HIS A CE1   1 
ATOM   1034 N  NE2   . HIS A 1 134 ? -23.506 46.660  -2.555   1.00 122.46 ?  134 HIS A NE2   1 
ATOM   1035 N  N     . GLU A 1 135 ? -24.786 53.115  -1.292   1.00 104.64 ?  135 GLU A N     1 
ATOM   1036 C  CA    . GLU A 1 135 ? -25.556 54.358  -1.342   1.00 103.30 ?  135 GLU A CA    1 
ATOM   1037 C  C     . GLU A 1 135 ? -24.789 55.464  -0.637   1.00 106.37 ?  135 GLU A C     1 
ATOM   1038 O  O     . GLU A 1 135 ? -23.982 55.187  0.255    1.00 107.53 ?  135 GLU A O     1 
ATOM   1039 C  CB    . GLU A 1 135 ? -26.919 54.185  -0.655   1.00 108.84 ?  135 GLU A CB    1 
ATOM   1040 C  CG    . GLU A 1 135 ? -27.998 53.545  -1.511   1.00 121.49 ?  135 GLU A CG    1 
ATOM   1041 C  CD    . GLU A 1 135 ? -29.256 53.115  -0.776   1.00 150.68 ?  135 GLU A CD    1 
ATOM   1042 O  OE1   . GLU A 1 135 ? -29.547 53.675  0.306    1.00 148.27 ?  135 GLU A OE1   1 
ATOM   1043 O  OE2   . GLU A 1 135 ? -29.963 52.223  -1.298   1.00 149.32 -1 135 GLU A OE2   1 
ATOM   1044 N  N     . SER A 1 136 ? -25.056 56.719  -1.025   1.00 101.12 ?  136 SER A N     1 
ATOM   1045 C  CA    . SER A 1 136 ? -24.460 57.908  -0.417   1.00 100.75 ?  136 SER A CA    1 
ATOM   1046 C  C     . SER A 1 136 ? -25.325 59.148  -0.618   1.00 104.88 ?  136 SER A C     1 
ATOM   1047 O  O     . SER A 1 136 ? -25.842 59.379  -1.714   1.00 102.70 ?  136 SER A O     1 
ATOM   1048 C  CB    . SER A 1 136 ? -23.045 58.156  -0.927   1.00 100.59 ?  136 SER A CB    1 
ATOM   1049 O  OG    . SER A 1 136 ? -22.423 59.181  -0.169   1.00 107.98 ?  136 SER A OG    1 
ATOM   1050 N  N     . SER A 1 137 ? -25.488 59.931  0.454    1.00 103.66 ?  137 SER A N     1 
ATOM   1051 C  CA    . SER A 1 137 ? -26.233 61.187  0.473    1.00 103.92 ?  137 SER A CA    1 
ATOM   1052 C  C     . SER A 1 137 ? -25.247 62.234  0.968    1.00 106.96 ?  137 SER A C     1 
ATOM   1053 O  O     . SER A 1 137 ? -24.767 62.151  2.105    1.00 108.96 ?  137 SER A O     1 
ATOM   1054 C  CB    . SER A 1 137 ? -27.437 61.081  1.402    1.00 112.68 ?  137 SER A CB    1 
ATOM   1055 O  OG    . SER A 1 137 ? -28.196 62.279  1.401    1.00 124.26 ?  137 SER A OG    1 
ATOM   1056 N  N     . ILE A 1 138 ? -24.869 63.162  0.081    1.00 100.25 ?  138 ILE A N     1 
ATOM   1057 C  CA    . ILE A 1 138 ? -23.848 64.172  0.378    1.00 99.64  ?  138 ILE A CA    1 
ATOM   1058 C  C     . ILE A 1 138 ? -24.336 65.616  0.266    1.00 104.05 ?  138 ILE A C     1 
ATOM   1059 O  O     . ILE A 1 138 ? -25.281 65.892  -0.477   1.00 102.88 ?  138 ILE A O     1 
ATOM   1060 C  CB    . ILE A 1 138 ? -22.535 63.906  -0.418   1.00 99.14  ?  138 ILE A CB    1 
ATOM   1061 C  CG1   . ILE A 1 138 ? -22.775 63.974  -1.934   1.00 96.06  ?  138 ILE A CG1   1 
ATOM   1062 C  CG2   . ILE A 1 138 ? -21.893 62.565  -0.003   1.00 99.63  ?  138 ILE A CG2   1 
ATOM   1063 C  CD1   . ILE A 1 138 ? -21.569 64.220  -2.732   1.00 102.53 ?  138 ILE A CD1   1 
ATOM   1064 N  N     . GLN A 1 139 ? -23.689 66.529  1.020    1.00 102.57 ?  139 GLN A N     1 
ATOM   1065 C  CA    . GLN A 1 139 ? -24.010 67.959  1.073    1.00 104.51 ?  139 GLN A CA    1 
ATOM   1066 C  C     . GLN A 1 139 ? -22.745 68.811  1.053    1.00 108.67 ?  139 GLN A C     1 
ATOM   1067 O  O     . GLN A 1 139 ? -21.819 68.554  1.825    1.00 108.80 ?  139 GLN A O     1 
ATOM   1068 C  CB    . GLN A 1 139 ? -24.814 68.292  2.343    1.00 110.67 ?  139 GLN A CB    1 
ATOM   1069 C  CG    . GLN A 1 139 ? -26.229 67.738  2.372    1.00 126.80 ?  139 GLN A CG    1 
ATOM   1070 C  CD    . GLN A 1 139 ? -26.890 68.057  3.677    1.00 151.90 ?  139 GLN A CD    1 
ATOM   1071 O  OE1   . GLN A 1 139 ? -26.831 67.118  4.606    1.00 152.00 ?  139 GLN A OE1   1 
ATOM   1072 N  NE2   . GLN A 1 139 ? -27.420 69.148  3.876    1.00 146.15 ?  139 GLN A NE2   1 
ATOM   1073 N  N     . PHE A 1 140 ? -22.725 69.844  0.194    1.00 105.62 ?  140 PHE A N     1 
ATOM   1074 C  CA    . PHE A 1 140 ? -21.602 70.778  0.073    1.00 106.59 ?  140 PHE A CA    1 
ATOM   1075 C  C     . PHE A 1 140 ? -21.972 72.102  0.737    1.00 114.86 ?  140 PHE A C     1 
ATOM   1076 O  O     . PHE A 1 140 ? -22.409 73.046  0.067    1.00 115.39 ?  140 PHE A O     1 
ATOM   1077 C  CB    . PHE A 1 140 ? -21.204 70.968  -1.399   1.00 105.53 ?  140 PHE A CB    1 
ATOM   1078 C  CG    . PHE A 1 140 ? -20.747 69.702  -2.083   1.00 103.94 ?  140 PHE A CG    1 
ATOM   1079 C  CD1   . PHE A 1 140 ? -19.410 69.323  -2.057   1.00 106.53 ?  140 PHE A CD1   1 
ATOM   1080 C  CD2   . PHE A 1 140 ? -21.651 68.896  -2.767   1.00 104.35 ?  140 PHE A CD2   1 
ATOM   1081 C  CE1   . PHE A 1 140 ? -18.988 68.156  -2.696   1.00 104.51 ?  140 PHE A CE1   1 
ATOM   1082 C  CE2   . PHE A 1 140 ? -21.228 67.731  -3.406   1.00 104.20 ?  140 PHE A CE2   1 
ATOM   1083 C  CZ    . PHE A 1 140 ? -19.900 67.369  -3.367   1.00 101.43 ?  140 PHE A CZ    1 
ATOM   1084 N  N     . ILE A 1 141 ? -21.817 72.142  2.074    1.00 114.20 ?  141 ILE A N     1 
ATOM   1085 C  CA    . ILE A 1 141 ? -22.159 73.258  2.960    1.00 118.57 ?  141 ILE A CA    1 
ATOM   1086 C  C     . ILE A 1 141 ? -21.482 74.575  2.580    1.00 123.27 ?  141 ILE A C     1 
ATOM   1087 O  O     . ILE A 1 141 ? -22.177 75.575  2.373    1.00 125.32 ?  141 ILE A O     1 
ATOM   1088 C  CB    . ILE A 1 141 ? -21.978 72.860  4.456    1.00 125.02 ?  141 ILE A CB    1 
ATOM   1089 C  CG1   . ILE A 1 141 ? -22.940 71.726  4.843    1.00 125.20 ?  141 ILE A CG1   1 
ATOM   1090 C  CG2   . ILE A 1 141 ? -22.170 74.050  5.402    1.00 131.58 ?  141 ILE A CG2   1 
ATOM   1091 C  CD1   . ILE A 1 141 ? -22.324 70.413  4.924    1.00 130.05 ?  141 ILE A CD1   1 
ATOM   1092 N  N     . GLU A 1 142 ? -20.142 74.579  2.491    1.00 118.12 ?  142 GLU A N     1 
ATOM   1093 C  CA    . GLU A 1 142 ? -19.378 75.773  2.124    1.00 119.39 ?  142 GLU A CA    1 
ATOM   1094 C  C     . GLU A 1 142 ? -18.470 75.501  0.931    1.00 118.55 ?  142 GLU A C     1 
ATOM   1095 O  O     . GLU A 1 142 ? -18.167 74.340  0.638    1.00 114.94 ?  142 GLU A O     1 
ATOM   1096 C  CB    . GLU A 1 142 ? -18.561 76.314  3.318    1.00 125.28 ?  142 GLU A CB    1 
ATOM   1097 C  CG    . GLU A 1 142 ? -19.370 76.720  4.546    1.00 141.92 ?  142 GLU A CG    1 
ATOM   1098 C  CD    . GLU A 1 142 ? -20.418 77.806  4.375    1.00 170.77 ?  142 GLU A CD    1 
ATOM   1099 O  OE1   . GLU A 1 142 ? -20.202 78.730  3.557    1.00 171.44 ?  142 GLU A OE1   1 
ATOM   1100 O  OE2   . GLU A 1 142 ? -21.447 77.746  5.086    1.00 168.47 -1 142 GLU A OE2   1 
ATOM   1101 N  N     . LYS A 1 143 ? -18.042 76.574  0.238    1.00 114.93 ?  143 LYS A N     1 
ATOM   1102 C  CA    . LYS A 1 143 ? -17.141 76.469  -0.911   1.00 111.01 ?  143 LYS A CA    1 
ATOM   1103 C  C     . LYS A 1 143 ? -15.713 76.232  -0.423   1.00 113.36 ?  143 LYS A C     1 
ATOM   1104 O  O     . LYS A 1 143 ? -15.176 77.043  0.336    1.00 116.71 ?  143 LYS A O     1 
ATOM   1105 C  CB    . LYS A 1 143 ? -17.202 77.732  -1.795   1.00 115.26 ?  143 LYS A CB    1 
ATOM   1106 C  CG    . LYS A 1 143 ? -18.417 77.808  -2.710   1.00 125.38 ?  143 LYS A CG    1 
ATOM   1107 C  CD    . LYS A 1 143 ? -19.038 79.211  -2.741   1.00 137.90 ?  143 LYS A CD    1 
ATOM   1108 C  CE    . LYS A 1 143 ? -18.421 80.137  -3.768   1.00 145.22 ?  143 LYS A CE    1 
ATOM   1109 N  NZ    . LYS A 1 143 ? -19.077 81.468  -3.790   1.00 158.88 ?  143 LYS A NZ    1 
ATOM   1110 N  N     . VAL A 1 144 ? -15.115 75.103  -0.833   1.00 104.90 ?  144 VAL A N     1 
ATOM   1111 C  CA    . VAL A 1 144 ? -13.733 74.772  -0.490   1.00 104.59 ?  144 VAL A CA    1 
ATOM   1112 C  C     . VAL A 1 144 ? -12.865 75.410  -1.567   1.00 107.81 ?  144 VAL A C     1 
ATOM   1113 O  O     . VAL A 1 144 ? -12.995 75.073  -2.748   1.00 104.23 ?  144 VAL A O     1 
ATOM   1114 C  CB    . VAL A 1 144 ? -13.485 73.250  -0.364   1.00 104.94 ?  144 VAL A CB    1 
ATOM   1115 C  CG1   . VAL A 1 144 ? -12.006 72.960  -0.165   1.00 105.30 ?  144 VAL A CG1   1 
ATOM   1116 C  CG2   . VAL A 1 144 ? -14.299 72.652  0.772    1.00 105.73 ?  144 VAL A CG2   1 
ATOM   1117 N  N     . LYS A 1 145 ? -12.019 76.361  -1.170   1.00 108.03 ?  145 LYS A N     1 
ATOM   1118 C  CA    . LYS A 1 145 ? -11.166 77.065  -2.119   1.00 108.60 ?  145 LYS A CA    1 
ATOM   1119 C  C     . LYS A 1 145 ? -9.732  76.525  -2.172   1.00 111.59 ?  145 LYS A C     1 
ATOM   1120 O  O     . LYS A 1 145 ? -9.387  75.611  -1.420   1.00 109.81 ?  145 LYS A O     1 
ATOM   1121 C  CB    . LYS A 1 145 ? -11.231 78.586  -1.887   1.00 116.16 ?  145 LYS A CB    1 
ATOM   1122 C  CG    . LYS A 1 145 ? -12.501 79.207  -2.469   1.00 128.26 ?  145 LYS A CG    1 
ATOM   1123 C  CD    . LYS A 1 145 ? -12.569 80.717  -2.283   1.00 144.62 ?  145 LYS A CD    1 
ATOM   1124 C  CE    . LYS A 1 145 ? -12.286 81.499  -3.554   1.00 158.29 ?  145 LYS A CE    1 
ATOM   1125 N  NZ    . LYS A 1 145 ? -13.407 81.429  -4.533   1.00 164.02 ?  145 LYS A NZ    1 
ATOM   1126 N  N     . LEU A 1 146 ? -8.924  77.052  -3.108   1.00 109.04 ?  146 LEU A N     1 
ATOM   1127 C  CA    . LEU A 1 146 ? -7.526  76.696  -3.320   1.00 109.22 ?  146 LEU A CA    1 
ATOM   1128 C  C     . LEU A 1 146 ? -6.701  77.000  -2.062   1.00 118.66 ?  146 LEU A C     1 
ATOM   1129 O  O     . LEU A 1 146 ? -6.962  77.994  -1.379   1.00 122.16 ?  146 LEU A O     1 
ATOM   1130 C  CB    . LEU A 1 146 ? -6.995  77.467  -4.547   1.00 110.24 ?  146 LEU A CB    1 
ATOM   1131 C  CG    . LEU A 1 146 ? -5.516  77.333  -4.930   1.00 116.13 ?  146 LEU A CG    1 
ATOM   1132 C  CD1   . LEU A 1 146 ? -5.155  75.912  -5.287   1.00 112.09 ?  146 LEU A CD1   1 
ATOM   1133 C  CD2   . LEU A 1 146 ? -5.185  78.238  -6.089   1.00 120.01 ?  146 LEU A CD2   1 
ATOM   1134 N  N     . ASN A 1 147 ? -5.740  76.108  -1.748   1.00 115.48 ?  147 ASN A N     1 
ATOM   1135 C  CA    . ASN A 1 147 ? -4.824  76.152  -0.597   1.00 119.56 ?  147 ASN A CA    1 
ATOM   1136 C  C     . ASN A 1 147 ? -5.428  75.771  0.769    1.00 124.82 ?  147 ASN A C     1 
ATOM   1137 O  O     . ASN A 1 147 ? -4.705  75.725  1.771    1.00 127.94 ?  147 ASN A O     1 
ATOM   1138 C  CB    . ASN A 1 147 ? -3.960  77.422  -0.562   1.00 126.03 ?  147 ASN A CB    1 
ATOM   1139 C  CG    . ASN A 1 147 ? -3.060  77.558  -1.762   1.00 149.00 ?  147 ASN A CG    1 
ATOM   1140 O  OD1   . ASN A 1 147 ? -2.293  76.649  -2.109   1.00 142.13 ?  147 ASN A OD1   1 
ATOM   1141 N  ND2   . ASN A 1 147 ? -3.134  78.702  -2.424   1.00 143.64 ?  147 ASN A ND2   1 
ATOM   1142 N  N     . ASP A 1 148 ? -6.735  75.443  0.799    1.00 118.52 ?  148 ASP A N     1 
ATOM   1143 C  CA    . ASP A 1 148 ? -7.412  74.992  2.017    1.00 119.04 ?  148 ASP A CA    1 
ATOM   1144 C  C     . ASP A 1 148 ? -7.019  73.541  2.286    1.00 120.43 ?  148 ASP A C     1 
ATOM   1145 O  O     . ASP A 1 148 ? -6.734  72.797  1.346    1.00 116.13 ?  148 ASP A O     1 
ATOM   1146 C  CB    . ASP A 1 148 ? -8.946  75.074  1.872    1.00 118.78 ?  148 ASP A CB    1 
ATOM   1147 C  CG    . ASP A 1 148 ? -9.547  76.469  1.914    1.00 129.81 ?  148 ASP A CG    1 
ATOM   1148 O  OD1   . ASP A 1 148 ? -9.306  77.198  2.904    1.00 140.24 -1 148 ASP A OD1   1 
ATOM   1149 O  OD2   . ASP A 1 148 ? -10.256 76.829  0.973    1.00 127.67 ?  148 ASP A OD2   1 
ATOM   1150 N  N     . THR A 1 149 ? -7.008  73.139  3.561    1.00 119.63 ?  149 THR A N     1 
ATOM   1151 C  CA    . THR A 1 149 ? -6.716  71.760  3.942    1.00 117.69 ?  149 THR A CA    1 
ATOM   1152 C  C     . THR A 1 149 ? -7.992  71.178  4.544    1.00 120.20 ?  149 THR A C     1 
ATOM   1153 O  O     . THR A 1 149 ? -8.481  71.675  5.563    1.00 123.52 ?  149 THR A O     1 
ATOM   1154 C  CB    . THR A 1 149 ? -5.479  71.671  4.838    1.00 129.67 ?  149 THR A CB    1 
ATOM   1155 O  OG1   . THR A 1 149 ? -4.454  72.513  4.307    1.00 131.91 ?  149 THR A OG1   1 
ATOM   1156 C  CG2   . THR A 1 149 ? -4.955  70.258  4.944    1.00 126.51 ?  149 THR A CG2   1 
ATOM   1157 N  N     . VAL A 1 150 ? -8.567  70.175  3.870    1.00 111.26 ?  150 VAL A N     1 
ATOM   1158 C  CA    . VAL A 1 150 ? -9.816  69.548  4.291    1.00 109.44 ?  150 VAL A CA    1 
ATOM   1159 C  C     . VAL A 1 150 ? -9.570  68.408  5.275    1.00 113.82 ?  150 VAL A C     1 
ATOM   1160 O  O     . VAL A 1 150 ? -8.919  67.419  4.933    1.00 112.02 ?  150 VAL A O     1 
ATOM   1161 C  CB    . VAL A 1 150 ? -10.694 69.116  3.093    1.00 108.44 ?  150 VAL A CB    1 
ATOM   1162 C  CG1   . VAL A 1 150 ? -12.056 68.627  3.563    1.00 108.02 ?  150 VAL A CG1   1 
ATOM   1163 C  CG2   . VAL A 1 150 ? -10.860 70.256  2.098    1.00 107.34 ?  150 VAL A CG2   1 
ATOM   1164 N  N     . ARG A 1 151 ? -10.104 68.558  6.493    1.00 112.83 ?  151 ARG A N     1 
ATOM   1165 C  CA    . ARG A 1 151 ? -10.001 67.569  7.558    1.00 114.37 ?  151 ARG A CA    1 
ATOM   1166 C  C     . ARG A 1 151 ? -11.301 66.772  7.578    1.00 116.47 ?  151 ARG A C     1 
ATOM   1167 O  O     . ARG A 1 151 ? -12.316 67.256  8.081    1.00 117.79 ?  151 ARG A O     1 
ATOM   1168 C  CB    . ARG A 1 151 ? -9.753  68.260  8.911    1.00 119.18 ?  151 ARG A CB    1 
ATOM   1169 C  CG    . ARG A 1 151 ? -9.240  67.315  9.985    1.00 128.99 ?  151 ARG A CG    1 
ATOM   1170 C  CD    . ARG A 1 151 ? -9.216  67.965  11.344   1.00 138.79 ?  151 ARG A CD    1 
ATOM   1171 N  NE    . ARG A 1 151 ? -10.477 67.764  12.053   1.00 145.98 ?  151 ARG A NE    1 
ATOM   1172 C  CZ    . ARG A 1 151 ? -11.410 68.697  12.210   1.00 160.67 ?  151 ARG A CZ    1 
ATOM   1173 N  NH1   . ARG A 1 151 ? -11.233 69.916  11.712   1.00 146.57 ?  151 ARG A NH1   1 
ATOM   1174 N  NH2   . ARG A 1 151 ? -12.522 68.424  12.879   1.00 148.78 ?  151 ARG A NH2   1 
ATOM   1175 N  N     . ALA A 1 152 ? -11.285 65.576  6.988    1.00 110.03 ?  152 ALA A N     1 
ATOM   1176 C  CA    . ALA A 1 152 ? -12.468 64.725  6.939    1.00 108.73 ?  152 ALA A CA    1 
ATOM   1177 C  C     . ALA A 1 152 ? -12.449 63.709  8.056    1.00 117.14 ?  152 ALA A C     1 
ATOM   1178 O  O     . ALA A 1 152 ? -11.427 63.053  8.273    1.00 117.90 ?  152 ALA A O     1 
ATOM   1179 C  CB    . ALA A 1 152 ? -12.545 64.011  5.608    1.00 104.71 ?  152 ALA A CB    1 
ATOM   1180 N  N     . GLU A 1 153 ? -13.574 63.582  8.774    1.00 116.85 ?  153 GLU A N     1 
ATOM   1181 C  CA    . GLU A 1 153 ? -13.712 62.594  9.841    1.00 120.57 ?  153 GLU A CA    1 
ATOM   1182 C  C     . GLU A 1 153 ? -14.934 61.723  9.629    1.00 123.01 ?  153 GLU A C     1 
ATOM   1183 O  O     . GLU A 1 153 ? -16.035 62.240  9.449    1.00 121.79 ?  153 GLU A O     1 
ATOM   1184 C  CB    . GLU A 1 153 ? -13.612 63.179  11.271   1.00 127.83 ?  153 GLU A CB    1 
ATOM   1185 C  CG    . GLU A 1 153 ? -14.263 64.535  11.516   1.00 142.73 ?  153 GLU A CG    1 
ATOM   1186 C  CD    . GLU A 1 153 ? -14.165 65.063  12.940   1.00 168.15 ?  153 GLU A CD    1 
ATOM   1187 O  OE1   . GLU A 1 153 ? -13.109 64.868  13.587   1.00 164.91 ?  153 GLU A OE1   1 
ATOM   1188 O  OE2   . GLU A 1 153 ? -15.141 65.696  13.404   1.00 166.39 -1 153 GLU A OE2   1 
ATOM   1189 N  N     . ALA A 1 154 ? -14.713 60.400  9.566    1.00 119.34 ?  154 ALA A N     1 
ATOM   1190 C  CA    . ALA A 1 154 ? -15.759 59.402  9.357    1.00 118.81 ?  154 ALA A CA    1 
ATOM   1191 C  C     . ALA A 1 154 ? -16.002 58.598  10.625   1.00 128.22 ?  154 ALA A C     1 
ATOM   1192 O  O     . ALA A 1 154 ? -15.048 58.199  11.295   1.00 130.68 ?  154 ALA A O     1 
ATOM   1193 C  CB    . ALA A 1 154 ? -15.377 58.474  8.223    1.00 115.74 ?  154 ALA A CB    1 
ATOM   1194 N  N     . ARG A 1 155 ? -17.283 58.382  10.965   1.00 126.36 ?  155 ARG A N     1 
ATOM   1195 C  CA    . ARG A 1 155 ? -17.698 57.626  12.147   1.00 131.61 ?  155 ARG A CA    1 
ATOM   1196 C  C     . ARG A 1 155 ? -18.756 56.599  11.779   1.00 134.04 ?  155 ARG A C     1 
ATOM   1197 O  O     . ARG A 1 155 ? -19.688 56.921  11.037   1.00 131.02 ?  155 ARG A O     1 
ATOM   1198 C  CB    . ARG A 1 155 ? -18.256 58.564  13.227   1.00 137.85 ?  155 ARG A CB    1 
ATOM   1199 C  CG    . ARG A 1 155 ? -17.202 59.410  13.938   1.00 155.15 ?  155 ARG A CG    1 
ATOM   1200 C  CD    . ARG A 1 155 ? -17.777 60.372  14.975   1.00 169.40 ?  155 ARG A CD    1 
ATOM   1201 N  NE    . ARG A 1 155 ? -18.875 61.198  14.459   1.00 184.17 ?  155 ARG A NE    1 
ATOM   1202 C  CZ    . ARG A 1 155 ? -18.731 62.306  13.732   1.00 197.91 ?  155 ARG A CZ    1 
ATOM   1203 N  NH1   . ARG A 1 155 ? -17.521 62.749  13.411   1.00 189.39 ?  155 ARG A NH1   1 
ATOM   1204 N  NH2   . ARG A 1 155 ? -19.798 62.971  13.310   1.00 189.33 ?  155 ARG A NH2   1 
ATOM   1205 N  N     . VAL A 1 156 ? -18.620 55.366  12.303   1.00 132.76 ?  156 VAL A N     1 
ATOM   1206 C  CA    . VAL A 1 156 ? -19.597 54.297  12.077   1.00 133.18 ?  156 VAL A CA    1 
ATOM   1207 C  C     . VAL A 1 156 ? -20.778 54.586  13.009   1.00 140.86 ?  156 VAL A C     1 
ATOM   1208 O  O     . VAL A 1 156 ? -20.602 54.618  14.227   1.00 143.34 ?  156 VAL A O     1 
ATOM   1209 C  CB    . VAL A 1 156 ? -19.007 52.872  12.282   1.00 139.42 ?  156 VAL A CB    1 
ATOM   1210 C  CG1   . VAL A 1 156 ? -20.085 51.800  12.136   1.00 141.13 ?  156 VAL A CG1   1 
ATOM   1211 C  CG2   . VAL A 1 156 ? -17.864 52.603  11.312   1.00 134.88 ?  156 VAL A CG2   1 
ATOM   1212 N  N     . VAL A 1 157 ? -21.958 54.847  12.434   1.00 135.52 ?  157 VAL A N     1 
ATOM   1213 C  CA    . VAL A 1 157 ? -23.171 55.182  13.195   1.00 139.71 ?  157 VAL A CA    1 
ATOM   1214 C  C     . VAL A 1 157 ? -24.048 53.943  13.433   1.00 143.85 ?  157 VAL A C     1 
ATOM   1215 O  O     . VAL A 1 157 ? -24.658 53.818  14.503   1.00 144.90 ?  157 VAL A O     1 
ATOM   1216 C  CB    . VAL A 1 157 ? -23.942 56.402  12.602   1.00 140.19 ?  157 VAL A CB    1 
ATOM   1217 C  CG1   . VAL A 1 157 ? -24.957 56.985  13.587   1.00 141.72 ?  157 VAL A CG1   1 
ATOM   1218 C  CG2   . VAL A 1 157 ? -22.967 57.482  12.156   1.00 135.47 ?  157 VAL A CG2   1 
ATOM   1219 N  N     . ASN A 1 158 ? -24.067 53.012  12.457   1.00 140.85 ?  158 ASN A N     1 
ATOM   1220 C  CA    . ASN A 1 158 ? -24.823 51.763  12.538   1.00 142.08 ?  158 ASN A CA    1 
ATOM   1221 C  C     . ASN A 1 158 ? -24.132 50.653  11.747   1.00 144.27 ?  158 ASN A C     1 
ATOM   1222 O  O     . ASN A 1 158 ? -23.274 50.937  10.908   1.00 139.95 ?  158 ASN A O     1 
ATOM   1223 C  CB    . ASN A 1 158 ? -26.264 51.968  12.058   1.00 142.45 ?  158 ASN A CB    1 
ATOM   1224 C  CG    . ASN A 1 158 ? -27.236 50.903  12.516   1.00 160.27 ?  158 ASN A CG    1 
ATOM   1225 O  OD1   . ASN A 1 158 ? -27.301 50.536  13.700   1.00 157.72 ?  158 ASN A OD1   1 
ATOM   1226 N  ND2   . ASN A 1 158 ? -28.038 50.402  11.587   1.00 154.06 ?  158 ASN A ND2   1 
ATOM   1227 N  N     . GLN A 1 159 ? -24.483 49.390  12.041   1.00 143.70 ?  159 GLN A N     1 
ATOM   1228 C  CA    . GLN A 1 159 ? -23.937 48.213  11.376   1.00 144.27 ?  159 GLN A CA    1 
ATOM   1229 C  C     . GLN A 1 159 ? -24.961 47.081  11.380   1.00 150.08 ?  159 GLN A C     1 
ATOM   1230 O  O     . GLN A 1 159 ? -25.360 46.606  12.450   1.00 152.06 ?  159 GLN A O     1 
ATOM   1231 C  CB    . GLN A 1 159 ? -22.614 47.767  12.033   1.00 146.06 ?  159 GLN A CB    1 
ATOM   1232 C  CG    . GLN A 1 159 ? -21.882 46.663  11.267   1.00 148.25 ?  159 GLN A CG    1 
ATOM   1233 C  CD    . GLN A 1 159 ? -20.986 45.827  12.148   1.00 159.87 ?  159 GLN A CD    1 
ATOM   1234 O  OE1   . GLN A 1 159 ? -20.173 46.335  12.931   1.00 154.51 ?  159 GLN A OE1   1 
ATOM   1235 N  NE2   . GLN A 1 159 ? -21.077 44.515  11.996   1.00 156.51 ?  159 GLN A NE2   1 
ATOM   1236 N  N     . THR A 1 160 ? -25.389 46.664  10.178   1.00 147.67 ?  160 THR A N     1 
ATOM   1237 C  CA    . THR A 1 160 ? -26.321 45.551  9.980    1.00 149.70 ?  160 THR A CA    1 
ATOM   1238 C  C     . THR A 1 160 ? -25.493 44.307  9.621    1.00 154.46 ?  160 THR A C     1 
ATOM   1239 O  O     . THR A 1 160 ? -24.266 44.349  9.739    1.00 153.79 ?  160 THR A O     1 
ATOM   1240 C  CB    . THR A 1 160 ? -27.395 45.904  8.936    1.00 154.43 ?  160 THR A CB    1 
ATOM   1241 O  OG1   . THR A 1 160 ? -26.776 46.153  7.674    1.00 152.79 ?  160 THR A OG1   1 
ATOM   1242 C  CG2   . THR A 1 160 ? -28.258 47.087  9.355    1.00 152.65 ?  160 THR A CG2   1 
ATOM   1243 N  N     . ALA A 1 161 ? -26.147 43.205  9.212    1.00 154.35 ?  161 ALA A N     1 
ATOM   1244 C  CA    . ALA A 1 161 ? -25.451 41.971  8.841    1.00 156.19 ?  161 ALA A CA    1 
ATOM   1245 C  C     . ALA A 1 161 ? -24.772 42.100  7.474    1.00 157.68 ?  161 ALA A C     1 
ATOM   1246 O  O     . ALA A 1 161 ? -23.775 41.422  7.220    1.00 157.98 ?  161 ALA A O     1 
ATOM   1247 C  CB    . ALA A 1 161 ? -26.422 40.801  8.841    1.00 159.22 ?  161 ALA A CB    1 
ATOM   1248 N  N     . LYS A 1 162 ? -25.305 42.979  6.605    1.00 152.84 ?  162 LYS A N     1 
ATOM   1249 C  CA    . LYS A 1 162 ? -24.803 43.209  5.248    1.00 146.11 ?  162 LYS A CA    1 
ATOM   1250 C  C     . LYS A 1 162 ? -24.227 44.614  5.018    1.00 144.43 ?  162 LYS A C     1 
ATOM   1251 O  O     . LYS A 1 162 ? -23.516 44.811  4.032    1.00 138.90 ?  162 LYS A O     1 
ATOM   1252 C  CB    . LYS A 1 162 ? -25.906 42.920  4.219    1.00 147.75 ?  162 LYS A CB    1 
ATOM   1253 C  CG    . LYS A 1 162 ? -26.044 41.449  3.863    1.00 163.36 ?  162 LYS A CG    1 
ATOM   1254 C  CD    . LYS A 1 162 ? -27.260 41.210  2.996    1.00 170.08 ?  162 LYS A CD    1 
ATOM   1255 C  CE    . LYS A 1 162 ? -27.200 39.865  2.331    1.00 180.03 ?  162 LYS A CE    1 
ATOM   1256 N  NZ    . LYS A 1 162 ? -26.575 39.936  0.983    1.00 185.67 ?  162 LYS A NZ    1 
ATOM   1257 N  N     . HIS A 1 163 ? -24.523 45.588  5.908    1.00 141.89 ?  163 HIS A N     1 
ATOM   1258 C  CA    . HIS A 1 163 ? -24.056 46.967  5.731    1.00 136.31 ?  163 HIS A CA    1 
ATOM   1259 C  C     . HIS A 1 163 ? -23.444 47.644  6.955    1.00 141.58 ?  163 HIS A C     1 
ATOM   1260 O  O     . HIS A 1 163 ? -23.674 47.228  8.089    1.00 147.70 ?  163 HIS A O     1 
ATOM   1261 C  CB    . HIS A 1 163 ? -25.188 47.845  5.181    1.00 134.61 ?  163 HIS A CB    1 
ATOM   1262 C  CG    . HIS A 1 163 ? -25.598 47.488  3.792    1.00 135.14 ?  163 HIS A CG    1 
ATOM   1263 N  ND1   . HIS A 1 163 ? -26.554 46.520  3.553    1.00 140.56 ?  163 HIS A ND1   1 
ATOM   1264 C  CD2   . HIS A 1 163 ? -25.158 47.973  2.609    1.00 131.39 ?  163 HIS A CD2   1 
ATOM   1265 C  CE1   . HIS A 1 163 ? -26.673 46.453  2.237    1.00 136.28 ?  163 HIS A CE1   1 
ATOM   1266 N  NE2   . HIS A 1 163 ? -25.854 47.311  1.627    1.00 130.96 ?  163 HIS A NE2   1 
ATOM   1267 N  N     . TYR A 1 164 ? -22.675 48.714  6.698    1.00 132.39 ?  164 TYR A N     1 
ATOM   1268 C  CA    . TYR A 1 164 ? -22.036 49.596  7.671    1.00 132.65 ?  164 TYR A CA    1 
ATOM   1269 C  C     . TYR A 1 164 ? -22.525 51.004  7.335    1.00 132.83 ?  164 TYR A C     1 
ATOM   1270 O  O     . TYR A 1 164 ? -22.413 51.430  6.182    1.00 127.39 ?  164 TYR A O     1 
ATOM   1271 C  CB    . TYR A 1 164 ? -20.505 49.540  7.539    1.00 131.77 ?  164 TYR A CB    1 
ATOM   1272 C  CG    . TYR A 1 164 ? -19.802 48.623  8.515    1.00 138.86 ?  164 TYR A CG    1 
ATOM   1273 C  CD1   . TYR A 1 164 ? -19.352 49.095  9.746    1.00 144.27 ?  164 TYR A CD1   1 
ATOM   1274 C  CD2   . TYR A 1 164 ? -19.491 47.312  8.170    1.00 141.42 ?  164 TYR A CD2   1 
ATOM   1275 C  CE1   . TYR A 1 164 ? -18.658 48.270  10.629   1.00 150.45 ?  164 TYR A CE1   1 
ATOM   1276 C  CE2   . TYR A 1 164 ? -18.805 46.473  9.047    1.00 147.57 ?  164 TYR A CE2   1 
ATOM   1277 C  CZ    . TYR A 1 164 ? -18.386 46.958  10.274   1.00 158.56 ?  164 TYR A CZ    1 
ATOM   1278 O  OH    . TYR A 1 164 ? -17.717 46.129  11.142   1.00 162.95 ?  164 TYR A OH    1 
ATOM   1279 N  N     . TYR A 1 165 ? -23.103 51.710  8.308    1.00 132.84 ?  165 TYR A N     1 
ATOM   1280 C  CA    . TYR A 1 165 ? -23.602 53.062  8.080    1.00 130.28 ?  165 TYR A CA    1 
ATOM   1281 C  C     . TYR A 1 165 ? -22.610 54.067  8.644    1.00 133.78 ?  165 TYR A C     1 
ATOM   1282 O  O     . TYR A 1 165 ? -22.304 54.032  9.836    1.00 138.22 ?  165 TYR A O     1 
ATOM   1283 C  CB    . TYR A 1 165 ? -25.039 53.235  8.607    1.00 135.41 ?  165 TYR A CB    1 
ATOM   1284 C  CG    . TYR A 1 165 ? -26.037 52.327  7.916    1.00 138.12 ?  165 TYR A CG    1 
ATOM   1285 C  CD1   . TYR A 1 165 ? -26.645 52.707  6.723    1.00 136.08 ?  165 TYR A CD1   1 
ATOM   1286 C  CD2   . TYR A 1 165 ? -26.361 51.082  8.443    1.00 144.19 ?  165 TYR A CD2   1 
ATOM   1287 C  CE1   . TYR A 1 165 ? -27.566 51.875  6.082    1.00 138.03 ?  165 TYR A CE1   1 
ATOM   1288 C  CE2   . TYR A 1 165 ? -27.266 50.235  7.803    1.00 146.19 ?  165 TYR A CE2   1 
ATOM   1289 C  CZ    . TYR A 1 165 ? -27.868 50.634  6.623    1.00 149.16 ?  165 TYR A CZ    1 
ATOM   1290 O  OH    . TYR A 1 165 ? -28.766 49.797  6.001    1.00 151.51 ?  165 TYR A OH    1 
ATOM   1291 N  N     . VAL A 1 166 ? -22.035 54.898  7.759    1.00 124.56 ?  166 VAL A N     1 
ATOM   1292 C  CA    . VAL A 1 166 ? -20.988 55.865  8.104    1.00 123.10 ?  166 VAL A CA    1 
ATOM   1293 C  C     . VAL A 1 166 ? -21.419 57.318  7.867    1.00 125.32 ?  166 VAL A C     1 
ATOM   1294 O  O     . VAL A 1 166 ? -22.014 57.630  6.838    1.00 122.26 ?  166 VAL A O     1 
ATOM   1295 C  CB    . VAL A 1 166 ? -19.658 55.548  7.349    1.00 123.22 ?  166 VAL A CB    1 
ATOM   1296 C  CG1   . VAL A 1 166 ? -18.513 56.427  7.841    1.00 123.19 ?  166 VAL A CG1   1 
ATOM   1297 C  CG2   . VAL A 1 166 ? -19.275 54.073  7.461    1.00 124.90 ?  166 VAL A CG2   1 
ATOM   1298 N  N     . GLU A 1 167 ? -21.085 58.202  8.819    1.00 123.98 ?  167 GLU A N     1 
ATOM   1299 C  CA    . GLU A 1 167 ? -21.329 59.640  8.729    1.00 122.62 ?  167 GLU A CA    1 
ATOM   1300 C  C     . GLU A 1 167 ? -19.979 60.333  8.595    1.00 123.56 ?  167 GLU A C     1 
ATOM   1301 O  O     . GLU A 1 167 ? -19.100 60.144  9.440    1.00 125.82 ?  167 GLU A O     1 
ATOM   1302 C  CB    . GLU A 1 167 ? -22.071 60.163  9.966    1.00 129.42 ?  167 GLU A CB    1 
ATOM   1303 C  CG    . GLU A 1 167 ? -23.581 60.226  9.805    1.00 143.64 ?  167 GLU A CG    1 
ATOM   1304 C  CD    . GLU A 1 167 ? -24.380 60.634  11.032   1.00 169.53 ?  167 GLU A CD    1 
ATOM   1305 O  OE1   . GLU A 1 167 ? -23.791 61.209  11.977   1.00 167.67 ?  167 GLU A OE1   1 
ATOM   1306 O  OE2   . GLU A 1 167 ? -25.608 60.388  11.041   1.00 168.19 -1 167 GLU A OE2   1 
ATOM   1307 N  N     . VAL A 1 168 ? -19.806 61.105  7.518    1.00 115.09 ?  168 VAL A N     1 
ATOM   1308 C  CA    . VAL A 1 168 ? -18.575 61.846  7.235    1.00 112.65 ?  168 VAL A CA    1 
ATOM   1309 C  C     . VAL A 1 168 ? -18.835 63.340  7.403    1.00 116.14 ?  168 VAL A C     1 
ATOM   1310 O  O     . VAL A 1 168 ? -19.844 63.858  6.918    1.00 114.68 ?  168 VAL A O     1 
ATOM   1311 C  CB    . VAL A 1 168 ? -17.986 61.515  5.835    1.00 111.72 ?  168 VAL A CB    1 
ATOM   1312 C  CG1   . VAL A 1 168 ? -16.673 62.261  5.585    1.00 110.38 ?  168 VAL A CG1   1 
ATOM   1313 C  CG2   . VAL A 1 168 ? -17.786 60.014  5.666    1.00 111.13 ?  168 VAL A CG2   1 
ATOM   1314 N  N     . LYS A 1 169 ? -17.928 64.018  8.108    1.00 114.76 ?  169 LYS A N     1 
ATOM   1315 C  CA    . LYS A 1 169 ? -17.987 65.453  8.348    1.00 116.26 ?  169 LYS A CA    1 
ATOM   1316 C  C     . LYS A 1 169 ? -16.621 66.031  8.012    1.00 119.25 ?  169 LYS A C     1 
ATOM   1317 O  O     . LYS A 1 169 ? -15.627 65.695  8.663    1.00 120.95 ?  169 LYS A O     1 
ATOM   1318 C  CB    . LYS A 1 169 ? -18.390 65.753  9.802    1.00 124.27 ?  169 LYS A CB    1 
ATOM   1319 C  CG    . LYS A 1 169 ? -19.889 65.652  10.050   1.00 138.69 ?  169 LYS A CG    1 
ATOM   1320 C  CD    . LYS A 1 169 ? -20.239 65.871  11.517   1.00 152.53 ?  169 LYS A CD    1 
ATOM   1321 C  CE    . LYS A 1 169 ? -21.722 65.783  11.795   1.00 159.06 ?  169 LYS A CE    1 
ATOM   1322 N  NZ    . LYS A 1 169 ? -22.237 64.387  11.741   1.00 164.09 ?  169 LYS A NZ    1 
ATOM   1323 N  N     . SER A 1 170 ? -16.560 66.836  6.947    1.00 112.68 ?  170 SER A N     1 
ATOM   1324 C  CA    . SER A 1 170 ? -15.312 67.454  6.513    1.00 111.75 ?  170 SER A CA    1 
ATOM   1325 C  C     . SER A 1 170 ? -15.281 68.921  6.911    1.00 118.74 ?  170 SER A C     1 
ATOM   1326 O  O     . SER A 1 170 ? -16.293 69.618  6.788    1.00 118.74 ?  170 SER A O     1 
ATOM   1327 C  CB    . SER A 1 170 ? -15.119 67.282  5.014    1.00 110.86 ?  170 SER A CB    1 
ATOM   1328 O  OG    . SER A 1 170 ? -15.056 65.907  4.677    1.00 118.42 ?  170 SER A OG    1 
ATOM   1329 N  N     . TYR A 1 171 ? -14.123 69.375  7.417    1.00 117.80 ?  171 TYR A N     1 
ATOM   1330 C  CA    . TYR A 1 171 ? -13.924 70.734  7.914    1.00 121.57 ?  171 TYR A CA    1 
ATOM   1331 C  C     . TYR A 1 171 ? -12.702 71.415  7.319    1.00 125.92 ?  171 TYR A C     1 
ATOM   1332 O  O     . TYR A 1 171 ? -11.744 70.749  6.931    1.00 123.60 ?  171 TYR A O     1 
ATOM   1333 C  CB    . TYR A 1 171 ? -13.751 70.714  9.445    1.00 128.03 ?  171 TYR A CB    1 
ATOM   1334 C  CG    . TYR A 1 171 ? -14.872 70.054  10.215   1.00 131.16 ?  171 TYR A CG    1 
ATOM   1335 C  CD1   . TYR A 1 171 ? -14.863 68.684  10.465   1.00 130.79 ?  171 TYR A CD1   1 
ATOM   1336 C  CD2   . TYR A 1 171 ? -15.911 70.807  10.754   1.00 136.29 ?  171 TYR A CD2   1 
ATOM   1337 C  CE1   . TYR A 1 171 ? -15.881 68.073  11.194   1.00 133.67 ?  171 TYR A CE1   1 
ATOM   1338 C  CE2   . TYR A 1 171 ? -16.935 70.209  11.485   1.00 138.93 ?  171 TYR A CE2   1 
ATOM   1339 C  CZ    . TYR A 1 171 ? -16.917 68.840  11.702   1.00 143.39 ?  171 TYR A CZ    1 
ATOM   1340 O  OH    . TYR A 1 171 ? -17.915 68.241  12.430   1.00 145.69 ?  171 TYR A OH    1 
ATOM   1341 N  N     . VAL A 1 172 ? -12.725 72.756  7.299    1.00 125.91 ?  172 VAL A N     1 
ATOM   1342 C  CA    . VAL A 1 172 ? -11.618 73.624  6.890    1.00 127.28 ?  172 VAL A CA    1 
ATOM   1343 C  C     . VAL A 1 172 ? -11.507 74.653  8.030    1.00 137.29 ?  172 VAL A C     1 
ATOM   1344 O  O     . VAL A 1 172 ? -12.392 75.502  8.161    1.00 139.01 ?  172 VAL A O     1 
ATOM   1345 C  CB    . VAL A 1 172 ? -11.823 74.292  5.496    1.00 128.67 ?  172 VAL A CB    1 
ATOM   1346 C  CG1   . VAL A 1 172 ? -10.714 75.297  5.203    1.00 131.00 ?  172 VAL A CG1   1 
ATOM   1347 C  CG2   . VAL A 1 172 ? -11.902 73.249  4.385    1.00 122.89 ?  172 VAL A CG2   1 
ATOM   1348 N  N     . LYS A 1 173 ? -10.439 74.551  8.807    1.00 136.61 ?  173 LYS A N     1 
ATOM   1349 C  CA    . LYS A 1 173 ? -10.335 75.316  10.011   1.00 142.66 ?  173 LYS A CA    1 
ATOM   1350 C  C     . LYS A 1 173 ? -11.197 74.525  10.933   1.00 148.99 ?  173 LYS A C     1 
ATOM   1351 O  O     . LYS A 1 173 ? -11.083 73.312  11.033   1.00 152.43 ?  173 LYS A O     1 
ATOM   1352 C  CB    . LYS A 1 173 ? -10.994 76.665  9.800    1.00 147.83 ?  173 LYS A CB    1 
ATOM   1353 C  CG    . LYS A 1 173 ? -10.371 77.497  8.714    1.00 156.75 ?  173 LYS A CG    1 
ATOM   1354 C  CD    . LYS A 1 173 ? -8.945  77.873  9.048    1.00 164.15 ?  173 LYS A CD    1 
ATOM   1355 C  CE    . LYS A 1 173 ? -8.378  78.764  7.976    1.00 170.48 ?  173 LYS A CE    1 
ATOM   1356 N  NZ    . LYS A 1 173 ? -6.974  79.108  8.300    1.00 176.28 ?  173 LYS A NZ    1 
ATOM   1357 N  N     . HIS A 1 174 ? -12.099 75.230  11.581   1.00 143.62 ?  174 HIS A N     1 
ATOM   1358 C  CA    . HIS A 1 174 ? -13.205 74.608  12.242   1.00 145.30 ?  174 HIS A CA    1 
ATOM   1359 C  C     . HIS A 1 174 ? -14.376 75.213  11.527   1.00 147.60 ?  174 HIS A C     1 
ATOM   1360 O  O     . HIS A 1 174 ? -14.912 76.227  11.944   1.00 150.01 ?  174 HIS A O     1 
ATOM   1361 C  CB    . HIS A 1 174 ? -13.236 74.982  13.714   1.00 148.55 ?  174 HIS A CB    1 
ATOM   1362 C  CG    . HIS A 1 174 ? -11.946 74.731  14.426   1.00 152.65 ?  174 HIS A CG    1 
ATOM   1363 N  ND1   . HIS A 1 174 ? -11.077 75.742  14.767   1.00 155.68 ?  174 HIS A ND1   1 
ATOM   1364 C  CD2   . HIS A 1 174 ? -11.377 73.583  14.860   1.00 153.95 ?  174 HIS A CD2   1 
ATOM   1365 C  CE1   . HIS A 1 174 ? -10.025 75.227  15.376   1.00 156.31 ?  174 HIS A CE1   1 
ATOM   1366 N  NE2   . HIS A 1 174 ? -10.183 73.919  15.447   1.00 155.61 ?  174 HIS A NE2   1 
ATOM   1367 N  N     . THR A 1 175 ? -14.746 74.621  10.408   1.00 138.02 ?  175 THR A N     1 
ATOM   1368 C  CA    . THR A 1 175 ? -15.890 75.143  9.660    1.00 135.84 ?  175 THR A CA    1 
ATOM   1369 C  C     . THR A 1 175 ? -16.368 73.983  8.784    1.00 133.45 ?  175 THR A C     1 
ATOM   1370 O  O     . THR A 1 175 ? -15.638 73.564  7.881    1.00 129.14 ?  175 THR A O     1 
ATOM   1371 C  CB    . THR A 1 175 ? -15.482 76.358  8.803    1.00 142.62 ?  175 THR A CB    1 
ATOM   1372 O  OG1   . THR A 1 175 ? -14.815 77.321  9.619    1.00 148.47 ?  175 THR A OG1   1 
ATOM   1373 C  CG2   . THR A 1 175 ? -16.666 77.000  8.085    1.00 139.65 ?  175 THR A CG2   1 
ATOM   1374 N  N     . LEU A 1 176 ? -17.568 73.444  9.072    1.00 129.79 ?  176 LEU A N     1 
ATOM   1375 C  CA    . LEU A 1 176 ? -18.142 72.333  8.312    1.00 124.95 ?  176 LEU A CA    1 
ATOM   1376 C  C     . LEU A 1 176 ? -18.395 72.771  6.875    1.00 125.95 ?  176 LEU A C     1 
ATOM   1377 O  O     . LEU A 1 176 ? -19.134 73.729  6.636    1.00 127.23 ?  176 LEU A O     1 
ATOM   1378 C  CB    . LEU A 1 176 ? -19.424 71.791  8.972    1.00 126.44 ?  176 LEU A CB    1 
ATOM   1379 C  CG    . LEU A 1 176 ? -20.028 70.524  8.355    1.00 126.62 ?  176 LEU A CG    1 
ATOM   1380 C  CD1   . LEU A 1 176 ? -19.310 69.271  8.837    1.00 126.44 ?  176 LEU A CD1   1 
ATOM   1381 C  CD2   . LEU A 1 176 ? -21.498 70.424  8.669    1.00 130.26 ?  176 LEU A CD2   1 
ATOM   1382 N  N     . VAL A 1 177 ? -17.715 72.105  5.935    1.00 118.06 ?  177 VAL A N     1 
ATOM   1383 C  CA    . VAL A 1 177 ? -17.782 72.398  4.502    1.00 114.15 ?  177 VAL A CA    1 
ATOM   1384 C  C     . VAL A 1 177 ? -18.490 71.282  3.725    1.00 114.29 ?  177 VAL A C     1 
ATOM   1385 O  O     . VAL A 1 177 ? -19.033 71.523  2.641    1.00 111.43 ?  177 VAL A O     1 
ATOM   1386 C  CB    . VAL A 1 177 ? -16.378 72.716  3.913    1.00 116.76 ?  177 VAL A CB    1 
ATOM   1387 C  CG1   . VAL A 1 177 ? -15.834 74.034  4.454    1.00 121.07 ?  177 VAL A CG1   1 
ATOM   1388 C  CG2   . VAL A 1 177 ? -15.386 71.579  4.159    1.00 115.06 ?  177 VAL A CG2   1 
ATOM   1389 N  N     . PHE A 1 178 ? -18.470 70.061  4.285    1.00 110.57 ?  178 PHE A N     1 
ATOM   1390 C  CA    . PHE A 1 178 ? -19.045 68.873  3.673    1.00 107.01 ?  178 PHE A CA    1 
ATOM   1391 C  C     . PHE A 1 178 ? -19.607 67.925  4.724    1.00 113.09 ?  178 PHE A C     1 
ATOM   1392 O  O     . PHE A 1 178 ? -19.006 67.730  5.783    1.00 115.27 ?  178 PHE A O     1 
ATOM   1393 C  CB    . PHE A 1 178 ? -17.971 68.166  2.827    1.00 105.23 ?  178 PHE A CB    1 
ATOM   1394 C  CG    . PHE A 1 178 ? -18.376 66.872  2.162    1.00 103.58 ?  178 PHE A CG    1 
ATOM   1395 C  CD1   . PHE A 1 178 ? -18.256 65.657  2.832    1.00 106.25 ?  178 PHE A CD1   1 
ATOM   1396 C  CD2   . PHE A 1 178 ? -18.829 66.861  0.849    1.00 103.39 ?  178 PHE A CD2   1 
ATOM   1397 C  CE1   . PHE A 1 178 ? -18.632 64.462  2.218    1.00 106.60 ?  178 PHE A CE1   1 
ATOM   1398 C  CE2   . PHE A 1 178 ? -19.189 65.662  0.229    1.00 101.69 ?  178 PHE A CE2   1 
ATOM   1399 C  CZ    . PHE A 1 178 ? -19.081 64.471  0.917    1.00 101.51 ?  178 PHE A CZ    1 
ATOM   1400 N  N     . LYS A 1 179 ? -20.742 67.304  4.392    1.00 108.85 ?  179 LYS A N     1 
ATOM   1401 C  CA    . LYS A 1 179 ? -21.433 66.313  5.210    1.00 110.79 ?  179 LYS A CA    1 
ATOM   1402 C  C     . LYS A 1 179 ? -21.876 65.199  4.271    1.00 112.22 ?  179 LYS A C     1 
ATOM   1403 O  O     . LYS A 1 179 ? -22.393 65.472  3.184    1.00 108.94 ?  179 LYS A O     1 
ATOM   1404 C  CB    . LYS A 1 179 ? -22.639 66.937  5.932    1.00 116.37 ?  179 LYS A CB    1 
ATOM   1405 C  CG    . LYS A 1 179 ? -23.080 66.183  7.176    1.00 126.88 ?  179 LYS A CG    1 
ATOM   1406 C  CD    . LYS A 1 179 ? -24.160 66.945  7.930    1.00 138.17 ?  179 LYS A CD    1 
ATOM   1407 C  CE    . LYS A 1 179 ? -25.535 66.370  7.696    1.00 145.10 ?  179 LYS A CE    1 
ATOM   1408 N  NZ    . LYS A 1 179 ? -26.596 67.231  8.276    1.00 155.40 ?  179 LYS A NZ    1 
ATOM   1409 N  N     . GLY A 1 180 ? -21.632 63.962  4.682    1.00 110.04 ?  180 GLY A N     1 
ATOM   1410 C  CA    . GLY A 1 180 ? -21.984 62.791  3.894    1.00 107.73 ?  180 GLY A CA    1 
ATOM   1411 C  C     . GLY A 1 180 ? -22.424 61.601  4.716    1.00 115.16 ?  180 GLY A C     1 
ATOM   1412 O  O     . GLY A 1 180 ? -21.886 61.346  5.796    1.00 117.93 ?  180 GLY A O     1 
ATOM   1413 N  N     . ASN A 1 181 ? -23.425 60.879  4.208    1.00 111.37 ?  181 ASN A N     1 
ATOM   1414 C  CA    . ASN A 1 181 ? -23.940 59.656  4.817    1.00 114.21 ?  181 ASN A CA    1 
ATOM   1415 C  C     . ASN A 1 181 ? -23.642 58.520  3.851    1.00 115.26 ?  181 ASN A C     1 
ATOM   1416 O  O     . ASN A 1 181 ? -23.960 58.628  2.666    1.00 111.99 ?  181 ASN A O     1 
ATOM   1417 C  CB    . ASN A 1 181 ? -25.430 59.782  5.119    1.00 118.13 ?  181 ASN A CB    1 
ATOM   1418 C  CG    . ASN A 1 181 ? -25.716 60.790  6.203    1.00 146.70 ?  181 ASN A CG    1 
ATOM   1419 O  OD1   . ASN A 1 181 ? -25.823 60.454  7.387    1.00 144.60 ?  181 ASN A OD1   1 
ATOM   1420 N  ND2   . ASN A 1 181 ? -25.825 62.055  5.826    1.00 138.57 ?  181 ASN A ND2   1 
ATOM   1421 N  N     . PHE A 1 182 ? -22.974 57.465  4.336    1.00 112.88 ?  182 PHE A N     1 
ATOM   1422 C  CA    . PHE A 1 182 ? -22.538 56.353  3.499    1.00 110.67 ?  182 PHE A CA    1 
ATOM   1423 C  C     . PHE A 1 182 ? -23.097 55.006  3.914    1.00 117.72 ?  182 PHE A C     1 
ATOM   1424 O  O     . PHE A 1 182 ? -23.095 54.670  5.098    1.00 121.33 ?  182 PHE A O     1 
ATOM   1425 C  CB    . PHE A 1 182 ? -21.000 56.305  3.453    1.00 110.98 ?  182 PHE A CB    1 
ATOM   1426 C  CG    . PHE A 1 182 ? -20.364 57.403  2.637    1.00 108.58 ?  182 PHE A CG    1 
ATOM   1427 C  CD1   . PHE A 1 182 ? -20.240 58.691  3.148    1.00 111.36 ?  182 PHE A CD1   1 
ATOM   1428 C  CD2   . PHE A 1 182 ? -19.875 57.148  1.364    1.00 108.01 ?  182 PHE A CD2   1 
ATOM   1429 C  CE1   . PHE A 1 182 ? -19.664 59.710  2.385    1.00 111.22 ?  182 PHE A CE1   1 
ATOM   1430 C  CE2   . PHE A 1 182 ? -19.280 58.162  0.610    1.00 105.89 ?  182 PHE A CE2   1 
ATOM   1431 C  CZ    . PHE A 1 182 ? -19.184 59.437  1.123    1.00 105.69 ?  182 PHE A CZ    1 
ATOM   1432 N  N     . LYS A 1 183 ? -23.563 54.231  2.922    1.00 113.00 ?  183 LYS A N     1 
ATOM   1433 C  CA    . LYS A 1 183 ? -24.083 52.878  3.104    1.00 116.40 ?  183 LYS A CA    1 
ATOM   1434 C  C     . LYS A 1 183 ? -23.054 51.936  2.479    1.00 120.24 ?  183 LYS A C     1 
ATOM   1435 O  O     . LYS A 1 183 ? -23.020 51.750  1.261    1.00 116.12 ?  183 LYS A O     1 
ATOM   1436 C  CB    . LYS A 1 183 ? -25.485 52.734  2.477    1.00 118.75 ?  183 LYS A CB    1 
ATOM   1437 C  CG    . LYS A 1 183 ? -26.155 51.388  2.728    1.00 128.89 ?  183 LYS A CG    1 
ATOM   1438 C  CD    . LYS A 1 183 ? -27.571 51.354  2.186    1.00 135.49 ?  183 LYS A CD    1 
ATOM   1439 C  CE    . LYS A 1 183 ? -28.255 50.045  2.482    1.00 149.87 ?  183 LYS A CE    1 
ATOM   1440 N  NZ    . LYS A 1 183 ? -29.709 50.102  2.174    1.00 161.44 ?  183 LYS A NZ    1 
HETATM 1441 N  N     . MSE A 1 184 ? -22.172 51.400  3.322    1.00 121.31 ?  184 MSE A N     1 
HETATM 1442 C  CA    . MSE A 1 184 ? -21.081 50.533  2.895    1.00 121.52 ?  184 MSE A CA    1 
HETATM 1443 C  C     . MSE A 1 184 ? -21.442 49.071  3.053    1.00 130.72 ?  184 MSE A C     1 
HETATM 1444 O  O     . MSE A 1 184 ? -21.725 48.625  4.163    1.00 135.57 ?  184 MSE A O     1 
HETATM 1445 C  CB    . MSE A 1 184 ? -19.796 50.846  3.684    1.00 125.04 ?  184 MSE A CB    1 
HETATM 1446 C  CG    . MSE A 1 184 ? -19.492 52.336  3.818    1.00 130.63 ?  184 MSE A CG    1 
HETATM 1447 SE SE    . MSE A 1 184 ? -19.123 53.210  2.121    1.00 133.08 ?  184 MSE A SE    1 
HETATM 1448 C  CE    . MSE A 1 184 ? -17.424 52.297  1.677    1.00 129.01 ?  184 MSE A CE    1 
ATOM   1449 N  N     . PHE A 1 185 ? -21.428 48.321  1.950    1.00 126.44 ?  185 PHE A N     1 
ATOM   1450 C  CA    . PHE A 1 185 ? -21.691 46.888  1.973    1.00 130.82 ?  185 PHE A CA    1 
ATOM   1451 C  C     . PHE A 1 185 ? -20.418 46.175  2.420    1.00 137.57 ?  185 PHE A C     1 
ATOM   1452 O  O     . PHE A 1 185 ? -19.330 46.530  1.966    1.00 134.08 ?  185 PHE A O     1 
ATOM   1453 C  CB    . PHE A 1 185 ? -22.140 46.382  0.590    1.00 130.56 ?  185 PHE A CB    1 
ATOM   1454 C  CG    . PHE A 1 185 ? -22.023 44.887  0.387    1.00 136.07 ?  185 PHE A CG    1 
ATOM   1455 C  CD1   . PHE A 1 185 ? -22.945 44.016  0.955    1.00 145.07 ?  185 PHE A CD1   1 
ATOM   1456 C  CD2   . PHE A 1 185 ? -20.980 44.349  -0.359   1.00 136.79 ?  185 PHE A CD2   1 
ATOM   1457 C  CE1   . PHE A 1 185 ? -22.820 42.633  0.787    1.00 150.09 ?  185 PHE A CE1   1 
ATOM   1458 C  CE2   . PHE A 1 185 ? -20.856 42.966  -0.527   1.00 143.77 ?  185 PHE A CE2   1 
ATOM   1459 C  CZ    . PHE A 1 185 ? -21.778 42.118  0.045    1.00 147.55 ?  185 PHE A CZ    1 
ATOM   1460 N  N     . TYR A 1 186 ? -20.555 45.169  3.292    1.00 140.63 ?  186 TYR A N     1 
ATOM   1461 C  CA    . TYR A 1 186 ? -19.416 44.400  3.782    1.00 143.85 ?  186 TYR A CA    1 
ATOM   1462 C  C     . TYR A 1 186 ? -19.656 42.899  3.705    1.00 154.36 ?  186 TYR A C     1 
ATOM   1463 O  O     . TYR A 1 186 ? -20.789 42.441  3.891    1.00 157.74 ?  186 TYR A O     1 
ATOM   1464 C  CB    . TYR A 1 186 ? -19.003 44.854  5.196    1.00 148.12 ?  186 TYR A CB    1 
ATOM   1465 C  CG    . TYR A 1 186 ? -19.840 44.294  6.330    1.00 156.72 ?  186 TYR A CG    1 
ATOM   1466 C  CD1   . TYR A 1 186 ? -21.124 44.772  6.577    1.00 158.20 ?  186 TYR A CD1   1 
ATOM   1467 C  CD2   . TYR A 1 186 ? -19.338 43.307  7.171    1.00 164.71 ?  186 TYR A CD2   1 
ATOM   1468 C  CE1   . TYR A 1 186 ? -21.890 44.274  7.629    1.00 165.62 ?  186 TYR A CE1   1 
ATOM   1469 C  CE2   . TYR A 1 186 ? -20.095 42.801  8.226    1.00 169.69 ?  186 TYR A CE2   1 
ATOM   1470 C  CZ    . TYR A 1 186 ? -21.372 43.288  8.451    1.00 172.86 ?  186 TYR A CZ    1 
ATOM   1471 O  OH    . TYR A 1 186 ? -22.122 42.789  9.490    1.00 175.37 ?  186 TYR A OH    1 
ATOM   1472 N  N     . ASP A 1 187 ? -18.585 42.137  3.426    1.00 152.58 ?  187 ASP A N     1 
ATOM   1473 C  CA    . ASP A 1 187 ? -18.633 40.680  3.326    1.00 158.01 ?  187 ASP A CA    1 
ATOM   1474 C  C     . ASP A 1 187 ? -17.369 40.056  3.915    1.00 165.38 ?  187 ASP A C     1 
ATOM   1475 O  O     . ASP A 1 187 ? -16.256 40.457  3.557    1.00 161.27 ?  187 ASP A O     1 
ATOM   1476 C  CB    . ASP A 1 187 ? -18.877 40.233  1.869    1.00 157.32 ?  187 ASP A CB    1 
ATOM   1477 C  CG    . ASP A 1 187 ? -19.034 38.737  1.645    1.00 173.94 ?  187 ASP A CG    1 
ATOM   1478 O  OD1   . ASP A 1 187 ? -19.567 38.046  2.552    1.00 184.96 -1 187 ASP A OD1   1 
ATOM   1479 O  OD2   . ASP A 1 187 ? -18.653 38.260  0.554    1.00 172.77 ?  187 ASP A OD2   1 
ATOM   1480 N  N     . LYS A 1 188 ? -17.565 39.072  4.824    1.00 168.96 ?  188 LYS A N     1 
ATOM   1481 C  CA    . LYS A 1 188 ? -16.537 38.319  5.561    1.00 173.67 ?  188 LYS A CA    1 
ATOM   1482 C  C     . LYS A 1 188 ? -15.670 37.429  4.652    1.00 178.30 ?  188 LYS A C     1 
ATOM   1483 O  O     . LYS A 1 188 ? -14.561 37.053  5.040    1.00 179.93 ?  188 LYS A O     1 
ATOM   1484 C  CB    . LYS A 1 188 ? -17.188 37.457  6.665    1.00 178.16 ?  188 LYS A CB    1 
ATOM   1485 C  CG    . LYS A 1 188 ? -18.148 38.202  7.601    1.00 183.65 ?  188 LYS A CG    1 
ATOM   1486 C  CD    . LYS A 1 188 ? -17.484 38.666  8.892    1.00 186.76 ?  188 LYS A CD    1 
ATOM   1487 C  CE    . LYS A 1 188 ? -18.476 39.315  9.827    1.00 188.79 ?  188 LYS A CE    1 
ATOM   1488 N  NZ    . LYS A 1 188 ? -17.822 39.826  11.059   1.00 191.64 ?  188 LYS A NZ    1 
ATOM   1489 N  N     . ARG A 1 189 ? -16.192 37.075  3.462    1.00 173.19 ?  189 ARG A N     1 
ATOM   1490 C  CA    . ARG A 1 189 ? -15.522 36.243  2.460    1.00 176.27 ?  189 ARG A CA    1 
ATOM   1491 C  C     . ARG A 1 189 ? -14.807 37.122  1.417    1.00 180.45 ?  189 ARG A C     1 
ATOM   1492 O  O     . ARG A 1 189 ? -13.621 36.852  1.128    1.00 183.16 ?  189 ARG A O     1 
ATOM   1493 C  CB    . ARG A 1 189 ? -16.545 35.305  1.787    1.00 179.13 ?  189 ARG A CB    1 
ATOM   1494 C  CG    . ARG A 1 189 ? -17.210 34.296  2.721    1.00 188.05 ?  189 ARG A CG    1 
ATOM   1495 C  CD    . ARG A 1 189 ? -16.232 33.274  3.273    1.00 196.87 ?  189 ARG A CD    1 
ATOM   1496 N  NE    . ARG A 1 189 ? -16.889 32.302  4.146    1.00 201.32 ?  189 ARG A NE    1 
ATOM   1497 C  CZ    . ARG A 1 189 ? -16.250 31.445  4.937    1.00 211.14 ?  189 ARG A CZ    1 
ATOM   1498 N  NH1   . ARG A 1 189 ? -14.923 31.429  4.978    1.00 202.16 ?  189 ARG A NH1   1 
ATOM   1499 N  NH2   . ARG A 1 189 ? -16.933 30.598  5.696    1.00 205.59 ?  189 ARG A NH2   1 
ATOM   1500 N  N     . GLY A 1 190 ? -15.425 38.082  0.902    1.00 192.44 ?  190 GLY A N     1 
ATOM   1501 N  N     . GLU B 1 4   ? 25.415  37.378  -24.288  1.00 108.24 ?  4   GLU B N     1 
ATOM   1502 C  CA    . GLU B 1 4   ? 25.341  38.839  -24.423  1.00 104.44 ?  4   GLU B CA    1 
ATOM   1503 C  C     . GLU B 1 4   ? 24.232  39.311  -25.400  1.00 102.82 ?  4   GLU B C     1 
ATOM   1504 O  O     . GLU B 1 4   ? 24.343  40.382  -26.001  1.00 98.92  ?  4   GLU B O     1 
ATOM   1505 C  CB    . GLU B 1 4   ? 26.704  39.393  -24.833  1.00 105.15 ?  4   GLU B CB    1 
ATOM   1506 N  N     . THR B 1 5   ? 23.151  38.516  -25.515  1.00 99.46  ?  5   THR B N     1 
ATOM   1507 C  CA    . THR B 1 5   ? 22.009  38.758  -26.407  1.00 96.10  ?  5   THR B CA    1 
ATOM   1508 C  C     . THR B 1 5   ? 21.205  40.027  -26.132  1.00 95.13  ?  5   THR B C     1 
ATOM   1509 O  O     . THR B 1 5   ? 20.978  40.392  -24.978  1.00 95.50  ?  5   THR B O     1 
ATOM   1510 C  CB    . THR B 1 5   ? 21.129  37.497  -26.573  1.00 109.37 ?  5   THR B CB    1 
ATOM   1511 O  OG1   . THR B 1 5   ? 20.067  37.789  -27.485  1.00 109.08 ?  5   THR B OG1   1 
ATOM   1512 C  CG2   . THR B 1 5   ? 20.552  36.980  -25.247  1.00 110.60 ?  5   THR B CG2   1 
ATOM   1513 N  N     . LEU B 1 6   ? 20.756  40.672  -27.216  1.00 87.10  ?  6   LEU B N     1 
ATOM   1514 C  CA    . LEU B 1 6   ? 19.952  41.881  -27.181  1.00 83.46  ?  6   LEU B CA    1 
ATOM   1515 C  C     . LEU B 1 6   ? 18.503  41.483  -27.387  1.00 87.71  ?  6   LEU B C     1 
ATOM   1516 O  O     . LEU B 1 6   ? 18.042  41.327  -28.521  1.00 86.08  ?  6   LEU B O     1 
ATOM   1517 C  CB    . LEU B 1 6   ? 20.419  42.874  -28.244  1.00 79.99  ?  6   LEU B CB    1 
ATOM   1518 C  CG    . LEU B 1 6   ? 20.566  44.296  -27.760  1.00 82.94  ?  6   LEU B CG    1 
ATOM   1519 C  CD1   . LEU B 1 6   ? 21.518  45.052  -28.636  1.00 81.36  ?  6   LEU B CD1   1 
ATOM   1520 C  CD2   . LEU B 1 6   ? 19.215  45.001  -27.662  1.00 84.53  ?  6   LEU B CD2   1 
ATOM   1521 N  N     . LYS B 1 7   ? 17.809  41.275  -26.259  1.00 86.30  ?  7   LYS B N     1 
ATOM   1522 C  CA    . LYS B 1 7   ? 16.425  40.829  -26.105  1.00 86.59  ?  7   LYS B CA    1 
ATOM   1523 C  C     . LYS B 1 7   ? 15.437  41.329  -27.164  1.00 87.98  ?  7   LYS B C     1 
ATOM   1524 O  O     . LYS B 1 7   ? 14.564  40.555  -27.575  1.00 88.07  ?  7   LYS B O     1 
ATOM   1525 C  CB    . LYS B 1 7   ? 15.927  41.130  -24.675  1.00 89.95  ?  7   LYS B CB    1 
ATOM   1526 C  CG    . LYS B 1 7   ? 15.022  40.063  -24.059  1.00 103.61 ?  7   LYS B CG    1 
ATOM   1527 C  CD    . LYS B 1 7   ? 15.772  38.830  -23.553  1.00 116.58 ?  7   LYS B CD    1 
ATOM   1528 C  CE    . LYS B 1 7   ? 14.813  37.776  -23.049  1.00 131.67 ?  7   LYS B CE    1 
ATOM   1529 N  NZ    . LYS B 1 7   ? 15.479  36.469  -22.805  1.00 144.18 ?  7   LYS B NZ    1 
ATOM   1530 N  N     . LEU B 1 8   ? 15.586  42.597  -27.616  1.00 81.38  ?  8   LEU B N     1 
ATOM   1531 C  CA    . LEU B 1 8   ? 14.685  43.184  -28.606  1.00 78.82  ?  8   LEU B CA    1 
ATOM   1532 C  C     . LEU B 1 8   ? 15.193  43.138  -30.053  1.00 80.41  ?  8   LEU B C     1 
ATOM   1533 O  O     . LEU B 1 8   ? 16.235  43.717  -30.375  1.00 79.35  ?  8   LEU B O     1 
ATOM   1534 C  CB    . LEU B 1 8   ? 14.283  44.625  -28.224  1.00 77.33  ?  8   LEU B CB    1 
ATOM   1535 C  CG    . LEU B 1 8   ? 13.447  44.823  -26.962  1.00 83.44  ?  8   LEU B CG    1 
ATOM   1536 C  CD1   . LEU B 1 8   ? 13.429  46.283  -26.552  1.00 82.29  ?  8   LEU B CD1   1 
ATOM   1537 C  CD2   . LEU B 1 8   ? 12.027  44.331  -27.154  1.00 87.16  ?  8   LEU B CD2   1 
ATOM   1538 N  N     . LYS B 1 9   ? 14.429  42.467  -30.933  1.00 75.57  ?  9   LYS B N     1 
ATOM   1539 C  CA    . LYS B 1 9   ? 14.730  42.384  -32.366  1.00 72.99  ?  9   LYS B CA    1 
ATOM   1540 C  C     . LYS B 1 9   ? 14.212  43.660  -33.066  1.00 71.84  ?  9   LYS B C     1 
ATOM   1541 O  O     . LYS B 1 9   ? 13.442  44.412  -32.466  1.00 70.66  ?  9   LYS B O     1 
ATOM   1542 C  CB    . LYS B 1 9   ? 14.119  41.109  -32.998  1.00 76.99  ?  9   LYS B CB    1 
ATOM   1543 C  CG    . LYS B 1 9   ? 14.561  39.777  -32.359  1.00 95.49  ?  9   LYS B CG    1 
ATOM   1544 C  CD    . LYS B 1 9   ? 15.508  38.862  -33.208  1.00 109.57 ?  9   LYS B CD    1 
ATOM   1545 C  CE    . LYS B 1 9   ? 14.831  38.067  -34.300  1.00 125.37 ?  9   LYS B CE    1 
ATOM   1546 N  NZ    . LYS B 1 9   ? 15.831  37.386  -35.162  1.00 135.76 ?  9   LYS B NZ    1 
ATOM   1547 N  N     . LYS B 1 10  ? 14.648  43.904  -34.318  1.00 65.99  ?  10  LYS B N     1 
ATOM   1548 C  CA    . LYS B 1 10  ? 14.298  45.069  -35.150  1.00 63.57  ?  10  LYS B CA    1 
ATOM   1549 C  C     . LYS B 1 10  ? 12.842  45.566  -34.990  1.00 67.51  ?  10  LYS B C     1 
ATOM   1550 O  O     . LYS B 1 10  ? 12.644  46.698  -34.554  1.00 66.23  ?  10  LYS B O     1 
ATOM   1551 C  CB    . LYS B 1 10  ? 14.652  44.787  -36.627  1.00 64.88  ?  10  LYS B CB    1 
ATOM   1552 C  CG    . LYS B 1 10  ? 14.316  45.889  -37.631  1.00 64.70  ?  10  LYS B CG    1 
ATOM   1553 C  CD    . LYS B 1 10  ? 14.470  45.366  -39.049  1.00 72.58  ?  10  LYS B CD    1 
ATOM   1554 C  CE    . LYS B 1 10  ? 13.258  45.600  -39.916  1.00 89.04  ?  10  LYS B CE    1 
ATOM   1555 N  NZ    . LYS B 1 10  ? 13.626  46.315  -41.165  1.00 103.66 ?  10  LYS B NZ    1 
ATOM   1556 N  N     . ASP B 1 11  ? 11.846  44.722  -35.301  1.00 65.77  ?  11  ASP B N     1 
ATOM   1557 C  CA    . ASP B 1 11  ? 10.433  45.090  -35.204  1.00 66.41  ?  11  ASP B CA    1 
ATOM   1558 C  C     . ASP B 1 11  ? 9.960   45.394  -33.782  1.00 71.49  ?  11  ASP B C     1 
ATOM   1559 O  O     . ASP B 1 11  ? 9.244   46.378  -33.584  1.00 71.02  ?  11  ASP B O     1 
ATOM   1560 C  CB    . ASP B 1 11  ? 9.540   44.040  -35.886  1.00 70.15  ?  11  ASP B CB    1 
ATOM   1561 C  CG    . ASP B 1 11  ? 9.533   44.084  -37.414  1.00 83.48  ?  11  ASP B CG    1 
ATOM   1562 O  OD1   . ASP B 1 11  ? 10.002  45.104  -37.994  1.00 82.07  ?  11  ASP B OD1   1 
ATOM   1563 O  OD2   . ASP B 1 11  ? 9.020   43.123  -38.032  1.00 91.65  -1 11  ASP B OD2   1 
ATOM   1564 N  N     . LYS B 1 12  ? 10.370  44.563  -32.800  1.00 69.23  ?  12  LYS B N     1 
ATOM   1565 C  CA    . LYS B 1 12  ? 10.012  44.721  -31.383  1.00 69.82  ?  12  LYS B CA    1 
ATOM   1566 C  C     . LYS B 1 12  ? 10.603  46.000  -30.788  1.00 70.76  ?  12  LYS B C     1 
ATOM   1567 O  O     . LYS B 1 12  ? 9.913   46.689  -30.033  1.00 70.98  ?  12  LYS B O     1 
ATOM   1568 C  CB    . LYS B 1 12  ? 10.435  43.496  -30.561  1.00 74.79  ?  12  LYS B CB    1 
ATOM   1569 C  CG    . LYS B 1 12  ? 9.604   42.254  -30.850  1.00 98.94  ?  12  LYS B CG    1 
ATOM   1570 C  CD    . LYS B 1 12  ? 9.181   41.542  -29.574  1.00 114.04 ?  12  LYS B CD    1 
ATOM   1571 C  CE    . LYS B 1 12  ? 8.276   40.370  -29.874  1.00 123.20 ?  12  LYS B CE    1 
ATOM   1572 N  NZ    . LYS B 1 12  ? 8.068   39.504  -28.682  1.00 132.22 ?  12  LYS B NZ    1 
ATOM   1573 N  N     . ARG B 1 13  ? 11.869  46.321  -31.147  1.00 64.30  ?  13  ARG B N     1 
ATOM   1574 C  CA    . ARG B 1 13  ? 12.588  47.514  -30.694  1.00 62.29  ?  13  ARG B CA    1 
ATOM   1575 C  C     . ARG B 1 13  ? 11.899  48.777  -31.203  1.00 63.35  ?  13  ARG B C     1 
ATOM   1576 O  O     . ARG B 1 13  ? 11.695  49.714  -30.432  1.00 62.92  ?  13  ARG B O     1 
ATOM   1577 C  CB    . ARG B 1 13  ? 14.055  47.486  -31.167  1.00 60.62  ?  13  ARG B CB    1 
ATOM   1578 C  CG    . ARG B 1 13  ? 14.904  48.616  -30.579  1.00 64.16  ?  13  ARG B CG    1 
ATOM   1579 C  CD    . ARG B 1 13  ? 16.232  48.874  -31.274  1.00 65.85  ?  13  ARG B CD    1 
ATOM   1580 N  NE    . ARG B 1 13  ? 16.124  49.073  -32.719  1.00 62.49  ?  13  ARG B NE    1 
ATOM   1581 C  CZ    . ARG B 1 13  ? 16.406  48.152  -33.635  1.00 72.08  ?  13  ARG B CZ    1 
ATOM   1582 N  NH1   . ARG B 1 13  ? 16.771  46.931  -33.271  1.00 60.26  ?  13  ARG B NH1   1 
ATOM   1583 N  NH2   . ARG B 1 13  ? 16.267  48.425  -34.921  1.00 58.76  ?  13  ARG B NH2   1 
ATOM   1584 N  N     . ARG B 1 14  ? 11.546  48.792  -32.498  1.00 58.15  ?  14  ARG B N     1 
ATOM   1585 C  CA    . ARG B 1 14  ? 10.877  49.916  -33.150  1.00 56.35  ?  14  ARG B CA    1 
ATOM   1586 C  C     . ARG B 1 14  ? 9.533   50.229  -32.494  1.00 62.28  ?  14  ARG B C     1 
ATOM   1587 O  O     . ARG B 1 14  ? 9.228   51.407  -32.295  1.00 62.21  ?  14  ARG B O     1 
ATOM   1588 C  CB    . ARG B 1 14  ? 10.744  49.676  -34.652  1.00 52.90  ?  14  ARG B CB    1 
ATOM   1589 C  CG    . ARG B 1 14  ? 12.050  49.905  -35.393  1.00 58.58  ?  14  ARG B CG    1 
ATOM   1590 C  CD    . ARG B 1 14  ? 11.981  49.402  -36.814  1.00 67.65  ?  14  ARG B CD    1 
ATOM   1591 N  NE    . ARG B 1 14  ? 13.156  49.786  -37.590  1.00 72.36  ?  14  ARG B NE    1 
ATOM   1592 C  CZ    . ARG B 1 14  ? 13.295  49.579  -38.895  1.00 90.36  ?  14  ARG B CZ    1 
ATOM   1593 N  NH1   . ARG B 1 14  ? 12.332  48.977  -39.587  1.00 79.05  ?  14  ARG B NH1   1 
ATOM   1594 N  NH2   . ARG B 1 14  ? 14.399  49.968  -39.521  1.00 77.36  ?  14  ARG B NH2   1 
ATOM   1595 N  N     . GLU B 1 15  ? 8.778   49.189  -32.065  1.00 59.79  ?  15  GLU B N     1 
ATOM   1596 C  CA    . GLU B 1 15  ? 7.513   49.417  -31.372  1.00 60.94  ?  15  GLU B CA    1 
ATOM   1597 C  C     . GLU B 1 15  ? 7.775   50.051  -30.021  1.00 64.57  ?  15  GLU B C     1 
ATOM   1598 O  O     . GLU B 1 15  ? 7.101   51.018  -29.665  1.00 64.54  ?  15  GLU B O     1 
ATOM   1599 C  CB    . GLU B 1 15  ? 6.669   48.135  -31.250  1.00 64.52  ?  15  GLU B CB    1 
ATOM   1600 C  CG    . GLU B 1 15  ? 5.286   48.321  -30.620  1.00 78.36  ?  15  GLU B CG    1 
ATOM   1601 C  CD    . GLU B 1 15  ? 4.363   49.433  -31.109  1.00 103.40 ?  15  GLU B CD    1 
ATOM   1602 O  OE1   . GLU B 1 15  ? 4.476   49.866  -32.282  1.00 95.65  -1 15  GLU B OE1   1 
ATOM   1603 O  OE2   . GLU B 1 15  ? 3.504   49.860  -30.304  1.00 99.84  ?  15  GLU B OE2   1 
ATOM   1604 N  N     . ALA B 1 16  ? 8.802   49.557  -29.309  1.00 61.26  ?  16  ALA B N     1 
ATOM   1605 C  CA    . ALA B 1 16  ? 9.209   50.086  -28.004  1.00 62.00  ?  16  ALA B CA    1 
ATOM   1606 C  C     . ALA B 1 16  ? 9.707   51.534  -28.124  1.00 63.76  ?  16  ALA B C     1 
ATOM   1607 O  O     . ALA B 1 16  ? 9.458   52.338  -27.225  1.00 64.87  ?  16  ALA B O     1 
ATOM   1608 C  CB    . ALA B 1 16  ? 10.279  49.200  -27.387  1.00 63.53  ?  16  ALA B CB    1 
ATOM   1609 N  N     . ILE B 1 17  ? 10.351  51.870  -29.254  1.00 56.96  ?  17  ILE B N     1 
ATOM   1610 C  CA    . ILE B 1 17  ? 10.853  53.214  -29.531  1.00 55.30  ?  17  ILE B CA    1 
ATOM   1611 C  C     . ILE B 1 17  ? 9.670   54.154  -29.782  1.00 59.61  ?  17  ILE B C     1 
ATOM   1612 O  O     . ILE B 1 17  ? 9.613   55.245  -29.206  1.00 59.81  ?  17  ILE B O     1 
ATOM   1613 C  CB    . ILE B 1 17  ? 11.883  53.194  -30.695  1.00 56.32  ?  17  ILE B CB    1 
ATOM   1614 C  CG1   . ILE B 1 17  ? 13.237  52.643  -30.205  1.00 57.24  ?  17  ILE B CG1   1 
ATOM   1615 C  CG2   . ILE B 1 17  ? 12.045  54.583  -31.339  1.00 54.91  ?  17  ILE B CG2   1 
ATOM   1616 C  CD1   . ILE B 1 17  ? 14.215  52.257  -31.292  1.00 66.33  ?  17  ILE B CD1   1 
ATOM   1617 N  N     . ARG B 1 18  ? 8.721   53.699  -30.620  1.00 55.97  ?  18  ARG B N     1 
ATOM   1618 C  CA    . ARG B 1 18  ? 7.508   54.417  -30.988  1.00 56.12  ?  18  ARG B CA    1 
ATOM   1619 C  C     . ARG B 1 18  ? 6.735   54.802  -29.727  1.00 61.82  ?  18  ARG B C     1 
ATOM   1620 O  O     . ARG B 1 18  ? 6.391   55.974  -29.556  1.00 62.15  ?  18  ARG B O     1 
ATOM   1621 C  CB    . ARG B 1 18  ? 6.649   53.543  -31.915  1.00 56.80  ?  18  ARG B CB    1 
ATOM   1622 C  CG    . ARG B 1 18  ? 5.585   54.313  -32.690  1.00 68.28  ?  18  ARG B CG    1 
ATOM   1623 C  CD    . ARG B 1 18  ? 4.441   53.433  -33.173  1.00 78.72  ?  18  ARG B CD    1 
ATOM   1624 N  NE    . ARG B 1 18  ? 3.784   52.681  -32.095  1.00 88.28  ?  18  ARG B NE    1 
ATOM   1625 C  CZ    . ARG B 1 18  ? 2.994   53.213  -31.165  1.00 105.46 ?  18  ARG B CZ    1 
ATOM   1626 N  NH1   . ARG B 1 18  ? 2.768   54.522  -31.143  1.00 94.74  ?  18  ARG B NH1   1 
ATOM   1627 N  NH2   . ARG B 1 18  ? 2.440   52.443  -30.239  1.00 93.78  ?  18  ARG B NH2   1 
ATOM   1628 N  N     . GLN B 1 19  ? 6.528   53.826  -28.822  1.00 59.26  ?  19  GLN B N     1 
ATOM   1629 C  CA    . GLN B 1 19  ? 5.821   54.001  -27.552  1.00 61.12  ?  19  GLN B CA    1 
ATOM   1630 C  C     . GLN B 1 19  ? 6.565   54.940  -26.612  1.00 64.90  ?  19  GLN B C     1 
ATOM   1631 O  O     . GLN B 1 19  ? 5.918   55.718  -25.915  1.00 66.65  ?  19  GLN B O     1 
ATOM   1632 C  CB    . GLN B 1 19  ? 5.588   52.649  -26.861  1.00 64.22  ?  19  GLN B CB    1 
ATOM   1633 C  CG    . GLN B 1 19  ? 4.491   51.797  -27.470  1.00 81.54  ?  19  GLN B CG    1 
ATOM   1634 C  CD    . GLN B 1 19  ? 4.427   50.451  -26.798  1.00 106.52 ?  19  GLN B CD    1 
ATOM   1635 O  OE1   . GLN B 1 19  ? 5.279   49.585  -27.013  1.00 102.35 ?  19  GLN B OE1   1 
ATOM   1636 N  NE2   . GLN B 1 19  ? 3.430   50.256  -25.945  1.00 103.56 ?  19  GLN B NE2   1 
ATOM   1637 N  N     . GLN B 1 20  ? 7.915   54.875  -26.588  1.00 59.79  ?  20  GLN B N     1 
ATOM   1638 C  CA    . GLN B 1 20  ? 8.759   55.722  -25.736  1.00 60.03  ?  20  GLN B CA    1 
ATOM   1639 C  C     . GLN B 1 20  ? 8.678   57.192  -26.160  1.00 64.53  ?  20  GLN B C     1 
ATOM   1640 O  O     . GLN B 1 20  ? 8.588   58.072  -25.297  1.00 65.64  ?  20  GLN B O     1 
ATOM   1641 C  CB    . GLN B 1 20  ? 10.219  55.224  -25.733  1.00 60.12  ?  20  GLN B CB    1 
ATOM   1642 C  CG    . GLN B 1 20  ? 11.139  55.886  -24.695  1.00 65.26  ?  20  GLN B CG    1 
ATOM   1643 C  CD    . GLN B 1 20  ? 10.638  55.786  -23.264  1.00 74.52  ?  20  GLN B CD    1 
ATOM   1644 O  OE1   . GLN B 1 20  ? 10.319  56.797  -22.639  1.00 67.06  ?  20  GLN B OE1   1 
ATOM   1645 N  NE2   . GLN B 1 20  ? 10.519  54.570  -22.724  1.00 62.45  ?  20  GLN B NE2   1 
ATOM   1646 N  N     . ILE B 1 21  ? 8.699   57.449  -27.487  1.00 59.81  ?  21  ILE B N     1 
ATOM   1647 C  CA    . ILE B 1 21  ? 8.593   58.791  -28.068  1.00 59.34  ?  21  ILE B CA    1 
ATOM   1648 C  C     . ILE B 1 21  ? 7.178   59.338  -27.839  1.00 67.97  ?  21  ILE B C     1 
ATOM   1649 O  O     . ILE B 1 21  ? 7.021   60.533  -27.576  1.00 69.19  ?  21  ILE B O     1 
ATOM   1650 C  CB    . ILE B 1 21  ? 9.043   58.799  -29.553  1.00 59.60  ?  21  ILE B CB    1 
ATOM   1651 C  CG1   . ILE B 1 21  ? 10.577  58.652  -29.654  1.00 58.12  ?  21  ILE B CG1   1 
ATOM   1652 C  CG2   . ILE B 1 21  ? 8.575   60.056  -30.273  1.00 60.10  ?  21  ILE B CG2   1 
ATOM   1653 C  CD1   . ILE B 1 21  ? 11.121  58.301  -31.020  1.00 56.70  ?  21  ILE B CD1   1 
ATOM   1654 N  N     . ASP B 1 22  ? 6.159   58.455  -27.896  1.00 66.69  ?  22  ASP B N     1 
ATOM   1655 C  CA    . ASP B 1 22  ? 4.770   58.825  -27.636  1.00 69.15  ?  22  ASP B CA    1 
ATOM   1656 C  C     . ASP B 1 22  ? 4.610   59.235  -26.171  1.00 74.05  ?  22  ASP B C     1 
ATOM   1657 O  O     . ASP B 1 22  ? 3.970   60.246  -25.891  1.00 75.06  ?  22  ASP B O     1 
ATOM   1658 C  CB    . ASP B 1 22  ? 3.820   57.666  -27.987  1.00 72.69  ?  22  ASP B CB    1 
ATOM   1659 C  CG    . ASP B 1 22  ? 2.674   58.047  -28.910  1.00 96.13  ?  22  ASP B CG    1 
ATOM   1660 O  OD1   . ASP B 1 22  ? 2.782   59.094  -29.600  1.00 98.28  ?  22  ASP B OD1   1 
ATOM   1661 O  OD2   . ASP B 1 22  ? 1.671   57.290  -28.959  1.00 107.61 -1 22  ASP B OD2   1 
ATOM   1662 N  N     . SER B 1 23  ? 5.238   58.477  -25.250  1.00 70.64  ?  23  SER B N     1 
ATOM   1663 C  CA    . SER B 1 23  ? 5.184   58.726  -23.811  1.00 72.98  ?  23  SER B CA    1 
ATOM   1664 C  C     . SER B 1 23  ? 5.993   59.954  -23.384  1.00 77.04  ?  23  SER B C     1 
ATOM   1665 O  O     . SER B 1 23  ? 5.650   60.596  -22.378  1.00 79.25  ?  23  SER B O     1 
ATOM   1666 C  CB    . SER B 1 23  ? 5.622   57.494  -23.027  1.00 77.42  ?  23  SER B CB    1 
ATOM   1667 O  OG    . SER B 1 23  ? 5.775   57.810  -21.653  1.00 90.30  ?  23  SER B OG    1 
ATOM   1668 N  N     . ASN B 1 24  ? 7.080   60.248  -24.120  1.00 70.48  ?  24  ASN B N     1 
ATOM   1669 C  CA    . ASN B 1 24  ? 7.955   61.392  -23.865  1.00 69.81  ?  24  ASN B CA    1 
ATOM   1670 C  C     . ASN B 1 24  ? 8.510   61.914  -25.184  1.00 69.72  ?  24  ASN B C     1 
ATOM   1671 O  O     . ASN B 1 24  ? 9.503   61.382  -25.678  1.00 67.29  ?  24  ASN B O     1 
ATOM   1672 C  CB    . ASN B 1 24  ? 9.081   61.045  -22.872  1.00 71.67  ?  24  ASN B CB    1 
ATOM   1673 C  CG    . ASN B 1 24  ? 10.065  62.173  -22.612  1.00 92.36  ?  24  ASN B CG    1 
ATOM   1674 O  OD1   . ASN B 1 24  ? 9.734   63.363  -22.654  1.00 86.09  ?  24  ASN B OD1   1 
ATOM   1675 N  ND2   . ASN B 1 24  ? 11.304  61.818  -22.321  1.00 82.62  ?  24  ASN B ND2   1 
ATOM   1676 N  N     . PRO B 1 25  ? 7.873   62.941  -25.788  1.00 65.97  ?  25  PRO B N     1 
ATOM   1677 C  CA    . PRO B 1 25  ? 8.373   63.461  -27.069  1.00 64.02  ?  25  PRO B CA    1 
ATOM   1678 C  C     . PRO B 1 25  ? 9.654   64.273  -26.929  1.00 67.43  ?  25  PRO B C     1 
ATOM   1679 O  O     . PRO B 1 25  ? 10.351  64.483  -27.918  1.00 66.29  ?  25  PRO B O     1 
ATOM   1680 C  CB    . PRO B 1 25  ? 7.214   64.321  -27.580  1.00 66.95  ?  25  PRO B CB    1 
ATOM   1681 C  CG    . PRO B 1 25  ? 6.073   64.093  -26.639  1.00 73.48  ?  25  PRO B CG    1 
ATOM   1682 C  CD    . PRO B 1 25  ? 6.680   63.683  -25.352  1.00 69.74  ?  25  PRO B CD    1 
ATOM   1683 N  N     . PHE B 1 26  ? 9.977   64.689  -25.694  1.00 64.37  ?  26  PHE B N     1 
ATOM   1684 C  CA    . PHE B 1 26  ? 11.155  65.476  -25.355  1.00 64.23  ?  26  PHE B CA    1 
ATOM   1685 C  C     . PHE B 1 26  ? 12.443  64.643  -25.283  1.00 67.02  ?  26  PHE B C     1 
ATOM   1686 O  O     . PHE B 1 26  ? 13.518  65.216  -25.065  1.00 67.70  ?  26  PHE B O     1 
ATOM   1687 C  CB    . PHE B 1 26  ? 10.921  66.247  -24.051  1.00 68.62  ?  26  PHE B CB    1 
ATOM   1688 C  CG    . PHE B 1 26  ? 9.767   67.215  -24.097  1.00 71.65  ?  26  PHE B CG    1 
ATOM   1689 C  CD1   . PHE B 1 26  ? 8.486   66.810  -23.741  1.00 75.52  ?  26  PHE B CD1   1 
ATOM   1690 C  CD2   . PHE B 1 26  ? 9.965   68.540  -24.464  1.00 74.37  ?  26  PHE B CD2   1 
ATOM   1691 C  CE1   . PHE B 1 26  ? 7.424   67.705  -23.774  1.00 78.11  ?  26  PHE B CE1   1 
ATOM   1692 C  CE2   . PHE B 1 26  ? 8.900   69.437  -24.497  1.00 78.90  ?  26  PHE B CE2   1 
ATOM   1693 C  CZ    . PHE B 1 26  ? 7.638   69.016  -24.146  1.00 77.89  ?  26  PHE B CZ    1 
ATOM   1694 N  N     . ILE B 1 27  ? 12.344  63.310  -25.491  1.00 61.56  ?  27  ILE B N     1 
ATOM   1695 C  CA    . ILE B 1 27  ? 13.490  62.398  -25.473  1.00 60.59  ?  27  ILE B CA    1 
ATOM   1696 C  C     . ILE B 1 27  ? 14.403  62.667  -26.667  1.00 66.50  ?  27  ILE B C     1 
ATOM   1697 O  O     . ILE B 1 27  ? 13.915  63.026  -27.735  1.00 65.92  ?  27  ILE B O     1 
ATOM   1698 C  CB    . ILE B 1 27  ? 13.046  60.905  -25.361  1.00 62.32  ?  27  ILE B CB    1 
ATOM   1699 C  CG1   . ILE B 1 27  ? 14.164  60.011  -24.791  1.00 61.68  ?  27  ILE B CG1   1 
ATOM   1700 C  CG2   . ILE B 1 27  ? 12.464  60.344  -26.678  1.00 61.52  ?  27  ILE B CG2   1 
ATOM   1701 C  CD1   . ILE B 1 27  ? 13.684  58.824  -24.023  1.00 65.96  ?  27  ILE B CD1   1 
ATOM   1702 N  N     . THR B 1 28  ? 15.721  62.527  -26.476  1.00 65.14  ?  28  THR B N     1 
ATOM   1703 C  CA    . THR B 1 28  ? 16.717  62.713  -27.536  1.00 64.30  ?  28  THR B CA    1 
ATOM   1704 C  C     . THR B 1 28  ? 17.070  61.357  -28.148  1.00 67.57  ?  28  THR B C     1 
ATOM   1705 O  O     . THR B 1 28  ? 16.796  60.315  -27.544  1.00 66.92  ?  28  THR B O     1 
ATOM   1706 C  CB    . THR B 1 28  ? 17.971  63.384  -26.978  1.00 75.52  ?  28  THR B CB    1 
ATOM   1707 O  OG1   . THR B 1 28  ? 18.439  62.652  -25.834  1.00 75.40  ?  28  THR B OG1   1 
ATOM   1708 C  CG2   . THR B 1 28  ? 17.742  64.849  -26.638  1.00 77.07  ?  28  THR B CG2   1 
ATOM   1709 N  N     . ASP B 1 29  ? 17.699  61.367  -29.336  1.00 64.55  ?  29  ASP B N     1 
ATOM   1710 C  CA    . ASP B 1 29  ? 18.135  60.138  -30.005  1.00 63.87  ?  29  ASP B CA    1 
ATOM   1711 C  C     . ASP B 1 29  ? 19.256  59.490  -29.194  1.00 70.70  ?  29  ASP B C     1 
ATOM   1712 O  O     . ASP B 1 29  ? 19.355  58.262  -29.165  1.00 70.07  ?  29  ASP B O     1 
ATOM   1713 C  CB    . ASP B 1 29  ? 18.595  60.413  -31.443  1.00 64.60  ?  29  ASP B CB    1 
ATOM   1714 C  CG    . ASP B 1 29  ? 17.488  60.583  -32.474  1.00 74.27  ?  29  ASP B CG    1 
ATOM   1715 O  OD1   . ASP B 1 29  ? 16.303  60.730  -32.072  1.00 77.23  -1 29  ASP B OD1   1 
ATOM   1716 O  OD2   . ASP B 1 29  ? 17.805  60.612  -33.675  1.00 75.50  ?  29  ASP B OD2   1 
ATOM   1717 N  N     . HIS B 1 30  ? 20.061  60.320  -28.486  1.00 69.80  ?  30  HIS B N     1 
ATOM   1718 C  CA    . HIS B 1 30  ? 21.141  59.862  -27.619  1.00 71.15  ?  30  HIS B CA    1 
ATOM   1719 C  C     . HIS B 1 30  ? 20.601  59.047  -26.458  1.00 73.11  ?  30  HIS B C     1 
ATOM   1720 O  O     . HIS B 1 30  ? 21.147  57.979  -26.193  1.00 73.85  ?  30  HIS B O     1 
ATOM   1721 C  CB    . HIS B 1 30  ? 21.991  61.027  -27.105  1.00 74.61  ?  30  HIS B CB    1 
ATOM   1722 C  CG    . HIS B 1 30  ? 23.125  60.576  -26.237  1.00 80.86  ?  30  HIS B CG    1 
ATOM   1723 N  ND1   . HIS B 1 30  ? 24.287  60.052  -26.782  1.00 83.37  ?  30  HIS B ND1   1 
ATOM   1724 C  CD2   . HIS B 1 30  ? 23.222  60.546  -24.886  1.00 85.29  ?  30  HIS B CD2   1 
ATOM   1725 C  CE1   . HIS B 1 30  ? 25.057  59.738  -25.748  1.00 85.23  ?  30  HIS B CE1   1 
ATOM   1726 N  NE2   . HIS B 1 30  ? 24.458  60.016  -24.587  1.00 86.69  ?  30  HIS B NE2   1 
ATOM   1727 N  N     . GLU B 1 31  ? 19.558  59.532  -25.759  1.00 67.50  ?  31  GLU B N     1 
ATOM   1728 C  CA    . GLU B 1 31  ? 18.978  58.783  -24.638  1.00 67.49  ?  31  GLU B CA    1 
ATOM   1729 C  C     . GLU B 1 31  ? 18.409  57.458  -25.143  1.00 67.81  ?  31  GLU B C     1 
ATOM   1730 O  O     . GLU B 1 31  ? 18.678  56.414  -24.541  1.00 67.41  ?  31  GLU B O     1 
ATOM   1731 C  CB    . GLU B 1 31  ? 17.901  59.603  -23.905  1.00 69.77  ?  31  GLU B CB    1 
ATOM   1732 C  CG    . GLU B 1 31  ? 17.387  58.954  -22.626  1.00 80.91  ?  31  GLU B CG    1 
ATOM   1733 C  CD    . GLU B 1 31  ? 16.467  59.797  -21.762  1.00 103.30 ?  31  GLU B CD    1 
ATOM   1734 O  OE1   . GLU B 1 31  ? 16.092  60.911  -22.197  1.00 96.82  ?  31  GLU B OE1   1 
ATOM   1735 O  OE2   . GLU B 1 31  ? 16.150  59.358  -20.629  1.00 96.20  -1 31  GLU B OE2   1 
ATOM   1736 N  N     . LEU B 1 32  ? 17.678  57.498  -26.285  1.00 61.44  ?  32  LEU B N     1 
ATOM   1737 C  CA    . LEU B 1 32  ? 17.086  56.295  -26.878  1.00 59.61  ?  32  LEU B CA    1 
ATOM   1738 C  C     . LEU B 1 32  ? 18.158  55.257  -27.208  1.00 63.80  ?  32  LEU B C     1 
ATOM   1739 O  O     . LEU B 1 32  ? 17.953  54.066  -26.937  1.00 64.43  ?  32  LEU B O     1 
ATOM   1740 C  CB    . LEU B 1 32  ? 16.256  56.632  -28.123  1.00 57.40  ?  32  LEU B CB    1 
ATOM   1741 C  CG    . LEU B 1 32  ? 14.960  57.394  -27.901  1.00 61.50  ?  32  LEU B CG    1 
ATOM   1742 C  CD1   . LEU B 1 32  ? 14.504  58.055  -29.180  1.00 59.79  ?  32  LEU B CD1   1 
ATOM   1743 C  CD2   . LEU B 1 32  ? 13.875  56.487  -27.363  1.00 64.25  ?  32  LEU B CD2   1 
ATOM   1744 N  N     . SER B 1 33  ? 19.322  55.721  -27.736  1.00 58.84  ?  33  SER B N     1 
ATOM   1745 C  CA    . SER B 1 33  ? 20.442  54.847  -28.070  1.00 58.42  ?  33  SER B CA    1 
ATOM   1746 C  C     . SER B 1 33  ? 20.939  54.112  -26.826  1.00 64.63  ?  33  SER B C     1 
ATOM   1747 O  O     . SER B 1 33  ? 21.123  52.895  -26.878  1.00 64.51  ?  33  SER B O     1 
ATOM   1748 C  CB    . SER B 1 33  ? 21.561  55.627  -28.748  1.00 61.10  ?  33  SER B CB    1 
ATOM   1749 O  OG    . SER B 1 33  ? 22.315  56.374  -27.810  1.00 73.30  ?  33  SER B OG    1 
ATOM   1750 N  N     . ASP B 1 34  ? 21.070  54.844  -25.694  1.00 62.90  ?  34  ASP B N     1 
ATOM   1751 C  CA    . ASP B 1 34  ? 21.504  54.309  -24.399  1.00 64.79  ?  34  ASP B CA    1 
ATOM   1752 C  C     . ASP B 1 34  ? 20.461  53.367  -23.813  1.00 66.61  ?  34  ASP B C     1 
ATOM   1753 O  O     . ASP B 1 34  ? 20.826  52.296  -23.336  1.00 66.97  ?  34  ASP B O     1 
ATOM   1754 C  CB    . ASP B 1 34  ? 21.808  55.441  -23.406  1.00 68.84  ?  34  ASP B CB    1 
ATOM   1755 C  CG    . ASP B 1 34  ? 23.210  56.001  -23.508  1.00 85.89  ?  34  ASP B CG    1 
ATOM   1756 O  OD1   . ASP B 1 34  ? 23.414  56.949  -24.291  1.00 85.78  ?  34  ASP B OD1   1 
ATOM   1757 O  OD2   . ASP B 1 34  ? 24.095  55.523  -22.768  1.00 98.36  -1 34  ASP B OD2   1 
ATOM   1758 N  N     . LEU B 1 35  ? 19.169  53.762  -23.854  1.00 61.55  ?  35  LEU B N     1 
ATOM   1759 C  CA    . LEU B 1 35  ? 18.057  52.966  -23.316  1.00 61.69  ?  35  LEU B CA    1 
ATOM   1760 C  C     . LEU B 1 35  ? 17.914  51.633  -24.032  1.00 64.87  ?  35  LEU B C     1 
ATOM   1761 O  O     . LEU B 1 35  ? 17.709  50.605  -23.387  1.00 65.24  ?  35  LEU B O     1 
ATOM   1762 C  CB    . LEU B 1 35  ? 16.720  53.725  -23.415  1.00 60.47  ?  35  LEU B CB    1 
ATOM   1763 C  CG    . LEU B 1 35  ? 16.490  54.937  -22.534  1.00 65.61  ?  35  LEU B CG    1 
ATOM   1764 C  CD1   . LEU B 1 35  ? 15.266  55.654  -22.975  1.00 64.33  ?  35  LEU B CD1   1 
ATOM   1765 C  CD2   . LEU B 1 35  ? 16.343  54.555  -21.077  1.00 70.74  ?  35  LEU B CD2   1 
ATOM   1766 N  N     . PHE B 1 36  ? 18.028  51.652  -25.363  1.00 60.56  ?  36  PHE B N     1 
ATOM   1767 C  CA    . PHE B 1 36  ? 17.858  50.454  -26.177  1.00 60.34  ?  36  PHE B CA    1 
ATOM   1768 C  C     . PHE B 1 36  ? 19.135  49.686  -26.498  1.00 65.84  ?  36  PHE B C     1 
ATOM   1769 O  O     . PHE B 1 36  ? 19.054  48.607  -27.090  1.00 65.98  ?  36  PHE B O     1 
ATOM   1770 C  CB    . PHE B 1 36  ? 17.022  50.767  -27.425  1.00 59.80  ?  36  PHE B CB    1 
ATOM   1771 C  CG    . PHE B 1 36  ? 15.603  51.160  -27.084  1.00 61.19  ?  36  PHE B CG    1 
ATOM   1772 C  CD1   . PHE B 1 36  ? 14.632  50.193  -26.852  1.00 64.58  ?  36  PHE B CD1   1 
ATOM   1773 C  CD2   . PHE B 1 36  ? 15.245  52.495  -26.966  1.00 63.05  ?  36  PHE B CD2   1 
ATOM   1774 C  CE1   . PHE B 1 36  ? 13.330  50.559  -26.520  1.00 66.06  ?  36  PHE B CE1   1 
ATOM   1775 C  CE2   . PHE B 1 36  ? 13.941  52.860  -26.623  1.00 66.39  ?  36  PHE B CE2   1 
ATOM   1776 C  CZ    . PHE B 1 36  ? 12.986  51.891  -26.423  1.00 65.25  ?  36  PHE B CZ    1 
ATOM   1777 N  N     . GLN B 1 37  ? 20.299  50.202  -26.048  1.00 63.25  ?  37  GLN B N     1 
ATOM   1778 C  CA    . GLN B 1 37  ? 21.625  49.606  -26.257  1.00 64.16  ?  37  GLN B CA    1 
ATOM   1779 C  C     . GLN B 1 37  ? 21.870  49.282  -27.733  1.00 67.94  ?  37  GLN B C     1 
ATOM   1780 O  O     . GLN B 1 37  ? 22.197  48.156  -28.114  1.00 69.06  ?  37  GLN B O     1 
ATOM   1781 C  CB    . GLN B 1 37  ? 21.885  48.420  -25.315  1.00 67.72  ?  37  GLN B CB    1 
ATOM   1782 C  CG    . GLN B 1 37  ? 22.068  48.821  -23.855  1.00 73.72  ?  37  GLN B CG    1 
ATOM   1783 C  CD    . GLN B 1 37  ? 23.355  49.558  -23.623  1.00 90.42  ?  37  GLN B CD    1 
ATOM   1784 O  OE1   . GLN B 1 37  ? 23.424  50.778  -23.761  1.00 81.52  ?  37  GLN B OE1   1 
ATOM   1785 N  NE2   . GLN B 1 37  ? 24.404  48.835  -23.261  1.00 93.73  ?  37  GLN B NE2   1 
ATOM   1786 N  N     . VAL B 1 38  ? 21.641  50.291  -28.568  1.00 61.97  ?  38  VAL B N     1 
ATOM   1787 C  CA    . VAL B 1 38  ? 21.974  50.251  -29.986  1.00 59.56  ?  38  VAL B CA    1 
ATOM   1788 C  C     . VAL B 1 38  ? 22.587  51.563  -30.384  1.00 62.99  ?  38  VAL B C     1 
ATOM   1789 O  O     . VAL B 1 38  ? 22.619  52.468  -29.591  1.00 63.82  ?  38  VAL B O     1 
ATOM   1790 C  CB    . VAL B 1 38  ? 20.780  50.058  -30.879  1.00 61.63  ?  38  VAL B CB    1 
ATOM   1791 C  CG1   . VAL B 1 38  ? 20.194  48.728  -30.688  1.00 59.58  ?  38  VAL B CG1   1 
ATOM   1792 C  CG2   . VAL B 1 38  ? 19.795  51.125  -30.673  1.00 61.30  ?  38  VAL B CG2   1 
ATOM   1793 N  N     . SER B 1 39  ? 23.078  51.660  -31.614  1.00 58.08  ?  39  SER B N     1 
ATOM   1794 C  CA    . SER B 1 39  ? 23.782  52.866  -32.068  1.00 57.15  ?  39  SER B CA    1 
ATOM   1795 C  C     . SER B 1 39  ? 22.800  53.980  -32.382  1.00 61.47  ?  39  SER B C     1 
ATOM   1796 O  O     . SER B 1 39  ? 21.660  53.698  -32.791  1.00 61.09  ?  39  SER B O     1 
ATOM   1797 C  CB    . SER B 1 39  ? 24.636  52.569  -33.293  1.00 58.89  ?  39  SER B CB    1 
ATOM   1798 O  OG    . SER B 1 39  ? 23.843  52.341  -34.445  1.00 63.95  ?  39  SER B OG    1 
ATOM   1799 N  N     . ILE B 1 40  ? 23.239  55.248  -32.212  1.00 57.67  ?  40  ILE B N     1 
ATOM   1800 C  CA    . ILE B 1 40  ? 22.407  56.418  -32.514  1.00 55.87  ?  40  ILE B CA    1 
ATOM   1801 C  C     . ILE B 1 40  ? 21.889  56.353  -33.961  1.00 59.68  ?  40  ILE B C     1 
ATOM   1802 O  O     . ILE B 1 40  ? 20.766  56.775  -34.224  1.00 58.30  ?  40  ILE B O     1 
ATOM   1803 C  CB    . ILE B 1 40  ? 23.124  57.749  -32.182  1.00 59.12  ?  40  ILE B CB    1 
ATOM   1804 C  CG1   . ILE B 1 40  ? 22.120  58.906  -32.041  1.00 58.33  ?  40  ILE B CG1   1 
ATOM   1805 C  CG2   . ILE B 1 40  ? 24.250  58.059  -33.175  1.00 60.16  ?  40  ILE B CG2   1 
ATOM   1806 C  CD1   . ILE B 1 40  ? 22.578  60.040  -31.202  1.00 66.93  ?  40  ILE B CD1   1 
ATOM   1807 N  N     . GLN B 1 41  ? 22.693  55.759  -34.871  1.00 57.23  ?  41  GLN B N     1 
ATOM   1808 C  CA    . GLN B 1 41  ? 22.351  55.595  -36.278  1.00 56.20  ?  41  GLN B CA    1 
ATOM   1809 C  C     . GLN B 1 41  ? 21.157  54.679  -36.437  1.00 58.77  ?  41  GLN B C     1 
ATOM   1810 O  O     . GLN B 1 41  ? 20.239  55.022  -37.197  1.00 57.28  ?  41  GLN B O     1 
ATOM   1811 C  CB    . GLN B 1 41  ? 23.551  55.130  -37.103  1.00 58.34  ?  41  GLN B CB    1 
ATOM   1812 C  CG    . GLN B 1 41  ? 24.630  56.205  -37.237  1.00 73.61  ?  41  GLN B CG    1 
ATOM   1813 C  CD    . GLN B 1 41  ? 25.668  56.175  -36.130  1.00 84.26  ?  41  GLN B CD    1 
ATOM   1814 O  OE1   . GLN B 1 41  ? 25.641  55.336  -35.216  1.00 78.32  ?  41  GLN B OE1   1 
ATOM   1815 N  NE2   . GLN B 1 41  ? 26.614  57.101  -36.199  1.00 71.93  ?  41  GLN B NE2   1 
ATOM   1816 N  N     . THR B 1 42  ? 21.116  53.569  -35.656  1.00 55.10  ?  42  THR B N     1 
ATOM   1817 C  CA    . THR B 1 42  ? 19.964  52.666  -35.670  1.00 54.43  ?  42  THR B CA    1 
ATOM   1818 C  C     . THR B 1 42  ? 18.716  53.434  -35.221  1.00 57.85  ?  42  THR B C     1 
ATOM   1819 O  O     . THR B 1 42  ? 17.689  53.348  -35.896  1.00 56.02  ?  42  THR B O     1 
ATOM   1820 C  CB    . THR B 1 42  ? 20.241  51.379  -34.904  1.00 63.88  ?  42  THR B CB    1 
ATOM   1821 O  OG1   . THR B 1 42  ? 21.319  50.704  -35.542  1.00 65.75  ?  42  THR B OG1   1 
ATOM   1822 C  CG2   . THR B 1 42  ? 19.048  50.447  -34.881  1.00 63.08  ?  42  THR B CG2   1 
ATOM   1823 N  N     . ILE B 1 43  ? 18.841  54.259  -34.148  1.00 55.34  ?  43  ILE B N     1 
ATOM   1824 C  CA    . ILE B 1 43  ? 17.746  55.101  -33.638  1.00 54.79  ?  43  ILE B CA    1 
ATOM   1825 C  C     . ILE B 1 43  ? 17.191  56.013  -34.730  1.00 58.43  ?  43  ILE B C     1 
ATOM   1826 O  O     . ILE B 1 43  ? 15.978  56.049  -34.916  1.00 58.24  ?  43  ILE B O     1 
ATOM   1827 C  CB    . ILE B 1 43  ? 18.132  55.879  -32.348  1.00 58.39  ?  43  ILE B CB    1 
ATOM   1828 C  CG1   . ILE B 1 43  ? 18.510  54.928  -31.191  1.00 59.81  ?  43  ILE B CG1   1 
ATOM   1829 C  CG2   . ILE B 1 43  ? 17.066  56.920  -31.932  1.00 58.36  ?  43  ILE B CG2   1 
ATOM   1830 C  CD1   . ILE B 1 43  ? 17.396  54.025  -30.604  1.00 65.35  ?  43  ILE B CD1   1 
ATOM   1831 N  N     . ARG B 1 44  ? 18.074  56.702  -35.475  1.00 55.12  ?  44  ARG B N     1 
ATOM   1832 C  CA    . ARG B 1 44  ? 17.683  57.612  -36.559  1.00 54.60  ?  44  ARG B CA    1 
ATOM   1833 C  C     . ARG B 1 44  ? 16.977  56.847  -37.672  1.00 58.37  ?  44  ARG B C     1 
ATOM   1834 O  O     . ARG B 1 44  ? 15.971  57.330  -38.210  1.00 57.34  ?  44  ARG B O     1 
ATOM   1835 C  CB    . ARG B 1 44  ? 18.888  58.380  -37.104  1.00 55.17  ?  44  ARG B CB    1 
ATOM   1836 C  CG    . ARG B 1 44  ? 19.678  59.116  -36.039  1.00 69.18  ?  44  ARG B CG    1 
ATOM   1837 C  CD    . ARG B 1 44  ? 20.498  60.216  -36.649  1.00 85.11  ?  44  ARG B CD    1 
ATOM   1838 N  NE    . ARG B 1 44  ? 21.819  60.356  -36.036  1.00 96.57  ?  44  ARG B NE    1 
ATOM   1839 C  CZ    . ARG B 1 44  ? 22.074  61.079  -34.951  1.00 117.48 ?  44  ARG B CZ    1 
ATOM   1840 N  NH1   . ARG B 1 44  ? 21.089  61.703  -34.311  1.00 101.24 ?  44  ARG B NH1   1 
ATOM   1841 N  NH2   . ARG B 1 44  ? 23.311  61.167  -34.482  1.00 113.87 ?  44  ARG B NH2   1 
ATOM   1842 N  N     . LEU B 1 45  ? 17.472  55.621  -37.965  1.00 55.01  ?  45  LEU B N     1 
ATOM   1843 C  CA    . LEU B 1 45  ? 16.880  54.731  -38.965  1.00 53.90  ?  45  LEU B CA    1 
ATOM   1844 C  C     . LEU B 1 45  ? 15.495  54.291  -38.535  1.00 59.71  ?  45  LEU B C     1 
ATOM   1845 O  O     . LEU B 1 45  ? 14.598  54.221  -39.372  1.00 59.38  ?  45  LEU B O     1 
ATOM   1846 C  CB    . LEU B 1 45  ? 17.760  53.489  -39.189  1.00 53.45  ?  45  LEU B CB    1 
ATOM   1847 C  CG    . LEU B 1 45  ? 18.918  53.630  -40.159  1.00 56.63  ?  45  LEU B CG    1 
ATOM   1848 C  CD1   . LEU B 1 45  ? 19.764  52.384  -40.165  1.00 56.51  ?  45  LEU B CD1   1 
ATOM   1849 C  CD2   . LEU B 1 45  ? 18.425  53.939  -41.566  1.00 58.05  ?  45  LEU B CD2   1 
ATOM   1850 N  N     . ASP B 1 46  ? 15.330  54.000  -37.229  1.00 58.04  ?  46  ASP B N     1 
ATOM   1851 C  CA    . ASP B 1 46  ? 14.077  53.553  -36.636  1.00 58.93  ?  46  ASP B CA    1 
ATOM   1852 C  C     . ASP B 1 46  ? 13.012  54.617  -36.715  1.00 62.42  ?  46  ASP B C     1 
ATOM   1853 O  O     . ASP B 1 46  ? 11.938  54.314  -37.217  1.00 62.27  ?  46  ASP B O     1 
ATOM   1854 C  CB    . ASP B 1 46  ? 14.282  53.019  -35.207  1.00 62.73  ?  46  ASP B CB    1 
ATOM   1855 C  CG    . ASP B 1 46  ? 15.171  51.776  -35.120  1.00 82.14  ?  46  ASP B CG    1 
ATOM   1856 O  OD1   . ASP B 1 46  ? 15.151  50.952  -36.072  1.00 83.83  ?  46  ASP B OD1   1 
ATOM   1857 O  OD2   . ASP B 1 46  ? 15.903  51.639  -34.115  1.00 91.24  -1 46  ASP B OD2   1 
ATOM   1858 N  N     . ARG B 1 47  ? 13.329  55.878  -36.325  1.00 59.32  ?  47  ARG B N     1 
ATOM   1859 C  CA    . ARG B 1 47  ? 12.415  57.024  -36.399  1.00 59.57  ?  47  ARG B CA    1 
ATOM   1860 C  C     . ARG B 1 47  ? 11.996  57.290  -37.838  1.00 66.23  ?  47  ARG B C     1 
ATOM   1861 O  O     . ARG B 1 47  ? 10.836  57.640  -38.075  1.00 67.22  ?  47  ARG B O     1 
ATOM   1862 C  CB    . ARG B 1 47  ? 13.071  58.287  -35.861  1.00 57.07  ?  47  ARG B CB    1 
ATOM   1863 C  CG    . ARG B 1 47  ? 12.989  58.478  -34.360  1.00 60.24  ?  47  ARG B CG    1 
ATOM   1864 C  CD    . ARG B 1 47  ? 13.339  59.912  -33.953  1.00 61.06  ?  47  ARG B CD    1 
ATOM   1865 N  NE    . ARG B 1 47  ? 14.681  60.319  -34.389  1.00 56.51  ?  47  ARG B NE    1 
ATOM   1866 C  CZ    . ARG B 1 47  ? 14.930  61.070  -35.460  1.00 63.32  ?  47  ARG B CZ    1 
ATOM   1867 N  NH1   . ARG B 1 47  ? 13.931  61.525  -36.209  1.00 49.01  ?  47  ARG B NH1   1 
ATOM   1868 N  NH2   . ARG B 1 47  ? 16.177  61.360  -35.797  1.00 43.43  ?  47  ARG B NH2   1 
ATOM   1869 N  N     . THR B 1 48  ? 12.946  57.128  -38.792  1.00 63.24  ?  48  THR B N     1 
ATOM   1870 C  CA    . THR B 1 48  ? 12.721  57.330  -40.221  1.00 63.21  ?  48  THR B CA    1 
ATOM   1871 C  C     . THR B 1 48  ? 11.636  56.380  -40.729  1.00 69.44  ?  48  THR B C     1 
ATOM   1872 O  O     . THR B 1 48  ? 10.659  56.840  -41.327  1.00 70.81  ?  48  THR B O     1 
ATOM   1873 C  CB    . THR B 1 48  ? 14.044  57.233  -40.987  1.00 67.85  ?  48  THR B CB    1 
ATOM   1874 O  OG1   . THR B 1 48  ? 14.911  58.275  -40.535  1.00 64.62  ?  48  THR B OG1   1 
ATOM   1875 C  CG2   . THR B 1 48  ? 13.857  57.343  -42.493  1.00 69.35  ?  48  THR B CG2   1 
ATOM   1876 N  N     . TYR B 1 49  ? 11.795  55.071  -40.450  1.00 65.72  ?  49  TYR B N     1 
ATOM   1877 C  CA    . TYR B 1 49  ? 10.855  54.036  -40.858  1.00 65.76  ?  49  TYR B CA    1 
ATOM   1878 C  C     . TYR B 1 49  ? 9.507   54.220  -40.172  1.00 68.28  ?  49  TYR B C     1 
ATOM   1879 O  O     . TYR B 1 49  ? 8.472   54.020  -40.809  1.00 69.27  ?  49  TYR B O     1 
ATOM   1880 C  CB    . TYR B 1 49  ? 11.439  52.631  -40.612  1.00 68.24  ?  49  TYR B CB    1 
ATOM   1881 C  CG    . TYR B 1 49  ? 10.645  51.525  -41.276  1.00 73.79  ?  49  TYR B CG    1 
ATOM   1882 C  CD1   . TYR B 1 49  ? 10.841  51.205  -42.618  1.00 76.01  ?  49  TYR B CD1   1 
ATOM   1883 C  CD2   . TYR B 1 49  ? 9.683   50.806  -40.566  1.00 77.04  ?  49  TYR B CD2   1 
ATOM   1884 C  CE1   . TYR B 1 49  ? 10.088  50.208  -43.244  1.00 78.71  ?  49  TYR B CE1   1 
ATOM   1885 C  CE2   . TYR B 1 49  ? 8.932   49.799  -41.179  1.00 79.66  ?  49  TYR B CE2   1 
ATOM   1886 C  CZ    . TYR B 1 49  ? 9.136   49.505  -42.519  1.00 89.13  ?  49  TYR B CZ    1 
ATOM   1887 O  OH    . TYR B 1 49  ? 8.395   48.514  -43.122  1.00 94.14  ?  49  TYR B OH    1 
ATOM   1888 N  N     . LEU B 1 50  ? 9.517   54.634  -38.887  1.00 62.97  ?  50  LEU B N     1 
ATOM   1889 C  CA    . LEU B 1 50  ? 8.308   54.849  -38.081  1.00 63.04  ?  50  LEU B CA    1 
ATOM   1890 C  C     . LEU B 1 50  ? 7.661   56.216  -38.359  1.00 66.58  ?  50  LEU B C     1 
ATOM   1891 O  O     . LEU B 1 50  ? 6.628   56.539  -37.756  1.00 68.60  ?  50  LEU B O     1 
ATOM   1892 C  CB    . LEU B 1 50  ? 8.613   54.717  -36.576  1.00 63.25  ?  50  LEU B CB    1 
ATOM   1893 C  CG    . LEU B 1 50  ? 9.042   53.360  -36.032  1.00 68.03  ?  50  LEU B CG    1 
ATOM   1894 C  CD1   . LEU B 1 50  ? 9.838   53.522  -34.760  1.00 68.59  ?  50  LEU B CD1   1 
ATOM   1895 C  CD2   . LEU B 1 50  ? 7.863   52.465  -35.755  1.00 72.47  ?  50  LEU B CD2   1 
ATOM   1896 N  N     . ASN B 1 51  ? 8.265   57.009  -39.272  1.00 59.93  ?  51  ASN B N     1 
ATOM   1897 C  CA    . ASN B 1 51  ? 7.822   58.351  -39.665  1.00 59.26  ?  51  ASN B CA    1 
ATOM   1898 C  C     . ASN B 1 51  ? 7.657   59.328  -38.494  1.00 60.56  ?  51  ASN B C     1 
ATOM   1899 O  O     . ASN B 1 51  ? 6.761   60.180  -38.484  1.00 60.88  ?  51  ASN B O     1 
ATOM   1900 C  CB    . ASN B 1 51  ? 6.641   58.329  -40.645  1.00 62.39  ?  51  ASN B CB    1 
ATOM   1901 C  CG    . ASN B 1 51  ? 7.084   58.063  -42.067  1.00 100.15 ?  51  ASN B CG    1 
ATOM   1902 O  OD1   . ASN B 1 51  ? 7.802   58.865  -42.684  1.00 94.92  ?  51  ASN B OD1   1 
ATOM   1903 N  ND2   . ASN B 1 51  ? 6.689   56.916  -42.613  1.00 95.99  ?  51  ASN B ND2   1 
ATOM   1904 N  N     . ILE B 1 52  ? 8.567   59.188  -37.510  1.00 54.58  ?  52  ILE B N     1 
ATOM   1905 C  CA    . ILE B 1 52  ? 8.668   60.029  -36.327  1.00 54.12  ?  52  ILE B CA    1 
ATOM   1906 C  C     . ILE B 1 52  ? 9.652   61.155  -36.670  1.00 56.99  ?  52  ILE B C     1 
ATOM   1907 O  O     . ILE B 1 52  ? 10.794  60.856  -37.053  1.00 55.84  ?  52  ILE B O     1 
ATOM   1908 C  CB    . ILE B 1 52  ? 9.133   59.216  -35.091  1.00 56.69  ?  52  ILE B CB    1 
ATOM   1909 C  CG1   . ILE B 1 52  ? 8.100   58.137  -34.710  1.00 57.31  ?  52  ILE B CG1   1 
ATOM   1910 C  CG2   . ILE B 1 52  ? 9.429   60.154  -33.914  1.00 58.87  ?  52  ILE B CG2   1 
ATOM   1911 C  CD1   . ILE B 1 52  ? 8.568   57.090  -33.722  1.00 64.39  ?  52  ILE B CD1   1 
ATOM   1912 N  N     . PRO B 1 53  ? 9.242   62.443  -36.551  1.00 53.53  ?  53  PRO B N     1 
ATOM   1913 C  CA    . PRO B 1 53  ? 10.172  63.535  -36.847  1.00 53.49  ?  53  PRO B CA    1 
ATOM   1914 C  C     . PRO B 1 53  ? 11.194  63.718  -35.727  1.00 59.56  ?  53  PRO B C     1 
ATOM   1915 O  O     . PRO B 1 53  ? 11.069  63.097  -34.666  1.00 59.55  ?  53  PRO B O     1 
ATOM   1916 C  CB    . PRO B 1 53  ? 9.255   64.746  -36.990  1.00 56.46  ?  53  PRO B CB    1 
ATOM   1917 C  CG    . PRO B 1 53  ? 8.130   64.460  -36.127  1.00 62.11  ?  53  PRO B CG    1 
ATOM   1918 C  CD    . PRO B 1 53  ? 7.939   62.969  -36.109  1.00 56.74  ?  53  PRO B CD    1 
ATOM   1919 N  N     . GLU B 1 54  ? 12.206  64.565  -35.966  1.00 56.70  ?  54  GLU B N     1 
ATOM   1920 C  CA    . GLU B 1 54  ? 13.238  64.861  -34.980  1.00 56.98  ?  54  GLU B CA    1 
ATOM   1921 C  C     . GLU B 1 54  ? 12.674  65.619  -33.769  1.00 62.00  ?  54  GLU B C     1 
ATOM   1922 O  O     . GLU B 1 54  ? 11.608  66.229  -33.861  1.00 62.56  ?  54  GLU B O     1 
ATOM   1923 C  CB    . GLU B 1 54  ? 14.392  65.628  -35.626  1.00 58.99  ?  54  GLU B CB    1 
ATOM   1924 C  CG    . GLU B 1 54  ? 14.043  67.009  -36.154  1.00 73.57  ?  54  GLU B CG    1 
ATOM   1925 C  CD    . GLU B 1 54  ? 15.249  67.916  -36.249  1.00 102.29 ?  54  GLU B CD    1 
ATOM   1926 O  OE1   . GLU B 1 54  ? 15.833  68.242  -35.188  1.00 104.28 ?  54  GLU B OE1   1 
ATOM   1927 O  OE2   . GLU B 1 54  ? 15.620  68.290  -37.385  1.00 97.19  -1 54  GLU B OE2   1 
ATOM   1928 N  N     . LEU B 1 55  ? 13.400  65.569  -32.641  1.00 58.86  ?  55  LEU B N     1 
ATOM   1929 C  CA    . LEU B 1 55  ? 13.067  66.203  -31.360  1.00 59.71  ?  55  LEU B CA    1 
ATOM   1930 C  C     . LEU B 1 55  ? 12.468  67.599  -31.503  1.00 65.14  ?  55  LEU B C     1 
ATOM   1931 O  O     . LEU B 1 55  ? 11.363  67.838  -31.022  1.00 65.85  ?  55  LEU B O     1 
ATOM   1932 C  CB    . LEU B 1 55  ? 14.324  66.242  -30.463  1.00 60.03  ?  55  LEU B CB    1 
ATOM   1933 C  CG    . LEU B 1 55  ? 14.235  67.029  -29.177  1.00 66.20  ?  55  LEU B CG    1 
ATOM   1934 C  CD1   . LEU B 1 55  ? 13.416  66.308  -28.177  1.00 66.66  ?  55  LEU B CD1   1 
ATOM   1935 C  CD2   . LEU B 1 55  ? 15.597  67.292  -28.618  1.00 69.08  ?  55  LEU B CD2   1 
ATOM   1936 N  N     . ARG B 1 56  ? 13.194  68.504  -32.179  1.00 61.99  ?  56  ARG B N     1 
ATOM   1937 C  CA    . ARG B 1 56  ? 12.780  69.889  -32.379  1.00 63.30  ?  56  ARG B CA    1 
ATOM   1938 C  C     . ARG B 1 56  ? 11.442  70.008  -33.111  1.00 67.35  ?  56  ARG B C     1 
ATOM   1939 O  O     . ARG B 1 56  ? 10.634  70.883  -32.775  1.00 69.90  ?  56  ARG B O     1 
ATOM   1940 C  CB    . ARG B 1 56  ? 13.893  70.694  -33.053  1.00 62.16  ?  56  ARG B CB    1 
ATOM   1941 C  CG    . ARG B 1 56  ? 15.061  70.961  -32.117  1.00 70.71  ?  56  ARG B CG    1 
ATOM   1942 C  CD    . ARG B 1 56  ? 16.252  71.542  -32.842  1.00 78.89  ?  56  ARG B CD    1 
ATOM   1943 N  NE    . ARG B 1 56  ? 17.385  71.770  -31.940  1.00 81.80  ?  56  ARG B NE    1 
ATOM   1944 C  CZ    . ARG B 1 56  ? 18.660  71.658  -32.302  1.00 89.03  ?  56  ARG B CZ    1 
ATOM   1945 N  NH1   . ARG B 1 56  ? 18.979  71.311  -33.543  1.00 70.92  ?  56  ARG B NH1   1 
ATOM   1946 N  NH2   . ARG B 1 56  ? 19.627  71.866  -31.418  1.00 74.84  ?  56  ARG B NH2   1 
ATOM   1947 N  N     . LYS B 1 57  ? 11.189  69.101  -34.070  1.00 60.38  ?  57  LYS B N     1 
ATOM   1948 C  CA    . LYS B 1 57  ? 9.933   69.076  -34.810  1.00 59.78  ?  57  LYS B CA    1 
ATOM   1949 C  C     . LYS B 1 57  ? 8.807   68.535  -33.929  1.00 63.48  ?  57  LYS B C     1 
ATOM   1950 O  O     . LYS B 1 57  ? 7.678   69.020  -34.025  1.00 64.92  ?  57  LYS B O     1 
ATOM   1951 C  CB    . LYS B 1 57  ? 10.070  68.288  -36.118  1.00 60.10  ?  57  LYS B CB    1 
ATOM   1952 C  CG    . LYS B 1 57  ? 10.893  69.025  -37.167  1.00 75.14  ?  57  LYS B CG    1 
ATOM   1953 C  CD    . LYS B 1 57  ? 10.971  68.266  -38.478  1.00 84.24  ?  57  LYS B CD    1 
ATOM   1954 C  CE    . LYS B 1 57  ? 11.742  69.028  -39.528  1.00 97.36  ?  57  LYS B CE    1 
ATOM   1955 N  NZ    . LYS B 1 57  ? 13.213  68.927  -39.320  1.00 110.91 ?  57  LYS B NZ    1 
ATOM   1956 N  N     . ARG B 1 58  ? 9.123   67.570  -33.036  1.00 58.41  ?  58  ARG B N     1 
ATOM   1957 C  CA    . ARG B 1 58  ? 8.148   66.985  -32.107  1.00 58.69  ?  58  ARG B CA    1 
ATOM   1958 C  C     . ARG B 1 58  ? 7.727   68.032  -31.086  1.00 66.55  ?  58  ARG B C     1 
ATOM   1959 O  O     . ARG B 1 58  ? 6.526   68.222  -30.892  1.00 68.23  ?  58  ARG B O     1 
ATOM   1960 C  CB    . ARG B 1 58  ? 8.700   65.742  -31.388  1.00 55.59  ?  58  ARG B CB    1 
ATOM   1961 C  CG    . ARG B 1 58  ? 9.038   64.583  -32.314  1.00 58.53  ?  58  ARG B CG    1 
ATOM   1962 C  CD    . ARG B 1 58  ? 9.187   63.260  -31.582  1.00 57.45  ?  58  ARG B CD    1 
ATOM   1963 N  NE    . ARG B 1 58  ? 10.287  63.249  -30.613  1.00 61.35  ?  58  ARG B NE    1 
ATOM   1964 C  CZ    . ARG B 1 58  ? 11.546  62.925  -30.896  1.00 73.41  ?  58  ARG B CZ    1 
ATOM   1965 N  NH1   . ARG B 1 58  ? 11.892  62.587  -32.133  1.00 63.08  ?  58  ARG B NH1   1 
ATOM   1966 N  NH2   . ARG B 1 58  ? 12.472  62.948  -29.950  1.00 55.60  ?  58  ARG B NH2   1 
ATOM   1967 N  N     . ILE B 1 59  ? 8.716   68.742  -30.469  1.00 64.01  ?  59  ILE B N     1 
ATOM   1968 C  CA    . ILE B 1 59  ? 8.480   69.801  -29.477  1.00 66.31  ?  59  ILE B CA    1 
ATOM   1969 C  C     . ILE B 1 59  ? 7.609   70.909  -30.086  1.00 73.76  ?  59  ILE B C     1 
ATOM   1970 O  O     . ILE B 1 59  ? 6.711   71.403  -29.406  1.00 75.37  ?  59  ILE B O     1 
ATOM   1971 C  CB    . ILE B 1 59  ? 9.790   70.341  -28.823  1.00 69.48  ?  59  ILE B CB    1 
ATOM   1972 C  CG1   . ILE B 1 59  ? 10.554  69.233  -28.059  1.00 68.02  ?  59  ILE B CG1   1 
ATOM   1973 C  CG2   . ILE B 1 59  ? 9.505   71.536  -27.905  1.00 73.51  ?  59  ILE B CG2   1 
ATOM   1974 C  CD1   . ILE B 1 59  ? 11.961  69.627  -27.542  1.00 73.23  ?  59  ILE B CD1   1 
ATOM   1975 N  N     . LYS B 1 60  ? 7.841   71.255  -31.376  1.00 71.67  ?  60  LYS B N     1 
ATOM   1976 C  CA    . LYS B 1 60  ? 7.062   72.274  -32.095  1.00 74.18  ?  60  LYS B CA    1 
ATOM   1977 C  C     . LYS B 1 60  ? 5.597   71.864  -32.185  1.00 79.81  ?  60  LYS B C     1 
ATOM   1978 O  O     . LYS B 1 60  ? 4.737   72.672  -31.846  1.00 82.73  ?  60  LYS B O     1 
ATOM   1979 C  CB    . LYS B 1 60  ? 7.638   72.565  -33.488  1.00 75.80  ?  60  LYS B CB    1 
ATOM   1980 C  CG    . LYS B 1 60  ? 7.178   73.902  -34.073  1.00 95.64  ?  60  LYS B CG    1 
ATOM   1981 C  CD    . LYS B 1 60  ? 7.397   73.935  -35.577  1.00 106.48 ?  60  LYS B CD    1 
ATOM   1982 C  CE    . LYS B 1 60  ? 6.998   75.236  -36.213  1.00 122.07 ?  60  LYS B CE    1 
ATOM   1983 N  NZ    . LYS B 1 60  ? 7.176   75.180  -37.687  1.00 133.98 ?  60  LYS B NZ    1 
ATOM   1984 N  N     . LEU B 1 61  ? 5.322   70.603  -32.575  1.00 74.41  ?  61  LEU B N     1 
ATOM   1985 C  CA    . LEU B 1 61  ? 3.967   70.052  -32.681  1.00 75.30  ?  61  LEU B CA    1 
ATOM   1986 C  C     . LEU B 1 61  ? 3.212   70.080  -31.343  1.00 81.88  ?  61  LEU B C     1 
ATOM   1987 O  O     . LEU B 1 61  ? 2.007   70.338  -31.331  1.00 83.60  ?  61  LEU B O     1 
ATOM   1988 C  CB    . LEU B 1 61  ? 4.007   68.627  -33.245  1.00 72.82  ?  61  LEU B CB    1 
ATOM   1989 C  CG    . LEU B 1 61  ? 4.294   68.513  -34.727  1.00 76.79  ?  61  LEU B CG    1 
ATOM   1990 C  CD1   . LEU B 1 61  ? 5.013   67.213  -35.045  1.00 74.64  ?  61  LEU B CD1   1 
ATOM   1991 C  CD2   . LEU B 1 61  ? 3.013   68.615  -35.533  1.00 81.15  ?  61  LEU B CD2   1 
ATOM   1992 N  N     . VAL B 1 62  ? 3.929   69.838  -30.225  1.00 78.40  ?  62  VAL B N     1 
ATOM   1993 C  CA    . VAL B 1 62  ? 3.373   69.866  -28.869  1.00 80.56  ?  62  VAL B CA    1 
ATOM   1994 C  C     . VAL B 1 62  ? 3.000   71.309  -28.524  1.00 89.21  ?  62  VAL B C     1 
ATOM   1995 O  O     . VAL B 1 62  ? 1.901   71.548  -28.029  1.00 91.48  ?  62  VAL B O     1 
ATOM   1996 C  CB    . VAL B 1 62  ? 4.321   69.229  -27.818  1.00 83.04  ?  62  VAL B CB    1 
ATOM   1997 C  CG1   . VAL B 1 62  ? 3.742   69.329  -26.406  1.00 85.37  ?  62  VAL B CG1   1 
ATOM   1998 C  CG2   . VAL B 1 62  ? 4.616   67.775  -28.162  1.00 79.89  ?  62  VAL B CG2   1 
ATOM   1999 N  N     . ALA B 1 63  ? 3.896   72.264  -28.835  1.00 86.89  ?  63  ALA B N     1 
ATOM   2000 C  CA    . ALA B 1 63  ? 3.705   73.696  -28.610  1.00 90.50  ?  63  ALA B CA    1 
ATOM   2001 C  C     . ALA B 1 63  ? 2.574   74.261  -29.469  1.00 97.53  ?  63  ALA B C     1 
ATOM   2002 O  O     . ALA B 1 63  ? 1.773   75.045  -28.961  1.00 100.76 ?  63  ALA B O     1 
ATOM   2003 C  CB    . ALA B 1 63  ? 4.995   74.442  -28.898  1.00 90.82  ?  63  ALA B CB    1 
ATOM   2004 N  N     . GLU B 1 64  ? 2.504   73.853  -30.757  1.00 92.81  ?  64  GLU B N     1 
ATOM   2005 C  CA    . GLU B 1 64  ? 1.487   74.289  -31.720  1.00 94.75  ?  64  GLU B CA    1 
ATOM   2006 C  C     . GLU B 1 64  ? 0.074   73.861  -31.323  1.00 101.85 ?  64  GLU B C     1 
ATOM   2007 O  O     . GLU B 1 64  ? -0.859  74.628  -31.535  1.00 104.52 ?  64  GLU B O     1 
ATOM   2008 C  CB    . GLU B 1 64  ? 1.822   73.808  -33.142  1.00 93.55  ?  64  GLU B CB    1 
ATOM   2009 C  CG    . GLU B 1 64  ? 2.947   74.585  -33.804  1.00 103.66 ?  64  GLU B CG    1 
ATOM   2010 C  CD    . GLU B 1 64  ? 3.289   74.212  -35.235  1.00 128.44 ?  64  GLU B CD    1 
ATOM   2011 O  OE1   . GLU B 1 64  ? 3.316   73.004  -35.571  1.00 122.31 ?  64  GLU B OE1   1 
ATOM   2012 O  OE2   . GLU B 1 64  ? 3.584   75.144  -36.015  1.00 127.95 -1 64  GLU B OE2   1 
ATOM   2013 N  N     . LYS B 1 65  ? -0.083  72.651  -30.745  1.00 98.34  ?  65  LYS B N     1 
ATOM   2014 C  CA    . LYS B 1 65  ? -1.381  72.131  -30.291  1.00 101.01 ?  65  LYS B CA    1 
ATOM   2015 C  C     . LYS B 1 65  ? -1.900  72.988  -29.138  1.00 112.23 ?  65  LYS B C     1 
ATOM   2016 O  O     . LYS B 1 65  ? -3.061  73.397  -29.135  1.00 115.22 ?  65  LYS B O     1 
ATOM   2017 C  CB    . LYS B 1 65  ? -1.268  70.661  -29.860  1.00 100.83 ?  65  LYS B CB    1 
ATOM   2018 C  CG    . LYS B 1 65  ? -1.286  69.675  -31.020  1.00 112.98 ?  65  LYS B CG    1 
ATOM   2019 C  CD    . LYS B 1 65  ? -0.975  68.257  -30.548  1.00 119.55 ?  65  LYS B CD    1 
ATOM   2020 C  CE    . LYS B 1 65  ? -0.813  67.274  -31.681  1.00 124.51 ?  65  LYS B CE    1 
ATOM   2021 N  NZ    . LYS B 1 65  ? -0.488  65.914  -31.174  1.00 128.69 ?  65  LYS B NZ    1 
ATOM   2022 N  N     . ASN B 1 66  ? -0.974  73.315  -28.204  1.00 111.52 ?  66  ASN B N     1 
ATOM   2023 C  CA    . ASN B 1 66  ? -1.177  74.150  -27.017  1.00 116.25 ?  66  ASN B CA    1 
ATOM   2024 C  C     . ASN B 1 66  ? -1.454  75.606  -27.398  1.00 126.49 ?  66  ASN B C     1 
ATOM   2025 O  O     . ASN B 1 66  ? -2.300  76.244  -26.768  1.00 129.92 ?  66  ASN B O     1 
ATOM   2026 C  CB    . ASN B 1 66  ? 0.054   74.092  -26.090  1.00 116.05 ?  66  ASN B CB    1 
ATOM   2027 C  CG    . ASN B 1 66  ? 0.402   72.735  -25.518  1.00 136.02 ?  66  ASN B CG    1 
ATOM   2028 O  OD1   . ASN B 1 66  ? -0.393  71.786  -25.516  1.00 131.10 ?  66  ASN B OD1   1 
ATOM   2029 N  ND2   . ASN B 1 66  ? 1.595   72.636  -24.951  1.00 125.52 ?  66  ASN B ND2   1 
ATOM   2030 N  N     . TYR B 1 67  ? -0.726  76.136  -28.407  1.00 124.20 ?  67  TYR B N     1 
ATOM   2031 C  CA    . TYR B 1 67  ? -0.896  77.514  -28.864  1.00 128.36 ?  67  TYR B CA    1 
ATOM   2032 C  C     . TYR B 1 67  ? -2.218  77.735  -29.611  1.00 136.48 ?  67  TYR B C     1 
ATOM   2033 O  O     . TYR B 1 67  ? -2.933  78.691  -29.297  1.00 140.18 ?  67  TYR B O     1 
ATOM   2034 C  CB    . TYR B 1 67  ? 0.321   78.027  -29.661  1.00 128.30 ?  67  TYR B CB    1 
ATOM   2035 C  CG    . TYR B 1 67  ? 0.315   79.534  -29.807  1.00 134.78 ?  67  TYR B CG    1 
ATOM   2036 C  CD1   . TYR B 1 67  ? 0.607   80.362  -28.726  1.00 140.01 ?  67  TYR B CD1   1 
ATOM   2037 C  CD2   . TYR B 1 67  ? -0.055  80.134  -31.009  1.00 136.85 ?  67  TYR B CD2   1 
ATOM   2038 C  CE1   . TYR B 1 67  ? 0.543   81.750  -28.838  1.00 145.26 ?  67  TYR B CE1   1 
ATOM   2039 C  CE2   . TYR B 1 67  ? -0.117  81.523  -31.134  1.00 141.89 ?  67  TYR B CE2   1 
ATOM   2040 C  CZ    . TYR B 1 67  ? 0.186   82.326  -30.046  1.00 153.22 ?  67  TYR B CZ    1 
ATOM   2041 O  OH    . TYR B 1 67  ? 0.128   83.694  -30.157  1.00 159.14 ?  67  TYR B OH    1 
ATOM   2042 N  N     . ASP B 1 68  ? -2.568  76.826  -30.553  1.00 132.14 ?  68  ASP B N     1 
ATOM   2043 C  CA    . ASP B 1 68  ? -3.814  76.881  -31.333  1.00 134.81 ?  68  ASP B CA    1 
ATOM   2044 C  C     . ASP B 1 68  ? -5.071  76.613  -30.474  1.00 143.29 ?  68  ASP B C     1 
ATOM   2045 O  O     . ASP B 1 68  ? -6.180  76.542  -31.013  1.00 145.23 ?  68  ASP B O     1 
ATOM   2046 C  CB    . ASP B 1 68  ? -3.758  75.908  -32.535  1.00 133.36 ?  68  ASP B CB    1 
ATOM   2047 C  CG    . ASP B 1 68  ? -2.683  76.185  -33.575  1.00 140.82 ?  68  ASP B CG    1 
ATOM   2048 O  OD1   . ASP B 1 68  ? -2.064  77.273  -33.524  1.00 143.04 ?  68  ASP B OD1   1 
ATOM   2049 O  OD2   . ASP B 1 68  ? -2.459  75.311  -34.440  1.00 142.89 -1 68  ASP B OD2   1 
ATOM   2050 N  N     . GLN B 1 69  ? -4.890  76.490  -29.139  1.00 141.30 ?  69  GLN B N     1 
ATOM   2051 C  CA    . GLN B 1 69  ? -5.925  76.229  -28.133  1.00 144.44 ?  69  GLN B CA    1 
ATOM   2052 C  C     . GLN B 1 69  ? -6.750  74.953  -28.389  1.00 149.03 ?  69  GLN B C     1 
ATOM   2053 O  O     . GLN B 1 69  ? -7.946  74.903  -28.077  1.00 152.14 ?  69  GLN B O     1 
ATOM   2054 C  CB    . GLN B 1 69  ? -6.778  77.477  -27.829  1.00 150.99 ?  69  GLN B CB    1 
ATOM   2055 C  CG    . GLN B 1 69  ? -6.075  78.467  -26.907  1.00 163.71 ?  69  GLN B CG    1 
ATOM   2056 C  CD    . GLN B 1 69  ? -6.957  79.638  -26.550  1.00 186.02 ?  69  GLN B CD    1 
ATOM   2057 O  OE1   . GLN B 1 69  ? -6.915  80.696  -27.185  1.00 183.29 ?  69  GLN B OE1   1 
ATOM   2058 N  NE2   . GLN B 1 69  ? -7.765  79.482  -25.512  1.00 180.05 ?  69  GLN B NE2   1 
ATOM   2059 N  N     . ILE B 1 70  ? -6.081  73.912  -28.945  1.00 139.89 ?  70  ILE B N     1 
ATOM   2060 C  CA    . ILE B 1 70  ? -6.659  72.588  -29.210  1.00 135.73 ?  70  ILE B CA    1 
ATOM   2061 C  C     . ILE B 1 70  ? -6.767  71.902  -27.838  1.00 137.04 ?  70  ILE B C     1 
ATOM   2062 O  O     . ILE B 1 70  ? -5.759  71.770  -27.136  1.00 136.88 ?  70  ILE B O     1 
ATOM   2063 C  CB    . ILE B 1 70  ? -5.828  71.772  -30.253  1.00 139.59 ?  70  ILE B CB    1 
ATOM   2064 C  CG1   . ILE B 1 70  ? -5.652  72.564  -31.577  1.00 144.88 ?  70  ILE B CG1   1 
ATOM   2065 C  CG2   . ILE B 1 70  ? -6.466  70.397  -30.513  1.00 136.13 ?  70  ILE B CG2   1 
ATOM   2066 C  CD1   . ILE B 1 70  ? -4.488  72.124  -32.485  1.00 153.66 ?  70  ILE B CD1   1 
ATOM   2067 N  N     . SER B 1 71  ? -8.007  71.525  -27.451  1.00 131.48 ?  71  SER B N     1 
ATOM   2068 C  CA    . SER B 1 71  ? -8.413  70.951  -26.157  1.00 128.33 ?  71  SER B CA    1 
ATOM   2069 C  C     . SER B 1 71  ? -8.367  72.027  -25.054  1.00 134.33 ?  71  SER B C     1 
ATOM   2070 O  O     . SER B 1 71  ? -7.288  72.432  -24.608  1.00 136.00 ?  71  SER B O     1 
ATOM   2071 C  CB    . SER B 1 71  ? -7.624  69.690  -25.790  1.00 130.05 ?  71  SER B CB    1 
ATOM   2072 O  OG    . SER B 1 71  ? -8.048  69.133  -24.553  1.00 136.02 ?  71  SER B OG    1 
ATOM   2073 N  N     . SER B 1 72  ? -9.562  72.513  -24.659  1.00 130.39 ?  72  SER B N     1 
ATOM   2074 C  CA    . SER B 1 72  ? -9.770  73.548  -23.642  1.00 131.74 ?  72  SER B CA    1 
ATOM   2075 C  C     . SER B 1 72  ? -9.422  73.056  -22.234  1.00 133.13 ?  72  SER B C     1 
ATOM   2076 O  O     . SER B 1 72  ? -9.293  71.846  -22.016  1.00 129.79 ?  72  SER B O     1 
ATOM   2077 C  CB    . SER B 1 72  ? -11.220 74.029  -23.673  1.00 134.93 ?  72  SER B CB    1 
ATOM   2078 O  OG    . SER B 1 72  ? -12.129 72.991  -23.340  1.00 138.34 ?  72  SER B OG    1 
ATOM   2079 N  N     . ILE B 1 73  ? -9.298  74.000  -21.275  1.00 131.05 ?  73  ILE B N     1 
ATOM   2080 C  CA    . ILE B 1 73  ? -9.020  73.715  -19.862  1.00 129.22 ?  73  ILE B CA    1 
ATOM   2081 C  C     . ILE B 1 73  ? -10.184 72.891  -19.272  1.00 127.09 ?  73  ILE B C     1 
ATOM   2082 O  O     . ILE B 1 73  ? -9.935  71.908  -18.571  1.00 123.99 ?  73  ILE B O     1 
ATOM   2083 C  CB    . ILE B 1 73  ? -8.678  75.023  -19.071  1.00 136.51 ?  73  ILE B CB    1 
ATOM   2084 C  CG1   . ILE B 1 73  ? -7.335  75.628  -19.568  1.00 140.84 ?  73  ILE B CG1   1 
ATOM   2085 C  CG2   . ILE B 1 73  ? -8.629  74.789  -17.551  1.00 136.13 ?  73  ILE B CG2   1 
ATOM   2086 C  CD1   . ILE B 1 73  ? -7.241  77.162  -19.533  1.00 152.99 ?  73  ILE B CD1   1 
ATOM   2087 N  N     . GLU B 1 74  ? -11.438 73.245  -19.641  1.00 122.13 ?  74  GLU B N     1 
ATOM   2088 C  CA    . GLU B 1 74  ? -12.681 72.568  -19.235  1.00 118.35 ?  74  GLU B CA    1 
ATOM   2089 C  C     . GLU B 1 74  ? -12.663 71.081  -19.635  1.00 116.36 ?  74  GLU B C     1 
ATOM   2090 O  O     . GLU B 1 74  ? -13.062 70.223  -18.841  1.00 113.73 ?  74  GLU B O     1 
ATOM   2091 C  CB    . GLU B 1 74  ? -13.913 73.258  -19.864  1.00 120.90 ?  74  GLU B CB    1 
ATOM   2092 C  CG    . GLU B 1 74  ? -14.218 74.656  -19.340  1.00 136.13 ?  74  GLU B CG    1 
ATOM   2093 C  CD    . GLU B 1 74  ? -13.485 75.820  -19.985  1.00 164.43 ?  74  GLU B CD    1 
ATOM   2094 O  OE1   . GLU B 1 74  ? -13.163 75.742  -21.194  1.00 162.27 ?  74  GLU B OE1   1 
ATOM   2095 O  OE2   . GLU B 1 74  ? -13.276 76.839  -19.287  1.00 161.21 ?  74  GLU B OE2   1 
ATOM   2096 N  N     . GLU B 1 75  ? -12.176 70.795  -20.863  1.00 110.80 ?  75  GLU B N     1 
ATOM   2097 C  CA    . GLU B 1 75  ? -12.054 69.466  -21.468  1.00 107.17 ?  75  GLU B CA    1 
ATOM   2098 C  C     . GLU B 1 75  ? -10.997 68.590  -20.765  1.00 106.26 ?  75  GLU B C     1 
ATOM   2099 O  O     . GLU B 1 75  ? -11.097 67.361  -20.801  1.00 103.20 ?  75  GLU B O     1 
ATOM   2100 C  CB    . GLU B 1 75  ? -11.699 69.627  -22.955  1.00 110.34 ?  75  GLU B CB    1 
ATOM   2101 C  CG    . GLU B 1 75  ? -12.013 68.425  -23.830  1.00 120.44 ?  75  GLU B CG    1 
ATOM   2102 C  CD    . GLU B 1 75  ? -11.329 68.439  -25.184  1.00 140.45 ?  75  GLU B CD    1 
ATOM   2103 O  OE1   . GLU B 1 75  ? -11.563 69.391  -25.965  1.00 139.62 ?  75  GLU B OE1   1 
ATOM   2104 O  OE2   . GLU B 1 75  ? -10.567 67.487  -25.470  1.00 129.64 ?  75  GLU B OE2   1 
ATOM   2105 N  N     . GLN B 1 76  ? -9.988  69.223  -20.145  1.00 102.59 ?  76  GLN B N     1 
ATOM   2106 C  CA    . GLN B 1 76  ? -8.892  68.547  -19.443  1.00 101.11 ?  76  GLN B CA    1 
ATOM   2107 C  C     . GLN B 1 76  ? -9.233  68.171  -17.990  1.00 100.94 ?  76  GLN B C     1 
ATOM   2108 O  O     . GLN B 1 76  ? -8.723  67.167  -17.493  1.00 99.54  ?  76  GLN B O     1 
ATOM   2109 C  CB    . GLN B 1 76  ? -7.615  69.404  -19.501  1.00 105.86 ?  76  GLN B CB    1 
ATOM   2110 C  CG    . GLN B 1 76  ? -7.029  69.540  -20.912  1.00 125.43 ?  76  GLN B CG    1 
ATOM   2111 C  CD    . GLN B 1 76  ? -6.314  70.851  -21.171  1.00 151.39 ?  76  GLN B CD    1 
ATOM   2112 O  OE1   . GLN B 1 76  ? -6.227  71.743  -20.314  1.00 149.34 ?  76  GLN B OE1   1 
ATOM   2113 N  NE2   . GLN B 1 76  ? -5.797  71.004  -22.381  1.00 145.80 ?  76  GLN B NE2   1 
ATOM   2114 N  N     . GLU B 1 77  ? -10.092 68.976  -17.322  1.00 95.50  ?  77  GLU B N     1 
ATOM   2115 C  CA    . GLU B 1 77  ? -10.540 68.820  -15.928  1.00 93.51  ?  77  GLU B CA    1 
ATOM   2116 C  C     . GLU B 1 77  ? -11.765 67.877  -15.794  1.00 90.91  ?  77  GLU B C     1 
ATOM   2117 O  O     . GLU B 1 77  ? -12.296 67.695  -14.687  1.00 90.32  ?  77  GLU B O     1 
ATOM   2118 C  CB    . GLU B 1 77  ? -10.922 70.207  -15.352  1.00 97.58  ?  77  GLU B CB    1 
ATOM   2119 C  CG    . GLU B 1 77  ? -9.809  71.248  -15.304  1.00 112.98 ?  77  GLU B CG    1 
ATOM   2120 C  CD    . GLU B 1 77  ? -10.212 72.645  -14.853  1.00 136.16 ?  77  GLU B CD    1 
ATOM   2121 O  OE1   . GLU B 1 77  ? -11.370 73.055  -15.105  1.00 125.06 ?  77  GLU B OE1   1 
ATOM   2122 O  OE2   . GLU B 1 77  ? -9.364  73.328  -14.232  1.00 132.49 ?  77  GLU B OE2   1 
ATOM   2123 N  N     . PHE B 1 78  ? -12.195 67.280  -16.918  1.00 82.51  ?  78  PHE B N     1 
ATOM   2124 C  CA    . PHE B 1 78  ? -13.390 66.461  -17.069  1.00 79.13  ?  78  PHE B CA    1 
ATOM   2125 C  C     . PHE B 1 78  ? -13.137 64.958  -16.941  1.00 80.66  ?  78  PHE B C     1 
ATOM   2126 O  O     . PHE B 1 78  ? -12.218 64.442  -17.585  1.00 80.69  ?  78  PHE B O     1 
ATOM   2127 C  CB    . PHE B 1 78  ? -14.024 66.815  -18.422  1.00 80.09  ?  78  PHE B CB    1 
ATOM   2128 C  CG    . PHE B 1 78  ? -15.359 66.181  -18.700  1.00 79.66  ?  78  PHE B CG    1 
ATOM   2129 C  CD1   . PHE B 1 78  ? -16.535 66.777  -18.263  1.00 83.35  ?  78  PHE B CD1   1 
ATOM   2130 C  CD2   . PHE B 1 78  ? -15.444 64.999  -19.416  1.00 79.72  ?  78  PHE B CD2   1 
ATOM   2131 C  CE1   . PHE B 1 78  ? -17.773 66.193  -18.535  1.00 83.05  ?  78  PHE B CE1   1 
ATOM   2132 C  CE2   . PHE B 1 78  ? -16.679 64.415  -19.686  1.00 81.59  ?  78  PHE B CE2   1 
ATOM   2133 C  CZ    . PHE B 1 78  ? -17.835 65.016  -19.246  1.00 80.36  ?  78  PHE B CZ    1 
ATOM   2134 N  N     . ILE B 1 79  ? -13.951 64.259  -16.102  1.00 74.42  ?  79  ILE B N     1 
ATOM   2135 C  CA    . ILE B 1 79  ? -13.847 62.809  -15.916  1.00 72.34  ?  79  ILE B CA    1 
ATOM   2136 C  C     . ILE B 1 79  ? -14.693 62.116  -16.972  1.00 74.16  ?  79  ILE B C     1 
ATOM   2137 O  O     . ILE B 1 79  ? -15.901 62.338  -17.049  1.00 74.16  ?  79  ILE B O     1 
ATOM   2138 C  CB    . ILE B 1 79  ? -14.127 62.326  -14.456  1.00 75.37  ?  79  ILE B CB    1 
ATOM   2139 C  CG1   . ILE B 1 79  ? -13.214 63.028  -13.385  1.00 76.99  ?  79  ILE B CG1   1 
ATOM   2140 C  CG2   . ILE B 1 79  ? -14.139 60.782  -14.338  1.00 75.41  ?  79  ILE B CG2   1 
ATOM   2141 C  CD1   . ILE B 1 79  ? -11.726 63.304  -13.641  1.00 86.24  ?  79  ILE B CD1   1 
ATOM   2142 N  N     . GLY B 1 80  ? -14.031 61.314  -17.793  1.00 69.30  ?  80  GLY B N     1 
ATOM   2143 C  CA    . GLY B 1 80  ? -14.656 60.602  -18.897  1.00 68.30  ?  80  GLY B CA    1 
ATOM   2144 C  C     . GLY B 1 80  ? -14.503 61.340  -20.209  1.00 71.47  ?  80  GLY B C     1 
ATOM   2145 O  O     . GLY B 1 80  ? -13.729 62.299  -20.298  1.00 73.05  ?  80  GLY B O     1 
ATOM   2146 N  N     . ASP B 1 81  ? -15.219 60.884  -21.241  1.00 65.51  ?  81  ASP B N     1 
ATOM   2147 C  CA    . ASP B 1 81  ? -15.208 61.493  -22.566  1.00 65.11  ?  81  ASP B CA    1 
ATOM   2148 C  C     . ASP B 1 81  ? -16.600 61.994  -22.853  1.00 65.92  ?  81  ASP B C     1 
ATOM   2149 O  O     . ASP B 1 81  ? -17.549 61.218  -22.799  1.00 64.75  ?  81  ASP B O     1 
ATOM   2150 C  CB    . ASP B 1 81  ? -14.769 60.481  -23.633  1.00 67.77  ?  81  ASP B CB    1 
ATOM   2151 C  CG    . ASP B 1 81  ? -13.319 60.067  -23.508  1.00 85.35  ?  81  ASP B CG    1 
ATOM   2152 O  OD1   . ASP B 1 81  ? -12.963 59.448  -22.477  1.00 93.32  -1 81  ASP B OD1   1 
ATOM   2153 O  OD2   . ASP B 1 81  ? -12.534 60.353  -24.447  1.00 87.91  ?  81  ASP B OD2   1 
ATOM   2154 N  N     . LEU B 1 82  ? -16.743 63.303  -23.103  1.00 61.24  ?  82  LEU B N     1 
ATOM   2155 C  CA    . LEU B 1 82  ? -18.047 63.897  -23.393  1.00 59.98  ?  82  LEU B CA    1 
ATOM   2156 C  C     . LEU B 1 82  ? -18.439 63.574  -24.833  1.00 62.62  ?  82  LEU B C     1 
ATOM   2157 O  O     . LEU B 1 82  ? -17.711 63.919  -25.772  1.00 63.27  ?  82  LEU B O     1 
ATOM   2158 C  CB    . LEU B 1 82  ? -18.033 65.409  -23.137  1.00 60.64  ?  82  LEU B CB    1 
ATOM   2159 C  CG    . LEU B 1 82  ? -19.370 66.130  -23.091  1.00 64.29  ?  82  LEU B CG    1 
ATOM   2160 C  CD1   . LEU B 1 82  ? -20.278 65.541  -22.041  1.00 63.20  ?  82  LEU B CD1   1 
ATOM   2161 C  CD2   . LEU B 1 82  ? -19.158 67.591  -22.838  1.00 66.41  ?  82  LEU B CD2   1 
ATOM   2162 N  N     . ILE B 1 83  ? -19.579 62.886  -24.988  1.00 56.40  ?  83  ILE B N     1 
ATOM   2163 C  CA    . ILE B 1 83  ? -20.073 62.422  -26.271  1.00 55.82  ?  83  ILE B CA    1 
ATOM   2164 C  C     . ILE B 1 83  ? -21.104 63.357  -26.911  1.00 60.33  ?  83  ILE B C     1 
ATOM   2165 O  O     . ILE B 1 83  ? -20.967 63.702  -28.085  1.00 60.92  ?  83  ILE B O     1 
ATOM   2166 C  CB    . ILE B 1 83  ? -20.492 60.916  -26.147  1.00 57.70  ?  83  ILE B CB    1 
ATOM   2167 C  CG1   . ILE B 1 83  ? -19.333 59.983  -26.520  1.00 57.31  ?  83  ILE B CG1   1 
ATOM   2168 C  CG2   . ILE B 1 83  ? -21.727 60.542  -26.974  1.00 59.78  ?  83  ILE B CG2   1 
ATOM   2169 C  CD1   . ILE B 1 83  ? -18.132 59.998  -25.679  1.00 61.79  ?  83  ILE B CD1   1 
ATOM   2170 N  N     . GLN B 1 84  ? -22.119 63.769  -26.143  1.00 57.03  ?  84  GLN B N     1 
ATOM   2171 C  CA    . GLN B 1 84  ? -23.211 64.605  -26.631  1.00 58.89  ?  84  GLN B CA    1 
ATOM   2172 C  C     . GLN B 1 84  ? -23.721 65.525  -25.519  1.00 64.20  ?  84  GLN B C     1 
ATOM   2173 O  O     . GLN B 1 84  ? -23.809 65.105  -24.367  1.00 62.88  ?  84  GLN B O     1 
ATOM   2174 C  CB    . GLN B 1 84  ? -24.307 63.682  -27.184  1.00 60.76  ?  84  GLN B CB    1 
ATOM   2175 C  CG    . GLN B 1 84  ? -25.668 64.275  -27.474  1.00 83.46  ?  84  GLN B CG    1 
ATOM   2176 C  CD    . GLN B 1 84  ? -26.632 63.124  -27.583  1.00 104.58 ?  84  GLN B CD    1 
ATOM   2177 O  OE1   . GLN B 1 84  ? -26.654 62.397  -28.588  1.00 95.08  ?  84  GLN B OE1   1 
ATOM   2178 N  NE2   . GLN B 1 84  ? -27.410 62.894  -26.524  1.00 101.47 ?  84  GLN B NE2   1 
ATOM   2179 N  N     . VAL B 1 85  ? -24.023 66.789  -25.872  1.00 63.55  ?  85  VAL B N     1 
ATOM   2180 C  CA    . VAL B 1 85  ? -24.530 67.820  -24.965  1.00 64.99  ?  85  VAL B CA    1 
ATOM   2181 C  C     . VAL B 1 85  ? -25.634 68.642  -25.625  1.00 73.12  ?  85  VAL B C     1 
ATOM   2182 O  O     . VAL B 1 85  ? -25.454 69.165  -26.731  1.00 75.01  ?  85  VAL B O     1 
ATOM   2183 C  CB    . VAL B 1 85  ? -23.398 68.726  -24.392  1.00 69.15  ?  85  VAL B CB    1 
ATOM   2184 C  CG1   . VAL B 1 85  ? -23.925 70.070  -23.895  1.00 71.35  ?  85  VAL B CG1   1 
ATOM   2185 C  CG2   . VAL B 1 85  ? -22.665 68.030  -23.271  1.00 66.75  ?  85  VAL B CG2   1 
ATOM   2186 N  N     . ASN B 1 86  ? -26.769 68.757  -24.927  1.00 70.68  ?  86  ASN B N     1 
ATOM   2187 C  CA    . ASN B 1 86  ? -27.897 69.609  -25.285  1.00 73.79  ?  86  ASN B CA    1 
ATOM   2188 C  C     . ASN B 1 86  ? -27.962 70.564  -24.086  1.00 79.81  ?  86  ASN B C     1 
ATOM   2189 O  O     . ASN B 1 86  ? -28.387 70.138  -23.003  1.00 78.85  ?  86  ASN B O     1 
ATOM   2190 C  CB    . ASN B 1 86  ? -29.185 68.797  -25.446  1.00 74.98  ?  86  ASN B CB    1 
ATOM   2191 C  CG    . ASN B 1 86  ? -30.342 69.557  -26.053  1.00 98.70  ?  86  ASN B CG    1 
ATOM   2192 O  OD1   . ASN B 1 86  ? -30.359 70.796  -26.133  1.00 96.91  ?  86  ASN B OD1   1 
ATOM   2193 N  ND2   . ASN B 1 86  ? -31.362 68.817  -26.462  1.00 88.90  ?  86  ASN B ND2   1 
ATOM   2194 N  N     . PRO B 1 87  ? -27.405 71.798  -24.211  1.00 78.85  ?  87  PRO B N     1 
ATOM   2195 C  CA    . PRO B 1 87  ? -27.311 72.698  -23.047  1.00 80.10  ?  87  PRO B CA    1 
ATOM   2196 C  C     . PRO B 1 87  ? -28.569 72.843  -22.208  1.00 86.32  ?  87  PRO B C     1 
ATOM   2197 O  O     . PRO B 1 87  ? -29.645 73.143  -22.737  1.00 89.45  ?  87  PRO B O     1 
ATOM   2198 C  CB    . PRO B 1 87  ? -26.835 74.015  -23.648  1.00 84.86  ?  87  PRO B CB    1 
ATOM   2199 C  CG    . PRO B 1 87  ? -26.057 73.604  -24.818  1.00 88.77  ?  87  PRO B CG    1 
ATOM   2200 C  CD    . PRO B 1 87  ? -26.786 72.418  -25.396  1.00 82.52  ?  87  PRO B CD    1 
ATOM   2201 N  N     . ASN B 1 88  ? -28.424 72.559  -20.896  1.00 80.26  ?  88  ASN B N     1 
ATOM   2202 C  CA    . ASN B 1 88  ? -29.469 72.616  -19.876  1.00 80.85  ?  88  ASN B CA    1 
ATOM   2203 C  C     . ASN B 1 88  ? -30.642 71.649  -20.155  1.00 85.01  ?  88  ASN B C     1 
ATOM   2204 O  O     . ASN B 1 88  ? -31.739 71.848  -19.621  1.00 87.62  ?  88  ASN B O     1 
ATOM   2205 C  CB    . ASN B 1 88  ? -29.942 74.068  -19.643  1.00 83.49  ?  88  ASN B CB    1 
ATOM   2206 C  CG    . ASN B 1 88  ? -28.829 75.091  -19.588  1.00 98.90  ?  88  ASN B CG    1 
ATOM   2207 O  OD1   . ASN B 1 88  ? -27.964 75.069  -18.707  1.00 89.92  ?  88  ASN B OD1   1 
ATOM   2208 N  ND2   . ASN B 1 88  ? -28.836 76.023  -20.528  1.00 91.83  ?  88  ASN B ND2   1 
ATOM   2209 N  N     . VAL B 1 89  ? -30.407 70.590  -20.972  1.00 78.93  ?  89  VAL B N     1 
ATOM   2210 C  CA    . VAL B 1 89  ? -31.431 69.595  -21.326  1.00 78.94  ?  89  VAL B CA    1 
ATOM   2211 C  C     . VAL B 1 89  ? -30.973 68.161  -20.990  1.00 81.39  ?  89  VAL B C     1 
ATOM   2212 O  O     . VAL B 1 89  ? -31.423 67.598  -19.991  1.00 81.63  ?  89  VAL B O     1 
ATOM   2213 C  CB    . VAL B 1 89  ? -31.946 69.723  -22.792  1.00 84.09  ?  89  VAL B CB    1 
ATOM   2214 C  CG1   . VAL B 1 89  ? -33.066 68.726  -23.075  1.00 84.46  ?  89  VAL B CG1   1 
ATOM   2215 C  CG2   . VAL B 1 89  ? -32.407 71.143  -23.114  1.00 87.39  ?  89  VAL B CG2   1 
ATOM   2216 N  N     . LYS B 1 90  ? -30.100 67.575  -21.833  1.00 76.03  ?  90  LYS B N     1 
ATOM   2217 C  CA    . LYS B 1 90  ? -29.586 66.212  -21.691  1.00 73.38  ?  90  LYS B CA    1 
ATOM   2218 C  C     . LYS B 1 90  ? -28.136 66.147  -22.179  1.00 76.09  ?  90  LYS B C     1 
ATOM   2219 O  O     . LYS B 1 90  ? -27.785 66.792  -23.175  1.00 77.78  ?  90  LYS B O     1 
ATOM   2220 C  CB    . LYS B 1 90  ? -30.473 65.221  -22.483  1.00 76.48  ?  90  LYS B CB    1 
ATOM   2221 C  CG    . LYS B 1 90  ? -30.119 63.740  -22.306  1.00 88.27  ?  90  LYS B CG    1 
ATOM   2222 C  CD    . LYS B 1 90  ? -30.695 62.889  -23.417  1.00 102.72 ?  90  LYS B CD    1 
ATOM   2223 C  CE    . LYS B 1 90  ? -30.029 61.539  -23.514  1.00 121.98 ?  90  LYS B CE    1 
ATOM   2224 N  NZ    . LYS B 1 90  ? -30.522 60.775  -24.694  1.00 139.16 ?  90  LYS B NZ    1 
ATOM   2225 N  N     . ALA B 1 91  ? -27.303 65.351  -21.487  1.00 69.09  ?  91  ALA B N     1 
ATOM   2226 C  CA    . ALA B 1 91  ? -25.897 65.147  -21.837  1.00 66.47  ?  91  ALA B CA    1 
ATOM   2227 C  C     . ALA B 1 91  ? -25.448 63.708  -21.566  1.00 67.32  ?  91  ALA B C     1 
ATOM   2228 O  O     . ALA B 1 91  ? -25.985 63.064  -20.670  1.00 66.25  ?  91  ALA B O     1 
ATOM   2229 C  CB    . ALA B 1 91  ? -25.027 66.123  -21.064  1.00 67.11  ?  91  ALA B CB    1 
ATOM   2230 N  N     . GLN B 1 92  ? -24.464 63.205  -22.333  1.00 62.98  ?  92  GLN B N     1 
ATOM   2231 C  CA    . GLN B 1 92  ? -23.910 61.859  -22.164  1.00 61.56  ?  92  GLN B CA    1 
ATOM   2232 C  C     . GLN B 1 92  ? -22.381 61.840  -22.273  1.00 65.11  ?  92  GLN B C     1 
ATOM   2233 O  O     . GLN B 1 92  ? -21.812 62.360  -23.242  1.00 64.91  ?  92  GLN B O     1 
ATOM   2234 C  CB    . GLN B 1 92  ? -24.538 60.856  -23.150  1.00 63.52  ?  92  GLN B CB    1 
ATOM   2235 C  CG    . GLN B 1 92  ? -23.961 59.433  -23.057  1.00 72.81  ?  92  GLN B CG    1 
ATOM   2236 C  CD    . GLN B 1 92  ? -24.441 58.485  -24.128  1.00 82.59  ?  92  GLN B CD    1 
ATOM   2237 O  OE1   . GLN B 1 92  ? -23.656 58.008  -24.956  1.00 71.86  ?  92  GLN B OE1   1 
ATOM   2238 N  NE2   . GLN B 1 92  ? -25.720 58.113  -24.074  1.00 76.47  ?  92  GLN B NE2   1 
ATOM   2239 N  N     . SER B 1 93  ? -21.733 61.216  -21.270  1.00 61.21  ?  93  SER B N     1 
ATOM   2240 C  CA    . SER B 1 93  ? -20.292 61.003  -21.191  1.00 60.24  ?  93  SER B CA    1 
ATOM   2241 C  C     . SER B 1 93  ? -19.985 59.515  -21.077  1.00 63.64  ?  93  SER B C     1 
ATOM   2242 O  O     . SER B 1 93  ? -20.792 58.734  -20.571  1.00 63.69  ?  93  SER B O     1 
ATOM   2243 C  CB    . SER B 1 93  ? -19.666 61.778  -20.034  1.00 64.46  ?  93  SER B CB    1 
ATOM   2244 O  OG    . SER B 1 93  ? -19.797 61.134  -18.776  1.00 73.97  ?  93  SER B OG    1 
ATOM   2245 N  N     . ILE B 1 94  ? -18.808 59.136  -21.541  1.00 59.94  ?  94  ILE B N     1 
ATOM   2246 C  CA    . ILE B 1 94  ? -18.335 57.763  -21.569  1.00 59.76  ?  94  ILE B CA    1 
ATOM   2247 C  C     . ILE B 1 94  ? -17.122 57.596  -20.672  1.00 63.86  ?  94  ILE B C     1 
ATOM   2248 O  O     . ILE B 1 94  ? -16.337 58.535  -20.525  1.00 63.63  ?  94  ILE B O     1 
ATOM   2249 C  CB    . ILE B 1 94  ? -18.111 57.399  -23.068  1.00 63.37  ?  94  ILE B CB    1 
ATOM   2250 C  CG1   . ILE B 1 94  ? -19.143 56.421  -23.553  1.00 65.80  ?  94  ILE B CG1   1 
ATOM   2251 C  CG2   . ILE B 1 94  ? -16.697 57.010  -23.478  1.00 63.22  ?  94  ILE B CG2   1 
ATOM   2252 C  CD1   . ILE B 1 94  ? -20.595 56.947  -23.433  1.00 80.89  ?  94  ILE B CD1   1 
ATOM   2253 N  N     . LEU B 1 95  ? -16.979 56.427  -20.044  1.00 60.29  ?  95  LEU B N     1 
ATOM   2254 C  CA    . LEU B 1 95  ? -15.815 56.194  -19.201  1.00 60.27  ?  95  LEU B CA    1 
ATOM   2255 C  C     . LEU B 1 95  ? -15.367 54.759  -19.260  1.00 67.73  ?  95  LEU B C     1 
ATOM   2256 O  O     . LEU B 1 95  ? -16.077 53.867  -18.801  1.00 68.92  ?  95  LEU B O     1 
ATOM   2257 C  CB    . LEU B 1 95  ? -16.042 56.661  -17.752  1.00 59.97  ?  95  LEU B CB    1 
ATOM   2258 C  CG    . LEU B 1 95  ? -14.883 56.475  -16.764  1.00 64.78  ?  95  LEU B CG    1 
ATOM   2259 C  CD1   . LEU B 1 95  ? -13.773 57.473  -17.004  1.00 64.38  ?  95  LEU B CD1   1 
ATOM   2260 C  CD2   . LEU B 1 95  ? -15.364 56.644  -15.360  1.00 68.66  ?  95  LEU B CD2   1 
ATOM   2261 N  N     . ASP B 1 96  ? -14.188 54.530  -19.838  1.00 66.51  ?  96  ASP B N     1 
ATOM   2262 C  CA    . ASP B 1 96  ? -13.638 53.188  -19.909  1.00 68.53  ?  96  ASP B CA    1 
ATOM   2263 C  C     . ASP B 1 96  ? -12.958 52.881  -18.582  1.00 73.75  ?  96  ASP B C     1 
ATOM   2264 O  O     . ASP B 1 96  ? -12.112 53.657  -18.124  1.00 73.70  ?  96  ASP B O     1 
ATOM   2265 C  CB    . ASP B 1 96  ? -12.677 53.024  -21.095  1.00 71.19  ?  96  ASP B CB    1 
ATOM   2266 C  CG    . ASP B 1 96  ? -12.207 51.596  -21.270  1.00 85.57  ?  96  ASP B CG    1 
ATOM   2267 O  OD1   . ASP B 1 96  ? -13.058 50.716  -21.565  1.00 93.77  -1 96  ASP B OD1   1 
ATOM   2268 O  OD2   . ASP B 1 96  ? -11.011 51.345  -21.057  1.00 87.68  ?  96  ASP B OD2   1 
ATOM   2269 N  N     . ILE B 1 97  ? -13.367 51.775  -17.945  1.00 71.14  ?  97  ILE B N     1 
ATOM   2270 C  CA    . ILE B 1 97  ? -12.826 51.361  -16.657  1.00 71.91  ?  97  ILE B CA    1 
ATOM   2271 C  C     . ILE B 1 97  ? -11.500 50.619  -16.834  1.00 78.42  ?  97  ILE B C     1 
ATOM   2272 O  O     . ILE B 1 97  ? -11.472 49.459  -17.262  1.00 79.66  ?  97  ILE B O     1 
ATOM   2273 C  CB    . ILE B 1 97  ? -13.874 50.621  -15.779  1.00 76.01  ?  97  ILE B CB    1 
ATOM   2274 C  CG1   . ILE B 1 97  ? -15.193 51.438  -15.630  1.00 74.90  ?  97  ILE B CG1   1 
ATOM   2275 C  CG2   . ILE B 1 97  ? -13.301 50.208  -14.424  1.00 78.22  ?  97  ILE B CG2   1 
ATOM   2276 C  CD1   . ILE B 1 97  ? -15.138 52.818  -14.893  1.00 78.05  ?  97  ILE B CD1   1 
ATOM   2277 N  N     . THR B 1 98  ? -10.397 51.333  -16.535  1.00 75.36  ?  98  THR B N     1 
ATOM   2278 C  CA    . THR B 1 98  ? -9.023  50.836  -16.618  1.00 76.78  ?  98  THR B CA    1 
ATOM   2279 C  C     . THR B 1 98  ? -8.590  50.264  -15.267  1.00 83.21  ?  98  THR B C     1 
ATOM   2280 O  O     . THR B 1 98  ? -9.309  50.422  -14.276  1.00 82.69  ?  98  THR B O     1 
ATOM   2281 C  CB    . THR B 1 98  ? -8.075  51.955  -17.079  1.00 82.85  ?  98  THR B CB    1 
ATOM   2282 O  OG1   . THR B 1 98  ? -8.130  53.047  -16.159  1.00 81.04  ?  98  THR B OG1   1 
ATOM   2283 C  CG2   . THR B 1 98  ? -8.361  52.428  -18.494  1.00 81.35  ?  98  THR B CG2   1 
ATOM   2284 N  N     . SER B 1 99  ? -7.408  49.611  -15.227  1.00 82.48  ?  99  SER B N     1 
ATOM   2285 C  CA    . SER B 1 99  ? -6.816  49.012  -14.024  1.00 85.00  ?  99  SER B CA    1 
ATOM   2286 C  C     . SER B 1 99  ? -6.614  50.017  -12.890  1.00 89.69  ?  99  SER B C     1 
ATOM   2287 O  O     . SER B 1 99  ? -6.612  49.634  -11.719  1.00 91.40  ?  99  SER B O     1 
ATOM   2288 C  CB    . SER B 1 99  ? -5.502  48.313  -14.362  1.00 90.89  ?  99  SER B CB    1 
ATOM   2289 O  OG    . SER B 1 99  ? -4.644  49.133  -15.137  1.00 99.29  ?  99  SER B OG    1 
ATOM   2290 N  N     . ASP B 1 100 ? -6.483  51.299  -13.243  1.00 85.55  ?  100 ASP B N     1 
ATOM   2291 C  CA    . ASP B 1 100 ? -6.275  52.411  -12.322  1.00 86.20  ?  100 ASP B CA    1 
ATOM   2292 C  C     . ASP B 1 100 ? -7.551  52.822  -11.589  1.00 89.78  ?  100 ASP B C     1 
ATOM   2293 O  O     . ASP B 1 100 ? -7.463  53.492  -10.559  1.00 90.57  ?  100 ASP B O     1 
ATOM   2294 C  CB    . ASP B 1 100 ? -5.688  53.617  -13.077  1.00 87.54  ?  100 ASP B CB    1 
ATOM   2295 C  CG    . ASP B 1 100 ? -4.523  53.281  -13.993  1.00 104.01 ?  100 ASP B CG    1 
ATOM   2296 O  OD1   . ASP B 1 100 ? -3.527  52.693  -13.502  1.00 106.84 ?  100 ASP B OD1   1 
ATOM   2297 O  OD2   . ASP B 1 100 ? -4.609  53.599  -15.204  1.00 111.34 -1 100 ASP B OD2   1 
ATOM   2298 N  N     . SER B 1 101 ? -8.726  52.428  -12.116  1.00 84.75  ?  101 SER B N     1 
ATOM   2299 C  CA    . SER B 1 101 ? -10.042 52.764  -11.560  1.00 83.40  ?  101 SER B CA    1 
ATOM   2300 C  C     . SER B 1 101 ? -10.622 51.667  -10.652  1.00 89.01  ?  101 SER B C     1 
ATOM   2301 O  O     . SER B 1 101 ? -11.508 51.957  -9.849   1.00 89.09  ?  101 SER B O     1 
ATOM   2302 C  CB    . SER B 1 101 ? -11.018 53.091  -12.687  1.00 84.79  ?  101 SER B CB    1 
ATOM   2303 O  OG    . SER B 1 101 ? -10.452 53.967  -13.652  1.00 91.77  ?  101 SER B OG    1 
ATOM   2304 N  N     . VAL B 1 102 ? -10.131 50.417  -10.787  1.00 87.04  ?  102 VAL B N     1 
ATOM   2305 C  CA    . VAL B 1 102 ? -10.600 49.252  -10.023  1.00 89.41  ?  102 VAL B CA    1 
ATOM   2306 C  C     . VAL B 1 102 ? -9.750  48.929  -8.786   1.00 96.82  ?  102 VAL B C     1 
ATOM   2307 O  O     . VAL B 1 102 ? -8.553  49.235  -8.763   1.00 97.28  ?  102 VAL B O     1 
ATOM   2308 C  CB    . VAL B 1 102 ? -10.762 47.987  -10.908  1.00 94.26  ?  102 VAL B CB    1 
ATOM   2309 C  CG1   . VAL B 1 102 ? -11.874 48.156  -11.925  1.00 92.03  ?  102 VAL B CG1   1 
ATOM   2310 C  CG2   . VAL B 1 102 ? -9.455  47.593  -11.590  1.00 94.76  ?  102 VAL B CG2   1 
ATOM   2311 N  N     . PHE B 1 103 ? -10.364 48.250  -7.788   1.00 95.68  ?  103 PHE B N     1 
ATOM   2312 C  CA    . PHE B 1 103 ? -9.682  47.752  -6.594   1.00 98.97  ?  103 PHE B CA    1 
ATOM   2313 C  C     . PHE B 1 103 ? -8.884  46.535  -7.061   1.00 106.36 ?  103 PHE B C     1 
ATOM   2314 O  O     . PHE B 1 103 ? -9.468  45.598  -7.605   1.00 106.67 ?  103 PHE B O     1 
ATOM   2315 C  CB    . PHE B 1 103 ? -10.689 47.317  -5.512   1.00 103.20 ?  103 PHE B CB    1 
ATOM   2316 C  CG    . PHE B 1 103 ? -11.411 48.409  -4.757   1.00 103.54 ?  103 PHE B CG    1 
ATOM   2317 C  CD1   . PHE B 1 103 ? -10.720 49.267  -3.910   1.00 107.14 ?  103 PHE B CD1   1 
ATOM   2318 C  CD2   . PHE B 1 103 ? -12.793 48.511  -4.809   1.00 105.27 ?  103 PHE B CD2   1 
ATOM   2319 C  CE1   . PHE B 1 103 ? -11.393 50.253  -3.183   1.00 107.59 ?  103 PHE B CE1   1 
ATOM   2320 C  CE2   . PHE B 1 103 ? -13.467 49.498  -4.082   1.00 107.80 ?  103 PHE B CE2   1 
ATOM   2321 C  CZ    . PHE B 1 103 ? -12.762 50.362  -3.273   1.00 106.09 ?  103 PHE B CZ    1 
ATOM   2322 N  N     . HIS B 1 104 ? -7.557  46.560  -6.876   1.00 105.71 ?  104 HIS B N     1 
ATOM   2323 C  CA    . HIS B 1 104 ? -6.629  45.516  -7.330   1.00 108.87 ?  104 HIS B CA    1 
ATOM   2324 C  C     . HIS B 1 104 ? -6.982  44.083  -6.965   1.00 115.36 ?  104 HIS B C     1 
ATOM   2325 O  O     . HIS B 1 104 ? -6.839  43.191  -7.803   1.00 116.02 ?  104 HIS B O     1 
ATOM   2326 C  CB    . HIS B 1 104 ? -5.179  45.877  -6.986   1.00 111.75 ?  104 HIS B CB    1 
ATOM   2327 C  CG    . HIS B 1 104 ? -4.833  47.285  -7.368   1.00 112.71 ?  104 HIS B CG    1 
ATOM   2328 N  ND1   . HIS B 1 104 ? -5.162  47.802  -8.622   1.00 111.55 ?  104 HIS B ND1   1 
ATOM   2329 C  CD2   . HIS B 1 104 ? -4.245  48.260  -6.637   1.00 115.19 ?  104 HIS B CD2   1 
ATOM   2330 C  CE1   . HIS B 1 104 ? -4.752  49.060  -8.612   1.00 109.38 ?  104 HIS B CE1   1 
ATOM   2331 N  NE2   . HIS B 1 104 ? -4.184  49.380  -7.445   1.00 111.78 ?  104 HIS B NE2   1 
ATOM   2332 N  N     . LYS B 1 105 ? -7.489  43.874  -5.743   1.00 113.36 ?  105 LYS B N     1 
ATOM   2333 C  CA    . LYS B 1 105 ? -7.891  42.563  -5.245   1.00 117.11 ?  105 LYS B CA    1 
ATOM   2334 C  C     . LYS B 1 105 ? -9.159  42.026  -5.916   1.00 119.72 ?  105 LYS B C     1 
ATOM   2335 O  O     . LYS B 1 105 ? -9.160  40.885  -6.381   1.00 122.30 ?  105 LYS B O     1 
ATOM   2336 C  CB    . LYS B 1 105 ? -8.090  42.608  -3.719   1.00 122.08 ?  105 LYS B CB    1 
ATOM   2337 C  CG    . LYS B 1 105 ? -6.889  42.166  -2.890   1.00 136.93 ?  105 LYS B CG    1 
ATOM   2338 C  CD    . LYS B 1 105 ? -7.247  41.089  -1.837   1.00 151.38 ?  105 LYS B CD    1 
ATOM   2339 C  CE    . LYS B 1 105 ? -8.113  41.555  -0.680   1.00 160.83 ?  105 LYS B CE    1 
ATOM   2340 N  NZ    . LYS B 1 105 ? -7.399  42.498  0.219    1.00 168.79 ?  105 LYS B NZ    1 
ATOM   2341 N  N     . THR B 1 106 ? -10.229 42.848  -5.974   1.00 112.29 ?  106 THR B N     1 
ATOM   2342 C  CA    . THR B 1 106 ? -11.553 42.472  -6.488   1.00 111.40 ?  106 THR B CA    1 
ATOM   2343 C  C     . THR B 1 106 ? -11.781 42.672  -7.983   1.00 110.78 ?  106 THR B C     1 
ATOM   2344 O  O     . THR B 1 106 ? -12.492 41.878  -8.598   1.00 111.70 ?  106 THR B O     1 
ATOM   2345 C  CB    . THR B 1 106 ? -12.664 43.144  -5.663   1.00 118.68 ?  106 THR B CB    1 
ATOM   2346 O  OG1   . THR B 1 106 ? -12.555 44.564  -5.772   1.00 113.87 ?  106 THR B OG1   1 
ATOM   2347 C  CG2   . THR B 1 106 ? -12.659 42.721  -4.199   1.00 122.20 ?  106 THR B CG2   1 
ATOM   2348 N  N     . GLY B 1 107 ? -11.216 43.740  -8.540   1.00 102.54 ?  107 GLY B N     1 
ATOM   2349 C  CA    . GLY B 1 107 ? -11.376 44.095  -9.945   1.00 98.52  ?  107 GLY B CA    1 
ATOM   2350 C  C     . GLY B 1 107 ? -12.628 44.909  -10.199  1.00 98.43  ?  107 GLY B C     1 
ATOM   2351 O  O     . GLY B 1 107 ? -13.059 45.037  -11.345  1.00 95.98  ?  107 GLY B O     1 
ATOM   2352 N  N     . ILE B 1 108 ? -13.216 45.465  -9.122   1.00 94.70  ?  108 ILE B N     1 
ATOM   2353 C  CA    . ILE B 1 108 ? -14.429 46.290  -9.144   1.00 92.27  ?  108 ILE B CA    1 
ATOM   2354 C  C     . ILE B 1 108 ? -14.032 47.762  -9.018   1.00 92.44  ?  108 ILE B C     1 
ATOM   2355 O  O     . ILE B 1 108 ? -13.180 48.094  -8.198   1.00 92.60  ?  108 ILE B O     1 
ATOM   2356 C  CB    . ILE B 1 108 ? -15.414 45.865  -8.010   1.00 98.45  ?  108 ILE B CB    1 
ATOM   2357 C  CG1   . ILE B 1 108 ? -15.685 44.341  -8.038   1.00 103.03 ?  108 ILE B CG1   1 
ATOM   2358 C  CG2   . ILE B 1 108 ? -16.729 46.670  -8.071   1.00 97.53  ?  108 ILE B CG2   1 
ATOM   2359 C  CD1   . ILE B 1 108 ? -16.094 43.750  -6.714   1.00 114.54 ?  108 ILE B CD1   1 
ATOM   2360 N  N     . ALA B 1 109 ? -14.662 48.636  -9.820   1.00 86.14  ?  109 ALA B N     1 
ATOM   2361 C  CA    . ALA B 1 109 ? -14.425 50.080  -9.830   1.00 83.40  ?  109 ALA B CA    1 
ATOM   2362 C  C     . ALA B 1 109 ? -14.711 50.711  -8.478   1.00 89.86  ?  109 ALA B C     1 
ATOM   2363 O  O     . ALA B 1 109 ? -15.669 50.324  -7.804   1.00 92.13  ?  109 ALA B O     1 
ATOM   2364 C  CB    . ALA B 1 109 ? -15.287 50.740  -10.892  1.00 81.49  ?  109 ALA B CB    1 
ATOM   2365 N  N     . ARG B 1 110 ? -13.871 51.675  -8.079   1.00 85.76  ?  110 ARG B N     1 
ATOM   2366 C  CA    . ARG B 1 110 ? -14.010 52.401  -6.815   1.00 86.87  ?  110 ARG B CA    1 
ATOM   2367 C  C     . ARG B 1 110 ? -15.196 53.359  -6.880   1.00 90.77  ?  110 ARG B C     1 
ATOM   2368 O  O     . ARG B 1 110 ? -15.520 53.873  -7.956   1.00 88.50  ?  110 ARG B O     1 
ATOM   2369 C  CB    . ARG B 1 110 ? -12.717 53.139  -6.457   1.00 87.25  ?  110 ARG B CB    1 
ATOM   2370 C  CG    . ARG B 1 110 ? -11.558 52.187  -6.254   1.00 99.87  ?  110 ARG B CG    1 
ATOM   2371 C  CD    . ARG B 1 110 ? -10.312 52.836  -5.720   1.00 110.65 ?  110 ARG B CD    1 
ATOM   2372 N  NE    . ARG B 1 110 ? -9.198  51.994  -6.128   1.00 122.33 ?  110 ARG B NE    1 
ATOM   2373 C  CZ    . ARG B 1 110 ? -8.399  52.252  -7.155   1.00 141.20 ?  110 ARG B CZ    1 
ATOM   2374 N  NH1   . ARG B 1 110 ? -8.548  53.370  -7.858   1.00 129.50 ?  110 ARG B NH1   1 
ATOM   2375 N  NH2   . ARG B 1 110 ? -7.445  51.398  -7.491   1.00 130.30 ?  110 ARG B NH2   1 
ATOM   2376 N  N     . GLY B 1 111 ? -15.856 53.542  -5.736   1.00 89.87  ?  111 GLY B N     1 
ATOM   2377 C  CA    . GLY B 1 111 ? -17.049 54.376  -5.601   1.00 89.35  ?  111 GLY B CA    1 
ATOM   2378 C  C     . GLY B 1 111 ? -16.957 55.755  -6.223   1.00 90.02  ?  111 GLY B C     1 
ATOM   2379 O  O     . GLY B 1 111 ? -17.833 56.150  -7.005   1.00 88.35  ?  111 GLY B O     1 
ATOM   2380 N  N     . HIS B 1 112 ? -15.861 56.473  -5.905   1.00 85.11  ?  112 HIS B N     1 
ATOM   2381 C  CA    . HIS B 1 112 ? -15.598 57.830  -6.383   1.00 82.67  ?  112 HIS B CA    1 
ATOM   2382 C  C     . HIS B 1 112 ? -15.411 57.949  -7.884   1.00 83.29  ?  112 HIS B C     1 
ATOM   2383 O  O     . HIS B 1 112 ? -15.616 59.037  -8.415   1.00 81.89  ?  112 HIS B O     1 
ATOM   2384 C  CB    . HIS B 1 112 ? -14.422 58.475  -5.642   1.00 84.40  ?  112 HIS B CB    1 
ATOM   2385 C  CG    . HIS B 1 112 ? -13.146 57.696  -5.713   1.00 88.16  ?  112 HIS B CG    1 
ATOM   2386 N  ND1   . HIS B 1 112 ? -12.796 56.805  -4.718   1.00 92.56  ?  112 HIS B ND1   1 
ATOM   2387 C  CD2   . HIS B 1 112 ? -12.172 57.707  -6.655   1.00 88.18  ?  112 HIS B CD2   1 
ATOM   2388 C  CE1   . HIS B 1 112 ? -11.630 56.298  -5.087   1.00 91.89  ?  112 HIS B CE1   1 
ATOM   2389 N  NE2   . HIS B 1 112 ? -11.216 56.809  -6.250   1.00 89.69  ?  112 HIS B NE2   1 
ATOM   2390 N  N     . VAL B 1 113 ? -15.032 56.848  -8.563   1.00 78.62  ?  113 VAL B N     1 
ATOM   2391 C  CA    . VAL B 1 113 ? -14.804 56.815  -10.008  1.00 76.32  ?  113 VAL B CA    1 
ATOM   2392 C  C     . VAL B 1 113 ? -16.099 57.166  -10.749  1.00 79.12  ?  113 VAL B C     1 
ATOM   2393 O  O     . VAL B 1 113 ? -16.111 58.074  -11.587  1.00 77.77  ?  113 VAL B O     1 
ATOM   2394 C  CB    . VAL B 1 113 ? -14.198 55.452  -10.469  1.00 80.74  ?  113 VAL B CB    1 
ATOM   2395 C  CG1   . VAL B 1 113 ? -13.970 55.419  -11.972  1.00 79.10  ?  113 VAL B CG1   1 
ATOM   2396 C  CG2   . VAL B 1 113 ? -12.901 55.135  -9.737   1.00 82.08  ?  113 VAL B CG2   1 
ATOM   2397 N  N     . LEU B 1 114 ? -17.186 56.457  -10.415  1.00 76.22  ?  114 LEU B N     1 
ATOM   2398 C  CA    . LEU B 1 114 ? -18.488 56.645  -11.051  1.00 75.18  ?  114 LEU B CA    1 
ATOM   2399 C  C     . LEU B 1 114 ? -19.154 57.957  -10.685  1.00 77.63  ?  114 LEU B C     1 
ATOM   2400 O  O     . LEU B 1 114 ? -19.846 58.538  -11.528  1.00 76.46  ?  114 LEU B O     1 
ATOM   2401 C  CB    . LEU B 1 114 ? -19.403 55.458  -10.775  1.00 77.00  ?  114 LEU B CB    1 
ATOM   2402 C  CG    . LEU B 1 114 ? -19.020 54.205  -11.528  1.00 82.00  ?  114 LEU B CG    1 
ATOM   2403 C  CD1   . LEU B 1 114 ? -18.793 53.037  -10.574  1.00 85.38  ?  114 LEU B CD1   1 
ATOM   2404 C  CD2   . LEU B 1 114 ? -20.018 53.903  -12.606  1.00 82.82  ?  114 LEU B CD2   1 
ATOM   2405 N  N     . PHE B 1 115 ? -18.933 58.437  -9.443   1.00 73.94  ?  115 PHE B N     1 
ATOM   2406 C  CA    . PHE B 1 115 ? -19.473 59.718  -9.000   1.00 73.56  ?  115 PHE B CA    1 
ATOM   2407 C  C     . PHE B 1 115 ? -18.776 60.858  -9.751   1.00 75.92  ?  115 PHE B C     1 
ATOM   2408 O  O     . PHE B 1 115 ? -19.432 61.831  -10.127  1.00 76.00  ?  115 PHE B O     1 
ATOM   2409 C  CB    . PHE B 1 115 ? -19.323 59.905  -7.479   1.00 77.22  ?  115 PHE B CB    1 
ATOM   2410 C  CG    . PHE B 1 115 ? -19.826 61.254  -7.012   1.00 79.69  ?  115 PHE B CG    1 
ATOM   2411 C  CD1   . PHE B 1 115 ? -21.180 61.468  -6.782   1.00 84.18  ?  115 PHE B CD1   1 
ATOM   2412 C  CD2   . PHE B 1 115 ? -18.954 62.326  -6.860   1.00 81.91  ?  115 PHE B CD2   1 
ATOM   2413 C  CE1   . PHE B 1 115 ? -21.649 62.723  -6.383   1.00 86.38  ?  115 PHE B CE1   1 
ATOM   2414 C  CE2   . PHE B 1 115 ? -19.428 63.584  -6.475   1.00 86.12  ?  115 PHE B CE2   1 
ATOM   2415 C  CZ    . PHE B 1 115 ? -20.771 63.775  -6.244   1.00 85.44  ?  115 PHE B CZ    1 
ATOM   2416 N  N     . ALA B 1 116 ? -17.449 60.734  -9.951   1.00 70.64  ?  116 ALA B N     1 
ATOM   2417 C  CA    . ALA B 1 116 ? -16.629 61.719  -10.648  1.00 69.12  ?  116 ALA B CA    1 
ATOM   2418 C  C     . ALA B 1 116 ? -17.130 61.971  -12.069  1.00 70.24  ?  116 ALA B C     1 
ATOM   2419 O  O     . ALA B 1 116 ? -17.259 63.128  -12.477  1.00 69.87  ?  116 ALA B O     1 
ATOM   2420 C  CB    . ALA B 1 116 ? -15.173 61.272  -10.664  1.00 69.83  ?  116 ALA B CB    1 
ATOM   2421 N  N     . GLN B 1 117 ? -17.450 60.888  -12.797  1.00 65.01  ?  117 GLN B N     1 
ATOM   2422 C  CA    . GLN B 1 117 ? -17.974 60.959  -14.155  1.00 63.96  ?  117 GLN B CA    1 
ATOM   2423 C  C     . GLN B 1 117 ? -19.338 61.652  -14.148  1.00 69.02  ?  117 GLN B C     1 
ATOM   2424 O  O     . GLN B 1 117 ? -19.583 62.512  -15.002  1.00 69.05  ?  117 GLN B O     1 
ATOM   2425 C  CB    . GLN B 1 117 ? -18.089 59.552  -14.758  1.00 64.67  ?  117 GLN B CB    1 
ATOM   2426 C  CG    . GLN B 1 117 ? -18.565 59.533  -16.211  1.00 69.02  ?  117 GLN B CG    1 
ATOM   2427 C  CD    . GLN B 1 117 ? -19.101 58.192  -16.658  1.00 75.93  ?  117 GLN B CD    1 
ATOM   2428 O  OE1   . GLN B 1 117 ? -19.362 57.284  -15.862  1.00 70.03  ?  117 GLN B OE1   1 
ATOM   2429 N  NE2   . GLN B 1 117 ? -19.296 58.046  -17.956  1.00 66.52  ?  117 GLN B NE2   1 
ATOM   2430 N  N     . ALA B 1 118 ? -20.209 61.281  -13.174  1.00 65.65  ?  118 ALA B N     1 
ATOM   2431 C  CA    . ALA B 1 118 ? -21.554 61.820  -13.001  1.00 66.02  ?  118 ALA B CA    1 
ATOM   2432 C  C     . ALA B 1 118 ? -21.522 63.314  -12.707  1.00 70.83  ?  118 ALA B C     1 
ATOM   2433 O  O     . ALA B 1 118 ? -22.181 64.082  -13.403  1.00 70.32  ?  118 ALA B O     1 
ATOM   2434 C  CB    . ALA B 1 118 ? -22.275 61.073  -11.895  1.00 68.07  ?  118 ALA B CB    1 
ATOM   2435 N  N     . ASN B 1 119 ? -20.721 63.729  -11.713  1.00 69.47  ?  119 ASN B N     1 
ATOM   2436 C  CA    . ASN B 1 119 ? -20.565 65.127  -11.319  1.00 71.47  ?  119 ASN B CA    1 
ATOM   2437 C  C     . ASN B 1 119 ? -20.036 65.967  -12.485  1.00 76.12  ?  119 ASN B C     1 
ATOM   2438 O  O     . ASN B 1 119 ? -20.627 67.006  -12.791  1.00 77.19  ?  119 ASN B O     1 
ATOM   2439 C  CB    . ASN B 1 119 ? -19.652 65.246  -10.097  1.00 74.31  ?  119 ASN B CB    1 
ATOM   2440 C  CG    . ASN B 1 119 ? -19.698 66.606  -9.451   1.00 100.81 ?  119 ASN B CG    1 
ATOM   2441 O  OD1   . ASN B 1 119 ? -18.636 67.388  -9.619   1.00 98.85  ?  119 ASN B OD1   1 
ATOM   2442 N  ND2   . ASN B 1 119 ? -20.681 66.972  -8.801   1.00 91.60  ?  119 ASN B ND2   1 
ATOM   2443 N  N     . SER B 1 120 ? -18.967 65.484  -13.168  1.00 71.70  ?  120 SER B N     1 
ATOM   2444 C  CA    . SER B 1 120 ? -18.360 66.153  -14.325  1.00 71.82  ?  120 SER B CA    1 
ATOM   2445 C  C     . SER B 1 120 ? -19.388 66.412  -15.413  1.00 75.98  ?  120 SER B C     1 
ATOM   2446 O  O     . SER B 1 120 ? -19.413 67.511  -15.971  1.00 77.76  ?  120 SER B O     1 
ATOM   2447 C  CB    . SER B 1 120 ? -17.211 65.330  -14.902  1.00 74.74  ?  120 SER B CB    1 
ATOM   2448 O  OG    . SER B 1 120 ? -15.995 65.571  -14.217  1.00 85.30  ?  120 SER B OG    1 
ATOM   2449 N  N     . LEU B 1 121 ? -20.250 65.409  -15.686  1.00 70.42  ?  121 LEU B N     1 
ATOM   2450 C  CA    . LEU B 1 121 ? -21.305 65.457  -16.696  1.00 69.78  ?  121 LEU B CA    1 
ATOM   2451 C  C     . LEU B 1 121 ? -22.322 66.549  -16.392  1.00 76.69  ?  121 LEU B C     1 
ATOM   2452 O  O     . LEU B 1 121 ? -22.777 67.220  -17.322  1.00 77.54  ?  121 LEU B O     1 
ATOM   2453 C  CB    . LEU B 1 121 ? -21.980 64.078  -16.811  1.00 68.48  ?  121 LEU B CB    1 
ATOM   2454 C  CG    . LEU B 1 121 ? -22.984 63.832  -17.948  1.00 72.58  ?  121 LEU B CG    1 
ATOM   2455 C  CD1   . LEU B 1 121 ? -22.384 64.124  -19.313  1.00 72.06  ?  121 LEU B CD1   1 
ATOM   2456 C  CD2   . LEU B 1 121 ? -23.486 62.407  -17.908  1.00 73.76  ?  121 LEU B CD2   1 
ATOM   2457 N  N     . CYS B 1 122 ? -22.646 66.750  -15.095  1.00 74.50  ?  122 CYS B N     1 
ATOM   2458 C  CA    . CYS B 1 122 ? -23.594 67.765  -14.643  1.00 76.61  ?  122 CYS B CA    1 
ATOM   2459 C  C     . CYS B 1 122 ? -23.084 69.178  -14.879  1.00 81.73  ?  122 CYS B C     1 
ATOM   2460 O  O     . CYS B 1 122 ? -23.840 70.012  -15.380  1.00 83.67  ?  122 CYS B O     1 
ATOM   2461 C  CB    . CYS B 1 122 ? -23.974 67.539  -13.188  1.00 78.16  ?  122 CYS B CB    1 
ATOM   2462 S  SG    . CYS B 1 122 ? -24.877 65.998  -12.904  1.00 81.67  ?  122 CYS B SG    1 
ATOM   2463 N  N     . VAL B 1 123 ? -21.795 69.434  -14.573  1.00 76.83  ?  123 VAL B N     1 
ATOM   2464 C  CA    . VAL B 1 123 ? -21.140 70.732  -14.778  1.00 78.22  ?  123 VAL B CA    1 
ATOM   2465 C  C     . VAL B 1 123 ? -21.119 71.074  -16.290  1.00 82.36  ?  123 VAL B C     1 
ATOM   2466 O  O     . VAL B 1 123 ? -21.323 72.233  -16.677  1.00 84.44  ?  123 VAL B O     1 
ATOM   2467 C  CB    . VAL B 1 123 ? -19.723 70.756  -14.149  1.00 81.86  ?  123 VAL B CB    1 
ATOM   2468 C  CG1   . VAL B 1 123 ? -19.128 72.159  -14.175  1.00 84.79  ?  123 VAL B CG1   1 
ATOM   2469 C  CG2   . VAL B 1 123 ? -19.743 70.227  -12.722  1.00 81.47  ?  123 VAL B CG2   1 
ATOM   2470 N  N     . ALA B 1 124 ? -20.908 70.043  -17.131  1.00 76.59  ?  124 ALA B N     1 
ATOM   2471 C  CA    . ALA B 1 124 ? -20.882 70.156  -18.589  1.00 76.41  ?  124 ALA B CA    1 
ATOM   2472 C  C     . ALA B 1 124 ? -22.280 70.420  -19.135  1.00 81.51  ?  124 ALA B C     1 
ATOM   2473 O  O     . ALA B 1 124 ? -22.429 71.198  -20.080  1.00 83.96  ?  124 ALA B O     1 
ATOM   2474 C  CB    . ALA B 1 124 ? -20.314 68.885  -19.206  1.00 74.51  ?  124 ALA B CB    1 
ATOM   2475 N  N     . LEU B 1 125 ? -23.299 69.779  -18.533  1.00 76.04  ?  125 LEU B N     1 
ATOM   2476 C  CA    . LEU B 1 125 ? -24.696 69.892  -18.942  1.00 76.62  ?  125 LEU B CA    1 
ATOM   2477 C  C     . LEU B 1 125 ? -25.255 71.300  -18.747  1.00 83.87  ?  125 LEU B C     1 
ATOM   2478 O  O     . LEU B 1 125 ? -25.920 71.817  -19.649  1.00 85.28  ?  125 LEU B O     1 
ATOM   2479 C  CB    . LEU B 1 125 ? -25.546 68.822  -18.224  1.00 75.33  ?  125 LEU B CB    1 
ATOM   2480 C  CG    . LEU B 1 125 ? -27.068 68.846  -18.379  1.00 81.32  ?  125 LEU B CG    1 
ATOM   2481 C  CD1   . LEU B 1 125 ? -27.507 68.772  -19.838  1.00 81.59  ?  125 LEU B CD1   1 
ATOM   2482 C  CD2   . LEU B 1 125 ? -27.682 67.716  -17.616  1.00 83.31  ?  125 LEU B CD2   1 
ATOM   2483 N  N     . ILE B 1 126 ? -24.977 71.918  -17.588  1.00 81.51  ?  126 ILE B N     1 
ATOM   2484 C  CA    . ILE B 1 126 ? -25.470 73.259  -17.275  1.00 84.74  ?  126 ILE B CA    1 
ATOM   2485 C  C     . ILE B 1 126 ? -24.606 74.356  -17.901  1.00 91.10  ?  126 ILE B C     1 
ATOM   2486 O  O     . ILE B 1 126 ? -23.443 74.538  -17.521  1.00 90.96  ?  126 ILE B O     1 
ATOM   2487 C  CB    . ILE B 1 126 ? -25.769 73.441  -15.761  1.00 88.69  ?  126 ILE B CB    1 
ATOM   2488 C  CG1   . ILE B 1 126 ? -26.900 72.499  -15.331  1.00 88.13  ?  126 ILE B CG1   1 
ATOM   2489 C  CG2   . ILE B 1 126 ? -26.151 74.879  -15.429  1.00 93.33  ?  126 ILE B CG2   1 
ATOM   2490 C  CD1   . ILE B 1 126 ? -26.525 71.566  -14.306  1.00 92.73  ?  126 ILE B CD1   1 
ATOM   2491 N  N     . LYS B 1 127 ? -25.189 75.062  -18.889  1.00 89.72  ?  127 LYS B N     1 
ATOM   2492 C  CA    . LYS B 1 127 ? -24.554 76.153  -19.623  1.00 92.24  ?  127 LYS B CA    1 
ATOM   2493 C  C     . LYS B 1 127 ? -24.856 77.472  -18.899  1.00 100.35 ?  127 LYS B C     1 
ATOM   2494 O  O     . LYS B 1 127 ? -25.782 78.202  -19.266  1.00 102.95 ?  127 LYS B O     1 
ATOM   2495 C  CB    . LYS B 1 127 ? -25.024 76.161  -21.096  1.00 95.28  ?  127 LYS B CB    1 
ATOM   2496 C  CG    . LYS B 1 127 ? -24.228 77.083  -22.012  1.00 108.30 ?  127 LYS B CG    1 
ATOM   2497 C  CD    . LYS B 1 127 ? -24.856 77.168  -23.391  1.00 117.50 ?  127 LYS B CD    1 
ATOM   2498 C  CE    . LYS B 1 127 ? -24.151 78.171  -24.263  1.00 131.31 ?  127 LYS B CE    1 
ATOM   2499 N  NZ    . LYS B 1 127 ? -24.703 78.175  -25.642  1.00 141.95 ?  127 LYS B NZ    1 
ATOM   2500 N  N     . GLN B 1 128 ? -24.093 77.731  -17.825  1.00 97.55  ?  128 GLN B N     1 
ATOM   2501 C  CA    . GLN B 1 128 ? -24.198 78.920  -16.973  1.00 101.75 ?  128 GLN B CA    1 
ATOM   2502 C  C     . GLN B 1 128 ? -22.791 79.397  -16.564  1.00 108.14 ?  128 GLN B C     1 
ATOM   2503 O  O     . GLN B 1 128 ? -21.883 78.560  -16.526  1.00 105.12 ?  128 GLN B O     1 
ATOM   2504 C  CB    . GLN B 1 128 ? -25.047 78.621  -15.717  1.00 102.63 ?  128 GLN B CB    1 
ATOM   2505 C  CG    . GLN B 1 128 ? -26.556 78.505  -15.965  1.00 113.44 ?  128 GLN B CG    1 
ATOM   2506 C  CD    . GLN B 1 128 ? -27.202 79.748  -16.532  1.00 137.29 ?  128 GLN B CD    1 
ATOM   2507 O  OE1   . GLN B 1 128 ? -26.888 80.882  -16.152  1.00 138.37 ?  128 GLN B OE1   1 
ATOM   2508 N  NE2   . GLN B 1 128 ? -28.144 79.555  -17.442  1.00 128.47 ?  128 GLN B NE2   1 
ATOM   2509 N  N     . PRO B 1 129 ? -22.573 80.708  -16.253  1.00 109.65 ?  129 PRO B N     1 
ATOM   2510 C  CA    . PRO B 1 129 ? -21.219 81.156  -15.866  1.00 111.15 ?  129 PRO B CA    1 
ATOM   2511 C  C     . PRO B 1 129 ? -20.633 80.403  -14.668  1.00 113.40 ?  129 PRO B C     1 
ATOM   2512 O  O     . PRO B 1 129 ? -19.541 79.841  -14.773  1.00 110.74 ?  129 PRO B O     1 
ATOM   2513 C  CB    . PRO B 1 129 ? -21.401 82.650  -15.574  1.00 118.87 ?  129 PRO B CB    1 
ATOM   2514 C  CG    . PRO B 1 129 ? -22.636 83.037  -16.289  1.00 124.92 ?  129 PRO B CG    1 
ATOM   2515 C  CD    . PRO B 1 129 ? -23.524 81.839  -16.258  1.00 115.84 ?  129 PRO B CD    1 
ATOM   2516 N  N     . THR B 1 130 ? -21.379 80.352  -13.552  1.00 111.17 ?  130 THR B N     1 
ATOM   2517 C  CA    . THR B 1 130 ? -20.958 79.662  -12.333  1.00 109.27 ?  130 THR B CA    1 
ATOM   2518 C  C     . THR B 1 130 ? -21.898 78.508  -11.996  1.00 109.69 ?  130 THR B C     1 
ATOM   2519 O  O     . THR B 1 130 ? -23.099 78.718  -11.828  1.00 110.72 ?  130 THR B O     1 
ATOM   2520 C  CB    . THR B 1 130 ? -20.729 80.656  -11.180  1.00 121.09 ?  130 THR B CB    1 
ATOM   2521 O  OG1   . THR B 1 130 ? -21.764 81.641  -11.182  1.00 123.19 ?  130 THR B OG1   1 
ATOM   2522 C  CG2   . THR B 1 130 ? -19.369 81.339  -11.265  1.00 122.05 ?  130 THR B CG2   1 
ATOM   2523 N  N     . VAL B 1 131 ? -21.348 77.282  -11.956  1.00 102.07 ?  131 VAL B N     1 
ATOM   2524 C  CA    . VAL B 1 131 ? -22.072 76.040  -11.663  1.00 98.84  ?  131 VAL B CA    1 
ATOM   2525 C  C     . VAL B 1 131 ? -21.329 75.304  -10.537  1.00 101.67 ?  131 VAL B C     1 
ATOM   2526 O  O     . VAL B 1 131 ? -20.126 75.050  -10.660  1.00 100.82 ?  131 VAL B O     1 
ATOM   2527 C  CB    . VAL B 1 131 ? -22.248 75.143  -12.929  1.00 99.67  ?  131 VAL B CB    1 
ATOM   2528 C  CG1   . VAL B 1 131 ? -23.075 73.899  -12.623  1.00 96.96  ?  131 VAL B CG1   1 
ATOM   2529 C  CG2   . VAL B 1 131 ? -22.869 75.918  -14.089  1.00 101.27 ?  131 VAL B CG2   1 
ATOM   2530 N  N     . LEU B 1 132 ? -22.038 74.990  -9.435   1.00 98.32  ?  132 LEU B N     1 
ATOM   2531 C  CA    . LEU B 1 132 ? -21.472 74.299  -8.267   1.00 97.36  ?  132 LEU B CA    1 
ATOM   2532 C  C     . LEU B 1 132 ? -22.431 73.246  -7.733   1.00 99.10  ?  132 LEU B C     1 
ATOM   2533 O  O     . LEU B 1 132 ? -23.624 73.519  -7.608   1.00 100.46 ?  132 LEU B O     1 
ATOM   2534 C  CB    . LEU B 1 132 ? -21.145 75.291  -7.128   1.00 101.51 ?  132 LEU B CB    1 
ATOM   2535 C  CG    . LEU B 1 132 ? -20.175 76.443  -7.408   1.00 109.12 ?  132 LEU B CG    1 
ATOM   2536 C  CD1   . LEU B 1 132 ? -20.241 77.477  -6.301   1.00 113.92 ?  132 LEU B CD1   1 
ATOM   2537 C  CD2   . LEU B 1 132 ? -18.737 75.946  -7.600   1.00 110.21 ?  132 LEU B CD2   1 
ATOM   2538 N  N     . THR B 1 133 ? -21.911 72.059  -7.383   1.00 92.58  ?  133 THR B N     1 
ATOM   2539 C  CA    . THR B 1 133 ? -22.719 70.981  -6.813   1.00 91.46  ?  133 THR B CA    1 
ATOM   2540 C  C     . THR B 1 133 ? -23.003 71.336  -5.361   1.00 99.40  ?  133 THR B C     1 
ATOM   2541 O  O     . THR B 1 133 ? -22.070 71.629  -4.609   1.00 100.70 ?  133 THR B O     1 
ATOM   2542 C  CB    . THR B 1 133 ? -22.002 69.630  -6.924   1.00 95.72  ?  133 THR B CB    1 
ATOM   2543 O  OG1   . THR B 1 133 ? -21.398 69.509  -8.214   1.00 96.40  ?  133 THR B OG1   1 
ATOM   2544 C  CG2   . THR B 1 133 ? -22.929 68.452  -6.666   1.00 91.67  ?  133 THR B CG2   1 
ATOM   2545 N  N     . HIS B 1 134 ? -24.289 71.340  -4.978   1.00 97.67  ?  134 HIS B N     1 
ATOM   2546 C  CA    . HIS B 1 134 ? -24.725 71.668  -3.623   1.00 100.75 ?  134 HIS B CA    1 
ATOM   2547 C  C     . HIS B 1 134 ? -25.118 70.435  -2.827   1.00 104.39 ?  134 HIS B C     1 
ATOM   2548 O  O     . HIS B 1 134 ? -24.772 70.331  -1.651   1.00 106.31 ?  134 HIS B O     1 
ATOM   2549 C  CB    . HIS B 1 134 ? -25.848 72.711  -3.651   1.00 104.59 ?  134 HIS B CB    1 
ATOM   2550 C  CG    . HIS B 1 134 ? -25.358 74.124  -3.539   1.00 110.82 ?  134 HIS B CG    1 
ATOM   2551 N  ND1   . HIS B 1 134 ? -26.168 75.126  -3.036   1.00 116.91 ?  134 HIS B ND1   1 
ATOM   2552 C  CD2   . HIS B 1 134 ? -24.149 74.653  -3.844   1.00 112.13 ?  134 HIS B CD2   1 
ATOM   2553 C  CE1   . HIS B 1 134 ? -25.436 76.228  -3.065   1.00 118.36 ?  134 HIS B CE1   1 
ATOM   2554 N  NE2   . HIS B 1 134 ? -24.213 75.991  -3.540   1.00 115.98 ?  134 HIS B NE2   1 
ATOM   2555 N  N     . GLU B 1 135 ? -25.829 69.499  -3.467   1.00 98.83  ?  135 GLU B N     1 
ATOM   2556 C  CA    . GLU B 1 135 ? -26.273 68.243  -2.868   1.00 98.84  ?  135 GLU B CA    1 
ATOM   2557 C  C     . GLU B 1 135 ? -26.260 67.145  -3.921   1.00 99.94  ?  135 GLU B C     1 
ATOM   2558 O  O     . GLU B 1 135 ? -26.392 67.428  -5.117   1.00 97.28  ?  135 GLU B O     1 
ATOM   2559 C  CB    . GLU B 1 135 ? -27.700 68.378  -2.313   1.00 103.46 ?  135 GLU B CB    1 
ATOM   2560 C  CG    . GLU B 1 135 ? -27.805 68.997  -0.930   1.00 117.14 ?  135 GLU B CG    1 
ATOM   2561 C  CD    . GLU B 1 135 ? -29.207 69.386  -0.488   1.00 135.91 ?  135 GLU B CD    1 
ATOM   2562 O  OE1   . GLU B 1 135 ? -30.192 68.802  -0.997   1.00 114.50 ?  135 GLU B OE1   1 
ATOM   2563 O  OE2   . GLU B 1 135 ? -29.318 70.273  0.389    1.00 136.35 -1 135 GLU B OE2   1 
ATOM   2564 N  N     . SER B 1 136 ? -26.117 65.890  -3.472   1.00 96.94  ?  136 SER B N     1 
ATOM   2565 C  CA    . SER B 1 136 ? -26.146 64.709  -4.328   1.00 94.46  ?  136 SER B CA    1 
ATOM   2566 C  C     . SER B 1 136 ? -26.557 63.460  -3.564   1.00 101.57 ?  136 SER B C     1 
ATOM   2567 O  O     . SER B 1 136 ? -26.099 63.234  -2.439   1.00 103.90 ?  136 SER B O     1 
ATOM   2568 C  CB    . SER B 1 136 ? -24.814 64.491  -5.034   1.00 94.26  ?  136 SER B CB    1 
ATOM   2569 O  OG    . SER B 1 136 ? -24.949 63.466  -6.004   1.00 100.65 ?  136 SER B OG    1 
ATOM   2570 N  N     . SER B 1 137 ? -27.447 62.668  -4.172   1.00 97.91  ?  137 SER B N     1 
ATOM   2571 C  CA    . SER B 1 137 ? -27.944 61.404  -3.638   1.00 99.69  ?  137 SER B CA    1 
ATOM   2572 C  C     . SER B 1 137 ? -27.631 60.368  -4.698   1.00 100.64 ?  137 SER B C     1 
ATOM   2573 O  O     . SER B 1 137 ? -28.154 60.446  -5.811   1.00 99.44  ?  137 SER B O     1 
ATOM   2574 C  CB    . SER B 1 137 ? -29.443 61.482  -3.368   1.00 107.28 ?  137 SER B CB    1 
ATOM   2575 O  OG    . SER B 1 137 ? -29.721 62.307  -2.250   1.00 121.97 ?  137 SER B OG    1 
ATOM   2576 N  N     . ILE B 1 138 ? -26.708 59.454  -4.394   1.00 95.77  ?  138 ILE B N     1 
ATOM   2577 C  CA    . ILE B 1 138 ? -26.255 58.451  -5.359   1.00 92.96  ?  138 ILE B CA    1 
ATOM   2578 C  C     . ILE B 1 138 ? -26.476 57.008  -4.889   1.00 98.86  ?  138 ILE B C     1 
ATOM   2579 O  O     . ILE B 1 138 ? -26.535 56.752  -3.679   1.00 101.70 ?  138 ILE B O     1 
ATOM   2580 C  CB    . ILE B 1 138 ? -24.788 58.731  -5.799   1.00 92.87  ?  138 ILE B CB    1 
ATOM   2581 C  CG1   . ILE B 1 138 ? -23.809 58.666  -4.604   1.00 94.11  ?  138 ILE B CG1   1 
ATOM   2582 C  CG2   . ILE B 1 138 ? -24.680 60.080  -6.539   1.00 91.69  ?  138 ILE B CG2   1 
ATOM   2583 C  CD1   . ILE B 1 138 ? -22.413 58.444  -4.973   1.00 96.03  ?  138 ILE B CD1   1 
ATOM   2584 N  N     . GLN B 1 139 ? -26.623 56.071  -5.845   1.00 93.50  ?  139 GLN B N     1 
ATOM   2585 C  CA    . GLN B 1 139 ? -26.794 54.649  -5.538   1.00 95.43  ?  139 GLN B CA    1 
ATOM   2586 C  C     . GLN B 1 139 ? -26.129 53.742  -6.555   1.00 96.86  ?  139 GLN B C     1 
ATOM   2587 O  O     . GLN B 1 139 ? -26.306 53.925  -7.758   1.00 94.90  ?  139 GLN B O     1 
ATOM   2588 C  CB    . GLN B 1 139 ? -28.241 54.253  -5.199   1.00 100.40 ?  139 GLN B CB    1 
ATOM   2589 C  CG    . GLN B 1 139 ? -29.289 54.556  -6.263   1.00 118.06 ?  139 GLN B CG    1 
ATOM   2590 C  CD    . GLN B 1 139 ? -30.622 53.893  -5.985   1.00 140.56 ?  139 GLN B CD    1 
ATOM   2591 O  OE1   . GLN B 1 139 ? -30.782 53.072  -5.064   1.00 135.99 ?  139 GLN B OE1   1 
ATOM   2592 N  NE2   . GLN B 1 139 ? -31.611 54.216  -6.806   1.00 135.36 ?  139 GLN B NE2   1 
ATOM   2593 N  N     . PHE B 1 140 ? -25.313 52.803  -6.059   1.00 93.67  ?  140 PHE B N     1 
ATOM   2594 C  CA    . PHE B 1 140 ? -24.497 51.872  -6.836   1.00 91.97  ?  140 PHE B CA    1 
ATOM   2595 C  C     . PHE B 1 140 ? -25.230 50.546  -7.004   1.00 97.06  ?  140 PHE B C     1 
ATOM   2596 O  O     . PHE B 1 140 ? -25.013 49.602  -6.237   1.00 99.73  ?  140 PHE B O     1 
ATOM   2597 C  CB    . PHE B 1 140 ? -23.114 51.694  -6.179   1.00 93.76  ?  140 PHE B CB    1 
ATOM   2598 C  CG    . PHE B 1 140 ? -22.306 52.966  -6.052   1.00 92.74  ?  140 PHE B CG    1 
ATOM   2599 C  CD1   . PHE B 1 140 ? -22.410 53.766  -4.920   1.00 96.12  ?  140 PHE B CD1   1 
ATOM   2600 C  CD2   . PHE B 1 140 ? -21.428 53.354  -7.054   1.00 93.01  ?  140 PHE B CD2   1 
ATOM   2601 C  CE1   . PHE B 1 140 ? -21.659 54.937  -4.799   1.00 97.12  ?  140 PHE B CE1   1 
ATOM   2602 C  CE2   . PHE B 1 140 ? -20.677 54.528  -6.932   1.00 92.21  ?  140 PHE B CE2   1 
ATOM   2603 C  CZ    . PHE B 1 140 ? -20.795 55.309  -5.805   1.00 92.30  ?  140 PHE B CZ    1 
ATOM   2604 N  N     . ILE B 1 141 ? -26.122 50.506  -8.012   1.00 91.61  ?  141 ILE B N     1 
ATOM   2605 C  CA    . ILE B 1 141 ? -26.999 49.385  -8.368   1.00 93.76  ?  141 ILE B CA    1 
ATOM   2606 C  C     . ILE B 1 141 ? -26.254 48.075  -8.627   1.00 99.21  ?  141 ILE B C     1 
ATOM   2607 O  O     . ILE B 1 141 ? -26.557 47.068  -7.978   1.00 104.40 ?  141 ILE B O     1 
ATOM   2608 C  CB    . ILE B 1 141 ? -27.989 49.780  -9.500   1.00 95.16  ?  141 ILE B CB    1 
ATOM   2609 C  CG1   . ILE B 1 141 ? -28.928 50.901  -9.034   1.00 95.35  ?  141 ILE B CG1   1 
ATOM   2610 C  CG2   . ILE B 1 141 ? -28.806 48.582  -10.003  1.00 99.32  ?  141 ILE B CG2   1 
ATOM   2611 C  CD1   . ILE B 1 141 ? -28.597 52.195  -9.543   1.00 96.86  ?  141 ILE B CD1   1 
ATOM   2612 N  N     . GLU B 1 142 ? -25.297 48.086  -9.562   1.00 91.28  ?  142 GLU B N     1 
ATOM   2613 C  CA    . GLU B 1 142 ? -24.504 46.905  -9.890   1.00 92.08  ?  142 GLU B CA    1 
ATOM   2614 C  C     . GLU B 1 142 ? -23.013 47.198  -9.773   1.00 92.77  ?  142 GLU B C     1 
ATOM   2615 O  O     . GLU B 1 142 ? -22.597 48.362  -9.788   1.00 88.30  ?  142 GLU B O     1 
ATOM   2616 C  CB    . GLU B 1 142 ? -24.841 46.359  -11.293  1.00 93.35  ?  142 GLU B CB    1 
ATOM   2617 C  CG    . GLU B 1 142 ? -26.289 45.938  -11.512  1.00 106.77 ?  142 GLU B CG    1 
ATOM   2618 C  CD    . GLU B 1 142 ? -26.848 44.844  -10.621  1.00 133.51 ?  142 GLU B CD    1 
ATOM   2619 O  OE1   . GLU B 1 142 ? -26.087 43.928  -10.235  1.00 131.76 ?  142 GLU B OE1   1 
ATOM   2620 O  OE2   . GLU B 1 142 ? -28.064 44.893  -10.329  1.00 132.18 -1 142 GLU B OE2   1 
ATOM   2621 N  N     . LYS B 1 143 ? -22.209 46.134  -9.646   1.00 91.76  ?  143 LYS B N     1 
ATOM   2622 C  CA    . LYS B 1 143 ? -20.761 46.245  -9.536   1.00 90.15  ?  143 LYS B CA    1 
ATOM   2623 C  C     . LYS B 1 143 ? -20.164 46.504  -10.916  1.00 90.95  ?  143 LYS B C     1 
ATOM   2624 O  O     . LYS B 1 143 ? -20.363 45.702  -11.832  1.00 92.09  ?  143 LYS B O     1 
ATOM   2625 C  CB    . LYS B 1 143 ? -20.160 44.972  -8.902   1.00 96.60  ?  143 LYS B CB    1 
ATOM   2626 C  CG    . LYS B 1 143 ? -20.312 44.900  -7.380   1.00 110.82 ?  143 LYS B CG    1 
ATOM   2627 C  CD    . LYS B 1 143 ? -20.751 43.517  -6.895   1.00 124.74 ?  143 LYS B CD    1 
ATOM   2628 C  CE    . LYS B 1 143 ? -19.599 42.626  -6.517   1.00 135.84 ?  143 LYS B CE    1 
ATOM   2629 N  NZ    . LYS B 1 143 ? -20.068 41.317  -5.997   1.00 150.09 ?  143 LYS B NZ    1 
ATOM   2630 N  N     . VAL B 1 144 ? -19.470 47.643  -11.074  1.00 83.40  ?  144 VAL B N     1 
ATOM   2631 C  CA    . VAL B 1 144 ? -18.801 47.991  -12.328  1.00 80.20  ?  144 VAL B CA    1 
ATOM   2632 C  C     . VAL B 1 144 ? -17.423 47.348  -12.267  1.00 84.95  ?  144 VAL B C     1 
ATOM   2633 O  O     . VAL B 1 144 ? -16.634 47.666  -11.375  1.00 84.46  ?  144 VAL B O     1 
ATOM   2634 C  CB    . VAL B 1 144 ? -18.726 49.517  -12.577  1.00 80.40  ?  144 VAL B CB    1 
ATOM   2635 C  CG1   . VAL B 1 144 ? -17.876 49.831  -13.799  1.00 78.02  ?  144 VAL B CG1   1 
ATOM   2636 C  CG2   . VAL B 1 144 ? -20.115 50.105  -12.740  1.00 79.73  ?  144 VAL B CG2   1 
ATOM   2637 N  N     . LYS B 1 145 ? -17.153 46.417  -13.181  1.00 82.47  ?  145 LYS B N     1 
ATOM   2638 C  CA    . LYS B 1 145 ? -15.882 45.704  -13.191  1.00 83.39  ?  145 LYS B CA    1 
ATOM   2639 C  C     . LYS B 1 145 ? -14.883 46.260  -14.209  1.00 84.14  ?  145 LYS B C     1 
ATOM   2640 O  O     . LYS B 1 145 ? -15.204 47.190  -14.951  1.00 80.66  ?  145 LYS B O     1 
ATOM   2641 C  CB    . LYS B 1 145 ? -16.106 44.186  -13.332  1.00 89.78  ?  145 LYS B CB    1 
ATOM   2642 C  CG    . LYS B 1 145 ? -16.522 43.522  -12.020  1.00 105.37 ?  145 LYS B CG    1 
ATOM   2643 C  CD    . LYS B 1 145 ? -17.816 42.735  -12.171  1.00 120.29 ?  145 LYS B CD    1 
ATOM   2644 C  CE    . LYS B 1 145 ? -17.636 41.232  -12.234  1.00 139.68 ?  145 LYS B CE    1 
ATOM   2645 N  NZ    . LYS B 1 145 ? -17.354 40.661  -10.897  1.00 153.60 ?  145 LYS B NZ    1 
ATOM   2646 N  N     . LEU B 1 146 ? -13.656 45.719  -14.194  1.00 81.92  ?  146 LEU B N     1 
ATOM   2647 C  CA    . LEU B 1 146 ? -12.559 46.087  -15.084  1.00 80.07  ?  146 LEU B CA    1 
ATOM   2648 C  C     . LEU B 1 146 ? -12.938 45.819  -16.544  1.00 84.33  ?  146 LEU B C     1 
ATOM   2649 O  O     . LEU B 1 146 ? -13.626 44.836  -16.831  1.00 86.34  ?  146 LEU B O     1 
ATOM   2650 C  CB    . LEU B 1 146 ? -11.301 45.292  -14.673  1.00 82.48  ?  146 LEU B CB    1 
ATOM   2651 C  CG    . LEU B 1 146 ? -10.028 45.423  -15.513  1.00 86.16  ?  146 LEU B CG    1 
ATOM   2652 C  CD1   . LEU B 1 146 ? -9.507  46.832  -15.507  1.00 82.84  ?  146 LEU B CD1   1 
ATOM   2653 C  CD2   . LEU B 1 146 ? -8.958  44.491  -15.005  1.00 91.86  ?  146 LEU B CD2   1 
ATOM   2654 N  N     . ASN B 1 147 ? -12.513 46.726  -17.449  1.00 78.82  ?  147 ASN B N     1 
ATOM   2655 C  CA    . ASN B 1 147 ? -12.755 46.709  -18.901  1.00 78.36  ?  147 ASN B CA    1 
ATOM   2656 C  C     . ASN B 1 147 ? -14.168 47.111  -19.361  1.00 79.57  ?  147 ASN B C     1 
ATOM   2657 O  O     . ASN B 1 147 ? -14.422 47.197  -20.569  1.00 78.32  ?  147 ASN B O     1 
ATOM   2658 C  CB    . ASN B 1 147 ? -12.217 45.443  -19.592  1.00 84.48  ?  147 ASN B CB    1 
ATOM   2659 C  CG    . ASN B 1 147 ? -10.722 45.297  -19.468  1.00 119.76 ?  147 ASN B CG    1 
ATOM   2660 O  OD1   . ASN B 1 147 ? -9.948  46.207  -19.799  1.00 118.42 ?  147 ASN B OD1   1 
ATOM   2661 N  ND2   . ASN B 1 147 ? -10.284 44.145  -18.986  1.00 115.25 ?  147 ASN B ND2   1 
ATOM   2662 N  N     . ASP B 1 148 ? -15.059 47.421  -18.404  1.00 74.99  ?  148 ASP B N     1 
ATOM   2663 C  CA    . ASP B 1 148 ? -16.407 47.887  -18.709  1.00 73.76  ?  148 ASP B CA    1 
ATOM   2664 C  C     . ASP B 1 148 ? -16.340 49.344  -19.156  1.00 73.68  ?  148 ASP B C     1 
ATOM   2665 O  O     . ASP B 1 148 ? -15.461 50.085  -18.716  1.00 71.62  ?  148 ASP B O     1 
ATOM   2666 C  CB    . ASP B 1 148 ? -17.320 47.790  -17.470  1.00 76.73  ?  148 ASP B CB    1 
ATOM   2667 C  CG    . ASP B 1 148 ? -17.769 46.400  -17.054  1.00 94.20  ?  148 ASP B CG    1 
ATOM   2668 O  OD1   . ASP B 1 148 ? -17.583 45.442  -17.849  1.00 97.63  ?  148 ASP B OD1   1 
ATOM   2669 O  OD2   . ASP B 1 148 ? -18.344 46.272  -15.946  1.00 101.73 -1 148 ASP B OD2   1 
ATOM   2670 N  N     . THR B 1 149 ? -17.273 49.754  -20.022  1.00 68.91  ?  149 THR B N     1 
ATOM   2671 C  CA    . THR B 1 149 ? -17.365 51.139  -20.470  1.00 65.65  ?  149 THR B CA    1 
ATOM   2672 C  C     . THR B 1 149 ? -18.682 51.682  -19.926  1.00 67.63  ?  149 THR B C     1 
ATOM   2673 O  O     . THR B 1 149 ? -19.752 51.162  -20.252  1.00 68.44  ?  149 THR B O     1 
ATOM   2674 C  CB    . THR B 1 149 ? -17.174 51.262  -21.986  1.00 72.17  ?  149 THR B CB    1 
ATOM   2675 O  OG1   . THR B 1 149 ? -16.062 50.461  -22.390  1.00 74.09  ?  149 THR B OG1   1 
ATOM   2676 C  CG2   . THR B 1 149 ? -16.940 52.688  -22.419  1.00 66.80  ?  149 THR B CG2   1 
ATOM   2677 N  N     . VAL B 1 150 ? -18.590 52.670  -19.033  1.00 62.49  ?  150 VAL B N     1 
ATOM   2678 C  CA    . VAL B 1 150 ? -19.749 53.270  -18.381  1.00 62.24  ?  150 VAL B CA    1 
ATOM   2679 C  C     . VAL B 1 150 ? -20.336 54.402  -19.216  1.00 66.63  ?  150 VAL B C     1 
ATOM   2680 O  O     . VAL B 1 150 ? -19.662 55.406  -19.473  1.00 66.75  ?  150 VAL B O     1 
ATOM   2681 C  CB    . VAL B 1 150 ? -19.451 53.702  -16.929  1.00 65.66  ?  150 VAL B CB    1 
ATOM   2682 C  CG1   . VAL B 1 150 ? -20.724 54.162  -16.234  1.00 66.13  ?  150 VAL B CG1   1 
ATOM   2683 C  CG2   . VAL B 1 150 ? -18.805 52.568  -16.147  1.00 66.94  ?  150 VAL B CG2   1 
ATOM   2684 N  N     . ARG B 1 151 ? -21.598 54.228  -19.637  1.00 63.11  ?  151 ARG B N     1 
ATOM   2685 C  CA    . ARG B 1 151 ? -22.334 55.199  -20.433  1.00 62.34  ?  151 ARG B CA    1 
ATOM   2686 C  C     . ARG B 1 151 ? -23.233 55.973  -19.485  1.00 68.40  ?  151 ARG B C     1 
ATOM   2687 O  O     . ARG B 1 151 ? -24.284 55.472  -19.080  1.00 70.36  ?  151 ARG B O     1 
ATOM   2688 C  CB    . ARG B 1 151 ? -23.154 54.489  -21.525  1.00 61.96  ?  151 ARG B CB    1 
ATOM   2689 C  CG    . ARG B 1 151 ? -23.639 55.419  -22.619  1.00 66.23  ?  151 ARG B CG    1 
ATOM   2690 C  CD    . ARG B 1 151 ? -24.606 54.744  -23.553  1.00 69.89  ?  151 ARG B CD    1 
ATOM   2691 N  NE    . ARG B 1 151 ? -25.980 54.933  -23.104  1.00 77.67  ?  151 ARG B NE    1 
ATOM   2692 C  CZ    . ARG B 1 151 ? -26.712 53.993  -22.518  1.00 96.21  ?  151 ARG B CZ    1 
ATOM   2693 N  NH1   . ARG B 1 151 ? -26.211 52.779  -22.318  1.00 83.99  ?  151 ARG B NH1   1 
ATOM   2694 N  NH2   . ARG B 1 151 ? -27.955 54.254  -22.136  1.00 85.50  ?  151 ARG B NH2   1 
ATOM   2695 N  N     . ALA B 1 152 ? -22.798 57.174  -19.089  1.00 64.77  ?  152 ALA B N     1 
ATOM   2696 C  CA    . ALA B 1 152 ? -23.566 58.009  -18.170  1.00 65.50  ?  152 ALA B CA    1 
ATOM   2697 C  C     . ALA B 1 152 ? -24.416 59.005  -18.930  1.00 69.29  ?  152 ALA B C     1 
ATOM   2698 O  O     . ALA B 1 152 ? -23.910 59.679  -19.827  1.00 68.21  ?  152 ALA B O     1 
ATOM   2699 C  CB    . ALA B 1 152 ? -22.635 58.745  -17.219  1.00 65.54  ?  152 ALA B CB    1 
ATOM   2700 N  N     . GLU B 1 153 ? -25.705 59.095  -18.576  1.00 66.29  ?  153 GLU B N     1 
ATOM   2701 C  CA    . GLU B 1 153 ? -26.605 60.069  -19.177  1.00 66.81  ?  153 GLU B CA    1 
ATOM   2702 C  C     . GLU B 1 153 ? -27.271 60.925  -18.119  1.00 71.42  ?  153 GLU B C     1 
ATOM   2703 O  O     . GLU B 1 153 ? -27.874 60.393  -17.186  1.00 73.08  ?  153 GLU B O     1 
ATOM   2704 C  CB    . GLU B 1 153 ? -27.592 59.475  -20.206  1.00 69.55  ?  153 GLU B CB    1 
ATOM   2705 C  CG    . GLU B 1 153 ? -28.176 58.107  -19.898  1.00 83.70  ?  153 GLU B CG    1 
ATOM   2706 C  CD    . GLU B 1 153 ? -29.144 57.559  -20.933  1.00 112.05 ?  153 GLU B CD    1 
ATOM   2707 O  OE1   . GLU B 1 153 ? -28.909 57.765  -22.148  1.00 114.83 ?  153 GLU B OE1   1 
ATOM   2708 O  OE2   . GLU B 1 153 ? -30.145 56.923  -20.528  1.00 107.22 -1 153 GLU B OE2   1 
ATOM   2709 N  N     . ALA B 1 154 ? -27.105 62.249  -18.233  1.00 66.52  ?  154 ALA B N     1 
ATOM   2710 C  CA    . ALA B 1 154 ? -27.657 63.227  -17.305  1.00 67.12  ?  154 ALA B CA    1 
ATOM   2711 C  C     . ALA B 1 154 ? -28.784 64.005  -17.965  1.00 72.84  ?  154 ALA B C     1 
ATOM   2712 O  O     . ALA B 1 154 ? -28.655 64.416  -19.119  1.00 72.44  ?  154 ALA B O     1 
ATOM   2713 C  CB    . ALA B 1 154 ? -26.567 64.176  -16.833  1.00 67.02  ?  154 ALA B CB    1 
ATOM   2714 N  N     . ARG B 1 155 ? -29.893 64.197  -17.235  1.00 71.38  ?  155 ARG B N     1 
ATOM   2715 C  CA    . ARG B 1 155 ? -31.068 64.928  -17.709  1.00 73.28  ?  155 ARG B CA    1 
ATOM   2716 C  C     . ARG B 1 155 ? -31.506 65.950  -16.674  1.00 80.06  ?  155 ARG B C     1 
ATOM   2717 O  O     . ARG B 1 155 ? -31.557 65.630  -15.485  1.00 80.60  ?  155 ARG B O     1 
ATOM   2718 C  CB    . ARG B 1 155 ? -32.231 63.966  -17.995  1.00 73.66  ?  155 ARG B CB    1 
ATOM   2719 C  CG    . ARG B 1 155 ? -32.068 63.144  -19.251  1.00 83.50  ?  155 ARG B CG    1 
ATOM   2720 C  CD    . ARG B 1 155 ? -33.205 62.160  -19.424  1.00 96.02  ?  155 ARG B CD    1 
ATOM   2721 N  NE    . ARG B 1 155 ? -32.862 61.068  -20.334  1.00 109.60 ?  155 ARG B NE    1 
ATOM   2722 C  CZ    . ARG B 1 155 ? -32.206 59.966  -19.978  1.00 126.17 ?  155 ARG B CZ    1 
ATOM   2723 N  NH1   . ARG B 1 155 ? -31.796 59.803  -18.725  1.00 111.06 ?  155 ARG B NH1   1 
ATOM   2724 N  NH2   . ARG B 1 155 ? -31.949 59.023  -20.874  1.00 115.78 ?  155 ARG B NH2   1 
ATOM   2725 N  N     . VAL B 1 156 ? -31.838 67.171  -17.123  1.00 78.31  ?  156 VAL B N     1 
ATOM   2726 C  CA    . VAL B 1 156 ? -32.334 68.226  -16.239  1.00 80.62  ?  156 VAL B CA    1 
ATOM   2727 C  C     . VAL B 1 156 ? -33.807 67.906  -15.975  1.00 87.55  ?  156 VAL B C     1 
ATOM   2728 O  O     . VAL B 1 156 ? -34.603 67.864  -16.917  1.00 88.78  ?  156 VAL B O     1 
ATOM   2729 C  CB    . VAL B 1 156 ? -32.123 69.657  -16.813  1.00 85.59  ?  156 VAL B CB    1 
ATOM   2730 C  CG1   . VAL B 1 156 ? -32.756 70.712  -15.912  1.00 88.79  ?  156 VAL B CG1   1 
ATOM   2731 C  CG2   . VAL B 1 156 ? -30.644 69.957  -17.013  1.00 83.06  ?  156 VAL B CG2   1 
ATOM   2732 N  N     . VAL B 1 157 ? -34.149 67.622  -14.710  1.00 85.11  ?  157 VAL B N     1 
ATOM   2733 C  CA    . VAL B 1 157 ? -35.517 67.274  -14.316  1.00 88.00  ?  157 VAL B CA    1 
ATOM   2734 C  C     . VAL B 1 157 ? -36.310 68.476  -13.816  1.00 95.10  ?  157 VAL B C     1 
ATOM   2735 O  O     . VAL B 1 157 ? -37.522 68.548  -14.034  1.00 97.68  ?  157 VAL B O     1 
ATOM   2736 C  CB    . VAL B 1 157 ? -35.616 66.033  -13.391  1.00 92.02  ?  157 VAL B CB    1 
ATOM   2737 C  CG1   . VAL B 1 157 ? -35.127 64.781  -14.110  1.00 89.42  ?  157 VAL B CG1   1 
ATOM   2738 C  CG2   . VAL B 1 157 ? -34.872 66.232  -12.074  1.00 91.55  ?  157 VAL B CG2   1 
ATOM   2739 N  N     . ASN B 1 158 ? -35.617 69.426  -13.165  1.00 91.27  ?  158 ASN B N     1 
ATOM   2740 C  CA    . ASN B 1 158 ? -36.205 70.659  -12.647  1.00 94.54  ?  158 ASN B CA    1 
ATOM   2741 C  C     . ASN B 1 158 ? -35.181 71.788  -12.631  1.00 97.22  ?  158 ASN B C     1 
ATOM   2742 O  O     . ASN B 1 158 ? -33.979 71.533  -12.716  1.00 93.48  ?  158 ASN B O     1 
ATOM   2743 C  CB    . ASN B 1 158 ? -36.792 70.441  -11.254  1.00 97.97  ?  158 ASN B CB    1 
ATOM   2744 C  CG    . ASN B 1 158 ? -37.811 71.474  -10.834  1.00 122.27 ?  158 ASN B CG    1 
ATOM   2745 O  OD1   . ASN B 1 158 ? -38.743 71.821  -11.575  1.00 119.92 ?  158 ASN B OD1   1 
ATOM   2746 N  ND2   . ASN B 1 158 ? -37.672 71.958  -9.612   1.00 112.99 ?  158 ASN B ND2   1 
ATOM   2747 N  N     . GLN B 1 159 ? -35.667 73.037  -12.560  1.00 96.92  ?  159 GLN B N     1 
ATOM   2748 C  CA    . GLN B 1 159 ? -34.843 74.238  -12.524  1.00 97.31  ?  159 GLN B CA    1 
ATOM   2749 C  C     . GLN B 1 159 ? -35.564 75.349  -11.763  1.00 106.62 ?  159 GLN B C     1 
ATOM   2750 O  O     . GLN B 1 159 ? -36.639 75.798  -12.180  1.00 109.08 ?  159 GLN B O     1 
ATOM   2751 C  CB    . GLN B 1 159 ? -34.466 74.698  -13.945  1.00 97.53  ?  159 GLN B CB    1 
ATOM   2752 C  CG    . GLN B 1 159 ? -33.438 75.828  -13.977  1.00 106.91 ?  159 GLN B CG    1 
ATOM   2753 C  CD    . GLN B 1 159 ? -33.521 76.670  -15.229  1.00 126.08 ?  159 GLN B CD    1 
ATOM   2754 O  OE1   . GLN B 1 159 ? -33.550 76.169  -16.362  1.00 120.64 ?  159 GLN B OE1   1 
ATOM   2755 N  NE2   . GLN B 1 159 ? -33.501 77.980  -15.051  1.00 119.43 ?  159 GLN B NE2   1 
ATOM   2756 N  N     . THR B 1 160 ? -34.968 75.775  -10.638  1.00 104.51 ?  160 THR B N     1 
ATOM   2757 C  CA    . THR B 1 160 ? -35.467 76.868  -9.805   1.00 109.14 ?  160 THR B CA    1 
ATOM   2758 C  C     . THR B 1 160 ? -34.679 78.133  -10.179  1.00 114.80 ?  160 THR B C     1 
ATOM   2759 O  O     . THR B 1 160 ? -33.949 78.113  -11.169  1.00 112.16 ?  160 THR B O     1 
ATOM   2760 C  CB    . THR B 1 160 ? -35.389 76.503  -8.314   1.00 118.91 ?  160 THR B CB    1 
ATOM   2761 O  OG1   . THR B 1 160 ? -34.029 76.284  -7.941   1.00 115.08 ?  160 THR B OG1   1 
ATOM   2762 C  CG2   . THR B 1 160 ? -36.244 75.295  -7.958   1.00 117.83 ?  160 THR B CG2   1 
ATOM   2763 N  N     . ALA B 1 161 ? -34.835 79.230  -9.421   1.00 116.06 ?  161 ALA B N     1 
ATOM   2764 C  CA    . ALA B 1 161 ? -34.120 80.478  -9.691   1.00 118.12 ?  161 ALA B CA    1 
ATOM   2765 C  C     . ALA B 1 161 ? -32.647 80.382  -9.279   1.00 119.30 ?  161 ALA B C     1 
ATOM   2766 O  O     . ALA B 1 161 ? -31.807 81.082  -9.845   1.00 119.01 ?  161 ALA B O     1 
ATOM   2767 C  CB    . ALA B 1 161 ? -34.795 81.633  -8.971   1.00 125.06 ?  161 ALA B CB    1 
ATOM   2768 N  N     . LYS B 1 162 ? -32.337 79.503  -8.306   1.00 114.06 ?  162 LYS B N     1 
ATOM   2769 C  CA    . LYS B 1 162 ? -30.989 79.303  -7.767   1.00 111.99 ?  162 LYS B CA    1 
ATOM   2770 C  C     . LYS B 1 162 ? -30.400 77.917  -8.046   1.00 110.58 ?  162 LYS B C     1 
ATOM   2771 O  O     . LYS B 1 162 ? -29.187 77.751  -7.917   1.00 108.10 ?  162 LYS B O     1 
ATOM   2772 C  CB    . LYS B 1 162 ? -30.971 79.586  -6.253   1.00 117.88 ?  162 LYS B CB    1 
ATOM   2773 C  CG    . LYS B 1 162 ? -30.862 81.057  -5.903   1.00 137.14 ?  162 LYS B CG    1 
ATOM   2774 C  CD    . LYS B 1 162 ? -31.013 81.273  -4.418   1.00 149.11 ?  162 LYS B CD    1 
ATOM   2775 C  CE    . LYS B 1 162 ? -30.796 82.712  -4.049   1.00 165.81 ?  162 LYS B CE    1 
ATOM   2776 N  NZ    . LYS B 1 162 ? -32.041 83.515  -4.171   1.00 179.84 ?  162 LYS B NZ    1 
ATOM   2777 N  N     . HIS B 1 163 ? -31.234 76.924  -8.425   1.00 105.42 ?  163 HIS B N     1 
ATOM   2778 C  CA    . HIS B 1 163 ? -30.751 75.558  -8.666   1.00 100.38 ?  163 HIS B CA    1 
ATOM   2779 C  C     . HIS B 1 163 ? -31.240 74.874  -9.944   1.00 100.41 ?  163 HIS B C     1 
ATOM   2780 O  O     . HIS B 1 163 ? -32.247 75.267  -10.528  1.00 101.62 ?  163 HIS B O     1 
ATOM   2781 C  CB    . HIS B 1 163 ? -31.066 74.663  -7.460   1.00 101.30 ?  163 HIS B CB    1 
ATOM   2782 C  CG    . HIS B 1 163 ? -30.314 75.032  -6.226   1.00 106.28 ?  163 HIS B CG    1 
ATOM   2783 N  ND1   . HIS B 1 163 ? -30.799 75.979  -5.348   1.00 112.70 ?  163 HIS B ND1   1 
ATOM   2784 C  CD2   . HIS B 1 163 ? -29.128 74.573  -5.767   1.00 105.83 ?  163 HIS B CD2   1 
ATOM   2785 C  CE1   . HIS B 1 163 ? -29.898 76.065  -4.383   1.00 112.63 ?  163 HIS B CE1   1 
ATOM   2786 N  NE2   . HIS B 1 163 ? -28.877 75.233  -4.590   1.00 108.88 ?  163 HIS B NE2   1 
ATOM   2787 N  N     . TYR B 1 164 ? -30.509 73.826  -10.349  1.00 92.53  ?  164 TYR B N     1 
ATOM   2788 C  CA    . TYR B 1 164 ? -30.784 72.940  -11.481  1.00 89.43  ?  164 TYR B CA    1 
ATOM   2789 C  C     . TYR B 1 164 ? -30.816 71.528  -10.896  1.00 92.47  ?  164 TYR B C     1 
ATOM   2790 O  O     . TYR B 1 164 ? -29.869 71.124  -10.214  1.00 90.74  ?  164 TYR B O     1 
ATOM   2791 C  CB    . TYR B 1 164 ? -29.670 73.029  -12.536  1.00 87.31  ?  164 TYR B CB    1 
ATOM   2792 C  CG    . TYR B 1 164 ? -29.955 73.946  -13.705  1.00 89.89  ?  164 TYR B CG    1 
ATOM   2793 C  CD1   . TYR B 1 164 ? -30.562 73.464  -14.859  1.00 90.89  ?  164 TYR B CD1   1 
ATOM   2794 C  CD2   . TYR B 1 164 ? -29.522 75.266  -13.699  1.00 93.17  ?  164 TYR B CD2   1 
ATOM   2795 C  CE1   . TYR B 1 164 ? -30.780 74.291  -15.962  1.00 93.32  ?  164 TYR B CE1   1 
ATOM   2796 C  CE2   . TYR B 1 164 ? -29.741 76.106  -14.792  1.00 95.91  ?  164 TYR B CE2   1 
ATOM   2797 C  CZ    . TYR B 1 164 ? -30.367 75.613  -15.924  1.00 101.77 ?  164 TYR B CZ    1 
ATOM   2798 O  OH    . TYR B 1 164 ? -30.593 76.441  -17.000  1.00 103.84 ?  164 TYR B OH    1 
ATOM   2799 N  N     . TYR B 1 165 ? -31.907 70.795  -11.115  1.00 90.11  ?  165 TYR B N     1 
ATOM   2800 C  CA    . TYR B 1 165 ? -32.035 69.439  -10.593  1.00 88.78  ?  165 TYR B CA    1 
ATOM   2801 C  C     . TYR B 1 165 ? -31.775 68.447  -11.710  1.00 89.78  ?  165 TYR B C     1 
ATOM   2802 O  O     . TYR B 1 165 ? -32.466 68.466  -12.729  1.00 89.62  ?  165 TYR B O     1 
ATOM   2803 C  CB    . TYR B 1 165 ? -33.380 69.232  -9.875   1.00 93.25  ?  165 TYR B CB    1 
ATOM   2804 C  CG    . TYR B 1 165 ? -33.552 70.129  -8.663   1.00 98.37  ?  165 TYR B CG    1 
ATOM   2805 C  CD1   . TYR B 1 165 ? -33.057 69.753  -7.419   1.00 100.75 ?  165 TYR B CD1   1 
ATOM   2806 C  CD2   . TYR B 1 165 ? -34.193 71.358  -8.768   1.00 102.29 ?  165 TYR B CD2   1 
ATOM   2807 C  CE1   . TYR B 1 165 ? -33.211 70.576  -6.302   1.00 105.01 ?  165 TYR B CE1   1 
ATOM   2808 C  CE2   . TYR B 1 165 ? -34.337 72.196  -7.663   1.00 106.54 ?  165 TYR B CE2   1 
ATOM   2809 C  CZ    . TYR B 1 165 ? -33.847 71.800  -6.431   1.00 114.14 ?  165 TYR B CZ    1 
ATOM   2810 O  OH    . TYR B 1 165 ? -33.995 72.628  -5.343   1.00 118.80 ?  165 TYR B OH    1 
ATOM   2811 N  N     . VAL B 1 166 ? -30.706 67.649  -11.556  1.00 84.04  ?  166 VAL B N     1 
ATOM   2812 C  CA    . VAL B 1 166 ? -30.239 66.697  -12.569  1.00 81.34  ?  166 VAL B CA    1 
ATOM   2813 C  C     . VAL B 1 166 ? -30.323 65.244  -12.097  1.00 85.86  ?  166 VAL B C     1 
ATOM   2814 O  O     . VAL B 1 166 ? -29.915 64.935  -10.980  1.00 86.22  ?  166 VAL B O     1 
ATOM   2815 C  CB    . VAL B 1 166 ? -28.800 67.043  -13.056  1.00 82.51  ?  166 VAL B CB    1 
ATOM   2816 C  CG1   . VAL B 1 166 ? -28.394 66.175  -14.236  1.00 79.92  ?  166 VAL B CG1   1 
ATOM   2817 C  CG2   . VAL B 1 166 ? -28.663 68.519  -13.416  1.00 83.61  ?  166 VAL B CG2   1 
ATOM   2818 N  N     . GLU B 1 167 ? -30.812 64.356  -12.974  1.00 82.23  ?  167 GLU B N     1 
ATOM   2819 C  CA    . GLU B 1 167 ? -30.890 62.919  -12.741  1.00 82.04  ?  167 GLU B CA    1 
ATOM   2820 C  C     . GLU B 1 167 ? -29.878 62.244  -13.656  1.00 81.44  ?  167 GLU B C     1 
ATOM   2821 O  O     . GLU B 1 167 ? -29.932 62.425  -14.876  1.00 80.21  ?  167 GLU B O     1 
ATOM   2822 C  CB    . GLU B 1 167 ? -32.306 62.384  -13.016  1.00 86.24  ?  167 GLU B CB    1 
ATOM   2823 C  CG    . GLU B 1 167 ? -33.190 62.320  -11.783  1.00 106.17 ?  167 GLU B CG    1 
ATOM   2824 C  CD    . GLU B 1 167 ? -34.621 61.851  -11.993  1.00 147.97 ?  167 GLU B CD    1 
ATOM   2825 O  OE1   . GLU B 1 167 ? -34.920 61.271  -13.064  1.00 153.46 ?  167 GLU B OE1   1 
ATOM   2826 O  OE2   . GLU B 1 167 ? -35.446 62.056  -11.071  1.00 149.97 -1 167 GLU B OE2   1 
ATOM   2827 N  N     . VAL B 1 168 ? -28.940 61.495  -13.069  1.00 75.65  ?  168 VAL B N     1 
ATOM   2828 C  CA    . VAL B 1 168 ? -27.898 60.773  -13.802  1.00 72.67  ?  168 VAL B CA    1 
ATOM   2829 C  C     . VAL B 1 168 ? -28.191 59.273  -13.739  1.00 78.14  ?  168 VAL B C     1 
ATOM   2830 O  O     . VAL B 1 168 ? -28.508 58.744  -12.671  1.00 80.69  ?  168 VAL B O     1 
ATOM   2831 C  CB    . VAL B 1 168 ? -26.466 61.122  -13.307  1.00 74.05  ?  168 VAL B CB    1 
ATOM   2832 C  CG1   . VAL B 1 168 ? -25.401 60.400  -14.122  1.00 71.69  ?  168 VAL B CG1   1 
ATOM   2833 C  CG2   . VAL B 1 168 ? -26.223 62.623  -13.341  1.00 73.57  ?  168 VAL B CG2   1 
ATOM   2834 N  N     . LYS B 1 169 ? -28.114 58.606  -14.891  1.00 72.69  ?  169 LYS B N     1 
ATOM   2835 C  CA    . LYS B 1 169 ? -28.313 57.170  -15.016  1.00 73.02  ?  169 LYS B CA    1 
ATOM   2836 C  C     . LYS B 1 169 ? -27.135 56.616  -15.812  1.00 75.53  ?  169 LYS B C     1 
ATOM   2837 O  O     . LYS B 1 169 ? -26.954 56.962  -16.985  1.00 74.45  ?  169 LYS B O     1 
ATOM   2838 C  CB    . LYS B 1 169 ? -29.652 56.855  -15.690  1.00 76.93  ?  169 LYS B CB    1 
ATOM   2839 C  CG    . LYS B 1 169 ? -30.836 56.933  -14.741  1.00 94.73  ?  169 LYS B CG    1 
ATOM   2840 C  CD    . LYS B 1 169 ? -32.159 56.690  -15.467  1.00 105.95 ?  169 LYS B CD    1 
ATOM   2841 C  CE    . LYS B 1 169 ? -33.353 56.762  -14.545  1.00 119.69 ?  169 LYS B CE    1 
ATOM   2842 N  NZ    . LYS B 1 169 ? -33.671 58.159  -14.138  1.00 129.09 ?  169 LYS B NZ    1 
ATOM   2843 N  N     . SER B 1 170 ? -26.286 55.825  -15.150  1.00 71.08  ?  170 SER B N     1 
ATOM   2844 C  CA    . SER B 1 170 ? -25.119 55.238  -15.792  1.00 68.89  ?  170 SER B CA    1 
ATOM   2845 C  C     . SER B 1 170 ? -25.375 53.772  -16.090  1.00 73.06  ?  170 SER B C     1 
ATOM   2846 O  O     . SER B 1 170 ? -25.955 53.065  -15.259  1.00 74.69  ?  170 SER B O     1 
ATOM   2847 C  CB    . SER B 1 170 ? -23.879 55.427  -14.931  1.00 71.49  ?  170 SER B CB    1 
ATOM   2848 O  OG    . SER B 1 170 ? -23.600 56.806  -14.751  1.00 77.96  ?  170 SER B OG    1 
ATOM   2849 N  N     . TYR B 1 171 ? -24.971 53.330  -17.295  1.00 67.90  ?  171 TYR B N     1 
ATOM   2850 C  CA    . TYR B 1 171 ? -25.182 51.971  -17.783  1.00 69.26  ?  171 TYR B CA    1 
ATOM   2851 C  C     . TYR B 1 171 ? -23.908 51.324  -18.295  1.00 73.41  ?  171 TYR B C     1 
ATOM   2852 O  O     . TYR B 1 171 ? -22.986 52.012  -18.741  1.00 70.67  ?  171 TYR B O     1 
ATOM   2853 C  CB    . TYR B 1 171 ? -26.200 51.976  -18.937  1.00 71.11  ?  171 TYR B CB    1 
ATOM   2854 C  CG    . TYR B 1 171 ? -27.534 52.608  -18.619  1.00 73.81  ?  171 TYR B CG    1 
ATOM   2855 C  CD1   . TYR B 1 171 ? -27.737 53.974  -18.779  1.00 72.96  ?  171 TYR B CD1   1 
ATOM   2856 C  CD2   . TYR B 1 171 ? -28.617 51.833  -18.215  1.00 78.80  ?  171 TYR B CD2   1 
ATOM   2857 C  CE1   . TYR B 1 171 ? -28.971 54.562  -18.503  1.00 75.40  ?  171 TYR B CE1   1 
ATOM   2858 C  CE2   . TYR B 1 171 ? -29.857 52.406  -17.937  1.00 80.68  ?  171 TYR B CE2   1 
ATOM   2859 C  CZ    . TYR B 1 171 ? -30.030 53.773  -18.080  1.00 86.14  ?  171 TYR B CZ    1 
ATOM   2860 O  OH    . TYR B 1 171 ? -31.250 54.349  -17.817  1.00 89.72  ?  171 TYR B OH    1 
ATOM   2861 N  N     . VAL B 1 172 ? -23.889 49.983  -18.277  1.00 73.24  ?  172 VAL B N     1 
ATOM   2862 C  CA    . VAL B 1 172 ? -22.824 49.146  -18.834  1.00 73.56  ?  172 VAL B CA    1 
ATOM   2863 C  C     . VAL B 1 172 ? -23.571 48.104  -19.686  1.00 81.21  ?  172 VAL B C     1 
ATOM   2864 O  O     . VAL B 1 172 ? -24.243 47.245  -19.115  1.00 84.17  ?  172 VAL B O     1 
ATOM   2865 C  CB    . VAL B 1 172 ? -21.922 48.492  -17.748  1.00 77.89  ?  172 VAL B CB    1 
ATOM   2866 C  CG1   . VAL B 1 172 ? -20.944 47.505  -18.375  1.00 78.60  ?  172 VAL B CG1   1 
ATOM   2867 C  CG2   . VAL B 1 172 ? -21.165 49.540  -16.939  1.00 75.32  ?  172 VAL B CG2   1 
ATOM   2868 N  N     . LYS B 1 173 ? -23.491 48.203  -21.037  1.00 77.56  ?  173 LYS B N     1 
ATOM   2869 C  CA    . LYS B 1 173 ? -24.177 47.316  -21.998  1.00 80.60  ?  173 LYS B CA    1 
ATOM   2870 C  C     . LYS B 1 173 ? -25.691 47.283  -21.684  1.00 89.60  ?  173 LYS B C     1 
ATOM   2871 O  O     . LYS B 1 173 ? -26.259 46.197  -21.484  1.00 93.50  ?  173 LYS B O     1 
ATOM   2872 C  CB    . LYS B 1 173 ? -23.593 45.881  -21.965  1.00 85.34  ?  173 LYS B CB    1 
ATOM   2873 C  CG    . LYS B 1 173 ? -22.218 45.682  -22.556  1.00 94.16  ?  173 LYS B CG    1 
ATOM   2874 C  CD    . LYS B 1 173 ? -21.864 44.189  -22.566  1.00 106.92 ?  173 LYS B CD    1 
ATOM   2875 C  CE    . LYS B 1 173 ? -20.674 43.856  -23.431  1.00 121.83 ?  173 LYS B CE    1 
ATOM   2876 N  NZ    . LYS B 1 173 ? -19.375 44.183  -22.774  1.00 129.83 ?  173 LYS B NZ    1 
ATOM   2877 N  N     . HIS B 1 174 ? -26.329 48.472  -21.595  1.00 85.49  ?  174 HIS B N     1 
ATOM   2878 C  CA    . HIS B 1 174 ? -27.748 48.630  -21.221  1.00 87.88  ?  174 HIS B CA    1 
ATOM   2879 C  C     . HIS B 1 174 ? -28.224 47.810  -19.983  1.00 92.60  ?  174 HIS B C     1 
ATOM   2880 O  O     . HIS B 1 174 ? -29.153 47.000  -20.053  1.00 94.93  ?  174 HIS B O     1 
ATOM   2881 C  CB    . HIS B 1 174 ? -28.753 48.664  -22.408  1.00 90.77  ?  174 HIS B CB    1 
ATOM   2882 C  CG    . HIS B 1 174 ? -28.658 47.537  -23.391  1.00 97.00  ?  174 HIS B CG    1 
ATOM   2883 N  ND1   . HIS B 1 174 ? -28.605 47.778  -24.754  1.00 98.55  ?  174 HIS B ND1   1 
ATOM   2884 C  CD2   . HIS B 1 174 ? -28.676 46.199  -23.185  1.00 102.37 ?  174 HIS B CD2   1 
ATOM   2885 C  CE1   . HIS B 1 174 ? -28.546 46.587  -25.325  1.00 101.17 ?  174 HIS B CE1   1 
ATOM   2886 N  NE2   . HIS B 1 174 ? -28.580 45.607  -24.422  1.00 103.91 ?  174 HIS B NE2   1 
ATOM   2887 N  N     . THR B 1 175 ? -27.511 48.035  -18.865  1.00 86.90  ?  175 THR B N     1 
ATOM   2888 C  CA    . THR B 1 175 ? -27.705 47.506  -17.516  1.00 88.33  ?  175 THR B CA    1 
ATOM   2889 C  C     . THR B 1 175 ? -27.399 48.673  -16.570  1.00 88.93  ?  175 THR B C     1 
ATOM   2890 O  O     . THR B 1 175 ? -26.249 49.120  -16.507  1.00 85.79  ?  175 THR B O     1 
ATOM   2891 C  CB    . THR B 1 175 ? -26.763 46.316  -17.252  1.00 95.52  ?  175 THR B CB    1 
ATOM   2892 O  OG1   . THR B 1 175 ? -26.897 45.354  -18.294  1.00 98.28  ?  175 THR B OG1   1 
ATOM   2893 C  CG2   . THR B 1 175 ? -27.000 45.665  -15.901  1.00 96.36  ?  175 THR B CG2   1 
ATOM   2894 N  N     . LEU B 1 176 ? -28.429 49.189  -15.869  1.00 86.17  ?  176 LEU B N     1 
ATOM   2895 C  CA    . LEU B 1 176 ? -28.273 50.305  -14.933  1.00 83.90  ?  176 LEU B CA    1 
ATOM   2896 C  C     . LEU B 1 176 ? -27.371 49.882  -13.788  1.00 88.21  ?  176 LEU B C     1 
ATOM   2897 O  O     . LEU B 1 176 ? -27.673 48.915  -13.090  1.00 92.37  ?  176 LEU B O     1 
ATOM   2898 C  CB    . LEU B 1 176 ? -29.635 50.816  -14.422  1.00 85.76  ?  176 LEU B CB    1 
ATOM   2899 C  CG    . LEU B 1 176 ? -29.604 52.079  -13.549  1.00 88.82  ?  176 LEU B CG    1 
ATOM   2900 C  CD1   . LEU B 1 176 ? -29.493 53.338  -14.391  1.00 86.32  ?  176 LEU B CD1   1 
ATOM   2901 C  CD2   . LEU B 1 176 ? -30.827 52.160  -12.675  1.00 93.86  ?  176 LEU B CD2   1 
ATOM   2902 N  N     . VAL B 1 177 ? -26.235 50.567  -13.652  1.00 80.55  ?  177 VAL B N     1 
ATOM   2903 C  CA    . VAL B 1 177 ? -25.215 50.286  -12.644  1.00 80.31  ?  177 VAL B CA    1 
ATOM   2904 C  C     . VAL B 1 177 ? -25.130 51.396  -11.593  1.00 84.15  ?  177 VAL B C     1 
ATOM   2905 O  O     . VAL B 1 177 ? -24.681 51.153  -10.467  1.00 85.71  ?  177 VAL B O     1 
ATOM   2906 C  CB    . VAL B 1 177 ? -23.833 49.992  -13.288  1.00 82.06  ?  177 VAL B CB    1 
ATOM   2907 C  CG1   . VAL B 1 177 ? -23.852 48.683  -14.068  1.00 83.83  ?  177 VAL B CG1   1 
ATOM   2908 C  CG2   . VAL B 1 177 ? -23.359 51.143  -14.179  1.00 78.41  ?  177 VAL B CG2   1 
ATOM   2909 N  N     . PHE B 1 178 ? -25.554 52.614  -11.970  1.00 78.46  ?  178 PHE B N     1 
ATOM   2910 C  CA    . PHE B 1 178 ? -25.500 53.797  -11.118  1.00 77.21  ?  178 PHE B CA    1 
ATOM   2911 C  C     . PHE B 1 178 ? -26.670 54.727  -11.397  1.00 81.26  ?  178 PHE B C     1 
ATOM   2912 O  O     . PHE B 1 178 ? -27.049 54.914  -12.555  1.00 80.80  ?  178 PHE B O     1 
ATOM   2913 C  CB    . PHE B 1 178 ? -24.165 54.520  -11.350  1.00 76.01  ?  178 PHE B CB    1 
ATOM   2914 C  CG    . PHE B 1 178 ? -23.947 55.808  -10.600  1.00 76.65  ?  178 PHE B CG    1 
ATOM   2915 C  CD1   . PHE B 1 178 ? -24.380 57.020  -11.127  1.00 77.33  ?  178 PHE B CD1   1 
ATOM   2916 C  CD2   . PHE B 1 178 ? -23.247 55.821  -9.401   1.00 80.23  ?  178 PHE B CD2   1 
ATOM   2917 C  CE1   . PHE B 1 178 ? -24.165 58.214  -10.441  1.00 79.98  ?  178 PHE B CE1   1 
ATOM   2918 C  CE2   . PHE B 1 178 ? -23.021 57.017  -8.720   1.00 80.83  ?  178 PHE B CE2   1 
ATOM   2919 C  CZ    . PHE B 1 178 ? -23.473 58.207  -9.250   1.00 78.92  ?  178 PHE B CZ    1 
ATOM   2920 N  N     . LYS B 1 179 ? -27.218 55.325  -10.329  1.00 78.62  ?  179 LYS B N     1 
ATOM   2921 C  CA    . LYS B 1 179 ? -28.331 56.281  -10.343  1.00 79.39  ?  179 LYS B CA    1 
ATOM   2922 C  C     . LYS B 1 179 ? -27.936 57.417  -9.400   1.00 84.13  ?  179 LYS B C     1 
ATOM   2923 O  O     . LYS B 1 179 ? -27.550 57.160  -8.253   1.00 85.44  ?  179 LYS B O     1 
ATOM   2924 C  CB    . LYS B 1 179 ? -29.617 55.604  -9.840   1.00 85.63  ?  179 LYS B CB    1 
ATOM   2925 C  CG    . LYS B 1 179 ? -30.886 55.979  -10.581  1.00 99.33  ?  179 LYS B CG    1 
ATOM   2926 C  CD    . LYS B 1 179 ? -32.025 55.034  -10.183  1.00 111.29 ?  179 LYS B CD    1 
ATOM   2927 C  CE    . LYS B 1 179 ? -33.226 55.160  -11.092  1.00 121.88 ?  179 LYS B CE    1 
ATOM   2928 N  NZ    . LYS B 1 179 ? -34.163 54.014  -10.944  1.00 131.63 ?  179 LYS B NZ    1 
ATOM   2929 N  N     . GLY B 1 180 ? -27.996 58.651  -9.892   1.00 79.87  ?  180 GLY B N     1 
ATOM   2930 C  CA    . GLY B 1 180 ? -27.601 59.814  -9.104   1.00 80.15  ?  180 GLY B CA    1 
ATOM   2931 C  C     . GLY B 1 180 ? -28.433 61.058  -9.314   1.00 85.13  ?  180 GLY B C     1 
ATOM   2932 O  O     . GLY B 1 180 ? -28.666 61.466  -10.454  1.00 84.21  ?  180 GLY B O     1 
ATOM   2933 N  N     . ASN B 1 181 ? -28.862 61.682  -8.207   1.00 83.23  ?  181 ASN B N     1 
ATOM   2934 C  CA    . ASN B 1 181 ? -29.659 62.904  -8.222   1.00 84.21  ?  181 ASN B CA    1 
ATOM   2935 C  C     . ASN B 1 181 ? -28.759 64.056  -7.796   1.00 86.86  ?  181 ASN B C     1 
ATOM   2936 O  O     . ASN B 1 181 ? -28.084 63.954  -6.773   1.00 87.74  ?  181 ASN B O     1 
ATOM   2937 C  CB    . ASN B 1 181 ? -30.878 62.752  -7.322   1.00 89.45  ?  181 ASN B CB    1 
ATOM   2938 C  CG    . ASN B 1 181 ? -31.844 61.712  -7.831   1.00 121.93 ?  181 ASN B CG    1 
ATOM   2939 O  OD1   . ASN B 1 181 ? -32.808 62.026  -8.527   1.00 119.75 ?  181 ASN B OD1   1 
ATOM   2940 N  ND2   . ASN B 1 181 ? -31.585 60.443  -7.536   1.00 115.77 ?  181 ASN B ND2   1 
ATOM   2941 N  N     . PHE B 1 182 ? -28.694 65.117  -8.608   1.00 81.34  ?  182 PHE B N     1 
ATOM   2942 C  CA    . PHE B 1 182 ? -27.807 66.245  -8.363   1.00 80.93  ?  182 PHE B CA    1 
ATOM   2943 C  C     . PHE B 1 182 ? -28.522 67.574  -8.219   1.00 89.05  ?  182 PHE B C     1 
ATOM   2944 O  O     . PHE B 1 182 ? -29.419 67.892  -9.003   1.00 88.83  ?  182 PHE B O     1 
ATOM   2945 C  CB    . PHE B 1 182 ? -26.750 66.321  -9.471   1.00 79.68  ?  182 PHE B CB    1 
ATOM   2946 C  CG    . PHE B 1 182 ? -25.696 65.241  -9.403   1.00 79.03  ?  182 PHE B CG    1 
ATOM   2947 C  CD1   . PHE B 1 182 ? -25.971 63.946  -9.837   1.00 79.94  ?  182 PHE B CD1   1 
ATOM   2948 C  CD2   . PHE B 1 182 ? -24.424 65.519  -8.915   1.00 81.48  ?  182 PHE B CD2   1 
ATOM   2949 C  CE1   . PHE B 1 182 ? -24.999 62.943  -9.759   1.00 81.24  ?  182 PHE B CE1   1 
ATOM   2950 C  CE2   . PHE B 1 182 ? -23.447 64.519  -8.854   1.00 80.85  ?  182 PHE B CE2   1 
ATOM   2951 C  CZ    . PHE B 1 182 ? -23.743 63.237  -9.273   1.00 78.90  ?  182 PHE B CZ    1 
ATOM   2952 N  N     . LYS B 1 183 ? -28.114 68.352  -7.205   1.00 89.51  ?  183 LYS B N     1 
ATOM   2953 C  CA    . LYS B 1 183 ? -28.640 69.687  -6.927   1.00 93.28  ?  183 LYS B CA    1 
ATOM   2954 C  C     . LYS B 1 183 ? -27.513 70.661  -7.274   1.00 98.32  ?  183 LYS B C     1 
ATOM   2955 O  O     . LYS B 1 183 ? -26.581 70.860  -6.489   1.00 98.37  ?  183 LYS B O     1 
ATOM   2956 C  CB    . LYS B 1 183 ? -29.110 69.809  -5.462   1.00 99.15  ?  183 LYS B CB    1 
ATOM   2957 C  CG    . LYS B 1 183 ? -29.776 71.137  -5.123   1.00 115.32 ?  183 LYS B CG    1 
ATOM   2958 C  CD    . LYS B 1 183 ? -30.321 71.148  -3.705   1.00 128.51 ?  183 LYS B CD    1 
ATOM   2959 C  CE    . LYS B 1 183 ? -31.036 72.436  -3.382   1.00 140.09 ?  183 LYS B CE    1 
ATOM   2960 N  NZ    . LYS B 1 183 ? -31.766 72.349  -2.092   1.00 149.44 ?  183 LYS B NZ    1 
HETATM 2961 N  N     . MSE B 1 184 ? -27.577 71.203  -8.494   1.00 95.36  ?  184 MSE B N     1 
HETATM 2962 C  CA    . MSE B 1 184 ? -26.568 72.098  -9.045   1.00 95.69  ?  184 MSE B CA    1 
HETATM 2963 C  C     . MSE B 1 184 ? -26.955 73.548  -8.857   1.00 102.21 ?  184 MSE B C     1 
HETATM 2964 O  O     . MSE B 1 184 ? -27.974 73.980  -9.387   1.00 103.37 ?  184 MSE B O     1 
HETATM 2965 C  CB    . MSE B 1 184 ? -26.349 71.808  -10.544  1.00 96.20  ?  184 MSE B CB    1 
HETATM 2966 C  CG    . MSE B 1 184 ? -26.093 70.339  -10.866  1.00 101.42 ?  184 MSE B CG    1 
HETATM 2967 SE SE    . MSE B 1 184 ? -24.533 69.634  -9.953   1.00 109.72 ?  184 MSE B SE    1 
HETATM 2968 C  CE    . MSE B 1 184 ? -23.130 70.553  -10.964  1.00 105.78 ?  184 MSE B CE    1 
ATOM   2969 N  N     . PHE B 1 185 ? -26.142 74.306  -8.111   1.00 99.89  ?  185 PHE B N     1 
ATOM   2970 C  CA    . PHE B 1 185 ? -26.374 75.733  -7.918   1.00 103.48 ?  185 PHE B CA    1 
ATOM   2971 C  C     . PHE B 1 185 ? -25.881 76.467  -9.162   1.00 107.27 ?  185 PHE B C     1 
ATOM   2972 O  O     . PHE B 1 185 ? -24.810 76.144  -9.673   1.00 104.49 ?  185 PHE B O     1 
ATOM   2973 C  CB    . PHE B 1 185 ? -25.657 76.250  -6.656   1.00 107.54 ?  185 PHE B CB    1 
ATOM   2974 C  CG    . PHE B 1 185 ? -25.471 77.751  -6.598   1.00 113.06 ?  185 PHE B CG    1 
ATOM   2975 C  CD1   . PHE B 1 185 ? -26.534 78.589  -6.284   1.00 119.63 ?  185 PHE B CD1   1 
ATOM   2976 C  CD2   . PHE B 1 185 ? -24.237 78.326  -6.876   1.00 115.67 ?  185 PHE B CD2   1 
ATOM   2977 C  CE1   . PHE B 1 185 ? -26.369 79.974  -6.256   1.00 124.86 ?  185 PHE B CE1   1 
ATOM   2978 C  CE2   . PHE B 1 185 ? -24.073 79.713  -6.845   1.00 122.85 ?  185 PHE B CE2   1 
ATOM   2979 C  CZ    . PHE B 1 185 ? -25.139 80.527  -6.530   1.00 124.64 ?  185 PHE B CZ    1 
ATOM   2980 N  N     . TYR B 1 186 ? -26.651 77.453  -9.635   1.00 107.09 ?  186 TYR B N     1 
ATOM   2981 C  CA    . TYR B 1 186 ? -26.282 78.241  -10.803  1.00 108.16 ?  186 TYR B CA    1 
ATOM   2982 C  C     . TYR B 1 186 ? -26.428 79.737  -10.562  1.00 119.65 ?  186 TYR B C     1 
ATOM   2983 O  O     . TYR B 1 186 ? -27.329 80.165  -9.835   1.00 122.68 ?  186 TYR B O     1 
ATOM   2984 C  CB    . TYR B 1 186 ? -27.047 77.774  -12.057  1.00 107.32 ?  186 TYR B CB    1 
ATOM   2985 C  CG    . TYR B 1 186 ? -28.461 78.300  -12.193  1.00 111.70 ?  186 TYR B CG    1 
ATOM   2986 C  CD1   . TYR B 1 186 ? -29.490 77.791  -11.406  1.00 112.67 ?  186 TYR B CD1   1 
ATOM   2987 C  CD2   . TYR B 1 186 ? -28.775 79.282  -13.123  1.00 116.64 ?  186 TYR B CD2   1 
ATOM   2988 C  CE1   . TYR B 1 186 ? -30.795 78.259  -11.537  1.00 116.76 ?  186 TYR B CE1   1 
ATOM   2989 C  CE2   . TYR B 1 186 ? -30.075 79.760  -13.262  1.00 120.71 ?  186 TYR B CE2   1 
ATOM   2990 C  CZ    . TYR B 1 186 ? -31.084 79.246  -12.465  1.00 126.95 ?  186 TYR B CZ    1 
ATOM   2991 O  OH    . TYR B 1 186 ? -32.366 79.718  -12.598  1.00 131.04 ?  186 TYR B OH    1 
ATOM   2992 N  N     . ASP B 1 187 ? -25.536 80.531  -11.173  1.00 119.07 ?  187 ASP B N     1 
ATOM   2993 C  CA    . ASP B 1 187 ? -25.546 81.989  -11.062  1.00 124.97 ?  187 ASP B CA    1 
ATOM   2994 C  C     . ASP B 1 187 ? -25.148 82.625  -12.396  1.00 130.20 ?  187 ASP B C     1 
ATOM   2995 O  O     . ASP B 1 187 ? -24.131 82.249  -12.981  1.00 127.04 ?  187 ASP B O     1 
ATOM   2996 C  CB    . ASP B 1 187 ? -24.640 82.455  -9.900   1.00 129.25 ?  187 ASP B CB    1 
ATOM   2997 C  CG    . ASP B 1 187 ? -24.631 83.948  -9.613   1.00 146.08 ?  187 ASP B CG    1 
ATOM   2998 O  OD1   . ASP B 1 187 ? -25.681 84.604  -9.816   1.00 154.61 -1 187 ASP B OD1   1 
ATOM   2999 O  OD2   . ASP B 1 187 ? -23.589 84.451  -9.142   1.00 148.95 ?  187 ASP B OD2   1 
ATOM   3000 N  N     . LYS B 1 188 ? -25.963 83.584  -12.874  1.00 131.42 ?  188 LYS B N     1 
ATOM   3001 C  CA    . LYS B 1 188 ? -25.759 84.304  -14.140  1.00 133.76 ?  188 LYS B CA    1 
ATOM   3002 C  C     . LYS B 1 188 ? -24.728 85.457  -14.004  1.00 143.12 ?  188 LYS B C     1 
ATOM   3003 O  O     . LYS B 1 188 ? -24.881 86.520  -14.618  1.00 147.75 ?  188 LYS B O     1 
ATOM   3004 C  CB    . LYS B 1 188 ? -27.106 84.795  -14.716  1.00 139.01 ?  188 LYS B CB    1 
ATOM   3005 C  CG    . LYS B 1 188 ? -28.135 83.694  -14.943  1.00 145.49 ?  188 LYS B CG    1 
ATOM   3006 C  CD    . LYS B 1 188 ? -29.389 84.226  -15.616  1.00 157.20 ?  188 LYS B CD    1 
ATOM   3007 C  CE    . LYS B 1 188 ? -30.485 83.190  -15.718  1.00 164.45 ?  188 LYS B CE    1 
ATOM   3008 N  NZ    . LYS B 1 188 ? -30.201 82.162  -16.757  1.00 169.02 ?  188 LYS B NZ    1 
ATOM   3009 N  N     . ARG B 1 189 ? -23.659 85.209  -13.211  1.00 138.69 ?  189 ARG B N     1 
ATOM   3010 C  CA    . ARG B 1 189 ? -22.540 86.120  -12.945  1.00 145.66 ?  189 ARG B CA    1 
ATOM   3011 C  C     . ARG B 1 189 ? -21.217 85.390  -13.230  1.00 153.87 ?  189 ARG B C     1 
ATOM   3012 O  O     . ARG B 1 189 ? -20.445 85.874  -14.084  1.00 158.83 ?  189 ARG B O     1 
ATOM   3013 C  CB    . ARG B 1 189 ? -22.559 86.624  -11.485  1.00 149.28 ?  189 ARG B CB    1 
ATOM   3014 C  CG    . ARG B 1 189 ? -23.743 87.511  -11.108  1.00 164.50 ?  189 ARG B CG    1 
ATOM   3015 C  CD    . ARG B 1 189 ? -23.725 87.820  -9.622   1.00 175.72 ?  189 ARG B CD    1 
ATOM   3016 N  NE    . ARG B 1 189 ? -24.856 88.654  -9.213   1.00 190.17 ?  189 ARG B NE    1 
ATOM   3017 C  CZ    . ARG B 1 189 ? -25.069 89.073  -7.969   1.00 206.99 ?  189 ARG B CZ    1 
ATOM   3018 N  NH1   . ARG B 1 189 ? -24.231 88.739  -6.994   1.00 194.48 ?  189 ARG B NH1   1 
ATOM   3019 N  NH2   . ARG B 1 189 ? -26.122 89.830  -7.689   1.00 197.95 ?  189 ARG B NH2   1 
ATOM   3020 N  N     . GLY B 1 190 ? -20.970 84.318  -12.630  1.00 167.00 ?  190 GLY B N     1 
ATOM   3021 N  N     . GLU C 1 4   ? 27.965  67.633  -61.079  1.00 103.74 ?  4   GLU C N     1 
ATOM   3022 C  CA    . GLU C 1 4   ? 27.904  68.602  -59.993  1.00 103.34 ?  4   GLU C CA    1 
ATOM   3023 C  C     . GLU C 1 4   ? 26.516  68.601  -59.358  1.00 104.49 ?  4   GLU C C     1 
ATOM   3024 O  O     . GLU C 1 4   ? 26.358  68.065  -58.260  1.00 101.99 ?  4   GLU C O     1 
ATOM   3025 C  CB    . GLU C 1 4   ? 28.272  69.995  -60.498  1.00 107.94 ?  4   GLU C CB    1 
ATOM   3026 N  N     . THR C 1 5   ? 25.509  69.169  -60.051  1.00 101.34 ?  5   THR C N     1 
ATOM   3027 C  CA    . THR C 1 5   ? 24.127  69.235  -59.563  1.00 98.47  ?  5   THR C CA    1 
ATOM   3028 C  C     . THR C 1 5   ? 23.470  67.869  -59.726  1.00 96.80  ?  5   THR C C     1 
ATOM   3029 O  O     . THR C 1 5   ? 23.095  67.503  -60.841  1.00 96.81  ?  5   THR C O     1 
ATOM   3030 C  CB    . THR C 1 5   ? 23.330  70.355  -60.303  1.00 111.71 ?  5   THR C CB    1 
ATOM   3031 O  OG1   . THR C 1 5   ? 24.069  71.581  -60.295  1.00 118.55 ?  5   THR C OG1   1 
ATOM   3032 C  CG2   . THR C 1 5   ? 21.920  70.575  -59.733  1.00 106.33 ?  5   THR C CG2   1 
ATOM   3033 N  N     . LEU C 1 6   ? 23.329  67.105  -58.632  1.00 89.05  ?  6   LEU C N     1 
ATOM   3034 C  CA    . LEU C 1 6   ? 22.619  65.836  -58.746  1.00 85.71  ?  6   LEU C CA    1 
ATOM   3035 C  C     . LEU C 1 6   ? 21.144  66.190  -58.779  1.00 87.96  ?  6   LEU C C     1 
ATOM   3036 O  O     . LEU C 1 6   ? 20.495  66.339  -57.743  1.00 84.63  ?  6   LEU C O     1 
ATOM   3037 C  CB    . LEU C 1 6   ? 22.955  64.843  -57.635  1.00 82.98  ?  6   LEU C CB    1 
ATOM   3038 C  CG    . LEU C 1 6   ? 23.188  63.423  -58.130  1.00 86.87  ?  6   LEU C CG    1 
ATOM   3039 C  CD1   . LEU C 1 6   ? 24.039  62.657  -57.167  1.00 86.15  ?  6   LEU C CD1   1 
ATOM   3040 C  CD2   . LEU C 1 6   ? 21.872  62.694  -58.414  1.00 88.16  ?  6   LEU C CD2   1 
ATOM   3041 N  N     . LYS C 1 7   ? 20.660  66.422  -60.010  1.00 87.35  ?  7   LYS C N     1 
ATOM   3042 C  CA    . LYS C 1 7   ? 19.322  66.869  -60.396  1.00 87.84  ?  7   LYS C CA    1 
ATOM   3043 C  C     . LYS C 1 7   ? 18.170  66.333  -59.553  1.00 89.12  ?  7   LYS C C     1 
ATOM   3044 O  O     . LYS C 1 7   ? 17.219  67.079  -59.298  1.00 89.56  ?  7   LYS C O     1 
ATOM   3045 C  CB    . LYS C 1 7   ? 19.075  66.636  -61.902  1.00 91.70  ?  7   LYS C CB    1 
ATOM   3046 C  CG    . LYS C 1 7   ? 18.344  67.780  -62.608  1.00 106.38 ?  7   LYS C CG    1 
ATOM   3047 C  CD    . LYS C 1 7   ? 19.246  68.969  -62.926  1.00 120.46 ?  7   LYS C CD    1 
ATOM   3048 C  CE    . LYS C 1 7   ? 18.469  70.144  -63.466  1.00 137.36 ?  7   LYS C CE    1 
ATOM   3049 N  NZ    . LYS C 1 7   ? 19.368  71.252  -63.877  1.00 150.85 ?  7   LYS C NZ    1 
ATOM   3050 N  N     . LEU C 1 8   ? 18.261  65.062  -59.105  1.00 82.18  ?  8   LEU C N     1 
ATOM   3051 C  CA    . LEU C 1 8   ? 17.210  64.439  -58.304  1.00 79.18  ?  8   LEU C CA    1 
ATOM   3052 C  C     . LEU C 1 8   ? 17.456  64.469  -56.788  1.00 79.40  ?  8   LEU C C     1 
ATOM   3053 O  O     . LEU C 1 8   ? 18.437  63.893  -56.297  1.00 78.06  ?  8   LEU C O     1 
ATOM   3054 C  CB    . LEU C 1 8   ? 16.910  62.998  -58.776  1.00 78.01  ?  8   LEU C CB    1 
ATOM   3055 C  CG    . LEU C 1 8   ? 16.313  62.822  -60.173  1.00 84.28  ?  8   LEU C CG    1 
ATOM   3056 C  CD1   . LEU C 1 8   ? 16.390  61.386  -60.608  1.00 83.59  ?  8   LEU C CD1   1 
ATOM   3057 C  CD2   . LEU C 1 8   ? 14.865  63.279  -60.228  1.00 87.89  ?  8   LEU C CD2   1 
ATOM   3058 N  N     . LYS C 1 9   ? 16.539  65.122  -56.052  1.00 73.78  ?  9   LYS C N     1 
ATOM   3059 C  CA    . LYS C 1 9   ? 16.586  65.189  -54.589  1.00 71.26  ?  9   LYS C CA    1 
ATOM   3060 C  C     . LYS C 1 9   ? 15.975  63.895  -54.011  1.00 71.86  ?  9   LYS C C     1 
ATOM   3061 O  O     . LYS C 1 9   ? 15.326  63.145  -54.748  1.00 71.61  ?  9   LYS C O     1 
ATOM   3062 C  CB    . LYS C 1 9   ? 15.860  66.440  -54.071  1.00 74.52  ?  9   LYS C CB    1 
ATOM   3063 C  CG    . LYS C 1 9   ? 16.502  67.743  -54.514  1.00 88.56  ?  9   LYS C CG    1 
ATOM   3064 C  CD    . LYS C 1 9   ? 15.938  68.911  -53.765  1.00 100.19 ?  9   LYS C CD    1 
ATOM   3065 C  CE    . LYS C 1 9   ? 16.979  69.600  -52.917  1.00 113.54 ?  9   LYS C CE    1 
ATOM   3066 N  NZ    . LYS C 1 9   ? 17.732  70.638  -53.681  1.00 126.84 ?  9   LYS C NZ    1 
ATOM   3067 N  N     . LYS C 1 10  ? 16.209  63.624  -52.709  1.00 65.57  ?  10  LYS C N     1 
ATOM   3068 C  CA    . LYS C 1 10  ? 15.746  62.438  -51.971  1.00 62.78  ?  10  LYS C CA    1 
ATOM   3069 C  C     . LYS C 1 10  ? 14.342  61.931  -52.389  1.00 65.90  ?  10  LYS C C     1 
ATOM   3070 O  O     . LYS C 1 10  ? 14.230  60.811  -52.876  1.00 64.02  ?  10  LYS C O     1 
ATOM   3071 C  CB    . LYS C 1 10  ? 15.848  62.704  -50.457  1.00 63.53  ?  10  LYS C CB    1 
ATOM   3072 C  CG    . LYS C 1 10  ? 15.363  61.590  -49.544  1.00 60.38  ?  10  LYS C CG    1 
ATOM   3073 C  CD    . LYS C 1 10  ? 15.242  62.094  -48.106  1.00 65.94  ?  10  LYS C CD    1 
ATOM   3074 C  CE    . LYS C 1 10  ? 13.890  61.854  -47.467  1.00 75.71  ?  10  LYS C CE    1 
ATOM   3075 N  NZ    . LYS C 1 10  ? 13.037  63.085  -47.464  1.00 81.58  ?  10  LYS C NZ    1 
ATOM   3076 N  N     . ASP C 1 11  ? 13.296  62.762  -52.240  1.00 64.39  ?  11  ASP C N     1 
ATOM   3077 C  CA    . ASP C 1 11  ? 11.924  62.387  -52.587  1.00 65.30  ?  11  ASP C CA    1 
ATOM   3078 C  C     . ASP C 1 11  ? 11.703  62.094  -54.074  1.00 69.63  ?  11  ASP C C     1 
ATOM   3079 O  O     . ASP C 1 11  ? 11.046  61.101  -54.403  1.00 69.00  ?  11  ASP C O     1 
ATOM   3080 C  CB    . ASP C 1 11  ? 10.914  63.420  -52.058  1.00 69.08  ?  11  ASP C CB    1 
ATOM   3081 C  CG    . ASP C 1 11  ? 10.674  63.381  -50.551  1.00 85.53  ?  11  ASP C CG    1 
ATOM   3082 O  OD1   . ASP C 1 11  ? 11.018  62.352  -49.913  1.00 84.91  ?  11  ASP C OD1   1 
ATOM   3083 O  OD2   . ASP C 1 11  ? 10.120  64.366  -50.012  1.00 96.23  -1 11  ASP C OD2   1 
ATOM   3084 N  N     . LYS C 1 12  ? 12.263  62.945  -54.961  1.00 66.72  ?  12  LYS C N     1 
ATOM   3085 C  CA    . LYS C 1 12  ? 12.152  62.798  -56.415  1.00 67.46  ?  12  LYS C CA    1 
ATOM   3086 C  C     . LYS C 1 12  ? 12.858  61.535  -56.918  1.00 69.17  ?  12  LYS C C     1 
ATOM   3087 O  O     . LYS C 1 12  ? 12.323  60.848  -57.795  1.00 69.76  ?  12  LYS C O     1 
ATOM   3088 C  CB    . LYS C 1 12  ? 12.699  64.034  -57.140  1.00 72.24  ?  12  LYS C CB    1 
ATOM   3089 C  CG    . LYS C 1 12  ? 11.826  65.276  -57.020  1.00 98.25  ?  12  LYS C CG    1 
ATOM   3090 C  CD    . LYS C 1 12  ? 11.449  65.898  -58.398  1.00 115.43 ?  12  LYS C CD    1 
ATOM   3091 C  CE    . LYS C 1 12  ? 12.582  66.222  -59.374  1.00 129.32 ?  12  LYS C CE    1 
ATOM   3092 N  NZ    . LYS C 1 12  ? 13.664  67.045  -58.764  1.00 138.33 ?  12  LYS C NZ    1 
ATOM   3093 N  N     . ARG C 1 13  ? 14.051  61.230  -56.352  1.00 62.56  ?  13  ARG C N     1 
ATOM   3094 C  CA    . ARG C 1 13  ? 14.862  60.058  -56.689  1.00 60.73  ?  13  ARG C CA    1 
ATOM   3095 C  C     . ARG C 1 13  ? 14.117  58.784  -56.329  1.00 63.41  ?  13  ARG C C     1 
ATOM   3096 O  O     . ARG C 1 13  ? 14.061  57.863  -57.141  1.00 63.91  ?  13  ARG C O     1 
ATOM   3097 C  CB    . ARG C 1 13  ? 16.219  60.092  -55.965  1.00 57.88  ?  13  ARG C CB    1 
ATOM   3098 C  CG    . ARG C 1 13  ? 17.173  58.990  -56.424  1.00 60.86  ?  13  ARG C CG    1 
ATOM   3099 C  CD    . ARG C 1 13  ? 18.362  58.735  -55.521  1.00 60.80  ?  13  ARG C CD    1 
ATOM   3100 N  NE    . ARG C 1 13  ? 18.019  58.511  -54.115  1.00 57.02  ?  13  ARG C NE    1 
ATOM   3101 C  CZ    . ARG C 1 13  ? 18.143  59.419  -53.152  1.00 69.67  ?  13  ARG C CZ    1 
ATOM   3102 N  NH1   . ARG C 1 13  ? 18.559  60.647  -53.435  1.00 56.79  ?  13  ARG C NH1   1 
ATOM   3103 N  NH2   . ARG C 1 13  ? 17.835  59.113  -51.901  1.00 57.45  ?  13  ARG C NH2   1 
ATOM   3104 N  N     . ARG C 1 14  ? 13.541  58.741  -55.115  1.00 58.50  ?  14  ARG C N     1 
ATOM   3105 C  CA    . ARG C 1 14  ? 12.791  57.596  -54.606  1.00 57.11  ?  14  ARG C CA    1 
ATOM   3106 C  C     . ARG C 1 14  ? 11.587  57.268  -55.477  1.00 62.20  ?  14  ARG C C     1 
ATOM   3107 O  O     . ARG C 1 14  ? 11.370  56.095  -55.758  1.00 62.69  ?  14  ARG C O     1 
ATOM   3108 C  CB    . ARG C 1 14  ? 12.400  57.808  -53.145  1.00 54.71  ?  14  ARG C CB    1 
ATOM   3109 C  CG    . ARG C 1 14  ? 13.556  57.587  -52.188  1.00 58.28  ?  14  ARG C CG    1 
ATOM   3110 C  CD    . ARG C 1 14  ? 13.222  58.071  -50.796  1.00 64.42  ?  14  ARG C CD    1 
ATOM   3111 N  NE    . ARG C 1 14  ? 14.256  57.696  -49.839  1.00 69.81  ?  14  ARG C NE    1 
ATOM   3112 C  CZ    . ARG C 1 14  ? 14.172  57.892  -48.528  1.00 89.45  ?  14  ARG C CZ    1 
ATOM   3113 N  NH1   . ARG C 1 14  ? 13.096  58.470  -48.002  1.00 78.21  ?  14  ARG C NH1   1 
ATOM   3114 N  NH2   . ARG C 1 14  ? 15.163  57.514  -47.732  1.00 80.77  ?  14  ARG C NH2   1 
ATOM   3115 N  N     . GLU C 1 15  ? 10.844  58.281  -55.955  1.00 58.96  ?  15  GLU C N     1 
ATOM   3116 C  CA    . GLU C 1 15  ? 9.714   58.027  -56.844  1.00 59.94  ?  15  GLU C CA    1 
ATOM   3117 C  C     . GLU C 1 15  ? 10.222  57.470  -58.177  1.00 63.87  ?  15  GLU C C     1 
ATOM   3118 O  O     . GLU C 1 15  ? 9.632   56.527  -58.706  1.00 64.48  ?  15  GLU C O     1 
ATOM   3119 C  CB    . GLU C 1 15  ? 8.864   59.293  -57.040  1.00 63.03  ?  15  GLU C CB    1 
ATOM   3120 C  CG    . GLU C 1 15  ? 7.613   59.115  -57.896  1.00 77.03  ?  15  GLU C CG    1 
ATOM   3121 C  CD    . GLU C 1 15  ? 6.675   57.960  -57.582  1.00 104.08 ?  15  GLU C CD    1 
ATOM   3122 O  OE1   . GLU C 1 15  ? 6.486   57.632  -56.386  1.00 105.29 ?  15  GLU C OE1   1 
ATOM   3123 O  OE2   . GLU C 1 15  ? 6.104   57.398  -58.544  1.00 99.17  -1 15  GLU C OE2   1 
ATOM   3124 N  N     . ALA C 1 16  ? 11.347  58.012  -58.685  1.00 59.79  ?  16  ALA C N     1 
ATOM   3125 C  CA    . ALA C 1 16  ? 11.965  57.547  -59.929  1.00 60.43  ?  16  ALA C CA    1 
ATOM   3126 C  C     . ALA C 1 16  ? 12.476  56.108  -59.789  1.00 62.27  ?  16  ALA C C     1 
ATOM   3127 O  O     . ALA C 1 16  ? 12.400  55.344  -60.753  1.00 63.48  ?  16  ALA C O     1 
ATOM   3128 C  CB    . ALA C 1 16  ? 13.091  58.477  -60.340  1.00 61.86  ?  16  ALA C CB    1 
ATOM   3129 N  N     . ILE C 1 17  ? 12.951  55.736  -58.580  1.00 55.49  ?  17  ILE C N     1 
ATOM   3130 C  CA    . ILE C 1 17  ? 13.433  54.394  -58.252  1.00 54.03  ?  17  ILE C CA    1 
ATOM   3131 C  C     . ILE C 1 17  ? 12.237  53.436  -58.226  1.00 57.86  ?  17  ILE C C     1 
ATOM   3132 O  O     . ILE C 1 17  ? 12.310  52.360  -58.826  1.00 58.56  ?  17  ILE C O     1 
ATOM   3133 C  CB    . ILE C 1 17  ? 14.254  54.396  -56.926  1.00 54.89  ?  17  ILE C CB    1 
ATOM   3134 C  CG1   . ILE C 1 17  ? 15.668  54.961  -57.172  1.00 55.20  ?  17  ILE C CG1   1 
ATOM   3135 C  CG2   . ILE C 1 17  ? 14.317  52.995  -56.282  1.00 54.22  ?  17  ILE C CG2   1 
ATOM   3136 C  CD1   . ILE C 1 17  ? 16.440  55.327  -55.930  1.00 62.35  ?  17  ILE C CD1   1 
ATOM   3137 N  N     . ARG C 1 18  ? 11.137  53.863  -57.564  1.00 53.07  ?  18  ARG C N     1 
ATOM   3138 C  CA    . ARG C 1 18  ? 9.868   53.149  -57.419  1.00 52.91  ?  18  ARG C CA    1 
ATOM   3139 C  C     . ARG C 1 18  ? 9.312   52.787  -58.796  1.00 59.96  ?  18  ARG C C     1 
ATOM   3140 O  O     . ARG C 1 18  ? 8.928   51.634  -59.027  1.00 61.26  ?  18  ARG C O     1 
ATOM   3141 C  CB    . ARG C 1 18  ? 8.865   54.039  -56.677  1.00 50.86  ?  18  ARG C CB    1 
ATOM   3142 C  CG    . ARG C 1 18  ? 7.679   53.292  -56.120  1.00 59.84  ?  18  ARG C CG    1 
ATOM   3143 C  CD    . ARG C 1 18  ? 6.467   54.182  -55.925  1.00 67.72  ?  18  ARG C CD    1 
ATOM   3144 N  NE    . ARG C 1 18  ? 5.959   54.756  -57.174  1.00 75.41  ?  18  ARG C NE    1 
ATOM   3145 C  CZ    . ARG C 1 18  ? 5.305   54.077  -58.111  1.00 99.08  ?  18  ARG C CZ    1 
ATOM   3146 N  NH1   . ARG C 1 18  ? 5.088   52.773  -57.969  1.00 88.37  ?  18  ARG C NH1   1 
ATOM   3147 N  NH2   . ARG C 1 18  ? 4.879   54.690  -59.206  1.00 95.75  ?  18  ARG C NH2   1 
ATOM   3148 N  N     . GLN C 1 19  ? 9.307   53.767  -59.713  1.00 56.88  ?  19  GLN C N     1 
ATOM   3149 C  CA    . GLN C 1 19  ? 8.827   53.597  -61.075  1.00 58.92  ?  19  GLN C CA    1 
ATOM   3150 C  C     . GLN C 1 19  ? 9.731   52.682  -61.887  1.00 64.97  ?  19  GLN C C     1 
ATOM   3151 O  O     . GLN C 1 19  ? 9.216   51.905  -62.682  1.00 67.37  ?  19  GLN C O     1 
ATOM   3152 C  CB    . GLN C 1 19  ? 8.675   54.952  -61.765  1.00 61.43  ?  19  GLN C CB    1 
ATOM   3153 C  CG    . GLN C 1 19  ? 7.440   55.728  -61.346  1.00 75.25  ?  19  GLN C CG    1 
ATOM   3154 C  CD    . GLN C 1 19  ? 7.424   57.098  -61.967  1.00 101.76 ?  19  GLN C CD    1 
ATOM   3155 O  OE1   . GLN C 1 19  ? 7.595   58.115  -61.142  1.00 101.19 ?  19  GLN C OE1   1 
ATOM   3156 N  NE2   . GLN C 1 19  ? 7.266   57.262  -63.184  1.00 95.74  ?  19  GLN C NE2   1 
ATOM   3157 N  N     . GLN C 1 20  ? 11.064  52.766  -61.690  1.00 60.97  ?  20  GLN C N     1 
ATOM   3158 C  CA    . GLN C 1 20  ? 12.053  51.939  -62.394  1.00 61.72  ?  20  GLN C CA    1 
ATOM   3159 C  C     . GLN C 1 20  ? 11.922  50.462  -62.009  1.00 66.24  ?  20  GLN C C     1 
ATOM   3160 O  O     . GLN C 1 20  ? 11.991  49.596  -62.885  1.00 67.56  ?  20  GLN C O     1 
ATOM   3161 C  CB    . GLN C 1 20  ? 13.484  52.453  -62.141  1.00 61.98  ?  20  GLN C CB    1 
ATOM   3162 C  CG    . GLN C 1 20  ? 14.580  51.809  -63.006  1.00 67.05  ?  20  GLN C CG    1 
ATOM   3163 C  CD    . GLN C 1 20  ? 14.342  51.926  -64.492  1.00 81.45  ?  20  GLN C CD    1 
ATOM   3164 O  OE1   . GLN C 1 20  ? 14.148  50.921  -65.177  1.00 75.80  ?  20  GLN C OE1   1 
ATOM   3165 N  NE2   . GLN C 1 20  ? 14.330  53.151  -65.019  1.00 73.95  ?  20  GLN C NE2   1 
ATOM   3166 N  N     . ILE C 1 21  ? 11.725  50.183  -60.702  1.00 61.80  ?  21  ILE C N     1 
ATOM   3167 C  CA    . ILE C 1 21  ? 11.539  48.831  -60.170  1.00 62.34  ?  21  ILE C CA    1 
ATOM   3168 C  C     . ILE C 1 21  ? 10.236  48.158  -60.640  1.00 71.60  ?  21  ILE C C     1 
ATOM   3169 O  O     . ILE C 1 21  ? 10.242  46.961  -60.930  1.00 73.13  ?  21  ILE C O     1 
ATOM   3170 C  CB    . ILE C 1 21  ? 11.723  48.807  -58.631  1.00 63.12  ?  21  ILE C CB    1 
ATOM   3171 C  CG1   . ILE C 1 21  ? 13.211  48.959  -58.270  1.00 62.51  ?  21  ILE C CG1   1 
ATOM   3172 C  CG2   . ILE C 1 21  ? 11.139  47.539  -58.013  1.00 64.33  ?  21  ILE C CG2   1 
ATOM   3173 C  CD1   . ILE C 1 21  ? 13.509  49.308  -56.813  1.00 67.99  ?  21  ILE C CD1   1 
ATOM   3174 N  N     . ASP C 1 22  ? 9.192   48.958  -60.781  1.00 69.71  ?  22  ASP C N     1 
ATOM   3175 C  CA    . ASP C 1 22  ? 7.923   48.522  -61.315  1.00 71.85  ?  22  ASP C CA    1 
ATOM   3176 C  C     . ASP C 1 22  ? 8.104   48.129  -62.747  1.00 77.27  ?  22  ASP C C     1 
ATOM   3177 O  O     . ASP C 1 22  ? 7.711   47.073  -63.169  1.00 78.63  ?  22  ASP C O     1 
ATOM   3178 C  CB    . ASP C 1 22  ? 6.963   49.694  -61.291  1.00 74.87  ?  22  ASP C CB    1 
ATOM   3179 C  CG    . ASP C 1 22  ? 5.761   49.451  -60.420  1.00 93.61  ?  22  ASP C CG    1 
ATOM   3180 O  OD1   . ASP C 1 22  ? 5.919   48.859  -59.343  1.00 97.35  ?  22  ASP C OD1   1 
ATOM   3181 O  OD2   . ASP C 1 22  ? 4.655   49.866  -60.805  1.00 100.28 -1 22  ASP C OD2   1 
ATOM   3182 N  N     . SER C 1 23  ? 8.693   49.035  -63.493  1.00 74.05  ?  23  SER C N     1 
ATOM   3183 C  CA    . SER C 1 23  ? 8.893   48.937  -64.941  1.00 76.50  ?  23  SER C CA    1 
ATOM   3184 C  C     . SER C 1 23  ? 9.777   47.727  -65.242  1.00 80.53  ?  23  SER C C     1 
ATOM   3185 O  O     . SER C 1 23  ? 9.621   47.105  -66.301  1.00 82.61  ?  23  SER C O     1 
ATOM   3186 C  CB    . SER C 1 23  ? 9.448   50.185  -65.619  1.00 81.11  ?  23  SER C CB    1 
ATOM   3187 O  OG    . SER C 1 23  ? 9.822   49.883  -66.952  1.00 95.74  ?  23  SER C OG    1 
ATOM   3188 N  N     . ASN C 1 24  ? 10.726  47.429  -64.339  1.00 74.50  ?  24  ASN C N     1 
ATOM   3189 C  CA    . ASN C 1 24  ? 11.643  46.297  -64.458  1.00 74.65  ?  24  ASN C CA    1 
ATOM   3190 C  C     . ASN C 1 24  ? 11.973  45.758  -63.066  1.00 76.15  ?  24  ASN C C     1 
ATOM   3191 O  O     . ASN C 1 24  ? 12.865  46.287  -62.403  1.00 73.56  ?  24  ASN C O     1 
ATOM   3192 C  CB    . ASN C 1 24  ? 12.916  46.668  -65.242  1.00 75.58  ?  24  ASN C CB    1 
ATOM   3193 C  CG    . ASN C 1 24  ? 13.941  45.556  -65.345  1.00 96.20  ?  24  ASN C CG    1 
ATOM   3194 O  OD1   . ASN C 1 24  ? 13.621  44.363  -65.372  1.00 88.97  ?  24  ASN C OD1   1 
ATOM   3195 N  ND2   . ASN C 1 24  ? 15.206  45.923  -65.416  1.00 88.39  ?  24  ASN C ND2   1 
ATOM   3196 N  N     . PRO C 1 25  ? 11.253  44.718  -62.589  1.00 73.57  ?  25  PRO C N     1 
ATOM   3197 C  CA    . PRO C 1 25  ? 11.538  44.185  -61.246  1.00 72.04  ?  25  PRO C CA    1 
ATOM   3198 C  C     . PRO C 1 25  ? 12.834  43.388  -61.181  1.00 76.36  ?  25  PRO C C     1 
ATOM   3199 O  O     . PRO C 1 25  ? 13.358  43.169  -60.093  1.00 74.69  ?  25  PRO C O     1 
ATOM   3200 C  CB    . PRO C 1 25  ? 10.319  43.306  -60.943  1.00 75.07  ?  25  PRO C CB    1 
ATOM   3201 C  CG    . PRO C 1 25  ? 9.342   43.541  -62.069  1.00 81.30  ?  25  PRO C CG    1 
ATOM   3202 C  CD    . PRO C 1 25  ? 10.153  43.975  -63.228  1.00 77.41  ?  25  PRO C CD    1 
ATOM   3203 N  N     . PHE C 1 26  ? 13.361  42.992  -62.352  1.00 74.54  ?  26  PHE C N     1 
ATOM   3204 C  CA    . PHE C 1 26  ? 14.583  42.214  -62.507  1.00 75.01  ?  26  PHE C CA    1 
ATOM   3205 C  C     . PHE C 1 26  ? 15.861  43.057  -62.349  1.00 77.18  ?  26  PHE C C     1 
ATOM   3206 O  O     . PHE C 1 26  ? 16.967  42.499  -62.399  1.00 78.47  ?  26  PHE C O     1 
ATOM   3207 C  CB    . PHE C 1 26  ? 14.567  41.466  -63.847  1.00 79.97  ?  26  PHE C CB    1 
ATOM   3208 C  CG    . PHE C 1 26  ? 13.421  40.496  -64.006  1.00 83.67  ?  26  PHE C CG    1 
ATOM   3209 C  CD1   . PHE C 1 26  ? 12.216  40.903  -64.561  1.00 87.45  ?  26  PHE C CD1   1 
ATOM   3210 C  CD2   . PHE C 1 26  ? 13.558  39.167  -63.628  1.00 87.75  ?  26  PHE C CD2   1 
ATOM   3211 C  CE1   . PHE C 1 26  ? 11.161  40.006  -64.716  1.00 90.57  ?  26  PHE C CE1   1 
ATOM   3212 C  CE2   . PHE C 1 26  ? 12.500  38.267  -63.784  1.00 92.68  ?  26  PHE C CE2   1 
ATOM   3213 C  CZ    . PHE C 1 26  ? 11.309  38.693  -64.328  1.00 91.25  ?  26  PHE C CZ    1 
ATOM   3214 N  N     . ILE C 1 27  ? 15.713  44.388  -62.132  1.00 70.01  ?  27  ILE C N     1 
ATOM   3215 C  CA    . ILE C 1 27  ? 16.836  45.309  -61.940  1.00 67.74  ?  27  ILE C CA    1 
ATOM   3216 C  C     . ILE C 1 27  ? 17.546  45.024  -60.610  1.00 71.07  ?  27  ILE C C     1 
ATOM   3217 O  O     . ILE C 1 27  ? 16.895  44.633  -59.649  1.00 69.81  ?  27  ILE C O     1 
ATOM   3218 C  CB    . ILE C 1 27  ? 16.396  46.798  -62.105  1.00 68.74  ?  27  ILE C CB    1 
ATOM   3219 C  CG1   . ILE C 1 27  ? 17.586  47.707  -62.466  1.00 68.53  ?  27  ILE C CG1   1 
ATOM   3220 C  CG2   . ILE C 1 27  ? 15.596  47.333  -60.896  1.00 66.38  ?  27  ILE C CG2   1 
ATOM   3221 C  CD1   . ILE C 1 27  ? 17.238  48.901  -63.291  1.00 73.57  ?  27  ILE C CD1   1 
ATOM   3222 N  N     . THR C 1 28  ? 18.873  45.185  -60.570  1.00 68.53  ?  28  THR C N     1 
ATOM   3223 C  CA    . THR C 1 28  ? 19.670  44.991  -59.356  1.00 67.30  ?  28  THR C CA    1 
ATOM   3224 C  C     . THR C 1 28  ? 19.897  46.343  -58.678  1.00 68.76  ?  28  THR C C     1 
ATOM   3225 O  O     . THR C 1 28  ? 19.721  47.387  -59.313  1.00 67.22  ?  28  THR C O     1 
ATOM   3226 C  CB    . THR C 1 28  ? 21.015  44.336  -59.690  1.00 77.90  ?  28  THR C CB    1 
ATOM   3227 O  OG1   . THR C 1 28  ? 21.665  45.089  -60.722  1.00 80.80  ?  28  THR C OG1   1 
ATOM   3228 C  CG2   . THR C 1 28  ? 20.871  42.877  -60.080  1.00 77.50  ?  28  THR C CG2   1 
ATOM   3229 N  N     . ASP C 1 29  ? 20.312  46.324  -57.394  1.00 64.98  ?  29  ASP C N     1 
ATOM   3230 C  CA    . ASP C 1 29  ? 20.623  47.543  -56.638  1.00 63.29  ?  29  ASP C CA    1 
ATOM   3231 C  C     . ASP C 1 29  ? 21.852  48.222  -57.240  1.00 69.14  ?  29  ASP C C     1 
ATOM   3232 O  O     . ASP C 1 29  ? 21.938  49.452  -57.227  1.00 67.74  ?  29  ASP C O     1 
ATOM   3233 C  CB    . ASP C 1 29  ? 20.841  47.235  -55.148  1.00 63.70  ?  29  ASP C CB    1 
ATOM   3234 C  CG    . ASP C 1 29  ? 19.576  47.064  -54.321  1.00 72.34  ?  29  ASP C CG    1 
ATOM   3235 O  OD1   . ASP C 1 29  ? 18.476  46.939  -54.920  1.00 80.47  -1 29  ASP C OD1   1 
ATOM   3236 O  OD2   . ASP C 1 29  ? 19.684  47.029  -53.080  1.00 71.20  ?  29  ASP C OD2   1 
ATOM   3237 N  N     . HIS C 1 30  ? 22.774  47.413  -57.816  1.00 68.53  ?  30  HIS C N     1 
ATOM   3238 C  CA    . HIS C 1 30  ? 23.978  47.897  -58.476  1.00 70.16  ?  30  HIS C CA    1 
ATOM   3239 C  C     . HIS C 1 30  ? 23.638  48.710  -59.707  1.00 73.30  ?  30  HIS C C     1 
ATOM   3240 O  O     . HIS C 1 30  ? 24.209  49.788  -59.882  1.00 73.55  ?  30  HIS C O     1 
ATOM   3241 C  CB    . HIS C 1 30  ? 24.924  46.752  -58.837  1.00 73.93  ?  30  HIS C CB    1 
ATOM   3242 C  CG    . HIS C 1 30  ? 26.190  47.232  -59.476  1.00 79.92  ?  30  HIS C CG    1 
ATOM   3243 N  ND1   . HIS C 1 30  ? 27.223  47.767  -58.720  1.00 82.23  ?  30  HIS C ND1   1 
ATOM   3244 C  CD2   . HIS C 1 30  ? 26.533  47.280  -60.784  1.00 84.07  ?  30  HIS C CD2   1 
ATOM   3245 C  CE1   . HIS C 1 30  ? 28.163  48.103  -59.590  1.00 84.00  ?  30  HIS C CE1   1 
ATOM   3246 N  NE2   . HIS C 1 30  ? 27.794  47.827  -60.844  1.00 85.49  ?  30  HIS C NE2   1 
ATOM   3247 N  N     . GLU C 1 31  ? 22.728  48.208  -60.565  1.00 69.00  ?  31  GLU C N     1 
ATOM   3248 C  CA    . GLU C 1 31  ? 22.339  48.950  -61.766  1.00 69.14  ?  31  GLU C CA    1 
ATOM   3249 C  C     . GLU C 1 31  ? 21.657  50.269  -61.379  1.00 69.34  ?  31  GLU C C     1 
ATOM   3250 O  O     . GLU C 1 31  ? 22.008  51.312  -61.931  1.00 69.25  ?  31  GLU C O     1 
ATOM   3251 C  CB    . GLU C 1 31  ? 21.466  48.103  -62.699  1.00 71.66  ?  31  GLU C CB    1 
ATOM   3252 C  CG    . GLU C 1 31  ? 21.304  48.711  -64.085  1.00 82.17  ?  31  GLU C CG    1 
ATOM   3253 C  CD    . GLU C 1 31  ? 20.442  47.933  -65.060  1.00 103.57 ?  31  GLU C CD    1 
ATOM   3254 O  OE1   . GLU C 1 31  ? 20.011  46.807  -64.716  1.00 105.36 ?  31  GLU C OE1   1 
ATOM   3255 O  OE2   . GLU C 1 31  ? 20.234  48.432  -66.191  1.00 92.43  -1 31  GLU C OE2   1 
ATOM   3256 N  N     . LEU C 1 32  ? 20.761  50.231  -60.366  1.00 62.75  ?  32  LEU C N     1 
ATOM   3257 C  CA    . LEU C 1 32  ? 20.062  51.423  -59.865  1.00 60.22  ?  32  LEU C CA    1 
ATOM   3258 C  C     . LEU C 1 32  ? 21.053  52.468  -59.357  1.00 63.50  ?  32  LEU C C     1 
ATOM   3259 O  O     . LEU C 1 32  ? 20.872  53.657  -59.640  1.00 63.13  ?  32  LEU C O     1 
ATOM   3260 C  CB    . LEU C 1 32  ? 19.045  51.063  -58.771  1.00 57.93  ?  32  LEU C CB    1 
ATOM   3261 C  CG    . LEU C 1 32  ? 17.814  50.286  -59.217  1.00 62.35  ?  32  LEU C CG    1 
ATOM   3262 C  CD1   . LEU C 1 32  ? 17.159  49.593  -58.041  1.00 60.66  ?  32  LEU C CD1   1 
ATOM   3263 C  CD2   . LEU C 1 32  ? 16.823  51.186  -59.924  1.00 64.92  ?  32  LEU C CD2   1 
ATOM   3264 N  N     . SER C 1 33  ? 22.134  52.016  -58.671  1.00 59.45  ?  33  SER C N     1 
ATOM   3265 C  CA    . SER C 1 33  ? 23.186  52.896  -58.161  1.00 59.09  ?  33  SER C CA    1 
ATOM   3266 C  C     . SER C 1 33  ? 23.901  53.622  -59.308  1.00 64.95  ?  33  SER C C     1 
ATOM   3267 O  O     . SER C 1 33  ? 24.148  54.825  -59.200  1.00 64.93  ?  33  SER C O     1 
ATOM   3268 C  CB    . SER C 1 33  ? 24.166  52.131  -57.279  1.00 62.14  ?  33  SER C CB    1 
ATOM   3269 O  OG    . SER C 1 33  ? 25.006  51.296  -58.056  1.00 74.74  ?  33  SER C OG    1 
ATOM   3270 N  N     . ASP C 1 34  ? 24.170  52.908  -60.424  1.00 62.85  ?  34  ASP C N     1 
ATOM   3271 C  CA    . ASP C 1 34  ? 24.806  53.486  -61.612  1.00 64.67  ?  34  ASP C CA    1 
ATOM   3272 C  C     . ASP C 1 34  ? 23.864  54.441  -62.327  1.00 66.27  ?  34  ASP C C     1 
ATOM   3273 O  O     . ASP C 1 34  ? 24.287  55.533  -62.709  1.00 67.32  ?  34  ASP C O     1 
ATOM   3274 C  CB    . ASP C 1 34  ? 25.295  52.394  -62.582  1.00 69.00  ?  34  ASP C CB    1 
ATOM   3275 C  CG    . ASP C 1 34  ? 26.558  51.673  -62.152  1.00 83.95  ?  34  ASP C CG    1 
ATOM   3276 O  OD1   . ASP C 1 34  ? 27.400  52.300  -61.450  1.00 90.53  -1 34  ASP C OD1   1 
ATOM   3277 O  OD2   . ASP C 1 34  ? 26.717  50.486  -62.523  1.00 86.08  ?  34  ASP C OD2   1 
ATOM   3278 N  N     . LEU C 1 35  ? 22.589  54.040  -62.489  1.00 59.90  ?  35  LEU C N     1 
ATOM   3279 C  CA    . LEU C 1 35  ? 21.575  54.839  -63.176  1.00 59.33  ?  35  LEU C CA    1 
ATOM   3280 C  C     . LEU C 1 35  ? 21.305  56.148  -62.458  1.00 63.26  ?  35  LEU C C     1 
ATOM   3281 O  O     . LEU C 1 35  ? 21.218  57.190  -63.107  1.00 63.39  ?  35  LEU C O     1 
ATOM   3282 C  CB    . LEU C 1 35  ? 20.250  54.068  -63.323  1.00 58.11  ?  35  LEU C CB    1 
ATOM   3283 C  CG    . LEU C 1 35  ? 20.205  52.832  -64.201  1.00 63.36  ?  35  LEU C CG    1 
ATOM   3284 C  CD1   . LEU C 1 35  ? 18.937  52.096  -63.981  1.00 62.21  ?  35  LEU C CD1   1 
ATOM   3285 C  CD2   . LEU C 1 35  ? 20.366  53.164  -65.662  1.00 68.01  ?  35  LEU C CD2   1 
ATOM   3286 N  N     . PHE C 1 36  ? 21.184  56.098  -61.119  1.00 59.52  ?  36  PHE C N     1 
ATOM   3287 C  CA    . PHE C 1 36  ? 20.864  57.277  -60.322  1.00 59.46  ?  36  PHE C CA    1 
ATOM   3288 C  C     . PHE C 1 36  ? 22.056  58.045  -59.767  1.00 64.97  ?  36  PHE C C     1 
ATOM   3289 O  O     . PHE C 1 36  ? 21.858  59.119  -59.188  1.00 65.10  ?  36  PHE C O     1 
ATOM   3290 C  CB    . PHE C 1 36  ? 19.832  56.936  -59.243  1.00 59.44  ?  36  PHE C CB    1 
ATOM   3291 C  CG    . PHE C 1 36  ? 18.497  56.538  -59.822  1.00 61.54  ?  36  PHE C CG    1 
ATOM   3292 C  CD1   . PHE C 1 36  ? 17.561  57.503  -60.182  1.00 64.83  ?  36  PHE C CD1   1 
ATOM   3293 C  CD2   . PHE C 1 36  ? 18.183  55.202  -60.031  1.00 64.27  ?  36  PHE C CD2   1 
ATOM   3294 C  CE1   . PHE C 1 36  ? 16.336  57.135  -60.732  1.00 66.42  ?  36  PHE C CE1   1 
ATOM   3295 C  CE2   . PHE C 1 36  ? 16.959  54.834  -60.592  1.00 67.78  ?  36  PHE C CE2   1 
ATOM   3296 C  CZ    . PHE C 1 36  ? 16.034  55.800  -60.919  1.00 66.33  ?  36  PHE C CZ    1 
ATOM   3297 N  N     . GLN C 1 37  ? 23.292  57.533  -60.003  1.00 62.23  ?  37  GLN C N     1 
ATOM   3298 C  CA    . GLN C 1 37  ? 24.562  58.127  -59.561  1.00 62.73  ?  37  GLN C CA    1 
ATOM   3299 C  C     . GLN C 1 37  ? 24.542  58.412  -58.057  1.00 65.28  ?  37  GLN C C     1 
ATOM   3300 O  O     . GLN C 1 37  ? 24.808  59.525  -57.595  1.00 65.17  ?  37  GLN C O     1 
ATOM   3301 C  CB    . GLN C 1 37  ? 24.951  59.361  -60.403  1.00 66.07  ?  37  GLN C CB    1 
ATOM   3302 C  CG    . GLN C 1 37  ? 25.369  59.044  -61.834  1.00 70.32  ?  37  GLN C CG    1 
ATOM   3303 C  CD    . GLN C 1 37  ? 26.658  58.280  -61.900  1.00 85.58  ?  37  GLN C CD    1 
ATOM   3304 O  OE1   . GLN C 1 37  ? 27.751  58.827  -61.717  1.00 89.47  ?  37  GLN C OE1   1 
ATOM   3305 N  NE2   . GLN C 1 37  ? 26.552  56.994  -62.167  1.00 68.29  ?  37  GLN C NE2   1 
ATOM   3306 N  N     . VAL C 1 38  ? 24.161  57.377  -57.311  1.00 60.15  ?  38  VAL C N     1 
ATOM   3307 C  CA    . VAL C 1 38  ? 24.029  57.378  -55.867  1.00 58.36  ?  38  VAL C CA    1 
ATOM   3308 C  C     . VAL C 1 38  ? 24.643  56.067  -55.334  1.00 61.92  ?  38  VAL C C     1 
ATOM   3309 O  O     . VAL C 1 38  ? 24.807  55.124  -56.117  1.00 63.00  ?  38  VAL C O     1 
ATOM   3310 C  CB    . VAL C 1 38  ? 22.539  57.608  -55.514  1.00 61.04  ?  38  VAL C CB    1 
ATOM   3311 C  CG1   . VAL C 1 38  ? 21.632  56.490  -56.017  1.00 59.24  ?  38  VAL C CG1   1 
ATOM   3312 C  CG2   . VAL C 1 38  ? 22.354  57.866  -54.024  1.00 60.62  ?  38  VAL C CG2   1 
ATOM   3313 N  N     . SER C 1 39  ? 25.054  56.027  -54.048  1.00 56.98  ?  39  SER C N     1 
ATOM   3314 C  CA    . SER C 1 39  ? 25.693  54.835  -53.475  1.00 56.82  ?  39  SER C CA    1 
ATOM   3315 C  C     . SER C 1 39  ? 24.723  53.678  -53.378  1.00 59.87  ?  39  SER C C     1 
ATOM   3316 O  O     . SER C 1 39  ? 23.535  53.920  -53.168  1.00 59.04  ?  39  SER C O     1 
ATOM   3317 C  CB    . SER C 1 39  ? 26.263  55.135  -52.093  1.00 59.60  ?  39  SER C CB    1 
ATOM   3318 O  OG    . SER C 1 39  ? 25.242  55.468  -51.167  1.00 64.96  ?  39  SER C OG    1 
ATOM   3319 N  N     . ILE C 1 40  ? 25.219  52.421  -53.494  1.00 56.35  ?  40  ILE C N     1 
ATOM   3320 C  CA    . ILE C 1 40  ? 24.369  51.229  -53.344  1.00 54.76  ?  40  ILE C CA    1 
ATOM   3321 C  C     . ILE C 1 40  ? 23.603  51.309  -52.012  1.00 58.19  ?  40  ILE C C     1 
ATOM   3322 O  O     . ILE C 1 40  ? 22.420  50.978  -51.973  1.00 56.58  ?  40  ILE C O     1 
ATOM   3323 C  CB    . ILE C 1 40  ? 25.121  49.873  -53.543  1.00 58.17  ?  40  ILE C CB    1 
ATOM   3324 C  CG1   . ILE C 1 40  ? 24.140  48.739  -53.852  1.00 57.75  ?  40  ILE C CG1   1 
ATOM   3325 C  CG2   . ILE C 1 40  ? 26.026  49.511  -52.360  1.00 58.28  ?  40  ILE C CG2   1 
ATOM   3326 C  CD1   . ILE C 1 40  ? 24.663  47.696  -54.746  1.00 67.72  ?  40  ILE C CD1   1 
ATOM   3327 N  N     . GLN C 1 41  ? 24.263  51.857  -50.963  1.00 55.48  ?  41  GLN C N     1 
ATOM   3328 C  CA    . GLN C 1 41  ? 23.698  52.022  -49.625  1.00 54.28  ?  41  GLN C CA    1 
ATOM   3329 C  C     . GLN C 1 41  ? 22.474  52.915  -49.634  1.00 56.41  ?  41  GLN C C     1 
ATOM   3330 O  O     . GLN C 1 41  ? 21.507  52.603  -48.937  1.00 54.89  ?  41  GLN C O     1 
ATOM   3331 C  CB    . GLN C 1 41  ? 24.751  52.485  -48.617  1.00 56.28  ?  41  GLN C CB    1 
ATOM   3332 C  CG    . GLN C 1 41  ? 25.780  51.399  -48.295  1.00 75.78  ?  41  GLN C CG    1 
ATOM   3333 C  CD    . GLN C 1 41  ? 27.011  51.423  -49.178  1.00 91.00  ?  41  GLN C CD    1 
ATOM   3334 O  OE1   . GLN C 1 41  ? 27.146  52.227  -50.113  1.00 87.51  ?  41  GLN C OE1   1 
ATOM   3335 N  NE2   . GLN C 1 41  ? 27.950  50.538  -48.882  1.00 79.77  ?  41  GLN C NE2   1 
ATOM   3336 N  N     . THR C 1 42  ? 22.486  53.976  -50.475  1.00 52.87  ?  42  THR C N     1 
ATOM   3337 C  CA    . THR C 1 42  ? 21.353  54.880  -50.658  1.00 51.97  ?  42  THR C CA    1 
ATOM   3338 C  C     . THR C 1 42  ? 20.211  54.115  -51.328  1.00 55.88  ?  42  THR C C     1 
ATOM   3339 O  O     . THR C 1 42  ? 19.080  54.196  -50.846  1.00 54.93  ?  42  THR C O     1 
ATOM   3340 C  CB    . THR C 1 42  ? 21.777  56.164  -51.379  1.00 62.78  ?  42  THR C CB    1 
ATOM   3341 O  OG1   . THR C 1 42  ? 22.760  56.824  -50.586  1.00 64.16  ?  42  THR C OG1   1 
ATOM   3342 C  CG2   . THR C 1 42  ? 20.621  57.120  -51.610  1.00 62.78  ?  42  THR C CG2   1 
ATOM   3343 N  N     . ILE C 1 43  ? 20.519  53.306  -52.372  1.00 53.29  ?  43  ILE C N     1 
ATOM   3344 C  CA    . ILE C 1 43  ? 19.526  52.474  -53.072  1.00 53.27  ?  43  ILE C CA    1 
ATOM   3345 C  C     . ILE C 1 43  ? 18.818  51.543  -52.084  1.00 57.45  ?  43  ILE C C     1 
ATOM   3346 O  O     . ILE C 1 43  ? 17.585  51.483  -52.081  1.00 56.86  ?  43  ILE C O     1 
ATOM   3347 C  CB    . ILE C 1 43  ? 20.138  51.709  -54.276  1.00 57.51  ?  43  ILE C CB    1 
ATOM   3348 C  CG1   . ILE C 1 43  ? 20.724  52.668  -55.337  1.00 59.00  ?  43  ILE C CG1   1 
ATOM   3349 C  CG2   . ILE C 1 43  ? 19.157  50.693  -54.889  1.00 58.62  ?  43  ILE C CG2   1 
ATOM   3350 C  CD1   . ILE C 1 43  ? 19.728  53.611  -56.087  1.00 66.65  ?  43  ILE C CD1   1 
ATOM   3351 N  N     . ARG C 1 44  ? 19.601  50.876  -51.210  1.00 54.33  ?  44  ARG C N     1 
ATOM   3352 C  CA    . ARG C 1 44  ? 19.103  49.954  -50.183  1.00 53.80  ?  44  ARG C CA    1 
ATOM   3353 C  C     . ARG C 1 44  ? 18.192  50.691  -49.199  1.00 56.12  ?  44  ARG C C     1 
ATOM   3354 O  O     . ARG C 1 44  ? 17.150  50.154  -48.817  1.00 55.03  ?  44  ARG C O     1 
ATOM   3355 C  CB    . ARG C 1 44  ? 20.260  49.266  -49.435  1.00 54.68  ?  44  ARG C CB    1 
ATOM   3356 C  CG    . ARG C 1 44  ? 21.382  48.754  -50.324  1.00 66.74  ?  44  ARG C CG    1 
ATOM   3357 C  CD    . ARG C 1 44  ? 21.541  47.255  -50.261  1.00 83.62  ?  44  ARG C CD    1 
ATOM   3358 N  NE    . ARG C 1 44  ? 22.794  46.802  -50.873  1.00 95.89  ?  44  ARG C NE    1 
ATOM   3359 C  CZ    . ARG C 1 44  ? 23.981  46.830  -50.270  1.00 113.22 ?  44  ARG C CZ    1 
ATOM   3360 N  NH1   . ARG C 1 44  ? 24.101  47.321  -49.040  1.00 90.23  ?  44  ARG C NH1   1 
ATOM   3361 N  NH2   . ARG C 1 44  ? 25.060  46.384  -50.898  1.00 111.80 ?  44  ARG C NH2   1 
ATOM   3362 N  N     . LEU C 1 45  ? 18.570  51.933  -48.826  1.00 52.35  ?  45  LEU C N     1 
ATOM   3363 C  CA    . LEU C 1 45  ? 17.784  52.783  -47.929  1.00 51.50  ?  45  LEU C CA    1 
ATOM   3364 C  C     . LEU C 1 45  ? 16.493  53.219  -48.604  1.00 57.74  ?  45  LEU C C     1 
ATOM   3365 O  O     . LEU C 1 45  ? 15.452  53.271  -47.947  1.00 57.20  ?  45  LEU C O     1 
ATOM   3366 C  CB    . LEU C 1 45  ? 18.579  54.033  -47.493  1.00 50.84  ?  45  LEU C CB    1 
ATOM   3367 C  CG    . LEU C 1 45  ? 19.538  53.869  -46.321  1.00 54.27  ?  45  LEU C CG    1 
ATOM   3368 C  CD1   . LEU C 1 45  ? 20.329  55.120  -46.104  1.00 54.36  ?  45  LEU C CD1   1 
ATOM   3369 C  CD2   . LEU C 1 45  ? 18.810  53.525  -45.050  1.00 54.86  ?  45  LEU C CD2   1 
ATOM   3370 N  N     . ASP C 1 46  ? 16.575  53.532  -49.916  1.00 56.29  ?  46  ASP C N     1 
ATOM   3371 C  CA    . ASP C 1 46  ? 15.443  53.976  -50.721  1.00 57.81  ?  46  ASP C CA    1 
ATOM   3372 C  C     . ASP C 1 46  ? 14.366  52.903  -50.825  1.00 62.26  ?  46  ASP C C     1 
ATOM   3373 O  O     . ASP C 1 46  ? 13.216  53.200  -50.526  1.00 61.93  ?  46  ASP C O     1 
ATOM   3374 C  CB    . ASP C 1 46  ? 15.895  54.495  -52.103  1.00 61.76  ?  46  ASP C CB    1 
ATOM   3375 C  CG    . ASP C 1 46  ? 16.756  55.762  -52.078  1.00 80.48  ?  46  ASP C CG    1 
ATOM   3376 O  OD1   . ASP C 1 46  ? 16.503  56.647  -51.223  1.00 82.66  ?  46  ASP C OD1   1 
ATOM   3377 O  OD2   . ASP C 1 46  ? 17.684  55.866  -52.909  1.00 88.21  -1 46  ASP C OD2   1 
ATOM   3378 N  N     . ARG C 1 47  ? 14.748  51.644  -51.164  1.00 59.32  ?  47  ARG C N     1 
ATOM   3379 C  CA    . ARG C 1 47  ? 13.843  50.490  -51.263  1.00 59.08  ?  47  ARG C CA    1 
ATOM   3380 C  C     . ARG C 1 47  ? 13.198  50.195  -49.927  1.00 63.26  ?  47  ARG C C     1 
ATOM   3381 O  O     . ARG C 1 47  ? 12.023  49.823  -49.892  1.00 64.72  ?  47  ARG C O     1 
ATOM   3382 C  CB    . ARG C 1 47  ? 14.594  49.238  -51.706  1.00 57.46  ?  47  ARG C CB    1 
ATOM   3383 C  CG    . ARG C 1 47  ? 14.775  49.073  -53.201  1.00 64.10  ?  47  ARG C CG    1 
ATOM   3384 C  CD    . ARG C 1 47  ? 15.215  47.653  -53.569  1.00 69.02  ?  47  ARG C CD    1 
ATOM   3385 N  NE    . ARG C 1 47  ? 16.470  47.262  -52.919  1.00 67.92  ?  47  ARG C NE    1 
ATOM   3386 C  CZ    . ARG C 1 47  ? 16.545  46.494  -51.838  1.00 74.58  ?  47  ARG C CZ    1 
ATOM   3387 N  NH1   . ARG C 1 47  ? 15.442  46.009  -51.281  1.00 64.58  ?  47  ARG C NH1   1 
ATOM   3388 N  NH2   . ARG C 1 47  ? 17.719  46.222  -51.292  1.00 52.10  ?  47  ARG C NH2   1 
ATOM   3389 N  N     . THR C 1 48  ? 13.972  50.351  -48.832  1.00 58.69  ?  48  THR C N     1 
ATOM   3390 C  CA    . THR C 1 48  ? 13.515  50.112  -47.464  1.00 58.48  ?  48  THR C CA    1 
ATOM   3391 C  C     . THR C 1 48  ? 12.345  51.032  -47.123  1.00 63.42  ?  48  THR C C     1 
ATOM   3392 O  O     . THR C 1 48  ? 11.291  50.544  -46.710  1.00 63.65  ?  48  THR C O     1 
ATOM   3393 C  CB    . THR C 1 48  ? 14.692  50.197  -46.477  1.00 61.63  ?  48  THR C CB    1 
ATOM   3394 O  OG1   . THR C 1 48  ? 15.644  49.183  -46.796  1.00 56.23  ?  48  THR C OG1   1 
ATOM   3395 C  CG2   . THR C 1 48  ? 14.258  50.027  -45.038  1.00 62.06  ?  48  THR C CG2   1 
ATOM   3396 N  N     . TYR C 1 49  ? 12.526  52.348  -47.340  1.00 60.37  ?  49  TYR C N     1 
ATOM   3397 C  CA    . TYR C 1 49  ? 11.516  53.362  -47.073  1.00 60.58  ?  49  TYR C CA    1 
ATOM   3398 C  C     . TYR C 1 49  ? 10.296  53.175  -47.973  1.00 64.42  ?  49  TYR C C     1 
ATOM   3399 O  O     . TYR C 1 49  ? 9.166   53.344  -47.503  1.00 65.71  ?  49  TYR C O     1 
ATOM   3400 C  CB    . TYR C 1 49  ? 12.110  54.779  -47.200  1.00 62.54  ?  49  TYR C CB    1 
ATOM   3401 C  CG    . TYR C 1 49  ? 11.205  55.861  -46.655  1.00 67.64  ?  49  TYR C CG    1 
ATOM   3402 C  CD1   . TYR C 1 49  ? 11.175  56.156  -45.293  1.00 70.36  ?  49  TYR C CD1   1 
ATOM   3403 C  CD2   . TYR C 1 49  ? 10.361  56.584  -47.497  1.00 70.13  ?  49  TYR C CD2   1 
ATOM   3404 C  CE1   . TYR C 1 49  ? 10.313  57.128  -44.778  1.00 73.35  ?  49  TYR C CE1   1 
ATOM   3405 C  CE2   . TYR C 1 49  ? 9.504   57.566  -46.997  1.00 72.31  ?  49  TYR C CE2   1 
ATOM   3406 C  CZ    . TYR C 1 49  ? 9.480   57.832  -45.635  1.00 82.29  ?  49  TYR C CZ    1 
ATOM   3407 O  OH    . TYR C 1 49  ? 8.637   58.801  -45.140  1.00 86.22  ?  49  TYR C OH    1 
ATOM   3408 N  N     . LEU C 1 50  ? 10.522  52.797  -49.254  1.00 59.02  ?  50  LEU C N     1 
ATOM   3409 C  CA    . LEU C 1 50  ? 9.466   52.578  -50.253  1.00 58.60  ?  50  LEU C CA    1 
ATOM   3410 C  C     . LEU C 1 50  ? 8.813   51.196  -50.112  1.00 60.73  ?  50  LEU C C     1 
ATOM   3411 O  O     . LEU C 1 50  ? 7.908   50.869  -50.888  1.00 61.77  ?  50  LEU C O     1 
ATOM   3412 C  CB    . LEU C 1 50  ? 10.013  52.745  -51.683  1.00 58.98  ?  50  LEU C CB    1 
ATOM   3413 C  CG    . LEU C 1 50  ? 10.510  54.116  -52.122  1.00 63.51  ?  50  LEU C CG    1 
ATOM   3414 C  CD1   . LEU C 1 50  ? 11.526  53.985  -53.248  1.00 64.55  ?  50  LEU C CD1   1 
ATOM   3415 C  CD2   . LEU C 1 50  ? 9.388   55.002  -52.580  1.00 66.53  ?  50  LEU C CD2   1 
ATOM   3416 N  N     . ASN C 1 51  ? 9.272   50.392  -49.129  1.00 54.95  ?  51  ASN C N     1 
ATOM   3417 C  CA    . ASN C 1 51  ? 8.804   49.033  -48.842  1.00 55.23  ?  51  ASN C CA    1 
ATOM   3418 C  C     . ASN C 1 51  ? 8.851   48.084  -50.042  1.00 57.34  ?  51  ASN C C     1 
ATOM   3419 O  O     . ASN C 1 51  ? 7.979   47.224  -50.217  1.00 58.63  ?  51  ASN C O     1 
ATOM   3420 C  CB    . ASN C 1 51  ? 7.481   49.007  -48.063  1.00 60.00  ?  51  ASN C CB    1 
ATOM   3421 C  CG    . ASN C 1 51  ? 7.682   49.244  -46.581  1.00 99.51  ?  51  ASN C CG    1 
ATOM   3422 O  OD1   . ASN C 1 51  ? 8.306   48.438  -45.871  1.00 94.76  ?  51  ASN C OD1   1 
ATOM   3423 N  ND2   . ASN C 1 51  ? 7.178   50.367  -46.083  1.00 95.51  ?  51  ASN C ND2   1 
ATOM   3424 N  N     . ILE C 1 52  ? 9.906   48.254  -50.860  1.00 51.08  ?  52  ILE C N     1 
ATOM   3425 C  CA    . ILE C 1 52  ? 10.212  47.443  -52.031  1.00 51.25  ?  52  ILE C CA    1 
ATOM   3426 C  C     . ILE C 1 52  ? 11.140  46.324  -51.547  1.00 56.84  ?  52  ILE C C     1 
ATOM   3427 O  O     . ILE C 1 52  ? 12.194  46.622  -50.964  1.00 55.73  ?  52  ILE C O     1 
ATOM   3428 C  CB    . ILE C 1 52  ? 10.870  48.289  -53.152  1.00 53.40  ?  52  ILE C CB    1 
ATOM   3429 C  CG1   . ILE C 1 52  ? 9.903   49.363  -53.682  1.00 53.86  ?  52  ILE C CG1   1 
ATOM   3430 C  CG2   . ILE C 1 52  ? 11.383  47.387  -54.279  1.00 55.15  ?  52  ILE C CG2   1 
ATOM   3431 C  CD1   . ILE C 1 52  ? 10.512  50.439  -54.562  1.00 61.40  ?  52  ILE C CD1   1 
ATOM   3432 N  N     . PRO C 1 53  ? 10.778  45.035  -51.765  1.00 55.56  ?  53  PRO C N     1 
ATOM   3433 C  CA    . PRO C 1 53  ? 11.664  43.950  -51.315  1.00 55.90  ?  53  PRO C CA    1 
ATOM   3434 C  C     . PRO C 1 53  ? 12.862  43.795  -52.244  1.00 60.80  ?  53  PRO C C     1 
ATOM   3435 O  O     . PRO C 1 53  ? 12.911  44.428  -53.301  1.00 59.92  ?  53  PRO C O     1 
ATOM   3436 C  CB    . PRO C 1 53  ? 10.752  42.723  -51.337  1.00 59.50  ?  53  PRO C CB    1 
ATOM   3437 C  CG    . PRO C 1 53  ? 9.766   43.011  -52.394  1.00 64.97  ?  53  PRO C CG    1 
ATOM   3438 C  CD    . PRO C 1 53  ? 9.575   44.504  -52.442  1.00 58.91  ?  53  PRO C CD    1 
ATOM   3439 N  N     . GLU C 1 54  ? 13.825  42.956  -51.848  1.00 58.96  ?  54  GLU C N     1 
ATOM   3440 C  CA    . GLU C 1 54  ? 15.015  42.686  -52.651  1.00 59.99  ?  54  GLU C CA    1 
ATOM   3441 C  C     . GLU C 1 54  ? 14.675  41.942  -53.953  1.00 65.78  ?  54  GLU C C     1 
ATOM   3442 O  O     . GLU C 1 54  ? 13.615  41.321  -54.049  1.00 67.06  ?  54  GLU C O     1 
ATOM   3443 C  CB    . GLU C 1 54  ? 16.055  41.920  -51.831  1.00 62.25  ?  54  GLU C CB    1 
ATOM   3444 C  CG    . GLU C 1 54  ? 15.640  40.519  -51.403  1.00 76.35  ?  54  GLU C CG    1 
ATOM   3445 C  CD    . GLU C 1 54  ? 16.821  39.617  -51.116  1.00 102.25 ?  54  GLU C CD    1 
ATOM   3446 O  OE1   . GLU C 1 54  ? 17.575  39.304  -52.067  1.00 108.42 ?  54  GLU C OE1   1 
ATOM   3447 O  OE2   . GLU C 1 54  ? 17.005  39.243  -49.935  1.00 90.94  -1 54  GLU C OE2   1 
ATOM   3448 N  N     . LEU C 1 55  ? 15.582  42.013  -54.942  1.00 62.34  ?  55  LEU C N     1 
ATOM   3449 C  CA    . LEU C 1 55  ? 15.471  41.403  -56.269  1.00 63.67  ?  55  LEU C CA    1 
ATOM   3450 C  C     . LEU C 1 55  ? 14.861  40.009  -56.256  1.00 68.77  ?  55  LEU C C     1 
ATOM   3451 O  O     . LEU C 1 55  ? 13.850  39.776  -56.918  1.00 68.95  ?  55  LEU C O     1 
ATOM   3452 C  CB    . LEU C 1 55  ? 16.862  41.376  -56.938  1.00 64.52  ?  55  LEU C CB    1 
ATOM   3453 C  CG    . LEU C 1 55  ? 16.996  40.612  -58.243  1.00 71.51  ?  55  LEU C CG    1 
ATOM   3454 C  CD1   . LEU C 1 55  ? 16.350  41.353  -59.356  1.00 72.11  ?  55  LEU C CD1   1 
ATOM   3455 C  CD2   . LEU C 1 55  ? 18.435  40.369  -58.573  1.00 74.56  ?  55  LEU C CD2   1 
ATOM   3456 N  N     . ARG C 1 56  ? 15.470  39.093  -55.486  1.00 66.00  ?  56  ARG C N     1 
ATOM   3457 C  CA    . ARG C 1 56  ? 15.040  37.700  -55.382  1.00 67.45  ?  56  ARG C CA    1 
ATOM   3458 C  C     . ARG C 1 56  ? 13.605  37.559  -54.885  1.00 70.85  ?  56  ARG C C     1 
ATOM   3459 O  O     . ARG C 1 56  ? 12.874  36.691  -55.370  1.00 72.88  ?  56  ARG C O     1 
ATOM   3460 C  CB    . ARG C 1 56  ? 16.030  36.885  -54.547  1.00 66.35  ?  56  ARG C CB    1 
ATOM   3461 C  CG    . ARG C 1 56  ? 17.345  36.654  -55.276  1.00 72.15  ?  56  ARG C CG    1 
ATOM   3462 C  CD    . ARG C 1 56  ? 18.390  36.063  -54.368  1.00 81.09  ?  56  ARG C CD    1 
ATOM   3463 N  NE    . ARG C 1 56  ? 19.656  35.867  -55.071  1.00 88.14  ?  56  ARG C NE    1 
ATOM   3464 C  CZ    . ARG C 1 56  ? 20.844  35.897  -54.480  1.00 96.62  ?  56  ARG C CZ    1 
ATOM   3465 N  NH1   . ARG C 1 56  ? 20.939  36.114  -53.174  1.00 76.42  ?  56  ARG C NH1   1 
ATOM   3466 N  NH2   . ARG C 1 56  ? 21.949  35.726  -55.192  1.00 86.06  ?  56  ARG C NH2   1 
ATOM   3467 N  N     . LYS C 1 57  ? 13.190  38.444  -53.963  1.00 64.64  ?  57  LYS C N     1 
ATOM   3468 C  CA    . LYS C 1 57  ? 11.830  38.445  -53.437  1.00 64.31  ?  57  LYS C CA    1 
ATOM   3469 C  C     . LYS C 1 57  ? 10.851  38.987  -54.488  1.00 69.24  ?  57  LYS C C     1 
ATOM   3470 O  O     . LYS C 1 57  ? 9.727   38.486  -54.591  1.00 70.84  ?  57  LYS C O     1 
ATOM   3471 C  CB    . LYS C 1 57  ? 11.746  39.213  -52.111  1.00 63.51  ?  57  LYS C CB    1 
ATOM   3472 C  CG    . LYS C 1 57  ? 12.388  38.467  -50.948  1.00 75.70  ?  57  LYS C CG    1 
ATOM   3473 C  CD    . LYS C 1 57  ? 12.253  39.226  -49.634  1.00 81.75  ?  57  LYS C CD    1 
ATOM   3474 C  CE    . LYS C 1 57  ? 12.857  38.500  -48.461  1.00 86.03  ?  57  LYS C CE    1 
ATOM   3475 N  NZ    . LYS C 1 57  ? 11.950  37.451  -47.936  1.00 95.84  ?  57  LYS C NZ    1 
ATOM   3476 N  N     . ARG C 1 58  ? 11.298  39.966  -55.306  1.00 64.28  ?  58  ARG C N     1 
ATOM   3477 C  CA    . ARG C 1 58  ? 10.471  40.548  -56.368  1.00 64.30  ?  58  ARG C CA    1 
ATOM   3478 C  C     . ARG C 1 58  ? 10.258  39.521  -57.460  1.00 71.26  ?  58  ARG C C     1 
ATOM   3479 O  O     . ARG C 1 58  ? 9.112   39.286  -57.832  1.00 72.86  ?  58  ARG C O     1 
ATOM   3480 C  CB    . ARG C 1 58  ? 11.071  41.843  -56.948  1.00 61.42  ?  58  ARG C CB    1 
ATOM   3481 C  CG    . ARG C 1 58  ? 11.362  42.916  -55.903  1.00 63.22  ?  58  ARG C CG    1 
ATOM   3482 C  CD    . ARG C 1 58  ? 11.570  44.294  -56.500  1.00 62.92  ?  58  ARG C CD    1 
ATOM   3483 N  NE    . ARG C 1 58  ? 12.739  44.387  -57.378  1.00 65.22  ?  58  ARG C NE    1 
ATOM   3484 C  CZ    . ARG C 1 58  ? 13.973  44.658  -56.965  1.00 79.45  ?  58  ARG C CZ    1 
ATOM   3485 N  NH1   . ARG C 1 58  ? 14.226  44.844  -55.676  1.00 74.38  ?  58  ARG C NH1   1 
ATOM   3486 N  NH2   . ARG C 1 58  ? 14.967  44.726  -57.834  1.00 63.74  ?  58  ARG C NH2   1 
ATOM   3487 N  N     . ILE C 1 59  ? 11.346  38.858  -57.918  1.00 68.79  ?  59  ILE C N     1 
ATOM   3488 C  CA    . ILE C 1 59  ? 11.288  37.823  -58.958  1.00 71.84  ?  59  ILE C CA    1 
ATOM   3489 C  C     . ILE C 1 59  ? 10.339  36.692  -58.528  1.00 79.07  ?  59  ILE C C     1 
ATOM   3490 O  O     . ILE C 1 59  ? 9.570   36.210  -59.359  1.00 80.63  ?  59  ILE C O     1 
ATOM   3491 C  CB    . ILE C 1 59  ? 12.697  37.305  -59.394  1.00 75.60  ?  59  ILE C CB    1 
ATOM   3492 C  CG1   . ILE C 1 59  ? 13.564  38.426  -60.004  1.00 74.10  ?  59  ILE C CG1   1 
ATOM   3493 C  CG2   . ILE C 1 59  ? 12.588  36.122  -60.363  1.00 80.23  ?  59  ILE C CG2   1 
ATOM   3494 C  CD1   . ILE C 1 59  ? 15.050  38.043  -60.286  1.00 81.20  ?  59  ILE C CD1   1 
ATOM   3495 N  N     . LYS C 1 60  ? 10.364  36.311  -57.228  1.00 76.52  ?  60  LYS C N     1 
ATOM   3496 C  CA    . LYS C 1 60  ? 9.500   35.264  -56.677  1.00 79.29  ?  60  LYS C CA    1 
ATOM   3497 C  C     . LYS C 1 60  ? 8.037   35.640  -56.822  1.00 85.40  ?  60  LYS C C     1 
ATOM   3498 O  O     . LYS C 1 60  ? 7.263   34.828  -57.326  1.00 88.32  ?  60  LYS C O     1 
ATOM   3499 C  CB    . LYS C 1 60  ? 9.847   34.941  -55.215  1.00 80.88  ?  60  LYS C CB    1 
ATOM   3500 C  CG    . LYS C 1 60  ? 9.330   33.579  -54.753  1.00 97.72  ?  60  LYS C CG    1 
ATOM   3501 C  CD    . LYS C 1 60  ? 9.302   33.494  -53.236  1.00 106.99 ?  60  LYS C CD    1 
ATOM   3502 C  CE    . LYS C 1 60  ? 8.871   32.141  -52.735  1.00 119.74 ?  60  LYS C CE    1 
ATOM   3503 N  NZ    . LYS C 1 60  ? 8.813   32.108  -51.250  1.00 127.12 ?  60  LYS C NZ    1 
ATOM   3504 N  N     . LEU C 1 61  ? 7.676   36.884  -56.443  1.00 80.18  ?  61  LEU C N     1 
ATOM   3505 C  CA    . LEU C 1 61  ? 6.311   37.412  -56.536  1.00 80.85  ?  61  LEU C CA    1 
ATOM   3506 C  C     . LEU C 1 61  ? 5.780   37.421  -57.972  1.00 87.30  ?  61  LEU C C     1 
ATOM   3507 O  O     . LEU C 1 61  ? 4.600   37.137  -58.184  1.00 88.90  ?  61  LEU C O     1 
ATOM   3508 C  CB    . LEU C 1 61  ? 6.228   38.813  -55.910  1.00 77.94  ?  61  LEU C CB    1 
ATOM   3509 C  CG    . LEU C 1 61  ? 6.281   38.856  -54.378  1.00 81.68  ?  61  LEU C CG    1 
ATOM   3510 C  CD1   . LEU C 1 61  ? 6.897   40.151  -53.880  1.00 78.64  ?  61  LEU C CD1   1 
ATOM   3511 C  CD2   . LEU C 1 61  ? 4.901   38.662  -53.774  1.00 86.25  ?  61  LEU C CD2   1 
ATOM   3512 N  N     . VAL C 1 62  ? 6.660   37.715  -58.952  1.00 84.08  ?  62  VAL C N     1 
ATOM   3513 C  CA    . VAL C 1 62  ? 6.329   37.731  -60.381  1.00 86.30  ?  62  VAL C CA    1 
ATOM   3514 C  C     . VAL C 1 62  ? 6.040   36.300  -60.829  1.00 95.96  ?  62  VAL C C     1 
ATOM   3515 O  O     . VAL C 1 62  ? 5.037   36.068  -61.497  1.00 98.48  ?  62  VAL C O     1 
ATOM   3516 C  CB    . VAL C 1 62  ? 7.429   38.411  -61.244  1.00 88.66  ?  62  VAL C CB    1 
ATOM   3517 C  CG1   . VAL C 1 62  ? 7.090   38.355  -62.732  1.00 91.13  ?  62  VAL C CG1   1 
ATOM   3518 C  CG2   . VAL C 1 62  ? 7.646   39.855  -60.819  1.00 85.09  ?  62  VAL C CG2   1 
ATOM   3519 N  N     . ALA C 1 63  ? 6.894   35.345  -60.420  1.00 94.76  ?  63  ALA C N     1 
ATOM   3520 C  CA    . ALA C 1 63  ? 6.766   33.920  -60.729  1.00 99.24  ?  63  ALA C CA    1 
ATOM   3521 C  C     . ALA C 1 63  ? 5.533   33.304  -60.077  1.00 107.30 ?  63  ALA C C     1 
ATOM   3522 O  O     . ALA C 1 63  ? 4.838   32.530  -60.732  1.00 110.34 ?  63  ALA C O     1 
ATOM   3523 C  CB    . ALA C 1 63  ? 8.008   33.178  -60.277  1.00 99.99  ?  63  ALA C CB    1 
ATOM   3524 N  N     . GLU C 1 64  ? 5.256   33.658  -58.800  1.00 103.88 ?  64  GLU C N     1 
ATOM   3525 C  CA    . GLU C 1 64  ? 4.114   33.166  -58.024  1.00 106.73 ?  64  GLU C CA    1 
ATOM   3526 C  C     . GLU C 1 64  ? 2.769   33.582  -58.618  1.00 115.70 ?  64  GLU C C     1 
ATOM   3527 O  O     . GLU C 1 64  ? 1.828   32.793  -58.576  1.00 118.88 ?  64  GLU C O     1 
ATOM   3528 C  CB    . GLU C 1 64  ? 4.212   33.593  -56.552  1.00 105.45 ?  64  GLU C CB    1 
ATOM   3529 C  CG    . GLU C 1 64  ? 5.235   32.800  -55.753  1.00 116.18 ?  64  GLU C CG    1 
ATOM   3530 C  CD    . GLU C 1 64  ? 5.331   33.119  -54.273  1.00 135.96 ?  64  GLU C CD    1 
ATOM   3531 O  OE1   . GLU C 1 64  ? 5.315   34.317  -53.905  1.00 125.54 -1 64  GLU C OE1   1 
ATOM   3532 O  OE2   . GLU C 1 64  ? 5.438   32.158  -53.477  1.00 133.94 ?  64  GLU C OE2   1 
ATOM   3533 N  N     . LYS C 1 65  ? 2.678   34.809  -59.172  1.00 112.74 ?  65  LYS C N     1 
ATOM   3534 C  CA    . LYS C 1 65  ? 1.455   35.328  -59.803  1.00 115.37 ?  65  LYS C CA    1 
ATOM   3535 C  C     . LYS C 1 65  ? 1.128   34.506  -61.053  1.00 126.28 ?  65  LYS C C     1 
ATOM   3536 O  O     . LYS C 1 65  ? -0.019  34.099  -61.238  1.00 129.42 ?  65  LYS C O     1 
ATOM   3537 C  CB    . LYS C 1 65  ? 1.595   36.822  -60.144  1.00 115.14 ?  65  LYS C CB    1 
ATOM   3538 C  CG    . LYS C 1 65  ? 1.370   37.742  -58.949  1.00 128.79 ?  65  LYS C CG    1 
ATOM   3539 C  CD    . LYS C 1 65  ? 1.726   39.190  -59.257  1.00 137.93 ?  65  LYS C CD    1 
ATOM   3540 C  CE    . LYS C 1 65  ? 1.607   40.069  -58.031  1.00 147.52 ?  65  LYS C CE    1 
ATOM   3541 N  NZ    . LYS C 1 65  ? 1.997   41.476  -58.311  1.00 154.88 ?  65  LYS C NZ    1 
ATOM   3542 N  N     . ASN C 1 66  ? 2.185   34.189  -61.849  1.00 125.22 ?  66  ASN C N     1 
ATOM   3543 C  CA    . ASN C 1 66  ? 2.150   33.381  -63.078  1.00 130.07 ?  66  ASN C CA    1 
ATOM   3544 C  C     . ASN C 1 66  ? 1.885   31.899  -62.784  1.00 140.17 ?  66  ASN C C     1 
ATOM   3545 O  O     . ASN C 1 66  ? 1.179   31.244  -63.558  1.00 143.64 ?  66  ASN C O     1 
ATOM   3546 C  CB    . ASN C 1 66  ? 3.468   33.514  -63.865  1.00 130.32 ?  66  ASN C CB    1 
ATOM   3547 C  CG    . ASN C 1 66  ? 3.866   34.914  -64.279  1.00 152.86 ?  66  ASN C CG    1 
ATOM   3548 O  OD1   . ASN C 1 66  ? 3.080   35.871  -64.248  1.00 147.50 ?  66  ASN C OD1   1 
ATOM   3549 N  ND2   . ASN C 1 66  ? 5.103   35.052  -64.734  1.00 143.56 ?  66  ASN C ND2   1 
ATOM   3550 N  N     . TYR C 1 67  ? 2.480   31.367  -61.687  1.00 137.62 ?  67  TYR C N     1 
ATOM   3551 C  CA    . TYR C 1 67  ? 2.313   29.974  -61.262  1.00 141.82 ?  67  TYR C CA    1 
ATOM   3552 C  C     . TYR C 1 67  ? 0.883   29.713  -60.765  1.00 150.24 ?  67  TYR C C     1 
ATOM   3553 O  O     . TYR C 1 67  ? 0.288   28.699  -61.141  1.00 154.44 ?  67  TYR C O     1 
ATOM   3554 C  CB    . TYR C 1 67  ? 3.371   29.567  -60.215  1.00 141.33 ?  67  TYR C CB    1 
ATOM   3555 C  CG    . TYR C 1 67  ? 3.285   28.116  -59.788  1.00 147.34 ?  67  TYR C CG    1 
ATOM   3556 C  CD1   . TYR C 1 67  ? 3.640   27.088  -60.659  1.00 153.12 ?  67  TYR C CD1   1 
ATOM   3557 C  CD2   . TYR C 1 67  ? 2.846   27.769  -58.513  1.00 148.51 ?  67  TYR C CD2   1 
ATOM   3558 C  CE1   . TYR C 1 67  ? 3.539   25.750  -60.280  1.00 157.89 ?  67  TYR C CE1   1 
ATOM   3559 C  CE2   . TYR C 1 67  ? 2.750   26.434  -58.120  1.00 153.48 ?  67  TYR C CE2   1 
ATOM   3560 C  CZ    . TYR C 1 67  ? 3.097   25.428  -59.007  1.00 164.63 ?  67  TYR C CZ    1 
ATOM   3561 O  OH    . TYR C 1 67  ? 3.001   24.112  -58.625  1.00 169.93 ?  67  TYR C OH    1 
ATOM   3562 N  N     . ASP C 1 68  ? 0.319   30.655  -59.968  1.00 145.52 ?  68  ASP C N     1 
ATOM   3563 C  CA    . ASP C 1 68  ? -1.056  30.592  -59.454  1.00 148.21 ?  68  ASP C CA    1 
ATOM   3564 C  C     . ASP C 1 68  ? -2.091  30.776  -60.583  1.00 156.52 ?  68  ASP C C     1 
ATOM   3565 O  O     . ASP C 1 68  ? -3.290  30.587  -60.354  1.00 159.15 ?  68  ASP C O     1 
ATOM   3566 C  CB    . ASP C 1 68  ? -1.279  31.631  -58.339  1.00 146.59 ?  68  ASP C CB    1 
ATOM   3567 C  CG    . ASP C 1 68  ? -0.822  31.191  -56.961  1.00 156.24 ?  68  ASP C CG    1 
ATOM   3568 O  OD1   . ASP C 1 68  ? -1.367  30.187  -56.446  1.00 160.21 ?  68  ASP C OD1   1 
ATOM   3569 O  OD2   . ASP C 1 68  ? 0.030   31.889  -56.367  1.00 158.14 -1 68  ASP C OD2   1 
ATOM   3570 N  N     . GLN C 1 69  ? -1.609  31.124  -61.800  1.00 153.56 ?  69  GLN C N     1 
ATOM   3571 C  CA    . GLN C 1 69  ? -2.377  31.339  -63.032  1.00 156.51 ?  69  GLN C CA    1 
ATOM   3572 C  C     . GLN C 1 69  ? -3.428  32.456  -62.925  1.00 160.73 ?  69  GLN C C     1 
ATOM   3573 O  O     . GLN C 1 69  ? -4.531  32.340  -63.475  1.00 164.07 ?  69  GLN C O     1 
ATOM   3574 C  CB    . GLN C 1 69  ? -2.926  30.017  -63.614  1.00 163.34 ?  69  GLN C CB    1 
ATOM   3575 C  CG    . GLN C 1 69  ? -1.841  29.125  -64.214  1.00 177.03 ?  69  GLN C CG    1 
ATOM   3576 C  CD    . GLN C 1 69  ? -2.332  27.727  -64.495  1.00 199.75 ?  69  GLN C CD    1 
ATOM   3577 O  OE1   . GLN C 1 69  ? -2.603  26.939  -63.582  1.00 197.33 ?  69  GLN C OE1   1 
ATOM   3578 N  NE2   . GLN C 1 69  ? -2.417  27.375  -65.768  1.00 194.96 ?  69  GLN C NE2   1 
ATOM   3579 N  N     . ILE C 1 70  ? -3.059  33.554  -62.223  1.00 159.58 ?  70  ILE C N     1 
ATOM   3580 C  CA    . ILE C 1 70  ? -3.895  34.748  -62.040  1.00 154.20 ?  70  ILE C CA    1 
ATOM   3581 C  C     . ILE C 1 70  ? -3.908  35.513  -63.375  1.00 153.58 ?  70  ILE C C     1 
ATOM   3582 O  O     . ILE C 1 70  ? -2.850  35.696  -63.986  1.00 153.36 ?  70  ILE C O     1 
ATOM   3583 C  CB    . ILE C 1 70  ? -3.429  35.625  -60.835  1.00 157.46 ?  70  ILE C CB    1 
ATOM   3584 C  CG1   . ILE C 1 70  ? -3.219  34.772  -59.558  1.00 163.71 ?  70  ILE C CG1   1 
ATOM   3585 C  CG2   . ILE C 1 70  ? -4.420  36.775  -60.570  1.00 153.26 ?  70  ILE C CG2   1 
ATOM   3586 C  CD1   . ILE C 1 70  ? -2.191  35.327  -58.556  1.00 172.98 ?  70  ILE C CD1   1 
ATOM   3587 N  N     . SER C 1 71  ? -5.116  35.927  -63.826  1.00 146.50 ?  71  SER C N     1 
ATOM   3588 C  CA    . SER C 1 71  ? -5.406  36.597  -65.103  1.00 141.95 ?  71  SER C CA    1 
ATOM   3589 C  C     . SER C 1 71  ? -5.202  35.611  -66.272  1.00 147.25 ?  71  SER C C     1 
ATOM   3590 O  O     . SER C 1 71  ? -4.066  35.308  -66.658  1.00 149.18 ?  71  SER C O     1 
ATOM   3591 C  CB    . SER C 1 71  ? -4.618  37.899  -65.276  1.00 142.83 ?  71  SER C CB    1 
ATOM   3592 O  OG    . SER C 1 71  ? -5.056  38.646  -66.401  1.00 147.24 ?  71  SER C OG    1 
ATOM   3593 N  N     . SER C 1 72  ? -6.331  35.074  -66.787  1.00 142.47 ?  72  SER C N     1 
ATOM   3594 C  CA    . SER C 1 72  ? -6.419  34.090  -67.873  1.00 143.63 ?  72  SER C CA    1 
ATOM   3595 C  C     . SER C 1 72  ? -5.863  34.601  -69.210  1.00 143.67 ?  72  SER C C     1 
ATOM   3596 O  O     . SER C 1 72  ? -5.605  35.801  -69.355  1.00 139.69 ?  72  SER C O     1 
ATOM   3597 C  CB    . SER C 1 72  ? -7.870  33.644  -68.053  1.00 146.63 ?  72  SER C CB    1 
ATOM   3598 O  OG    . SER C 1 72  ? -8.715  34.723  -68.424  1.00 148.85 ?  72  SER C OG    1 
ATOM   3599 N  N     . ILE C 1 73  ? -5.703  33.681  -70.195  1.00 141.22 ?  73  ILE C N     1 
ATOM   3600 C  CA    . ILE C 1 73  ? -5.241  34.000  -71.555  1.00 138.52 ?  73  ILE C CA    1 
ATOM   3601 C  C     . ILE C 1 73  ? -6.260  34.971  -72.172  1.00 134.92 ?  73  ILE C C     1 
ATOM   3602 O  O     . ILE C 1 73  ? -5.863  35.986  -72.745  1.00 131.07 ?  73  ILE C O     1 
ATOM   3603 C  CB    . ILE C 1 73  ? -5.030  32.724  -72.430  1.00 145.93 ?  73  ILE C CB    1 
ATOM   3604 C  CG1   . ILE C 1 73  ? -4.177  31.661  -71.695  1.00 152.44 ?  73  ILE C CG1   1 
ATOM   3605 C  CG2   . ILE C 1 73  ? -4.407  33.082  -73.788  1.00 145.19 ?  73  ILE C CG2   1 
ATOM   3606 C  CD1   . ILE C 1 73  ? -4.470  30.201  -72.083  1.00 165.58 ?  73  ILE C CD1   1 
ATOM   3607 N  N     . GLU C 1 74  ? -7.568  34.686  -71.958  1.00 129.58 ?  74  GLU C N     1 
ATOM   3608 C  CA    . GLU C 1 74  ? -8.729  35.468  -72.397  1.00 124.73 ?  74  GLU C CA    1 
ATOM   3609 C  C     . GLU C 1 74  ? -8.663  36.935  -71.949  1.00 122.74 ?  74  GLU C C     1 
ATOM   3610 O  O     . GLU C 1 74  ? -9.077  37.815  -72.706  1.00 118.80 ?  74  GLU C O     1 
ATOM   3611 C  CB    . GLU C 1 74  ? -10.032 34.820  -71.894  1.00 127.43 ?  74  GLU C CB    1 
ATOM   3612 C  CG    . GLU C 1 74  ? -10.509 33.634  -72.721  1.00 140.98 ?  74  GLU C CG    1 
ATOM   3613 C  CD    . GLU C 1 74  ? -9.751  32.325  -72.583  1.00 168.08 ?  74  GLU C CD    1 
ATOM   3614 O  OE1   . GLU C 1 74  ? -9.071  32.122  -71.551  1.00 164.70 ?  74  GLU C OE1   1 
ATOM   3615 O  OE2   . GLU C 1 74  ? -9.864  31.487  -73.506  1.00 165.71 ?  74  GLU C OE2   1 
ATOM   3616 N  N     . GLU C 1 75  ? -8.139  37.187  -70.726  1.00 118.60 ?  75  GLU C N     1 
ATOM   3617 C  CA    . GLU C 1 75  ? -7.974  38.524  -70.144  1.00 114.79 ?  75  GLU C CA    1 
ATOM   3618 C  C     . GLU C 1 75  ? -6.843  39.298  -70.827  1.00 115.11 ?  75  GLU C C     1 
ATOM   3619 O  O     . GLU C 1 75  ? -6.970  40.502  -71.057  1.00 111.46 ?  75  GLU C O     1 
ATOM   3620 C  CB    . GLU C 1 75  ? -7.667  38.424  -68.640  1.00 118.41 ?  75  GLU C CB    1 
ATOM   3621 C  CG    . GLU C 1 75  ? -8.880  38.228  -67.750  1.00 130.64 ?  75  GLU C CG    1 
ATOM   3622 C  CD    . GLU C 1 75  ? -8.568  38.281  -66.265  1.00 153.59 ?  75  GLU C CD    1 
ATOM   3623 O  OE1   . GLU C 1 75  ? -8.126  39.351  -65.784  1.00 139.30 ?  75  GLU C OE1   1 
ATOM   3624 O  OE2   . GLU C 1 75  ? -8.774  37.253  -65.580  1.00 153.39 ?  75  GLU C OE2   1 
ATOM   3625 N  N     . GLN C 1 76  ? -5.731  38.603  -71.121  1.00 112.89 ?  76  GLN C N     1 
ATOM   3626 C  CA    . GLN C 1 76  ? -4.525  39.161  -71.734  1.00 111.64 ?  76  GLN C CA    1 
ATOM   3627 C  C     . GLN C 1 76  ? -4.740  39.666  -73.168  1.00 110.95 ?  76  GLN C C     1 
ATOM   3628 O  O     . GLN C 1 76  ? -4.334  40.786  -73.483  1.00 108.73 ?  76  GLN C O     1 
ATOM   3629 C  CB    . GLN C 1 76  ? -3.379  38.133  -71.676  1.00 117.54 ?  76  GLN C CB    1 
ATOM   3630 C  CG    . GLN C 1 76  ? -2.897  37.829  -70.252  1.00 132.84 ?  76  GLN C CG    1 
ATOM   3631 C  CD    . GLN C 1 76  ? -2.323  36.440  -70.065  1.00 153.57 ?  76  GLN C CD    1 
ATOM   3632 O  OE1   . GLN C 1 76  ? -2.240  35.624  -70.992  1.00 150.66 ?  76  GLN C OE1   1 
ATOM   3633 N  NE2   . GLN C 1 76  ? -1.921  36.137  -68.840  1.00 147.28 ?  76  GLN C NE2   1 
ATOM   3634 N  N     . GLU C 1 77  ? -5.399  38.848  -74.018  1.00 105.72 ?  77  GLU C N     1 
ATOM   3635 C  CA    . GLU C 1 77  ? -5.675  39.119  -75.437  1.00 102.54 ?  77  GLU C CA    1 
ATOM   3636 C  C     . GLU C 1 77  ? -6.959  39.952  -75.716  1.00 98.98  ?  77  GLU C C     1 
ATOM   3637 O  O     . GLU C 1 77  ? -7.446  40.000  -76.852  1.00 98.13  ?  77  GLU C O     1 
ATOM   3638 C  CB    . GLU C 1 77  ? -5.662  37.792  -76.229  1.00 107.38 ?  77  GLU C CB    1 
ATOM   3639 C  CG    . GLU C 1 77  ? -6.735  36.786  -75.825  1.00 121.53 ?  77  GLU C CG    1 
ATOM   3640 C  CD    . GLU C 1 77  ? -6.692  35.428  -76.506  1.00 151.24 ?  77  GLU C CD    1 
ATOM   3641 O  OE1   . GLU C 1 77  ? -5.594  34.830  -76.601  1.00 148.79 ?  77  GLU C OE1   1 
ATOM   3642 O  OE2   . GLU C 1 77  ? -7.770  34.952  -76.928  1.00 149.66 ?  77  GLU C OE2   1 
ATOM   3643 N  N     . PHE C 1 78  ? -7.462  40.639  -74.686  1.00 90.26  ?  78  PHE C N     1 
ATOM   3644 C  CA    . PHE C 1 78  ? -8.684  41.435  -74.707  1.00 85.57  ?  78  PHE C CA    1 
ATOM   3645 C  C     . PHE C 1 78  ? -8.383  42.932  -74.724  1.00 83.80  ?  78  PHE C C     1 
ATOM   3646 O  O     . PHE C 1 78  ? -7.575  43.402  -73.916  1.00 84.07  ?  78  PHE C O     1 
ATOM   3647 C  CB    . PHE C 1 78  ? -9.523  41.052  -73.478  1.00 87.62  ?  78  PHE C CB    1 
ATOM   3648 C  CG    . PHE C 1 78  ? -10.872 41.709  -73.383  1.00 86.69  ?  78  PHE C CG    1 
ATOM   3649 C  CD1   . PHE C 1 78  ? -11.979 41.154  -74.013  1.00 90.18  ?  78  PHE C CD1   1 
ATOM   3650 C  CD2   . PHE C 1 78  ? -11.044 42.869  -72.643  1.00 86.80  ?  78  PHE C CD2   1 
ATOM   3651 C  CE1   . PHE C 1 78  ? -13.232 41.759  -73.912  1.00 89.59  ?  78  PHE C CE1   1 
ATOM   3652 C  CE2   . PHE C 1 78  ? -12.294 43.479  -72.548  1.00 88.13  ?  78  PHE C CE2   1 
ATOM   3653 C  CZ    . PHE C 1 78  ? -13.380 42.919  -73.180  1.00 86.68  ?  78  PHE C CZ    1 
ATOM   3654 N  N     . ILE C 1 79  ? -9.026  43.677  -75.650  1.00 75.34  ?  79  ILE C N     1 
ATOM   3655 C  CA    . ILE C 1 79  ? -8.858  45.127  -75.756  1.00 72.03  ?  79  ILE C CA    1 
ATOM   3656 C  C     . ILE C 1 79  ? -9.852  45.807  -74.821  1.00 73.32  ?  79  ILE C C     1 
ATOM   3657 O  O     . ILE C 1 79  ? -11.065 45.613  -74.940  1.00 73.02  ?  79  ILE C O     1 
ATOM   3658 C  CB    . ILE C 1 79  ? -8.897  45.664  -77.222  1.00 73.95  ?  79  ILE C CB    1 
ATOM   3659 C  CG1   . ILE C 1 79  ? -7.862  44.977  -78.173  1.00 76.08  ?  79  ILE C CG1   1 
ATOM   3660 C  CG2   . ILE C 1 79  ? -8.854  47.206  -77.292  1.00 72.83  ?  79  ILE C CG2   1 
ATOM   3661 C  CD1   . ILE C 1 79  ? -6.436  44.673  -77.710  1.00 89.27  ?  79  ILE C CD1   1 
ATOM   3662 N  N     . GLY C 1 80  ? -9.310  46.565  -73.880  1.00 68.16  ?  80  GLY C N     1 
ATOM   3663 C  CA    . GLY C 1 80  ? -10.077 47.257  -72.855  1.00 66.54  ?  80  GLY C CA    1 
ATOM   3664 C  C     . GLY C 1 80  ? -10.144 46.466  -71.562  1.00 70.13  ?  80  GLY C C     1 
ATOM   3665 O  O     . GLY C 1 80  ? -9.417  45.481  -71.387  1.00 72.03  ?  80  GLY C O     1 
ATOM   3666 N  N     . ASP C 1 81  ? -11.006 46.906  -70.642  1.00 63.86  ?  81  ASP C N     1 
ATOM   3667 C  CA    . ASP C 1 81  ? -11.225 46.263  -69.357  1.00 64.24  ?  81  ASP C CA    1 
ATOM   3668 C  C     . ASP C 1 81  ? -12.658 45.793  -69.316  1.00 65.70  ?  81  ASP C C     1 
ATOM   3669 O  O     . ASP C 1 81  ? -13.569 46.595  -69.486  1.00 63.70  ?  81  ASP C O     1 
ATOM   3670 C  CB    . ASP C 1 81  ? -10.952 47.247  -68.212  1.00 66.70  ?  81  ASP C CB    1 
ATOM   3671 C  CG    . ASP C 1 81  ? -9.496  47.619  -68.056  1.00 84.52  ?  81  ASP C CG    1 
ATOM   3672 O  OD1   . ASP C 1 81  ? -8.922  48.195  -69.007  1.00 92.47  -1 81  ASP C OD1   1 
ATOM   3673 O  OD2   . ASP C 1 81  ? -8.930  47.351  -66.979  1.00 88.57  ?  81  ASP C OD2   1 
ATOM   3674 N  N     . LEU C 1 82  ? -12.869 44.488  -69.144  1.00 63.40  ?  82  LEU C N     1 
ATOM   3675 C  CA    . LEU C 1 82  ? -14.214 43.924  -69.088  1.00 63.61  ?  82  LEU C CA    1 
ATOM   3676 C  C     . LEU C 1 82  ? -14.817 44.210  -67.718  1.00 67.72  ?  82  LEU C C     1 
ATOM   3677 O  O     . LEU C 1 82  ? -14.251 43.807  -66.690  1.00 69.82  ?  82  LEU C O     1 
ATOM   3678 C  CB    . LEU C 1 82  ? -14.180 42.415  -69.378  1.00 65.88  ?  82  LEU C CB    1 
ATOM   3679 C  CG    . LEU C 1 82  ? -15.506 41.718  -69.658  1.00 71.03  ?  82  LEU C CG    1 
ATOM   3680 C  CD1   . LEU C 1 82  ? -16.233 42.357  -70.820  1.00 69.01  ?  82  LEU C CD1   1 
ATOM   3681 C  CD2   . LEU C 1 82  ? -15.279 40.256  -69.932  1.00 76.14  ?  82  LEU C CD2   1 
ATOM   3682 N  N     . ILE C 1 83  ? -15.953 44.928  -67.712  1.00 60.91  ?  83  ILE C N     1 
ATOM   3683 C  CA    . ILE C 1 83  ? -16.625 45.343  -66.487  1.00 60.23  ?  83  ILE C CA    1 
ATOM   3684 C  C     . ILE C 1 83  ? -17.755 44.410  -66.051  1.00 65.37  ?  83  ILE C C     1 
ATOM   3685 O  O     . ILE C 1 83  ? -17.795 44.009  -64.888  1.00 66.94  ?  83  ILE C O     1 
ATOM   3686 C  CB    . ILE C 1 83  ? -16.992 46.864  -66.561  1.00 60.77  ?  83  ILE C CB    1 
ATOM   3687 C  CG1   . ILE C 1 83  ? -15.865 47.742  -66.005  1.00 60.26  ?  83  ILE C CG1   1 
ATOM   3688 C  CG2   . ILE C 1 83  ? -18.297 47.210  -65.826  1.00 61.97  ?  83  ILE C CG2   1 
ATOM   3689 C  CD1   . ILE C 1 83  ? -14.581 47.732  -66.693  1.00 63.75  ?  83  ILE C CD1   1 
ATOM   3690 N  N     . GLN C 1 84  ? -18.653 44.059  -66.980  1.00 61.91  ?  84  GLN C N     1 
ATOM   3691 C  CA    . GLN C 1 84  ? -19.817 43.231  -66.698  1.00 64.68  ?  84  GLN C CA    1 
ATOM   3692 C  C     . GLN C 1 84  ? -20.160 42.349  -67.899  1.00 70.05  ?  84  GLN C C     1 
ATOM   3693 O  O     . GLN C 1 84  ? -20.049 42.800  -69.037  1.00 67.59  ?  84  GLN C O     1 
ATOM   3694 C  CB    . GLN C 1 84  ? -20.972 44.161  -66.307  1.00 66.25  ?  84  GLN C CB    1 
ATOM   3695 C  CG    . GLN C 1 84  ? -22.368 43.576  -66.233  1.00 88.60  ?  84  GLN C CG    1 
ATOM   3696 C  CD    . GLN C 1 84  ? -23.323 44.732  -66.194  1.00 106.79 ?  84  GLN C CD    1 
ATOM   3697 O  OE1   . GLN C 1 84  ? -23.530 45.349  -65.142  1.00 97.93  ?  84  GLN C OE1   1 
ATOM   3698 N  NE2   . GLN C 1 84  ? -23.873 45.096  -67.354  1.00 101.41 ?  84  GLN C NE2   1 
ATOM   3699 N  N     . VAL C 1 85  ? -20.544 41.081  -67.636  1.00 70.60  ?  85  VAL C N     1 
ATOM   3700 C  CA    . VAL C 1 85  ? -20.924 40.088  -68.647  1.00 72.22  ?  85  VAL C CA    1 
ATOM   3701 C  C     . VAL C 1 85  ? -22.131 39.274  -68.193  1.00 79.92  ?  85  VAL C C     1 
ATOM   3702 O  O     . VAL C 1 85  ? -22.137 38.718  -67.089  1.00 81.99  ?  85  VAL C O     1 
ATOM   3703 C  CB    . VAL C 1 85  ? -19.735 39.172  -69.079  1.00 76.97  ?  85  VAL C CB    1 
ATOM   3704 C  CG1   . VAL C 1 85  ? -20.209 37.857  -69.697  1.00 79.84  ?  85  VAL C CG1   1 
ATOM   3705 C  CG2   . VAL C 1 85  ? -18.822 39.888  -70.052  1.00 73.62  ?  85  VAL C CG2   1 
ATOM   3706 N  N     . ASN C 1 86  ? -23.145 39.209  -69.063  1.00 77.14  ?  86  ASN C N     1 
ATOM   3707 C  CA    . ASN C 1 86  ? -24.338 38.381  -68.913  1.00 80.75  ?  86  ASN C CA    1 
ATOM   3708 C  C     . ASN C 1 86  ? -24.243 37.471  -70.142  1.00 86.61  ?  86  ASN C C     1 
ATOM   3709 O  O     . ASN C 1 86  ? -24.494 37.945  -71.257  1.00 85.15  ?  86  ASN C O     1 
ATOM   3710 C  CB    . ASN C 1 86  ? -25.622 39.221  -68.918  1.00 80.06  ?  86  ASN C CB    1 
ATOM   3711 C  CG    . ASN C 1 86  ? -26.873 38.473  -68.517  1.00 99.31  ?  86  ASN C CG    1 
ATOM   3712 O  OD1   . ASN C 1 86  ? -26.930 37.235  -68.487  1.00 96.62  ?  86  ASN C OD1   1 
ATOM   3713 N  ND2   . ASN C 1 86  ? -27.924 39.222  -68.234  1.00 89.60  ?  86  ASN C ND2   1 
ATOM   3714 N  N     . PRO C 1 87  ? -23.736 36.222  -69.981  1.00 85.94  ?  87  PRO C N     1 
ATOM   3715 C  CA    . PRO C 1 87  ? -23.499 35.356  -71.149  1.00 87.40  ?  87  PRO C CA    1 
ATOM   3716 C  C     . PRO C 1 87  ? -24.622 35.278  -72.169  1.00 93.18  ?  87  PRO C C     1 
ATOM   3717 O  O     . PRO C 1 87  ? -25.768 34.995  -71.815  1.00 96.05  ?  87  PRO C O     1 
ATOM   3718 C  CB    . PRO C 1 87  ? -23.154 34.005  -70.528  1.00 93.37  ?  87  PRO C CB    1 
ATOM   3719 C  CG    . PRO C 1 87  ? -22.545 34.359  -69.239  1.00 96.94  ?  87  PRO C CG    1 
ATOM   3720 C  CD    . PRO C 1 87  ? -23.315 35.547  -68.738  1.00 89.99  ?  87  PRO C CD    1 
ATOM   3721 N  N     . ASN C 1 88  ? -24.276 35.603  -73.434  1.00 87.48  ?  88  ASN C N     1 
ATOM   3722 C  CA    . ASN C 1 88  ? -25.157 35.615  -74.603  1.00 88.35  ?  88  ASN C CA    1 
ATOM   3723 C  C     . ASN C 1 88  ? -26.340 36.603  -74.465  1.00 91.68  ?  88  ASN C C     1 
ATOM   3724 O  O     . ASN C 1 88  ? -27.349 36.452  -75.159  1.00 94.14  ?  88  ASN C O     1 
ATOM   3725 C  CB    . ASN C 1 88  ? -25.626 34.187  -74.961  1.00 94.89  ?  88  ASN C CB    1 
ATOM   3726 C  CG    . ASN C 1 88  ? -24.545 33.134  -74.886  1.00 119.19 ?  88  ASN C CG    1 
ATOM   3727 O  OD1   . ASN C 1 88  ? -23.558 33.164  -75.626  1.00 111.97 ?  88  ASN C OD1   1 
ATOM   3728 N  ND2   . ASN C 1 88  ? -24.714 32.172  -73.989  1.00 114.25 ?  88  ASN C ND2   1 
ATOM   3729 N  N     . VAL C 1 89  ? -26.207 37.624  -73.584  1.00 85.04  ?  89  VAL C N     1 
ATOM   3730 C  CA    . VAL C 1 89  ? -27.248 38.636  -73.351  1.00 84.21  ?  89  VAL C CA    1 
ATOM   3731 C  C     . VAL C 1 89  ? -26.708 40.064  -73.563  1.00 84.37  ?  89  VAL C C     1 
ATOM   3732 O  O     . VAL C 1 89  ? -26.990 40.673  -74.598  1.00 83.10  ?  89  VAL C O     1 
ATOM   3733 C  CB    . VAL C 1 89  ? -27.974 38.475  -71.981  1.00 90.35  ?  89  VAL C CB    1 
ATOM   3734 C  CG1   . VAL C 1 89  ? -29.103 39.494  -71.826  1.00 90.11  ?  89  VAL C CG1   1 
ATOM   3735 C  CG2   . VAL C 1 89  ? -28.509 37.058  -71.782  1.00 95.15  ?  89  VAL C CG2   1 
ATOM   3736 N  N     . LYS C 1 90  ? -25.953 40.595  -72.572  1.00 78.86  ?  90  LYS C N     1 
ATOM   3737 C  CA    . LYS C 1 90  ? -25.387 41.945  -72.577  1.00 74.91  ?  90  LYS C CA    1 
ATOM   3738 C  C     . LYS C 1 90  ? -24.028 41.950  -71.878  1.00 77.70  ?  90  LYS C C     1 
ATOM   3739 O  O     . LYS C 1 90  ? -23.843 41.255  -70.878  1.00 78.94  ?  90  LYS C O     1 
ATOM   3740 C  CB    . LYS C 1 90  ? -26.357 42.934  -71.892  1.00 77.25  ?  90  LYS C CB    1 
ATOM   3741 C  CG    . LYS C 1 90  ? -25.943 44.406  -71.960  1.00 89.34  ?  90  LYS C CG    1 
ATOM   3742 C  CD    . LYS C 1 90  ? -26.660 45.237  -70.913  1.00 103.94 ?  90  LYS C CD    1 
ATOM   3743 C  CE    . LYS C 1 90  ? -25.986 46.564  -70.662  1.00 120.09 ?  90  LYS C CE    1 
ATOM   3744 N  NZ    . LYS C 1 90  ? -26.648 47.304  -69.550  1.00 134.08 ?  90  LYS C NZ    1 
ATOM   3745 N  N     . ALA C 1 91  ? -23.083 42.747  -72.400  1.00 71.95  ?  91  ALA C N     1 
ATOM   3746 C  CA    . ALA C 1 91  ? -21.740 42.897  -71.841  1.00 70.26  ?  91  ALA C CA    1 
ATOM   3747 C  C     . ALA C 1 91  ? -21.222 44.331  -71.979  1.00 71.90  ?  91  ALA C C     1 
ATOM   3748 O  O     . ALA C 1 91  ? -21.596 45.022  -72.920  1.00 70.57  ?  91  ALA C O     1 
ATOM   3749 C  CB    . ALA C 1 91  ? -20.784 41.924  -72.513  1.00 71.46  ?  91  ALA C CB    1 
ATOM   3750 N  N     . GLN C 1 92  ? -20.365 44.775  -71.038  1.00 68.66  ?  92  GLN C N     1 
ATOM   3751 C  CA    . GLN C 1 92  ? -19.752 46.109  -71.045  1.00 66.58  ?  92  GLN C CA    1 
ATOM   3752 C  C     . GLN C 1 92  ? -18.247 46.073  -70.760  1.00 70.42  ?  92  GLN C C     1 
ATOM   3753 O  O     . GLN C 1 92  ? -17.797 45.415  -69.808  1.00 71.07  ?  92  GLN C O     1 
ATOM   3754 C  CB    . GLN C 1 92  ? -20.453 47.073  -70.061  1.00 68.05  ?  92  GLN C CB    1 
ATOM   3755 C  CG    . GLN C 1 92  ? -19.828 48.483  -70.018  1.00 69.47  ?  92  GLN C CG    1 
ATOM   3756 C  CD    . GLN C 1 92  ? -20.526 49.461  -69.106  1.00 77.06  ?  92  GLN C CD    1 
ATOM   3757 O  OE1   . GLN C 1 92  ? -19.913 50.028  -68.202  1.00 67.72  ?  92  GLN C OE1   1 
ATOM   3758 N  NE2   . GLN C 1 92  ? -21.788 49.777  -69.392  1.00 68.99  ?  92  GLN C NE2   1 
ATOM   3759 N  N     . SER C 1 93  ? -17.485 46.817  -71.582  1.00 65.53  ?  93  SER C N     1 
ATOM   3760 C  CA    . SER C 1 93  ? -16.045 47.001  -71.433  1.00 64.80  ?  93  SER C CA    1 
ATOM   3761 C  C     . SER C 1 93  ? -15.696 48.485  -71.464  1.00 67.22  ?  93  SER C C     1 
ATOM   3762 O  O     . SER C 1 93  ? -16.426 49.288  -72.053  1.00 66.41  ?  93  SER C O     1 
ATOM   3763 C  CB    . SER C 1 93  ? -15.250 46.211  -72.473  1.00 68.78  ?  93  SER C CB    1 
ATOM   3764 O  OG    . SER C 1 93  ? -15.171 46.822  -73.751  1.00 75.15  ?  93  SER C OG    1 
ATOM   3765 N  N     . ILE C 1 94  ? -14.615 48.854  -70.774  1.00 63.19  ?  94  ILE C N     1 
ATOM   3766 C  CA    . ILE C 1 94  ? -14.148 50.234  -70.726  1.00 61.76  ?  94  ILE C CA    1 
ATOM   3767 C  C     . ILE C 1 94  ? -12.762 50.320  -71.358  1.00 65.78  ?  94  ILE C C     1 
ATOM   3768 O  O     . ILE C 1 94  ? -12.004 49.352  -71.310  1.00 66.30  ?  94  ILE C O     1 
ATOM   3769 C  CB    . ILE C 1 94  ? -14.235 50.880  -69.308  1.00 65.17  ?  94  ILE C CB    1 
ATOM   3770 C  CG1   . ILE C 1 94  ? -13.179 50.329  -68.338  1.00 66.43  ?  94  ILE C CG1   1 
ATOM   3771 C  CG2   . ILE C 1 94  ? -15.643 50.779  -68.736  1.00 66.54  ?  94  ILE C CG2   1 
ATOM   3772 C  CD1   . ILE C 1 94  ? -12.853 51.223  -67.126  1.00 76.66  ?  94  ILE C CD1   1 
ATOM   3773 N  N     . LEU C 1 95  ? -12.441 51.454  -71.973  1.00 61.64  ?  95  LEU C N     1 
ATOM   3774 C  CA    . LEU C 1 95  ? -11.139 51.662  -72.595  1.00 61.62  ?  95  LEU C CA    1 
ATOM   3775 C  C     . LEU C 1 95  ? -10.674 53.088  -72.418  1.00 66.61  ?  95  LEU C C     1 
ATOM   3776 O  O     . LEU C 1 95  ? -11.286 54.013  -72.957  1.00 66.37  ?  95  LEU C O     1 
ATOM   3777 C  CB    . LEU C 1 95  ? -11.151 51.259  -74.082  1.00 61.00  ?  95  LEU C CB    1 
ATOM   3778 C  CG    . LEU C 1 95  ? -9.848  51.444  -74.877  1.00 65.56  ?  95  LEU C CG    1 
ATOM   3779 C  CD1   . LEU C 1 95  ? -8.820  50.401  -74.503  1.00 66.51  ?  95  LEU C CD1   1 
ATOM   3780 C  CD2   . LEU C 1 95  ? -10.108 51.338  -76.352  1.00 67.60  ?  95  LEU C CD2   1 
ATOM   3781 N  N     . ASP C 1 96  ? -9.593  53.268  -71.652  1.00 64.51  ?  96  ASP C N     1 
ATOM   3782 C  CA    . ASP C 1 96  ? -9.040  54.595  -71.450  1.00 65.51  ?  96  ASP C CA    1 
ATOM   3783 C  C     . ASP C 1 96  ? -8.149  54.923  -72.636  1.00 69.76  ?  96  ASP C C     1 
ATOM   3784 O  O     . ASP C 1 96  ? -7.255  54.140  -72.984  1.00 70.48  ?  96  ASP C O     1 
ATOM   3785 C  CB    . ASP C 1 96  ? -8.285  54.701  -70.122  1.00 69.37  ?  96  ASP C CB    1 
ATOM   3786 C  CG    . ASP C 1 96  ? -7.823  56.111  -69.823  1.00 86.89  ?  96  ASP C CG    1 
ATOM   3787 O  OD1   . ASP C 1 96  ? -8.694  57.000  -69.645  1.00 94.97  -1 96  ASP C OD1   1 
ATOM   3788 O  OD2   . ASP C 1 96  ? -6.595  56.341  -69.821  1.00 90.18  ?  96  ASP C OD2   1 
ATOM   3789 N  N     . ILE C 1 97  ? -8.429  56.061  -73.286  1.00 65.62  ?  97  ILE C N     1 
ATOM   3790 C  CA    . ILE C 1 97  ? -7.683  56.503  -74.460  1.00 65.41  ?  97  ILE C CA    1 
ATOM   3791 C  C     . ILE C 1 97  ? -6.388  57.210  -74.055  1.00 71.53  ?  97  ILE C C     1 
ATOM   3792 O  O     . ILE C 1 97  ? -6.405  58.352  -73.588  1.00 71.66  ?  97  ILE C O     1 
ATOM   3793 C  CB    . ILE C 1 97  ? -8.570  57.296  -75.469  1.00 67.66  ?  97  ILE C CB    1 
ATOM   3794 C  CG1   . ILE C 1 97  ? -9.866  56.521  -75.853  1.00 65.95  ?  97  ILE C CG1   1 
ATOM   3795 C  CG2   . ILE C 1 97  ? -7.781  57.741  -76.699  1.00 68.98  ?  97  ILE C CG2   1 
ATOM   3796 C  CD1   . ILE C 1 97  ? -9.715  55.165  -76.612  1.00 71.00  ?  97  ILE C CD1   1 
ATOM   3797 N  N     . THR C 1 98  ? -5.267  56.484  -74.208  1.00 69.84  ?  98  THR C N     1 
ATOM   3798 C  CA    . THR C 1 98  ? -3.915  56.952  -73.901  1.00 72.23  ?  98  THR C CA    1 
ATOM   3799 C  C     . THR C 1 98  ? -3.269  57.559  -75.149  1.00 77.28  ?  98  THR C C     1 
ATOM   3800 O  O     . THR C 1 98  ? -3.825  57.445  -76.241  1.00 75.19  ?  98  THR C O     1 
ATOM   3801 C  CB    . THR C 1 98  ? -3.064  55.804  -73.333  1.00 83.86  ?  98  THR C CB    1 
ATOM   3802 O  OG1   . THR C 1 98  ? -2.985  54.745  -74.289  1.00 83.90  ?  98  THR C OG1   1 
ATOM   3803 C  CG2   . THR C 1 98  ? -3.573  55.295  -71.986  1.00 83.74  ?  98  THR C CG2   1 
ATOM   3804 N  N     . SER C 1 99  ? -2.090  58.194  -74.985  1.00 77.68  ?  99  SER C N     1 
ATOM   3805 C  CA    . SER C 1 99  ? -1.308  58.822  -76.060  1.00 79.89  ?  99  SER C CA    1 
ATOM   3806 C  C     . SER C 1 99  ? -0.945  57.845  -77.183  1.00 84.86  ?  99  SER C C     1 
ATOM   3807 O  O     . SER C 1 99  ? -0.749  58.261  -78.329  1.00 85.79  ?  99  SER C O     1 
ATOM   3808 C  CB    . SER C 1 99  ? -0.052  59.485  -75.497  1.00 86.90  ?  99  SER C CB    1 
ATOM   3809 O  OG    . SER C 1 99  ? 0.664   58.629  -74.622  1.00 97.90  ?  99  SER C OG    1 
ATOM   3810 N  N     . ASP C 1 100 ? -0.892  56.549  -76.856  1.00 81.38  ?  100 ASP C N     1 
ATOM   3811 C  CA    . ASP C 1 100 ? -0.553  55.466  -77.773  1.00 81.93  ?  100 ASP C CA    1 
ATOM   3812 C  C     . ASP C 1 100 ? -1.701  55.101  -78.705  1.00 83.68  ?  100 ASP C C     1 
ATOM   3813 O  O     . ASP C 1 100 ? -1.461  54.463  -79.728  1.00 84.02  ?  100 ASP C O     1 
ATOM   3814 C  CB    . ASP C 1 100 ? -0.099  54.231  -76.978  1.00 85.19  ?  100 ASP C CB    1 
ATOM   3815 C  CG    . ASP C 1 100 ? 0.914   54.522  -75.875  1.00 104.14 ?  100 ASP C CG    1 
ATOM   3816 O  OD1   . ASP C 1 100 ? 1.982   55.115  -76.182  1.00 107.31 ?  100 ASP C OD1   1 
ATOM   3817 O  OD2   . ASP C 1 100 ? 0.636   54.165  -74.704  1.00 111.80 -1 100 ASP C OD2   1 
ATOM   3818 N  N     . SER C 1 101 ? -2.942  55.498  -78.352  1.00 77.94  ?  101 SER C N     1 
ATOM   3819 C  CA    . SER C 1 101 ? -4.167  55.209  -79.115  1.00 75.26  ?  101 SER C CA    1 
ATOM   3820 C  C     . SER C 1 101 ? -4.590  56.347  -80.057  1.00 78.95  ?  101 SER C C     1 
ATOM   3821 O  O     . SER C 1 101 ? -5.354  56.104  -80.990  1.00 77.97  ?  101 SER C O     1 
ATOM   3822 C  CB    . SER C 1 101 ? -5.309  54.860  -78.164  1.00 76.37  ?  101 SER C CB    1 
ATOM   3823 O  OG    . SER C 1 101 ? -4.908  53.947  -77.154  1.00 82.62  ?  101 SER C OG    1 
ATOM   3824 N  N     . VAL C 1 102 ? -4.088  57.577  -79.821  1.00 77.00  ?  102 VAL C N     1 
ATOM   3825 C  CA    . VAL C 1 102 ? -4.411  58.778  -80.607  1.00 77.88  ?  102 VAL C CA    1 
ATOM   3826 C  C     . VAL C 1 102 ? -3.377  59.127  -81.679  1.00 85.25  ?  102 VAL C C     1 
ATOM   3827 O  O     . VAL C 1 102 ? -2.197  58.792  -81.531  1.00 86.30  ?  102 VAL C O     1 
ATOM   3828 C  CB    . VAL C 1 102 ? -4.690  60.018  -79.709  1.00 82.45  ?  102 VAL C CB    1 
ATOM   3829 C  CG1   . VAL C 1 102 ? -5.953  59.841  -78.881  1.00 80.44  ?  102 VAL C CG1   1 
ATOM   3830 C  CG2   . VAL C 1 102 ? -3.498  60.364  -78.819  1.00 84.03  ?  102 VAL C CG2   1 
ATOM   3831 N  N     . PHE C 1 103 ? -3.816  59.860  -82.731  1.00 83.44  ?  103 PHE C N     1 
ATOM   3832 C  CA    . PHE C 1 103 ? -2.946  60.390  -83.787  1.00 86.11  ?  103 PHE C CA    1 
ATOM   3833 C  C     . PHE C 1 103 ? -2.215  61.576  -83.148  1.00 93.24  ?  103 PHE C C     1 
ATOM   3834 O  O     . PHE C 1 103 ? -2.871  62.501  -82.673  1.00 93.20  ?  103 PHE C O     1 
ATOM   3835 C  CB    . PHE C 1 103 ? -3.768  60.888  -84.996  1.00 88.45  ?  103 PHE C CB    1 
ATOM   3836 C  CG    . PHE C 1 103 ? -4.388  59.838  -85.890  1.00 88.57  ?  103 PHE C CG    1 
ATOM   3837 C  CD1   . PHE C 1 103 ? -3.591  58.986  -86.647  1.00 92.75  ?  103 PHE C CD1   1 
ATOM   3838 C  CD2   . PHE C 1 103 ? -5.762  59.765  -86.052  1.00 89.35  ?  103 PHE C CD2   1 
ATOM   3839 C  CE1   . PHE C 1 103 ? -4.164  58.040  -87.503  1.00 92.85  ?  103 PHE C CE1   1 
ATOM   3840 C  CE2   . PHE C 1 103 ? -6.335  58.818  -86.905  1.00 91.64  ?  103 PHE C CE2   1 
ATOM   3841 C  CZ    . PHE C 1 103 ? -5.531  57.963  -87.626  1.00 90.45  ?  103 PHE C CZ    1 
ATOM   3842 N  N     . HIS C 1 104 ? -0.875  61.541  -83.103  1.00 92.63  ?  104 HIS C N     1 
ATOM   3843 C  CA    . HIS C 1 104 ? -0.040  62.563  -82.451  1.00 95.88  ?  104 HIS C CA    1 
ATOM   3844 C  C     . HIS C 1 104 ? -0.363  64.005  -82.806  1.00 101.18 ?  104 HIS C C     1 
ATOM   3845 O  O     . HIS C 1 104 ? -0.420  64.856  -81.917  1.00 101.69 ?  104 HIS C O     1 
ATOM   3846 C  CB    . HIS C 1 104 ? 1.452   62.270  -82.646  1.00 99.87  ?  104 HIS C CB    1 
ATOM   3847 C  CG    . HIS C 1 104 ? 1.779   60.821  -82.503  1.00 102.29 ?  104 HIS C CG    1 
ATOM   3848 N  ND1   . HIS C 1 104 ? 1.670   60.171  -81.280  1.00 102.82 ?  104 HIS C ND1   1 
ATOM   3849 C  CD2   . HIS C 1 104 ? 2.133   59.921  -83.448  1.00 104.58 ?  104 HIS C CD2   1 
ATOM   3850 C  CE1   . HIS C 1 104 ? 1.982   58.909  -81.519  1.00 101.66 ?  104 HIS C CE1   1 
ATOM   3851 N  NE2   . HIS C 1 104 ? 2.274   58.712  -82.808  1.00 103.00 ?  104 HIS C NE2   1 
ATOM   3852 N  N     . LYS C 1 105 ? -0.593  64.267  -84.097  1.00 98.61  ?  105 LYS C N     1 
ATOM   3853 C  CA    . LYS C 1 105 ? -0.897  65.589  -84.629  1.00 101.11 ?  105 LYS C CA    1 
ATOM   3854 C  C     . LYS C 1 105 ? -2.251  66.134  -84.143  1.00 102.75 ?  105 LYS C C     1 
ATOM   3855 O  O     . LYS C 1 105 ? -2.314  67.268  -83.667  1.00 104.61 ?  105 LYS C O     1 
ATOM   3856 C  CB    . LYS C 1 105 ? -0.795  65.545  -86.171  1.00 105.19 ?  105 LYS C CB    1 
ATOM   3857 C  CG    . LYS C 1 105 ? -1.487  66.675  -86.936  1.00 125.50 ?  105 LYS C CG    1 
ATOM   3858 C  CD    . LYS C 1 105 ? -1.113  66.685  -88.430  1.00 137.80 ?  105 LYS C CD    1 
ATOM   3859 C  CE    . LYS C 1 105 ? -1.840  65.669  -89.293  1.00 144.52 ?  105 LYS C CE    1 
ATOM   3860 N  NZ    . LYS C 1 105 ? -3.308  65.927  -89.362  1.00 149.79 ?  105 LYS C NZ    1 
ATOM   3861 N  N     . THR C 1 106 ? -3.318  65.329  -84.280  1.00 95.59  ?  106 THR C N     1 
ATOM   3862 C  CA    . THR C 1 106 ? -4.698  65.713  -83.969  1.00 94.32  ?  106 THR C CA    1 
ATOM   3863 C  C     . THR C 1 106 ? -5.161  65.459  -82.537  1.00 95.34  ?  106 THR C C     1 
ATOM   3864 O  O     . THR C 1 106 ? -5.955  66.241  -82.012  1.00 96.06  ?  106 THR C O     1 
ATOM   3865 C  CB    . THR C 1 106 ? -5.671  65.096  -84.986  1.00 103.42 ?  106 THR C CB    1 
ATOM   3866 O  OG1   . THR C 1 106 ? -5.608  63.669  -84.917  1.00 100.96 ?  106 THR C OG1   1 
ATOM   3867 C  CG2   . THR C 1 106 ? -5.427  65.580  -86.415  1.00 106.68 ?  106 THR C CG2   1 
ATOM   3868 N  N     . GLY C 1 107 ? -4.698  64.362  -81.940  1.00 88.50  ?  107 GLY C N     1 
ATOM   3869 C  CA    . GLY C 1 107 ? -5.081  63.956  -80.593  1.00 85.87  ?  107 GLY C CA    1 
ATOM   3870 C  C     . GLY C 1 107 ? -6.374  63.162  -80.571  1.00 86.03  ?  107 GLY C C     1 
ATOM   3871 O  O     . GLY C 1 107 ? -6.984  63.004  -79.513  1.00 84.24  ?  107 GLY C O     1 
ATOM   3872 N  N     . ILE C 1 108 ? -6.800  62.658  -81.746  1.00 81.42  ?  108 ILE C N     1 
ATOM   3873 C  CA    . ILE C 1 108 ? -8.013  61.858  -81.943  1.00 78.61  ?  108 ILE C CA    1 
ATOM   3874 C  C     . ILE C 1 108 ? -7.624  60.383  -82.060  1.00 79.56  ?  108 ILE C C     1 
ATOM   3875 O  O     . ILE C 1 108 ? -6.659  60.060  -82.751  1.00 79.95  ?  108 ILE C O     1 
ATOM   3876 C  CB    . ILE C 1 108 ? -8.794  62.338  -83.198  1.00 83.04  ?  108 ILE C CB    1 
ATOM   3877 C  CG1   . ILE C 1 108 ? -9.029  63.861  -83.166  1.00 86.66  ?  108 ILE C CG1   1 
ATOM   3878 C  CG2   . ILE C 1 108 ? -10.120 61.570  -83.365  1.00 82.14  ?  108 ILE C CG2   1 
ATOM   3879 C  CD1   . ILE C 1 108 ? -9.221  64.499  -84.523  1.00 99.45  ?  108 ILE C CD1   1 
ATOM   3880 N  N     . ALA C 1 109 ? -8.385  59.494  -81.398  1.00 73.30  ?  109 ALA C N     1 
ATOM   3881 C  CA    . ALA C 1 109 ? -8.177  58.045  -81.403  1.00 71.13  ?  109 ALA C CA    1 
ATOM   3882 C  C     . ALA C 1 109 ? -8.264  57.472  -82.804  1.00 76.21  ?  109 ALA C C     1 
ATOM   3883 O  O     . ALA C 1 109 ? -9.099  57.906  -83.599  1.00 76.87  ?  109 ALA C O     1 
ATOM   3884 C  CB    . ALA C 1 109 ? -9.201  57.366  -80.510  1.00 69.97  ?  109 ALA C CB    1 
ATOM   3885 N  N     . ARG C 1 110 ? -7.391  56.508  -83.108  1.00 73.39  ?  110 ARG C N     1 
ATOM   3886 C  CA    . ARG C 1 110 ? -7.353  55.835  -84.404  1.00 74.33  ?  110 ARG C CA    1 
ATOM   3887 C  C     . ARG C 1 110 ? -8.562  54.912  -84.568  1.00 79.43  ?  110 ARG C C     1 
ATOM   3888 O  O     . ARG C 1 110 ? -9.060  54.366  -83.581  1.00 78.48  ?  110 ARG C O     1 
ATOM   3889 C  CB    . ARG C 1 110 ? -6.033  55.078  -84.580  1.00 75.29  ?  110 ARG C CB    1 
ATOM   3890 C  CG    . ARG C 1 110 ? -4.821  56.008  -84.559  1.00 87.79  ?  110 ARG C CG    1 
ATOM   3891 C  CD    . ARG C 1 110 ? -3.522  55.331  -84.950  1.00 101.97 ?  110 ARG C CD    1 
ATOM   3892 N  NE    . ARG C 1 110 ? -2.677  55.012  -83.794  1.00 114.14 ?  110 ARG C NE    1 
ATOM   3893 C  CZ    . ARG C 1 110 ? -1.832  55.864  -83.216  1.00 130.19 ?  110 ARG C CZ    1 
ATOM   3894 N  NH1   . ARG C 1 110 ? -1.704  57.102  -83.680  1.00 114.02 ?  110 ARG C NH1   1 
ATOM   3895 N  NH2   . ARG C 1 110 ? -1.106  55.484  -82.174  1.00 121.47 ?  110 ARG C NH2   1 
ATOM   3896 N  N     . GLY C 1 111 ? -9.046  54.793  -85.802  1.00 78.12  ?  111 GLY C N     1 
ATOM   3897 C  CA    . GLY C 1 111 ? -10.224 53.998  -86.150  1.00 78.15  ?  111 GLY C CA    1 
ATOM   3898 C  C     . GLY C 1 111 ? -10.252 52.590  -85.589  1.00 82.13  ?  111 GLY C C     1 
ATOM   3899 O  O     . GLY C 1 111 ? -11.249 52.180  -84.975  1.00 82.25  ?  111 GLY C O     1 
ATOM   3900 N  N     . HIS C 1 112 ? -9.133  51.861  -85.763  1.00 77.90  ?  112 HIS C N     1 
ATOM   3901 C  CA    . HIS C 1 112 ? -8.978  50.480  -85.314  1.00 77.29  ?  112 HIS C CA    1 
ATOM   3902 C  C     . HIS C 1 112 ? -9.018  50.294  -83.814  1.00 78.55  ?  112 HIS C C     1 
ATOM   3903 O  O     . HIS C 1 112 ? -9.325  49.188  -83.370  1.00 78.50  ?  112 HIS C O     1 
ATOM   3904 C  CB    . HIS C 1 112 ? -7.720  49.835  -85.906  1.00 79.91  ?  112 HIS C CB    1 
ATOM   3905 C  CG    . HIS C 1 112 ? -6.452  50.578  -85.620  1.00 83.95  ?  112 HIS C CG    1 
ATOM   3906 N  ND1   . HIS C 1 112 ? -5.944  51.497  -86.519  1.00 87.05  ?  112 HIS C ND1   1 
ATOM   3907 C  CD2   . HIS C 1 112 ? -5.623  50.503  -84.551  1.00 85.38  ?  112 HIS C CD2   1 
ATOM   3908 C  CE1   . HIS C 1 112 ? -4.830  51.956  -85.968  1.00 86.98  ?  112 HIS C CE1   1 
ATOM   3909 N  NE2   . HIS C 1 112 ? -4.600  51.391  -84.778  1.00 86.39  ?  112 HIS C NE2   1 
ATOM   3910 N  N     . VAL C 1 113 ? -8.727  51.362  -83.038  1.00 73.48  ?  113 VAL C N     1 
ATOM   3911 C  CA    . VAL C 1 113 ? -8.721  51.337  -81.571  1.00 72.61  ?  113 VAL C CA    1 
ATOM   3912 C  C     . VAL C 1 113 ? -10.123 50.987  -81.046  1.00 76.62  ?  113 VAL C C     1 
ATOM   3913 O  O     . VAL C 1 113 ? -10.282 50.044  -80.256  1.00 76.88  ?  113 VAL C O     1 
ATOM   3914 C  CB    . VAL C 1 113 ? -8.157  52.656  -80.960  1.00 76.21  ?  113 VAL C CB    1 
ATOM   3915 C  CG1   . VAL C 1 113 ? -8.163  52.619  -79.440  1.00 75.39  ?  113 VAL C CG1   1 
ATOM   3916 C  CG2   . VAL C 1 113 ? -6.755  52.958  -81.473  1.00 77.52  ?  113 VAL C CG2   1 
ATOM   3917 N  N     . LEU C 1 114 ? -11.130 51.730  -81.517  1.00 72.66  ?  114 LEU C N     1 
ATOM   3918 C  CA    . LEU C 1 114 ? -12.519 51.549  -81.099  1.00 72.09  ?  114 LEU C CA    1 
ATOM   3919 C  C     . LEU C 1 114 ? -13.145 50.269  -81.605  1.00 74.70  ?  114 LEU C C     1 
ATOM   3920 O  O     . LEU C 1 114 ? -13.973 49.686  -80.899  1.00 74.49  ?  114 LEU C O     1 
ATOM   3921 C  CB    . LEU C 1 114 ? -13.363 52.766  -81.464  1.00 72.66  ?  114 LEU C CB    1 
ATOM   3922 C  CG    . LEU C 1 114 ? -13.077 53.984  -80.612  1.00 77.61  ?  114 LEU C CG    1 
ATOM   3923 C  CD1   . LEU C 1 114 ? -12.686 55.177  -81.475  1.00 79.68  ?  114 LEU C CD1   1 
ATOM   3924 C  CD2   . LEU C 1 114 ? -14.228 54.273  -79.693  1.00 78.26  ?  114 LEU C CD2   1 
ATOM   3925 N  N     . PHE C 1 115 ? -12.744 49.821  -82.812  1.00 70.42  ?  115 PHE C N     1 
ATOM   3926 C  CA    . PHE C 1 115 ? -13.233 48.565  -83.374  1.00 70.57  ?  115 PHE C CA    1 
ATOM   3927 C  C     . PHE C 1 115 ? -12.692 47.378  -82.563  1.00 74.08  ?  115 PHE C C     1 
ATOM   3928 O  O     . PHE C 1 115 ? -13.427 46.414  -82.327  1.00 74.73  ?  115 PHE C O     1 
ATOM   3929 C  CB    . PHE C 1 115 ? -12.866 48.417  -84.861  1.00 73.40  ?  115 PHE C CB    1 
ATOM   3930 C  CG    . PHE C 1 115 ? -13.338 47.095  -85.439  1.00 76.48  ?  115 PHE C CG    1 
ATOM   3931 C  CD1   . PHE C 1 115 ? -14.654 46.928  -85.864  1.00 80.26  ?  115 PHE C CD1   1 
ATOM   3932 C  CD2   . PHE C 1 115 ? -12.485 45.998  -85.500  1.00 80.04  ?  115 PHE C CD2   1 
ATOM   3933 C  CE1   . PHE C 1 115 ? -15.095 45.700  -86.371  1.00 83.11  ?  115 PHE C CE1   1 
ATOM   3934 C  CE2   . PHE C 1 115 ? -12.932 44.769  -85.997  1.00 84.80  ?  115 PHE C CE2   1 
ATOM   3935 C  CZ    . PHE C 1 115 ? -14.234 44.627  -86.424  1.00 83.51  ?  115 PHE C CZ    1 
ATOM   3936 N  N     . ALA C 1 116 ? -11.409 47.456  -82.148  1.00 69.76  ?  116 ALA C N     1 
ATOM   3937 C  CA    . ALA C 1 116 ? -10.722 46.434  -81.357  1.00 70.19  ?  116 ALA C CA    1 
ATOM   3938 C  C     . ALA C 1 116 ? -11.423 46.164  -80.032  1.00 72.78  ?  116 ALA C C     1 
ATOM   3939 O  O     . ALA C 1 116 ? -11.570 45.004  -79.646  1.00 73.72  ?  116 ALA C O     1 
ATOM   3940 C  CB    . ALA C 1 116 ? -9.276  46.834  -81.116  1.00 71.17  ?  116 ALA C CB    1 
ATOM   3941 N  N     . GLN C 1 117 ? -11.876 47.230  -79.354  1.00 66.99  ?  117 GLN C N     1 
ATOM   3942 C  CA    . GLN C 1 117 ? -12.607 47.129  -78.093  1.00 66.25  ?  117 GLN C CA    1 
ATOM   3943 C  C     . GLN C 1 117 ? -13.972 46.468  -78.334  1.00 72.38  ?  117 GLN C C     1 
ATOM   3944 O  O     . GLN C 1 117 ? -14.379 45.593  -77.562  1.00 74.00  ?  117 GLN C O     1 
ATOM   3945 C  CB    . GLN C 1 117 ? -12.780 48.522  -77.470  1.00 65.74  ?  117 GLN C CB    1 
ATOM   3946 C  CG    . GLN C 1 117 ? -13.469 48.508  -76.111  1.00 67.32  ?  117 GLN C CG    1 
ATOM   3947 C  CD    . GLN C 1 117 ? -14.035 49.845  -75.700  1.00 76.83  ?  117 GLN C CD    1 
ATOM   3948 O  OE1   . GLN C 1 117 ? -14.154 50.779  -76.493  1.00 70.94  ?  117 GLN C OE1   1 
ATOM   3949 N  NE2   . GLN C 1 117 ? -14.422 49.954  -74.439  1.00 68.93  ?  117 GLN C NE2   1 
ATOM   3950 N  N     . ALA C 1 118 ? -14.656 46.882  -79.414  1.00 68.71  ?  118 ALA C N     1 
ATOM   3951 C  CA    . ALA C 1 118 ? -15.971 46.398  -79.813  1.00 69.76  ?  118 ALA C CA    1 
ATOM   3952 C  C     . ALA C 1 118 ? -15.951 44.906  -80.164  1.00 75.66  ?  118 ALA C C     1 
ATOM   3953 O  O     . ALA C 1 118 ? -16.772 44.140  -79.647  1.00 76.67  ?  118 ALA C O     1 
ATOM   3954 C  CB    . ALA C 1 118 ? -16.488 47.218  -80.987  1.00 70.45  ?  118 ALA C CB    1 
ATOM   3955 N  N     . ASN C 1 119 ? -15.004 44.498  -81.020  1.00 72.38  ?  119 ASN C N     1 
ATOM   3956 C  CA    . ASN C 1 119 ? -14.841 43.110  -81.439  1.00 74.37  ?  119 ASN C CA    1 
ATOM   3957 C  C     . ASN C 1 119 ? -14.523 42.220  -80.231  1.00 79.24  ?  119 ASN C C     1 
ATOM   3958 O  O     . ASN C 1 119 ? -15.178 41.188  -80.058  1.00 81.86  ?  119 ASN C O     1 
ATOM   3959 C  CB    . ASN C 1 119 ? -13.757 42.997  -82.509  1.00 75.17  ?  119 ASN C CB    1 
ATOM   3960 C  CG    . ASN C 1 119 ? -13.739 41.661  -83.202  1.00 99.40  ?  119 ASN C CG    1 
ATOM   3961 O  OD1   . ASN C 1 119 ? -14.615 41.341  -84.010  1.00 93.50  ?  119 ASN C OD1   1 
ATOM   3962 N  ND2   . ASN C 1 119 ? -12.741 40.848  -82.897  1.00 95.22  ?  119 ASN C ND2   1 
ATOM   3963 N  N     . SER C 1 120 ? -13.566 42.654  -79.368  1.00 73.04  ?  120 SER C N     1 
ATOM   3964 C  CA    . SER C 1 120 ? -13.160 41.937  -78.152  1.00 73.28  ?  120 SER C CA    1 
ATOM   3965 C  C     . SER C 1 120 ? -14.350 41.668  -77.252  1.00 76.53  ?  120 SER C C     1 
ATOM   3966 O  O     . SER C 1 120 ? -14.490 40.553  -76.744  1.00 78.73  ?  120 SER C O     1 
ATOM   3967 C  CB    . SER C 1 120 ? -12.101 42.718  -77.378  1.00 75.14  ?  120 SER C CB    1 
ATOM   3968 O  OG    . SER C 1 120 ? -10.798 42.464  -77.870  1.00 86.47  ?  120 SER C OG    1 
ATOM   3969 N  N     . LEU C 1 121 ? -15.220 42.685  -77.084  1.00 70.40  ?  121 LEU C N     1 
ATOM   3970 C  CA    . LEU C 1 121 ? -16.422 42.634  -76.256  1.00 70.49  ?  121 LEU C CA    1 
ATOM   3971 C  C     . LEU C 1 121 ? -17.406 41.581  -76.748  1.00 77.32  ?  121 LEU C C     1 
ATOM   3972 O  O     . LEU C 1 121 ? -18.014 40.895  -75.923  1.00 79.31  ?  121 LEU C O     1 
ATOM   3973 C  CB    . LEU C 1 121 ? -17.078 44.026  -76.197  1.00 68.24  ?  121 LEU C CB    1 
ATOM   3974 C  CG    . LEU C 1 121 ? -18.235 44.259  -75.209  1.00 72.52  ?  121 LEU C CG    1 
ATOM   3975 C  CD1   . LEU C 1 121 ? -17.853 43.912  -73.780  1.00 72.91  ?  121 LEU C CD1   1 
ATOM   3976 C  CD2   . LEU C 1 121 ? -18.683 45.695  -75.261  1.00 72.40  ?  121 LEU C CD2   1 
ATOM   3977 N  N     . CYS C 1 122 ? -17.533 41.430  -78.081  1.00 74.04  ?  122 CYS C N     1 
ATOM   3978 C  CA    . CYS C 1 122 ? -18.425 40.457  -78.707  1.00 76.87  ?  122 CYS C CA    1 
ATOM   3979 C  C     . CYS C 1 122 ? -18.000 39.026  -78.444  1.00 82.65  ?  122 CYS C C     1 
ATOM   3980 O  O     . CYS C 1 122 ? -18.844 38.201  -78.100  1.00 85.13  ?  122 CYS C O     1 
ATOM   3981 C  CB    . CYS C 1 122 ? -18.567 40.738  -80.195  1.00 78.04  ?  122 CYS C CB    1 
ATOM   3982 S  SG    . CYS C 1 122 ? -19.369 42.317  -80.569  1.00 80.27  ?  122 CYS C SG    1 
ATOM   3983 N  N     . VAL C 1 123 ? -16.689 38.742  -78.560  1.00 78.56  ?  123 VAL C N     1 
ATOM   3984 C  CA    . VAL C 1 123 ? -16.104 37.417  -78.308  1.00 81.34  ?  123 VAL C CA    1 
ATOM   3985 C  C     . VAL C 1 123 ? -16.323 37.030  -76.827  1.00 86.22  ?  123 VAL C C     1 
ATOM   3986 O  O     . VAL C 1 123 ? -16.622 35.867  -76.523  1.00 89.49  ?  123 VAL C O     1 
ATOM   3987 C  CB    . VAL C 1 123 ? -14.602 37.368  -78.713  1.00 85.05  ?  123 VAL C CB    1 
ATOM   3988 C  CG1   . VAL C 1 123 ? -14.058 35.945  -78.649  1.00 89.25  ?  123 VAL C CG1   1 
ATOM   3989 C  CG2   . VAL C 1 123 ? -14.381 37.944  -80.106  1.00 83.44  ?  123 VAL C CG2   1 
ATOM   3990 N  N     . ALA C 1 124 ? -16.206 38.027  -75.922  1.00 79.90  ?  124 ALA C N     1 
ATOM   3991 C  CA    . ALA C 1 124 ? -16.406 37.870  -74.484  1.00 80.60  ?  124 ALA C CA    1 
ATOM   3992 C  C     . ALA C 1 124 ? -17.880 37.627  -74.161  1.00 86.52  ?  124 ALA C C     1 
ATOM   3993 O  O     . ALA C 1 124 ? -18.188 36.818  -73.282  1.00 89.72  ?  124 ALA C O     1 
ATOM   3994 C  CB    . ALA C 1 124 ? -15.903 39.103  -73.747  1.00 78.14  ?  124 ALA C CB    1 
ATOM   3995 N  N     . LEU C 1 125 ? -18.783 38.319  -74.881  1.00 80.83  ?  125 LEU C N     1 
ATOM   3996 C  CA    . LEU C 1 125 ? -20.229 38.225  -74.696  1.00 81.76  ?  125 LEU C CA    1 
ATOM   3997 C  C     . LEU C 1 125 ? -20.784 36.839  -75.029  1.00 90.48  ?  125 LEU C C     1 
ATOM   3998 O  O     . LEU C 1 125 ? -21.594 36.310  -74.262  1.00 92.38  ?  125 LEU C O     1 
ATOM   3999 C  CB    . LEU C 1 125 ? -20.936 39.335  -75.500  1.00 79.31  ?  125 LEU C CB    1 
ATOM   4000 C  CG    . LEU C 1 125 ? -22.468 39.345  -75.580  1.00 85.35  ?  125 LEU C CG    1 
ATOM   4001 C  CD1   . LEU C 1 125 ? -23.123 39.387  -74.205  1.00 86.08  ?  125 LEU C CD1   1 
ATOM   4002 C  CD2   . LEU C 1 125 ? -22.932 40.515  -76.383  1.00 86.40  ?  125 LEU C CD2   1 
ATOM   4003 N  N     . ILE C 1 126 ? -20.350 36.256  -76.156  1.00 89.04  ?  126 ILE C N     1 
ATOM   4004 C  CA    . ILE C 1 126 ? -20.825 34.943  -76.588  1.00 93.77  ?  126 ILE C CA    1 
ATOM   4005 C  C     . ILE C 1 126 ? -20.090 33.799  -75.874  1.00 102.91 ?  126 ILE C C     1 
ATOM   4006 O  O     . ILE C 1 126 ? -18.888 33.595  -76.079  1.00 102.63 ?  126 ILE C O     1 
ATOM   4007 C  CB    . ILE C 1 126 ? -20.906 34.815  -78.137  1.00 97.04  ?  126 ILE C CB    1 
ATOM   4008 C  CG1   . ILE C 1 126 ? -21.935 35.800  -78.700  1.00 95.30  ?  126 ILE C CG1   1 
ATOM   4009 C  CG2   . ILE C 1 126 ? -21.274 33.402  -78.571  1.00 102.70 ?  126 ILE C CG2   1 
ATOM   4010 C  CD1   . ILE C 1 126 ? -21.384 36.751  -79.621  1.00 99.34  ?  126 ILE C CD1   1 
ATOM   4011 N  N     . LYS C 1 127 ? -20.831 33.082  -75.008  1.00 103.49 ?  127 LYS C N     1 
ATOM   4012 C  CA    . LYS C 1 127 ? -20.343 31.948  -74.232  1.00 107.48 ?  127 LYS C CA    1 
ATOM   4013 C  C     . LYS C 1 127 ? -20.575 30.665  -75.040  1.00 117.33 ?  127 LYS C C     1 
ATOM   4014 O  O     . LYS C 1 127 ? -21.565 29.952  -74.838  1.00 121.06 ?  127 LYS C O     1 
ATOM   4015 C  CB    . LYS C 1 127 ? -21.031 31.904  -72.851  1.00 111.33 ?  127 LYS C CB    1 
ATOM   4016 C  CG    . LYS C 1 127 ? -20.402 30.923  -71.864  1.00 127.85 ?  127 LYS C CG    1 
ATOM   4017 C  CD    . LYS C 1 127 ? -21.206 30.809  -70.582  1.00 136.40 ?  127 LYS C CD    1 
ATOM   4018 C  CE    . LYS C 1 127 ? -20.575 29.807  -69.650  1.00 147.04 ?  127 LYS C CE    1 
ATOM   4019 N  NZ    . LYS C 1 127 ? -21.166 29.866  -68.289  1.00 155.22 ?  127 LYS C NZ    1 
ATOM   4020 N  N     . GLN C 1 128 ? -19.671 30.415  -76.000  1.00 114.49 ?  128 GLN C N     1 
ATOM   4021 C  CA    . GLN C 1 128 ? -19.682 29.255  -76.896  1.00 119.15 ?  128 GLN C CA    1 
ATOM   4022 C  C     . GLN C 1 128 ? -18.242 28.744  -77.102  1.00 125.21 ?  128 GLN C C     1 
ATOM   4023 O  O     . GLN C 1 128 ? -17.312 29.548  -76.971  1.00 120.82 ?  128 GLN C O     1 
ATOM   4024 C  CB    . GLN C 1 128 ? -20.324 29.617  -78.252  1.00 119.31 ?  128 GLN C CB    1 
ATOM   4025 C  CG    . GLN C 1 128 ? -21.848 29.779  -78.230  1.00 131.71 ?  128 GLN C CG    1 
ATOM   4026 C  CD    . GLN C 1 128 ? -22.609 28.545  -77.808  1.00 158.46 ?  128 GLN C CD    1 
ATOM   4027 O  OE1   . GLN C 1 128 ? -22.277 27.414  -78.175  1.00 161.27 ?  128 GLN C OE1   1 
ATOM   4028 N  NE2   . GLN C 1 128 ? -23.669 28.743  -77.046  1.00 149.42 ?  128 GLN C NE2   1 
ATOM   4029 N  N     . PRO C 1 129 ? -18.018 27.436  -77.420  1.00 128.19 ?  129 PRO C N     1 
ATOM   4030 C  CA    . PRO C 1 129 ? -16.634 26.953  -77.612  1.00 130.01 ?  129 PRO C CA    1 
ATOM   4031 C  C     . PRO C 1 129 ? -15.852 27.722  -78.680  1.00 131.08 ?  129 PRO C C     1 
ATOM   4032 O  O     . PRO C 1 129 ? -14.773 28.245  -78.390  1.00 128.17 ?  129 PRO C O     1 
ATOM   4033 C  CB    . PRO C 1 129 ? -16.814 25.475  -77.981  1.00 138.92 ?  129 PRO C CB    1 
ATOM   4034 C  CG    . PRO C 1 129 ? -18.153 25.109  -77.467  1.00 145.58 ?  129 PRO C CG    1 
ATOM   4035 C  CD    . PRO C 1 129 ? -18.992 26.338  -77.595  1.00 135.47 ?  129 PRO C CD    1 
ATOM   4036 N  N     . THR C 1 130 ? -16.419 27.833  -79.893  1.00 128.10 ?  130 THR C N     1 
ATOM   4037 C  CA    . THR C 1 130 ? -15.803 28.546  -81.012  1.00 125.13 ?  130 THR C CA    1 
ATOM   4038 C  C     . THR C 1 130 ? -16.651 29.737  -81.443  1.00 123.87 ?  130 THR C C     1 
ATOM   4039 O  O     . THR C 1 130 ? -17.819 29.570  -81.799  1.00 124.79 ?  130 THR C O     1 
ATOM   4040 C  CB    . THR C 1 130 ? -15.429 27.586  -82.154  1.00 139.41 ?  130 THR C CB    1 
ATOM   4041 O  OG1   . THR C 1 130 ? -16.476 26.632  -82.337  1.00 143.90 ?  130 THR C OG1   1 
ATOM   4042 C  CG2   . THR C 1 130 ? -14.118 26.856  -81.894  1.00 141.50 ?  130 THR C CG2   1 
ATOM   4043 N  N     . VAL C 1 131 ? -16.068 30.947  -81.350  1.00 114.78 ?  131 VAL C N     1 
ATOM   4044 C  CA    . VAL C 1 131 ? -16.704 32.223  -81.702  1.00 109.88 ?  131 VAL C CA    1 
ATOM   4045 C  C     . VAL C 1 131 ? -15.780 32.962  -82.674  1.00 110.50 ?  131 VAL C C     1 
ATOM   4046 O  O     . VAL C 1 131 ? -14.604 33.178  -82.358  1.00 109.32 ?  131 VAL C O     1 
ATOM   4047 C  CB    . VAL C 1 131 ? -17.037 33.088  -80.449  1.00 110.43 ?  131 VAL C CB    1 
ATOM   4048 C  CG1   . VAL C 1 131 ? -17.774 34.369  -80.832  1.00 106.33 ?  131 VAL C CG1   1 
ATOM   4049 C  CG2   . VAL C 1 131 ? -17.846 32.299  -79.424  1.00 113.20 ?  131 VAL C CG2   1 
ATOM   4050 N  N     . LEU C 1 132 ? -16.304 33.323  -83.861  1.00 105.70 ?  132 LEU C N     1 
ATOM   4051 C  CA    . LEU C 1 132 ? -15.546 34.027  -84.901  1.00 103.23 ?  132 LEU C CA    1 
ATOM   4052 C  C     . LEU C 1 132 ? -16.379 35.130  -85.532  1.00 102.43 ?  132 LEU C C     1 
ATOM   4053 O  O     . LEU C 1 132 ? -17.548 34.904  -85.843  1.00 103.24 ?  132 LEU C O     1 
ATOM   4054 C  CB    . LEU C 1 132 ? -15.076 33.056  -86.010  1.00 107.69 ?  132 LEU C CB    1 
ATOM   4055 C  CG    . LEU C 1 132 ? -14.190 31.866  -85.620  1.00 116.67 ?  132 LEU C CG    1 
ATOM   4056 C  CD1   . LEU C 1 132 ? -14.119 30.859  -86.745  1.00 121.90 ?  132 LEU C CD1   1 
ATOM   4057 C  CD2   . LEU C 1 132 ? -12.787 32.309  -85.209  1.00 117.65 ?  132 LEU C CD2   1 
ATOM   4058 N  N     . THR C 1 133 ? -15.771 36.310  -85.752  1.00 94.55  ?  133 THR C N     1 
ATOM   4059 C  CA    . THR C 1 133 ? -16.445 37.434  -86.400  1.00 91.89  ?  133 THR C CA    1 
ATOM   4060 C  C     . THR C 1 133 ? -16.510 37.127  -87.890  1.00 98.23  ?  133 THR C C     1 
ATOM   4061 O  O     . THR C 1 133 ? -15.481 36.819  -88.497  1.00 99.03  ?  133 THR C O     1 
ATOM   4062 C  CB    . THR C 1 133 ? -15.711 38.759  -86.137  1.00 96.10  ?  133 THR C CB    1 
ATOM   4063 O  OG1   . THR C 1 133 ? -15.295 38.826  -84.772  1.00 97.45  ?  133 THR C OG1   1 
ATOM   4064 C  CG2   . THR C 1 133 ? -16.558 39.978  -86.493  1.00 91.06  ?  133 THR C CG2   1 
ATOM   4065 N  N     . HIS C 1 134 ? -17.720 37.179  -88.465  1.00 95.90  ?  134 HIS C N     1 
ATOM   4066 C  CA    . HIS C 1 134 ? -17.945 36.907  -89.880  1.00 98.26  ?  134 HIS C CA    1 
ATOM   4067 C  C     . HIS C 1 134 ? -18.155 38.182  -90.679  1.00 100.40 ?  134 HIS C C     1 
ATOM   4068 O  O     . HIS C 1 134 ? -17.591 38.322  -91.765  1.00 100.78 ?  134 HIS C O     1 
ATOM   4069 C  CB    . HIS C 1 134 ? -19.096 35.908  -90.065  1.00 102.94 ?  134 HIS C CB    1 
ATOM   4070 C  CG    . HIS C 1 134 ? -18.645 34.482  -90.149  1.00 110.48 ?  134 HIS C CG    1 
ATOM   4071 N  ND1   . HIS C 1 134 ? -19.398 33.529  -90.808  1.00 117.08 ?  134 HIS C ND1   1 
ATOM   4072 C  CD2   . HIS C 1 134 ? -17.515 33.899  -89.682  1.00 112.62 ?  134 HIS C CD2   1 
ATOM   4073 C  CE1   . HIS C 1 134 ? -18.715 32.399  -90.708  1.00 119.66 ?  134 HIS C CE1   1 
ATOM   4074 N  NE2   . HIS C 1 134 ? -17.575 32.573  -90.042  1.00 117.50 ?  134 HIS C NE2   1 
ATOM   4075 N  N     . GLU C 1 135 ? -18.944 39.119  -90.130  1.00 95.04  ?  135 GLU C N     1 
ATOM   4076 C  CA    . GLU C 1 135 ? -19.256 40.406  -90.748  1.00 93.52  ?  135 GLU C CA    1 
ATOM   4077 C  C     . GLU C 1 135 ? -19.383 41.472  -89.673  1.00 94.78  ?  135 GLU C C     1 
ATOM   4078 O  O     . GLU C 1 135 ? -19.708 41.158  -88.524  1.00 93.37  ?  135 GLU C O     1 
ATOM   4079 C  CB    . GLU C 1 135 ? -20.579 40.326  -91.533  1.00 97.76  ?  135 GLU C CB    1 
ATOM   4080 C  CG    . GLU C 1 135 ? -20.463 39.741  -92.932  1.00 113.13 ?  135 GLU C CG    1 
ATOM   4081 C  CD    . GLU C 1 135 ? -21.772 39.381  -93.611  1.00 140.73 ?  135 GLU C CD    1 
ATOM   4082 O  OE1   . GLU C 1 135 ? -22.817 39.976  -93.262  1.00 138.50 ?  135 GLU C OE1   1 
ATOM   4083 O  OE2   . GLU C 1 135 ? -21.747 38.513  -94.514  1.00 138.63 -1 135 GLU C OE2   1 
ATOM   4084 N  N     . SER C 1 136 ? -19.139 42.735  -90.053  1.00 90.64  ?  136 SER C N     1 
ATOM   4085 C  CA    . SER C 1 136 ? -19.272 43.892  -89.174  1.00 88.14  ?  136 SER C CA    1 
ATOM   4086 C  C     . SER C 1 136 ? -19.528 45.173  -89.953  1.00 93.27  ?  136 SER C C     1 
ATOM   4087 O  O     . SER C 1 136 ? -18.897 45.415  -90.984  1.00 94.62  ?  136 SER C O     1 
ATOM   4088 C  CB    . SER C 1 136 ? -18.058 44.054  -88.268  1.00 89.91  ?  136 SER C CB    1 
ATOM   4089 O  OG    . SER C 1 136 ? -18.312 45.048  -87.289  1.00 98.50  ?  136 SER C OG    1 
ATOM   4090 N  N     . SER C 1 137 ? -20.474 45.979  -89.463  1.00 89.24  ?  137 SER C N     1 
ATOM   4091 C  CA    . SER C 1 137 ? -20.846 47.269  -90.029  1.00 89.23  ?  137 SER C CA    1 
ATOM   4092 C  C     . SER C 1 137 ? -20.680 48.264  -88.887  1.00 90.09  ?  137 SER C C     1 
ATOM   4093 O  O     . SER C 1 137 ? -21.373 48.163  -87.867  1.00 89.79  ?  137 SER C O     1 
ATOM   4094 C  CB    . SER C 1 137 ? -22.289 47.247  -90.531  1.00 96.41  ?  137 SER C CB    1 
ATOM   4095 O  OG    . SER C 1 137 ? -22.592 48.464  -91.190  1.00 108.33 ?  137 SER C OG    1 
ATOM   4096 N  N     . ILE C 1 138 ? -19.692 49.159  -89.014  1.00 83.50  ?  138 ILE C N     1 
ATOM   4097 C  CA    . ILE C 1 138 ? -19.359 50.115  -87.957  1.00 80.16  ?  138 ILE C CA    1 
ATOM   4098 C  C     . ILE C 1 138 ? -19.490 51.581  -88.373  1.00 83.58  ?  138 ILE C C     1 
ATOM   4099 O  O     . ILE C 1 138 ? -19.365 51.905  -89.559  1.00 84.95  ?  138 ILE C O     1 
ATOM   4100 C  CB    . ILE C 1 138 ? -17.992 49.782  -87.308  1.00 81.05  ?  138 ILE C CB    1 
ATOM   4101 C  CG1   . ILE C 1 138 ? -16.848 49.853  -88.333  1.00 81.53  ?  138 ILE C CG1   1 
ATOM   4102 C  CG2   . ILE C 1 138 ? -18.033 48.411  -86.608  1.00 82.06  ?  138 ILE C CG2   1 
ATOM   4103 C  CD1   . ILE C 1 138 ? -15.516 50.032  -87.751  1.00 84.86  ?  138 ILE C CD1   1 
ATOM   4104 N  N     . GLN C 1 139 ? -19.764 52.459  -87.386  1.00 78.04  ?  139 GLN C N     1 
ATOM   4105 C  CA    . GLN C 1 139 ? -19.945 53.900  -87.572  1.00 78.26  ?  139 GLN C CA    1 
ATOM   4106 C  C     . GLN C 1 139 ? -19.214 54.691  -86.493  1.00 80.03  ?  139 GLN C C     1 
ATOM   4107 O  O     . GLN C 1 139 ? -19.366 54.391  -85.308  1.00 78.79  ?  139 GLN C O     1 
ATOM   4108 C  CB    . GLN C 1 139 ? -21.436 54.268  -87.534  1.00 81.45  ?  139 GLN C CB    1 
ATOM   4109 C  CG    . GLN C 1 139 ? -22.248 53.806  -88.726  1.00 101.31 ?  139 GLN C CG    1 
ATOM   4110 C  CD    . GLN C 1 139 ? -23.665 54.291  -88.587  1.00 131.10 ?  139 GLN C CD    1 
ATOM   4111 O  OE1   . GLN C 1 139 ? -24.477 53.715  -87.854  1.00 130.05 ?  139 GLN C OE1   1 
ATOM   4112 N  NE2   . GLN C 1 139 ? -23.979 55.411  -89.226  1.00 126.32 ?  139 GLN C NE2   1 
ATOM   4113 N  N     . PHE C 1 140 ? -18.448 55.716  -86.901  1.00 76.40  ?  140 PHE C N     1 
ATOM   4114 C  CA    . PHE C 1 140 ? -17.712 56.585  -85.987  1.00 75.41  ?  140 PHE C CA    1 
ATOM   4115 C  C     . PHE C 1 140 ? -18.436 57.927  -85.880  1.00 79.46  ?  140 PHE C C     1 
ATOM   4116 O  O     . PHE C 1 140 ? -18.084 58.890  -86.570  1.00 80.93  ?  140 PHE C O     1 
ATOM   4117 C  CB    . PHE C 1 140 ? -16.256 56.751  -86.448  1.00 77.59  ?  140 PHE C CB    1 
ATOM   4118 C  CG    . PHE C 1 140 ? -15.465 55.464  -86.493  1.00 78.53  ?  140 PHE C CG    1 
ATOM   4119 C  CD1   . PHE C 1 140 ? -14.766 55.018  -85.377  1.00 80.70  ?  140 PHE C CD1   1 
ATOM   4120 C  CD2   . PHE C 1 140 ? -15.402 54.707  -87.657  1.00 81.79  ?  140 PHE C CD2   1 
ATOM   4121 C  CE1   . PHE C 1 140 ? -14.024 53.833  -85.421  1.00 81.00  ?  140 PHE C CE1   1 
ATOM   4122 C  CE2   . PHE C 1 140 ? -14.667 53.519  -87.697  1.00 84.04  ?  140 PHE C CE2   1 
ATOM   4123 C  CZ    . PHE C 1 140 ? -13.980 53.093  -86.581  1.00 80.77  ?  140 PHE C CZ    1 
ATOM   4124 N  N     . ILE C 1 141 ? -19.476 57.960  -85.020  1.00 74.34  ?  141 ILE C N     1 
ATOM   4125 C  CA    . ILE C 1 141 ? -20.373 59.092  -84.766  1.00 75.44  ?  141 ILE C CA    1 
ATOM   4126 C  C     . ILE C 1 141 ? -19.646 60.370  -84.346  1.00 80.56  ?  141 ILE C C     1 
ATOM   4127 O  O     . ILE C 1 141 ? -19.823 61.407  -84.995  1.00 83.93  ?  141 ILE C O     1 
ATOM   4128 C  CB    . ILE C 1 141 ? -21.534 58.686  -83.817  1.00 77.98  ?  141 ILE C CB    1 
ATOM   4129 C  CG1   . ILE C 1 141 ? -22.417 57.609  -84.461  1.00 78.50  ?  141 ILE C CG1   1 
ATOM   4130 C  CG2   . ILE C 1 141 ? -22.391 59.886  -83.405  1.00 81.80  ?  141 ILE C CG2   1 
ATOM   4131 C  CD1   . ILE C 1 141 ? -22.189 56.286  -83.949  1.00 84.31  ?  141 ILE C CD1   1 
ATOM   4132 N  N     . GLU C 1 142 ? -18.842 60.301  -83.275  1.00 74.46  ?  142 GLU C N     1 
ATOM   4133 C  CA    . GLU C 1 142 ? -18.082 61.450  -82.784  1.00 74.90  ?  142 GLU C CA    1 
ATOM   4134 C  C     . GLU C 1 142 ? -16.598 61.127  -82.688  1.00 75.93  ?  142 GLU C C     1 
ATOM   4135 O  O     . GLU C 1 142 ? -16.213 59.952  -82.656  1.00 73.03  ?  142 GLU C O     1 
ATOM   4136 C  CB    . GLU C 1 142 ? -18.617 61.951  -81.428  1.00 76.91  ?  142 GLU C CB    1 
ATOM   4137 C  CG    . GLU C 1 142 ? -20.071 62.406  -81.413  1.00 94.13  ?  142 GLU C CG    1 
ATOM   4138 C  CD    . GLU C 1 142 ? -20.470 63.542  -82.338  1.00 130.41 ?  142 GLU C CD    1 
ATOM   4139 O  OE1   . GLU C 1 142 ? -19.637 64.447  -82.578  1.00 134.22 ?  142 GLU C OE1   1 
ATOM   4140 O  OE2   . GLU C 1 142 ? -21.635 63.538  -82.798  1.00 131.27 -1 142 GLU C OE2   1 
ATOM   4141 N  N     . LYS C 1 143 ? -15.764 62.177  -82.652  1.00 73.73  ?  143 LYS C N     1 
ATOM   4142 C  CA    . LYS C 1 143 ? -14.316 62.039  -82.534  1.00 72.39  ?  143 LYS C CA    1 
ATOM   4143 C  C     . LYS C 1 143 ? -13.951 61.711  -81.084  1.00 74.92  ?  143 LYS C C     1 
ATOM   4144 O  O     . LYS C 1 143 ? -14.276 62.480  -80.172  1.00 75.94  ?  143 LYS C O     1 
ATOM   4145 C  CB    . LYS C 1 143 ? -13.598 63.321  -83.001  1.00 76.88  ?  143 LYS C CB    1 
ATOM   4146 C  CG    . LYS C 1 143 ? -13.511 63.478  -84.515  1.00 87.32  ?  143 LYS C CG    1 
ATOM   4147 C  CD    . LYS C 1 143 ? -13.830 64.900  -84.985  1.00 99.34  ?  143 LYS C CD    1 
ATOM   4148 C  CE    . LYS C 1 143 ? -12.619 65.801  -85.052  1.00 107.96 ?  143 LYS C CE    1 
ATOM   4149 N  NZ    . LYS C 1 143 ? -12.961 67.153  -85.565  1.00 120.77 ?  143 LYS C NZ    1 
ATOM   4150 N  N     . VAL C 1 144 ? -13.313 60.549  -80.870  1.00 68.67  ?  144 VAL C N     1 
ATOM   4151 C  CA    . VAL C 1 144 ? -12.853 60.136  -79.542  1.00 66.52  ?  144 VAL C CA    1 
ATOM   4152 C  C     . VAL C 1 144 ? -11.472 60.746  -79.357  1.00 70.92  ?  144 VAL C C     1 
ATOM   4153 O  O     . VAL C 1 144 ? -10.558 60.451  -80.128  1.00 70.60  ?  144 VAL C O     1 
ATOM   4154 C  CB    . VAL C 1 144 ? -12.849 58.604  -79.342  1.00 67.40  ?  144 VAL C CB    1 
ATOM   4155 C  CG1   . VAL C 1 144 ? -12.200 58.227  -78.020  1.00 66.26  ?  144 VAL C CG1   1 
ATOM   4156 C  CG2   . VAL C 1 144 ? -14.259 58.054  -79.410  1.00 66.65  ?  144 VAL C CG2   1 
ATOM   4157 N  N     . LYS C 1 145 ? -11.332 61.623  -78.366  1.00 67.90  ?  145 LYS C N     1 
ATOM   4158 C  CA    . LYS C 1 145 ? -10.072 62.309  -78.142  1.00 68.86  ?  145 LYS C CA    1 
ATOM   4159 C  C     . LYS C 1 145 ? -9.263  61.744  -76.983  1.00 71.95  ?  145 LYS C C     1 
ATOM   4160 O  O     . LYS C 1 145 ? -9.728  60.849  -76.285  1.00 70.17  ?  145 LYS C O     1 
ATOM   4161 C  CB    . LYS C 1 145 ? -10.286 63.829  -78.057  1.00 73.79  ?  145 LYS C CB    1 
ATOM   4162 C  CG    . LYS C 1 145 ? -10.490 64.474  -79.432  1.00 79.78  ?  145 LYS C CG    1 
ATOM   4163 C  CD    . LYS C 1 145 ? -10.528 65.998  -79.373  1.00 93.50  ?  145 LYS C CD    1 
ATOM   4164 C  CE    . LYS C 1 145 ? -9.164  66.657  -79.306  1.00 109.08 ?  145 LYS C CE    1 
ATOM   4165 N  NZ    . LYS C 1 145 ? -8.430  66.569  -80.596  1.00 120.97 ?  145 LYS C NZ    1 
ATOM   4166 N  N     . LEU C 1 146 ? -8.025  62.226  -76.826  1.00 70.20  ?  146 LEU C N     1 
ATOM   4167 C  CA    . LEU C 1 146 ? -7.088  61.816  -75.786  1.00 70.15  ?  146 LEU C CA    1 
ATOM   4168 C  C     . LEU C 1 146 ? -7.680  62.050  -74.403  1.00 75.29  ?  146 LEU C C     1 
ATOM   4169 O  O     . LEU C 1 146 ? -8.392  63.035  -74.199  1.00 76.45  ?  146 LEU C O     1 
ATOM   4170 C  CB    . LEU C 1 146 ? -5.775  62.600  -75.972  1.00 72.71  ?  146 LEU C CB    1 
ATOM   4171 C  CG    . LEU C 1 146 ? -4.651  62.422  -74.966  1.00 78.05  ?  146 LEU C CG    1 
ATOM   4172 C  CD1   . LEU C 1 146 ? -4.161  60.998  -74.940  1.00 75.96  ?  146 LEU C CD1   1 
ATOM   4173 C  CD2   . LEU C 1 146 ? -3.505  63.360  -75.288  1.00 83.80  ?  146 LEU C CD2   1 
ATOM   4174 N  N     . ASN C 1 147 ? -7.417  61.108  -73.476  1.00 71.74  ?  147 ASN C N     1 
ATOM   4175 C  CA    . ASN C 1 147 ? -7.885  61.081  -72.079  1.00 72.13  ?  147 ASN C CA    1 
ATOM   4176 C  C     . ASN C 1 147 ? -9.363  60.701  -71.865  1.00 73.91  ?  147 ASN C C     1 
ATOM   4177 O  O     . ASN C 1 147 ? -9.812  60.593  -70.719  1.00 73.88  ?  147 ASN C O     1 
ATOM   4178 C  CB    . ASN C 1 147 ? -7.434  62.306  -71.262  1.00 76.29  ?  147 ASN C CB    1 
ATOM   4179 C  CG    . ASN C 1 147 ? -5.939  62.426  -71.154  1.00 102.00 ?  147 ASN C CG    1 
ATOM   4180 O  OD1   . ASN C 1 147 ? -5.241  61.488  -70.740  1.00 99.57  ?  147 ASN C OD1   1 
ATOM   4181 N  ND2   . ASN C 1 147 ? -5.416  63.587  -71.519  1.00 94.13  ?  147 ASN C ND2   1 
ATOM   4182 N  N     . ASP C 1 148 ? -10.094 60.438  -72.960  1.00 68.65  ?  148 ASP C N     1 
ATOM   4183 C  CA    . ASP C 1 148 ? -11.481 59.997  -72.886  1.00 67.79  ?  148 ASP C CA    1 
ATOM   4184 C  C     . ASP C 1 148 ? -11.514 58.527  -72.482  1.00 70.46  ?  148 ASP C C     1 
ATOM   4185 O  O     . ASP C 1 148 ? -10.586 57.782  -72.794  1.00 69.93  ?  148 ASP C O     1 
ATOM   4186 C  CB    . ASP C 1 148 ? -12.190 60.151  -74.246  1.00 69.49  ?  148 ASP C CB    1 
ATOM   4187 C  CG    . ASP C 1 148 ? -12.541 61.563  -74.684  1.00 85.08  ?  148 ASP C CG    1 
ATOM   4188 O  OD1   . ASP C 1 148 ? -12.453 62.495  -73.843  1.00 89.53  ?  148 ASP C OD1   1 
ATOM   4189 O  OD2   . ASP C 1 148 ? -12.944 61.734  -75.855  1.00 88.71  -1 148 ASP C OD2   1 
ATOM   4190 N  N     . THR C 1 149 ? -12.580 58.111  -71.792  1.00 66.30  ?  149 THR C N     1 
ATOM   4191 C  CA    . THR C 1 149 ? -12.766 56.715  -71.411  1.00 64.52  ?  149 THR C CA    1 
ATOM   4192 C  C     . THR C 1 149 ? -13.990 56.223  -72.175  1.00 66.97  ?  149 THR C C     1 
ATOM   4193 O  O     . THR C 1 149 ? -15.093 56.756  -72.002  1.00 68.29  ?  149 THR C O     1 
ATOM   4194 C  CB    . THR C 1 149 ? -12.830 56.543  -69.888  1.00 72.75  ?  149 THR C CB    1 
ATOM   4195 O  OG1   . THR C 1 149 ? -11.792 57.312  -69.280  1.00 77.90  ?  149 THR C OG1   1 
ATOM   4196 C  CG2   . THR C 1 149 ? -12.697 55.097  -69.468  1.00 66.67  ?  149 THR C CG2   1 
ATOM   4197 N  N     . VAL C 1 150 ? -13.777 55.263  -73.073  1.00 61.19  ?  150 VAL C N     1 
ATOM   4198 C  CA    . VAL C 1 150 ? -14.839 54.717  -73.915  1.00 60.00  ?  150 VAL C CA    1 
ATOM   4199 C  C     . VAL C 1 150 ? -15.568 53.569  -73.215  1.00 64.42  ?  150 VAL C C     1 
ATOM   4200 O  O     . VAL C 1 150 ? -14.959 52.540  -72.899  1.00 64.73  ?  150 VAL C O     1 
ATOM   4201 C  CB    . VAL C 1 150 ? -14.330 54.319  -75.319  1.00 62.44  ?  150 VAL C CB    1 
ATOM   4202 C  CG1   . VAL C 1 150 ? -15.491 53.907  -76.213  1.00 61.89  ?  150 VAL C CG1   1 
ATOM   4203 C  CG2   . VAL C 1 150 ? -13.541 55.456  -75.953  1.00 62.65  ?  150 VAL C CG2   1 
ATOM   4204 N  N     . ARG C 1 151 ? -16.874 53.760  -72.977  1.00 60.49  ?  151 ARG C N     1 
ATOM   4205 C  CA    . ARG C 1 151 ? -17.740 52.781  -72.336  1.00 60.40  ?  151 ARG C CA    1 
ATOM   4206 C  C     . ARG C 1 151 ? -18.506 52.063  -73.431  1.00 65.20  ?  151 ARG C C     1 
ATOM   4207 O  O     . ARG C 1 151 ? -19.471 52.606  -73.973  1.00 66.12  ?  151 ARG C O     1 
ATOM   4208 C  CB    . ARG C 1 151 ? -18.696 53.478  -71.352  1.00 60.57  ?  151 ARG C CB    1 
ATOM   4209 C  CG    . ARG C 1 151 ? -19.319 52.533  -70.338  1.00 65.13  ?  151 ARG C CG    1 
ATOM   4210 C  CD    . ARG C 1 151 ? -20.435 53.180  -69.549  1.00 61.86  ?  151 ARG C CD    1 
ATOM   4211 N  NE    . ARG C 1 151 ? -21.723 53.043  -70.226  1.00 67.17  ?  151 ARG C NE    1 
ATOM   4212 C  CZ    . ARG C 1 151 ? -22.337 54.023  -70.881  1.00 94.39  ?  151 ARG C CZ    1 
ATOM   4213 N  NH1   . ARG C 1 151 ? -21.787 55.231  -70.955  1.00 86.64  ?  151 ARG C NH1   1 
ATOM   4214 N  NH2   . ARG C 1 151 ? -23.512 53.808  -71.458  1.00 89.94  ?  151 ARG C NH2   1 
ATOM   4215 N  N     . ALA C 1 152 ? -18.050 50.865  -73.796  1.00 61.87  ?  152 ALA C N     1 
ATOM   4216 C  CA    . ALA C 1 152 ? -18.689 50.083  -74.850  1.00 62.27  ?  152 ALA C CA    1 
ATOM   4217 C  C     . ALA C 1 152 ? -19.667 49.087  -74.259  1.00 67.55  ?  152 ALA C C     1 
ATOM   4218 O  O     . ALA C 1 152 ? -19.330 48.382  -73.306  1.00 67.89  ?  152 ALA C O     1 
ATOM   4219 C  CB    . ALA C 1 152 ? -17.639 49.354  -75.678  1.00 62.58  ?  152 ALA C CB    1 
ATOM   4220 N  N     . GLU C 1 153 ? -20.882 49.037  -74.814  1.00 64.81  ?  153 GLU C N     1 
ATOM   4221 C  CA    . GLU C 1 153 ? -21.891 48.072  -74.395  1.00 66.20  ?  153 GLU C CA    1 
ATOM   4222 C  C     . GLU C 1 153 ? -22.410 47.271  -75.576  1.00 69.03  ?  153 GLU C C     1 
ATOM   4223 O  O     . GLU C 1 153 ? -22.847 47.849  -76.568  1.00 68.47  ?  153 GLU C O     1 
ATOM   4224 C  CB    . GLU C 1 153 ? -23.008 48.658  -73.502  1.00 69.10  ?  153 GLU C CB    1 
ATOM   4225 C  CG    . GLU C 1 153 ? -23.509 50.052  -73.843  1.00 82.90  ?  153 GLU C CG    1 
ATOM   4226 C  CD    . GLU C 1 153 ? -24.609 50.589  -72.940  1.00 111.29 ?  153 GLU C CD    1 
ATOM   4227 O  OE1   . GLU C 1 153 ? -24.570 50.330  -71.713  1.00 103.91 ?  153 GLU C OE1   1 
ATOM   4228 O  OE2   . GLU C 1 153 ? -25.519 51.272  -73.465  1.00 110.20 -1 153 GLU C OE2   1 
ATOM   4229 N  N     . ALA C 1 154 ? -22.295 45.939  -75.488  1.00 65.49  ?  154 ALA C N     1 
ATOM   4230 C  CA    . ALA C 1 154 ? -22.726 45.007  -76.519  1.00 66.68  ?  154 ALA C CA    1 
ATOM   4231 C  C     . ALA C 1 154 ? -23.963 44.241  -76.067  1.00 74.07  ?  154 ALA C C     1 
ATOM   4232 O  O     . ALA C 1 154 ? -24.024 43.790  -74.923  1.00 74.25  ?  154 ALA C O     1 
ATOM   4233 C  CB    . ALA C 1 154 ? -21.605 44.044  -76.851  1.00 67.21  ?  154 ALA C CB    1 
ATOM   4234 N  N     . ARG C 1 155 ? -24.950 44.106  -76.966  1.00 73.17  ?  155 ARG C N     1 
ATOM   4235 C  CA    . ARG C 1 155 ? -26.199 43.396  -76.702  1.00 76.49  ?  155 ARG C CA    1 
ATOM   4236 C  C     . ARG C 1 155 ? -26.501 42.429  -77.833  1.00 83.27  ?  155 ARG C C     1 
ATOM   4237 O  O     . ARG C 1 155 ? -26.367 42.794  -79.003  1.00 82.31  ?  155 ARG C O     1 
ATOM   4238 C  CB    . ARG C 1 155 ? -27.369 44.383  -76.552  1.00 78.42  ?  155 ARG C CB    1 
ATOM   4239 C  CG    . ARG C 1 155 ? -27.374 45.157  -75.253  1.00 92.81  ?  155 ARG C CG    1 
ATOM   4240 C  CD    . ARG C 1 155 ? -28.509 46.162  -75.206  1.00 110.09 ?  155 ARG C CD    1 
ATOM   4241 N  NE    . ARG C 1 155 ? -28.276 47.220  -74.221  1.00 122.21 ?  155 ARG C NE    1 
ATOM   4242 C  CZ    . ARG C 1 155 ? -27.548 48.313  -74.439  1.00 135.32 ?  155 ARG C CZ    1 
ATOM   4243 N  NH1   . ARG C 1 155 ? -26.948 48.499  -75.611  1.00 120.10 ?  155 ARG C NH1   1 
ATOM   4244 N  NH2   . ARG C 1 155 ? -27.408 49.224  -73.487  1.00 121.47 ?  155 ARG C NH2   1 
ATOM   4245 N  N     . VAL C 1 156 ? -26.932 41.205  -77.488  1.00 83.20  ?  156 VAL C N     1 
ATOM   4246 C  CA    . VAL C 1 156 ? -27.322 40.199  -78.476  1.00 86.09  ?  156 VAL C CA    1 
ATOM   4247 C  C     . VAL C 1 156 ? -28.732 40.578  -78.940  1.00 92.99  ?  156 VAL C C     1 
ATOM   4248 O  O     . VAL C 1 156 ? -29.659 40.618  -78.126  1.00 94.11  ?  156 VAL C O     1 
ATOM   4249 C  CB    . VAL C 1 156 ? -27.245 38.748  -77.929  1.00 92.77  ?  156 VAL C CB    1 
ATOM   4250 C  CG1   . VAL C 1 156 ? -27.766 37.745  -78.954  1.00 96.34  ?  156 VAL C CG1   1 
ATOM   4251 C  CG2   . VAL C 1 156 ? -25.823 38.391  -77.512  1.00 90.71  ?  156 VAL C CG2   1 
ATOM   4252 N  N     . VAL C 1 157 ? -28.875 40.916  -80.228  1.00 90.71  ?  157 VAL C N     1 
ATOM   4253 C  CA    . VAL C 1 157 ? -30.159 41.323  -80.803  1.00 93.49  ?  157 VAL C CA    1 
ATOM   4254 C  C     . VAL C 1 157 ? -30.904 40.162  -81.461  1.00 102.83 ?  157 VAL C C     1 
ATOM   4255 O  O     . VAL C 1 157 ? -32.136 40.115  -81.415  1.00 105.73 ?  157 VAL C O     1 
ATOM   4256 C  CB    . VAL C 1 157 ? -30.078 42.595  -81.687  1.00 95.64  ?  157 VAL C CB    1 
ATOM   4257 C  CG1   . VAL C 1 157 ? -29.667 43.806  -80.856  1.00 92.08  ?  157 VAL C CG1   1 
ATOM   4258 C  CG2   . VAL C 1 157 ? -29.148 42.413  -82.885  1.00 94.50  ?  157 VAL C CG2   1 
ATOM   4259 N  N     . ASN C 1 158 ? -30.150 39.219  -82.050  1.00 100.67 ?  158 ASN C N     1 
ATOM   4260 C  CA    . ASN C 1 158 ? -30.688 38.027  -82.702  1.00 105.33 ?  158 ASN C CA    1 
ATOM   4261 C  C     . ASN C 1 158 ? -29.703 36.863  -82.609  1.00 109.62 ?  158 ASN C C     1 
ATOM   4262 O  O     . ASN C 1 158 ? -28.517 37.073  -82.340  1.00 105.92 ?  158 ASN C O     1 
ATOM   4263 C  CB    . ASN C 1 158 ? -31.059 38.323  -84.159  1.00 107.74 ?  158 ASN C CB    1 
ATOM   4264 C  CG    . ASN C 1 158 ? -32.020 37.332  -84.771  1.00 137.04 ?  158 ASN C CG    1 
ATOM   4265 O  OD1   . ASN C 1 158 ? -33.062 36.989  -84.194  1.00 134.30 ?  158 ASN C OD1   1 
ATOM   4266 N  ND2   . ASN C 1 158 ? -31.702 36.870  -85.972  1.00 131.20 ?  158 ASN C ND2   1 
ATOM   4267 N  N     . GLN C 1 159 ? -30.208 35.634  -82.795  1.00 110.59 ?  159 GLN C N     1 
ATOM   4268 C  CA    . GLN C 1 159 ? -29.417 34.410  -82.753  1.00 112.01 ?  159 GLN C CA    1 
ATOM   4269 C  C     . GLN C 1 159 ? -30.041 33.345  -83.655  1.00 120.77 ?  159 GLN C C     1 
ATOM   4270 O  O     . GLN C 1 159 ? -31.178 32.920  -83.427  1.00 124.00 ?  159 GLN C O     1 
ATOM   4271 C  CB    . GLN C 1 159 ? -29.269 33.894  -81.306  1.00 113.67 ?  159 GLN C CB    1 
ATOM   4272 C  CG    . GLN C 1 159 ? -28.287 32.733  -81.157  1.00 128.21 ?  159 GLN C CG    1 
ATOM   4273 C  CD    . GLN C 1 159 ? -28.582 31.861  -79.961  1.00 145.25 ?  159 GLN C CD    1 
ATOM   4274 O  OE1   . GLN C 1 159 ? -28.768 32.335  -78.831  1.00 137.72 ?  159 GLN C OE1   1 
ATOM   4275 N  NE2   . GLN C 1 159 ? -28.573 30.556  -80.177  1.00 139.90 ?  159 GLN C NE2   1 
ATOM   4276 N  N     . THR C 1 160 ? -29.291 32.931  -84.685  1.00 117.56 ?  160 THR C N     1 
ATOM   4277 C  CA    . THR C 1 160 ? -29.686 31.880  -85.623  1.00 122.66 ?  160 THR C CA    1 
ATOM   4278 C  C     . THR C 1 160 ? -29.000 30.579  -85.176  1.00 129.00 ?  160 THR C C     1 
ATOM   4279 O  O     . THR C 1 160 ? -28.433 30.545  -84.083  1.00 126.75 ?  160 THR C O     1 
ATOM   4280 C  CB    . THR C 1 160 ? -29.369 32.286  -87.077  1.00 129.46 ?  160 THR C CB    1 
ATOM   4281 O  OG1   . THR C 1 160 ? -27.963 32.466  -87.233  1.00 125.21 ?  160 THR C OG1   1 
ATOM   4282 C  CG2   . THR C 1 160 ? -30.118 33.540  -87.519  1.00 126.42 ?  160 THR C CG2   1 
ATOM   4283 N  N     . ALA C 1 161 ? -29.066 29.513  -85.989  1.00 130.50 ?  161 ALA C N     1 
ATOM   4284 C  CA    . ALA C 1 161 ? -28.437 28.232  -85.662  1.00 133.73 ?  161 ALA C CA    1 
ATOM   4285 C  C     . ALA C 1 161 ? -26.913 28.293  -85.836  1.00 133.91 ?  161 ALA C C     1 
ATOM   4286 O  O     . ALA C 1 161 ? -26.190 27.548  -85.172  1.00 134.53 ?  161 ALA C O     1 
ATOM   4287 C  CB    . ALA C 1 161 ? -29.022 27.129  -86.530  1.00 141.62 ?  161 ALA C CB    1 
ATOM   4288 N  N     . LYS C 1 162 ? -26.433 29.189  -86.719  1.00 126.52 ?  162 LYS C N     1 
ATOM   4289 C  CA    . LYS C 1 162 ? -25.014 29.363  -87.029  1.00 123.36 ?  162 LYS C CA    1 
ATOM   4290 C  C     . LYS C 1 162 ? -24.436 30.722  -86.614  1.00 120.61 ?  162 LYS C C     1 
ATOM   4291 O  O     . LYS C 1 162 ? -23.211 30.853  -86.547  1.00 117.96 ?  162 LYS C O     1 
ATOM   4292 C  CB    . LYS C 1 162 ? -24.770 29.132  -88.529  1.00 127.96 ?  162 LYS C CB    1 
ATOM   4293 C  CG    . LYS C 1 162 ? -24.616 27.666  -88.918  1.00 145.17 ?  162 LYS C CG    1 
ATOM   4294 C  CD    . LYS C 1 162 ? -24.616 27.483  -90.440  1.00 157.26 ?  162 LYS C CD    1 
ATOM   4295 C  CE    . LYS C 1 162 ? -23.269 27.234  -91.106  1.00 167.25 ?  162 LYS C CE    1 
ATOM   4296 N  NZ    . LYS C 1 162 ? -22.698 25.896  -90.783  1.00 180.65 ?  162 LYS C NZ    1 
ATOM   4297 N  N     . HIS C 1 163 ? -25.292 31.730  -86.337  1.00 114.42 ?  163 HIS C N     1 
ATOM   4298 C  CA    . HIS C 1 163 ? -24.822 33.076  -85.986  1.00 108.06 ?  163 HIS C CA    1 
ATOM   4299 C  C     . HIS C 1 163 ? -25.477 33.731  -84.776  1.00 109.39 ?  163 HIS C C     1 
ATOM   4300 O  O     . HIS C 1 163 ? -26.574 33.354  -84.366  1.00 111.53 ?  163 HIS C O     1 
ATOM   4301 C  CB    . HIS C 1 163 ? -24.923 34.008  -87.199  1.00 107.13 ?  163 HIS C CB    1 
ATOM   4302 C  CG    . HIS C 1 163 ? -23.994 33.650  -88.311  1.00 111.48 ?  163 HIS C CG    1 
ATOM   4303 N  ND1   . HIS C 1 163 ? -24.358 32.742  -89.286  1.00 118.14 ?  163 HIS C ND1   1 
ATOM   4304 C  CD2   . HIS C 1 163 ? -22.736 34.082  -88.560  1.00 110.34 ?  163 HIS C CD2   1 
ATOM   4305 C  CE1   . HIS C 1 163 ? -23.320 32.658  -90.100  1.00 117.54 ?  163 HIS C CE1   1 
ATOM   4306 N  NE2   . HIS C 1 163 ? -22.321 33.448  -89.704  1.00 113.18 ?  163 HIS C NE2   1 
ATOM   4307 N  N     . TYR C 1 164 ? -24.787 34.746  -84.231  1.00 101.23 ?  164 TYR C N     1 
ATOM   4308 C  CA    . TYR C 1 164 ? -25.207 35.603  -83.125  1.00 98.18  ?  164 TYR C CA    1 
ATOM   4309 C  C     . TYR C 1 164 ? -25.112 37.031  -83.654  1.00 98.89  ?  164 TYR C C     1 
ATOM   4310 O  O     . TYR C 1 164 ? -24.064 37.422  -84.180  1.00 96.12  ?  164 TYR C O     1 
ATOM   4311 C  CB    . TYR C 1 164 ? -24.266 35.445  -81.914  1.00 97.24  ?  164 TYR C CB    1 
ATOM   4312 C  CG    . TYR C 1 164 ? -24.749 34.504  -80.833  1.00 101.81 ?  164 TYR C CG    1 
ATOM   4313 C  CD1   . TYR C 1 164 ? -25.511 34.970  -79.766  1.00 103.10 ?  164 TYR C CD1   1 
ATOM   4314 C  CD2   . TYR C 1 164 ? -24.356 33.171  -80.816  1.00 106.24 ?  164 TYR C CD2   1 
ATOM   4315 C  CE1   . TYR C 1 164 ? -25.917 34.119  -78.738  1.00 106.76 ?  164 TYR C CE1   1 
ATOM   4316 C  CE2   . TYR C 1 164 ? -24.762 32.308  -79.799  1.00 110.30 ?  164 TYR C CE2   1 
ATOM   4317 C  CZ    . TYR C 1 164 ? -25.538 32.787  -78.757  1.00 115.93 ?  164 TYR C CZ    1 
ATOM   4318 O  OH    . TYR C 1 164 ? -25.947 31.937  -77.756  1.00 118.86 ?  164 TYR C OH    1 
ATOM   4319 N  N     . TYR C 1 165 ? -26.203 37.792  -83.573  1.00 96.02  ?  165 TYR C N     1 
ATOM   4320 C  CA    . TYR C 1 165 ? -26.218 39.170  -84.052  1.00 93.31  ?  165 TYR C CA    1 
ATOM   4321 C  C     . TYR C 1 165 ? -26.100 40.115  -82.877  1.00 93.44  ?  165 TYR C C     1 
ATOM   4322 O  O     . TYR C 1 165 ? -26.934 40.082  -81.973  1.00 94.03  ?  165 TYR C O     1 
ATOM   4323 C  CB    . TYR C 1 165 ? -27.429 39.444  -84.963  1.00 97.78  ?  165 TYR C CB    1 
ATOM   4324 C  CG    . TYR C 1 165 ? -27.434 38.595  -86.222  1.00 103.66 ?  165 TYR C CG    1 
ATOM   4325 C  CD1   . TYR C 1 165 ? -26.264 38.391  -86.949  1.00 103.79 ?  165 TYR C CD1   1 
ATOM   4326 C  CD2   . TYR C 1 165 ? -28.589 37.970  -86.662  1.00 110.45 ?  165 TYR C CD2   1 
ATOM   4327 C  CE1   . TYR C 1 165 ? -26.257 37.603  -88.098  1.00 108.30 ?  165 TYR C CE1   1 
ATOM   4328 C  CE2   . TYR C 1 165 ? -28.587 37.156  -87.794  1.00 115.64 ?  165 TYR C CE2   1 
ATOM   4329 C  CZ    . TYR C 1 165 ? -27.421 36.995  -88.526  1.00 121.30 ?  165 TYR C CZ    1 
ATOM   4330 O  OH    . TYR C 1 165 ? -27.412 36.214  -89.659  1.00 126.81 ?  165 TYR C OH    1 
ATOM   4331 N  N     . VAL C 1 166 ? -24.992 40.878  -82.841  1.00 86.20  ?  166 VAL C N     1 
ATOM   4332 C  CA    . VAL C 1 166 ? -24.653 41.777  -81.734  1.00 82.99  ?  166 VAL C CA    1 
ATOM   4333 C  C     . VAL C 1 166 ? -24.625 43.246  -82.164  1.00 85.31  ?  166 VAL C C     1 
ATOM   4334 O  O     . VAL C 1 166 ? -24.045 43.580  -83.199  1.00 84.19  ?  166 VAL C O     1 
ATOM   4335 C  CB    . VAL C 1 166 ? -23.312 41.366  -81.041  1.00 84.70  ?  166 VAL C CB    1 
ATOM   4336 C  CG1   . VAL C 1 166 ? -23.061 42.181  -79.779  1.00 81.90  ?  166 VAL C CG1   1 
ATOM   4337 C  CG2   . VAL C 1 166 ? -23.276 39.876  -80.720  1.00 87.24  ?  166 VAL C CG2   1 
ATOM   4338 N  N     . GLU C 1 167 ? -25.217 44.120  -81.334  1.00 81.35  ?  167 GLU C N     1 
ATOM   4339 C  CA    . GLU C 1 167 ? -25.215 45.565  -81.524  1.00 79.49  ?  167 GLU C CA    1 
ATOM   4340 C  C     . GLU C 1 167 ? -24.332 46.169  -80.434  1.00 79.62  ?  167 GLU C C     1 
ATOM   4341 O  O     . GLU C 1 167 ? -24.575 45.945  -79.244  1.00 79.35  ?  167 GLU C O     1 
ATOM   4342 C  CB    . GLU C 1 167 ? -26.640 46.136  -81.442  1.00 83.06  ?  167 GLU C CB    1 
ATOM   4343 C  CG    . GLU C 1 167 ? -27.319 46.275  -82.792  1.00 99.38  ?  167 GLU C CG    1 
ATOM   4344 C  CD    . GLU C 1 167 ? -28.756 46.770  -82.784  1.00 130.36 ?  167 GLU C CD    1 
ATOM   4345 O  OE1   . GLU C 1 167 ? -29.194 47.334  -81.754  1.00 130.19 ?  167 GLU C OE1   1 
ATOM   4346 O  OE2   . GLU C 1 167 ? -29.441 46.605  -83.821  1.00 124.86 -1 167 GLU C OE2   1 
ATOM   4347 N  N     . VAL C 1 168 ? -23.293 46.907  -80.843  1.00 73.34  ?  168 VAL C N     1 
ATOM   4348 C  CA    . VAL C 1 168 ? -22.361 47.570  -79.931  1.00 70.83  ?  168 VAL C CA    1 
ATOM   4349 C  C     . VAL C 1 168 ? -22.601 49.078  -79.984  1.00 75.81  ?  168 VAL C C     1 
ATOM   4350 O  O     . VAL C 1 168 ? -22.743 49.651  -81.070  1.00 76.51  ?  168 VAL C O     1 
ATOM   4351 C  CB    . VAL C 1 168 ? -20.883 47.201  -80.217  1.00 72.80  ?  168 VAL C CB    1 
ATOM   4352 C  CG1   . VAL C 1 168 ? -19.935 47.865  -79.224  1.00 70.25  ?  168 VAL C CG1   1 
ATOM   4353 C  CG2   . VAL C 1 168 ? -20.688 45.694  -80.200  1.00 74.01  ?  168 VAL C CG2   1 
ATOM   4354 N  N     . LYS C 1 169 ? -22.677 49.707  -78.806  1.00 71.92  ?  169 LYS C N     1 
ATOM   4355 C  CA    . LYS C 1 169 ? -22.866 51.141  -78.657  1.00 71.59  ?  169 LYS C CA    1 
ATOM   4356 C  C     . LYS C 1 169 ? -21.816 51.636  -77.677  1.00 74.35  ?  169 LYS C C     1 
ATOM   4357 O  O     . LYS C 1 169 ? -21.830 51.251  -76.505  1.00 74.54  ?  169 LYS C O     1 
ATOM   4358 C  CB    . LYS C 1 169 ? -24.292 51.465  -78.181  1.00 76.12  ?  169 LYS C CB    1 
ATOM   4359 C  CG    . LYS C 1 169 ? -25.321 51.450  -79.305  1.00 94.57  ?  169 LYS C CG    1 
ATOM   4360 C  CD    . LYS C 1 169 ? -26.731 51.707  -78.780  1.00 107.42 ?  169 LYS C CD    1 
ATOM   4361 C  CE    . LYS C 1 169 ? -27.777 51.734  -79.872  1.00 121.53 ?  169 LYS C CE    1 
ATOM   4362 N  NZ    . LYS C 1 169 ? -28.080 50.374  -80.399  1.00 132.33 ?  169 LYS C NZ    1 
ATOM   4363 N  N     . SER C 1 170 ? -20.858 52.421  -78.174  1.00 69.31  ?  170 SER C N     1 
ATOM   4364 C  CA    . SER C 1 170 ? -19.790 52.957  -77.342  1.00 67.40  ?  170 SER C CA    1 
ATOM   4365 C  C     . SER C 1 170 ? -20.053 54.420  -77.036  1.00 70.05  ?  170 SER C C     1 
ATOM   4366 O  O     . SER C 1 170 ? -20.482 55.169  -77.921  1.00 70.95  ?  170 SER C O     1 
ATOM   4367 C  CB    . SER C 1 170 ? -18.439 52.761  -78.013  1.00 70.69  ?  170 SER C CB    1 
ATOM   4368 O  OG    . SER C 1 170 ? -18.167 51.383  -78.199  1.00 79.82  ?  170 SER C OG    1 
ATOM   4369 N  N     . TYR C 1 171 ? -19.828 54.814  -75.772  1.00 64.57  ?  171 TYR C N     1 
ATOM   4370 C  CA    . TYR C 1 171 ? -20.085 56.164  -75.277  1.00 64.62  ?  171 TYR C CA    1 
ATOM   4371 C  C     . TYR C 1 171 ? -18.893 56.767  -74.561  1.00 65.98  ?  171 TYR C C     1 
ATOM   4372 O  O     . TYR C 1 171 ? -18.060 56.044  -74.011  1.00 64.01  ?  171 TYR C O     1 
ATOM   4373 C  CB    . TYR C 1 171 ? -21.267 56.151  -74.287  1.00 67.10  ?  171 TYR C CB    1 
ATOM   4374 C  CG    . TYR C 1 171 ? -22.549 55.562  -74.822  1.00 69.78  ?  171 TYR C CG    1 
ATOM   4375 C  CD1   . TYR C 1 171 ? -22.799 54.198  -74.737  1.00 70.37  ?  171 TYR C CD1   1 
ATOM   4376 C  CD2   . TYR C 1 171 ? -23.538 56.377  -75.361  1.00 73.80  ?  171 TYR C CD2   1 
ATOM   4377 C  CE1   . TYR C 1 171 ? -23.989 53.651  -75.215  1.00 73.31  ?  171 TYR C CE1   1 
ATOM   4378 C  CE2   . TYR C 1 171 ? -24.733 55.843  -75.843  1.00 76.93  ?  171 TYR C CE2   1 
ATOM   4379 C  CZ    . TYR C 1 171 ? -24.956 54.478  -75.766  1.00 83.71  ?  171 TYR C CZ    1 
ATOM   4380 O  OH    . TYR C 1 171 ? -26.135 53.942  -76.223  1.00 86.25  ?  171 TYR C OH    1 
ATOM   4381 N  N     . VAL C 1 172 ? -18.847 58.108  -74.531  1.00 63.17  ?  172 VAL C N     1 
ATOM   4382 C  CA    . VAL C 1 172 ? -17.867 58.903  -73.796  1.00 63.25  ?  172 VAL C CA    1 
ATOM   4383 C  C     . VAL C 1 172 ? -18.721 59.934  -73.039  1.00 71.58  ?  172 VAL C C     1 
ATOM   4384 O  O     . VAL C 1 172 ? -19.277 60.823  -73.679  1.00 72.97  ?  172 VAL C O     1 
ATOM   4385 C  CB    . VAL C 1 172 ? -16.798 59.565  -74.707  1.00 66.39  ?  172 VAL C CB    1 
ATOM   4386 C  CG1   . VAL C 1 172 ? -15.909 60.513  -73.911  1.00 67.06  ?  172 VAL C CG1   1 
ATOM   4387 C  CG2   . VAL C 1 172 ? -15.944 58.523  -75.420  1.00 64.45  ?  172 VAL C CG2   1 
ATOM   4388 N  N     . LYS C 1 173 ? -18.861 59.793  -71.693  1.00 70.31  ?  173 LYS C N     1 
ATOM   4389 C  CA    . LYS C 1 173 ? -19.668 60.670  -70.818  1.00 73.26  ?  173 LYS C CA    1 
ATOM   4390 C  C     . LYS C 1 173 ? -21.109 60.752  -71.362  1.00 83.29  ?  173 LYS C C     1 
ATOM   4391 O  O     . LYS C 1 173 ? -21.612 61.858  -71.617  1.00 86.88  ?  173 LYS C O     1 
ATOM   4392 C  CB    . LYS C 1 173 ? -19.059 62.094  -70.704  1.00 76.58  ?  173 LYS C CB    1 
ATOM   4393 C  CG    . LYS C 1 173 ? -17.745 62.238  -69.958  1.00 84.78  ?  173 LYS C CG    1 
ATOM   4394 C  CD    . LYS C 1 173 ? -17.368 63.721  -69.793  1.00 97.84  ?  173 LYS C CD    1 
ATOM   4395 C  CE    . LYS C 1 173 ? -15.948 64.094  -70.210  1.00 110.49 ?  173 LYS C CE    1 
ATOM   4396 N  NZ    . LYS C 1 173 ? -14.923 63.652  -69.229  1.00 116.88 ?  173 LYS C NZ    1 
ATOM   4397 N  N     . HIS C 1 174 ? -21.751 59.584  -71.587  1.00 80.31  ?  174 HIS C N     1 
ATOM   4398 C  CA    . HIS C 1 174 ? -23.098 59.473  -72.182  1.00 82.63  ?  174 HIS C CA    1 
ATOM   4399 C  C     . HIS C 1 174 ? -23.358 60.333  -73.453  1.00 85.03  ?  174 HIS C C     1 
ATOM   4400 O  O     . HIS C 1 174 ? -24.277 61.150  -73.512  1.00 86.15  ?  174 HIS C O     1 
ATOM   4401 C  CB    . HIS C 1 174 ? -24.279 59.435  -71.167  1.00 86.52  ?  174 HIS C CB    1 
ATOM   4402 C  CG    . HIS C 1 174 ? -24.328 60.545  -70.160  1.00 92.81  ?  174 HIS C CG    1 
ATOM   4403 N  ND1   . HIS C 1 174 ? -24.499 60.280  -68.812  1.00 95.57  ?  174 HIS C ND1   1 
ATOM   4404 C  CD2   . HIS C 1 174 ? -24.282 61.887  -70.341  1.00 97.20  ?  174 HIS C CD2   1 
ATOM   4405 C  CE1   . HIS C 1 174 ? -24.503 61.461  -68.213  1.00 97.72  ?  174 HIS C CE1   1 
ATOM   4406 N  NE2   . HIS C 1 174 ? -24.367 62.457  -69.092  1.00 99.16  ?  174 HIS C NE2   1 
ATOM   4407 N  N     . THR C 1 175 ? -22.482 60.126  -74.448  1.00 79.23  ?  175 THR C N     1 
ATOM   4408 C  CA    . THR C 1 175 ? -22.451 60.698  -75.795  1.00 79.28  ?  175 THR C CA    1 
ATOM   4409 C  C     . THR C 1 175 ? -22.024 59.549  -76.716  1.00 81.00  ?  175 THR C C     1 
ATOM   4410 O  O     . THR C 1 175 ? -20.887 59.074  -76.614  1.00 77.93  ?  175 THR C O     1 
ATOM   4411 C  CB    . THR C 1 175 ? -21.459 61.873  -75.872  1.00 82.75  ?  175 THR C CB    1 
ATOM   4412 O  OG1   . THR C 1 175 ? -21.746 62.810  -74.836  1.00 87.72  ?  175 THR C OG1   1 
ATOM   4413 C  CG2   . THR C 1 175 ? -21.472 62.564  -77.215  1.00 79.27  ?  175 THR C CG2   1 
ATOM   4414 N  N     . LEU C 1 176 ? -22.946 59.079  -77.581  1.00 78.76  ?  176 LEU C N     1 
ATOM   4415 C  CA    . LEU C 1 176 ? -22.671 57.987  -78.514  1.00 77.00  ?  176 LEU C CA    1 
ATOM   4416 C  C     . LEU C 1 176 ? -21.596 58.424  -79.495  1.00 80.73  ?  176 LEU C C     1 
ATOM   4417 O  O     . LEU C 1 176 ? -21.768 59.417  -80.202  1.00 83.21  ?  176 LEU C O     1 
ATOM   4418 C  CB    . LEU C 1 176 ? -23.946 57.528  -79.242  1.00 78.69  ?  176 LEU C CB    1 
ATOM   4419 C  CG    . LEU C 1 176 ? -23.805 56.294  -80.137  1.00 82.53  ?  176 LEU C CG    1 
ATOM   4420 C  CD1   . LEU C 1 176 ? -23.851 55.011  -79.325  1.00 81.55  ?  176 LEU C CD1   1 
ATOM   4421 C  CD2   . LEU C 1 176 ? -24.878 56.272  -81.203  1.00 87.66  ?  176 LEU C CD2   1 
ATOM   4422 N  N     . VAL C 1 177 ? -20.463 57.719  -79.472  1.00 74.04  ?  177 VAL C N     1 
ATOM   4423 C  CA    . VAL C 1 177 ? -19.293 58.006  -80.303  1.00 72.83  ?  177 VAL C CA    1 
ATOM   4424 C  C     . VAL C 1 177 ? -19.072 56.931  -81.367  1.00 75.75  ?  177 VAL C C     1 
ATOM   4425 O  O     . VAL C 1 177 ? -18.452 57.198  -82.404  1.00 76.26  ?  177 VAL C O     1 
ATOM   4426 C  CB    . VAL C 1 177 ? -18.020 58.238  -79.443  1.00 75.09  ?  177 VAL C CB    1 
ATOM   4427 C  CG1   . VAL C 1 177 ? -18.131 59.522  -78.634  1.00 76.45  ?  177 VAL C CG1   1 
ATOM   4428 C  CG2   . VAL C 1 177 ? -17.713 57.046  -78.534  1.00 72.88  ?  177 VAL C CG2   1 
ATOM   4429 N  N     . PHE C 1 178 ? -19.569 55.714  -81.096  1.00 70.41  ?  178 PHE C N     1 
ATOM   4430 C  CA    . PHE C 1 178 ? -19.406 54.556  -81.963  1.00 68.98  ?  178 PHE C CA    1 
ATOM   4431 C  C     . PHE C 1 178 ? -20.617 53.649  -81.899  1.00 74.04  ?  178 PHE C C     1 
ATOM   4432 O  O     . PHE C 1 178 ? -21.184 53.432  -80.825  1.00 74.00  ?  178 PHE C O     1 
ATOM   4433 C  CB    . PHE C 1 178 ? -18.133 53.790  -81.556  1.00 68.25  ?  178 PHE C CB    1 
ATOM   4434 C  CG    . PHE C 1 178 ? -17.831 52.524  -82.315  1.00 68.82  ?  178 PHE C CG    1 
ATOM   4435 C  CD1   . PHE C 1 178 ? -18.364 51.307  -81.907  1.00 70.68  ?  178 PHE C CD1   1 
ATOM   4436 C  CD2   . PHE C 1 178 ? -16.970 52.538  -83.407  1.00 71.22  ?  178 PHE C CD2   1 
ATOM   4437 C  CE1   . PHE C 1 178 ? -18.076 50.134  -82.603  1.00 73.78  ?  178 PHE C CE1   1 
ATOM   4438 C  CE2   . PHE C 1 178 ? -16.670 51.360  -84.094  1.00 72.24  ?  178 PHE C CE2   1 
ATOM   4439 C  CZ    . PHE C 1 178 ? -17.216 50.165  -83.679  1.00 71.72  ?  178 PHE C CZ    1 
ATOM   4440 N  N     . LYS C 1 179 ? -20.977 53.092  -83.055  1.00 71.66  ?  179 LYS C N     1 
ATOM   4441 C  CA    . LYS C 1 179 ? -22.072 52.147  -83.227  1.00 73.31  ?  179 LYS C CA    1 
ATOM   4442 C  C     . LYS C 1 179 ? -21.556 51.057  -84.159  1.00 78.20  ?  179 LYS C C     1 
ATOM   4443 O  O     . LYS C 1 179 ? -20.923 51.358  -85.176  1.00 78.09  ?  179 LYS C O     1 
ATOM   4444 C  CB    . LYS C 1 179 ? -23.310 52.846  -83.815  1.00 78.44  ?  179 LYS C CB    1 
ATOM   4445 C  CG    . LYS C 1 179 ? -24.628 52.147  -83.523  1.00 96.71  ?  179 LYS C CG    1 
ATOM   4446 C  CD    . LYS C 1 179 ? -25.815 52.988  -83.993  1.00 109.87 ?  179 LYS C CD    1 
ATOM   4447 C  CE    . LYS C 1 179 ? -26.366 52.551  -85.331  1.00 119.98 ?  179 LYS C CE    1 
ATOM   4448 N  NZ    . LYS C 1 179 ? -27.351 53.529  -85.862  1.00 128.58 ?  179 LYS C NZ    1 
ATOM   4449 N  N     . GLY C 1 180 ? -21.795 49.807  -83.787  1.00 75.40  ?  180 GLY C N     1 
ATOM   4450 C  CA    . GLY C 1 180 ? -21.333 48.672  -84.571  1.00 76.12  ?  180 GLY C CA    1 
ATOM   4451 C  C     . GLY C 1 180 ? -22.227 47.456  -84.510  1.00 82.21  ?  180 GLY C C     1 
ATOM   4452 O  O     . GLY C 1 180 ? -22.645 47.032  -83.430  1.00 82.45  ?  180 GLY C O     1 
ATOM   4453 N  N     . ASN C 1 181 ? -22.493 46.873  -85.677  1.00 79.93  ?  181 ASN C N     1 
ATOM   4454 C  CA    . ASN C 1 181 ? -23.311 45.676  -85.823  1.00 82.07  ?  181 ASN C CA    1 
ATOM   4455 C  C     . ASN C 1 181 ? -22.379 44.516  -86.139  1.00 85.61  ?  181 ASN C C     1 
ATOM   4456 O  O     . ASN C 1 181 ? -21.551 44.628  -87.043  1.00 84.95  ?  181 ASN C O     1 
ATOM   4457 C  CB    . ASN C 1 181 ? -24.370 45.883  -86.906  1.00 85.44  ?  181 ASN C CB    1 
ATOM   4458 C  CG    . ASN C 1 181 ? -25.402 46.911  -86.514  1.00 107.77 ?  181 ASN C CG    1 
ATOM   4459 O  OD1   . ASN C 1 181 ? -26.475 46.582  -85.994  1.00 102.15 ?  181 ASN C OD1   1 
ATOM   4460 N  ND2   . ASN C 1 181 ? -25.090 48.184  -86.735  1.00 99.17  ?  181 ASN C ND2   1 
ATOM   4461 N  N     . PHE C 1 182 ? -22.465 43.433  -85.354  1.00 82.26  ?  182 PHE C N     1 
ATOM   4462 C  CA    . PHE C 1 182 ? -21.580 42.284  -85.494  1.00 82.71  ?  182 PHE C CA    1 
ATOM   4463 C  C     . PHE C 1 182 ? -22.304 40.980  -85.797  1.00 91.58  ?  182 PHE C C     1 
ATOM   4464 O  O     . PHE C 1 182 ? -23.323 40.668  -85.174  1.00 92.92  ?  182 PHE C O     1 
ATOM   4465 C  CB    . PHE C 1 182 ? -20.709 42.143  -84.240  1.00 82.19  ?  182 PHE C CB    1 
ATOM   4466 C  CG    . PHE C 1 182 ? -19.629 43.196  -84.112  1.00 80.62  ?  182 PHE C CG    1 
ATOM   4467 C  CD1   . PHE C 1 182 ? -19.934 44.484  -83.682  1.00 80.62  ?  182 PHE C CD1   1 
ATOM   4468 C  CD2   . PHE C 1 182 ? -18.302 42.896  -84.410  1.00 83.46  ?  182 PHE C CD2   1 
ATOM   4469 C  CE1   . PHE C 1 182 ? -18.935 45.461  -83.573  1.00 81.10  ?  182 PHE C CE1   1 
ATOM   4470 C  CE2   . PHE C 1 182 ? -17.300 43.871  -84.287  1.00 82.02  ?  182 PHE C CE2   1 
ATOM   4471 C  CZ    . PHE C 1 182 ? -17.624 45.147  -83.873  1.00 78.94  ?  182 PHE C CZ    1 
ATOM   4472 N  N     . LYS C 1 183 ? -21.768 40.224  -86.765  1.00 90.73  ?  183 LYS C N     1 
ATOM   4473 C  CA    . LYS C 1 183 ? -22.283 38.918  -87.170  1.00 95.12  ?  183 LYS C CA    1 
ATOM   4474 C  C     . LYS C 1 183 ? -21.252 37.896  -86.687  1.00 100.97 ?  183 LYS C C     1 
ATOM   4475 O  O     . LYS C 1 183 ? -20.212 37.690  -87.322  1.00 100.49 ?  183 LYS C O     1 
ATOM   4476 C  CB    . LYS C 1 183 ? -22.518 38.856  -88.696  1.00 99.88  ?  183 LYS C CB    1 
ATOM   4477 C  CG    . LYS C 1 183 ? -23.147 37.556  -89.184  1.00 115.01 ?  183 LYS C CG    1 
ATOM   4478 C  CD    . LYS C 1 183 ? -23.468 37.606  -90.663  1.00 127.02 ?  183 LYS C CD    1 
ATOM   4479 C  CE    . LYS C 1 183 ? -24.169 36.356  -91.133  1.00 142.40 ?  183 LYS C CE    1 
ATOM   4480 N  NZ    . LYS C 1 183 ? -24.676 36.499  -92.523  1.00 154.60 ?  183 LYS C NZ    1 
HETATM 4481 N  N     . MSE C 1 184 ? -21.525 37.319  -85.514  1.00 99.46  ?  184 MSE C N     1 
HETATM 4482 C  CA    . MSE C 1 184 ? -20.638 36.376  -84.844  1.00 101.02 ?  184 MSE C CA    1 
HETATM 4483 C  C     . MSE C 1 184 ? -21.034 34.946  -85.141  1.00 110.54 ?  184 MSE C C     1 
HETATM 4484 O  O     . MSE C 1 184 ? -22.139 34.533  -84.798  1.00 112.17 ?  184 MSE C O     1 
HETATM 4485 C  CB    . MSE C 1 184 ? -20.645 36.617  -83.319  1.00 101.72 ?  184 MSE C CB    1 
HETATM 4486 C  CG    . MSE C 1 184 ? -20.393 38.066  -82.912  1.00 105.10 ?  184 MSE C CG    1 
HETATM 4487 SE SE    . MSE C 1 184 ? -18.680 38.737  -83.546  1.00 111.68 ?  184 MSE C SE    1 
HETATM 4488 C  CE    . MSE C 1 184 ? -17.483 37.761  -82.364  1.00 109.21 ?  184 MSE C CE    1 
ATOM   4489 N  N     . PHE C 1 185 ? -20.138 34.185  -85.773  1.00 110.31 ?  185 PHE C N     1 
ATOM   4490 C  CA    . PHE C 1 185 ? -20.380 32.773  -86.048  1.00 116.13 ?  185 PHE C CA    1 
ATOM   4491 C  C     . PHE C 1 185 ? -20.101 31.988  -84.769  1.00 122.95 ?  185 PHE C C     1 
ATOM   4492 O  O     . PHE C 1 185 ? -19.109 32.260  -84.087  1.00 120.30 ?  185 PHE C O     1 
ATOM   4493 C  CB    . PHE C 1 185 ? -19.489 32.269  -87.199  1.00 120.21 ?  185 PHE C CB    1 
ATOM   4494 C  CG    . PHE C 1 185 ? -19.337 30.764  -87.279  1.00 127.51 ?  185 PHE C CG    1 
ATOM   4495 C  CD1   . PHE C 1 185 ? -20.361 29.971  -87.781  1.00 135.30 ?  185 PHE C CD1   1 
ATOM   4496 C  CD2   . PHE C 1 185 ? -18.176 30.142  -86.837  1.00 130.89 ?  185 PHE C CD2   1 
ATOM   4497 C  CE1   . PHE C 1 185 ? -20.231 28.581  -87.832  1.00 142.01 ?  185 PHE C CE1   1 
ATOM   4498 C  CE2   . PHE C 1 185 ? -18.045 28.751  -86.890  1.00 139.57 ?  185 PHE C CE2   1 
ATOM   4499 C  CZ    . PHE C 1 185 ? -19.072 27.980  -87.389  1.00 142.30 ?  185 PHE C CZ    1 
ATOM   4500 N  N     . TYR C 1 186 ? -20.961 31.010  -84.456  1.00 124.62 ?  186 TYR C N     1 
ATOM   4501 C  CA    . TYR C 1 186 ? -20.795 30.177  -83.270  1.00 127.01 ?  186 TYR C CA    1 
ATOM   4502 C  C     . TYR C 1 186 ? -20.945 28.691  -83.582  1.00 138.62 ?  186 TYR C C     1 
ATOM   4503 O  O     . TYR C 1 186 ? -21.735 28.316  -84.453  1.00 141.44 ?  186 TYR C O     1 
ATOM   4504 C  CB    . TYR C 1 186 ? -21.732 30.633  -82.134  1.00 126.58 ?  186 TYR C CB    1 
ATOM   4505 C  CG    . TYR C 1 186 ? -23.165 30.149  -82.238  1.00 132.04 ?  186 TYR C CG    1 
ATOM   4506 C  CD1   . TYR C 1 186 ? -24.045 30.712  -83.159  1.00 132.53 ?  186 TYR C CD1   1 
ATOM   4507 C  CD2   . TYR C 1 186 ? -23.647 29.151  -81.400  1.00 138.24 ?  186 TYR C CD2   1 
ATOM   4508 C  CE1   . TYR C 1 186 ? -25.369 30.284  -83.246  1.00 137.32 ?  186 TYR C CE1   1 
ATOM   4509 C  CE2   . TYR C 1 186 ? -24.968 28.716  -81.477  1.00 142.82 ?  186 TYR C CE2   1 
ATOM   4510 C  CZ    . TYR C 1 186 ? -25.826 29.285  -82.404  1.00 148.87 ?  186 TYR C CZ    1 
ATOM   4511 O  OH    . TYR C 1 186 ? -27.128 28.853  -82.486  1.00 154.42 ?  186 TYR C OH    1 
ATOM   4512 N  N     . ASP C 1 187 ? -20.177 27.851  -82.871  1.00 138.48 ?  187 ASP C N     1 
ATOM   4513 C  CA    . ASP C 1 187 ? -20.206 26.397  -83.030  1.00 145.41 ?  187 ASP C CA    1 
ATOM   4514 C  C     . ASP C 1 187 ? -20.037 25.711  -81.673  1.00 151.78 ?  187 ASP C C     1 
ATOM   4515 O  O     . ASP C 1 187 ? -19.107 26.034  -80.930  1.00 148.80 ?  187 ASP C O     1 
ATOM   4516 C  CB    . ASP C 1 187 ? -19.144 25.935  -84.052  1.00 149.37 ?  187 ASP C CB    1 
ATOM   4517 C  CG    . ASP C 1 187 ? -19.122 24.449  -84.371  1.00 166.96 ?  187 ASP C CG    1 
ATOM   4518 O  OD1   . ASP C 1 187 ? -20.204 23.817  -84.350  1.00 177.21 -1 187 ASP C OD1   1 
ATOM   4519 O  OD2   . ASP C 1 187 ? -18.029 23.925  -84.674  1.00 169.52 ?  187 ASP C OD2   1 
ATOM   4520 N  N     . LYS C 1 188 ? -20.947 24.770  -81.354  1.00 153.85 ?  188 LYS C N     1 
ATOM   4521 C  CA    . LYS C 1 188 ? -20.969 24.017  -80.091  1.00 157.28 ?  188 LYS C CA    1 
ATOM   4522 C  C     . LYS C 1 188 ? -19.972 22.828  -80.075  1.00 167.62 ?  188 LYS C C     1 
ATOM   4523 O  O     . LYS C 1 188 ? -20.278 21.758  -79.538  1.00 173.32 ?  188 LYS C O     1 
ATOM   4524 C  CB    . LYS C 1 188 ? -22.406 23.565  -79.747  1.00 163.32 ?  188 LYS C CB    1 
ATOM   4525 C  CG    . LYS C 1 188 ? -23.434 24.693  -79.665  1.00 165.97 ?  188 LYS C CG    1 
ATOM   4526 C  CD    . LYS C 1 188 ? -24.775 24.189  -79.155  1.00 175.66 ?  188 LYS C CD    1 
ATOM   4527 C  CE    . LYS C 1 188 ? -25.848 25.246  -79.212  1.00 177.88 ?  188 LYS C CE    1 
ATOM   4528 N  NZ    . LYS C 1 188 ? -26.475 25.320  -80.556  1.00 184.99 ?  188 LYS C NZ    1 
ATOM   4529 N  N     . ARG C 1 189 ? -18.756 23.051  -80.612  1.00 162.54 ?  189 ARG C N     1 
ATOM   4530 C  CA    . ARG C 1 189 ? -17.677 22.064  -80.672  1.00 169.11 ?  189 ARG C CA    1 
ATOM   4531 C  C     . ARG C 1 189 ? -16.337 22.732  -80.322  1.00 170.47 ?  189 ARG C C     1 
ATOM   4532 O  O     . ARG C 1 189 ? -15.673 22.267  -79.371  1.00 172.00 ?  189 ARG C O     1 
ATOM   4533 C  CB    . ARG C 1 189 ? -17.636 21.389  -82.059  1.00 173.76 ?  189 ARG C CB    1 
ATOM   4534 C  CG    . ARG C 1 189 ? -16.717 20.174  -82.137  1.00 189.43 ?  189 ARG C CG    1 
ATOM   4535 C  CD    . ARG C 1 189 ? -16.801 19.478  -83.481  1.00 195.78 ?  189 ARG C CD    1 
ATOM   4536 N  NE    . ARG C 1 189 ? -17.937 18.556  -83.552  1.00 203.83 ?  189 ARG C NE    1 
ATOM   4537 C  CZ    . ARG C 1 189 ? -18.137 17.679  -84.531  1.00 215.21 ?  189 ARG C CZ    1 
ATOM   4538 N  NH1   . ARG C 1 189 ? -17.276 17.589  -85.538  1.00 208.62 ?  189 ARG C NH1   1 
ATOM   4539 N  NH2   . ARG C 1 189 ? -19.196 16.882  -84.510  1.00 208.18 ?  189 ARG C NH2   1 
ATOM   4540 N  N     . GLY C 1 190 ? -15.978 23.743  -80.967  1.00 183.65 ?  190 GLY C N     1 
ATOM   4541 N  N     . LYS D 1 7   ? 14.077  2.869   -50.280  1.00 189.94 ?  7   LYS D N     1 
ATOM   4542 C  CA    . LYS D 1 7   ? 13.156  2.279   -51.253  1.00 193.20 ?  7   LYS D CA    1 
ATOM   4543 C  C     . LYS D 1 7   ? 13.460  2.662   -52.712  1.00 194.19 ?  7   LYS D C     1 
ATOM   4544 O  O     . LYS D 1 7   ? 13.313  1.818   -53.603  1.00 196.23 ?  7   LYS D O     1 
ATOM   4545 C  CB    . LYS D 1 7   ? 11.696  2.616   -50.898  1.00 195.33 ?  7   LYS D CB    1 
ATOM   4546 C  CG    . LYS D 1 7   ? 11.100  1.747   -49.798  1.00 207.79 ?  7   LYS D CG    1 
ATOM   4547 C  CD    . LYS D 1 7   ? 10.560  0.421   -50.329  1.00 219.10 ?  7   LYS D CD    1 
ATOM   4548 C  CE    . LYS D 1 7   ? 9.937   -0.424  -49.250  1.00 229.23 ?  7   LYS D CE    1 
ATOM   4549 N  NZ    . LYS D 1 7   ? 9.566   -1.769  -49.759  1.00 241.17 ?  7   LYS D NZ    1 
ATOM   4550 N  N     . LEU D 1 8   ? 13.876  3.921   -52.957  1.00 189.70 ?  8   LEU D N     1 
ATOM   4551 C  CA    . LEU D 1 8   ? 14.169  4.417   -54.306  1.00 190.21 ?  8   LEU D CA    1 
ATOM   4552 C  C     . LEU D 1 8   ? 15.648  4.356   -54.695  1.00 190.51 ?  8   LEU D C     1 
ATOM   4553 O  O     . LEU D 1 8   ? 16.494  4.960   -54.029  1.00 192.33 ?  8   LEU D O     1 
ATOM   4554 C  CB    . LEU D 1 8   ? 13.613  5.842   -54.509  1.00 194.04 ?  8   LEU D CB    1 
ATOM   4555 C  CG    . LEU D 1 8   ? 12.091  6.009   -54.522  1.00 194.00 ?  8   LEU D CG    1 
ATOM   4556 C  CD1   . LEU D 1 8   ? 11.711  7.467   -54.360  1.00 197.53 ?  8   LEU D CD1   1 
ATOM   4557 C  CD2   . LEU D 1 8   ? 11.481  5.455   -55.802  1.00 192.27 ?  8   LEU D CD2   1 
ATOM   4558 N  N     . LYS D 1 9   ? 15.946  3.647   -55.796  1.00 188.38 ?  9   LYS D N     1 
ATOM   4559 C  CA    . LYS D 1 9   ? 17.301  3.531   -56.342  1.00 188.16 ?  9   LYS D CA    1 
ATOM   4560 C  C     . LYS D 1 9   ? 17.608  4.779   -57.195  1.00 191.69 ?  9   LYS D C     1 
ATOM   4561 O  O     . LYS D 1 9   ? 16.683  5.522   -57.534  1.00 194.39 ?  9   LYS D O     1 
ATOM   4562 C  CB    . LYS D 1 9   ? 17.451  2.247   -57.170  1.00 193.96 ?  9   LYS D CB    1 
ATOM   4563 C  CG    . LYS D 1 9   ? 17.279  0.964   -56.362  1.00 206.41 ?  9   LYS D CG    1 
ATOM   4564 C  CD    . LYS D 1 9   ? 17.271  -0.243  -57.277  1.00 220.54 ?  9   LYS D CD    1 
ATOM   4565 C  CE    . LYS D 1 9   ? 18.598  -0.965  -57.343  1.00 234.28 ?  9   LYS D CE    1 
ATOM   4566 N  NZ    . LYS D 1 9   ? 18.673  -2.089  -56.371  1.00 242.72 ?  9   LYS D NZ    1 
ATOM   4567 N  N     . LYS D 1 10  ? 18.900  5.014   -57.516  1.00 191.85 ?  10  LYS D N     1 
ATOM   4568 C  CA    . LYS D 1 10  ? 19.415  6.149   -58.298  1.00 195.07 ?  10  LYS D CA    1 
ATOM   4569 C  C     . LYS D 1 10  ? 18.487  6.635   -59.428  1.00 195.99 ?  10  LYS D C     1 
ATOM   4570 O  O     . LYS D 1 10  ? 18.016  7.770   -59.369  1.00 197.30 ?  10  LYS D O     1 
ATOM   4571 C  CB    . LYS D 1 10  ? 20.842  5.846   -58.800  1.00 194.36 ?  10  LYS D CB    1 
ATOM   4572 C  CG    . LYS D 1 10  ? 21.502  6.936   -59.641  1.00 200.02 ?  10  LYS D CG    1 
ATOM   4573 C  CD    . LYS D 1 10  ? 22.781  6.413   -60.267  1.00 199.21 ?  10  LYS D CD    1 
ATOM   4574 C  CE    . LYS D 1 10  ? 22.842  6.612   -61.764  1.00 197.97 ?  10  LYS D CE    1 
ATOM   4575 N  NZ    . LYS D 1 10  ? 24.097  7.292   -62.161  1.00 200.59 ?  10  LYS D NZ    1 
ATOM   4576 N  N     . ASP D 1 11  ? 18.200  5.772   -60.418  1.00 192.43 ?  11  ASP D N     1 
ATOM   4577 C  CA    . ASP D 1 11  ? 17.346  6.102   -61.563  1.00 192.25 ?  11  ASP D CA    1 
ATOM   4578 C  C     . ASP D 1 11  ? 15.896  6.418   -61.188  1.00 194.12 ?  11  ASP D C     1 
ATOM   4579 O  O     . ASP D 1 11  ? 15.340  7.387   -61.707  1.00 195.69 ?  11  ASP D O     1 
ATOM   4580 C  CB    . ASP D 1 11  ? 17.419  5.010   -62.649  1.00 190.40 ?  11  ASP D CB    1 
ATOM   4581 C  CG    . ASP D 1 11  ? 18.714  4.976   -63.448  1.00 196.28 ?  11  ASP D CG    1 
ATOM   4582 O  OD1   . ASP D 1 11  ? 19.453  5.992   -63.435  1.00 194.86 ?  11  ASP D OD1   1 
ATOM   4583 O  OD2   . ASP D 1 11  ? 18.976  3.945   -64.109  1.00 201.03 -1 11  ASP D OD2   1 
ATOM   4584 N  N     . LYS D 1 12  ? 15.295  5.613   -60.285  1.00 192.65 ?  12  LYS D N     1 
ATOM   4585 C  CA    . LYS D 1 12  ? 13.914  5.782   -59.815  1.00 193.34 ?  12  LYS D CA    1 
ATOM   4586 C  C     . LYS D 1 12  ? 13.737  7.078   -59.028  1.00 197.66 ?  12  LYS D C     1 
ATOM   4587 O  O     . LYS D 1 12  ? 12.726  7.760   -59.209  1.00 196.08 ?  12  LYS D O     1 
ATOM   4588 C  CB    . LYS D 1 12  ? 13.453  4.573   -58.982  1.00 192.56 ?  12  LYS D CB    1 
ATOM   4589 C  CG    . LYS D 1 12  ? 13.237  3.312   -59.810  1.00 205.38 ?  12  LYS D CG    1 
ATOM   4590 C  CD    . LYS D 1 12  ? 11.922  2.631   -59.497  1.00 216.64 ?  12  LYS D CD    1 
ATOM   4591 C  CE    . LYS D 1 12  ? 11.743  1.405   -60.356  1.00 232.61 ?  12  LYS D CE    1 
ATOM   4592 N  NZ    . LYS D 1 12  ? 10.478  0.689   -60.048  1.00 243.17 ?  12  LYS D NZ    1 
ATOM   4593 N  N     . ARG D 1 13  ? 14.727  7.421   -58.173  1.00 194.33 ?  13  ARG D N     1 
ATOM   4594 C  CA    . ARG D 1 13  ? 14.739  8.637   -57.353  1.00 191.69 ?  13  ARG D CA    1 
ATOM   4595 C  C     . ARG D 1 13  ? 14.792  9.876   -58.240  1.00 191.91 ?  13  ARG D C     1 
ATOM   4596 O  O     . ARG D 1 13  ? 14.025  10.813  -58.021  1.00 190.13 ?  13  ARG D O     1 
ATOM   4597 C  CB    . ARG D 1 13  ? 15.937  8.636   -56.387  1.00 191.26 ?  13  ARG D CB    1 
ATOM   4598 C  CG    . ARG D 1 13  ? 15.887  9.759   -55.344  1.00 196.19 ?  13  ARG D CG    1 
ATOM   4599 C  CD    . ARG D 1 13  ? 17.202  10.156  -54.666  1.00 202.00 ?  13  ARG D CD    1 
ATOM   4600 N  NE    . ARG D 1 13  ? 18.318  9.215   -54.794  1.00 209.25 ?  13  ARG D NE    1 
ATOM   4601 C  CZ    . ARG D 1 13  ? 19.267  9.283   -55.724  1.00 218.43 ?  13  ARG D CZ    1 
ATOM   4602 N  NH1   . ARG D 1 13  ? 19.216  10.211  -56.668  1.00 206.58 ?  13  ARG D NH1   1 
ATOM   4603 N  NH2   . ARG D 1 13  ? 20.248  8.395   -55.745  1.00 211.04 ?  13  ARG D NH2   1 
ATOM   4604 N  N     . ARG D 1 14  ? 15.693  9.869   -59.241  1.00 189.60 ?  14  ARG D N     1 
ATOM   4605 C  CA    . ARG D 1 14  ? 15.878  10.967  -60.188  1.00 188.07 ?  14  ARG D CA    1 
ATOM   4606 C  C     . ARG D 1 14  ? 14.614  11.269  -60.982  1.00 190.44 ?  14  ARG D C     1 
ATOM   4607 O  O     . ARG D 1 14  ? 14.270  12.438  -61.142  1.00 189.42 ?  14  ARG D O     1 
ATOM   4608 C  CB    . ARG D 1 14  ? 17.063  10.698  -61.113  1.00 188.96 ?  14  ARG D CB    1 
ATOM   4609 C  CG    . ARG D 1 14  ? 18.397  10.933  -60.431  1.00 195.94 ?  14  ARG D CG    1 
ATOM   4610 C  CD    . ARG D 1 14  ? 19.539  10.411  -61.267  1.00 203.97 ?  14  ARG D CD    1 
ATOM   4611 N  NE    . ARG D 1 14  ? 20.834  10.806  -60.715  1.00 211.32 ?  14  ARG D NE    1 
ATOM   4612 C  CZ    . ARG D 1 14  ? 21.999  10.578  -61.310  1.00 216.54 ?  14  ARG D CZ    1 
ATOM   4613 N  NH1   . ARG D 1 14  ? 22.044  9.950   -62.479  1.00 210.71 ?  14  ARG D NH1   1 
ATOM   4614 N  NH2   . ARG D 1 14  ? 23.129  10.975  -60.744  1.00 210.89 ?  14  ARG D NH2   1 
ATOM   4615 N  N     . GLU D 1 15  ? 13.902  10.216  -61.438  1.00 190.09 ?  15  GLU D N     1 
ATOM   4616 C  CA    . GLU D 1 15  ? 12.642  10.316  -62.183  1.00 190.31 ?  15  GLU D CA    1 
ATOM   4617 C  C     . GLU D 1 15  ? 11.550  10.952  -61.305  1.00 191.13 ?  15  GLU D C     1 
ATOM   4618 O  O     . GLU D 1 15  ? 10.708  11.691  -61.818  1.00 190.29 ?  15  GLU D O     1 
ATOM   4619 C  CB    . GLU D 1 15  ? 12.203  8.929   -62.688  1.00 193.90 ?  15  GLU D CB    1 
ATOM   4620 C  CG    . GLU D 1 15  ? 11.149  8.970   -63.786  1.00 202.73 ?  15  GLU D CG    1 
ATOM   4621 C  CD    . GLU D 1 15  ? 10.735  7.635   -64.380  1.00 233.21 ?  15  GLU D CD    1 
ATOM   4622 O  OE1   . GLU D 1 15  ? 10.672  6.635   -63.630  1.00 234.35 ?  15  GLU D OE1   1 
ATOM   4623 O  OE2   . GLU D 1 15  ? 10.431  7.601   -65.594  1.00 232.56 -1 15  GLU D OE2   1 
ATOM   4624 N  N     . ALA D 1 16  ? 11.583  10.674  -59.988  1.00 188.12 ?  16  ALA D N     1 
ATOM   4625 C  CA    . ALA D 1 16  ? 10.644  11.220  -59.010  1.00 186.86 ?  16  ALA D CA    1 
ATOM   4626 C  C     . ALA D 1 16  ? 11.017  12.659  -58.642  1.00 187.59 ?  16  ALA D C     1 
ATOM   4627 O  O     . ALA D 1 16  ? 10.123  13.473  -58.406  1.00 186.85 ?  16  ALA D O     1 
ATOM   4628 C  CB    . ALA D 1 16  ? 10.607  10.343  -57.772  1.00 188.08 ?  16  ALA D CB    1 
ATOM   4629 N  N     . ILE D 1 17  ? 12.335  12.973  -58.610  1.00 184.34 ?  17  ILE D N     1 
ATOM   4630 C  CA    . ILE D 1 17  ? 12.863  14.313  -58.333  1.00 178.12 ?  17  ILE D CA    1 
ATOM   4631 C  C     . ILE D 1 17  ? 12.465  15.260  -59.469  1.00 178.18 ?  17  ILE D C     1 
ATOM   4632 O  O     . ILE D 1 17  ? 11.948  16.345  -59.191  1.00 173.29 ?  17  ILE D O     1 
ATOM   4633 C  CB    . ILE D 1 17  ? 14.401  14.283  -58.071  1.00 180.64 ?  17  ILE D CB    1 
ATOM   4634 C  CG1   . ILE D 1 17  ? 14.696  13.768  -56.650  1.00 182.44 ?  17  ILE D CG1   1 
ATOM   4635 C  CG2   . ILE D 1 17  ? 15.065  15.657  -58.303  1.00 174.95 ?  17  ILE D CG2   1 
ATOM   4636 C  CD1   . ILE D 1 17  ? 16.134  13.390  -56.395  1.00 189.34 ?  17  ILE D CD1   1 
ATOM   4637 N  N     . ARG D 1 18  ? 12.683  14.840  -60.743  1.00 176.86 ?  18  ARG D N     1 
ATOM   4638 C  CA    . ARG D 1 18  ? 12.344  15.632  -61.932  1.00 174.14 ?  18  ARG D CA    1 
ATOM   4639 C  C     . ARG D 1 18  ? 10.847  15.944  -61.996  1.00 176.38 ?  18  ARG D C     1 
ATOM   4640 O  O     . ARG D 1 18  ? 10.482  17.067  -62.345  1.00 172.28 ?  18  ARG D O     1 
ATOM   4641 C  CB    . ARG D 1 18  ? 12.839  14.967  -63.228  1.00 178.74 ?  18  ARG D CB    1 
ATOM   4642 C  CG    . ARG D 1 18  ? 12.911  15.940  -64.409  1.00 187.42 ?  18  ARG D CG    1 
ATOM   4643 C  CD    . ARG D 1 18  ? 13.247  15.274  -65.732  1.00 200.16 ?  18  ARG D CD    1 
ATOM   4644 N  NE    . ARG D 1 18  ? 12.172  14.403  -66.217  1.00 211.14 ?  18  ARG D NE    1 
ATOM   4645 C  CZ    . ARG D 1 18  ? 11.155  14.802  -66.977  1.00 221.38 ?  18  ARG D CZ    1 
ATOM   4646 N  NH1   . ARG D 1 18  ? 11.049  16.075  -67.343  1.00 213.97 ?  18  ARG D NH1   1 
ATOM   4647 N  NH2   . ARG D 1 18  ? 10.232  13.935  -67.370  1.00 215.05 ?  18  ARG D NH2   1 
ATOM   4648 N  N     . GLN D 1 19  ? 9.994   14.972  -61.619  1.00 176.29 ?  19  GLN D N     1 
ATOM   4649 C  CA    . GLN D 1 19  ? 8.544   15.148  -61.568  1.00 176.22 ?  19  GLN D CA    1 
ATOM   4650 C  C     . GLN D 1 19  ? 8.128   16.083  -60.430  1.00 174.30 ?  19  GLN D C     1 
ATOM   4651 O  O     . GLN D 1 19  ? 7.205   16.875  -60.613  1.00 171.53 ?  19  GLN D O     1 
ATOM   4652 C  CB    . GLN D 1 19  ? 7.832   13.798  -61.459  1.00 184.19 ?  19  GLN D CB    1 
ATOM   4653 C  CG    . GLN D 1 19  ? 7.691   13.099  -62.805  1.00 194.12 ?  19  GLN D CG    1 
ATOM   4654 C  CD    . GLN D 1 19  ? 7.215   11.678  -62.668  1.00 207.55 ?  19  GLN D CD    1 
ATOM   4655 O  OE1   . GLN D 1 19  ? 6.083   11.408  -62.254  1.00 204.07 ?  19  GLN D OE1   1 
ATOM   4656 N  NE2   . GLN D 1 19  ? 8.062   10.736  -63.048  1.00 202.25 ?  19  GLN D NE2   1 
ATOM   4657 N  N     . GLN D 1 20  ? 8.818   16.005  -59.271  1.00 169.30 ?  20  GLN D N     1 
ATOM   4658 C  CA    . GLN D 1 20  ? 8.555   16.851  -58.101  1.00 164.65 ?  20  GLN D CA    1 
ATOM   4659 C  C     . GLN D 1 20  ? 8.893   18.324  -58.387  1.00 162.36 ?  20  GLN D C     1 
ATOM   4660 O  O     . GLN D 1 20  ? 8.123   19.214  -58.010  1.00 158.78 ?  20  GLN D O     1 
ATOM   4661 C  CB    . GLN D 1 20  ? 9.307   16.331  -56.860  1.00 166.58 ?  20  GLN D CB    1 
ATOM   4662 C  CG    . GLN D 1 20  ? 8.928   17.005  -55.530  1.00 180.30 ?  20  GLN D CG    1 
ATOM   4663 C  CD    . GLN D 1 20  ? 7.454   16.929  -55.197  1.00 199.41 ?  20  GLN D CD    1 
ATOM   4664 O  OE1   . GLN D 1 20  ? 6.758   17.949  -55.143  1.00 191.97 ?  20  GLN D OE1   1 
ATOM   4665 N  NE2   . GLN D 1 20  ? 6.939   15.722  -54.985  1.00 196.36 ?  20  GLN D NE2   1 
ATOM   4666 N  N     . ILE D 1 21  ? 10.035  18.569  -59.062  1.00 157.44 ?  21  ILE D N     1 
ATOM   4667 C  CA    . ILE D 1 21  ? 10.490  19.903  -59.458  1.00 151.74 ?  21  ILE D CA    1 
ATOM   4668 C  C     . ILE D 1 21  ? 9.556   20.460  -60.545  1.00 155.18 ?  21  ILE D C     1 
ATOM   4669 O  O     . ILE D 1 21  ? 9.267   21.656  -60.542  1.00 150.28 ?  21  ILE D O     1 
ATOM   4670 C  CB    . ILE D 1 21  ? 11.995  19.894  -59.856  1.00 154.31 ?  21  ILE D CB    1 
ATOM   4671 C  CG1   . ILE D 1 21  ? 12.890  19.740  -58.603  1.00 153.64 ?  21  ILE D CG1   1 
ATOM   4672 C  CG2   . ILE D 1 21  ? 12.379  21.145  -60.650  1.00 150.80 ?  21  ILE D CG2   1 
ATOM   4673 C  CD1   . ILE D 1 21  ? 14.357  19.372  -58.869  1.00 161.38 ?  21  ILE D CD1   1 
ATOM   4674 N  N     . ASP D 1 22  ? 9.057   19.587  -61.445  1.00 156.75 ?  22  ASP D N     1 
ATOM   4675 C  CA    . ASP D 1 22  ? 8.113   19.975  -62.491  1.00 157.36 ?  22  ASP D CA    1 
ATOM   4676 C  C     . ASP D 1 22  ? 6.785   20.400  -61.863  1.00 160.03 ?  22  ASP D C     1 
ATOM   4677 O  O     . ASP D 1 22  ? 6.223   21.423  -62.262  1.00 156.97 ?  22  ASP D O     1 
ATOM   4678 C  CB    . ASP D 1 22  ? 7.896   18.827  -63.491  1.00 165.53 ?  22  ASP D CB    1 
ATOM   4679 C  CG    . ASP D 1 22  ? 6.944   19.148  -64.632  1.00 177.15 ?  22  ASP D CG    1 
ATOM   4680 O  OD1   . ASP D 1 22  ? 7.273   20.033  -65.456  1.00 173.10 ?  22  ASP D OD1   1 
ATOM   4681 O  OD2   . ASP D 1 22  ? 5.875   18.497  -64.717  1.00 189.76 -1 22  ASP D OD2   1 
ATOM   4682 N  N     . SER D 1 23  ? 6.318   19.640  -60.848  1.00 158.52 ?  23  SER D N     1 
ATOM   4683 C  CA    . SER D 1 23  ? 5.074   19.908  -60.126  1.00 157.74 ?  23  SER D CA    1 
ATOM   4684 C  C     . SER D 1 23  ? 5.157   21.122  -59.204  1.00 154.67 ?  23  SER D C     1 
ATOM   4685 O  O     . SER D 1 23  ? 4.140   21.779  -58.978  1.00 152.73 ?  23  SER D O     1 
ATOM   4686 C  CB    . SER D 1 23  ? 4.594   18.672  -59.371  1.00 166.52 ?  23  SER D CB    1 
ATOM   4687 O  OG    . SER D 1 23  ? 5.554   18.068  -58.523  1.00 176.50 ?  23  SER D OG    1 
ATOM   4688 N  N     . ASN D 1 24  ? 6.357   21.416  -58.675  1.00 147.50 ?  24  ASN D N     1 
ATOM   4689 C  CA    . ASN D 1 24  ? 6.615   22.558  -57.799  1.00 141.61 ?  24  ASN D CA    1 
ATOM   4690 C  C     . ASN D 1 24  ? 8.046   23.058  -58.018  1.00 141.82 ?  24  ASN D C     1 
ATOM   4691 O  O     . ASN D 1 24  ? 8.978   22.506  -57.427  1.00 142.49 ?  24  ASN D O     1 
ATOM   4692 C  CB    . ASN D 1 24  ? 6.353   22.213  -56.321  1.00 141.62 ?  24  ASN D CB    1 
ATOM   4693 C  CG    . ASN D 1 24  ? 6.665   23.334  -55.350  1.00 156.48 ?  24  ASN D CG    1 
ATOM   4694 O  OD1   . ASN D 1 24  ? 6.549   24.532  -55.658  1.00 144.63 ?  24  ASN D OD1   1 
ATOM   4695 N  ND2   . ASN D 1 24  ? 7.061   22.962  -54.144  1.00 150.06 ?  24  ASN D ND2   1 
ATOM   4696 N  N     . PRO D 1 25  ? 8.251   24.084  -58.877  1.00 134.21 ?  25  PRO D N     1 
ATOM   4697 C  CA    . PRO D 1 25  ? 9.620   24.577  -59.114  1.00 131.07 ?  25  PRO D CA    1 
ATOM   4698 C  C     . PRO D 1 25  ? 10.188  25.368  -57.941  1.00 129.52 ?  25  PRO D C     1 
ATOM   4699 O  O     . PRO D 1 25  ? 11.403  25.564  -57.860  1.00 127.51 ?  25  PRO D O     1 
ATOM   4700 C  CB    . PRO D 1 25  ? 9.478   25.446  -60.373  1.00 131.51 ?  25  PRO D CB    1 
ATOM   4701 C  CG    . PRO D 1 25  ? 8.067   25.234  -60.867  1.00 138.39 ?  25  PRO D CG    1 
ATOM   4702 C  CD    . PRO D 1 25  ? 7.273   24.843  -59.675  1.00 134.68 ?  25  PRO D CD    1 
ATOM   4703 N  N     . PHE D 1 26  ? 9.305   25.797  -57.025  1.00 123.80 ?  26  PHE D N     1 
ATOM   4704 C  CA    . PHE D 1 26  ? 9.630   26.581  -55.837  1.00 119.56 ?  26  PHE D CA    1 
ATOM   4705 C  C     . PHE D 1 26  ? 10.220  25.741  -54.696  1.00 123.45 ?  26  PHE D C     1 
ATOM   4706 O  O     . PHE D 1 26  ? 10.597  26.304  -53.664  1.00 120.24 ?  26  PHE D O     1 
ATOM   4707 C  CB    . PHE D 1 26  ? 8.403   27.384  -55.371  1.00 119.64 ?  26  PHE D CB    1 
ATOM   4708 C  CG    . PHE D 1 26  ? 7.880   28.367  -56.393  1.00 119.65 ?  26  PHE D CG    1 
ATOM   4709 C  CD1   . PHE D 1 26  ? 6.915   27.985  -57.319  1.00 125.81 ?  26  PHE D CD1   1 
ATOM   4710 C  CD2   . PHE D 1 26  ? 8.345   29.676  -56.425  1.00 117.79 ?  26  PHE D CD2   1 
ATOM   4711 C  CE1   . PHE D 1 26  ? 6.442   28.891  -58.274  1.00 125.57 ?  26  PHE D CE1   1 
ATOM   4712 C  CE2   . PHE D 1 26  ? 7.866   30.582  -57.376  1.00 119.57 ?  26  PHE D CE2   1 
ATOM   4713 C  CZ    . PHE D 1 26  ? 6.919   30.183  -58.294  1.00 120.64 ?  26  PHE D CZ    1 
ATOM   4714 N  N     . ILE D 1 27  ? 10.329  24.409  -54.891  1.00 123.45 ?  27  ILE D N     1 
ATOM   4715 C  CA    . ILE D 1 27  ? 10.902  23.485  -53.908  1.00 125.07 ?  27  ILE D CA    1 
ATOM   4716 C  C     . ILE D 1 27  ? 12.408  23.733  -53.749  1.00 126.83 ?  27  ILE D C     1 
ATOM   4717 O  O     . ILE D 1 27  ? 13.072  24.076  -54.727  1.00 125.61 ?  27  ILE D O     1 
ATOM   4718 C  CB    . ILE D 1 27  ? 10.554  21.998  -54.239  1.00 133.84 ?  27  ILE D CB    1 
ATOM   4719 C  CG1   . ILE D 1 27  ? 10.651  21.102  -52.990  1.00 136.75 ?  27  ILE D CG1   1 
ATOM   4720 C  CG2   . ILE D 1 27  ? 11.367  21.429  -55.425  1.00 136.83 ?  27  ILE D CG2   1 
ATOM   4721 C  CD1   . ILE D 1 27  ? 9.727   19.918  -52.991  1.00 148.14 ?  27  ILE D CD1   1 
ATOM   4722 N  N     . THR D 1 28  ? 12.933  23.591  -52.522  1.00 122.74 ?  28  THR D N     1 
ATOM   4723 C  CA    . THR D 1 28  ? 14.363  23.770  -52.247  1.00 121.40 ?  28  THR D CA    1 
ATOM   4724 C  C     . THR D 1 28  ? 15.066  22.420  -52.282  1.00 130.87 ?  28  THR D C     1 
ATOM   4725 O  O     . THR D 1 28  ? 14.399  21.385  -52.189  1.00 134.67 ?  28  THR D O     1 
ATOM   4726 C  CB    . THR D 1 28  ? 14.584  24.455  -50.894  1.00 125.66 ?  28  THR D CB    1 
ATOM   4727 O  OG1   . THR D 1 28  ? 13.879  23.743  -49.886  1.00 126.73 ?  28  THR D OG1   1 
ATOM   4728 C  CG2   . THR D 1 28  ? 14.157  25.905  -50.888  1.00 120.15 ?  28  THR D CG2   1 
ATOM   4729 N  N     . ASP D 1 29  ? 16.412  22.420  -52.395  1.00 127.74 ?  29  ASP D N     1 
ATOM   4730 C  CA    . ASP D 1 29  ? 17.203  21.188  -52.381  1.00 132.31 ?  29  ASP D CA    1 
ATOM   4731 C  C     . ASP D 1 29  ? 17.113  20.543  -50.994  1.00 139.34 ?  29  ASP D C     1 
ATOM   4732 O  O     . ASP D 1 29  ? 17.132  19.315  -50.889  1.00 143.85 ?  29  ASP D O     1 
ATOM   4733 C  CB    . ASP D 1 29  ? 18.665  21.467  -52.760  1.00 133.18 ?  29  ASP D CB    1 
ATOM   4734 C  CG    . ASP D 1 29  ? 18.961  21.590  -54.247  1.00 139.53 ?  29  ASP D CG    1 
ATOM   4735 O  OD1   . ASP D 1 29  ? 18.001  21.726  -55.042  1.00 144.86 -1 29  ASP D OD1   1 
ATOM   4736 O  OD2   . ASP D 1 29  ? 20.150  21.565  -54.613  1.00 139.78 ?  29  ASP D OD2   1 
ATOM   4737 N  N     . HIS D 1 30  ? 16.966  21.380  -49.940  1.00 133.24 ?  30  HIS D N     1 
ATOM   4738 C  CA    . HIS D 1 30  ? 16.813  20.937  -48.557  1.00 134.92 ?  30  HIS D CA    1 
ATOM   4739 C  C     . HIS D 1 30  ? 15.507  20.163  -48.374  1.00 139.96 ?  30  HIS D C     1 
ATOM   4740 O  O     . HIS D 1 30  ? 15.516  19.113  -47.738  1.00 144.05 ?  30  HIS D O     1 
ATOM   4741 C  CB    . HIS D 1 30  ? 16.883  22.120  -47.583  1.00 131.81 ?  30  HIS D CB    1 
ATOM   4742 C  CG    . HIS D 1 30  ? 16.770  21.699  -46.151  1.00 137.60 ?  30  HIS D CG    1 
ATOM   4743 N  ND1   . HIS D 1 30  ? 17.848  21.163  -45.472  1.00 141.80 ?  30  HIS D ND1   1 
ATOM   4744 C  CD2   . HIS D 1 30  ? 15.694  21.701  -45.331  1.00 140.25 ?  30  HIS D CD2   1 
ATOM   4745 C  CE1   . HIS D 1 30  ? 17.402  20.874  -44.260  1.00 142.89 ?  30  HIS D CE1   1 
ATOM   4746 N  NE2   . HIS D 1 30  ? 16.111  21.180  -44.128  1.00 142.29 ?  30  HIS D NE2   1 
ATOM   4747 N  N     . GLU D 1 31  ? 14.394  20.682  -48.941  1.00 132.78 ?  31  GLU D N     1 
ATOM   4748 C  CA    . GLU D 1 31  ? 13.067  20.061  -48.891  1.00 134.43 ?  31  GLU D CA    1 
ATOM   4749 C  C     . GLU D 1 31  ? 13.065  18.713  -49.609  1.00 141.70 ?  31  GLU D C     1 
ATOM   4750 O  O     . GLU D 1 31  ? 12.449  17.769  -49.114  1.00 145.28 ?  31  GLU D O     1 
ATOM   4751 C  CB    . GLU D 1 31  ? 12.002  20.992  -49.484  1.00 132.57 ?  31  GLU D CB    1 
ATOM   4752 C  CG    . GLU D 1 31  ? 11.442  21.995  -48.488  1.00 137.86 ?  31  GLU D CG    1 
ATOM   4753 C  CD    . GLU D 1 31  ? 10.782  23.219  -49.094  1.00 150.63 ?  31  GLU D CD    1 
ATOM   4754 O  OE1   . GLU D 1 31  ? 9.931   23.062  -49.999  1.00 145.29 ?  31  GLU D OE1   1 
ATOM   4755 O  OE2   . GLU D 1 31  ? 11.099  24.341  -48.641  1.00 139.01 -1 31  GLU D OE2   1 
ATOM   4756 N  N     . LEU D 1 32  ? 13.778  18.623  -50.754  1.00 137.31 ?  32  LEU D N     1 
ATOM   4757 C  CA    . LEU D 1 32  ? 13.930  17.406  -51.549  1.00 141.93 ?  32  LEU D CA    1 
ATOM   4758 C  C     . LEU D 1 32  ? 14.756  16.371  -50.782  1.00 149.72 ?  32  LEU D C     1 
ATOM   4759 O  O     . LEU D 1 32  ? 14.428  15.185  -50.828  1.00 154.45 ?  32  LEU D O     1 
ATOM   4760 C  CB    . LEU D 1 32  ? 14.566  17.704  -52.922  1.00 140.78 ?  32  LEU D CB    1 
ATOM   4761 C  CG    . LEU D 1 32  ? 13.708  18.471  -53.941  1.00 142.37 ?  32  LEU D CG    1 
ATOM   4762 C  CD1   . LEU D 1 32  ? 14.570  19.113  -55.007  1.00 140.15 ?  32  LEU D CD1   1 
ATOM   4763 C  CD2   . LEU D 1 32  ? 12.666  17.575  -54.592  1.00 148.79 ?  32  LEU D CD2   1 
ATOM   4764 N  N     . SER D 1 33  ? 15.792  16.829  -50.032  1.00 143.92 ?  33  SER D N     1 
ATOM   4765 C  CA    . SER D 1 33  ? 16.658  15.974  -49.209  1.00 147.52 ?  33  SER D CA    1 
ATOM   4766 C  C     . SER D 1 33  ? 15.862  15.259  -48.124  1.00 155.45 ?  33  SER D C     1 
ATOM   4767 O  O     . SER D 1 33  ? 16.067  14.065  -47.902  1.00 160.79 ?  33  SER D O     1 
ATOM   4768 C  CB    . SER D 1 33  ? 17.808  16.776  -48.602  1.00 147.16 ?  33  SER D CB    1 
ATOM   4769 O  OG    . SER D 1 33  ? 17.501  17.295  -47.319  1.00 153.42 ?  33  SER D OG    1 
ATOM   4770 N  N     . ASP D 1 34  ? 14.937  15.991  -47.477  1.00 149.11 ?  34  ASP D N     1 
ATOM   4771 C  CA    . ASP D 1 34  ? 14.065  15.462  -46.431  1.00 151.88 ?  34  ASP D CA    1 
ATOM   4772 C  C     . ASP D 1 34  ? 13.001  14.533  -47.019  1.00 161.20 ?  34  ASP D C     1 
ATOM   4773 O  O     . ASP D 1 34  ? 12.762  13.461  -46.464  1.00 166.32 ?  34  ASP D O     1 
ATOM   4774 C  CB    . ASP D 1 34  ? 13.411  16.603  -45.629  1.00 148.84 ?  34  ASP D CB    1 
ATOM   4775 C  CG    . ASP D 1 34  ? 14.337  17.335  -44.668  1.00 156.26 ?  34  ASP D CG    1 
ATOM   4776 O  OD1   . ASP D 1 34  ? 15.276  16.696  -44.142  1.00 167.72 -1 34  ASP D OD1   1 
ATOM   4777 O  OD2   . ASP D 1 34  ? 14.099  18.540  -44.414  1.00 150.94 ?  34  ASP D OD2   1 
ATOM   4778 N  N     . LEU D 1 35  ? 12.383  14.938  -48.150  1.00 156.65 ?  35  LEU D N     1 
ATOM   4779 C  CA    . LEU D 1 35  ? 11.333  14.196  -48.854  1.00 160.61 ?  35  LEU D CA    1 
ATOM   4780 C  C     . LEU D 1 35  ? 11.813  12.849  -49.402  1.00 171.14 ?  35  LEU D C     1 
ATOM   4781 O  O     . LEU D 1 35  ? 11.064  11.871  -49.345  1.00 175.60 ?  35  LEU D O     1 
ATOM   4782 C  CB    . LEU D 1 35  ? 10.763  15.062  -50.002  1.00 157.06 ?  35  LEU D CB    1 
ATOM   4783 C  CG    . LEU D 1 35  ? 9.683   14.477  -50.946  1.00 163.57 ?  35  LEU D CG    1 
ATOM   4784 C  CD1   . LEU D 1 35  ? 8.399   14.130  -50.215  1.00 169.44 ?  35  LEU D CD1   1 
ATOM   4785 C  CD2   . LEU D 1 35  ? 9.461   15.326  -52.199  1.00 167.13 ?  35  LEU D CD2   1 
ATOM   4786 N  N     . PHE D 1 36  ? 13.048  12.801  -49.935  1.00 168.09 ?  36  PHE D N     1 
ATOM   4787 C  CA    . PHE D 1 36  ? 13.625  11.595  -50.538  1.00 174.15 ?  36  PHE D CA    1 
ATOM   4788 C  C     . PHE D 1 36  ? 14.572  10.821  -49.618  1.00 175.90 ?  36  PHE D C     1 
ATOM   4789 O  O     . PHE D 1 36  ? 15.053  9.751   -50.010  1.00 176.93 ?  36  PHE D O     1 
ATOM   4790 C  CB    . PHE D 1 36  ? 14.273  11.927  -51.900  1.00 174.97 ?  36  PHE D CB    1 
ATOM   4791 C  CG    . PHE D 1 36  ? 13.267  12.343  -52.948  1.00 176.09 ?  36  PHE D CG    1 
ATOM   4792 C  CD1   . PHE D 1 36  ? 12.647  13.588  -52.890  1.00 173.62 ?  36  PHE D CD1   1 
ATOM   4793 C  CD2   . PHE D 1 36  ? 12.928  11.485  -53.986  1.00 178.75 ?  36  PHE D CD2   1 
ATOM   4794 C  CE1   . PHE D 1 36  ? 11.692  13.957  -53.838  1.00 173.99 ?  36  PHE D CE1   1 
ATOM   4795 C  CE2   . PHE D 1 36  ? 11.988  11.863  -54.943  1.00 180.88 ?  36  PHE D CE2   1 
ATOM   4796 C  CZ    . PHE D 1 36  ? 11.369  13.089  -54.858  1.00 178.43 ?  36  PHE D CZ    1 
ATOM   4797 N  N     . GLN D 1 37  ? 14.804  11.337  -48.386  1.00 173.26 ?  37  GLN D N     1 
ATOM   4798 C  CA    . GLN D 1 37  ? 15.675  10.742  -47.361  1.00 172.36 ?  37  GLN D CA    1 
ATOM   4799 C  C     . GLN D 1 37  ? 17.078  10.431  -47.906  1.00 173.75 ?  37  GLN D C     1 
ATOM   4800 O  O     . GLN D 1 37  ? 17.559  9.295   -47.830  1.00 175.04 ?  37  GLN D O     1 
ATOM   4801 C  CB    . GLN D 1 37  ? 15.003  9.531   -46.669  1.00 175.30 ?  37  GLN D CB    1 
ATOM   4802 C  CG    . GLN D 1 37  ? 13.832  9.899   -45.755  1.00 189.35 ?  37  GLN D CG    1 
ATOM   4803 C  CD    . GLN D 1 37  ? 14.270  10.668  -44.529  1.00 202.90 ?  37  GLN D CD    1 
ATOM   4804 O  OE1   . GLN D 1 37  ? 14.802  10.106  -43.566  1.00 203.00 ?  37  GLN D OE1   1 
ATOM   4805 N  NE2   . GLN D 1 37  ? 14.067  11.978  -44.545  1.00 195.28 ?  37  GLN D NE2   1 
ATOM   4806 N  N     . VAL D 1 38  ? 17.713  11.462  -48.485  1.00 169.55 ?  38  VAL D N     1 
ATOM   4807 C  CA    . VAL D 1 38  ? 19.039  11.409  -49.098  1.00 169.17 ?  38  VAL D CA    1 
ATOM   4808 C  C     . VAL D 1 38  ? 19.781  12.736  -48.810  1.00 165.89 ?  38  VAL D C     1 
ATOM   4809 O  O     . VAL D 1 38  ? 19.124  13.726  -48.482  1.00 160.31 ?  38  VAL D O     1 
ATOM   4810 C  CB    . VAL D 1 38  ? 18.901  11.040  -50.606  1.00 172.47 ?  38  VAL D CB    1 
ATOM   4811 C  CG1   . VAL D 1 38  ? 20.225  11.079  -51.358  1.00 168.52 ?  38  VAL D CG1   1 
ATOM   4812 C  CG2   . VAL D 1 38  ? 18.198  9.708   -50.792  1.00 172.69 ?  38  VAL D CG2   1 
ATOM   4813 N  N     . SER D 1 39  ? 21.129  12.751  -48.884  1.00 162.38 ?  39  SER D N     1 
ATOM   4814 C  CA    . SER D 1 39  ? 21.919  13.962  -48.604  1.00 156.58 ?  39  SER D CA    1 
ATOM   4815 C  C     . SER D 1 39  ? 21.777  15.039  -49.674  1.00 154.60 ?  39  SER D C     1 
ATOM   4816 O  O     . SER D 1 39  ? 21.573  14.718  -50.843  1.00 155.95 ?  39  SER D O     1 
ATOM   4817 C  CB    . SER D 1 39  ? 23.392  13.626  -48.399  1.00 163.13 ?  39  SER D CB    1 
ATOM   4818 O  OG    . SER D 1 39  ? 23.992  13.149  -49.593  1.00 174.84 ?  39  SER D OG    1 
ATOM   4819 N  N     . ILE D 1 40  ? 21.939  16.313  -49.266  1.00 144.31 ?  40  ILE D N     1 
ATOM   4820 C  CA    . ILE D 1 40  ? 21.860  17.509  -50.112  1.00 138.38 ?  40  ILE D CA    1 
ATOM   4821 C  C     . ILE D 1 40  ? 22.785  17.447  -51.349  1.00 141.98 ?  40  ILE D C     1 
ATOM   4822 O  O     . ILE D 1 40  ? 22.436  17.976  -52.408  1.00 139.42 ?  40  ILE D O     1 
ATOM   4823 C  CB    . ILE D 1 40  ? 22.060  18.782  -49.230  1.00 136.04 ?  40  ILE D CB    1 
ATOM   4824 C  CG1   . ILE D 1 40  ? 20.902  18.970  -48.232  1.00 131.71 ?  40  ILE D CG1   1 
ATOM   4825 C  CG2   . ILE D 1 40  ? 22.375  20.062  -50.034  1.00 134.95 ?  40  ILE D CG2   1 
ATOM   4826 C  CD1   . ILE D 1 40  ? 21.140  20.046  -47.139  1.00 134.66 ?  40  ILE D CD1   1 
ATOM   4827 N  N     . GLN D 1 41  ? 23.946  16.775  -51.202  1.00 141.34 ?  41  GLN D N     1 
ATOM   4828 C  CA    . GLN D 1 41  ? 24.976  16.600  -52.227  1.00 142.61 ?  41  GLN D CA    1 
ATOM   4829 C  C     . GLN D 1 41  ? 24.475  15.740  -53.382  1.00 148.73 ?  41  GLN D C     1 
ATOM   4830 O  O     . GLN D 1 41  ? 24.861  15.975  -54.530  1.00 147.47 ?  41  GLN D O     1 
ATOM   4831 C  CB    . GLN D 1 41  ? 26.249  15.986  -51.616  1.00 147.84 ?  41  GLN D CB    1 
ATOM   4832 C  CG    . GLN D 1 41  ? 27.009  16.901  -50.646  1.00 160.91 ?  41  GLN D CG    1 
ATOM   4833 C  CD    . GLN D 1 41  ? 26.407  16.990  -49.255  1.00 175.63 ?  41  GLN D CD    1 
ATOM   4834 O  OE1   . GLN D 1 41  ? 25.806  16.042  -48.731  1.00 172.97 ?  41  GLN D OE1   1 
ATOM   4835 N  NE2   . GLN D 1 41  ? 26.569  18.140  -48.619  1.00 161.39 ?  41  GLN D NE2   1 
ATOM   4836 N  N     . THR D 1 42  ? 23.615  14.746  -53.072  1.00 148.55 ?  42  THR D N     1 
ATOM   4837 C  CA    . THR D 1 42  ? 23.018  13.829  -54.045  1.00 152.37 ?  42  THR D CA    1 
ATOM   4838 C  C     . THR D 1 42  ? 22.048  14.588  -54.955  1.00 152.79 ?  42  THR D C     1 
ATOM   4839 O  O     . THR D 1 42  ? 22.171  14.476  -56.170  1.00 153.28 ?  42  THR D O     1 
ATOM   4840 C  CB    . THR D 1 42  ? 22.401  12.604  -53.344  1.00 162.92 ?  42  THR D CB    1 
ATOM   4841 O  OG1   . THR D 1 42  ? 23.317  12.116  -52.363  1.00 162.87 ?  42  THR D OG1   1 
ATOM   4842 C  CG2   . THR D 1 42  ? 22.045  11.478  -54.318  1.00 167.80 ?  42  THR D CG2   1 
ATOM   4843 N  N     . ILE D 1 43  ? 21.133  15.400  -54.370  1.00 145.37 ?  43  ILE D N     1 
ATOM   4844 C  CA    . ILE D 1 43  ? 20.152  16.223  -55.100  1.00 141.45 ?  43  ILE D CA    1 
ATOM   4845 C  C     . ILE D 1 43  ? 20.871  17.156  -56.076  1.00 142.88 ?  43  ILE D C     1 
ATOM   4846 O  O     . ILE D 1 43  ? 20.463  17.247  -57.237  1.00 143.02 ?  43  ILE D O     1 
ATOM   4847 C  CB    . ILE D 1 43  ? 19.184  16.975  -54.141  1.00 140.18 ?  43  ILE D CB    1 
ATOM   4848 C  CG1   . ILE D 1 43  ? 18.389  15.997  -53.277  1.00 144.09 ?  43  ILE D CG1   1 
ATOM   4849 C  CG2   . ILE D 1 43  ? 18.224  17.896  -54.891  1.00 137.00 ?  43  ILE D CG2   1 
ATOM   4850 C  CD1   . ILE D 1 43  ? 18.832  15.974  -51.947  1.00 150.74 ?  43  ILE D CD1   1 
ATOM   4851 N  N     . ARG D 1 44  ? 21.975  17.793  -55.618  1.00 137.42 ?  44  ARG D N     1 
ATOM   4852 C  CA    . ARG D 1 44  ? 22.821  18.661  -56.437  1.00 135.14 ?  44  ARG D CA    1 
ATOM   4853 C  C     . ARG D 1 44  ? 23.389  17.894  -57.637  1.00 144.90 ?  44  ARG D C     1 
ATOM   4854 O  O     . ARG D 1 44  ? 23.402  18.439  -58.739  1.00 143.26 ?  44  ARG D O     1 
ATOM   4855 C  CB    . ARG D 1 44  ? 23.935  19.289  -55.596  1.00 133.02 ?  44  ARG D CB    1 
ATOM   4856 C  CG    . ARG D 1 44  ? 23.527  20.627  -55.013  1.00 138.38 ?  44  ARG D CG    1 
ATOM   4857 C  CD    . ARG D 1 44  ? 24.366  21.026  -53.813  1.00 148.26 ?  44  ARG D CD    1 
ATOM   4858 N  NE    . ARG D 1 44  ? 23.933  22.295  -53.215  1.00 149.90 ?  44  ARG D NE    1 
ATOM   4859 C  CZ    . ARG D 1 44  ? 22.905  22.428  -52.380  1.00 160.01 ?  44  ARG D CZ    1 
ATOM   4860 N  NH1   . ARG D 1 44  ? 22.164  21.376  -52.054  1.00 152.08 ?  44  ARG D NH1   1 
ATOM   4861 N  NH2   . ARG D 1 44  ? 22.598  23.616  -51.879  1.00 136.87 ?  44  ARG D NH2   1 
ATOM   4862 N  N     . LEU D 1 45  ? 23.800  16.616  -57.432  1.00 147.88 ?  45  LEU D N     1 
ATOM   4863 C  CA    . LEU D 1 45  ? 24.297  15.741  -58.494  1.00 153.45 ?  45  LEU D CA    1 
ATOM   4864 C  C     . LEU D 1 45  ? 23.147  15.280  -59.391  1.00 159.42 ?  45  LEU D C     1 
ATOM   4865 O  O     . LEU D 1 45  ? 23.328  15.177  -60.608  1.00 161.10 ?  45  LEU D O     1 
ATOM   4866 C  CB    . LEU D 1 45  ? 25.021  14.512  -57.918  1.00 159.55 ?  45  LEU D CB    1 
ATOM   4867 C  CG    . LEU D 1 45  ? 26.490  14.676  -57.538  1.00 165.44 ?  45  LEU D CG    1 
ATOM   4868 C  CD1   . LEU D 1 45  ? 26.989  13.449  -56.796  1.00 171.14 ?  45  LEU D CD1   1 
ATOM   4869 C  CD2   . LEU D 1 45  ? 27.360  14.908  -58.766  1.00 169.87 ?  45  LEU D CD2   1 
ATOM   4870 N  N     . ASP D 1 46  ? 21.967  15.004  -58.796  1.00 155.64 ?  46  ASP D N     1 
ATOM   4871 C  CA    . ASP D 1 46  ? 20.779  14.556  -59.525  1.00 157.25 ?  46  ASP D CA    1 
ATOM   4872 C  C     . ASP D 1 46  ? 20.290  15.635  -60.471  1.00 155.23 ?  46  ASP D C     1 
ATOM   4873 O  O     . ASP D 1 46  ? 20.202  15.382  -61.671  1.00 156.51 ?  46  ASP D O     1 
ATOM   4874 C  CB    . ASP D 1 46  ? 19.663  14.113  -58.567  1.00 160.03 ?  46  ASP D CB    1 
ATOM   4875 C  CG    . ASP D 1 46  ? 20.026  12.939  -57.678  1.00 179.65 ?  46  ASP D CG    1 
ATOM   4876 O  OD1   . ASP D 1 46  ? 20.696  11.993  -58.173  1.00 182.20 ?  46  ASP D OD1   1 
ATOM   4877 O  OD2   . ASP D 1 46  ? 19.626  12.948  -56.495  1.00 185.76 -1 46  ASP D OD2   1 
ATOM   4878 N  N     . ARG D 1 47  ? 20.063  16.861  -59.947  1.00 144.91 ?  47  ARG D N     1 
ATOM   4879 C  CA    . ARG D 1 47  ? 19.627  18.014  -60.738  1.00 140.05 ?  47  ARG D CA    1 
ATOM   4880 C  C     . ARG D 1 47  ? 20.591  18.279  -61.886  1.00 144.64 ?  47  ARG D C     1 
ATOM   4881 O  O     . ARG D 1 47  ? 20.145  18.638  -62.974  1.00 143.97 ?  47  ARG D O     1 
ATOM   4882 C  CB    . ARG D 1 47  ? 19.536  19.266  -59.868  1.00 133.13 ?  47  ARG D CB    1 
ATOM   4883 C  CG    . ARG D 1 47  ? 18.220  19.455  -59.115  1.00 135.36 ?  47  ARG D CG    1 
ATOM   4884 C  CD    . ARG D 1 47  ? 18.077  20.870  -58.573  1.00 129.07 ?  47  ARG D CD    1 
ATOM   4885 N  NE    . ARG D 1 47  ? 19.162  21.232  -57.656  1.00 128.97 ?  47  ARG D NE    1 
ATOM   4886 C  CZ    . ARG D 1 47  ? 20.219  21.969  -57.989  1.00 135.36 ?  47  ARG D CZ    1 
ATOM   4887 N  NH1   . ARG D 1 47  ? 20.349  22.439  -59.225  1.00 114.24 ?  47  ARG D NH1   1 
ATOM   4888 N  NH2   . ARG D 1 47  ? 21.158  22.233  -57.092  1.00 123.18 ?  47  ARG D NH2   1 
ATOM   4889 N  N     . THR D 1 48  ? 21.911  18.097  -61.642  1.00 142.33 ?  48  THR D N     1 
ATOM   4890 C  CA    . THR D 1 48  ? 22.968  18.282  -62.641  1.00 143.35 ?  48  THR D CA    1 
ATOM   4891 C  C     . THR D 1 48  ? 22.772  17.318  -63.815  1.00 152.57 ?  48  THR D C     1 
ATOM   4892 O  O     . THR D 1 48  ? 22.746  17.761  -64.963  1.00 151.47 ?  48  THR D O     1 
ATOM   4893 C  CB    . THR D 1 48  ? 24.351  18.196  -61.987  1.00 151.80 ?  48  THR D CB    1 
ATOM   4894 O  OG1   . THR D 1 48  ? 24.463  19.240  -61.018  1.00 145.99 ?  48  THR D OG1   1 
ATOM   4895 C  CG2   . THR D 1 48  ? 25.489  18.320  -62.993  1.00 152.18 ?  48  THR D CG2   1 
ATOM   4896 N  N     . TYR D 1 49  ? 22.590  16.019  -63.518  1.00 154.82 ?  49  TYR D N     1 
ATOM   4897 C  CA    . TYR D 1 49  ? 22.367  14.980  -64.522  1.00 160.83 ?  49  TYR D CA    1 
ATOM   4898 C  C     . TYR D 1 49  ? 21.040  15.199  -65.266  1.00 164.49 ?  49  TYR D C     1 
ATOM   4899 O  O     . TYR D 1 49  ? 20.985  14.986  -66.478  1.00 166.90 ?  49  TYR D O     1 
ATOM   4900 C  CB    . TYR D 1 49  ? 22.425  13.579  -63.882  1.00 167.63 ?  49  TYR D CB    1 
ATOM   4901 C  CG    . TYR D 1 49  ? 22.489  12.453  -64.894  1.00 172.76 ?  49  TYR D CG    1 
ATOM   4902 C  CD1   . TYR D 1 49  ? 23.699  12.078  -65.469  1.00 175.15 ?  49  TYR D CD1   1 
ATOM   4903 C  CD2   . TYR D 1 49  ? 21.342  11.763  -65.268  1.00 174.49 ?  49  TYR D CD2   1 
ATOM   4904 C  CE1   . TYR D 1 49  ? 23.763  11.046  -66.408  1.00 177.61 ?  49  TYR D CE1   1 
ATOM   4905 C  CE2   . TYR D 1 49  ? 21.394  10.733  -66.208  1.00 177.14 ?  49  TYR D CE2   1 
ATOM   4906 C  CZ    . TYR D 1 49  ? 22.608  10.374  -66.772  1.00 183.12 ?  49  TYR D CZ    1 
ATOM   4907 O  OH    . TYR D 1 49  ? 22.669  9.352   -67.691  1.00 185.87 ?  49  TYR D OH    1 
ATOM   4908 N  N     . LEU D 1 50  ? 20.000  15.668  -64.554  1.00 157.82 ?  50  LEU D N     1 
ATOM   4909 C  CA    . LEU D 1 50  ? 18.669  15.925  -65.122  1.00 156.82 ?  50  LEU D CA    1 
ATOM   4910 C  C     . LEU D 1 50  ? 18.586  17.305  -65.797  1.00 155.90 ?  50  LEU D C     1 
ATOM   4911 O  O     . LEU D 1 50  ? 17.527  17.676  -66.320  1.00 154.47 ?  50  LEU D O     1 
ATOM   4912 C  CB    . LEU D 1 50  ? 17.590  15.818  -64.033  1.00 155.40 ?  50  LEU D CB    1 
ATOM   4913 C  CG    . LEU D 1 50  ? 17.287  14.489  -63.319  1.00 164.95 ?  50  LEU D CG    1 
ATOM   4914 C  CD1   . LEU D 1 50  ? 16.286  14.608  -62.168  1.00 170.47 ?  50  LEU D CD1   1 
ATOM   4915 C  CD2   . LEU D 1 50  ? 16.829  13.514  -64.335  1.00 163.95 ?  50  LEU D CD2   1 
ATOM   4916 N  N     . ASN D 1 51  ? 19.711  18.059  -65.789  1.00 149.84 ?  51  ASN D N     1 
ATOM   4917 C  CA    . ASN D 1 51  ? 19.861  19.407  -66.352  1.00 145.13 ?  51  ASN D CA    1 
ATOM   4918 C  C     . ASN D 1 51  ? 18.849  20.431  -65.819  1.00 142.59 ?  51  ASN D C     1 
ATOM   4919 O  O     . ASN D 1 51  ? 18.407  21.327  -66.541  1.00 140.05 ?  51  ASN D O     1 
ATOM   4920 C  CB    . ASN D 1 51  ? 20.011  19.387  -67.883  1.00 150.22 ?  51  ASN D CB    1 
ATOM   4921 C  CG    . ASN D 1 51  ? 21.415  19.039  -68.328  1.00 178.45 ?  51  ASN D CG    1 
ATOM   4922 O  OD1   . ASN D 1 51  ? 22.372  19.787  -68.090  1.00 173.27 ?  51  ASN D OD1   1 
ATOM   4923 N  ND2   . ASN D 1 51  ? 21.577  17.889  -68.971  1.00 174.38 ?  51  ASN D ND2   1 
ATOM   4924 N  N     . ILE D 1 52  ? 18.510  20.282  -64.527  1.00 136.33 ?  52  ILE D N     1 
ATOM   4925 C  CA    . ILE D 1 52  ? 17.604  21.147  -63.781  1.00 130.90 ?  52  ILE D CA    1 
ATOM   4926 C  C     . ILE D 1 52  ? 18.463  22.226  -63.111  1.00 128.37 ?  52  ILE D C     1 
ATOM   4927 O  O     . ILE D 1 52  ? 19.378  21.884  -62.358  1.00 128.32 ?  52  ILE D O     1 
ATOM   4928 C  CB    . ILE D 1 52  ? 16.773  20.342  -62.737  1.00 135.58 ?  52  ILE D CB    1 
ATOM   4929 C  CG1   . ILE D 1 52  ? 15.858  19.304  -63.421  1.00 141.05 ?  52  ILE D CG1   1 
ATOM   4930 C  CG2   . ILE D 1 52  ? 15.968  21.282  -61.824  1.00 131.45 ?  52  ILE D CG2   1 
ATOM   4931 C  CD1   . ILE D 1 52  ? 15.250  18.239  -62.486  1.00 152.41 ?  52  ILE D CD1   1 
ATOM   4932 N  N     . PRO D 1 53  ? 18.196  23.527  -63.356  1.00 119.68 ?  53  PRO D N     1 
ATOM   4933 C  CA    . PRO D 1 53  ? 18.994  24.571  -62.684  1.00 114.91 ?  53  PRO D CA    1 
ATOM   4934 C  C     . PRO D 1 53  ? 18.572  24.746  -61.225  1.00 115.23 ?  53  PRO D C     1 
ATOM   4935 O  O     . PRO D 1 53  ? 17.582  24.148  -60.799  1.00 116.62 ?  53  PRO D O     1 
ATOM   4936 C  CB    . PRO D 1 53  ? 18.706  25.822  -63.513  1.00 113.55 ?  53  PRO D CB    1 
ATOM   4937 C  CG    . PRO D 1 53  ? 17.338  25.601  -64.047  1.00 119.30 ?  53  PRO D CG    1 
ATOM   4938 C  CD    . PRO D 1 53  ? 17.142  24.115  -64.210  1.00 120.09 ?  53  PRO D CD    1 
ATOM   4939 N  N     . GLU D 1 54  ? 19.318  25.556  -60.461  1.00 106.90 ?  54  GLU D N     1 
ATOM   4940 C  CA    . GLU D 1 54  ? 19.009  25.818  -59.056  1.00 103.59 ?  54  GLU D CA    1 
ATOM   4941 C  C     . GLU D 1 54  ? 17.700  26.601  -58.887  1.00 103.55 ?  54  GLU D C     1 
ATOM   4942 O  O     . GLU D 1 54  ? 17.252  27.248  -59.834  1.00 102.54 ?  54  GLU D O     1 
ATOM   4943 C  CB    . GLU D 1 54  ? 20.176  26.531  -58.363  1.00 102.43 ?  54  GLU D CB    1 
ATOM   4944 C  CG    . GLU D 1 54  ? 20.478  27.928  -58.876  1.00 109.45 ?  54  GLU D CG    1 
ATOM   4945 C  CD    . GLU D 1 54  ? 21.195  28.797  -57.863  1.00 127.63 ?  54  GLU D CD    1 
ATOM   4946 O  OE1   . GLU D 1 54  ? 20.584  29.136  -56.822  1.00 118.16 ?  54  GLU D OE1   1 
ATOM   4947 O  OE2   . GLU D 1 54  ? 22.376  29.135  -58.109  1.00 120.94 -1 54  GLU D OE2   1 
ATOM   4948 N  N     . LEU D 1 55  ? 17.103  26.543  -57.678  1.00 97.71  ?  55  LEU D N     1 
ATOM   4949 C  CA    . LEU D 1 55  ? 15.849  27.202  -57.296  1.00 94.21  ?  55  LEU D CA    1 
ATOM   4950 C  C     . LEU D 1 55  ? 15.692  28.607  -57.863  1.00 93.15  ?  55  LEU D C     1 
ATOM   4951 O  O     . LEU D 1 55  ? 14.716  28.881  -58.562  1.00 92.71  ?  55  LEU D O     1 
ATOM   4952 C  CB    . LEU D 1 55  ? 15.715  27.230  -55.763  1.00 92.77  ?  55  LEU D CB    1 
ATOM   4953 C  CG    . LEU D 1 55  ? 14.557  28.039  -55.185  1.00 94.39  ?  55  LEU D CG    1 
ATOM   4954 C  CD1   . LEU D 1 55  ? 13.255  27.331  -55.388  1.00 96.90  ?  55  LEU D CD1   1 
ATOM   4955 C  CD2   . LEU D 1 55  ? 14.769  28.324  -53.721  1.00 95.01  ?  55  LEU D CD2   1 
ATOM   4956 N  N     . ARG D 1 56  ? 16.659  29.487  -57.562  1.00 86.15  ?  56  ARG D N     1 
ATOM   4957 C  CA    . ARG D 1 56  ? 16.652  30.882  -57.996  1.00 82.13  ?  56  ARG D CA    1 
ATOM   4958 C  C     . ARG D 1 56  ? 16.607  31.030  -59.512  1.00 86.89  ?  56  ARG D C     1 
ATOM   4959 O  O     . ARG D 1 56  ? 15.916  31.918  -60.015  1.00 85.56  ?  56  ARG D O     1 
ATOM   4960 C  CB    . ARG D 1 56  ? 17.819  31.655  -57.373  1.00 78.31  ?  56  ARG D CB    1 
ATOM   4961 C  CG    . ARG D 1 56  ? 17.616  31.911  -55.891  1.00 80.63  ?  56  ARG D CG    1 
ATOM   4962 C  CD    . ARG D 1 56  ? 18.854  32.474  -55.242  1.00 81.77  ?  56  ARG D CD    1 
ATOM   4963 N  NE    . ARG D 1 56  ? 18.641  32.708  -53.815  1.00 84.26  ?  56  ARG D NE    1 
ATOM   4964 C  CZ    . ARG D 1 56  ? 19.598  32.631  -52.896  1.00 97.07  ?  56  ARG D CZ    1 
ATOM   4965 N  NH1   . ARG D 1 56  ? 20.843  32.327  -53.246  1.00 89.42  ?  56  ARG D NH1   1 
ATOM   4966 N  NH2   . ARG D 1 56  ? 19.317  32.846  -51.617  1.00 75.76  ?  56  ARG D NH2   1 
ATOM   4967 N  N     . LYS D 1 57  ? 17.293  30.135  -60.235  1.00 85.25  ?  57  LYS D N     1 
ATOM   4968 C  CA    . LYS D 1 57  ? 17.294  30.151  -61.691  1.00 86.61  ?  57  LYS D CA    1 
ATOM   4969 C  C     . LYS D 1 57  ? 15.952  29.655  -62.224  1.00 92.92  ?  57  LYS D C     1 
ATOM   4970 O  O     . LYS D 1 57  ? 15.474  30.184  -63.227  1.00 92.99  ?  57  LYS D O     1 
ATOM   4971 C  CB    . LYS D 1 57  ? 18.472  29.344  -62.256  1.00 91.93  ?  57  LYS D CB    1 
ATOM   4972 C  CG    . LYS D 1 57  ? 19.819  30.030  -62.061  1.00 101.40 ?  57  LYS D CG    1 
ATOM   4973 C  CD    . LYS D 1 57  ? 20.964  29.244  -62.678  1.00 113.40 ?  57  LYS D CD    1 
ATOM   4974 C  CE    . LYS D 1 57  ? 22.305  29.915  -62.494  1.00 122.20 ?  57  LYS D CE    1 
ATOM   4975 N  NZ    . LYS D 1 57  ? 22.484  31.084  -63.396  1.00 131.99 ?  57  LYS D NZ    1 
ATOM   4976 N  N     . ARG D 1 58  ? 15.323  28.685  -61.518  1.00 91.14  ?  58  ARG D N     1 
ATOM   4977 C  CA    . ARG D 1 58  ? 14.017  28.107  -61.862  1.00 93.26  ?  58  ARG D CA    1 
ATOM   4978 C  C     . ARG D 1 58  ? 12.924  29.149  -61.692  1.00 95.11  ?  58  ARG D C     1 
ATOM   4979 O  O     . ARG D 1 58  ? 12.114  29.328  -62.601  1.00 95.61  ?  58  ARG D O     1 
ATOM   4980 C  CB    . ARG D 1 58  ? 13.689  26.875  -60.998  1.00 95.28  ?  58  ARG D CB    1 
ATOM   4981 C  CG    . ARG D 1 58  ? 14.608  25.682  -61.207  1.00 105.16 ?  58  ARG D CG    1 
ATOM   4982 C  CD    . ARG D 1 58  ? 14.002  24.383  -60.706  1.00 112.02 ?  58  ARG D CD    1 
ATOM   4983 N  NE    . ARG D 1 58  ? 13.747  24.371  -59.261  1.00 113.54 ?  58  ARG D NE    1 
ATOM   4984 C  CZ    . ARG D 1 58  ? 14.631  23.998  -58.339  1.00 125.83 ?  58  ARG D CZ    1 
ATOM   4985 N  NH1   . ARG D 1 58  ? 15.854  23.626  -58.692  1.00 118.43 ?  58  ARG D NH1   1 
ATOM   4986 N  NH2   . ARG D 1 58  ? 14.306  24.019  -57.055  1.00 105.22 ?  58  ARG D NH2   1 
ATOM   4987 N  N     . ILE D 1 59  ? 12.916  29.850  -60.538  1.00 89.27  ?  59  ILE D N     1 
ATOM   4988 C  CA    . ILE D 1 59  ? 11.953  30.915  -60.223  1.00 86.69  ?  59  ILE D CA    1 
ATOM   4989 C  C     . ILE D 1 59  ? 12.052  32.056  -61.254  1.00 89.89  ?  59  ILE D C     1 
ATOM   4990 O  O     . ILE D 1 59  ? 11.017  32.576  -61.681  1.00 89.46  ?  59  ILE D O     1 
ATOM   4991 C  CB    . ILE D 1 59  ? 12.063  31.420  -58.750  1.00 86.60  ?  59  ILE D CB    1 
ATOM   4992 C  CG1   . ILE D 1 59  ? 11.760  30.299  -57.732  1.00 88.99  ?  59  ILE D CG1   1 
ATOM   4993 C  CG2   . ILE D 1 59  ? 11.154  32.633  -58.504  1.00 84.29  ?  59  ILE D CG2   1 
ATOM   4994 C  CD1   . ILE D 1 59  ? 12.040  30.683  -56.243  1.00 93.00  ?  59  ILE D CD1   1 
ATOM   4995 N  N     . LYS D 1 60  ? 13.290  32.407  -61.675  1.00 86.21  ?  60  LYS D N     1 
ATOM   4996 C  CA    . LYS D 1 60  ? 13.530  33.457  -62.664  1.00 85.17  ?  60  LYS D CA    1 
ATOM   4997 C  C     . LYS D 1 60  ? 12.879  33.111  -63.992  1.00 94.18  ?  60  LYS D C     1 
ATOM   4998 O  O     . LYS D 1 60  ? 12.163  33.946  -64.538  1.00 93.70  ?  60  LYS D O     1 
ATOM   4999 C  CB    . LYS D 1 60  ? 15.028  33.747  -62.838  1.00 86.27  ?  60  LYS D CB    1 
ATOM   5000 C  CG    . LYS D 1 60  ? 15.306  35.125  -63.435  1.00 89.28  ?  60  LYS D CG    1 
ATOM   5001 C  CD    . LYS D 1 60  ? 16.718  35.214  -63.968  1.00 96.89  ?  60  LYS D CD    1 
ATOM   5002 C  CE    . LYS D 1 60  ? 17.041  36.589  -64.489  1.00 103.74 ?  60  LYS D CE    1 
ATOM   5003 N  NZ    . LYS D 1 60  ? 18.418  36.651  -65.044  1.00 114.54 ?  60  LYS D NZ    1 
ATOM   5004 N  N     . LEU D 1 61  ? 13.075  31.868  -64.471  1.00 95.30  ?  61  LEU D N     1 
ATOM   5005 C  CA    . LEU D 1 61  ? 12.506  31.371  -65.721  1.00 99.44  ?  61  LEU D CA    1 
ATOM   5006 C  C     . LEU D 1 61  ? 10.979  31.394  -65.720  1.00 105.17 ?  61  LEU D C     1 
ATOM   5007 O  O     . LEU D 1 61  ? 10.385  31.685  -66.758  1.00 106.06 ?  61  LEU D O     1 
ATOM   5008 C  CB    . LEU D 1 61  ? 13.025  29.963  -66.039  1.00 103.80 ?  61  LEU D CB    1 
ATOM   5009 C  CG    . LEU D 1 61  ? 14.474  29.881  -66.526  1.00 109.51 ?  61  LEU D CG    1 
ATOM   5010 C  CD1   . LEU D 1 61  ? 15.086  28.559  -66.166  1.00 112.59 ?  61  LEU D CD1   1 
ATOM   5011 C  CD2   . LEU D 1 61  ? 14.575  30.116  -68.029  1.00 114.72 ?  61  LEU D CD2   1 
ATOM   5012 N  N     . VAL D 1 62  ? 10.351  31.111  -64.558  1.00 102.08 ?  62  VAL D N     1 
ATOM   5013 C  CA    . VAL D 1 62  ? 8.893   31.131  -64.380  1.00 103.32 ?  62  VAL D CA    1 
ATOM   5014 C  C     . VAL D 1 62  ? 8.410   32.585  -64.516  1.00 106.05 ?  62  VAL D C     1 
ATOM   5015 O  O     . VAL D 1 62  ? 7.455   32.849  -65.255  1.00 107.46 ?  62  VAL D O     1 
ATOM   5016 C  CB    . VAL D 1 62  ? 8.446   30.471  -63.036  1.00 107.29 ?  62  VAL D CB    1 
ATOM   5017 C  CG1   . VAL D 1 62  ? 6.939   30.599  -62.814  1.00 107.99 ?  62  VAL D CG1   1 
ATOM   5018 C  CG2   . VAL D 1 62  ? 8.863   29.005  -62.970  1.00 110.62 ?  62  VAL D CG2   1 
ATOM   5019 N  N     . ALA D 1 63  ? 9.110   33.518  -63.837  1.00 99.88  ?  63  ALA D N     1 
ATOM   5020 C  CA    . ALA D 1 63  ? 8.827   34.952  -63.852  1.00 97.38  ?  63  ALA D CA    1 
ATOM   5021 C  C     . ALA D 1 63  ? 9.031   35.564  -65.249  1.00 104.83 ?  63  ALA D C     1 
ATOM   5022 O  O     . ALA D 1 63  ? 8.184   36.340  -65.707  1.00 104.58 ?  63  ALA D O     1 
ATOM   5023 C  CB    . ALA D 1 63  ? 9.703   35.658  -62.834  1.00 94.32  ?  63  ALA D CB    1 
ATOM   5024 N  N     . GLU D 1 64  ? 10.136  35.189  -65.927  1.00 104.37 ?  64  GLU D N     1 
ATOM   5025 C  CA    . GLU D 1 64  ? 10.502  35.674  -67.259  1.00 106.39 ?  64  GLU D CA    1 
ATOM   5026 C  C     . GLU D 1 64  ? 9.503   35.278  -68.337  1.00 116.88 ?  64  GLU D C     1 
ATOM   5027 O  O     . GLU D 1 64  ? 9.284   36.067  -69.255  1.00 116.51 ?  64  GLU D O     1 
ATOM   5028 C  CB    . GLU D 1 64  ? 11.913  35.217  -67.651  1.00 108.78 ?  64  GLU D CB    1 
ATOM   5029 C  CG    . GLU D 1 64  ? 13.024  35.983  -66.952  1.00 117.07 ?  64  GLU D CG    1 
ATOM   5030 C  CD    . GLU D 1 64  ? 14.444  35.633  -67.361  1.00 143.08 ?  64  GLU D CD    1 
ATOM   5031 O  OE1   . GLU D 1 64  ? 14.761  34.428  -67.505  1.00 139.09 -1 64  GLU D OE1   1 
ATOM   5032 O  OE2   . GLU D 1 64  ? 15.252  36.576  -67.515  1.00 141.54 ?  64  GLU D OE2   1 
ATOM   5033 N  N     . LYS D 1 65  ? 8.906   34.065  -68.234  1.00 119.37 ?  65  LYS D N     1 
ATOM   5034 C  CA    . LYS D 1 65  ? 7.928   33.549  -69.199  1.00 124.46 ?  65  LYS D CA    1 
ATOM   5035 C  C     . LYS D 1 65  ? 6.697   34.432  -69.309  1.00 131.41 ?  65  LYS D C     1 
ATOM   5036 O  O     . LYS D 1 65  ? 6.388   34.873  -70.421  1.00 132.29 ?  65  LYS D O     1 
ATOM   5037 C  CB    . LYS D 1 65  ? 7.573   32.079  -68.937  1.00 130.14 ?  65  LYS D CB    1 
ATOM   5038 C  CG    . LYS D 1 65  ? 8.587   31.110  -69.533  1.00 146.40 ?  65  LYS D CG    1 
ATOM   5039 C  CD    . LYS D 1 65  ? 8.334   29.678  -69.090  1.00 159.50 ?  65  LYS D CD    1 
ATOM   5040 C  CE    . LYS D 1 65  ? 9.403   28.739  -69.593  1.00 171.18 ?  65  LYS D CE    1 
ATOM   5041 N  NZ    . LYS D 1 65  ? 9.147   27.337  -69.175  1.00 181.51 ?  65  LYS D NZ    1 
ATOM   5042 N  N     . ASN D 1 66  ? 5.986   34.708  -68.205  1.00 129.26 ?  66  ASN D N     1 
ATOM   5043 C  CA    . ASN D 1 66  ? 4.854   35.623  -68.329  1.00 130.30 ?  66  ASN D CA    1 
ATOM   5044 C  C     . ASN D 1 66  ? 5.300   37.036  -67.948  1.00 132.00 ?  66  ASN D C     1 
ATOM   5045 O  O     . ASN D 1 66  ? 5.081   37.521  -66.830  1.00 129.34 ?  66  ASN D O     1 
ATOM   5046 C  CB    . ASN D 1 66  ? 3.554   35.124  -67.675  1.00 134.74 ?  66  ASN D CB    1 
ATOM   5047 C  CG    . ASN D 1 66  ? 2.786   34.101  -68.497  1.00 167.57 ?  66  ASN D CG    1 
ATOM   5048 O  OD1   . ASN D 1 66  ? 2.730   34.148  -69.738  1.00 163.29 ?  66  ASN D OD1   1 
ATOM   5049 N  ND2   . ASN D 1 66  ? 2.136   33.169  -67.814  1.00 162.78 ?  66  ASN D ND2   1 
ATOM   5050 N  N     . TYR D 1 67  ? 6.034   37.638  -68.906  1.00 128.60 ?  67  TYR D N     1 
ATOM   5051 C  CA    . TYR D 1 67  ? 6.660   38.961  -68.913  1.00 125.08 ?  67  TYR D CA    1 
ATOM   5052 C  C     . TYR D 1 67  ? 6.960   39.285  -70.398  1.00 131.46 ?  67  TYR D C     1 
ATOM   5053 O  O     . TYR D 1 67  ? 6.649   38.454  -71.262  1.00 134.65 ?  67  TYR D O     1 
ATOM   5054 C  CB    . TYR D 1 67  ? 7.950   38.929  -68.059  1.00 122.85 ?  67  TYR D CB    1 
ATOM   5055 C  CG    . TYR D 1 67  ? 8.425   40.290  -67.607  1.00 120.62 ?  67  TYR D CG    1 
ATOM   5056 C  CD1   . TYR D 1 67  ? 7.834   40.935  -66.525  1.00 119.96 ?  67  TYR D CD1   1 
ATOM   5057 C  CD2   . TYR D 1 67  ? 9.485   40.927  -68.245  1.00 120.85 ?  67  TYR D CD2   1 
ATOM   5058 C  CE1   . TYR D 1 67  ? 8.253   42.200  -66.118  1.00 117.53 ?  67  TYR D CE1   1 
ATOM   5059 C  CE2   . TYR D 1 67  ? 9.912   42.192  -67.850  1.00 119.00 ?  67  TYR D CE2   1 
ATOM   5060 C  CZ    . TYR D 1 67  ? 9.295   42.824  -66.784  1.00 124.32 ?  67  TYR D CZ    1 
ATOM   5061 O  OH    . TYR D 1 67  ? 9.718   44.074  -66.402  1.00 124.27 ?  67  TYR D OH    1 
ATOM   5062 N  N     . ASP D 1 68  ? 7.534   40.480  -70.695  1.00 126.43 ?  68  ASP D N     1 
ATOM   5063 C  CA    . ASP D 1 68  ? 7.888   40.961  -72.047  1.00 128.45 ?  68  ASP D CA    1 
ATOM   5064 C  C     . ASP D 1 68  ? 6.676   41.086  -72.996  1.00 134.71 ?  68  ASP D C     1 
ATOM   5065 O  O     . ASP D 1 68  ? 6.730   40.673  -74.163  1.00 137.41 ?  68  ASP D O     1 
ATOM   5066 C  CB    . ASP D 1 68  ? 9.051   40.153  -72.678  1.00 132.27 ?  68  ASP D CB    1 
ATOM   5067 C  CG    . ASP D 1 68  ? 10.422  40.423  -72.085  1.00 143.11 ?  68  ASP D CG    1 
ATOM   5068 O  OD1   . ASP D 1 68  ? 10.777  41.614  -71.922  1.00 141.53 ?  68  ASP D OD1   1 
ATOM   5069 O  OD2   . ASP D 1 68  ? 11.167  39.446  -71.845  1.00 151.33 ?  68  ASP D OD2   1 
ATOM   5070 N  N     . GLN D 1 69  ? 5.590   41.683  -72.477  1.00 129.68 ?  69  GLN D N     1 
ATOM   5071 C  CA    . GLN D 1 69  ? 4.337   41.894  -73.196  1.00 132.00 ?  69  GLN D CA    1 
ATOM   5072 C  C     . GLN D 1 69  ? 4.486   42.969  -74.276  1.00 135.69 ?  69  GLN D C     1 
ATOM   5073 O  O     . GLN D 1 69  ? 4.896   44.092  -73.976  1.00 132.61 ?  69  GLN D O     1 
ATOM   5074 C  CB    . GLN D 1 69  ? 3.202   42.249  -72.213  1.00 132.21 ?  69  GLN D CB    1 
ATOM   5075 C  CG    . GLN D 1 69  ? 2.809   41.110  -71.273  1.00 146.46 ?  69  GLN D CG    1 
ATOM   5076 C  CD    . GLN D 1 69  ? 1.800   41.544  -70.238  1.00 164.00 ?  69  GLN D CD    1 
ATOM   5077 O  OE1   . GLN D 1 69  ? 2.130   42.187  -69.235  1.00 154.68 ?  69  GLN D OE1   1 
ATOM   5078 N  NE2   . GLN D 1 69  ? 0.545   41.175  -70.446  1.00 160.80 ?  69  GLN D NE2   1 
ATOM   5079 N  N     . ILE D 1 70  ? 4.171   42.610  -75.534  1.00 119.66 ?  70  ILE D N     1 
ATOM   5080 C  CA    . ILE D 1 70  ? 4.217   43.509  -76.694  1.00 116.92 ?  70  ILE D CA    1 
ATOM   5081 C  C     . ILE D 1 70  ? 2.933   44.349  -76.666  1.00 114.41 ?  70  ILE D C     1 
ATOM   5082 O  O     . ILE D 1 70  ? 1.873   43.802  -76.349  1.00 112.60 ?  70  ILE D O     1 
ATOM   5083 C  CB    . ILE D 1 70  ? 4.382   42.682  -78.008  1.00 121.97 ?  70  ILE D CB    1 
ATOM   5084 C  CG1   . ILE D 1 70  ? 5.688   41.853  -77.972  1.00 128.23 ?  70  ILE D CG1   1 
ATOM   5085 C  CG2   . ILE D 1 70  ? 4.347   43.572  -79.259  1.00 120.76 ?  70  ILE D CG2   1 
ATOM   5086 C  CD1   . ILE D 1 70  ? 5.624   40.489  -78.651  1.00 140.51 ?  70  ILE D CD1   1 
ATOM   5087 N  N     . SER D 1 71  ? 3.029   45.671  -76.956  1.00 107.92 ?  71  SER D N     1 
ATOM   5088 C  CA    . SER D 1 71  ? 1.876   46.592  -76.943  1.00 103.22 ?  71  SER D CA    1 
ATOM   5089 C  C     . SER D 1 71  ? 0.740   46.140  -77.867  1.00 102.48 ?  71  SER D C     1 
ATOM   5090 O  O     . SER D 1 71  ? 0.965   45.924  -79.064  1.00 102.76 ?  71  SER D O     1 
ATOM   5091 C  CB    . SER D 1 71  ? 2.302   48.025  -77.259  1.00 106.32 ?  71  SER D CB    1 
ATOM   5092 O  OG    . SER D 1 71  ? 2.763   48.162  -78.593  1.00 116.09 ?  71  SER D OG    1 
ATOM   5093 N  N     . SER D 1 72  ? -0.467  45.960  -77.292  1.00 94.59  ?  72  SER D N     1 
ATOM   5094 C  CA    . SER D 1 72  ? -1.655  45.503  -78.018  1.00 91.69  ?  72  SER D CA    1 
ATOM   5095 C  C     . SER D 1 72  ? -2.080  46.454  -79.131  1.00 91.55  ?  72  SER D C     1 
ATOM   5096 O  O     . SER D 1 72  ? -1.784  47.647  -79.070  1.00 90.22  ?  72  SER D O     1 
ATOM   5097 C  CB    . SER D 1 72  ? -2.802  45.195  -77.064  1.00 93.72  ?  72  SER D CB    1 
ATOM   5098 O  OG    . SER D 1 72  ? -3.024  46.249  -76.142  1.00 101.49 ?  72  SER D OG    1 
ATOM   5099 N  N     . ILE D 1 73  ? -2.740  45.905  -80.164  1.00 86.65  ?  73  ILE D N     1 
ATOM   5100 C  CA    . ILE D 1 73  ? -3.176  46.581  -81.388  1.00 84.68  ?  73  ILE D CA    1 
ATOM   5101 C  C     . ILE D 1 73  ? -3.707  48.018  -81.275  1.00 85.90  ?  73  ILE D C     1 
ATOM   5102 O  O     . ILE D 1 73  ? -3.506  48.804  -82.204  1.00 85.58  ?  73  ILE D O     1 
ATOM   5103 C  CB    . ILE D 1 73  ? -4.053  45.649  -82.256  1.00 87.89  ?  73  ILE D CB    1 
ATOM   5104 C  CG1   . ILE D 1 73  ? -3.765  45.815  -83.752  1.00 89.76  ?  73  ILE D CG1   1 
ATOM   5105 C  CG2   . ILE D 1 73  ? -5.532  45.768  -81.934  1.00 86.33  ?  73  ILE D CG2   1 
ATOM   5106 C  CD1   . ILE D 1 73  ? -2.538  45.029  -84.243  1.00 105.18 ?  73  ILE D CD1   1 
ATOM   5107 N  N     . GLU D 1 74  ? -4.372  48.360  -80.146  1.00 80.57  ?  74  GLU D N     1 
ATOM   5108 C  CA    . GLU D 1 74  ? -4.926  49.699  -79.925  1.00 78.34  ?  74  GLU D CA    1 
ATOM   5109 C  C     . GLU D 1 74  ? -3.833  50.741  -79.636  1.00 82.77  ?  74  GLU D C     1 
ATOM   5110 O  O     . GLU D 1 74  ? -4.064  51.936  -79.813  1.00 82.05  ?  74  GLU D O     1 
ATOM   5111 C  CB    . GLU D 1 74  ? -6.042  49.680  -78.861  1.00 78.08  ?  74  GLU D CB    1 
ATOM   5112 C  CG    . GLU D 1 74  ? -5.597  49.938  -77.425  1.00 89.19  ?  74  GLU D CG    1 
ATOM   5113 C  CD    . GLU D 1 74  ? -5.161  48.743  -76.600  1.00 109.12 ?  74  GLU D CD    1 
ATOM   5114 O  OE1   . GLU D 1 74  ? -5.001  47.643  -77.177  1.00 106.75 -1 74  GLU D OE1   1 
ATOM   5115 O  OE2   . GLU D 1 74  ? -4.987  48.906  -75.369  1.00 90.51  ?  74  GLU D OE2   1 
ATOM   5116 N  N     . GLU D 1 75  ? -2.641  50.271  -79.217  1.00 80.36  ?  75  GLU D N     1 
ATOM   5117 C  CA    . GLU D 1 75  ? -1.469  51.093  -78.907  1.00 81.43  ?  75  GLU D CA    1 
ATOM   5118 C  C     . GLU D 1 75  ? -0.456  51.121  -80.076  1.00 86.29  ?  75  GLU D C     1 
ATOM   5119 O  O     . GLU D 1 75  ? 0.634   51.683  -79.932  1.00 88.20  ?  75  GLU D O     1 
ATOM   5120 C  CB    . GLU D 1 75  ? -0.804  50.595  -77.617  1.00 84.27  ?  75  GLU D CB    1 
ATOM   5121 C  CG    . GLU D 1 75  ? -1.657  50.791  -76.376  1.00 93.67  ?  75  GLU D CG    1 
ATOM   5122 C  CD    . GLU D 1 75  ? -1.288  49.941  -75.177  1.00 119.52 ?  75  GLU D CD    1 
ATOM   5123 O  OE1   . GLU D 1 75  ? -0.662  48.868  -75.356  1.00 108.75 ?  75  GLU D OE1   1 
ATOM   5124 O  OE2   . GLU D 1 75  ? -1.670  50.336  -74.051  1.00 120.06 -1 75  GLU D OE2   1 
ATOM   5125 N  N     . GLN D 1 76  ? -0.834  50.541  -81.235  1.00 81.29  ?  76  GLN D N     1 
ATOM   5126 C  CA    . GLN D 1 76  ? -0.023  50.489  -82.451  1.00 82.40  ?  76  GLN D CA    1 
ATOM   5127 C  C     . GLN D 1 76  ? -0.482  51.529  -83.482  1.00 86.06  ?  76  GLN D C     1 
ATOM   5128 O  O     . GLN D 1 76  ? -1.688  51.663  -83.711  1.00 83.99  ?  76  GLN D O     1 
ATOM   5129 C  CB    . GLN D 1 76  ? -0.072  49.084  -83.053  1.00 84.35  ?  76  GLN D CB    1 
ATOM   5130 C  CG    . GLN D 1 76  ? 0.764   48.071  -82.279  1.00 95.81  ?  76  GLN D CG    1 
ATOM   5131 C  CD    . GLN D 1 76  ? 0.664   46.666  -82.819  1.00 109.82 ?  76  GLN D CD    1 
ATOM   5132 O  OE1   . GLN D 1 76  ? 0.762   46.501  -84.132  1.00 106.99 ?  76  GLN D OE1   1 
ATOM   5133 N  NE2   . GLN D 1 76  ? 0.525   45.705  -82.061  1.00 97.99  ?  76  GLN D NE2   1 
ATOM   5134 N  N     . GLU D 1 77  ? 0.477   52.269  -84.088  1.00 85.25  ?  77  GLU D N     1 
ATOM   5135 C  CA    . GLU D 1 77  ? 0.230   53.307  -85.107  1.00 85.93  ?  77  GLU D CA    1 
ATOM   5136 C  C     . GLU D 1 77  ? -0.054  52.662  -86.469  1.00 91.22  ?  77  GLU D C     1 
ATOM   5137 O  O     . GLU D 1 77  ? -1.220  52.407  -86.761  1.00 88.96  ?  77  GLU D O     1 
ATOM   5138 C  CB    . GLU D 1 77  ? 1.402   54.304  -85.202  1.00 90.10  ?  77  GLU D CB    1 
ATOM   5139 C  CG    . GLU D 1 77  ? 1.603   55.182  -83.980  1.00 98.87  ?  77  GLU D CG    1 
ATOM   5140 C  CD    . GLU D 1 77  ? 2.929   55.913  -83.910  1.00 112.93 ?  77  GLU D CD    1 
ATOM   5141 O  OE1   . GLU D 1 77  ? 3.373   56.478  -84.938  1.00 94.34  ?  77  GLU D OE1   1 
ATOM   5142 O  OE2   . GLU D 1 77  ? 3.515   55.939  -82.805  1.00 106.50 ?  77  GLU D OE2   1 
ATOM   5143 N  N     . PHE D 1 78  ? 0.983   52.399  -87.308  1.00 91.66  ?  78  PHE D N     1 
ATOM   5144 C  CA    . PHE D 1 78  ? 0.720   51.712  -88.575  1.00 92.64  ?  78  PHE D CA    1 
ATOM   5145 C  C     . PHE D 1 78  ? 0.781   50.202  -88.372  1.00 96.45  ?  78  PHE D C     1 
ATOM   5146 O  O     . PHE D 1 78  ? 1.825   49.660  -87.980  1.00 98.87  ?  78  PHE D O     1 
ATOM   5147 C  CB    . PHE D 1 78  ? 1.624   52.158  -89.747  1.00 97.96  ?  78  PHE D CB    1 
ATOM   5148 C  CG    . PHE D 1 78  ? 1.178   51.617  -91.094  1.00 100.86 ?  78  PHE D CG    1 
ATOM   5149 C  CD1   . PHE D 1 78  ? 0.206   52.274  -91.838  1.00 103.37 ?  78  PHE D CD1   1 
ATOM   5150 C  CD2   . PHE D 1 78  ? 1.736   50.452  -91.619  1.00 105.80 ?  78  PHE D CD2   1 
ATOM   5151 C  CE1   . PHE D 1 78  ? -0.216  51.770  -93.075  1.00 105.85 ?  78  PHE D CE1   1 
ATOM   5152 C  CE2   . PHE D 1 78  ? 1.309   49.947  -92.854  1.00 110.18 ?  78  PHE D CE2   1 
ATOM   5153 C  CZ    . PHE D 1 78  ? 0.332   50.609  -93.572  1.00 107.38 ?  78  PHE D CZ    1 
ATOM   5154 N  N     . ILE D 1 79  ? -0.341  49.529  -88.657  1.00 90.23  ?  79  ILE D N     1 
ATOM   5155 C  CA    . ILE D 1 79  ? -0.445  48.076  -88.555  1.00 90.28  ?  79  ILE D CA    1 
ATOM   5156 C  C     . ILE D 1 79  ? -0.025  47.467  -89.895  1.00 97.71  ?  79  ILE D C     1 
ATOM   5157 O  O     . ILE D 1 79  ? -0.595  47.773  -90.942  1.00 97.46  ?  79  ILE D O     1 
ATOM   5158 C  CB    . ILE D 1 79  ? -1.826  47.581  -88.028  1.00 90.34  ?  79  ILE D CB    1 
ATOM   5159 C  CG1   . ILE D 1 79  ? -2.033  47.959  -86.567  1.00 88.21  ?  79  ILE D CG1   1 
ATOM   5160 C  CG2   . ILE D 1 79  ? -1.960  46.072  -88.126  1.00 92.27  ?  79  ILE D CG2   1 
ATOM   5161 C  CD1   . ILE D 1 79  ? -2.736  49.108  -86.339  1.00 94.68  ?  79  ILE D CD1   1 
ATOM   5162 N  N     . GLY D 1 80  ? 1.000   46.640  -89.836  1.00 97.87  ?  80  GLY D N     1 
ATOM   5163 C  CA    . GLY D 1 80  ? 1.566   45.993  -91.005  1.00 101.55 ?  80  GLY D CA    1 
ATOM   5164 C  C     . GLY D 1 80  ? 2.777   46.736  -91.520  1.00 109.37 ?  80  GLY D C     1 
ATOM   5165 O  O     . GLY D 1 80  ? 3.289   47.653  -90.863  1.00 109.14 ?  80  GLY D O     1 
ATOM   5166 N  N     . ASP D 1 81  ? 3.255   46.316  -92.694  1.00 109.21 ?  81  ASP D N     1 
ATOM   5167 C  CA    . ASP D 1 81  ? 4.397   46.911  -93.370  1.00 112.11 ?  81  ASP D CA    1 
ATOM   5168 C  C     . ASP D 1 81  ? 3.890   47.488  -94.674  1.00 114.74 ?  81  ASP D C     1 
ATOM   5169 O  O     . ASP D 1 81  ? 3.302   46.763  -95.475  1.00 114.92 ?  81  ASP D O     1 
ATOM   5170 C  CB    . ASP D 1 81  ? 5.481   45.850  -93.628  1.00 118.94 ?  81  ASP D CB    1 
ATOM   5171 C  CG    . ASP D 1 81  ? 6.893   46.340  -93.382  1.00 138.95 ?  81  ASP D CG    1 
ATOM   5172 O  OD1   . ASP D 1 81  ? 7.210   46.683  -92.215  1.00 146.03 -1 81  ASP D OD1   1 
ATOM   5173 O  OD2   . ASP D 1 81  ? 7.681   46.387  -94.355  1.00 144.02 ?  81  ASP D OD2   1 
ATOM   5174 N  N     . LEU D 1 82  ? 4.075   48.795  -94.868  1.00 109.87 ?  82  LEU D N     1 
ATOM   5175 C  CA    . LEU D 1 82  ? 3.630   49.462  -96.085  1.00 109.74 ?  82  LEU D CA    1 
ATOM   5176 C  C     . LEU D 1 82  ? 4.595   49.141  -97.225  1.00 117.44 ?  82  LEU D C     1 
ATOM   5177 O  O     . LEU D 1 82  ? 5.790   49.425  -97.129  1.00 120.01 ?  82  LEU D O     1 
ATOM   5178 C  CB    . LEU D 1 82  ? 3.503   50.970  -95.844  1.00 108.24 ?  82  LEU D CB    1 
ATOM   5179 C  CG    . LEU D 1 82  ? 2.775   51.781  -96.900  1.00 112.90 ?  82  LEU D CG    1 
ATOM   5180 C  CD1   . LEU D 1 82  ? 1.369   51.269  -97.112  1.00 110.71 ?  82  LEU D CD1   1 
ATOM   5181 C  CD2   . LEU D 1 82  ? 2.722   53.229  -96.496  1.00 114.49 ?  82  LEU D CD2   1 
ATOM   5182 N  N     . ILE D 1 83  ? 4.076   48.513  -98.283  1.00 114.27 ?  83  ILE D N     1 
ATOM   5183 C  CA    . ILE D 1 83  ? 4.860   48.059  -99.428  1.00 118.29 ?  83  ILE D CA    1 
ATOM   5184 C  C     . ILE D 1 83  ? 4.876   49.035  -100.603 1.00 124.16 ?  83  ILE D C     1 
ATOM   5185 O  O     . ILE D 1 83  ? 5.950   49.330  -101.127 1.00 127.71 ?  83  ILE D O     1 
ATOM   5186 C  CB    . ILE D 1 83  ? 4.449   46.592  -99.785  1.00 122.39 ?  83  ILE D CB    1 
ATOM   5187 C  CG1   . ILE D 1 83  ? 5.349   45.573  -99.070  1.00 124.56 ?  83  ILE D CG1   1 
ATOM   5188 C  CG2   . ILE D 1 83  ? 4.393   46.296  -101.291 1.00 126.67 ?  83  ILE D CG2   1 
ATOM   5189 C  CD1   . ILE D 1 83  ? 5.230   45.484  -97.602  1.00 130.03 ?  83  ILE D CD1   1 
ATOM   5190 N  N     . GLN D 1 84  ? 3.700   49.535  -101.011 1.00 118.13 ?  84  GLN D N     1 
ATOM   5191 C  CA    . GLN D 1 84  ? 3.561   50.432  -102.153 1.00 119.77 ?  84  GLN D CA    1 
ATOM   5192 C  C     . GLN D 1 84  ? 2.444   51.437  -101.895 1.00 120.17 ?  84  GLN D C     1 
ATOM   5193 O  O     . GLN D 1 84  ? 1.411   51.058  -101.344 1.00 116.65 ?  84  GLN D O     1 
ATOM   5194 C  CB    . GLN D 1 84  ? 3.259   49.573  -103.403 1.00 124.19 ?  84  GLN D CB    1 
ATOM   5195 C  CG    . GLN D 1 84  ? 2.905   50.321  -104.698 1.00 139.68 ?  84  GLN D CG    1 
ATOM   5196 C  CD    . GLN D 1 84  ? 1.420   50.616  -104.864 1.00 147.43 ?  84  GLN D CD    1 
ATOM   5197 O  OE1   . GLN D 1 84  ? 0.552   49.753  -104.676 1.00 138.50 ?  84  GLN D OE1   1 
ATOM   5198 N  NE2   . GLN D 1 84  ? 1.096   51.848  -105.216 1.00 137.99 ?  84  GLN D NE2   1 
ATOM   5199 N  N     . VAL D 1 85  ? 2.644   52.707  -102.305 1.00 118.01 ?  85  VAL D N     1 
ATOM   5200 C  CA    . VAL D 1 85  ? 1.657   53.785  -102.174 1.00 115.85 ?  85  VAL D CA    1 
ATOM   5201 C  C     . VAL D 1 85  ? 1.626   54.669  -103.418 1.00 123.05 ?  85  VAL D C     1 
ATOM   5202 O  O     . VAL D 1 85  ? 2.665   55.173  -103.853 1.00 126.39 ?  85  VAL D O     1 
ATOM   5203 C  CB    . VAL D 1 85  ? 1.831   54.621  -100.869 1.00 117.18 ?  85  VAL D CB    1 
ATOM   5204 C  CG1   . VAL D 1 85  ? 1.196   56.011  -100.979 1.00 116.68 ?  85  VAL D CG1   1 
ATOM   5205 C  CG2   . VAL D 1 85  ? 1.249   53.890  -99.679  1.00 113.00 ?  85  VAL D CG2   1 
ATOM   5206 N  N     . ASN D 1 86  ? 0.418   54.849  -103.974 1.00 118.28 ?  86  ASN D N     1 
ATOM   5207 C  CA    . ASN D 1 86  ? 0.119   55.758  -105.070 1.00 120.67 ?  86  ASN D CA    1 
ATOM   5208 C  C     . ASN D 1 86  ? -0.899  56.701  -104.425 1.00 120.81 ?  86  ASN D C     1 
ATOM   5209 O  O     . ASN D 1 86  ? -2.047  56.296  -104.218 1.00 117.27 ?  86  ASN D O     1 
ATOM   5210 C  CB    . ASN D 1 86  ? -0.461  55.020  -106.281 1.00 121.87 ?  86  ASN D CB    1 
ATOM   5211 C  CG    . ASN D 1 86  ? -0.542  55.847  -107.544 1.00 141.07 ?  86  ASN D CG    1 
ATOM   5212 O  OD1   . ASN D 1 86  ? -0.446  57.084  -107.541 1.00 130.92 ?  86  ASN D OD1   1 
ATOM   5213 N  ND2   . ASN D 1 86  ? -0.750  55.170  -108.659 1.00 137.13 ?  86  ASN D ND2   1 
ATOM   5214 N  N     . PRO D 1 87  ? -0.456  57.898  -103.958 1.00 118.00 ?  87  PRO D N     1 
ATOM   5215 C  CA    . PRO D 1 87  ? -1.366  58.795  -103.226 1.00 115.54 ?  87  PRO D CA    1 
ATOM   5216 C  C     . PRO D 1 87  ? -2.745  59.010  -103.838 1.00 120.25 ?  87  PRO D C     1 
ATOM   5217 O  O     . PRO D 1 87  ? -2.867  59.372  -105.013 1.00 124.20 ?  87  PRO D O     1 
ATOM   5218 C  CB    . PRO D 1 87  ? -0.566  60.091  -103.109 1.00 119.78 ?  87  PRO D CB    1 
ATOM   5219 C  CG    . PRO D 1 87  ? 0.838   59.653  -103.113 1.00 125.85 ?  87  PRO D CG    1 
ATOM   5220 C  CD    . PRO D 1 87  ? 0.895   58.489  -104.059 1.00 122.69 ?  87  PRO D CD    1 
ATOM   5221 N  N     . ASN D 1 88  ? -3.782  58.720  -103.028 1.00 112.44 ?  88  ASN D N     1 
ATOM   5222 C  CA    . ASN D 1 88  ? -5.206  58.831  -103.357 1.00 111.88 ?  88  ASN D CA    1 
ATOM   5223 C  C     . ASN D 1 88  ? -5.630  57.930  -104.538 1.00 118.32 ?  88  ASN D C     1 
ATOM   5224 O  O     . ASN D 1 88  ? -6.662  58.188  -105.162 1.00 120.10 ?  88  ASN D O     1 
ATOM   5225 C  CB    . ASN D 1 88  ? -5.622  60.306  -103.560 1.00 113.82 ?  88  ASN D CB    1 
ATOM   5226 C  CG    . ASN D 1 88  ? -5.035  61.273  -102.556 1.00 131.46 ?  88  ASN D CG    1 
ATOM   5227 O  OD1   . ASN D 1 88  ? -5.306  61.210  -101.358 1.00 122.12 ?  88  ASN D OD1   1 
ATOM   5228 N  ND2   . ASN D 1 88  ? -4.221  62.199  -103.028 1.00 127.01 ?  88  ASN D ND2   1 
ATOM   5229 N  N     . VAL D 1 89  ? -4.847  56.865  -104.830 1.00 115.11 ?  89  VAL D N     1 
ATOM   5230 C  CA    . VAL D 1 89  ? -5.125  55.930  -105.932 1.00 117.32 ?  89  VAL D CA    1 
ATOM   5231 C  C     . VAL D 1 89  ? -5.206  54.472  -105.430 1.00 119.51 ?  89  VAL D C     1 
ATOM   5232 O  O     . VAL D 1 89  ? -6.309  53.935  -105.298 1.00 118.09 ?  89  VAL D O     1 
ATOM   5233 C  CB    . VAL D 1 89  ? -4.149  56.088  -107.140 1.00 125.65 ?  89  VAL D CB    1 
ATOM   5234 C  CG1   . VAL D 1 89  ? -4.526  55.156  -108.287 1.00 128.23 ?  89  VAL D CG1   1 
ATOM   5235 C  CG2   . VAL D 1 89  ? -4.081  57.531  -107.631 1.00 128.51 ?  89  VAL D CG2   1 
ATOM   5236 N  N     . LYS D 1 90  ? -4.037  53.841  -105.178 1.00 115.94 ?  90  LYS D N     1 
ATOM   5237 C  CA    . LYS D 1 90  ? -3.906  52.453  -104.733 1.00 113.97 ?  90  LYS D CA    1 
ATOM   5238 C  C     . LYS D 1 90  ? -2.715  52.312  -103.778 1.00 116.12 ?  90  LYS D C     1 
ATOM   5239 O  O     . LYS D 1 90  ? -1.681  52.955  -103.971 1.00 117.91 ?  90  LYS D O     1 
ATOM   5240 C  CB    . LYS D 1 90  ? -3.741  51.516  -105.949 1.00 120.27 ?  90  LYS D CB    1 
ATOM   5241 C  CG    . LYS D 1 90  ? -3.722  50.023  -105.621 1.00 132.74 ?  90  LYS D CG    1 
ATOM   5242 C  CD    . LYS D 1 90  ? -3.059  49.205  -106.730 1.00 146.40 ?  90  LYS D CD    1 
ATOM   5243 C  CE    . LYS D 1 90  ? -2.751  47.797  -106.270 1.00 152.22 ?  90  LYS D CE    1 
ATOM   5244 N  NZ    . LYS D 1 90  ? -1.900  47.052  -107.230 1.00 161.01 ?  90  LYS D NZ    1 
ATOM   5245 N  N     . ALA D 1 91  ? -2.870  51.471  -102.745 1.00 108.92 ?  91  ALA D N     1 
ATOM   5246 C  CA    . ALA D 1 91  ? -1.828  51.200  -101.761 1.00 107.00 ?  91  ALA D CA    1 
ATOM   5247 C  C     . ALA D 1 91  ? -1.866  49.743  -101.301 1.00 109.87 ?  91  ALA D C     1 
ATOM   5248 O  O     . ALA D 1 91  ? -2.929  49.117  -101.302 1.00 108.71 ?  91  ALA D O     1 
ATOM   5249 C  CB    . ALA D 1 91  ? -1.975  52.131  -100.573 1.00 104.32 ?  91  ALA D CB    1 
ATOM   5250 N  N     . GLN D 1 92  ? -0.707  49.199  -100.916 1.00 107.07 ?  92  GLN D N     1 
ATOM   5251 C  CA    . GLN D 1 92  ? -0.625  47.831  -100.412 1.00 106.23 ?  92  GLN D CA    1 
ATOM   5252 C  C     . GLN D 1 92  ? 0.338   47.619  -99.254  1.00 108.06 ?  92  GLN D C     1 
ATOM   5253 O  O     . GLN D 1 92  ? 1.430   48.189  -99.237  1.00 108.91 ?  92  GLN D O     1 
ATOM   5254 C  CB    . GLN D 1 92  ? -0.537  46.753  -101.511 1.00 111.32 ?  92  GLN D CB    1 
ATOM   5255 C  CG    . GLN D 1 92  ? 0.384   47.055  -102.686 1.00 128.42 ?  92  GLN D CG    1 
ATOM   5256 C  CD    . GLN D 1 92  ? 0.093   46.164  -103.873 1.00 148.35 ?  92  GLN D CD    1 
ATOM   5257 O  OE1   . GLN D 1 92  ? -0.697  45.211  -103.804 1.00 141.92 ?  92  GLN D OE1   1 
ATOM   5258 N  NE2   . GLN D 1 92  ? 0.732   46.457  -104.998 1.00 145.60 ?  92  GLN D NE2   1 
ATOM   5259 N  N     . SER D 1 93  ? -0.111  46.843  -98.256  1.00 101.76 ?  93  SER D N     1 
ATOM   5260 C  CA    . SER D 1 93  ? 0.641   46.520  -97.050  1.00 100.47 ?  93  SER D CA    1 
ATOM   5261 C  C     . SER D 1 93  ? 0.652   45.019  -96.780  1.00 105.43 ?  93  SER D C     1 
ATOM   5262 O  O     . SER D 1 93  ? -0.296  44.315  -97.136  1.00 104.97 ?  93  SER D O     1 
ATOM   5263 C  CB    . SER D 1 93  ? 0.087   47.279  -95.845  1.00 100.10 ?  93  SER D CB    1 
ATOM   5264 O  OG    . SER D 1 93  ? -1.037  46.652  -95.244  1.00 105.91 ?  93  SER D OG    1 
ATOM   5265 N  N     . ILE D 1 94  ? 1.724   44.535  -96.144  1.00 103.58 ?  94  ILE D N     1 
ATOM   5266 C  CA    . ILE D 1 94  ? 1.892   43.126  -95.799  1.00 105.36 ?  94  ILE D CA    1 
ATOM   5267 C  C     . ILE D 1 94  ? 1.898   42.956  -94.281  1.00 107.06 ?  94  ILE D C     1 
ATOM   5268 O  O     . ILE D 1 94  ? 2.505   43.770  -93.584  1.00 105.57 ?  94  ILE D O     1 
ATOM   5269 C  CB    . ILE D 1 94  ? 3.138   42.546  -96.535  1.00 113.60 ?  94  ILE D CB    1 
ATOM   5270 C  CG1   . ILE D 1 94  ? 2.919   42.523  -98.047  1.00 117.02 ?  94  ILE D CG1   1 
ATOM   5271 C  CG2   . ILE D 1 94  ? 3.621   41.186  -96.015  1.00 116.76 ?  94  ILE D CG2   1 
ATOM   5272 C  CD1   . ILE D 1 94  ? 4.160   42.226  -98.815  1.00 127.65 ?  94  ILE D CD1   1 
ATOM   5273 N  N     . LEU D 1 95  ? 1.194   41.927  -93.770  1.00 103.52 ?  95  LEU D N     1 
ATOM   5274 C  CA    . LEU D 1 95  ? 1.129   41.651  -92.336  1.00 101.78 ?  95  LEU D CA    1 
ATOM   5275 C  C     . LEU D 1 95  ? 1.372   40.179  -92.049  1.00 110.15 ?  95  LEU D C     1 
ATOM   5276 O  O     . LEU D 1 95  ? 0.558   39.328  -92.423  1.00 110.54 ?  95  LEU D O     1 
ATOM   5277 C  CB    . LEU D 1 95  ? -0.206  42.136  -91.714  1.00 97.13  ?  95  LEU D CB    1 
ATOM   5278 C  CG    . LEU D 1 95  ? -0.428  41.885  -90.214  1.00 99.36  ?  95  LEU D CG    1 
ATOM   5279 C  CD1   . LEU D 1 95  ? 0.417   42.806  -89.370  1.00 98.33  ?  95  LEU D CD1   1 
ATOM   5280 C  CD2   . LEU D 1 95  ? -1.885  42.078  -89.840  1.00 99.03  ?  95  LEU D CD2   1 
ATOM   5281 N  N     . ASP D 1 96  ? 2.492   39.884  -91.382  1.00 109.75 ?  96  ASP D N     1 
ATOM   5282 C  CA    . ASP D 1 96  ? 2.803   38.514  -91.004  1.00 113.87 ?  96  ASP D CA    1 
ATOM   5283 C  C     . ASP D 1 96  ? 2.049   38.215  -89.714  1.00 115.24 ?  96  ASP D C     1 
ATOM   5284 O  O     . ASP D 1 96  ? 2.162   38.970  -88.743  1.00 111.92 ?  96  ASP D O     1 
ATOM   5285 C  CB    . ASP D 1 96  ? 4.313   38.294  -90.830  1.00 120.40 ?  96  ASP D CB    1 
ATOM   5286 C  CG    . ASP D 1 96  ? 5.156   38.767  -91.993  1.00 137.51 ?  96  ASP D CG    1 
ATOM   5287 O  OD1   . ASP D 1 96  ? 5.471   39.976  -92.041  1.00 143.00 -1 96  ASP D OD1   1 
ATOM   5288 O  OD2   . ASP D 1 96  ? 5.493   37.928  -92.863  1.00 142.51 ?  96  ASP D OD2   1 
ATOM   5289 N  N     . ILE D 1 97  ? 1.237   37.151  -89.726  1.00 113.13 ?  97  ILE D N     1 
ATOM   5290 C  CA    . ILE D 1 97  ? 0.429   36.752  -88.578  1.00 111.17 ?  97  ILE D CA    1 
ATOM   5291 C  C     . ILE D 1 97  ? 1.260   35.963  -87.569  1.00 118.86 ?  97  ILE D C     1 
ATOM   5292 O  O     . ILE D 1 97  ? 1.576   34.793  -87.791  1.00 122.96 ?  97  ILE D O     1 
ATOM   5293 C  CB    . ILE D 1 97  ? -0.906  36.065  -88.999  1.00 113.99 ?  97  ILE D CB    1 
ATOM   5294 C  CG1   . ILE D 1 97  ? -1.716  36.923  -90.009  1.00 111.30 ?  97  ILE D CG1   1 
ATOM   5295 C  CG2   . ILE D 1 97  ? -1.751  35.657  -87.794  1.00 113.22 ?  97  ILE D CG2   1 
ATOM   5296 C  CD1   . ILE D 1 97  ? -2.262  38.312  -89.526  1.00 112.66 ?  97  ILE D CD1   1 
ATOM   5297 N  N     . THR D 1 98  ? 1.644   36.645  -86.478  1.00 114.10 ?  98  THR D N     1 
ATOM   5298 C  CA    . THR D 1 98  ? 2.438   36.102  -85.372  1.00 116.97 ?  98  THR D CA    1 
ATOM   5299 C  C     . THR D 1 98  ? 1.514   35.554  -84.282  1.00 121.01 ?  98  THR D C     1 
ATOM   5300 O  O     . THR D 1 98  ? 0.297   35.752  -84.351  1.00 117.79 ?  98  THR D O     1 
ATOM   5301 C  CB    . THR D 1 98  ? 3.388   37.178  -84.808  1.00 123.32 ?  98  THR D CB    1 
ATOM   5302 O  OG1   . THR D 1 98  ? 2.632   38.300  -84.344  1.00 119.08 ?  98  THR D OG1   1 
ATOM   5303 C  CG2   . THR D 1 98  ? 4.452   37.613  -85.802  1.00 123.45 ?  98  THR D CG2   1 
ATOM   5304 N  N     . SER D 1 99  ? 2.097   34.878  -83.267  1.00 120.95 ?  99  SER D N     1 
ATOM   5305 C  CA    . SER D 1 99  ? 1.379   34.295  -82.125  1.00 120.77 ?  99  SER D CA    1 
ATOM   5306 C  C     . SER D 1 99  ? 0.570   35.330  -81.337  1.00 119.61 ?  99  SER D C     1 
ATOM   5307 O  O     . SER D 1 99  ? -0.427  34.978  -80.706  1.00 118.25 ?  99  SER D O     1 
ATOM   5308 C  CB    . SER D 1 99  ? 2.346   33.558  -81.204  1.00 128.68 ?  99  SER D CB    1 
ATOM   5309 O  OG    . SER D 1 99  ? 3.475   34.349  -80.872  1.00 137.11 ?  99  SER D OG    1 
ATOM   5310 N  N     . ASP D 1 100 ? 0.983   36.605  -81.411  1.00 113.32 ?  100 ASP D N     1 
ATOM   5311 C  CA    . ASP D 1 100 ? 0.357   37.739  -80.732  1.00 108.39 ?  100 ASP D CA    1 
ATOM   5312 C  C     . ASP D 1 100 ? -0.928  38.192  -81.412  1.00 108.11 ?  100 ASP D C     1 
ATOM   5313 O  O     . ASP D 1 100 ? -1.725  38.896  -80.792  1.00 104.32 ?  100 ASP D O     1 
ATOM   5314 C  CB    . ASP D 1 100 ? 1.347   38.913  -80.637  1.00 109.53 ?  100 ASP D CB    1 
ATOM   5315 C  CG    . ASP D 1 100 ? 2.731   38.527  -80.144  1.00 129.95 ?  100 ASP D CG    1 
ATOM   5316 O  OD1   . ASP D 1 100 ? 2.830   37.939  -79.042  1.00 132.86 ?  100 ASP D OD1   1 
ATOM   5317 O  OD2   . ASP D 1 100 ? 3.715   38.805  -80.865  1.00 140.80 -1 100 ASP D OD2   1 
ATOM   5318 N  N     . SER D 1 101 ? -1.128  37.796  -82.682  1.00 105.33 ?  101 SER D N     1 
ATOM   5319 C  CA    . SER D 1 101 ? -2.295  38.169  -83.483  1.00 102.07 ?  101 SER D CA    1 
ATOM   5320 C  C     . SER D 1 101 ? -3.409  37.107  -83.493  1.00 108.23 ?  101 SER D C     1 
ATOM   5321 O  O     . SER D 1 101 ? -4.555  37.433  -83.798  1.00 105.23 ?  101 SER D O     1 
ATOM   5322 C  CB    . SER D 1 101 ? -1.869  38.498  -84.911  1.00 104.88 ?  101 SER D CB    1 
ATOM   5323 O  OG    . SER D 1 101 ? -0.725  39.336  -84.954  1.00 111.05 ?  101 SER D OG    1 
ATOM   5324 N  N     . VAL D 1 102 ? -3.079  35.852  -83.150  1.00 110.34 ?  102 VAL D N     1 
ATOM   5325 C  CA    . VAL D 1 102 ? -4.018  34.722  -83.138  1.00 113.08 ?  102 VAL D CA    1 
ATOM   5326 C  C     . VAL D 1 102 ? -4.596  34.401  -81.757  1.00 119.00 ?  102 VAL D C     1 
ATOM   5327 O  O     . VAL D 1 102 ? -3.956  34.679  -80.739  1.00 118.28 ?  102 VAL D O     1 
ATOM   5328 C  CB    . VAL D 1 102 ? -3.406  33.439  -83.776  1.00 122.48 ?  102 VAL D CB    1 
ATOM   5329 C  CG1   . VAL D 1 102 ? -3.157  33.615  -85.264  1.00 123.00 ?  102 VAL D CG1   1 
ATOM   5330 C  CG2   . VAL D 1 102 ? -2.133  32.991  -83.058  1.00 125.52 ?  102 VAL D CG2   1 
ATOM   5331 N  N     . PHE D 1 103 ? -5.784  33.757  -81.734  1.00 118.09 ?  103 PHE D N     1 
ATOM   5332 C  CA    . PHE D 1 103 ? -6.419  33.263  -80.512  1.00 119.57 ?  103 PHE D CA    1 
ATOM   5333 C  C     . PHE D 1 103 ? -5.630  32.013  -80.129  1.00 129.14 ?  103 PHE D C     1 
ATOM   5334 O  O     . PHE D 1 103 ? -5.543  31.079  -80.932  1.00 132.61 ?  103 PHE D O     1 
ATOM   5335 C  CB    . PHE D 1 103 ? -7.890  32.880  -80.757  1.00 122.01 ?  103 PHE D CB    1 
ATOM   5336 C  CG    . PHE D 1 103 ? -8.884  34.000  -80.926  1.00 119.69 ?  103 PHE D CG    1 
ATOM   5337 C  CD1   . PHE D 1 103 ? -9.183  34.854  -79.866  1.00 119.97 ?  103 PHE D CD1   1 
ATOM   5338 C  CD2   . PHE D 1 103 ? -9.595  34.147  -82.113  1.00 122.18 ?  103 PHE D CD2   1 
ATOM   5339 C  CE1   . PHE D 1 103 ? -10.125 35.875  -80.010  1.00 117.34 ?  103 PHE D CE1   1 
ATOM   5340 C  CE2   . PHE D 1 103 ? -10.545 35.162  -82.256  1.00 121.60 ?  103 PHE D CE2   1 
ATOM   5341 C  CZ    . PHE D 1 103 ? -10.800 36.023  -81.204  1.00 116.48 ?  103 PHE D CZ    1 
ATOM   5342 N  N     . HIS D 1 104 ? -5.012  32.021  -78.936  1.00 126.19 ?  104 HIS D N     1 
ATOM   5343 C  CA    . HIS D 1 104 ? -4.175  30.927  -78.436  1.00 131.48 ?  104 HIS D CA    1 
ATOM   5344 C  C     . HIS D 1 104 ? -4.768  29.524  -78.637  1.00 139.23 ?  104 HIS D C     1 
ATOM   5345 O  O     . HIS D 1 104 ? -4.077  28.640  -79.145  1.00 143.94 ?  104 HIS D O     1 
ATOM   5346 C  CB    . HIS D 1 104 ? -3.783  31.172  -76.970  1.00 132.31 ?  104 HIS D CB    1 
ATOM   5347 C  CG    . HIS D 1 104 ? -2.903  30.111  -76.389  1.00 141.88 ?  104 HIS D CG    1 
ATOM   5348 N  ND1   . HIS D 1 104 ? -3.312  29.351  -75.309  1.00 146.69 ?  104 HIS D ND1   1 
ATOM   5349 C  CD2   . HIS D 1 104 ? -1.670  29.700  -76.771  1.00 147.60 ?  104 HIS D CD2   1 
ATOM   5350 C  CE1   . HIS D 1 104 ? -2.315  28.516  -75.059  1.00 151.73 ?  104 HIS D CE1   1 
ATOM   5351 N  NE2   . HIS D 1 104 ? -1.307  28.686  -75.916  1.00 152.85 ?  104 HIS D NE2   1 
ATOM   5352 N  N     . LYS D 1 105 ? -6.051  29.348  -78.282  1.00 134.07 ?  105 LYS D N     1 
ATOM   5353 C  CA    . LYS D 1 105 ? -6.804  28.092  -78.377  1.00 138.16 ?  105 LYS D CA    1 
ATOM   5354 C  C     . LYS D 1 105 ? -6.980  27.558  -79.803  1.00 142.86 ?  105 LYS D C     1 
ATOM   5355 O  O     . LYS D 1 105 ? -6.685  26.389  -80.057  1.00 148.08 ?  105 LYS D O     1 
ATOM   5356 C  CB    . LYS D 1 105 ? -8.163  28.181  -77.644  1.00 139.00 ?  105 LYS D CB    1 
ATOM   5357 C  CG    . LYS D 1 105 ? -9.042  29.373  -78.010  1.00 147.86 ?  105 LYS D CG    1 
ATOM   5358 C  CD    . LYS D 1 105 ? -10.482 29.173  -77.560  1.00 157.24 ?  105 LYS D CD    1 
ATOM   5359 C  CE    . LYS D 1 105 ? -11.268 30.454  -77.646  1.00 159.89 ?  105 LYS D CE    1 
ATOM   5360 N  NZ    . LYS D 1 105 ? -10.829 31.440  -76.619  1.00 162.83 ?  105 LYS D NZ    1 
ATOM   5361 N  N     . THR D 1 106 ? -7.448  28.418  -80.725  1.00 134.32 ?  106 THR D N     1 
ATOM   5362 C  CA    . THR D 1 106 ? -7.767  28.068  -82.114  1.00 135.25 ?  106 THR D CA    1 
ATOM   5363 C  C     . THR D 1 106 ? -6.628  28.233  -83.123  1.00 137.86 ?  106 THR D C     1 
ATOM   5364 O  O     . THR D 1 106 ? -6.540  27.447  -84.070  1.00 141.51 ?  106 THR D O     1 
ATOM   5365 C  CB    . THR D 1 106 ? -9.033  28.806  -82.583  1.00 139.64 ?  106 THR D CB    1 
ATOM   5366 O  OG1   . THR D 1 106 ? -8.812  30.215  -82.531  1.00 131.36 ?  106 THR D OG1   1 
ATOM   5367 C  CG2   . THR D 1 106 ? -10.275 28.442  -81.773  1.00 139.35 ?  106 THR D CG2   1 
ATOM   5368 N  N     . GLY D 1 107 ? -5.804  29.263  -82.934  1.00 128.77 ?  107 GLY D N     1 
ATOM   5369 C  CA    . GLY D 1 107 ? -4.698  29.588  -83.828  1.00 128.01 ?  107 GLY D CA    1 
ATOM   5370 C  C     . GLY D 1 107 ? -5.132  30.436  -85.008  1.00 125.78 ?  107 GLY D C     1 
ATOM   5371 O  O     . GLY D 1 107 ? -4.397  30.551  -85.993  1.00 126.32 ?  107 GLY D O     1 
ATOM   5372 N  N     . ILE D 1 108 ? -6.336  31.035  -84.908  1.00 116.91 ?  108 ILE D N     1 
ATOM   5373 C  CA    . ILE D 1 108 ? -6.944  31.898  -85.924  1.00 112.76 ?  108 ILE D CA    1 
ATOM   5374 C  C     . ILE D 1 108 ? -6.779  33.350  -85.498  1.00 110.01 ?  108 ILE D C     1 
ATOM   5375 O  O     . ILE D 1 108 ? -6.995  33.669  -84.326  1.00 107.79 ?  108 ILE D O     1 
ATOM   5376 C  CB    . ILE D 1 108 ? -8.444  31.538  -86.150  1.00 115.99 ?  108 ILE D CB    1 
ATOM   5377 C  CG1   . ILE D 1 108 ? -8.634  30.029  -86.400  1.00 122.70 ?  108 ILE D CG1   1 
ATOM   5378 C  CG2   . ILE D 1 108 ? -9.064  32.370  -87.290  1.00 113.84 ?  108 ILE D CG2   1 
ATOM   5379 C  CD1   . ILE D 1 108 ? -10.004 29.494  -86.036  1.00 132.17 ?  108 ILE D CD1   1 
ATOM   5380 N  N     . ALA D 1 109 ? -6.411  34.228  -86.453  1.00 103.58 ?  109 ALA D N     1 
ATOM   5381 C  CA    . ALA D 1 109 ? -6.224  35.665  -86.234  1.00 98.23  ?  109 ALA D CA    1 
ATOM   5382 C  C     . ALA D 1 109 ? -7.493  36.320  -85.718  1.00 97.22  ?  109 ALA D C     1 
ATOM   5383 O  O     . ALA D 1 109 ? -8.591  35.966  -86.148  1.00 96.67  ?  109 ALA D O     1 
ATOM   5384 C  CB    . ALA D 1 109 ? -5.777  36.340  -87.521  1.00 98.58  ?  109 ALA D CB    1 
ATOM   5385 N  N     . ARG D 1 110 ? -7.339  37.250  -84.772  1.00 90.93  ?  110 ARG D N     1 
ATOM   5386 C  CA    . ARG D 1 110 ? -8.456  37.980  -84.176  1.00 87.76  ?  110 ARG D CA    1 
ATOM   5387 C  C     . ARG D 1 110 ? -9.037  38.959  -85.190  1.00 90.23  ?  110 ARG D C     1 
ATOM   5388 O  O     . ARG D 1 110 ? -8.298  39.489  -86.016  1.00 89.66  ?  110 ARG D O     1 
ATOM   5389 C  CB    . ARG D 1 110 ? -8.024  38.692  -82.882  1.00 84.78  ?  110 ARG D CB    1 
ATOM   5390 C  CG    . ARG D 1 110 ? -7.572  37.722  -81.806  1.00 96.64  ?  110 ARG D CG    1 
ATOM   5391 C  CD    . ARG D 1 110 ? -7.345  38.366  -80.453  1.00 108.03 ?  110 ARG D CD    1 
ATOM   5392 N  NE    . ARG D 1 110 ? -5.926  38.597  -80.164  1.00 123.33 ?  110 ARG D NE    1 
ATOM   5393 C  CZ    . ARG D 1 110 ? -5.103  37.682  -79.663  1.00 147.19 ?  110 ARG D CZ    1 
ATOM   5394 N  NH1   . ARG D 1 110 ? -5.545  36.461  -79.384  1.00 143.32 ?  110 ARG D NH1   1 
ATOM   5395 N  NH2   . ARG D 1 110 ? -3.836  37.984  -79.415  1.00 134.69 ?  110 ARG D NH2   1 
ATOM   5396 N  N     . GLY D 1 111 ? -10.353 39.148  -85.142  1.00 85.98  ?  111 GLY D N     1 
ATOM   5397 C  CA    . GLY D 1 111 ? -11.084 40.022  -86.053  1.00 84.58  ?  111 GLY D CA    1 
ATOM   5398 C  C     . GLY D 1 111 ? -10.483 41.399  -86.250  1.00 86.51  ?  111 GLY D C     1 
ATOM   5399 O  O     . GLY D 1 111 ? -10.269 41.828  -87.385  1.00 85.94  ?  111 GLY D O     1 
ATOM   5400 N  N     . HIS D 1 112 ? -10.168 42.077  -85.138  1.00 81.89  ?  112 HIS D N     1 
ATOM   5401 C  CA    . HIS D 1 112 ? -9.600  43.423  -85.122  1.00 79.77  ?  112 HIS D CA    1 
ATOM   5402 C  C     . HIS D 1 112 ? -8.206  43.541  -85.721  1.00 84.21  ?  112 HIS D C     1 
ATOM   5403 O  O     . HIS D 1 112 ? -7.828  44.634  -86.129  1.00 83.45  ?  112 HIS D O     1 
ATOM   5404 C  CB    . HIS D 1 112 ? -9.659  44.030  -83.720  1.00 78.76  ?  112 HIS D CB    1 
ATOM   5405 C  CG    . HIS D 1 112 ? -8.978  43.208  -82.680  1.00 83.47  ?  112 HIS D CG    1 
ATOM   5406 N  ND1   . HIS D 1 112 ? -9.676  42.297  -81.907  1.00 85.97  ?  112 HIS D ND1   1 
ATOM   5407 C  CD2   . HIS D 1 112 ? -7.678  43.186  -82.319  1.00 86.49  ?  112 HIS D CD2   1 
ATOM   5408 C  CE1   . HIS D 1 112 ? -8.781  41.760  -81.097  1.00 86.96  ?  112 HIS D CE1   1 
ATOM   5409 N  NE2   . HIS D 1 112 ? -7.564  42.264  -81.310  1.00 87.57  ?  112 HIS D NE2   1 
ATOM   5410 N  N     . VAL D 1 113 ? -7.453  42.433  -85.792  1.00 82.27  ?  113 VAL D N     1 
ATOM   5411 C  CA    . VAL D 1 113 ? -6.106  42.399  -86.374  1.00 83.52  ?  113 VAL D CA    1 
ATOM   5412 C  C     . VAL D 1 113 ? -6.163  42.754  -87.868  1.00 88.88  ?  113 VAL D C     1 
ATOM   5413 O  O     . VAL D 1 113 ? -5.430  43.637  -88.312  1.00 88.68  ?  113 VAL D O     1 
ATOM   5414 C  CB    . VAL D 1 113 ? -5.411  41.036  -86.150  1.00 90.07  ?  113 VAL D CB    1 
ATOM   5415 C  CG1   . VAL D 1 113 ? -4.018  41.004  -86.784  1.00 92.00  ?  113 VAL D CG1   1 
ATOM   5416 C  CG2   . VAL D 1 113 ? -5.352  40.687  -84.665  1.00 89.47  ?  113 VAL D CG2   1 
ATOM   5417 N  N     . LEU D 1 114 ? -7.044  42.085  -88.629  1.00 86.29  ?  114 LEU D N     1 
ATOM   5418 C  CA    . LEU D 1 114 ? -7.196  42.315  -90.062  1.00 87.00  ?  114 LEU D CA    1 
ATOM   5419 C  C     . LEU D 1 114 ? -7.820  43.657  -90.383  1.00 87.43  ?  114 LEU D C     1 
ATOM   5420 O  O     . LEU D 1 114 ? -7.463  44.256  -91.399  1.00 87.87  ?  114 LEU D O     1 
ATOM   5421 C  CB    . LEU D 1 114 ? -7.956  41.173  -90.720  1.00 89.71  ?  114 LEU D CB    1 
ATOM   5422 C  CG    . LEU D 1 114 ? -7.146  39.901  -90.848  1.00 98.26  ?  114 LEU D CG    1 
ATOM   5423 C  CD1   . LEU D 1 114 ? -7.865  38.740  -90.209  1.00 99.69  ?  114 LEU D CD1   1 
ATOM   5424 C  CD2   . LEU D 1 114 ? -6.794  39.631  -92.289  1.00 104.82 ?  114 LEU D CD2   1 
ATOM   5425 N  N     . PHE D 1 115 ? -8.728  44.142  -89.517  1.00 80.93  ?  115 PHE D N     1 
ATOM   5426 C  CA    . PHE D 1 115 ? -9.356  45.451  -89.692  1.00 78.53  ?  115 PHE D CA    1 
ATOM   5427 C  C     . PHE D 1 115 ? -8.315  46.544  -89.469  1.00 80.95  ?  115 PHE D C     1 
ATOM   5428 O  O     . PHE D 1 115 ? -8.321  47.537  -90.193  1.00 80.66  ?  115 PHE D O     1 
ATOM   5429 C  CB    . PHE D 1 115 ? -10.551 45.643  -88.744  1.00 78.16  ?  115 PHE D CB    1 
ATOM   5430 C  CG    . PHE D 1 115 ? -11.167 47.010  -88.848  1.00 78.24  ?  115 PHE D CG    1 
ATOM   5431 C  CD1   . PHE D 1 115 ? -12.087 47.297  -89.844  1.00 82.44  ?  115 PHE D CD1   1 
ATOM   5432 C  CD2   . PHE D 1 115 ? -10.791 48.028  -87.979  1.00 78.83  ?  115 PHE D CD2   1 
ATOM   5433 C  CE1   . PHE D 1 115 ? -12.633 48.573  -89.960  1.00 82.66  ?  115 PHE D CE1   1 
ATOM   5434 C  CE2   . PHE D 1 115 ? -11.325 49.310  -88.107  1.00 80.86  ?  115 PHE D CE2   1 
ATOM   5435 C  CZ    . PHE D 1 115 ? -12.238 49.574  -89.099  1.00 79.98  ?  115 PHE D CZ    1 
ATOM   5436 N  N     . ALA D 1 116 ? -7.431  46.356  -88.466  1.00 76.05  ?  116 ALA D N     1 
ATOM   5437 C  CA    . ALA D 1 116 ? -6.364  47.288  -88.120  1.00 74.85  ?  116 ALA D CA    1 
ATOM   5438 C  C     . ALA D 1 116 ? -5.437  47.535  -89.298  1.00 79.82  ?  116 ALA D C     1 
ATOM   5439 O  O     . ALA D 1 116 ? -5.119  48.689  -89.575  1.00 78.85  ?  116 ALA D O     1 
ATOM   5440 C  CB    . ALA D 1 116 ? -5.579  46.770  -86.928  1.00 75.62  ?  116 ALA D CB    1 
ATOM   5441 N  N     . GLN D 1 117 ? -5.046  46.460  -90.017  1.00 78.65  ?  117 GLN D N     1 
ATOM   5442 C  CA    . GLN D 1 117 ? -4.186  46.539  -91.200  1.00 80.96  ?  117 GLN D CA    1 
ATOM   5443 C  C     . GLN D 1 117 ? -4.901  47.305  -92.307  1.00 85.60  ?  117 GLN D C     1 
ATOM   5444 O  O     . GLN D 1 117 ? -4.289  48.173  -92.934  1.00 87.09  ?  117 GLN D O     1 
ATOM   5445 C  CB    . GLN D 1 117 ? -3.793  45.134  -91.683  1.00 84.80  ?  117 GLN D CB    1 
ATOM   5446 C  CG    . GLN D 1 117 ? -2.822  45.137  -92.864  1.00 92.22  ?  117 GLN D CG    1 
ATOM   5447 C  CD    . GLN D 1 117 ? -2.757  43.818  -93.589  1.00 103.98 ?  117 GLN D CD    1 
ATOM   5448 O  OE1   . GLN D 1 117 ? -3.597  42.927  -93.405  1.00 99.40  ?  117 GLN D OE1   1 
ATOM   5449 N  NE2   . GLN D 1 117 ? -1.764  43.677  -94.458  1.00 91.03  ?  117 GLN D NE2   1 
ATOM   5450 N  N     . ALA D 1 118 ? -6.200  46.995  -92.518  1.00 80.69  ?  118 ALA D N     1 
ATOM   5451 C  CA    . ALA D 1 118 ? -7.039  47.620  -93.532  1.00 80.92  ?  118 ALA D CA    1 
ATOM   5452 C  C     . ALA D 1 118 ? -7.188  49.110  -93.275  1.00 83.51  ?  118 ALA D C     1 
ATOM   5453 O  O     . ALA D 1 118 ? -6.868  49.907  -94.155  1.00 84.15  ?  118 ALA D O     1 
ATOM   5454 C  CB    . ALA D 1 118 ? -8.401  46.947  -93.575  1.00 81.39  ?  118 ALA D CB    1 
ATOM   5455 N  N     . ASN D 1 119 ? -7.620  49.482  -92.057  1.00 78.63  ?  119 ASN D N     1 
ATOM   5456 C  CA    . ASN D 1 119 ? -7.822  50.872  -91.647  1.00 77.66  ?  119 ASN D CA    1 
ATOM   5457 C  C     . ASN D 1 119 ? -6.528  51.670  -91.796  1.00 83.89  ?  119 ASN D C     1 
ATOM   5458 O  O     . ASN D 1 119 ? -6.551  52.740  -92.407  1.00 84.78  ?  119 ASN D O     1 
ATOM   5459 C  CB    . ASN D 1 119 ? -8.349  50.942  -90.210  1.00 74.93  ?  119 ASN D CB    1 
ATOM   5460 C  CG    . ASN D 1 119 ? -8.847  52.298  -89.822  1.00 92.64  ?  119 ASN D CG    1 
ATOM   5461 O  OD1   . ASN D 1 119 ? -9.907  52.726  -90.262  1.00 87.13  ?  119 ASN D OD1   1 
ATOM   5462 N  ND2   . ASN D 1 119 ? -8.095  53.004  -88.990  1.00 85.10  ?  119 ASN D ND2   1 
ATOM   5463 N  N     . SER D 1 120 ? -5.396  51.120  -91.290  1.00 80.83  ?  120 SER D N     1 
ATOM   5464 C  CA    . SER D 1 120 ? -4.073  51.743  -91.357  1.00 81.95  ?  120 SER D CA    1 
ATOM   5465 C  C     . SER D 1 120 ? -3.691  52.073  -92.791  1.00 87.34  ?  120 SER D C     1 
ATOM   5466 O  O     . SER D 1 120 ? -3.202  53.173  -93.057  1.00 87.76  ?  120 SER D O     1 
ATOM   5467 C  CB    . SER D 1 120 ? -3.020  50.832  -90.734  1.00 86.51  ?  120 SER D CB    1 
ATOM   5468 O  OG    . SER D 1 120 ? -2.977  50.983  -89.325  1.00 94.92  ?  120 SER D OG    1 
ATOM   5469 N  N     . LEU D 1 121 ? -3.951  51.126  -93.712  1.00 84.68  ?  121 LEU D N     1 
ATOM   5470 C  CA    . LEU D 1 121 ? -3.663  51.235  -95.140  1.00 86.92  ?  121 LEU D CA    1 
ATOM   5471 C  C     . LEU D 1 121 ? -4.430  52.384  -95.783  1.00 90.57  ?  121 LEU D C     1 
ATOM   5472 O  O     . LEU D 1 121 ? -3.869  53.078  -96.630  1.00 92.42  ?  121 LEU D O     1 
ATOM   5473 C  CB    . LEU D 1 121 ? -3.969  49.891  -95.835  1.00 88.15  ?  121 LEU D CB    1 
ATOM   5474 C  CG    . LEU D 1 121 ? -3.548  49.690  -97.295  1.00 95.83  ?  121 LEU D CG    1 
ATOM   5475 C  CD1   . LEU D 1 121 ? -2.073  49.929  -97.497  1.00 98.00  ?  121 LEU D CD1   1 
ATOM   5476 C  CD2   . LEU D 1 121 ? -3.885  48.292  -97.756  1.00 98.95  ?  121 LEU D CD2   1 
ATOM   5477 N  N     . CYS D 1 122 ? -5.690  52.602  -95.354  1.00 84.82  ?  122 CYS D N     1 
ATOM   5478 C  CA    . CYS D 1 122 ? -6.552  53.672  -95.854  1.00 84.98  ?  122 CYS D CA    1 
ATOM   5479 C  C     . CYS D 1 122 ? -6.030  55.050  -95.483  1.00 89.86  ?  122 CYS D C     1 
ATOM   5480 O  O     . CYS D 1 122 ? -5.996  55.926  -96.342  1.00 92.00  ?  122 CYS D O     1 
ATOM   5481 C  CB    . CYS D 1 122 ? -7.990  53.473  -95.396  1.00 83.16  ?  122 CYS D CB    1 
ATOM   5482 S  SG    . CYS D 1 122 ? -8.772  51.989  -96.068  1.00 87.83  ?  122 CYS D SG    1 
ATOM   5483 N  N     . VAL D 1 123 ? -5.586  55.231  -94.226  1.00 85.00  ?  123 VAL D N     1 
ATOM   5484 C  CA    . VAL D 1 123 ? -5.019  56.491  -93.721  1.00 85.66  ?  123 VAL D CA    1 
ATOM   5485 C  C     . VAL D 1 123 ? -3.722  56.829  -94.503  1.00 93.34  ?  123 VAL D C     1 
ATOM   5486 O  O     . VAL D 1 123 ? -3.469  57.996  -94.829  1.00 94.65  ?  123 VAL D O     1 
ATOM   5487 C  CB    . VAL D 1 123 ? -4.789  56.431  -92.185  1.00 87.10  ?  123 VAL D CB    1 
ATOM   5488 C  CG1   . VAL D 1 123 ? -4.383  57.791  -91.627  1.00 87.81  ?  123 VAL D CG1   1 
ATOM   5489 C  CG2   . VAL D 1 123 ? -6.026  55.913  -91.460  1.00 84.11  ?  123 VAL D CG2   1 
ATOM   5490 N  N     . ALA D 1 124 ? -2.936  55.791  -94.830  1.00 91.49  ?  124 ALA D N     1 
ATOM   5491 C  CA    . ALA D 1 124 ? -1.693  55.905  -95.585  1.00 95.17  ?  124 ALA D CA    1 
ATOM   5492 C  C     . ALA D 1 124 ? -1.970  56.252  -97.049  1.00 102.20 ?  124 ALA D C     1 
ATOM   5493 O  O     . ALA D 1 124 ? -1.234  57.042  -97.644  1.00 104.90 ?  124 ALA D O     1 
ATOM   5494 C  CB    . ALA D 1 124 ? -0.906  54.602  -95.494  1.00 96.38  ?  124 ALA D CB    1 
ATOM   5495 N  N     . LEU D 1 125 ? -3.029  55.660  -97.624  1.00 98.35  ?  125 LEU D N     1 
ATOM   5496 C  CA    . LEU D 1 125 ? -3.431  55.862  -99.017  1.00 101.15 ?  125 LEU D CA    1 
ATOM   5497 C  C     . LEU D 1 125 ? -3.904  57.297  -99.308  1.00 106.98 ?  125 LEU D C     1 
ATOM   5498 O  O     . LEU D 1 125 ? -3.543  57.850  -100.352 1.00 110.27 ?  125 LEU D O     1 
ATOM   5499 C  CB    . LEU D 1 125 ? -4.485  54.805  -99.417  1.00 100.22 ?  125 LEU D CB    1 
ATOM   5500 C  CG    . LEU D 1 125 ? -5.201  54.923  -100.759 1.00 107.67 ?  125 LEU D CG    1 
ATOM   5501 C  CD1   . LEU D 1 125 ? -4.229  54.916  -101.922 1.00 111.85 ?  125 LEU D CD1   1 
ATOM   5502 C  CD2   . LEU D 1 125 ? -6.201  53.809  -100.920 1.00 109.40 ?  125 LEU D CD2   1 
ATOM   5503 N  N     . ILE D 1 126 ? -4.690  57.898  -98.394  1.00 101.11 ?  126 ILE D N     1 
ATOM   5504 C  CA    . ILE D 1 126 ? -5.190  59.260  -98.571  1.00 102.41 ?  126 ILE D CA    1 
ATOM   5505 C  C     . ILE D 1 126 ? -4.160  60.307  -98.138  1.00 109.51 ?  126 ILE D C     1 
ATOM   5506 O  O     . ILE D 1 126 ? -3.846  60.422  -96.951  1.00 107.43 ?  126 ILE D O     1 
ATOM   5507 C  CB    . ILE D 1 126 ? -6.615  59.457  -97.989  1.00 102.81 ?  126 ILE D CB    1 
ATOM   5508 C  CG1   . ILE D 1 126 ? -7.623  58.577  -98.744  1.00 102.85 ?  126 ILE D CG1   1 
ATOM   5509 C  CG2   . ILE D 1 126 ? -7.056  60.914  -98.060  1.00 105.44 ?  126 ILE D CG2   1 
ATOM   5510 C  CD1   . ILE D 1 126 ? -8.312  57.626  -97.923  1.00 104.19 ?  126 ILE D CD1   1 
ATOM   5511 N  N     . LYS D 1 127 ? -3.619  61.043  -99.129  1.00 111.04 ?  127 LYS D N     1 
ATOM   5512 C  CA    . LYS D 1 127 ? -2.627  62.102  -98.948  1.00 113.92 ?  127 LYS D CA    1 
ATOM   5513 C  C     . LYS D 1 127 ? -3.364  63.431  -98.750  1.00 119.75 ?  127 LYS D C     1 
ATOM   5514 O  O     . LYS D 1 127 ? -3.546  64.209  -99.693  1.00 123.53 ?  127 LYS D O     1 
ATOM   5515 C  CB    . LYS D 1 127 ? -1.659  62.149  -100.148 1.00 121.16 ?  127 LYS D CB    1 
ATOM   5516 C  CG    . LYS D 1 127 ? -0.432  63.043  -99.950  1.00 141.71 ?  127 LYS D CG    1 
ATOM   5517 C  CD    . LYS D 1 127 ? 0.362   63.172  -101.245 1.00 155.65 ?  127 LYS D CD    1 
ATOM   5518 C  CE    . LYS D 1 127 ? 1.426   64.234  -101.196 1.00 169.76 ?  127 LYS D CE    1 
ATOM   5519 N  NZ    . LYS D 1 127 ? 2.134   64.338  -102.499 1.00 183.47 ?  127 LYS D NZ    1 
ATOM   5520 N  N     . GLN D 1 128 ? -3.839  63.649  -97.515  1.00 113.42 ?  128 GLN D N     1 
ATOM   5521 C  CA    . GLN D 1 128 ? -4.570  64.844  -97.092  1.00 114.36 ?  128 GLN D CA    1 
ATOM   5522 C  C     . GLN D 1 128 ? -4.121  65.245  -95.674  1.00 118.14 ?  128 GLN D C     1 
ATOM   5523 O  O     . GLN D 1 128 ? -3.677  64.360  -94.931  1.00 114.72 ?  128 GLN D O     1 
ATOM   5524 C  CB    . GLN D 1 128 ? -6.091  64.590  -97.127  1.00 113.60 ?  128 GLN D CB    1 
ATOM   5525 C  CG    . GLN D 1 128 ? -6.716  64.554  -98.528  1.00 121.96 ?  128 GLN D CG    1 
ATOM   5526 C  CD    . GLN D 1 128 ? -6.561  65.827  -99.322  1.00 137.63 ?  128 GLN D CD    1 
ATOM   5527 O  OE1   . GLN D 1 128 ? -6.675  66.942  -98.802  1.00 132.00 ?  128 GLN D OE1   1 
ATOM   5528 N  NE2   . GLN D 1 128 ? -6.321  65.681  -100.615 1.00 132.74 ?  128 GLN D NE2   1 
ATOM   5529 N  N     . PRO D 1 129 ? -4.224  66.543  -95.265  1.00 118.18 ?  129 PRO D N     1 
ATOM   5530 C  CA    . PRO D 1 129 ? -3.794  66.920  -93.901  1.00 117.23 ?  129 PRO D CA    1 
ATOM   5531 C  C     . PRO D 1 129 ? -4.497  66.130  -92.793  1.00 116.46 ?  129 PRO D C     1 
ATOM   5532 O  O     . PRO D 1 129 ? -3.821  65.501  -91.975  1.00 114.05 ?  129 PRO D O     1 
ATOM   5533 C  CB    . PRO D 1 129 ? -4.106  68.422  -93.824  1.00 122.93 ?  129 PRO D CB    1 
ATOM   5534 C  CG    . PRO D 1 129 ? -4.167  68.875  -95.231  1.00 131.35 ?  129 PRO D CG    1 
ATOM   5535 C  CD    . PRO D 1 129 ? -4.713  67.721  -96.011  1.00 124.29 ?  129 PRO D CD    1 
ATOM   5536 N  N     . THR D 1 130 ? -5.843  66.115  -92.805  1.00 111.22 ?  130 THR D N     1 
ATOM   5537 C  CA    . THR D 1 130 ? -6.650  65.398  -91.817  1.00 106.65 ?  130 THR D CA    1 
ATOM   5538 C  C     . THR D 1 130 ? -7.482  64.299  -92.470  1.00 106.92 ?  130 THR D C     1 
ATOM   5539 O  O     . THR D 1 130 ? -8.272  64.576  -93.373  1.00 108.22 ?  130 THR D O     1 
ATOM   5540 C  CB    . THR D 1 130 ? -7.458  66.370  -90.943  1.00 117.38 ?  130 THR D CB    1 
ATOM   5541 O  OG1   . THR D 1 130 ? -7.990  67.417  -91.759  1.00 121.73 ?  130 THR D OG1   1 
ATOM   5542 C  CG2   . THR D 1 130 ? -6.623  66.972  -89.818  1.00 116.75 ?  130 THR D CG2   1 
ATOM   5543 N  N     . VAL D 1 131 ? -7.254  63.044  -92.044  1.00 99.09  ?  131 VAL D N     1 
ATOM   5544 C  CA    . VAL D 1 131 ? -7.937  61.844  -92.545  1.00 96.40  ?  131 VAL D CA    1 
ATOM   5545 C  C     . VAL D 1 131 ? -8.494  61.066  -91.342  1.00 95.07  ?  131 VAL D C     1 
ATOM   5546 O  O     . VAL D 1 131 ? -7.739  60.743  -90.421  1.00 93.47  ?  131 VAL D O     1 
ATOM   5547 C  CB    . VAL D 1 131 ? -7.008  60.957  -93.426  1.00 100.85 ?  131 VAL D CB    1 
ATOM   5548 C  CG1   . VAL D 1 131 ? -7.765  59.769  -94.016  1.00 99.21  ?  131 VAL D CG1   1 
ATOM   5549 C  CG2   . VAL D 1 131 ? -6.342  61.768  -94.536  1.00 104.79 ?  131 VAL D CG2   1 
ATOM   5550 N  N     . LEU D 1 132 ? -9.816  60.794  -91.342  1.00 88.45  ?  132 LEU D N     1 
ATOM   5551 C  CA    . LEU D 1 132 ? -10.503 60.073  -90.263  1.00 83.99  ?  132 LEU D CA    1 
ATOM   5552 C  C     . LEU D 1 132 ? -11.512 59.079  -90.818  1.00 84.91  ?  132 LEU D C     1 
ATOM   5553 O  O     . LEU D 1 132 ? -12.258 59.422  -91.728  1.00 86.99  ?  132 LEU D O     1 
ATOM   5554 C  CB    . LEU D 1 132 ? -11.238 61.052  -89.320  1.00 84.08  ?  132 LEU D CB    1 
ATOM   5555 C  CG    . LEU D 1 132 ? -10.430 62.149  -88.614  1.00 89.72  ?  132 LEU D CG    1 
ATOM   5556 C  CD1   . LEU D 1 132 ? -11.351 63.192  -88.019  1.00 90.96  ?  132 LEU D CD1   1 
ATOM   5557 C  CD2   . LEU D 1 132 ? -9.518  61.576  -87.539  1.00 89.97  ?  132 LEU D CD2   1 
ATOM   5558 N  N     . THR D 1 133 ? -11.567 57.868  -90.251  1.00 77.70  ?  133 THR D N     1 
ATOM   5559 C  CA    . THR D 1 133 ? -12.528 56.840  -90.660  1.00 76.73  ?  133 THR D CA    1 
ATOM   5560 C  C     . THR D 1 133 ? -13.882 57.217  -90.080  1.00 81.74  ?  133 THR D C     1 
ATOM   5561 O  O     . THR D 1 133 ? -13.990 57.459  -88.873  1.00 80.30  ?  133 THR D O     1 
ATOM   5562 C  CB    . THR D 1 133 ? -12.103 55.444  -90.187  1.00 79.42  ?  133 THR D CB    1 
ATOM   5563 O  OG1   . THR D 1 133 ? -10.702 55.281  -90.375  1.00 83.94  ?  133 THR D OG1   1 
ATOM   5564 C  CG2   . THR D 1 133 ? -12.865 54.326  -90.890  1.00 74.02  ?  133 THR D CG2   1 
ATOM   5565 N  N     . HIS D 1 134 ? -14.902 57.295  -90.943  1.00 80.77  ?  134 HIS D N     1 
ATOM   5566 C  CA    . HIS D 1 134 ? -16.262 57.652  -90.548  1.00 81.11  ?  134 HIS D CA    1 
ATOM   5567 C  C     . HIS D 1 134 ? -17.190 56.445  -90.496  1.00 83.74  ?  134 HIS D C     1 
ATOM   5568 O  O     . HIS D 1 134 ? -17.992 56.329  -89.569  1.00 83.18  ?  134 HIS D O     1 
ATOM   5569 C  CB    . HIS D 1 134 ? -16.815 58.756  -91.451  1.00 85.25  ?  134 HIS D CB    1 
ATOM   5570 C  CG    . HIS D 1 134 ? -16.590 60.136  -90.921  1.00 89.94  ?  134 HIS D CG    1 
ATOM   5571 N  ND1   . HIS D 1 134 ? -17.421 61.185  -91.278  1.00 95.05  ?  134 HIS D ND1   1 
ATOM   5572 C  CD2   . HIS D 1 134 ? -15.652 60.595  -90.058  1.00 90.71  ?  134 HIS D CD2   1 
ATOM   5573 C  CE1   . HIS D 1 134 ? -16.957 62.244  -90.634  1.00 95.21  ?  134 HIS D CE1   1 
ATOM   5574 N  NE2   . HIS D 1 134 ? -15.894 61.937  -89.885  1.00 92.95  ?  134 HIS D NE2   1 
ATOM   5575 N  N     . GLU D 1 135 ? -17.069 55.544  -91.480  1.00 79.49  ?  135 GLU D N     1 
ATOM   5576 C  CA    . GLU D 1 135 ? -17.856 54.319  -91.579  1.00 78.90  ?  135 GLU D CA    1 
ATOM   5577 C  C     . GLU D 1 135 ? -17.021 53.222  -92.203  1.00 80.75  ?  135 GLU D C     1 
ATOM   5578 O  O     . GLU D 1 135 ? -16.097 53.509  -92.965  1.00 81.38  ?  135 GLU D O     1 
ATOM   5579 C  CB    . GLU D 1 135 ? -19.098 54.546  -92.460  1.00 83.52  ?  135 GLU D CB    1 
ATOM   5580 C  CG    . GLU D 1 135 ? -20.293 55.166  -91.756  1.00 95.68  ?  135 GLU D CG    1 
ATOM   5581 C  CD    . GLU D 1 135 ? -21.418 55.610  -92.673  1.00 116.74 ?  135 GLU D CD    1 
ATOM   5582 O  OE1   . GLU D 1 135 ? -21.528 55.078  -93.802  1.00 102.77 ?  135 GLU D OE1   1 
ATOM   5583 O  OE2   . GLU D 1 135 ? -22.206 56.484  -92.246  1.00 116.68 -1 135 GLU D OE2   1 
ATOM   5584 N  N     . SER D 1 136 ? -17.373 51.963  -91.911  1.00 76.08  ?  136 SER D N     1 
ATOM   5585 C  CA    . SER D 1 136 ? -16.729 50.787  -92.481  1.00 76.80  ?  136 SER D CA    1 
ATOM   5586 C  C     . SER D 1 136 ? -17.641 49.569  -92.457  1.00 83.15  ?  136 SER D C     1 
ATOM   5587 O  O     . SER D 1 136 ? -18.330 49.323  -91.464  1.00 82.61  ?  136 SER D O     1 
ATOM   5588 C  CB    . SER D 1 136 ? -15.411 50.479  -91.785  1.00 78.82  ?  136 SER D CB    1 
ATOM   5589 O  OG    . SER D 1 136 ? -14.708 49.473  -92.493  1.00 90.42  ?  136 SER D OG    1 
ATOM   5590 N  N     . SER D 1 137 ? -17.657 48.823  -93.566  1.00 82.28  ?  137 SER D N     1 
ATOM   5591 C  CA    . SER D 1 137 ? -18.424 47.592  -93.726  1.00 84.08  ?  137 SER D CA    1 
ATOM   5592 C  C     . SER D 1 137 ? -17.404 46.535  -94.124  1.00 88.20  ?  137 SER D C     1 
ATOM   5593 O  O     . SER D 1 137 ? -16.767 46.643  -95.174  1.00 88.91  ?  137 SER D O     1 
ATOM   5594 C  CB    . SER D 1 137 ? -19.502 47.763  -94.791  1.00 92.25  ?  137 SER D CB    1 
ATOM   5595 O  OG    . SER D 1 137 ? -20.293 46.594  -94.914  1.00 107.08 ?  137 SER D OG    1 
ATOM   5596 N  N     . ILE D 1 138 ? -17.173 45.571  -93.234  1.00 84.45  ?  138 ILE D N     1 
ATOM   5597 C  CA    . ILE D 1 138 ? -16.141 44.547  -93.423  1.00 85.51  ?  138 ILE D CA    1 
ATOM   5598 C  C     . ILE D 1 138 ? -16.673 43.115  -93.438  1.00 92.01  ?  138 ILE D C     1 
ATOM   5599 O  O     . ILE D 1 138 ? -17.721 42.836  -92.853  1.00 92.01  ?  138 ILE D O     1 
ATOM   5600 C  CB    . ILE D 1 138 ? -14.962 44.749  -92.432  1.00 86.10  ?  138 ILE D CB    1 
ATOM   5601 C  CG1   . ILE D 1 138 ? -15.438 44.643  -90.967  1.00 84.71  ?  138 ILE D CG1   1 
ATOM   5602 C  CG2   . ILE D 1 138 ? -14.230 46.083  -92.698  1.00 85.46  ?  138 ILE D CG2   1 
ATOM   5603 C  CD1   . ILE D 1 138 ? -14.375 44.355  -90.003  1.00 94.26  ?  138 ILE D CD1   1 
ATOM   5604 N  N     . GLN D 1 139 ? -15.943 42.213  -94.124  1.00 90.75  ?  139 GLN D N     1 
ATOM   5605 C  CA    . GLN D 1 139 ? -16.286 40.796  -94.280  1.00 93.64  ?  139 GLN D CA    1 
ATOM   5606 C  C     . GLN D 1 139 ? -15.057 39.907  -94.092  1.00 97.78  ?  139 GLN D C     1 
ATOM   5607 O  O     . GLN D 1 139 ? -14.013 40.163  -94.700  1.00 97.30  ?  139 GLN D O     1 
ATOM   5608 C  CB    . GLN D 1 139 ? -16.890 40.529  -95.671  1.00 98.79  ?  139 GLN D CB    1 
ATOM   5609 C  CG    . GLN D 1 139 ? -18.258 41.138  -95.897  1.00 116.18 ?  139 GLN D CG    1 
ATOM   5610 C  CD    . GLN D 1 139 ? -18.772 40.785  -97.259  1.00 146.46 ?  139 GLN D CD    1 
ATOM   5611 O  OE1   . GLN D 1 139 ? -18.346 41.330  -98.281  1.00 144.86 ?  139 GLN D OE1   1 
ATOM   5612 N  NE2   . GLN D 1 139 ? -19.734 39.882  -97.296  1.00 144.18 ?  139 GLN D NE2   1 
ATOM   5613 N  N     . PHE D 1 140 ? -15.192 38.849  -93.270  1.00 94.99  ?  140 PHE D N     1 
ATOM   5614 C  CA    . PHE D 1 140 ? -14.123 37.883  -93.010  1.00 96.27  ?  140 PHE D CA    1 
ATOM   5615 C  C     . PHE D 1 140 ? -14.426 36.591  -93.767  1.00 104.77 ?  140 PHE D C     1 
ATOM   5616 O  O     . PHE D 1 140 ? -14.992 35.646  -93.208  1.00 106.09 ?  140 PHE D O     1 
ATOM   5617 C  CB    . PHE D 1 140 ? -13.955 37.639  -91.502  1.00 96.25  ?  140 PHE D CB    1 
ATOM   5618 C  CG    . PHE D 1 140 ? -13.587 38.872  -90.714  1.00 93.50  ?  140 PHE D CG    1 
ATOM   5619 C  CD1   . PHE D 1 140 ? -12.256 39.220  -90.519  1.00 95.29  ?  140 PHE D CD1   1 
ATOM   5620 C  CD2   . PHE D 1 140 ? -14.571 39.676  -90.148  1.00 93.14  ?  140 PHE D CD2   1 
ATOM   5621 C  CE1   . PHE D 1 140 ? -11.916 40.360  -89.789  1.00 92.45  ?  140 PHE D CE1   1 
ATOM   5622 C  CE2   . PHE D 1 140 ? -14.229 40.814  -89.416  1.00 92.08  ?  140 PHE D CE2   1 
ATOM   5623 C  CZ    . PHE D 1 140 ? -12.905 41.150  -89.245  1.00 88.95  ?  140 PHE D CZ    1 
ATOM   5624 N  N     . ILE D 1 141 ? -14.068 36.586  -95.066  1.00 103.53 ?  141 ILE D N     1 
ATOM   5625 C  CA    . ILE D 1 141 ? -14.288 35.507  -96.037  1.00 108.20 ?  141 ILE D CA    1 
ATOM   5626 C  C     . ILE D 1 141 ? -13.709 34.161  -95.595  1.00 115.46 ?  141 ILE D C     1 
ATOM   5627 O  O     . ILE D 1 141 ? -14.450 33.175  -95.534  1.00 118.47 ?  141 ILE D O     1 
ATOM   5628 C  CB    . ILE D 1 141 ? -13.855 35.944  -97.467  1.00 112.69 ?  141 ILE D CB    1 
ATOM   5629 C  CG1   . ILE D 1 141 ? -14.716 37.119  -97.962  1.00 111.02 ?  141 ILE D CG1   1 
ATOM   5630 C  CG2   . ILE D 1 141 ? -13.916 34.786  -98.470  1.00 119.70 ?  141 ILE D CG2   1 
ATOM   5631 C  CD1   . ILE D 1 141 ? -14.057 38.403  -97.903  1.00 114.00 ?  141 ILE D CD1   1 
ATOM   5632 N  N     . GLU D 1 142 ? -12.400 34.119  -95.294  1.00 111.42 ?  142 GLU D N     1 
ATOM   5633 C  CA    . GLU D 1 142 ? -11.731 32.899  -94.842  1.00 114.65 ?  142 GLU D CA    1 
ATOM   5634 C  C     . GLU D 1 142 ? -11.021 33.119  -93.513  1.00 114.68 ?  142 GLU D C     1 
ATOM   5635 O  O     . GLU D 1 142 ? -10.741 34.263  -93.142  1.00 109.94 ?  142 GLU D O     1 
ATOM   5636 C  CB    . GLU D 1 142 ? -10.745 32.367  -95.903  1.00 120.46 ?  142 GLU D CB    1 
ATOM   5637 C  CG    . GLU D 1 142 ? -11.355 32.013  -97.256  1.00 137.13 ?  142 GLU D CG    1 
ATOM   5638 C  CD    . GLU D 1 142 ? -12.445 30.955  -97.287  1.00 165.55 ?  142 GLU D CD    1 
ATOM   5639 O  OE1   . GLU D 1 142 ? -12.392 30.008  -96.469  1.00 163.98 ?  142 GLU D OE1   1 
ATOM   5640 O  OE2   . GLU D 1 142 ? -13.340 31.062  -98.156  1.00 163.22 -1 142 GLU D OE2   1 
ATOM   5641 N  N     . LYS D 1 143 ? -10.740 32.022  -92.791  1.00 113.33 ?  143 LYS D N     1 
ATOM   5642 C  CA    . LYS D 1 143 ? -10.041 32.073  -91.508  1.00 110.73 ?  143 LYS D CA    1 
ATOM   5643 C  C     . LYS D 1 143 ? -8.546  32.280  -91.747  1.00 113.60 ?  143 LYS D C     1 
ATOM   5644 O  O     . LYS D 1 143 ? -7.911  31.471  -92.430  1.00 117.64 ?  143 LYS D O     1 
ATOM   5645 C  CB    . LYS D 1 143 ? -10.285 30.791  -90.684  1.00 116.72 ?  143 LYS D CB    1 
ATOM   5646 C  CG    . LYS D 1 143 ? -11.639 30.745  -89.980  1.00 125.54 ?  143 LYS D CG    1 
ATOM   5647 C  CD    . LYS D 1 143 ? -12.316 29.376  -90.090  1.00 138.09 ?  143 LYS D CD    1 
ATOM   5648 C  CE    . LYS D 1 143 ? -11.908 28.395  -89.014  1.00 148.64 ?  143 LYS D CE    1 
ATOM   5649 N  NZ    . LYS D 1 143 ? -12.667 27.123  -89.113  1.00 162.86 ?  143 LYS D NZ    1 
ATOM   5650 N  N     . VAL D 1 144 ? -7.998  33.384  -91.214  1.00 104.63 ?  144 VAL D N     1 
ATOM   5651 C  CA    . VAL D 1 144 ? -6.571  33.682  -91.316  1.00 104.25 ?  144 VAL D CA    1 
ATOM   5652 C  C     . VAL D 1 144 ? -5.904  32.989  -90.132  1.00 108.97 ?  144 VAL D C     1 
ATOM   5653 O  O     . VAL D 1 144 ? -6.213  33.298  -88.979  1.00 105.80 ?  144 VAL D O     1 
ATOM   5654 C  CB    . VAL D 1 144 ? -6.265  35.199  -91.360  1.00 103.22 ?  144 VAL D CB    1 
ATOM   5655 C  CG1   . VAL D 1 144 ? -4.766  35.455  -91.299  1.00 103.76 ?  144 VAL D CG1   1 
ATOM   5656 C  CG2   . VAL D 1 144 ? -6.860  35.840  -92.601  1.00 102.28 ?  144 VAL D CG2   1 
ATOM   5657 N  N     . LYS D 1 145 ? -5.031  32.023  -90.416  1.00 109.78 ?  145 LYS D N     1 
ATOM   5658 C  CA    . LYS D 1 145 ? -4.359  31.270  -89.367  1.00 111.87 ?  145 LYS D CA    1 
ATOM   5659 C  C     . LYS D 1 145 ? -2.940  31.772  -89.069  1.00 115.52 ?  145 LYS D C     1 
ATOM   5660 O  O     . LYS D 1 145 ? -2.454  32.694  -89.730  1.00 113.11 ?  145 LYS D O     1 
ATOM   5661 C  CB    . LYS D 1 145 ? -4.420  29.759  -89.653  1.00 120.63 ?  145 LYS D CB    1 
ATOM   5662 C  CG    . LYS D 1 145 ? -5.776  29.165  -89.306  1.00 133.41 ?  145 LYS D CG    1 
ATOM   5663 C  CD    . LYS D 1 145 ? -5.844  27.677  -89.549  1.00 149.50 ?  145 LYS D CD    1 
ATOM   5664 C  CE    . LYS D 1 145 ? -7.126  27.121  -88.992  1.00 160.96 ?  145 LYS D CE    1 
ATOM   5665 N  NZ    . LYS D 1 145 ? -7.074  26.919  -87.514  1.00 166.02 ?  145 LYS D NZ    1 
ATOM   5666 N  N     . LEU D 1 146 ? -2.307  31.195  -88.034  1.00 114.33 ?  146 LEU D N     1 
ATOM   5667 C  CA    . LEU D 1 146 ? -0.954  31.505  -87.589  1.00 114.98 ?  146 LEU D CA    1 
ATOM   5668 C  C     . LEU D 1 146 ? 0.058   31.221  -88.708  1.00 124.64 ?  146 LEU D C     1 
ATOM   5669 O  O     . LEU D 1 146 ? -0.108  30.257  -89.459  1.00 128.53 ?  146 LEU D O     1 
ATOM   5670 C  CB    . LEU D 1 146 ? -0.646  30.679  -86.322  1.00 117.53 ?  146 LEU D CB    1 
ATOM   5671 C  CG    . LEU D 1 146 ? 0.754   30.756  -85.698  1.00 123.97 ?  146 LEU D CG    1 
ATOM   5672 C  CD1   . LEU D 1 146 ? 1.084   32.150  -85.232  1.00 119.05 ?  146 LEU D CD1   1 
ATOM   5673 C  CD2   . LEU D 1 146 ? 0.867   29.811  -84.533  1.00 129.41 ?  146 LEU D CD2   1 
ATOM   5674 N  N     . ASN D 1 147 ? 1.079   32.097  -88.825  1.00 121.19 ?  147 ASN D N     1 
ATOM   5675 C  CA    . ASN D 1 147 ? 2.170   32.068  -89.812  1.00 125.03 ?  147 ASN D CA    1 
ATOM   5676 C  C     . ASN D 1 147 ? 1.806   32.505  -91.245  1.00 128.46 ?  147 ASN D C     1 
ATOM   5677 O  O     . ASN D 1 147 ? 2.684   32.561  -92.113  1.00 131.50 ?  147 ASN D O     1 
ATOM   5678 C  CB    . ASN D 1 147 ? 3.003   30.778  -89.750  1.00 133.51 ?  147 ASN D CB    1 
ATOM   5679 C  CG    . ASN D 1 147 ? 3.690   30.579  -88.424  1.00 160.80 ?  147 ASN D CG    1 
ATOM   5680 O  OD1   . ASN D 1 147 ? 4.406   31.458  -87.923  1.00 154.06 ?  147 ASN D OD1   1 
ATOM   5681 N  ND2   . ASN D 1 147 ? 3.486   29.414  -87.826  1.00 157.77 ?  147 ASN D ND2   1 
ATOM   5682 N  N     . ASP D 1 148 ? 0.528   32.869  -91.474  1.00 120.63 ?  148 ASP D N     1 
ATOM   5683 C  CA    . ASP D 1 148 ? 0.071   33.373  -92.769  1.00 119.42 ?  148 ASP D CA    1 
ATOM   5684 C  C     . ASP D 1 148 ? 0.536   34.814  -92.934  1.00 119.04 ?  148 ASP D C     1 
ATOM   5685 O  O     . ASP D 1 148 ? 0.692   35.526  -91.941  1.00 115.58 ?  148 ASP D O     1 
ATOM   5686 C  CB    . ASP D 1 148 ? -1.466  33.336  -92.866  1.00 118.85 ?  148 ASP D CB    1 
ATOM   5687 C  CG    . ASP D 1 148 ? -2.112  31.973  -93.047  1.00 134.29 ?  148 ASP D CG    1 
ATOM   5688 O  OD1   . ASP D 1 148 ? -1.382  30.994  -93.339  1.00 140.50 ?  148 ASP D OD1   1 
ATOM   5689 O  OD2   . ASP D 1 148 ? -3.353  31.892  -92.937  1.00 137.32 -1 148 ASP D OD2   1 
ATOM   5690 N  N     . THR D 1 149 ? 0.756   35.246  -94.179  1.00 116.08 ?  149 THR D N     1 
ATOM   5691 C  CA    . THR D 1 149 ? 1.139   36.623  -94.471  1.00 112.69 ?  149 THR D CA    1 
ATOM   5692 C  C     . THR D 1 149 ? -0.010  37.247  -95.250  1.00 113.57 ?  149 THR D C     1 
ATOM   5693 O  O     . THR D 1 149 ? -0.337  36.784  -96.344  1.00 116.23 ?  149 THR D O     1 
ATOM   5694 C  CB    . THR D 1 149 ? 2.509   36.697  -95.158  1.00 123.84 ?  149 THR D CB    1 
ATOM   5695 O  OG1   . THR D 1 149 ? 3.426   35.841  -94.471  1.00 127.90 ?  149 THR D OG1   1 
ATOM   5696 C  CG2   . THR D 1 149 ? 3.065   38.109  -95.180  1.00 119.00 ?  149 THR D CG2   1 
ATOM   5697 N  N     . VAL D 1 150 ? -0.660  38.253  -94.658  1.00 104.58 ?  150 VAL D N     1 
ATOM   5698 C  CA    . VAL D 1 150 ? -1.811  38.921  -95.262  1.00 101.79 ?  150 VAL D CA    1 
ATOM   5699 C  C     . VAL D 1 150 ? -1.383  40.083  -96.157  1.00 105.32 ?  150 VAL D C     1 
ATOM   5700 O  O     . VAL D 1 150 ? -0.782  41.043  -95.681  1.00 103.04 ?  150 VAL D O     1 
ATOM   5701 C  CB    . VAL D 1 150 ? -2.861  39.348  -94.207  1.00 101.20 ?  150 VAL D CB    1 
ATOM   5702 C  CG1   . VAL D 1 150 ? -4.115  39.888  -94.874  1.00 99.22  ?  150 VAL D CG1   1 
ATOM   5703 C  CG2   . VAL D 1 150 ? -3.213  38.191  -93.281  1.00 101.96 ?  150 VAL D CG2   1 
ATOM   5704 N  N     . ARG D 1 151 ? -1.690  39.992  -97.449  1.00 104.27 ?  151 ARG D N     1 
ATOM   5705 C  CA    . ARG D 1 151 ? -1.366  41.042  -98.404  1.00 104.46 ?  151 ARG D CA    1 
ATOM   5706 C  C     . ARG D 1 151 ? -2.640  41.834  -98.662  1.00 106.53 ?  151 ARG D C     1 
ATOM   5707 O  O     . ARG D 1 151 ? -3.544  41.366  -99.362  1.00 107.72 ?  151 ARG D O     1 
ATOM   5708 C  CB    . ARG D 1 151 ? -0.787  40.442  -99.695  1.00 109.40 ?  151 ARG D CB    1 
ATOM   5709 C  CG    . ARG D 1 151 ? -0.231  41.477  -100.663 1.00 116.84 ?  151 ARG D CG    1 
ATOM   5710 C  CD    . ARG D 1 151 ? 0.158   40.863  -101.994 1.00 126.87 ?  151 ARG D CD    1 
ATOM   5711 N  NE    . ARG D 1 151 ? -0.954  40.169  -102.647 1.00 134.59 ?  151 ARG D NE    1 
ATOM   5712 C  CZ    . ARG D 1 151 ? -1.928  40.772  -103.323 1.00 147.44 ?  151 ARG D CZ    1 
ATOM   5713 N  NH1   . ARG D 1 151 ? -1.953  42.097  -103.428 1.00 129.97 ?  151 ARG D NH1   1 
ATOM   5714 N  NH2   . ARG D 1 151 ? -2.889  40.057  -103.892 1.00 138.12 ?  151 ARG D NH2   1 
ATOM   5715 N  N     . ALA D 1 152 ? -2.731  43.010  -98.040  1.00 100.00 ?  152 ALA D N     1 
ATOM   5716 C  CA    . ALA D 1 152 ? -3.891  43.888  -98.158  1.00 97.42  ?  152 ALA D CA    1 
ATOM   5717 C  C     . ALA D 1 152 ? -3.672  44.936  -99.229  1.00 103.59 ?  152 ALA D C     1 
ATOM   5718 O  O     . ALA D 1 152 ? -2.620  45.575  -99.257  1.00 103.73 ?  152 ALA D O     1 
ATOM   5719 C  CB    . ALA D 1 152 ? -4.168  44.569  -96.831  1.00 93.88  ?  152 ALA D CB    1 
ATOM   5720 N  N     . GLU D 1 153 ? -4.664  45.115  -100.111 1.00 101.65 ?  153 GLU D N     1 
ATOM   5721 C  CA    . GLU D 1 153 ? -4.610  46.136  -101.155 1.00 103.04 ?  153 GLU D CA    1 
ATOM   5722 C  C     . GLU D 1 153 ? -5.835  47.028  -101.105 1.00 103.62 ?  153 GLU D C     1 
ATOM   5723 O  O     . GLU D 1 153 ? -6.962  46.531  -101.117 1.00 102.98 ?  153 GLU D O     1 
ATOM   5724 C  CB    . GLU D 1 153 ? -4.300  45.587  -102.569 1.00 109.40 ?  153 GLU D CB    1 
ATOM   5725 C  CG    . GLU D 1 153 ? -4.930  44.249  -102.938 1.00 126.08 ?  153 GLU D CG    1 
ATOM   5726 C  CD    . GLU D 1 153 ? -4.692  43.772  -104.360 1.00 160.31 ?  153 GLU D CD    1 
ATOM   5727 O  OE1   . GLU D 1 153 ? -4.918  44.572  -105.293 1.00 158.37 ?  153 GLU D OE1   1 
ATOM   5728 O  OE2   . GLU D 1 153 ? -4.439  42.561  -104.548 1.00 162.57 -1 153 GLU D OE2   1 
ATOM   5729 N  N     . ALA D 1 154 ? -5.601  48.343  -100.957 1.00 98.24  ?  154 ALA D N     1 
ATOM   5730 C  CA    . ALA D 1 154 ? -6.647  49.357  -100.874 1.00 96.52  ?  154 ALA D CA    1 
ATOM   5731 C  C     . ALA D 1 154 ? -6.681  50.203  -102.138 1.00 104.24 ?  154 ALA D C     1 
ATOM   5732 O  O     . ALA D 1 154 ? -5.630  50.602  -102.642 1.00 106.27 ?  154 ALA D O     1 
ATOM   5733 C  CB    . ALA D 1 154 ? -6.425  50.242  -99.664  1.00 93.92  ?  154 ALA D CB    1 
ATOM   5734 N  N     . ARG D 1 155 ? -7.893  50.458  -102.661 1.00 101.30 ?  155 ARG D N     1 
ATOM   5735 C  CA    . ARG D 1 155 ? -8.110  51.256  -103.868 1.00 104.01 ?  155 ARG D CA    1 
ATOM   5736 C  C     . ARG D 1 155 ? -9.198  52.290  -103.631 1.00 104.35 ?  155 ARG D C     1 
ATOM   5737 O  O     . ARG D 1 155 ? -10.236 51.966  -103.047 1.00 101.36 ?  155 ARG D O     1 
ATOM   5738 C  CB    . ARG D 1 155 ? -8.511  50.362  -105.051 1.00 109.90 ?  155 ARG D CB    1 
ATOM   5739 C  CG    . ARG D 1 155 ? -7.374  49.518  -105.622 1.00 130.54 ?  155 ARG D CG    1 
ATOM   5740 C  CD    . ARG D 1 155 ? -7.810  48.607  -106.765 1.00 157.06 ?  155 ARG D CD    1 
ATOM   5741 N  NE    . ARG D 1 155 ? -8.995  47.798  -106.449 1.00 176.82 ?  155 ARG D NE    1 
ATOM   5742 C  CZ    . ARG D 1 155 ? -8.981  46.664  -105.752 1.00 195.23 ?  155 ARG D CZ    1 
ATOM   5743 N  NH1   . ARG D 1 155 ? -7.839  46.182  -105.271 1.00 182.59 ?  155 ARG D NH1   1 
ATOM   5744 N  NH2   . ARG D 1 155 ? -10.112 46.012  -105.515 1.00 185.87 ?  155 ARG D NH2   1 
ATOM   5745 N  N     . VAL D 1 156 ? -8.968  53.530  -104.095 1.00 101.60 ?  156 VAL D N     1 
ATOM   5746 C  CA    . VAL D 1 156 ? -9.952  54.607  -103.984 1.00 101.01 ?  156 VAL D CA    1 
ATOM   5747 C  C     . VAL D 1 156 ? -10.991 54.364  -105.083 1.00 108.16 ?  156 VAL D C     1 
ATOM   5748 O  O     . VAL D 1 156 ? -10.640 54.362  -106.267 1.00 111.67 ?  156 VAL D O     1 
ATOM   5749 C  CB    . VAL D 1 156 ? -9.318  56.025  -104.061 1.00 105.87 ?  156 VAL D CB    1 
ATOM   5750 C  CG1   . VAL D 1 156 ? -10.393 57.111  -104.043 1.00 106.39 ?  156 VAL D CG1   1 
ATOM   5751 C  CG2   . VAL D 1 156 ? -8.327  56.244  -102.925 1.00 102.75 ?  156 VAL D CG2   1 
ATOM   5752 N  N     . VAL D 1 157 ? -12.247 54.100  -104.684 1.00 103.11 ?  157 VAL D N     1 
ATOM   5753 C  CA    . VAL D 1 157 ? -13.334 53.823  -105.622 1.00 106.08 ?  157 VAL D CA    1 
ATOM   5754 C  C     . VAL D 1 157 ? -14.157 55.066  -105.958 1.00 113.79 ?  157 VAL D C     1 
ATOM   5755 O  O     . VAL D 1 157 ? -14.630 55.206  -107.091 1.00 118.08 ?  157 VAL D O     1 
ATOM   5756 C  CB    . VAL D 1 157 ? -14.193 52.585  -105.255 1.00 108.19 ?  157 VAL D CB    1 
ATOM   5757 C  CG1   . VAL D 1 157 ? -13.360 51.309  -105.298 1.00 107.42 ?  157 VAL D CG1   1 
ATOM   5758 C  CG2   . VAL D 1 157 ? -14.885 52.744  -103.907 1.00 104.20 ?  157 VAL D CG2   1 
ATOM   5759 N  N     . ASN D 1 158 ? -14.305 55.973  -104.979 1.00 108.42 ?  158 ASN D N     1 
ATOM   5760 C  CA    . ASN D 1 158 ? -15.034 57.230  -105.132 1.00 110.71 ?  158 ASN D CA    1 
ATOM   5761 C  C     . ASN D 1 158 ? -14.453 58.307  -104.219 1.00 112.95 ?  158 ASN D C     1 
ATOM   5762 O  O     . ASN D 1 158 ? -13.730 57.992  -103.271 1.00 108.73 ?  158 ASN D O     1 
ATOM   5763 C  CB    . ASN D 1 158 ? -16.532 57.032  -104.864 1.00 112.72 ?  158 ASN D CB    1 
ATOM   5764 C  CG    . ASN D 1 158 ? -17.415 58.121  -105.431 1.00 148.16 ?  158 ASN D CG    1 
ATOM   5765 O  OD1   . ASN D 1 158 ? -17.306 58.513  -106.603 1.00 147.85 ?  158 ASN D OD1   1 
ATOM   5766 N  ND2   . ASN D 1 158 ? -18.334 58.613  -104.613 1.00 141.25 ?  158 ASN D ND2   1 
ATOM   5767 N  N     . GLN D 1 159 ? -14.741 59.581  -104.532 1.00 112.89 ?  159 GLN D N     1 
ATOM   5768 C  CA    . GLN D 1 159 ? -14.281 60.734  -103.765 1.00 112.11 ?  159 GLN D CA    1 
ATOM   5769 C  C     . GLN D 1 159 ? -15.279 61.882  -103.892 1.00 119.92 ?  159 GLN D C     1 
ATOM   5770 O  O     . GLN D 1 159 ? -15.513 62.384  -104.995 1.00 124.53 ?  159 GLN D O     1 
ATOM   5771 C  CB    . GLN D 1 159 ? -12.868 61.173  -104.211 1.00 114.81 ?  159 GLN D CB    1 
ATOM   5772 C  CG    . GLN D 1 159 ? -12.240 62.242  -103.316 1.00 122.97 ?  159 GLN D CG    1 
ATOM   5773 C  CD    . GLN D 1 159 ? -11.210 63.078  -104.033 1.00 140.29 ?  159 GLN D CD    1 
ATOM   5774 O  OE1   . GLN D 1 159 ? -10.298 62.570  -104.700 1.00 134.72 ?  159 GLN D OE1   1 
ATOM   5775 N  NE2   . GLN D 1 159 ? -11.304 64.385  -103.863 1.00 135.60 ?  159 GLN D NE2   1 
ATOM   5776 N  N     . THR D 1 160 ? -15.872 62.280  -102.756 1.00 114.39 ?  160 THR D N     1 
ATOM   5777 C  CA    . THR D 1 160 ? -16.809 63.401  -102.671 1.00 117.28 ?  160 THR D CA    1 
ATOM   5778 C  C     . THR D 1 160 ? -16.023 64.623  -102.168 1.00 122.75 ?  160 THR D C     1 
ATOM   5779 O  O     . THR D 1 160 ? -14.792 64.564  -102.108 1.00 120.85 ?  160 THR D O     1 
ATOM   5780 C  CB    . THR D 1 160 ? -18.031 63.041  -101.801 1.00 120.22 ?  160 THR D CB    1 
ATOM   5781 O  OG1   . THR D 1 160 ? -17.603 62.754  -100.471 1.00 115.06 ?  160 THR D OG1   1 
ATOM   5782 C  CG2   . THR D 1 160 ? -18.839 61.879  -102.366 1.00 116.92 ?  160 THR D CG2   1 
ATOM   5783 N  N     . ALA D 1 161 ? -16.713 65.727  -101.830 1.00 122.53 ?  161 ALA D N     1 
ATOM   5784 C  CA    . ALA D 1 161 ? -16.065 66.940  -101.326 1.00 123.88 ?  161 ALA D CA    1 
ATOM   5785 C  C     . ALA D 1 161 ? -15.596 66.769  -99.874  1.00 122.85 ?  161 ALA D C     1 
ATOM   5786 O  O     . ALA D 1 161 ? -14.631 67.417  -99.465  1.00 122.75 ?  161 ALA D O     1 
ATOM   5787 C  CB    . ALA D 1 161 ? -17.013 68.122  -101.439 1.00 129.41 ?  161 ALA D CB    1 
ATOM   5788 N  N     . LYS D 1 162 ? -16.265 65.880  -99.116  1.00 115.23 ?  162 LYS D N     1 
ATOM   5789 C  CA    . LYS D 1 162 ? -15.968 65.604  -97.714  1.00 110.56 ?  162 LYS D CA    1 
ATOM   5790 C  C     . LYS D 1 162 ? -15.453 64.185  -97.438  1.00 109.45 ?  162 LYS D C     1 
ATOM   5791 O  O     . LYS D 1 162 ? -14.900 63.952  -96.361  1.00 106.04 ?  162 LYS D O     1 
ATOM   5792 C  CB    . LYS D 1 162 ? -17.208 65.895  -96.843  1.00 112.99 ?  162 LYS D CB    1 
ATOM   5793 C  CG    . LYS D 1 162 ? -17.391 67.364  -96.484  1.00 133.58 ?  162 LYS D CG    1 
ATOM   5794 C  CD    . LYS D 1 162 ? -17.455 67.565  -94.975  1.00 143.86 ?  162 LYS D CD    1 
ATOM   5795 C  CE    . LYS D 1 162 ? -18.758 68.156  -94.507  1.00 158.78 ?  162 LYS D CE    1 
ATOM   5796 N  NZ    . LYS D 1 162 ? -18.908 68.011  -93.041  1.00 166.36 ?  162 LYS D NZ    1 
ATOM   5797 N  N     . HIS D 1 163 ? -15.628 63.240  -98.383  1.00 105.29 ?  163 HIS D N     1 
ATOM   5798 C  CA    . HIS D 1 163 ? -15.210 61.852  -98.170  1.00 100.82 ?  163 HIS D CA    1 
ATOM   5799 C  C     . HIS D 1 163 ? -14.435 61.192  -99.308  1.00 103.82 ?  163 HIS D C     1 
ATOM   5800 O  O     . HIS D 1 163 ? -14.490 61.634  -100.453 1.00 107.23 ?  163 HIS D O     1 
ATOM   5801 C  CB    . HIS D 1 163 ? -16.423 60.981  -97.810  1.00 100.17 ?  163 HIS D CB    1 
ATOM   5802 C  CG    . HIS D 1 163 ? -17.032 61.316  -96.488  1.00 101.70 ?  163 HIS D CG    1 
ATOM   5803 N  ND1   . HIS D 1 163 ? -17.999 62.297  -96.368  1.00 106.10 ?  163 HIS D ND1   1 
ATOM   5804 C  CD2   . HIS D 1 163 ? -16.782 60.793  -95.267  1.00 99.66  ?  163 HIS D CD2   1 
ATOM   5805 C  CE1   . HIS D 1 163 ? -18.311 62.334  -95.082  1.00 103.12 ?  163 HIS D CE1   1 
ATOM   5806 N  NE2   . HIS D 1 163 ? -17.607 61.444  -94.382  1.00 99.48  ?  163 HIS D NE2   1 
ATOM   5807 N  N     . TYR D 1 164 ? -13.729 60.105  -98.968  1.00 96.31  ?  164 TYR D N     1 
ATOM   5808 C  CA    . TYR D 1 164 ? -12.964 59.234  -99.859  1.00 96.52  ?  164 TYR D CA    1 
ATOM   5809 C  C     . TYR D 1 164 ? -13.517 57.826  -99.630  1.00 96.44  ?  164 TYR D C     1 
ATOM   5810 O  O     . TYR D 1 164 ? -13.587 57.373  -98.483  1.00 92.32  ?  164 TYR D O     1 
ATOM   5811 C  CB    . TYR D 1 164 ? -11.467 59.257  -99.502  1.00 96.75  ?  164 TYR D CB    1 
ATOM   5812 C  CG    . TYR D 1 164 ? -10.615 60.184  -100.338 1.00 102.23 ?  164 TYR D CG    1 
ATOM   5813 C  CD1   . TYR D 1 164 ? -9.996  59.732  -101.500 1.00 106.74 ?  164 TYR D CD1   1 
ATOM   5814 C  CD2   . TYR D 1 164 ? -10.340 61.479  -99.916  1.00 104.26 ?  164 TYR D CD2   1 
ATOM   5815 C  CE1   . TYR D 1 164 ? -9.164  60.567  -102.248 1.00 111.39 ?  164 TYR D CE1   1 
ATOM   5816 C  CE2   . TYR D 1 164 ? -9.521  62.327  -100.660 1.00 108.97 ?  164 TYR D CE2   1 
ATOM   5817 C  CZ    . TYR D 1 164 ? -8.929  61.864  -101.823 1.00 119.38 ?  164 TYR D CZ    1 
ATOM   5818 O  OH    . TYR D 1 164 ? -8.125  62.700  -102.561 1.00 125.24 ?  164 TYR D OH    1 
ATOM   5819 N  N     . TYR D 1 165 ? -13.952 57.154  -100.697 1.00 94.01  ?  165 TYR D N     1 
ATOM   5820 C  CA    . TYR D 1 165 ? -14.498 55.805  -100.581 1.00 91.65  ?  165 TYR D CA    1 
ATOM   5821 C  C     . TYR D 1 165 ? -13.446 54.802  -101.027 1.00 95.89  ?  165 TYR D C     1 
ATOM   5822 O  O     . TYR D 1 165 ? -12.966 54.864  -102.160 1.00 98.77  ?  165 TYR D O     1 
ATOM   5823 C  CB    . TYR D 1 165 ? -15.848 55.668  -101.311 1.00 94.48  ?  165 TYR D CB    1 
ATOM   5824 C  CG    . TYR D 1 165 ? -16.923 56.577  -100.743 1.00 94.41  ?  165 TYR D CG    1 
ATOM   5825 C  CD1   . TYR D 1 165 ? -17.692 56.185  -99.650  1.00 92.79  ?  165 TYR D CD1   1 
ATOM   5826 C  CD2   . TYR D 1 165 ? -17.150 57.840  -101.276 1.00 98.18  ?  165 TYR D CD2   1 
ATOM   5827 C  CE1   . TYR D 1 165 ? -18.687 57.015  -99.127  1.00 92.32  ?  165 TYR D CE1   1 
ATOM   5828 C  CE2   . TYR D 1 165 ? -18.121 58.689  -100.744 1.00 99.44  ?  165 TYR D CE2   1 
ATOM   5829 C  CZ    . TYR D 1 165 ? -18.891 58.270  -99.671  1.00 100.42 ?  165 TYR D CZ    1 
ATOM   5830 O  OH    . TYR D 1 165 ? -19.855 59.102  -99.153  1.00 98.37  ?  165 TYR D OH    1 
ATOM   5831 N  N     . VAL D 1 166 ? -13.014 53.945  -100.087 1.00 89.06  ?  166 VAL D N     1 
ATOM   5832 C  CA    . VAL D 1 166 ? -11.942 52.970  -100.297 1.00 88.61  ?  166 VAL D CA    1 
ATOM   5833 C  C     . VAL D 1 166 ? -12.427 51.521  -100.177 1.00 93.01  ?  166 VAL D C     1 
ATOM   5834 O  O     . VAL D 1 166 ? -13.164 51.190  -99.250  1.00 90.71  ?  166 VAL D O     1 
ATOM   5835 C  CB    . VAL D 1 166 ? -10.739 53.240  -99.351  1.00 89.55  ?  166 VAL D CB    1 
ATOM   5836 C  CG1   . VAL D 1 166 ? -9.547  52.356  -99.702  1.00 90.33  ?  166 VAL D CG1   1 
ATOM   5837 C  CG2   . VAL D 1 166 ? -10.326 54.709  -99.365  1.00 89.85  ?  166 VAL D CG2   1 
ATOM   5838 N  N     . GLU D 1 167 ? -11.973 50.660  -101.098 1.00 92.66  ?  167 GLU D N     1 
ATOM   5839 C  CA    . GLU D 1 167 ? -12.255 49.230  -101.096 1.00 93.54  ?  167 GLU D CA    1 
ATOM   5840 C  C     . GLU D 1 167 ? -10.953 48.506  -100.788 1.00 97.74  ?  167 GLU D C     1 
ATOM   5841 O  O     . GLU D 1 167 ? -9.954  48.698  -101.490 1.00 99.92  ?  167 GLU D O     1 
ATOM   5842 C  CB    . GLU D 1 167 ? -12.814 48.769  -102.450 1.00 99.36  ?  167 GLU D CB    1 
ATOM   5843 C  CG    . GLU D 1 167 ? -14.334 48.739  -102.497 1.00 115.99 ?  167 GLU D CG    1 
ATOM   5844 C  CD    . GLU D 1 167 ? -14.963 48.357  -103.825 1.00 157.06 ?  167 GLU D CD    1 
ATOM   5845 O  OE1   . GLU D 1 167 ? -14.257 47.785  -104.689 1.00 161.61 ?  167 GLU D OE1   1 
ATOM   5846 O  OE2   . GLU D 1 167 ? -16.175 48.622  -103.995 1.00 161.28 -1 167 GLU D OE2   1 
ATOM   5847 N  N     . VAL D 1 168 ? -10.957 47.699  -99.721  1.00 91.65  ?  168 VAL D N     1 
ATOM   5848 C  CA    . VAL D 1 168 ? -9.797  46.921  -99.286  1.00 90.81  ?  168 VAL D CA    1 
ATOM   5849 C  C     . VAL D 1 168 ? -10.064 45.439  -99.553  1.00 97.31  ?  168 VAL D C     1 
ATOM   5850 O  O     . VAL D 1 168 ? -11.149 44.932  -99.255  1.00 96.09  ?  168 VAL D O     1 
ATOM   5851 C  CB    . VAL D 1 168 ? -9.423  47.195  -97.805  1.00 90.79  ?  168 VAL D CB    1 
ATOM   5852 C  CG1   . VAL D 1 168 ? -8.185  46.411  -97.385  1.00 90.87  ?  168 VAL D CG1   1 
ATOM   5853 C  CG2   . VAL D 1 168 ? -9.216  48.684  -97.555  1.00 89.00  ?  168 VAL D CG2   1 
ATOM   5854 N  N     . LYS D 1 169 ? -9.075  44.764  -100.141 1.00 97.56  ?  169 LYS D N     1 
ATOM   5855 C  CA    . LYS D 1 169 ? -9.125  43.339  -100.437 1.00 100.61 ?  169 LYS D CA    1 
ATOM   5856 C  C     . LYS D 1 169 ? -7.843  42.715  -99.907  1.00 105.58 ?  169 LYS D C     1 
ATOM   5857 O  O     . LYS D 1 169 ? -6.752  43.043  -100.380 1.00 106.98 ?  169 LYS D O     1 
ATOM   5858 C  CB    . LYS D 1 169 ? -9.303  43.091  -101.945 1.00 107.39 ?  169 LYS D CB    1 
ATOM   5859 C  CG    . LYS D 1 169 ? -10.741 43.238  -102.419 1.00 123.97 ?  169 LYS D CG    1 
ATOM   5860 C  CD    . LYS D 1 169 ? -10.854 43.051  -103.920 1.00 139.09 ?  169 LYS D CD    1 
ATOM   5861 C  CE    . LYS D 1 169 ? -12.264 43.206  -104.425 1.00 150.47 ?  169 LYS D CE    1 
ATOM   5862 N  NZ    . LYS D 1 169 ? -12.275 43.489  -105.882 1.00 163.26 ?  169 LYS D NZ    1 
ATOM   5863 N  N     . SER D 1 170 ? -7.969  41.878  -98.871  1.00 100.89 ?  170 SER D N     1 
ATOM   5864 C  CA    . SER D 1 170 ? -6.820  41.216  -98.264  1.00 101.30 ?  170 SER D CA    1 
ATOM   5865 C  C     . SER D 1 170 ? -6.760  39.761  -98.695  1.00 108.53 ?  170 SER D C     1 
ATOM   5866 O  O     . SER D 1 170 ? -7.797  39.090  -98.759  1.00 109.16 ?  170 SER D O     1 
ATOM   5867 C  CB    . SER D 1 170 ? -6.867  41.341  -96.751  1.00 102.27 ?  170 SER D CB    1 
ATOM   5868 O  OG    . SER D 1 170 ? -6.824  42.705  -96.367  1.00 110.65 ?  170 SER D OG    1 
ATOM   5869 N  N     . TYR D 1 171 ? -5.544  39.288  -99.026  1.00 107.21 ?  171 TYR D N     1 
ATOM   5870 C  CA    . TYR D 1 171 ? -5.296  37.937  -99.530  1.00 111.20 ?  171 TYR D CA    1 
ATOM   5871 C  C     . TYR D 1 171 ? -4.202  37.207  -98.765  1.00 116.83 ?  171 TYR D C     1 
ATOM   5872 O  O     . TYR D 1 171 ? -3.306  37.839  -98.208  1.00 114.29 ?  171 TYR D O     1 
ATOM   5873 C  CB    . TYR D 1 171 ? -4.878  37.995  -101.010 1.00 115.51 ?  171 TYR D CB    1 
ATOM   5874 C  CG    . TYR D 1 171 ? -5.849  38.703  -101.926 1.00 115.96 ?  171 TYR D CG    1 
ATOM   5875 C  CD1   . TYR D 1 171 ? -5.767  40.080  -102.130 1.00 113.85 ?  171 TYR D CD1   1 
ATOM   5876 C  CD2   . TYR D 1 171 ? -6.801  37.993  -102.646 1.00 120.82 ?  171 TYR D CD2   1 
ATOM   5877 C  CE1   . TYR D 1 171 ? -6.651  40.737  -102.985 1.00 114.84 ?  171 TYR D CE1   1 
ATOM   5878 C  CE2   . TYR D 1 171 ? -7.685  38.639  -103.511 1.00 121.72 ?  171 TYR D CE2   1 
ATOM   5879 C  CZ    . TYR D 1 171 ? -7.602  40.012  -103.681 1.00 124.82 ?  171 TYR D CZ    1 
ATOM   5880 O  OH    . TYR D 1 171 ? -8.468  40.654  -104.533 1.00 126.43 ?  171 TYR D OH    1 
ATOM   5881 N  N     . VAL D 1 172 ? -4.265  35.867  -98.777  1.00 117.86 ?  172 VAL D N     1 
ATOM   5882 C  CA    . VAL D 1 172 ? -3.266  34.958  -98.207  1.00 120.93 ?  172 VAL D CA    1 
ATOM   5883 C  C     . VAL D 1 172 ? -2.981  34.021  -99.364  1.00 131.26 ?  172 VAL D C     1 
ATOM   5884 O  O     . VAL D 1 172 ? -3.807  33.165  -99.697  1.00 133.16 ?  172 VAL D O     1 
ATOM   5885 C  CB    . VAL D 1 172 ? -3.710  34.251  -96.897  1.00 124.08 ?  172 VAL D CB    1 
ATOM   5886 C  CG1   . VAL D 1 172 ? -2.686  33.206  -96.456  1.00 128.11 ?  172 VAL D CG1   1 
ATOM   5887 C  CG2   . VAL D 1 172 ? -3.934  35.269  -95.781  1.00 118.18 ?  172 VAL D CG2   1 
ATOM   5888 N  N     . LYS D 1 173 ? -1.854  34.313  -100.049 1.00 130.15 ?  173 LYS D N     1 
ATOM   5889 C  CA    . LYS D 1 173 ? -1.380  33.744  -101.314 1.00 136.06 ?  173 LYS D CA    1 
ATOM   5890 C  C     . LYS D 1 173 ? -2.309  34.386  -102.367 1.00 140.28 ?  173 LYS D C     1 
ATOM   5891 O  O     . LYS D 1 173 ? -2.349  35.619  -102.449 1.00 135.73 ?  173 LYS D O     1 
ATOM   5892 C  CB    . LYS D 1 173 ? -1.381  32.190  -101.333 1.00 144.05 ?  173 LYS D CB    1 
ATOM   5893 C  CG    . LYS D 1 173 ? -0.480  31.534  -100.282 1.00 152.26 ?  173 LYS D CG    1 
ATOM   5894 C  CD    . LYS D 1 173 ? 0.940   31.283  -100.790 1.00 162.55 ?  173 LYS D CD    1 
ATOM   5895 C  CE    . LYS D 1 173 ? 1.861   30.755  -99.714  1.00 167.68 ?  173 LYS D CE    1 
ATOM   5896 N  NZ    . LYS D 1 173 ? 1.580   29.335  -99.377  1.00 172.06 ?  173 LYS D NZ    1 
ATOM   5897 N  N     . HIS D 1 174 ? -3.101  33.590  -103.101 1.00 141.21 ?  174 HIS D N     1 
ATOM   5898 C  CA    . HIS D 1 174 ? -4.075  34.124  -104.051 1.00 140.91 ?  174 HIS D CA    1 
ATOM   5899 C  C     . HIS D 1 174 ? -5.455  33.695  -103.534 1.00 142.82 ?  174 HIS D C     1 
ATOM   5900 O  O     . HIS D 1 174 ? -6.181  32.982  -104.235 1.00 146.57 ?  174 HIS D O     1 
ATOM   5901 C  CB    . HIS D 1 174 ? -3.815  33.596  -105.485 1.00 148.17 ?  174 HIS D CB    1 
ATOM   5902 C  CG    . HIS D 1 174 ? -2.403  33.733  -105.975 1.00 154.61 ?  174 HIS D CG    1 
ATOM   5903 N  ND1   . HIS D 1 174 ? -1.838  32.783  -106.811 1.00 163.14 ?  174 HIS D ND1   1 
ATOM   5904 C  CD2   . HIS D 1 174 ? -1.490  34.707  -105.744 1.00 153.89 ?  174 HIS D CD2   1 
ATOM   5905 C  CE1   . HIS D 1 174 ? -0.608  33.203  -107.054 1.00 163.34 ?  174 HIS D CE1   1 
ATOM   5906 N  NE2   . HIS D 1 174 ? -0.350  34.354  -106.431 1.00 158.76 ?  174 HIS D NE2   1 
ATOM   5907 N  N     . THR D 1 175 ? -5.797  34.077  -102.276 1.00 133.09 ?  175 THR D N     1 
ATOM   5908 C  CA    . THR D 1 175 ? -7.057  33.639  -101.676 1.00 131.37 ?  175 THR D CA    1 
ATOM   5909 C  C     . THR D 1 175 ? -7.637  34.785  -100.872 1.00 128.51 ?  175 THR D C     1 
ATOM   5910 O  O     . THR D 1 175 ? -7.054  35.162  -99.852  1.00 125.00 ?  175 THR D O     1 
ATOM   5911 C  CB    . THR D 1 175 ? -6.823  32.383  -100.798 1.00 143.15 ?  175 THR D CB    1 
ATOM   5912 O  OG1   . THR D 1 175 ? -6.051  31.412  -101.508 1.00 149.75 ?  175 THR D OG1   1 
ATOM   5913 C  CG2   . THR D 1 175 ? -8.116  31.758  -100.301 1.00 142.07 ?  175 THR D CG2   1 
ATOM   5914 N  N     . LEU D 1 176 ? -8.769  35.354  -101.333 1.00 123.34 ?  176 LEU D N     1 
ATOM   5915 C  CA    . LEU D 1 176 ? -9.433  36.463  -100.644 1.00 117.54 ?  176 LEU D CA    1 
ATOM   5916 C  C     . LEU D 1 176 ? -9.922  35.994  -99.280  1.00 120.03 ?  176 LEU D C     1 
ATOM   5917 O  O     . LEU D 1 176 ? -10.709 35.049  -99.192  1.00 122.61 ?  176 LEU D O     1 
ATOM   5918 C  CB    . LEU D 1 176 ? -10.581 37.056  -101.483 1.00 117.39 ?  176 LEU D CB    1 
ATOM   5919 C  CG    . LEU D 1 176 ? -11.247 38.323  -100.931 1.00 116.79 ?  176 LEU D CG    1 
ATOM   5920 C  CD1   . LEU D 1 176 ? -10.433 39.569  -101.248 1.00 115.04 ?  176 LEU D CD1   1 
ATOM   5921 C  CD2   . LEU D 1 176 ? -12.644 38.476  -101.472 1.00 119.97 ?  176 LEU D CD2   1 
ATOM   5922 N  N     . VAL D 1 177 ? -9.392  36.618  -98.223  1.00 112.33 ?  177 VAL D N     1 
ATOM   5923 C  CA    . VAL D 1 177 ? -9.696  36.287  -96.830  1.00 109.88 ?  177 VAL D CA    1 
ATOM   5924 C  C     . VAL D 1 177 ? -10.494 37.400  -96.145  1.00 109.45 ?  177 VAL D C     1 
ATOM   5925 O  O     . VAL D 1 177 ? -11.204 37.144  -95.168  1.00 108.09 ?  177 VAL D O     1 
ATOM   5926 C  CB    . VAL D 1 177 ? -8.413  35.919  -96.032  1.00 113.58 ?  177 VAL D CB    1 
ATOM   5927 C  CG1   . VAL D 1 177 ? -7.816  34.600  -96.514  1.00 118.79 ?  177 VAL D CG1   1 
ATOM   5928 C  CG2   . VAL D 1 177 ? -7.368  37.038  -96.078  1.00 110.83 ?  177 VAL D CG2   1 
ATOM   5929 N  N     . PHE D 1 178 ? -10.358 38.636  -96.655  1.00 103.58 ?  178 PHE D N     1 
ATOM   5930 C  CA    . PHE D 1 178 ? -10.995 39.823  -96.101  1.00 99.11  ?  178 PHE D CA    1 
ATOM   5931 C  C     . PHE D 1 178 ? -11.360 40.813  -97.194  1.00 103.54 ?  178 PHE D C     1 
ATOM   5932 O  O     . PHE D 1 178 ? -10.592 41.022  -98.137  1.00 105.13 ?  178 PHE D O     1 
ATOM   5933 C  CB    . PHE D 1 178 ? -10.051 40.477  -95.077  1.00 97.59  ?  178 PHE D CB    1 
ATOM   5934 C  CG    . PHE D 1 178 ? -10.526 41.760  -94.441  1.00 95.20  ?  178 PHE D CG    1 
ATOM   5935 C  CD1   . PHE D 1 178 ? -10.270 42.989  -95.040  1.00 96.18  ?  178 PHE D CD1   1 
ATOM   5936 C  CD2   . PHE D 1 178 ? -11.177 41.746  -93.214  1.00 96.27  ?  178 PHE D CD2   1 
ATOM   5937 C  CE1   . PHE D 1 178 ? -10.707 44.175  -94.451  1.00 95.95  ?  178 PHE D CE1   1 
ATOM   5938 C  CE2   . PHE D 1 178 ? -11.600 42.936  -92.617  1.00 94.01  ?  178 PHE D CE2   1 
ATOM   5939 C  CZ    . PHE D 1 178 ? -11.356 44.142  -93.237  1.00 92.04  ?  178 PHE D CZ    1 
ATOM   5940 N  N     . LYS D 1 179 ? -12.520 41.455  -97.027  1.00 98.72  ?  179 LYS D N     1 
ATOM   5941 C  CA    . LYS D 1 179 ? -13.052 42.490  -97.910  1.00 98.91  ?  179 LYS D CA    1 
ATOM   5942 C  C     . LYS D 1 179 ? -13.620 43.589  -97.009  1.00 100.14 ?  179 LYS D C     1 
ATOM   5943 O  O     . LYS D 1 179 ? -14.310 43.291  -96.031  1.00 98.59  ?  179 LYS D O     1 
ATOM   5944 C  CB    . LYS D 1 179 ? -14.141 41.913  -98.826  1.00 104.62 ?  179 LYS D CB    1 
ATOM   5945 C  CG    . LYS D 1 179 ? -14.361 42.696  -100.111 1.00 119.37 ?  179 LYS D CG    1 
ATOM   5946 C  CD    . LYS D 1 179 ? -15.320 41.963  -101.048 1.00 131.97 ?  179 LYS D CD    1 
ATOM   5947 C  CE    . LYS D 1 179 ? -16.737 42.480  -100.989 1.00 139.31 ?  179 LYS D CE    1 
ATOM   5948 N  NZ    . LYS D 1 179 ? -17.681 41.579  -101.704 1.00 149.84 ?  179 LYS D NZ    1 
ATOM   5949 N  N     . GLY D 1 180 ? -13.288 44.839  -97.314  1.00 95.62  ?  180 GLY D N     1 
ATOM   5950 C  CA    . GLY D 1 180 ? -13.734 45.974  -96.517  1.00 92.24  ?  180 GLY D CA    1 
ATOM   5951 C  C     . GLY D 1 180 ? -13.985 47.243  -97.299  1.00 96.28  ?  180 GLY D C     1 
ATOM   5952 O  O     . GLY D 1 180 ? -13.200 47.615  -98.176  1.00 97.31  ?  180 GLY D O     1 
ATOM   5953 N  N     . ASN D 1 181 ? -15.093 47.913  -96.977  1.00 91.76  ?  181 ASN D N     1 
ATOM   5954 C  CA    . ASN D 1 181 ? -15.470 49.184  -97.581  1.00 92.19  ?  181 ASN D CA    1 
ATOM   5955 C  C     . ASN D 1 181 ? -15.208 50.256  -96.542  1.00 92.97  ?  181 ASN D C     1 
ATOM   5956 O  O     . ASN D 1 181 ? -15.529 50.055  -95.370  1.00 90.87  ?  181 ASN D O     1 
ATOM   5957 C  CB    . ASN D 1 181 ? -16.930 49.177  -98.006  1.00 94.05  ?  181 ASN D CB    1 
ATOM   5958 C  CG    . ASN D 1 181 ? -17.202 50.158  -99.106  1.00 119.60 ?  181 ASN D CG    1 
ATOM   5959 O  OD1   . ASN D 1 181 ? -17.484 51.332  -98.856  1.00 114.21 ?  181 ASN D OD1   1 
ATOM   5960 N  ND2   . ASN D 1 181 ? -17.073 49.710  -100.354 1.00 113.75 ?  181 ASN D ND2   1 
ATOM   5961 N  N     . PHE D 1 182 ? -14.546 51.346  -96.938  1.00 89.00  ?  182 PHE D N     1 
ATOM   5962 C  CA    . PHE D 1 182 ? -14.192 52.407  -96.000  1.00 86.50  ?  182 PHE D CA    1 
ATOM   5963 C  C     . PHE D 1 182 ? -14.651 53.769  -96.442  1.00 92.35  ?  182 PHE D C     1 
ATOM   5964 O  O     . PHE D 1 182 ? -14.468 54.136  -97.603  1.00 94.67  ?  182 PHE D O     1 
ATOM   5965 C  CB    . PHE D 1 182 ? -12.679 52.412  -95.729  1.00 87.31  ?  182 PHE D CB    1 
ATOM   5966 C  CG    . PHE D 1 182 ? -12.199 51.276  -94.866  1.00 87.12  ?  182 PHE D CG    1 
ATOM   5967 C  CD1   . PHE D 1 182 ? -12.014 50.004  -95.399  1.00 90.64  ?  182 PHE D CD1   1 
ATOM   5968 C  CD2   . PHE D 1 182 ? -11.912 51.478  -93.527  1.00 87.97  ?  182 PHE D CD2   1 
ATOM   5969 C  CE1   . PHE D 1 182 ? -11.587 48.949  -94.596  1.00 92.40  ?  182 PHE D CE1   1 
ATOM   5970 C  CE2   . PHE D 1 182 ? -11.463 50.429  -92.731  1.00 87.76  ?  182 PHE D CE2   1 
ATOM   5971 C  CZ    . PHE D 1 182 ? -11.311 49.169  -93.269  1.00 87.99  ?  182 PHE D CZ    1 
ATOM   5972 N  N     . LYS D 1 183 ? -15.249 54.522  -95.507  1.00 88.22  ?  183 LYS D N     1 
ATOM   5973 C  CA    . LYS D 1 183 ? -15.716 55.890  -95.718  1.00 89.90  ?  183 LYS D CA    1 
ATOM   5974 C  C     . LYS D 1 183 ? -14.770 56.792  -94.920  1.00 94.15  ?  183 LYS D C     1 
ATOM   5975 O  O     . LYS D 1 183 ? -14.907 56.939  -93.704  1.00 90.60  ?  183 LYS D O     1 
ATOM   5976 C  CB    . LYS D 1 183 ? -17.190 56.044  -95.296  1.00 91.53  ?  183 LYS D CB    1 
ATOM   5977 C  CG    . LYS D 1 183 ? -17.791 57.410  -95.598  1.00 96.33  ?  183 LYS D CG    1 
ATOM   5978 C  CD    . LYS D 1 183 ? -19.274 57.458  -95.259  1.00 104.86 ?  183 LYS D CD    1 
ATOM   5979 C  CE    . LYS D 1 183 ? -19.894 58.784  -95.614  1.00 118.45 ?  183 LYS D CE    1 
ATOM   5980 N  NZ    . LYS D 1 183 ? -21.376 58.740  -95.518  1.00 127.09 ?  183 LYS D NZ    1 
HETATM 5981 N  N     . MSE D 1 184 ? -13.766 57.331  -95.615  1.00 94.59  ?  184 MSE D N     1 
HETATM 5982 C  CA    . MSE D 1 184 ? -12.721 58.163  -95.038  1.00 94.97  ?  184 MSE D CA    1 
HETATM 5983 C  C     . MSE D 1 184 ? -13.040 59.633  -95.191  1.00 101.18 ?  184 MSE D C     1 
HETATM 5984 O  O     . MSE D 1 184 ? -13.134 60.120  -96.312  1.00 104.70 ?  184 MSE D O     1 
HETATM 5985 C  CB    . MSE D 1 184 ? -11.363 57.855  -95.700  1.00 99.05  ?  184 MSE D CB    1 
HETATM 5986 C  CG    . MSE D 1 184 ? -11.006 56.374  -95.732  1.00 106.35 ?  184 MSE D CG    1 
HETATM 5987 SE SE    . MSE D 1 184 ? -10.926 55.576  -93.960  1.00 112.27 ?  184 MSE D SE    1 
HETATM 5988 C  CE    . MSE D 1 184 ? -9.295  56.423  -93.303  1.00 108.60 ?  184 MSE D CE    1 
ATOM   5989 N  N     . PHE D 1 185 ? -13.193 60.346  -94.074  1.00 96.60  ?  185 PHE D N     1 
ATOM   5990 C  CA    . PHE D 1 185 ? -13.432 61.785  -94.100  1.00 99.53  ?  185 PHE D CA    1 
ATOM   5991 C  C     . PHE D 1 185 ? -12.099 62.486  -94.336  1.00 107.14 ?  185 PHE D C     1 
ATOM   5992 O  O     . PHE D 1 185 ? -11.095 62.102  -93.734  1.00 104.96 ?  185 PHE D O     1 
ATOM   5993 C  CB    . PHE D 1 185 ? -14.074 62.265  -92.786  1.00 99.79  ?  185 PHE D CB    1 
ATOM   5994 C  CG    . PHE D 1 185 ? -13.972 63.752  -92.533  1.00 103.88 ?  185 PHE D CG    1 
ATOM   5995 C  CD1   . PHE D 1 185 ? -14.789 64.648  -93.213  1.00 110.68 ?  185 PHE D CD1   1 
ATOM   5996 C  CD2   . PHE D 1 185 ? -13.049 64.256  -91.626  1.00 105.39 ?  185 PHE D CD2   1 
ATOM   5997 C  CE1   . PHE D 1 185 ? -14.682 66.023  -92.995  1.00 114.73 ?  185 PHE D CE1   1 
ATOM   5998 C  CE2   . PHE D 1 185 ? -12.940 65.632  -91.410  1.00 111.39 ?  185 PHE D CE2   1 
ATOM   5999 C  CZ    . PHE D 1 185 ? -13.760 66.506  -92.094  1.00 113.23 ?  185 PHE D CZ    1 
ATOM   6000 N  N     . TYR D 1 186 ? -12.093 63.517  -95.193  1.00 108.97 ?  186 TYR D N     1 
ATOM   6001 C  CA    . TYR D 1 186 ? -10.885 64.281  -95.491  1.00 111.74 ?  186 TYR D CA    1 
ATOM   6002 C  C     . TYR D 1 186 ? -11.119 65.785  -95.411  1.00 121.02 ?  186 TYR D C     1 
ATOM   6003 O  O     . TYR D 1 186 ? -12.205 66.262  -95.749  1.00 122.93 ?  186 TYR D O     1 
ATOM   6004 C  CB    . TYR D 1 186 ? -10.270 63.855  -96.839  1.00 114.94 ?  186 TYR D CB    1 
ATOM   6005 C  CG    . TYR D 1 186 ? -10.922 64.454  -98.070  1.00 121.06 ?  186 TYR D CG    1 
ATOM   6006 C  CD1   . TYR D 1 186 ? -12.160 64.008  -98.519  1.00 121.96 ?  186 TYR D CD1   1 
ATOM   6007 C  CD2   . TYR D 1 186 ? -10.284 65.452  -98.802  1.00 127.39 ?  186 TYR D CD2   1 
ATOM   6008 C  CE1   . TYR D 1 186 ? -12.753 64.543  -99.660  1.00 127.16 ?  186 TYR D CE1   1 
ATOM   6009 C  CE2   . TYR D 1 186 ? -10.868 65.995  -99.945  1.00 132.68 ?  186 TYR D CE2   1 
ATOM   6010 C  CZ    . TYR D 1 186 ? -12.104 65.537  -100.372 1.00 138.79 ?  186 TYR D CZ    1 
ATOM   6011 O  OH    . TYR D 1 186 ? -12.685 66.072  -101.498 1.00 144.00 ?  186 TYR D OH    1 
ATOM   6012 N  N     . ASP D 1 187 ? -10.097 66.527  -94.960  1.00 119.97 ?  187 ASP D N     1 
ATOM   6013 C  CA    . ASP D 1 187 ? -10.147 67.984  -94.835  1.00 124.35 ?  187 ASP D CA    1 
ATOM   6014 C  C     . ASP D 1 187 ? -8.796  68.601  -95.213  1.00 132.32 ?  187 ASP D C     1 
ATOM   6015 O  O     . ASP D 1 187 ? -7.759  68.172  -94.699  1.00 130.14 ?  187 ASP D O     1 
ATOM   6016 C  CB    . ASP D 1 187 ? -10.598 68.396  -93.418  1.00 124.60 ?  187 ASP D CB    1 
ATOM   6017 C  CG    . ASP D 1 187 ? -10.774 69.887  -93.174  1.00 139.22 ?  187 ASP D CG    1 
ATOM   6018 O  OD1   . ASP D 1 187 ? -11.152 70.611  -94.128  1.00 149.83 -1 187 ASP D OD1   1 
ATOM   6019 O  OD2   . ASP D 1 187 ? -10.570 70.324  -92.021  1.00 138.85 ?  187 ASP D OD2   1 
ATOM   6020 N  N     . LYS D 1 188 ? -8.818  69.600  -96.122  1.00 134.27 ?  188 LYS D N     1 
ATOM   6021 C  CA    . LYS D 1 188 ? -7.632  70.309  -96.628  1.00 138.04 ?  188 LYS D CA    1 
ATOM   6022 C  C     . LYS D 1 188 ? -7.198  71.470  -95.701  1.00 145.15 ?  188 LYS D C     1 
ATOM   6023 O  O     . LYS D 1 188 ? -6.580  72.430  -96.166  1.00 149.46 ?  188 LYS D O     1 
ATOM   6024 C  CB    . LYS D 1 188 ? -7.891  70.842  -98.056  1.00 145.18 ?  188 LYS D CB    1 
ATOM   6025 C  CG    . LYS D 1 188 ? -8.310  69.797  -99.080  1.00 152.34 ?  188 LYS D CG    1 
ATOM   6026 C  CD    . LYS D 1 188 ? -8.409  70.397  -100.480 1.00 163.38 ?  188 LYS D CD    1 
ATOM   6027 C  CE    . LYS D 1 188 ? -8.937  69.421  -101.503 1.00 168.52 ?  188 LYS D CE    1 
ATOM   6028 N  NZ    . LYS D 1 188 ? -7.930  68.390  -101.877 1.00 173.29 ?  188 LYS D NZ    1 
ATOM   6029 N  N     . ARG D 1 189 ? -7.565  71.415  -94.412  1.00 139.92 ?  189 ARG D N     1 
ATOM   6030 C  CA    . ARG D 1 189 ? -7.242  72.457  -93.439  1.00 146.70 ?  189 ARG D CA    1 
ATOM   6031 C  C     . ARG D 1 189 ? -6.034  72.030  -92.597  1.00 159.42 ?  189 ARG D C     1 
ATOM   6032 O  O     . ARG D 1 189 ? -6.105  70.979  -91.917  1.00 156.27 ?  189 ARG D O     1 
ATOM   6033 C  CB    . ARG D 1 189 ? -8.470  72.764  -92.560  1.00 146.72 ?  189 ARG D CB    1 
ATOM   6034 C  CG    . ARG D 1 189 ? -8.564  74.205  -92.077  1.00 163.87 ?  189 ARG D CG    1 
ATOM   6035 C  CD    . ARG D 1 189 ? -9.822  74.891  -92.582  1.00 178.58 ?  189 ARG D CD    1 
ATOM   6036 N  NE    . ARG D 1 189 ? -9.611  75.524  -93.887  1.00 194.40 ?  189 ARG D NE    1 
ATOM   6037 C  CZ    . ARG D 1 189 ? -10.513 76.271  -94.520  1.00 212.02 ?  189 ARG D CZ    1 
ATOM   6038 N  NH1   . ARG D 1 189 ? -11.706 76.487  -93.978  1.00 200.06 ?  189 ARG D NH1   1 
ATOM   6039 N  NH2   . ARG D 1 189 ? -10.228 76.807  -95.699  1.00 202.84 ?  189 ARG D NH2   1 
ATOM   6040 N  N     . GLY D 1 190 ? -4.991  72.715  -92.677  1.00 183.42 ?  190 GLY D N     1 
ATOM   6041 O  "O5'" . DG  E 2 1   ? 40.111  -10.386 -51.958  1.00 189.19 ?  1   DG  F "O5'" 1 
ATOM   6042 C  "C5'" . DG  E 2 1   ? 39.699  -9.234  -51.228  1.00 189.05 ?  1   DG  F "C5'" 1 
ATOM   6043 C  "C4'" . DG  E 2 1   ? 39.085  -8.203  -52.159  1.00 189.21 ?  1   DG  F "C4'" 1 
ATOM   6044 O  "O4'" . DG  E 2 1   ? 37.639  -8.209  -52.051  1.00 188.98 ?  1   DG  F "O4'" 1 
ATOM   6045 C  "C3'" . DG  E 2 1   ? 39.544  -6.760  -51.968  1.00 189.57 ?  1   DG  F "C3'" 1 
ATOM   6046 O  "O3'" . DG  E 2 1   ? 40.099  -6.322  -53.214  1.00 190.88 ?  1   DG  F "O3'" 1 
ATOM   6047 C  "C2'" . DG  E 2 1   ? 38.277  -6.002  -51.558  1.00 188.74 ?  1   DG  F "C2'" 1 
ATOM   6048 C  "C1'" . DG  E 2 1   ? 37.148  -6.881  -52.088  1.00 188.34 ?  1   DG  F "C1'" 1 
ATOM   6049 N  N9    . DG  E 2 1   ? 35.896  -6.842  -51.323  1.00 187.35 ?  1   DG  F N9    1 
ATOM   6050 C  C8    . DG  E 2 1   ? 35.757  -6.943  -49.955  1.00 186.93 ?  1   DG  F C8    1 
ATOM   6051 N  N7    . DG  E 2 1   ? 34.521  -6.928  -49.543  1.00 186.83 ?  1   DG  F N7    1 
ATOM   6052 C  C5    . DG  E 2 1   ? 33.778  -6.840  -50.711  1.00 186.91 ?  1   DG  F C5    1 
ATOM   6053 C  C6    . DG  E 2 1   ? 32.368  -6.791  -50.895  1.00 186.85 ?  1   DG  F C6    1 
ATOM   6054 O  O6    . DG  E 2 1   ? 31.488  -6.820  -50.021  1.00 186.73 ?  1   DG  F O6    1 
ATOM   6055 N  N1    . DG  E 2 1   ? 32.005  -6.699  -52.246  1.00 186.87 ?  1   DG  F N1    1 
ATOM   6056 C  C2    . DG  E 2 1   ? 32.906  -6.656  -53.294  1.00 186.81 ?  1   DG  F C2    1 
ATOM   6057 N  N2    . DG  E 2 1   ? 32.384  -6.565  -54.528  1.00 186.66 ?  1   DG  F N2    1 
ATOM   6058 N  N3    . DG  E 2 1   ? 34.231  -6.698  -53.132  1.00 186.91 ?  1   DG  F N3    1 
ATOM   6059 C  C4    . DG  E 2 1   ? 34.606  -6.788  -51.821  1.00 187.06 ?  1   DG  F C4    1 
ATOM   6060 P  P     . DC  E 2 2   ? 40.695  -4.892  -53.645  1.00 192.25 ?  2   DC  F P     1 
ATOM   6061 O  OP1   . DC  E 2 2   ? 41.972  -5.162  -54.350  1.00 192.52 ?  2   DC  F OP1   1 
ATOM   6062 O  OP2   . DC  E 2 2   ? 40.676  -3.935  -52.509  1.00 192.30 ?  2   DC  F OP2   1 
ATOM   6063 O  "O5'" . DC  E 2 2   ? 39.601  -4.384  -54.702  1.00 192.78 ?  2   DC  F "O5'" 1 
ATOM   6064 C  "C5'" . DC  E 2 2   ? 39.267  -5.134  -55.880  1.00 193.31 ?  2   DC  F "C5'" 1 
ATOM   6065 C  "C4'" . DC  E 2 2   ? 38.053  -4.561  -56.596  1.00 194.18 ?  2   DC  F "C4'" 1 
ATOM   6066 O  "O4'" . DC  E 2 2   ? 36.862  -4.748  -55.791  1.00 194.05 ?  2   DC  F "O4'" 1 
ATOM   6067 C  "C3'" . DC  E 2 2   ? 38.137  -3.080  -56.952  1.00 195.24 ?  2   DC  F "C3'" 1 
ATOM   6068 O  "O3'" . DC  E 2 2   ? 37.957  -2.895  -58.354  1.00 196.83 ?  2   DC  F "O3'" 1 
ATOM   6069 C  "C2'" . DC  E 2 2   ? 37.049  -2.399  -56.122  1.00 194.71 ?  2   DC  F "C2'" 1 
ATOM   6070 C  "C1'" . DC  E 2 2   ? 36.121  -3.543  -55.715  1.00 193.83 ?  2   DC  F "C1'" 1 
ATOM   6071 N  N1    . DC  E 2 2   ? 35.466  -3.438  -54.347  1.00 192.47 ?  2   DC  F N1    1 
ATOM   6072 C  C2    . DC  E 2 2   ? 34.055  -3.453  -54.216  1.00 190.15 ?  2   DC  F C2    1 
ATOM   6073 O  O2    . DC  E 2 2   ? 33.320  -3.516  -55.213  1.00 189.86 ?  2   DC  F O2    1 
ATOM   6074 N  N3    . DC  E 2 2   ? 33.514  -3.388  -52.963  1.00 188.31 ?  2   DC  F N3    1 
ATOM   6075 C  C4    . DC  E 2 2   ? 34.301  -3.321  -51.879  1.00 188.13 ?  2   DC  F C4    1 
ATOM   6076 N  N4    . DC  E 2 2   ? 33.717  -3.257  -50.678  1.00 186.02 ?  2   DC  F N4    1 
ATOM   6077 C  C5    . DC  E 2 2   ? 35.729  -3.312  -51.984  1.00 190.93 ?  2   DC  F C5    1 
ATOM   6078 C  C6    . DC  E 2 2   ? 36.256  -3.381  -53.218  1.00 191.72 ?  2   DC  F C6    1 
ATOM   6079 P  P     . DC  E 2 3   ? 38.508  -1.635  -59.185  1.00 198.39 ?  3   DC  F P     1 
ATOM   6080 O  OP1   . DC  E 2 3   ? 38.986  -2.167  -60.485  1.00 198.62 ?  3   DC  F OP1   1 
ATOM   6081 O  OP2   . DC  E 2 3   ? 39.415  -0.809  -58.351  1.00 197.22 ?  3   DC  F OP2   1 
ATOM   6082 O  "O5'" . DC  E 2 3   ? 37.199  -0.744  -59.403  1.00 198.28 ?  3   DC  F "O5'" 1 
ATOM   6083 C  "C5'" . DC  E 2 3   ? 36.095  -1.141  -60.214  1.00 198.29 ?  3   DC  F "C5'" 1 
ATOM   6084 C  "C4'" . DC  E 2 3   ? 34.879  -0.293  -59.893  1.00 194.48 ?  3   DC  F "C4'" 1 
ATOM   6085 O  "O4'" . DC  E 2 3   ? 34.458  -0.609  -58.542  1.00 193.90 ?  3   DC  F "O4'" 1 
ATOM   6086 C  "C3'" . DC  E 2 3   ? 35.142  1.212   -59.912  1.00 191.44 ?  3   DC  F "C3'" 1 
ATOM   6087 O  "O3'" . DC  E 2 3   ? 34.609  1.894   -61.067  1.00 192.08 ?  3   DC  F "O3'" 1 
ATOM   6088 C  "C2'" . DC  E 2 3   ? 34.728  1.730   -58.537  1.00 186.79 ?  3   DC  F "C2'" 1 
ATOM   6089 C  "C1'" . DC  E 2 3   ? 33.952  0.558   -57.932  1.00 189.19 ?  3   DC  F "C1'" 1 
ATOM   6090 N  N1    . DC  E 2 3   ? 33.993  0.401   -56.419  1.00 188.86 ?  3   DC  F N1    1 
ATOM   6091 C  C2    . DC  E 2 3   ? 32.832  0.026   -55.698  1.00 187.25 ?  3   DC  F C2    1 
ATOM   6092 O  O2    . DC  E 2 3   ? 31.755  -0.175  -56.281  1.00 186.19 ?  3   DC  F O2    1 
ATOM   6093 N  N3    . DC  E 2 3   ? 32.917  -0.109  -54.341  1.00 186.68 ?  3   DC  F N3    1 
ATOM   6094 C  C4    . DC  E 2 3   ? 34.077  0.106   -53.703  1.00 186.99 ?  3   DC  F C4    1 
ATOM   6095 N  N4    . DC  E 2 3   ? 34.101  -0.038  -52.374  1.00 186.33 ?  3   DC  F N4    1 
ATOM   6096 C  C5    . DC  E 2 3   ? 35.266  0.481   -54.407  1.00 188.79 ?  3   DC  F C5    1 
ATOM   6097 C  C6    . DC  E 2 3   ? 35.173  0.614   -55.740  1.00 189.76 ?  3   DC  F C6    1 
ATOM   6098 P  P     . DA  E 2 4   ? 33.158  2.524   -61.358  1.00 190.05 ?  4   DA  F P     1 
ATOM   6099 O  OP1   . DA  E 2 4   ? 33.023  2.577   -62.833  1.00 191.67 ?  4   DA  F OP1   1 
ATOM   6100 O  OP2   . DA  E 2 4   ? 33.028  3.780   -60.582  1.00 183.73 ?  4   DA  F OP2   1 
ATOM   6101 O  "O5'" . DA  E 2 4   ? 32.121  1.448   -60.772  1.00 194.19 ?  4   DA  F "O5'" 1 
ATOM   6102 C  "C5'" . DA  E 2 4   ? 30.754  1.378   -61.195  1.00 195.36 ?  4   DA  F "C5'" 1 
ATOM   6103 C  "C4'" . DA  E 2 4   ? 29.783  1.990   -60.195  1.00 193.46 ?  4   DA  F "C4'" 1 
ATOM   6104 O  "O4'" . DA  E 2 4   ? 30.298  1.954   -58.839  1.00 192.99 ?  4   DA  F "O4'" 1 
ATOM   6105 C  "C3'" . DA  E 2 4   ? 29.329  3.421   -60.465  1.00 189.89 ?  4   DA  F "C3'" 1 
ATOM   6106 O  "O3'" . DA  E 2 4   ? 27.895  3.431   -60.467  1.00 191.15 ?  4   DA  F "O3'" 1 
ATOM   6107 C  "C2'" . DA  E 2 4   ? 29.937  4.220   -59.311  1.00 188.07 ?  4   DA  F "C2'" 1 
ATOM   6108 C  "C1'" . DA  E 2 4   ? 30.018  3.181   -58.195  1.00 189.41 ?  4   DA  F "C1'" 1 
ATOM   6109 N  N9    . DA  E 2 4   ? 31.049  3.406   -57.175  1.00 189.95 ?  4   DA  F N9    1 
ATOM   6110 C  C8    . DA  E 2 4   ? 32.342  3.806   -57.382  1.00 190.56 ?  4   DA  F C8    1 
ATOM   6111 N  N7    . DA  E 2 4   ? 33.072  3.878   -56.296  1.00 190.16 ?  4   DA  F N7    1 
ATOM   6112 C  C5    . DA  E 2 4   ? 32.196  3.511   -55.291  1.00 189.68 ?  4   DA  F C5    1 
ATOM   6113 C  C6    . DA  E 2 4   ? 32.346  3.405   -53.886  1.00 189.55 ?  4   DA  F C6    1 
ATOM   6114 N  N6    . DA  E 2 4   ? 33.494  3.671   -53.254  1.00 189.92 ?  4   DA  F N6    1 
ATOM   6115 N  N1    . DA  E 2 4   ? 31.269  3.023   -53.153  1.00 189.56 ?  4   DA  F N1    1 
ATOM   6116 C  C2    . DA  E 2 4   ? 30.107  2.791   -53.788  1.00 189.70 ?  4   DA  F C2    1 
ATOM   6117 N  N3    . DA  E 2 4   ? 29.852  2.832   -55.103  1.00 189.69 ?  4   DA  F N3    1 
ATOM   6118 C  C4    . DA  E 2 4   ? 30.940  3.217   -55.811  1.00 189.71 ?  4   DA  F C4    1 
ATOM   6119 P  P     . DA  E 2 5   ? 26.905  4.694   -60.582  1.00 190.24 ?  5   DA  F P     1 
ATOM   6120 O  OP1   . DA  E 2 5   ? 25.703  4.196   -61.294  1.00 190.59 ?  5   DA  F OP1   1 
ATOM   6121 O  OP2   . DA  E 2 5   ? 27.623  5.887   -61.101  1.00 188.94 ?  5   DA  F OP2   1 
ATOM   6122 O  "O5'" . DA  E 2 5   ? 26.534  5.008   -59.053  1.00 189.12 ?  5   DA  F "O5'" 1 
ATOM   6123 C  "C5'" . DA  E 2 5   ? 25.852  4.055   -58.222  1.00 189.93 ?  5   DA  F "C5'" 1 
ATOM   6124 C  "C4'" . DA  E 2 5   ? 25.749  4.521   -56.777  1.00 187.24 ?  5   DA  F "C4'" 1 
ATOM   6125 O  "O4'" . DA  E 2 5   ? 27.058  4.568   -56.159  1.00 186.62 ?  5   DA  F "O4'" 1 
ATOM   6126 C  "C3'" . DA  E 2 5   ? 25.090  5.874   -56.528  1.00 184.50 ?  5   DA  F "C3'" 1 
ATOM   6127 O  "O3'" . DA  E 2 5   ? 24.045  5.706   -55.571  1.00 184.15 ?  5   DA  F "O3'" 1 
ATOM   6128 C  "C2'" . DA  E 2 5   ? 26.223  6.760   -56.011  1.00 182.97 ?  5   DA  F "C2'" 1 
ATOM   6129 C  "C1'" . DA  E 2 5   ? 27.203  5.757   -55.410  1.00 184.19 ?  5   DA  F "C1'" 1 
ATOM   6130 N  N9    . DA  E 2 5   ? 28.614  6.146   -55.473  1.00 183.46 ?  5   DA  F N9    1 
ATOM   6131 C  C8    . DA  E 2 5   ? 29.330  6.427   -56.607  1.00 183.47 ?  5   DA  F C8    1 
ATOM   6132 N  N7    . DA  E 2 5   ? 30.588  6.724   -56.393  1.00 183.23 ?  5   DA  F N7    1 
ATOM   6133 C  C5    . DA  E 2 5   ? 30.725  6.588   -55.022  1.00 182.94 ?  5   DA  F C5    1 
ATOM   6134 C  C6    . DA  E 2 5   ? 31.832  6.756   -54.153  1.00 182.88 ?  5   DA  F C6    1 
ATOM   6135 N  N6    . DA  E 2 5   ? 33.049  7.096   -54.590  1.00 183.20 ?  5   DA  F N6    1 
ATOM   6136 N  N1    . DA  E 2 5   ? 31.649  6.533   -52.825  1.00 182.70 ?  5   DA  F N1    1 
ATOM   6137 C  C2    . DA  E 2 5   ? 30.428  6.170   -52.390  1.00 182.65 ?  5   DA  F C2    1 
ATOM   6138 N  N3    . DA  E 2 5   ? 29.310  6.003   -53.112  1.00 182.68 ?  5   DA  F N3    1 
ATOM   6139 C  C4    . DA  E 2 5   ? 29.523  6.214   -54.434  1.00 182.96 ?  5   DA  F C4    1 
ATOM   6140 P  P     . DT  E 2 6   ? 22.977  6.825   -55.153  1.00 182.25 ?  6   DT  F P     1 
ATOM   6141 O  OP1   . DT  E 2 6   ? 21.712  6.140   -54.801  1.00 183.09 ?  6   DT  F OP1   1 
ATOM   6142 O  OP2   . DT  E 2 6   ? 22.955  7.899   -56.172  1.00 181.30 ?  6   DT  F OP2   1 
ATOM   6143 O  "O5'" . DT  E 2 6   ? 23.613  7.459   -53.832  1.00 180.56 ?  6   DT  F "O5'" 1 
ATOM   6144 C  "C5'" . DT  E 2 6   ? 23.894  6.679   -52.677  1.00 180.87 ?  6   DT  F "C5'" 1 
ATOM   6145 C  "C4'" . DT  E 2 6   ? 24.876  7.392   -51.769  1.00 179.19 ?  6   DT  F "C4'" 1 
ATOM   6146 O  "O4'" . DT  E 2 6   ? 26.156  7.556   -52.421  1.00 178.81 ?  6   DT  F "O4'" 1 
ATOM   6147 C  "C3'" . DT  E 2 6   ? 24.466  8.787   -51.308  1.00 176.38 ?  6   DT  F "C3'" 1 
ATOM   6148 O  "O3'" . DT  E 2 6   ? 24.060  8.705   -49.951  1.00 176.55 ?  6   DT  F "O3'" 1 
ATOM   6149 C  "C2'" . DT  E 2 6   ? 25.713  9.653   -51.496  1.00 174.73 ?  6   DT  F "C2'" 1 
ATOM   6150 C  "C1'" . DT  E 2 6   ? 26.807  8.627   -51.769  1.00 176.35 ?  6   DT  F "C1'" 1 
ATOM   6151 N  N1    . DT  E 2 6   ? 28.022  9.087   -52.551  1.00 174.95 ?  6   DT  F N1    1 
ATOM   6152 C  C2    . DT  E 2 6   ? 29.242  9.282   -51.902  1.00 174.27 ?  6   DT  F C2    1 
ATOM   6153 O  O2    . DT  E 2 6   ? 29.427  9.150   -50.702  1.00 174.06 ?  6   DT  F O2    1 
ATOM   6154 N  N3    . DT  E 2 6   ? 30.281  9.654   -52.728  1.00 173.98 ?  6   DT  F N3    1 
ATOM   6155 C  C4    . DT  E 2 6   ? 30.235  9.852   -54.102  1.00 173.87 ?  6   DT  F C4    1 
ATOM   6156 O  O4    . DT  E 2 6   ? 31.263  10.192  -54.682  1.00 173.80 ?  6   DT  F O4    1 
ATOM   6157 C  C5    . DT  E 2 6   ? 28.944  9.617   -54.724  1.00 174.07 ?  6   DT  F C5    1 
ATOM   6158 C  C7    . DT  E 2 6   ? 28.745  9.799   -56.202  1.00 174.01 ?  6   DT  F C7    1 
ATOM   6159 C  C6    . DT  E 2 6   ? 27.922  9.248   -53.930  1.00 174.52 ?  6   DT  F C6    1 
ATOM   6160 P  P     . DT  E 2 7   ? 23.205  9.821   -49.180  1.00 175.05 ?  7   DT  F P     1 
ATOM   6161 O  OP1   . DT  E 2 7   ? 22.208  9.110   -48.344  1.00 175.93 ?  7   DT  F OP1   1 
ATOM   6162 O  OP2   . DT  E 2 7   ? 22.755  10.857  -50.137  1.00 173.54 ?  7   DT  F OP2   1 
ATOM   6163 O  "O5'" . DT  E 2 7   ? 24.300  10.519  -48.247  1.00 174.38 ?  7   DT  F "O5'" 1 
ATOM   6164 C  "C5'" . DT  E 2 7   ? 25.052  9.796   -47.286  1.00 175.98 ?  7   DT  F "C5'" 1 
ATOM   6165 C  "C4'" . DT  E 2 7   ? 26.390  10.461  -47.037  1.00 175.46 ?  7   DT  F "C4'" 1 
ATOM   6166 O  "O4'" . DT  E 2 7   ? 27.124  10.613  -48.273  1.00 175.15 ?  7   DT  F "O4'" 1 
ATOM   6167 C  "C3'" . DT  E 2 7   ? 26.331  11.847  -46.412  1.00 173.92 ?  7   DT  F "C3'" 1 
ATOM   6168 O  "O3'" . DT  E 2 7   ? 26.725  11.728  -45.053  1.00 175.94 ?  7   DT  F "O3'" 1 
ATOM   6169 C  "C2'" . DT  E 2 7   ? 27.304  12.687  -47.242  1.00 172.70 ?  7   DT  F "C2'" 1 
ATOM   6170 C  "C1'" . DT  E 2 7   ? 28.064  11.635  -48.038  1.00 173.52 ?  7   DT  F "C1'" 1 
ATOM   6171 N  N1    . DT  E 2 7   ? 28.736  12.069  -49.323  1.00 172.23 ?  7   DT  F N1    1 
ATOM   6172 C  C2    . DT  E 2 7   ? 30.116  12.263  -49.350  1.00 172.12 ?  7   DT  F C2    1 
ATOM   6173 O  O2    . DT  E 2 7   ? 30.852  12.169  -48.379  1.00 172.54 ?  7   DT  F O2    1 
ATOM   6174 N  N3    . DT  E 2 7   ? 30.620  12.631  -50.580  1.00 171.44 ?  7   DT  F N3    1 
ATOM   6175 C  C4    . DT  E 2 7   ? 29.922  12.793  -51.769  1.00 171.22 ?  7   DT  F C4    1 
ATOM   6176 O  O4    . DT  E 2 7   ? 30.547  13.107  -52.780  1.00 171.11 ?  7   DT  F O4    1 
ATOM   6177 C  C5    . DT  E 2 7   ? 28.491  12.561  -51.683  1.00 171.38 ?  7   DT  F C5    1 
ATOM   6178 C  C7    . DT  E 2 7   ? 27.608  12.696  -52.892  1.00 171.49 ?  7   DT  F C7    1 
ATOM   6179 C  C6    . DT  E 2 7   ? 27.981  12.220  -50.484  1.00 171.71 ?  7   DT  F C6    1 
ATOM   6180 P  P     . DA  E 2 8   ? 26.583  12.859  -43.923  1.00 176.10 ?  8   DA  F P     1 
ATOM   6181 O  OP1   . DA  E 2 8   ? 26.402  12.147  -42.635  1.00 177.26 ?  8   DA  F OP1   1 
ATOM   6182 O  OP2   . DA  E 2 8   ? 25.599  13.892  -44.331  1.00 175.35 ?  8   DA  F OP2   1 
ATOM   6183 O  "O5'" . DA  E 2 8   ? 28.032  13.544  -43.953  1.00 177.16 ?  8   DA  F "O5'" 1 
ATOM   6184 C  "C5'" . DA  E 2 8   ? 29.216  12.781  -43.665  1.00 180.12 ?  8   DA  F "C5'" 1 
ATOM   6185 C  "C4'" . DA  E 2 8   ? 30.495  13.547  -43.972  1.00 180.60 ?  8   DA  F "C4'" 1 
ATOM   6186 O  "O4'" . DA  E 2 8   ? 30.728  13.616  -45.402  1.00 180.39 ?  8   DA  F "O4'" 1 
ATOM   6187 C  "C3'" . DA  E 2 8   ? 30.613  14.968  -43.415  1.00 179.50 ?  8   DA  F "C3'" 1 
ATOM   6188 O  "O3'" . DA  E 2 8   ? 31.760  15.006  -42.537  1.00 181.54 ?  8   DA  F "O3'" 1 
ATOM   6189 C  "C2'" . DA  E 2 8   ? 30.698  15.846  -44.668  1.00 177.60 ?  8   DA  F "C2'" 1 
ATOM   6190 C  "C1'" . DA  E 2 8   ? 31.260  14.888  -45.714  1.00 178.41 ?  8   DA  F "C1'" 1 
ATOM   6191 N  N9    . DA  E 2 8   ? 30.932  15.205  -47.106  1.00 176.83 ?  8   DA  F N9    1 
ATOM   6192 C  C8    . DA  E 2 8   ? 29.688  15.199  -47.675  1.00 176.28 ?  8   DA  F C8    1 
ATOM   6193 N  N7    . DA  E 2 8   ? 29.677  15.485  -48.953  1.00 176.30 ?  8   DA  F N7    1 
ATOM   6194 C  C5    . DA  E 2 8   ? 31.011  15.694  -49.254  1.00 176.36 ?  8   DA  F C5    1 
ATOM   6195 C  C6    . DA  E 2 8   ? 31.675  16.060  -50.451  1.00 176.54 ?  8   DA  F C6    1 
ATOM   6196 N  N6    . DA  E 2 8   ? 31.030  16.263  -51.606  1.00 175.38 ?  8   DA  F N6    1 
ATOM   6197 N  N1    . DA  E 2 8   ? 33.026  16.203  -50.416  1.00 176.44 ?  8   DA  F N1    1 
ATOM   6198 C  C2    . DA  E 2 8   ? 33.670  16.030  -49.247  1.00 176.98 ?  8   DA  F C2    1 
ATOM   6199 N  N3    . DA  E 2 8   ? 33.152  15.666  -48.065  1.00 177.11 ?  8   DA  F N3    1 
ATOM   6200 C  C4    . DA  E 2 8   ? 31.806  15.529  -48.125  1.00 176.56 ?  8   DA  F C4    1 
ATOM   6201 P  P     . DT  E 2 9   ? 32.674  16.233  -42.038  1.00 181.57 ?  9   DT  F P     1 
ATOM   6202 O  OP1   . DT  E 2 9   ? 33.305  15.794  -40.766  1.00 182.80 ?  9   DT  F OP1   1 
ATOM   6203 O  OP2   . DT  E 2 9   ? 31.903  17.505  -42.099  1.00 179.70 ?  9   DT  F OP2   1 
ATOM   6204 O  "O5'" . DT  E 2 9   ? 33.791  16.246  -43.193  1.00 182.60 ?  9   DT  F "O5'" 1 
ATOM   6205 C  "C5'" . DT  E 2 9   ? 35.098  16.821  -43.074  1.00 183.02 ?  9   DT  F "C5'" 1 
ATOM   6206 C  "C4'" . DT  E 2 9   ? 35.242  18.087  -43.904  1.00 181.56 ?  9   DT  F "C4'" 1 
ATOM   6207 O  "O4'" . DT  E 2 9   ? 34.566  17.937  -45.178  1.00 180.80 ?  9   DT  F "O4'" 1 
ATOM   6208 C  "C3'" . DT  E 2 9   ? 34.633  19.333  -43.270  1.00 178.09 ?  9   DT  F "C3'" 1 
ATOM   6209 O  "O3'" . DT  E 2 9   ? 35.597  20.055  -42.462  1.00 178.58 ?  9   DT  F "O3'" 1 
ATOM   6210 C  "C2'" . DT  E 2 9   ? 33.971  20.108  -44.414  1.00 172.30 ?  9   DT  F "C2'" 1 
ATOM   6211 C  "C1'" . DT  E 2 9   ? 34.232  19.226  -45.643  1.00 175.66 ?  9   DT  F "C1'" 1 
ATOM   6212 N  N1    . DT  E 2 9   ? 33.152  19.147  -46.709  1.00 172.39 ?  9   DT  F N1    1 
ATOM   6213 C  C2    . DT  E 2 9   ? 33.498  19.233  -48.061  1.00 172.11 ?  9   DT  F C2    1 
ATOM   6214 O  O2    . DT  E 2 9   ? 34.638  19.344  -48.488  1.00 174.13 ?  9   DT  F O2    1 
ATOM   6215 N  N3    . DT  E 2 9   ? 32.436  19.155  -48.938  1.00 169.77 ?  9   DT  F N3    1 
ATOM   6216 C  C4    . DT  E 2 9   ? 31.092  19.013  -48.618  1.00 167.55 ?  9   DT  F C4    1 
ATOM   6217 O  O4    . DT  E 2 9   ? 30.276  18.956  -49.537  1.00 166.17 ?  9   DT  F O4    1 
ATOM   6218 C  C5    . DT  E 2 9   ? 30.796  18.925  -47.197  1.00 167.58 ?  9   DT  F C5    1 
ATOM   6219 C  C7    . DT  E 2 9   ? 29.388  18.770  -46.698  1.00 165.66 ?  9   DT  F C7    1 
ATOM   6220 C  C6    . DT  E 2 9   ? 31.822  18.990  -46.330  1.00 169.84 ?  9   DT  F C6    1 
ATOM   6221 P  P     . DA  E 2 10  ? 36.749  21.122  -42.831  1.00 177.24 ?  10  DA  F P     1 
ATOM   6222 O  OP1   . DA  E 2 10  ? 37.864  20.885  -41.878  1.00 181.63 ?  10  DA  F OP1   1 
ATOM   6223 O  OP2   . DA  E 2 10  ? 36.085  22.450  -42.893  1.00 170.35 ?  10  DA  F OP2   1 
ATOM   6224 O  "O5'" . DA  E 2 10  ? 37.269  20.735  -44.306  1.00 178.71 ?  10  DA  F "O5'" 1 
ATOM   6225 C  "C5'" . DA  E 2 10  ? 38.381  21.377  -44.955  1.00 177.60 ?  10  DA  F "C5'" 1 
ATOM   6226 C  "C4'" . DA  E 2 10  ? 37.974  22.405  -46.008  1.00 170.96 ?  10  DA  F "C4'" 1 
ATOM   6227 O  "O4'" . DA  E 2 10  ? 36.805  21.989  -46.765  1.00 168.39 ?  10  DA  F "O4'" 1 
ATOM   6228 C  "C3'" . DA  E 2 10  ? 37.690  23.828  -45.525  1.00 164.60 ?  10  DA  F "C3'" 1 
ATOM   6229 O  "O3'" . DA  E 2 10  ? 38.569  24.750  -46.193  1.00 164.23 ?  10  DA  F "O3'" 1 
ATOM   6230 C  "C2'" . DA  E 2 10  ? 36.229  24.048  -45.920  1.00 159.05 ?  10  DA  F "C2'" 1 
ATOM   6231 C  "C1'" . DA  E 2 10  ? 36.137  23.165  -47.158  1.00 161.01 ?  10  DA  F "C1'" 1 
ATOM   6232 N  N9    . DA  E 2 10  ? 34.798  22.888  -47.687  1.00 157.03 ?  10  DA  F N9    1 
ATOM   6233 C  C8    . DA  E 2 10  ? 33.660  22.592  -46.982  1.00 154.95 ?  10  DA  F C8    1 
ATOM   6234 N  N7    . DA  E 2 10  ? 32.591  22.422  -47.724  1.00 153.10 ?  10  DA  F N7    1 
ATOM   6235 C  C5    . DA  E 2 10  ? 33.054  22.611  -49.014  1.00 153.21 ?  10  DA  F C5    1 
ATOM   6236 C  C6    . DA  E 2 10  ? 32.414  22.560  -50.277  1.00 151.63 ?  10  DA  F C6    1 
ATOM   6237 N  N6    . DA  E 2 10  ? 31.116  22.279  -50.420  1.00 149.67 ?  10  DA  F N6    1 
ATOM   6238 N  N1    . DA  E 2 10  ? 33.160  22.799  -51.386  1.00 152.50 ?  10  DA  F N1    1 
ATOM   6239 C  C2    . DA  E 2 10  ? 34.468  23.079  -51.241  1.00 154.31 ?  10  DA  F C2    1 
ATOM   6240 N  N3    . DA  E 2 10  ? 35.178  23.145  -50.107  1.00 155.73 ?  10  DA  F N3    1 
ATOM   6241 C  C4    . DA  E 2 10  ? 34.412  22.906  -49.015  1.00 155.31 ?  10  DA  F C4    1 
ATOM   6242 P  P     . DT  E 2 11  ? 38.854  26.276  -45.761  1.00 160.41 ?  11  DT  F P     1 
ATOM   6243 O  OP1   . DT  E 2 11  ? 40.310  26.364  -45.490  1.00 164.40 ?  11  DT  F OP1   1 
ATOM   6244 O  OP2   . DT  E 2 11  ? 37.881  26.730  -44.732  1.00 156.45 ?  11  DT  F OP2   1 
ATOM   6245 O  "O5'" . DT  E 2 11  ? 38.501  27.116  -47.081  1.00 156.14 ?  11  DT  F "O5'" 1 
ATOM   6246 C  "C5'" . DT  E 2 11  ? 39.207  26.976  -48.320  1.00 157.76 ?  11  DT  F "C5'" 1 
ATOM   6247 C  "C4'" . DT  E 2 11  ? 38.306  27.260  -49.512  1.00 153.57 ?  11  DT  F "C4'" 1 
ATOM   6248 O  "O4'" . DT  E 2 11  ? 37.178  26.350  -49.490  1.00 152.90 ?  11  DT  F "O4'" 1 
ATOM   6249 C  "C3'" . DT  E 2 11  ? 37.653  28.635  -49.551  1.00 147.09 ?  11  DT  F "C3'" 1 
ATOM   6250 O  "O3'" . DT  E 2 11  ? 38.511  29.605  -50.155  1.00 146.68 ?  11  DT  F "O3'" 1 
ATOM   6251 C  "C2'" . DT  E 2 11  ? 36.410  28.390  -50.400  1.00 144.44 ?  11  DT  F "C2'" 1 
ATOM   6252 C  "C1'" . DT  E 2 11  ? 36.161  26.893  -50.308  1.00 147.98 ?  11  DT  F "C1'" 1 
ATOM   6253 N  N1    . DT  E 2 11  ? 34.768  26.577  -49.828  1.00 144.34 ?  11  DT  F N1    1 
ATOM   6254 C  C2    . DT  E 2 11  ? 33.744  26.456  -50.764  1.00 142.18 ?  11  DT  F C2    1 
ATOM   6255 O  O2    . DT  E 2 11  ? 33.895  26.547  -51.973  1.00 142.36 ?  11  DT  F O2    1 
ATOM   6256 N  N3    . DT  E 2 11  ? 32.504  26.190  -50.228  1.00 140.24 ?  11  DT  F N3    1 
ATOM   6257 C  C4    . DT  E 2 11  ? 32.183  26.063  -48.881  1.00 139.83 ?  11  DT  F C4    1 
ATOM   6258 O  O4    . DT  E 2 11  ? 31.011  25.838  -48.581  1.00 138.49 ?  11  DT  F O4    1 
ATOM   6259 C  C5    . DT  E 2 11  ? 33.292  26.223  -47.953  1.00 141.33 ?  11  DT  F C5    1 
ATOM   6260 C  C7    . DT  E 2 11  ? 33.089  26.125  -46.467  1.00 141.05 ?  11  DT  F C7    1 
ATOM   6261 C  C6    . DT  E 2 11  ? 34.510  26.479  -48.463  1.00 143.36 ?  11  DT  F C6    1 
ATOM   6262 P  P     . DA  E 2 12  ? 38.285  31.194  -50.022  1.00 141.54 ?  12  DA  F P     1 
ATOM   6263 O  OP1   . DA  E 2 12  ? 39.560  31.825  -50.435  1.00 143.93 ?  12  DA  F OP1   1 
ATOM   6264 O  OP2   . DA  E 2 12  ? 37.709  31.516  -48.692  1.00 138.80 ?  12  DA  F OP2   1 
ATOM   6265 O  "O5'" . DA  E 2 12  ? 37.152  31.535  -51.106  1.00 136.83 ?  12  DA  F "O5'" 1 
ATOM   6266 C  "C5'" . DA  E 2 12  ? 37.299  31.264  -52.504  1.00 137.30 ?  12  DA  F "C5'" 1 
ATOM   6267 C  "C4'" . DA  E 2 12  ? 35.953  31.244  -53.209  1.00 133.15 ?  12  DA  F "C4'" 1 
ATOM   6268 O  "O4'" . DA  E 2 12  ? 35.085  30.236  -52.640  1.00 133.00 ?  12  DA  F "O4'" 1 
ATOM   6269 C  "C3'" . DA  E 2 12  ? 35.166  32.547  -53.140  1.00 127.22 ?  12  DA  F "C3'" 1 
ATOM   6270 O  "O3'" . DA  E 2 12  ? 35.285  33.238  -54.372  1.00 126.15 ?  12  DA  F "O3'" 1 
ATOM   6271 C  "C2'" . DA  E 2 12  ? 33.724  32.137  -52.861  1.00 124.63 ?  12  DA  F "C2'" 1 
ATOM   6272 C  "C1'" . DA  E 2 12  ? 33.752  30.617  -52.896  1.00 128.63 ?  12  DA  F "C1'" 1 
ATOM   6273 N  N9    . DA  E 2 12  ? 32.837  30.045  -51.910  1.00 127.22 ?  12  DA  F N9    1 
ATOM   6274 C  C8    . DA  E 2 12  ? 33.054  29.880  -50.567  1.00 127.27 ?  12  DA  F C8    1 
ATOM   6275 N  N7    . DA  E 2 12  ? 32.028  29.393  -49.913  1.00 126.19 ?  12  DA  F N7    1 
ATOM   6276 C  C5    . DA  E 2 12  ? 31.063  29.245  -50.893  1.00 125.23 ?  12  DA  F C5    1 
ATOM   6277 C  C6    . DA  E 2 12  ? 29.733  28.769  -50.855  1.00 124.31 ?  12  DA  F C6    1 
ATOM   6278 N  N6    . DA  E 2 12  ? 29.161  28.347  -49.724  1.00 124.45 ?  12  DA  F N6    1 
ATOM   6279 N  N1    . DA  E 2 12  ? 29.019  28.753  -52.012  1.00 123.47 ?  12  DA  F N1    1 
ATOM   6280 C  C2    . DA  E 2 12  ? 29.597  29.188  -53.145  1.00 123.68 ?  12  DA  F C2    1 
ATOM   6281 N  N3    . DA  E 2 12  ? 30.845  29.648  -53.302  1.00 124.72 ?  12  DA  F N3    1 
ATOM   6282 C  C4    . DA  E 2 12  ? 31.532  29.658  -52.132  1.00 125.56 ?  12  DA  F C4    1 
ATOM   6283 P  P     . DC  E 2 13  ? 34.893  34.782  -54.572  1.00 121.43 ?  13  DC  F P     1 
ATOM   6284 O  OP1   . DC  E 2 13  ? 35.726  35.270  -55.699  1.00 123.41 ?  13  DC  F OP1   1 
ATOM   6285 O  OP2   . DC  E 2 13  ? 34.902  35.503  -53.270  1.00 118.79 ?  13  DC  F OP2   1 
ATOM   6286 O  "O5'" . DC  E 2 13  ? 33.362  34.704  -55.039  1.00 117.55 ?  13  DC  F "O5'" 1 
ATOM   6287 C  "C5'" . DC  E 2 13  ? 32.917  33.951  -56.177  1.00 117.72 ?  13  DC  F "C5'" 1 
ATOM   6288 C  "C4'" . DC  E 2 13  ? 31.401  33.822  -56.204  1.00 113.48 ?  13  DC  F "C4'" 1 
ATOM   6289 O  "O4'" . DC  E 2 13  ? 30.963  32.970  -55.125  1.00 113.23 ?  13  DC  F "O4'" 1 
ATOM   6290 C  "C3'" . DC  E 2 13  ? 30.621  35.116  -56.023  1.00 107.88 ?  13  DC  F "C3'" 1 
ATOM   6291 O  "O3'" . DC  E 2 13  ? 30.306  35.663  -57.289  1.00 106.83 ?  13  DC  F "O3'" 1 
ATOM   6292 C  "C2'" . DC  E 2 13  ? 29.364  34.721  -55.259  1.00 105.84 ?  13  DC  F "C2'" 1 
ATOM   6293 C  "C1'" . DC  E 2 13  ? 29.621  33.288  -54.821  1.00 109.26 ?  13  DC  F "C1'" 1 
ATOM   6294 N  N1    . DC  E 2 13  ? 29.308  32.966  -53.382  1.00 107.87 ?  13  DC  F N1    1 
ATOM   6295 C  C2    . DC  E 2 13  ? 28.077  32.361  -53.040  1.00 106.81 ?  13  DC  F C2    1 
ATOM   6296 O  O2    . DC  E 2 13  ? 27.234  32.120  -53.916  1.00 106.62 ?  13  DC  F O2    1 
ATOM   6297 N  N3    . DC  E 2 13  ? 27.839  32.051  -51.732  1.00 106.32 ?  13  DC  F N3    1 
ATOM   6298 C  C4    . DC  E 2 13  ? 28.764  32.306  -50.794  1.00 106.63 ?  13  DC  F C4    1 
ATOM   6299 N  N4    . DC  E 2 13  ? 28.487  31.979  -49.530  1.00 106.42 ?  13  DC  F N4    1 
ATOM   6300 C  C5    . DC  E 2 13  ? 30.021  32.910  -51.117  1.00 107.62 ?  13  DC  F C5    1 
ATOM   6301 C  C6    . DC  E 2 13  ? 30.242  33.222  -52.404  1.00 108.09 ?  13  DC  F C6    1 
ATOM   6302 P  P     . DT  E 2 14  ? 30.101  37.240  -57.508  1.00 103.10 ?  14  DT  F P     1 
ATOM   6303 O  OP1   . DT  E 2 14  ? 30.546  37.524  -58.896  1.00 104.92 ?  14  DT  F OP1   1 
ATOM   6304 O  OP2   . DT  E 2 14  ? 30.657  38.005  -56.359  1.00 101.43 ?  14  DT  F OP2   1 
ATOM   6305 O  "O5'" . DT  E 2 14  ? 28.515  37.426  -57.409  1.00 98.38  ?  14  DT  F "O5'" 1 
ATOM   6306 C  "C5'" . DT  E 2 14  ? 27.603  36.631  -58.164  1.00 97.37  ?  14  DT  F "C5'" 1 
ATOM   6307 C  "C4'" . DT  E 2 14  ? 26.222  36.687  -57.537  1.00 92.61  ?  14  DT  F "C4'" 1 
ATOM   6308 O  "O4'" . DT  E 2 14  ? 26.225  36.080  -56.226  1.00 91.92  ?  14  DT  F "O4'" 1 
ATOM   6309 C  "C3'" . DT  E 2 14  ? 25.675  38.085  -57.339  1.00 87.86  ?  14  DT  F "C3'" 1 
ATOM   6310 O  "O3'" . DT  E 2 14  ? 24.434  38.178  -58.011  1.00 86.20  ?  14  DT  F "O3'" 1 
ATOM   6311 C  "C2'" . DT  E 2 14  ? 25.580  38.276  -55.823  1.00 85.88  ?  14  DT  F "C2'" 1 
ATOM   6312 C  "C1'" . DT  E 2 14  ? 25.448  36.842  -55.327  1.00 87.90  ?  14  DT  F "C1'" 1 
ATOM   6313 N  N1    . DT  E 2 14  ? 25.909  36.486  -53.930  1.00 87.50  ?  14  DT  F N1    1 
ATOM   6314 C  C2    . DT  E 2 14  ? 25.104  35.704  -53.100  1.00 87.25  ?  14  DT  F C2    1 
ATOM   6315 O  O2    . DT  E 2 14  ? 23.968  35.343  -53.349  1.00 86.71  ?  14  DT  F O2    1 
ATOM   6316 N  N3    . DT  E 2 14  ? 25.669  35.356  -51.899  1.00 88.18  ?  14  DT  F N3    1 
ATOM   6317 C  C4    . DT  E 2 14  ? 26.949  35.643  -51.458  1.00 89.51  ?  14  DT  F C4    1 
ATOM   6318 O  O4    . DT  E 2 14  ? 27.283  35.256  -50.338  1.00 90.42  ?  14  DT  F O4    1 
ATOM   6319 C  C5    . DT  E 2 14  ? 27.749  36.445  -52.368  1.00 89.69  ?  14  DT  F C5    1 
ATOM   6320 C  C7    . DT  E 2 14  ? 29.154  36.850  -52.015  1.00 91.23  ?  14  DT  F C7    1 
ATOM   6321 C  C6    . DT  E 2 14  ? 27.200  36.813  -53.539  1.00 88.51  ?  14  DT  F C6    1 
ATOM   6322 P  P     . DA  E 2 15  ? 23.886  39.588  -58.533  1.00 83.11  ?  15  DA  F P     1 
ATOM   6323 O  OP1   . DA  E 2 15  ? 23.200  39.371  -59.830  1.00 84.30  ?  15  DA  F OP1   1 
ATOM   6324 O  OP2   . DA  E 2 15  ? 24.952  40.613  -58.403  1.00 82.46  ?  15  DA  F OP2   1 
ATOM   6325 O  "O5'" . DA  E 2 15  ? 22.807  39.974  -57.426  1.00 79.51  ?  15  DA  F "O5'" 1 
ATOM   6326 C  "C5'" . DA  E 2 15  ? 21.704  39.174  -57.029  1.00 78.93  ?  15  DA  F "C5'" 1 
ATOM   6327 C  "C4'" . DA  E 2 15  ? 21.321  39.534  -55.604  1.00 76.33  ?  15  DA  F "C4'" 1 
ATOM   6328 O  "O4'" . DA  E 2 15  ? 22.315  38.974  -54.710  1.00 77.05  ?  15  DA  F "O4'" 1 
ATOM   6329 C  "C3'" . DA  E 2 15  ? 21.292  41.034  -55.298  1.00 73.60  ?  15  DA  F "C3'" 1 
ATOM   6330 O  "O3'" . DA  E 2 15  ? 20.030  41.487  -54.774  1.00 71.97  ?  15  DA  F "O3'" 1 
ATOM   6331 C  "C2'" . DA  E 2 15  ? 22.461  41.239  -54.339  1.00 73.13  ?  15  DA  F "C2'" 1 
ATOM   6332 C  "C1'" . DA  E 2 15  ? 22.448  39.886  -53.654  1.00 74.81  ?  15  DA  F "C1'" 1 
ATOM   6333 N  N9    . DA  E 2 15  ? 23.586  39.576  -52.803  1.00 76.26  ?  15  DA  F N9    1 
ATOM   6334 C  C8    . DA  E 2 15  ? 24.862  40.067  -52.899  1.00 77.40  ?  15  DA  F C8    1 
ATOM   6335 N  N7    . DA  E 2 15  ? 25.679  39.634  -51.970  1.00 78.79  ?  15  DA  F N7    1 
ATOM   6336 C  C5    . DA  E 2 15  ? 24.877  38.812  -51.202  1.00 78.64  ?  15  DA  F C5    1 
ATOM   6337 C  C6    . DA  E 2 15  ? 25.139  38.072  -50.034  1.00 79.68  ?  15  DA  F C6    1 
ATOM   6338 N  N6    . DA  E 2 15  ? 26.345  38.055  -49.457  1.00 81.01  ?  15  DA  F N6    1 
ATOM   6339 N  N1    . DA  E 2 15  ? 24.128  37.333  -49.513  1.00 79.66  ?  15  DA  F N1    1 
ATOM   6340 C  C2    . DA  E 2 15  ? 22.912  37.374  -50.089  1.00 78.42  ?  15  DA  F C2    1 
ATOM   6341 N  N3    . DA  E 2 15  ? 22.542  38.069  -51.169  1.00 77.21  ?  15  DA  F N3    1 
ATOM   6342 C  C4    . DA  E 2 15  ? 23.577  38.770  -51.688  1.00 77.22  ?  15  DA  F C4    1 
ATOM   6343 P  P     . DC  E 2 16  ? 19.706  43.062  -54.767  1.00 69.74  ?  16  DC  F P     1 
ATOM   6344 O  OP1   . DC  E 2 16  ? 18.245  43.244  -54.584  1.00 68.56  ?  16  DC  F OP1   1 
ATOM   6345 O  OP2   . DC  E 2 16  ? 20.386  43.678  -55.939  1.00 70.31  ?  16  DC  F OP2   1 
ATOM   6346 O  "O5'" . DC  E 2 16  ? 20.482  43.603  -53.465  1.00 68.85  ?  16  DC  F "O5'" 1 
ATOM   6347 C  "C5'" . DC  E 2 16  ? 19.957  43.816  -52.157  1.00 67.60  ?  16  DC  F "C5'" 1 
ATOM   6348 C  "C4'" . DC  E 2 16  ? 19.791  42.531  -51.367  1.00 69.17  ?  16  DC  F "C4'" 1 
ATOM   6349 O  "O4'" . DC  E 2 16  ? 21.028  41.789  -51.340  1.00 71.38  ?  16  DC  F "O4'" 1 
ATOM   6350 C  "C3'" . DC  E 2 16  ? 19.516  42.743  -49.896  1.00 68.14  ?  16  DC  F "C3'" 1 
ATOM   6351 O  "O3'" . DC  E 2 16  ? 18.147  43.022  -49.722  1.00 67.58  ?  16  DC  F "O3'" 1 
ATOM   6352 C  "C2'" . DC  E 2 16  ? 19.901  41.394  -49.305  1.00 69.98  ?  16  DC  F "C2'" 1 
ATOM   6353 C  "C1'" . DC  E 2 16  ? 21.097  40.998  -50.167  1.00 71.95  ?  16  DC  F "C1'" 1 
ATOM   6354 N  N1    . DC  E 2 16  ? 22.490  41.094  -49.552  1.00 72.79  ?  16  DC  F N1    1 
ATOM   6355 C  C2    . DC  E 2 16  ? 22.853  40.396  -48.364  1.00 74.31  ?  16  DC  F C2    1 
ATOM   6356 O  O2    . DC  E 2 16  ? 22.040  39.700  -47.724  1.00 74.87  ?  16  DC  F O2    1 
ATOM   6357 N  N3    . DC  E 2 16  ? 24.133  40.514  -47.907  1.00 75.08  ?  16  DC  F N3    1 
ATOM   6358 C  C4    . DC  E 2 16  ? 25.034  41.251  -48.568  1.00 75.17  ?  16  DC  F C4    1 
ATOM   6359 N  N4    . DC  E 2 16  ? 26.268  41.336  -48.061  1.00 76.51  ?  16  DC  F N4    1 
ATOM   6360 C  C5    . DC  E 2 16  ? 24.700  41.949  -49.774  1.00 73.89  ?  16  DC  F C5    1 
ATOM   6361 C  C6    . DC  E 2 16  ? 23.443  41.825  -50.224  1.00 72.69  ?  16  DC  F C6    1 
ATOM   6362 P  P     . DT  E 2 17  ? 17.629  44.108  -48.674  1.00 66.03  ?  17  DT  F P     1 
ATOM   6363 O  OP1   . DT  E 2 17  ? 16.162  44.211  -48.863  1.00 65.66  ?  17  DT  F OP1   1 
ATOM   6364 O  OP2   . DT  E 2 17  ? 18.480  45.328  -48.741  1.00 65.19  ?  17  DT  F OP2   1 
ATOM   6365 O  "O5'" . DT  E 2 17  ? 17.972  43.406  -47.286  1.00 66.19  ?  17  DT  F "O5'" 1 
ATOM   6366 C  "C5'" . DT  E 2 17  ? 17.205  42.347  -46.777  1.00 67.56  ?  17  DT  F "C5'" 1 
ATOM   6367 C  "C4'" . DT  E 2 17  ? 17.646  42.076  -45.355  1.00 68.52  ?  17  DT  F "C4'" 1 
ATOM   6368 O  "O4'" . DT  E 2 17  ? 19.061  41.802  -45.309  1.00 69.56  ?  17  DT  F "O4'" 1 
ATOM   6369 C  "C3'" . DT  E 2 17  ? 17.393  43.189  -44.355  1.00 67.55  ?  17  DT  F "C3'" 1 
ATOM   6370 O  "O3'" . DT  E 2 17  ? 16.807  42.601  -43.198  1.00 69.29  ?  17  DT  F "O3'" 1 
ATOM   6371 C  "C2'" . DT  E 2 17  ? 18.770  43.802  -44.101  1.00 66.96  ?  17  DT  F "C2'" 1 
ATOM   6372 C  "C1'" . DT  E 2 17  ? 19.698  42.621  -44.359  1.00 68.79  ?  17  DT  F "C1'" 1 
ATOM   6373 N  N1    . DT  E 2 17  ? 21.072  42.928  -44.875  1.00 69.46  ?  17  DT  F N1    1 
ATOM   6374 C  C2    . DT  E 2 17  ? 22.190  42.608  -44.114  1.00 70.87  ?  17  DT  F C2    1 
ATOM   6375 O  O2    . DT  E 2 17  ? 22.148  42.123  -42.994  1.00 71.54  ?  17  DT  F O2    1 
ATOM   6376 N  N3    . DT  E 2 17  ? 23.396  42.904  -44.713  1.00 71.96  ?  17  DT  F N3    1 
ATOM   6377 C  C4    . DT  E 2 17  ? 23.605  43.456  -45.972  1.00 71.87  ?  17  DT  F C4    1 
ATOM   6378 O  O4    . DT  E 2 17  ? 24.757  43.664  -46.359  1.00 73.00  ?  17  DT  F O4    1 
ATOM   6379 C  C5    . DT  E 2 17  ? 22.395  43.746  -46.716  1.00 70.43  ?  17  DT  F C5    1 
ATOM   6380 C  C7    . DT  E 2 17  ? 22.456  44.359  -48.079  1.00 70.11  ?  17  DT  F C7    1 
ATOM   6381 C  C6    . DT  E 2 17  ? 21.211  43.471  -46.147  1.00 69.45  ?  17  DT  F C6    1 
ATOM   6382 P  P     . DA  E 2 18  ? 16.087  43.464  -42.061  1.00 68.68  ?  18  DA  F P     1 
ATOM   6383 O  OP1   . DA  E 2 18  ? 15.072  42.597  -41.409  1.00 70.17  ?  18  DA  F OP1   1 
ATOM   6384 O  OP2   . DA  E 2 18  ? 15.717  44.799  -42.603  1.00 67.13  ?  18  DA  F OP2   1 
ATOM   6385 O  "O5'" . DA  E 2 18  ? 17.310  43.708  -41.071  1.00 67.73  ?  18  DA  F "O5'" 1 
ATOM   6386 C  "C5'" . DA  E 2 18  ? 17.815  42.712  -40.216  1.00 68.47  ?  18  DA  F "C5'" 1 
ATOM   6387 C  "C4'" . DA  E 2 18  ? 18.986  43.305  -39.472  1.00 67.70  ?  18  DA  F "C4'" 1 
ATOM   6388 O  "O4'" . DA  E 2 18  ? 20.063  43.522  -40.411  1.00 67.38  ?  18  DA  F "O4'" 1 
ATOM   6389 C  "C3'" . DA  E 2 18  ? 18.699  44.654  -38.823  1.00 65.91  ?  18  DA  F "C3'" 1 
ATOM   6390 O  "O3'" . DA  E 2 18  ? 18.820  44.513  -37.421  1.00 67.02  ?  18  DA  F "O3'" 1 
ATOM   6391 C  "C2'" . DA  E 2 18  ? 19.721  45.606  -39.446  1.00 65.07  ?  18  DA  F "C2'" 1 
ATOM   6392 C  "C1'" . DA  E 2 18  ? 20.780  44.658  -39.991  1.00 66.30  ?  18  DA  F "C1'" 1 
ATOM   6393 N  N9    . DA  E 2 18  ? 21.554  45.173  -41.120  1.00 65.18  ?  18  DA  F N9    1 
ATOM   6394 C  C8    . DA  E 2 18  ? 21.075  45.739  -42.272  1.00 63.70  ?  18  DA  F C8    1 
ATOM   6395 N  N7    . DA  E 2 18  ? 22.002  46.089  -43.132  1.00 63.83  ?  18  DA  F N7    1 
ATOM   6396 C  C5    . DA  E 2 18  ? 23.173  45.703  -42.508  1.00 65.42  ?  18  DA  F C5    1 
ATOM   6397 C  C6    . DA  E 2 18  ? 24.528  45.795  -42.893  1.00 66.55  ?  18  DA  F C6    1 
ATOM   6398 N  N6    . DA  E 2 18  ? 24.912  46.318  -44.059  1.00 66.50  ?  18  DA  F N6    1 
ATOM   6399 N  N1    . DA  E 2 18  ? 25.468  45.338  -42.030  1.00 67.92  ?  18  DA  F N1    1 
ATOM   6400 C  C2    . DA  E 2 18  ? 25.079  44.806  -40.859  1.00 68.30  ?  18  DA  F C2    1 
ATOM   6401 N  N3    . DA  E 2 18  ? 23.835  44.652  -40.396  1.00 67.45  ?  18  DA  F N3    1 
ATOM   6402 C  C4    . DA  E 2 18  ? 22.920  45.131  -41.268  1.00 66.04  ?  18  DA  F C4    1 
ATOM   6403 P  P     . DT  E 2 19  ? 18.731  45.696  -36.350  1.00 66.68  ?  19  DT  F P     1 
ATOM   6404 O  OP1   . DT  E 2 19  ? 18.376  45.070  -35.054  1.00 68.71  ?  19  DT  F OP1   1 
ATOM   6405 O  OP2   . DT  E 2 19  ? 17.923  46.818  -36.900  1.00 65.32  ?  19  DT  F OP2   1 
ATOM   6406 O  "O5'" . DT  E 2 19  ? 20.229  46.225  -36.271  1.00 65.88  ?  19  DT  F "O5'" 1 
ATOM   6407 C  "C5'" . DT  E 2 19  ? 21.297  45.413  -35.841  1.00 67.22  ?  19  DT  F "C5'" 1 
ATOM   6408 C  "C4'" . DT  E 2 19  ? 22.603  46.083  -36.206  1.00 66.98  ?  19  DT  F "C4'" 1 
ATOM   6409 O  "O4'" . DT  E 2 19  ? 22.641  46.295  -37.630  1.00 65.77  ?  19  DT  F "O4'" 1 
ATOM   6410 C  "C3'" . DT  E 2 19  ? 22.796  47.483  -35.630  1.00 66.18  ?  19  DT  F "C3'" 1 
ATOM   6411 O  "O3'" . DT  E 2 19  ? 23.579  47.428  -34.449  1.00 67.87  ?  19  DT  F "O3'" 1 
ATOM   6412 C  "C2'" . DT  E 2 19  ? 23.490  48.266  -36.739  1.00 65.23  ?  19  DT  F "C2'" 1 
ATOM   6413 C  "C1'" . DT  E 2 19  ? 23.684  47.218  -37.813  1.00 65.59  ?  19  DT  F "C1'" 1 
ATOM   6414 N  N1    . DT  E 2 19  ? 23.695  47.799  -39.180  1.00 64.20  ?  19  DT  F N1    1 
ATOM   6415 C  C2    . DT  E 2 19  ? 24.924  47.982  -39.809  1.00 64.90  ?  19  DT  F C2    1 
ATOM   6416 O  O2    . DT  E 2 19  ? 26.011  47.639  -39.354  1.00 66.66  ?  19  DT  F O2    1 
ATOM   6417 N  N3    . DT  E 2 19  ? 24.831  48.541  -41.056  1.00 63.69  ?  19  DT  F N3    1 
ATOM   6418 C  C4    . DT  E 2 19  ? 23.681  48.957  -41.699  1.00 62.11  ?  19  DT  F C4    1 
ATOM   6419 O  O4    . DT  E 2 19  ? 23.792  49.448  -42.810  1.00 61.98  ?  19  DT  F O4    1 
ATOM   6420 C  C5    . DT  E 2 19  ? 22.439  48.750  -40.990  1.00 61.59  ?  19  DT  F C5    1 
ATOM   6421 C  C7    . DT  E 2 19  ? 21.132  49.176  -41.598  1.00 60.53  ?  19  DT  F C7    1 
ATOM   6422 C  C6    . DT  E 2 19  ? 22.501  48.208  -39.763  1.00 62.37  ?  19  DT  F C6    1 
ATOM   6423 P  P     . DT  E 2 20  ? 23.971  48.699  -33.558  1.00 67.35  ?  20  DT  F P     1 
ATOM   6424 O  OP1   . DT  E 2 20  ? 24.276  48.173  -32.204  1.00 69.36  ?  20  DT  F OP1   1 
ATOM   6425 O  OP2   . DT  E 2 20  ? 22.966  49.766  -33.743  1.00 64.89  ?  20  DT  F OP2   1 
ATOM   6426 O  "O5'" . DT  E 2 20  ? 25.310  49.218  -34.256  1.00 67.91  ?  20  DT  F "O5'" 1 
ATOM   6427 C  "C5'" . DT  E 2 20  ? 26.476  48.405  -34.327  1.00 70.15  ?  20  DT  F "C5'" 1 
ATOM   6428 C  "C4'" . DT  E 2 20  ? 27.562  49.140  -35.078  1.00 70.76  ?  20  DT  F "C4'" 1 
ATOM   6429 O  "O4'" . DT  E 2 20  ? 27.152  49.328  -36.447  1.00 69.30  ?  20  DT  F "O4'" 1 
ATOM   6430 C  "C3'" . DT  E 2 20  ? 27.868  50.528  -34.543  1.00 71.15  ?  20  DT  F "C3'" 1 
ATOM   6431 O  "O3'" . DT  E 2 20  ? 29.227  50.587  -34.210  1.00 74.56  ?  20  DT  F "O3'" 1 
ATOM   6432 C  "C2'" . DT  E 2 20  ? 27.505  51.493  -35.667  1.00 69.01  ?  20  DT  F "C2'" 1 
ATOM   6433 C  "C1'" . DT  E 2 20  ? 27.597  50.589  -36.883  1.00 68.86  ?  20  DT  F "C1'" 1 
ATOM   6434 N  N1    . DT  E 2 20  ? 26.751  51.024  -38.023  1.00 67.19  ?  20  DT  F N1    1 
ATOM   6435 C  C2    . DT  E 2 20  ? 27.329  51.244  -39.260  1.00 67.71  ?  20  DT  F C2    1 
ATOM   6436 O  O2    . DT  E 2 20  ? 28.527  51.153  -39.482  1.00 69.54  ?  20  DT  F O2    1 
ATOM   6437 N  N3    . DT  E 2 20  ? 26.435  51.651  -40.229  1.00 66.33  ?  20  DT  F N3    1 
ATOM   6438 C  C4    . DT  E 2 20  ? 25.060  51.825  -40.101  1.00 64.88  ?  20  DT  F C4    1 
ATOM   6439 O  O4    . DT  E 2 20  ? 24.418  52.196  -41.080  1.00 64.55  ?  20  DT  F O4    1 
ATOM   6440 C  C5    . DT  E 2 20  ? 24.517  51.552  -38.785  1.00 64.27  ?  20  DT  F C5    1 
ATOM   6441 C  C7    . DT  E 2 20  ? 23.051  51.682  -38.476  1.00 62.35  ?  20  DT  F C7    1 
ATOM   6442 C  C6    . DT  E 2 20  ? 25.381  51.164  -37.835  1.00 65.81  ?  20  DT  F C6    1 
ATOM   6443 P  P     . DA  E 2 21  ? 29.857  51.788  -33.369  1.00 77.05  ?  21  DA  F P     1 
ATOM   6444 O  OP1   . DA  E 2 21  ? 30.994  51.201  -32.622  1.00 80.46  ?  21  DA  F OP1   1 
ATOM   6445 O  OP2   . DA  E 2 21  ? 28.780  52.545  -32.679  1.00 75.25  ?  21  DA  F OP2   1 
ATOM   6446 O  "O5'" . DA  E 2 21  ? 30.430  52.765  -34.488  1.00 77.76  ?  21  DA  F "O5'" 1 
ATOM   6447 C  "C5'" . DA  E 2 21  ? 31.311  52.259  -35.466  1.00 80.03  ?  21  DA  F "C5'" 1 
ATOM   6448 C  "C4'" . DA  E 2 21  ? 31.444  53.255  -36.588  1.00 80.31  ?  21  DA  F "C4'" 1 
ATOM   6449 O  "O4'" . DA  E 2 21  ? 30.335  53.199  -37.506  1.00 77.56  ?  21  DA  F "O4'" 1 
ATOM   6450 C  "C3'" . DA  E 2 21  ? 31.567  54.699  -36.144  1.00 81.95  ?  21  DA  F "C3'" 1 
ATOM   6451 O  "O3'" . DA  E 2 21  ? 32.894  55.065  -36.459  1.00 87.26  ?  21  DA  F "O3'" 1 
ATOM   6452 C  "C2'" . DA  E 2 21  ? 30.518  55.444  -36.963  1.00 78.33  ?  21  DA  F "C2'" 1 
ATOM   6453 C  "C1'" . DA  E 2 21  ? 30.258  54.471  -38.104  1.00 76.65  ?  21  DA  F "C1'" 1 
ATOM   6454 N  N9    . DA  E 2 21  ? 28.965  54.585  -38.764  1.00 73.55  ?  21  DA  F N9    1 
ATOM   6455 C  C8    . DA  E 2 21  ? 27.740  54.319  -38.214  1.00 71.85  ?  21  DA  F C8    1 
ATOM   6456 N  N7    . DA  E 2 21  ? 26.739  54.432  -39.053  1.00 69.94  ?  21  DA  F N7    1 
ATOM   6457 C  C5    . DA  E 2 21  ? 27.343  54.816  -40.236  1.00 70.16  ?  21  DA  F C5    1 
ATOM   6458 C  C6    . DA  E 2 21  ? 26.819  55.123  -41.513  1.00 68.55  ?  21  DA  F C6    1 
ATOM   6459 N  N6    . DA  E 2 21  ? 25.512  55.095  -41.786  1.00 66.86  ?  21  DA  F N6    1 
ATOM   6460 N  N1    . DA  E 2 21  ? 27.686  55.476  -42.488  1.00 69.33  ?  21  DA  F N1    1 
ATOM   6461 C  C2    . DA  E 2 21  ? 29.000  55.501  -42.208  1.00 71.69  ?  21  DA  F C2    1 
ATOM   6462 N  N3    . DA  E 2 21  ? 29.612  55.232  -41.045  1.00 73.24  ?  21  DA  F N3    1 
ATOM   6463 C  C4    . DA  E 2 21  ? 28.723  54.891  -40.086  1.00 72.38  ?  21  DA  F C4    1 
ATOM   6464 P  P     . DG  E 2 22  ? 33.630  56.376  -35.924  1.00 91.65  ?  22  DG  F P     1 
ATOM   6465 O  OP1   . DG  E 2 22  ? 35.036  55.998  -35.628  1.00 94.88  ?  22  DG  F OP1   1 
ATOM   6466 O  OP2   . DG  E 2 22  ? 32.775  57.051  -34.913  1.00 90.88  ?  22  DG  F OP2   1 
ATOM   6467 O  "O5'" . DG  E 2 22  ? 33.581  57.302  -37.218  1.00 92.39  ?  22  DG  F "O5'" 1 
ATOM   6468 C  "C5'" . DG  E 2 22  ? 34.113  56.952  -38.494  1.00 93.91  ?  22  DG  F "C5'" 1 
ATOM   6469 C  "C4'" . DG  E 2 22  ? 33.471  57.860  -39.527  1.00 93.46  ?  22  DG  F "C4'" 1 
ATOM   6470 O  "O4'" . DG  E 2 22  ? 32.086  57.464  -39.717  1.00 90.65  ?  22  DG  F "O4'" 1 
ATOM   6471 C  "C3'" . DG  E 2 22  ? 33.427  59.328  -39.103  1.00 94.95  ?  22  DG  F "C3'" 1 
ATOM   6472 O  "O3'" . DG  E 2 22  ? 34.013  60.175  -40.071  1.00 97.57  ?  22  DG  F "O3'" 1 
ATOM   6473 C  "C2'" . DG  E 2 22  ? 31.946  59.624  -38.930  1.00 91.81  ?  22  DG  F "C2'" 1 
ATOM   6474 C  "C1'" . DG  E 2 22  ? 31.357  58.645  -39.928  1.00 89.67  ?  22  DG  F "C1'" 1 
ATOM   6475 N  N9    . DG  E 2 22  ? 29.924  58.424  -39.804  1.00 87.09  ?  22  DG  F N9    1 
ATOM   6476 C  C8    . DG  E 2 22  ? 29.204  58.090  -38.681  1.00 86.29  ?  22  DG  F C8    1 
ATOM   6477 N  N7    . DG  E 2 22  ? 27.919  58.013  -38.882  1.00 84.26  ?  22  DG  F N7    1 
ATOM   6478 C  C5    . DG  E 2 22  ? 27.772  58.339  -40.223  1.00 83.69  ?  22  DG  F C5    1 
ATOM   6479 C  C6    . DG  E 2 22  ? 26.604  58.431  -41.023  1.00 81.86  ?  22  DG  F C6    1 
ATOM   6480 O  O6    . DG  E 2 22  ? 25.438  58.223  -40.676  1.00 80.24  ?  22  DG  F O6    1 
ATOM   6481 N  N1    . DG  E 2 22  ? 26.884  58.787  -42.346  1.00 82.53  ?  22  DG  F N1    1 
ATOM   6482 C  C2    . DG  E 2 22  ? 28.157  59.044  -42.821  1.00 84.76  ?  22  DG  F C2    1 
ATOM   6483 N  N2    . DG  E 2 22  ? 28.269  59.392  -44.109  1.00 85.60  ?  22  DG  F N2    1 
ATOM   6484 N  N3    . DG  E 2 22  ? 29.261  58.959  -42.083  1.00 86.15  ?  22  DG  F N3    1 
ATOM   6485 C  C4    . DG  E 2 22  ? 28.997  58.621  -40.794  1.00 85.53  ?  22  DG  F C4    1 
ATOM   6486 P  P     . DT  E 2 23  ? 34.758  61.529  -39.645  1.00 101.14 ?  23  DT  F P     1 
ATOM   6487 O  OP1   . DT  E 2 23  ? 36.207  61.203  -39.581  1.00 104.51 ?  23  DT  F OP1   1 
ATOM   6488 O  OP2   . DT  E 2 23  ? 34.055  62.154  -38.491  1.00 100.28 ?  23  DT  F OP2   1 
ATOM   6489 O  "O5'" . DT  E 2 23  ? 34.499  62.493  -40.894  1.00 100.99 ?  23  DT  F "O5'" 1 
ATOM   6490 C  "C5'" . DT  E 2 23  ? 34.758  62.097  -42.242  1.00 100.77 ?  23  DT  F "C5'" 1 
ATOM   6491 C  "C4'" . DT  E 2 23  ? 33.622  62.556  -43.137  1.00 98.29  ?  23  DT  F "C4'" 1 
ATOM   6492 O  "O4'" . DT  E 2 23  ? 32.396  61.919  -42.708  1.00 95.01  ?  23  DT  F "O4'" 1 
ATOM   6493 C  "C3'" . DT  E 2 23  ? 33.345  64.052  -43.077  1.00 98.92  ?  23  DT  F "C3'" 1 
ATOM   6494 O  "O3'" . DT  E 2 23  ? 33.977  64.710  -44.167  1.00 100.69 ?  23  DT  F "O3'" 1 
ATOM   6495 C  "C2'" . DT  E 2 23  ? 31.828  64.185  -43.124  1.00 96.06  ?  23  DT  F "C2'" 1 
ATOM   6496 C  "C1'" . DT  E 2 23  ? 31.316  62.756  -43.056  1.00 93.54  ?  23  DT  F "C1'" 1 
ATOM   6497 N  N1    . DT  E 2 23  ? 30.110  62.539  -42.171  1.00 90.86  ?  23  DT  F N1    1 
ATOM   6498 C  C2    . DT  E 2 23  ? 28.860  62.507  -42.769  1.00 88.57  ?  23  DT  F C2    1 
ATOM   6499 O  O2    . DT  E 2 23  ? 28.674  62.660  -43.968  1.00 88.44  ?  23  DT  F O2    1 
ATOM   6500 N  N3    . DT  E 2 23  ? 27.814  62.275  -41.900  1.00 86.80  ?  23  DT  F N3    1 
ATOM   6501 C  C4    . DT  E 2 23  ? 27.877  62.083  -40.525  1.00 86.82  ?  23  DT  F C4    1 
ATOM   6502 O  O4    . DT  E 2 23  ? 26.835  61.894  -39.893  1.00 85.30  ?  23  DT  F O4    1 
ATOM   6503 C  C5    . DT  E 2 23  ? 29.209  62.141  -39.958  1.00 88.90  ?  23  DT  F C5    1 
ATOM   6504 C  C7    . DT  E 2 23  ? 29.396  61.978  -38.478  1.00 89.32  ?  23  DT  F C7    1 
ATOM   6505 C  C6    . DT  E 2 23  ? 30.247  62.364  -40.793  1.00 90.89  ?  23  DT  F C6    1 
ATOM   6506 P  P     . DA  E 2 24  ? 34.252  66.293  -44.208  1.00 102.83 ?  24  DA  F P     1 
ATOM   6507 O  OP1   . DA  E 2 24  ? 35.404  66.505  -45.122  1.00 106.10 ?  24  DA  F OP1   1 
ATOM   6508 O  OP2   . DA  E 2 24  ? 34.272  66.858  -42.836  1.00 103.70 ?  24  DA  F OP2   1 
ATOM   6509 O  "O5'" . DA  E 2 24  ? 32.913  66.861  -44.864  1.00 99.29  ?  24  DA  F "O5'" 1 
ATOM   6510 C  "C5'" . DA  E 2 24  ? 32.452  66.467  -46.150  1.00 96.56  ?  24  DA  F "C5'" 1 
ATOM   6511 C  "C4'" . DA  E 2 24  ? 31.039  66.969  -46.331  1.00 92.77  ?  24  DA  F "C4'" 1 
ATOM   6512 O  "O4'" . DA  E 2 24  ? 30.191  66.297  -45.379  1.00 89.27  ?  24  DA  F "O4'" 1 
ATOM   6513 C  "C3'" . DA  E 2 24  ? 30.866  68.458  -46.080  1.00 94.11  ?  24  DA  F "C3'" 1 
ATOM   6514 O  "O3'" . DA  E 2 24  ? 30.262  69.027  -47.213  1.00 94.99  ?  24  DA  F "O3'" 1 
ATOM   6515 C  "C2'" . DA  E 2 24  ? 29.997  68.567  -44.831  1.00 91.79  ?  24  DA  F "C2'" 1 
ATOM   6516 C  "C1'" . DA  E 2 24  ? 29.283  67.227  -44.834  1.00 88.11  ?  24  DA  F "C1'" 1 
ATOM   6517 N  N9    . DA  E 2 24  ? 28.859  66.744  -43.524  1.00 85.23  ?  24  DA  F N9    1 
ATOM   6518 C  C8    . DA  E 2 24  ? 29.612  66.599  -42.392  1.00 85.84  ?  24  DA  F C8    1 
ATOM   6519 N  N7    . DA  E 2 24  ? 28.969  66.091  -41.371  1.00 83.80  ?  24  DA  F N7    1 
ATOM   6520 C  C5    . DA  E 2 24  ? 27.697  65.898  -41.869  1.00 81.39  ?  24  DA  F C5    1 
ATOM   6521 C  C6    . DA  E 2 24  ? 26.511  65.421  -41.275  1.00 78.81  ?  24  DA  F C6    1 
ATOM   6522 N  N6    . DA  E 2 24  ? 26.451  65.027  -40.003  1.00 78.52  ?  24  DA  F N6    1 
ATOM   6523 N  N1    . DA  E 2 24  ? 25.398  65.353  -42.044  1.00 76.91  ?  24  DA  F N1    1 
ATOM   6524 C  C2    . DA  E 2 24  ? 25.458  65.783  -43.315  1.00 77.65  ?  24  DA  F C2    1 
ATOM   6525 N  N3    . DA  E 2 24  ? 26.514  66.258  -43.985  1.00 79.88  ?  24  DA  F N3    1 
ATOM   6526 C  C4    . DA  E 2 24  ? 27.608  66.297  -43.195  1.00 81.91  ?  24  DA  F C4    1 
ATOM   6527 P  P     . DC  E 2 25  ? 30.084  70.604  -47.423  1.00 98.50  ?  25  DC  F P     1 
ATOM   6528 O  OP1   . DC  E 2 25  ? 30.102  70.858  -48.885  1.00 100.14 ?  25  DC  F OP1   1 
ATOM   6529 O  OP2   . DC  E 2 25  ? 31.013  71.351  -46.532  1.00 101.57 ?  25  DC  F OP2   1 
ATOM   6530 O  "O5'" . DC  E 2 25  ? 28.610  70.845  -46.865  1.00 95.55  ?  25  DC  F "O5'" 1 
ATOM   6531 C  "C5'" . DC  E 2 25  ? 27.485  70.184  -47.412  1.00 92.24  ?  25  DC  F "C5'" 1 
ATOM   6532 C  "C4'" . DC  E 2 25  ? 26.329  70.281  -46.443  1.00 89.93  ?  25  DC  F "C4'" 1 
ATOM   6533 O  "O4'" . DC  E 2 25  ? 26.644  69.538  -45.240  1.00 88.55  ?  25  DC  F "O4'" 1 
ATOM   6534 C  "C3'" . DC  E 2 25  ? 26.038  71.696  -45.973  1.00 91.74  ?  25  DC  F "C3'" 1 
ATOM   6535 O  "O3'" . DC  E 2 25  ? 24.899  72.205  -46.640  1.00 92.04  ?  25  DC  F "O3'" 1 
ATOM   6536 C  "C2'" . DC  E 2 25  ? 25.868  71.570  -44.462  1.00 90.64  ?  25  DC  F "C2'" 1 
ATOM   6537 C  "C1'" . DC  E 2 25  ? 25.795  70.067  -44.253  1.00 87.67  ?  25  DC  F "C1'" 1 
ATOM   6538 N  N1    . DC  E 2 25  ? 26.124  69.578  -42.862  1.00 86.64  ?  25  DC  F N1    1 
ATOM   6539 C  C2    . DC  E 2 25  ? 25.103  68.992  -42.068  1.00 84.37  ?  25  DC  F C2    1 
ATOM   6540 O  O2    . DC  E 2 25  ? 23.946  68.851  -42.507  1.00 82.74  ?  25  DC  F O2    1 
ATOM   6541 N  N3    . DC  E 2 25  ? 25.420  68.574  -40.806  1.00 83.99  ?  25  DC  F N3    1 
ATOM   6542 C  C4    . DC  E 2 25  ? 26.664  68.728  -40.327  1.00 85.77  ?  25  DC  F C4    1 
ATOM   6543 N  N4    . DC  E 2 25  ? 26.916  68.295  -39.087  1.00 85.47  ?  25  DC  F N4    1 
ATOM   6544 C  C5    . DC  E 2 25  ? 27.709  69.320  -41.113  1.00 88.09  ?  25  DC  F C5    1 
ATOM   6545 C  C6    . DC  E 2 25  ? 27.397  69.724  -42.357  1.00 88.29  ?  25  DC  F C6    1 
ATOM   6546 P  P     . DC  E 2 26  ? 24.318  73.686  -46.406  1.00 95.43  ?  26  DC  F P     1 
ATOM   6547 O  OP1   . DC  E 2 26  ? 23.655  74.118  -47.657  1.00 96.91  ?  26  DC  F OP1   1 
ATOM   6548 O  OP2   . DC  E 2 26  ? 25.322  74.581  -45.771  1.00 97.95  ?  26  DC  F OP2   1 
ATOM   6549 O  "O5'" . DC  E 2 26  ? 23.186  73.405  -45.319  1.00 93.29  ?  26  DC  F "O5'" 1 
ATOM   6550 C  "C5'" . DC  E 2 26  ? 22.138  72.452  -45.525  1.00 90.01  ?  26  DC  F "C5'" 1 
ATOM   6551 C  "C4'" . DC  E 2 26  ? 21.227  72.434  -44.312  1.00 88.39  ?  26  DC  F "C4'" 1 
ATOM   6552 O  "O4'" . DC  E 2 26  ? 21.895  71.724  -43.242  1.00 86.51  ?  26  DC  F "O4'" 1 
ATOM   6553 C  "C3'" . DC  E 2 26  ? 20.910  73.825  -43.778  1.00 91.16  ?  26  DC  F "C3'" 1 
ATOM   6554 O  "O3'" . DC  E 2 26  ? 19.539  74.151  -43.917  1.00 92.21  ?  26  DC  F "O3'" 1 
ATOM   6555 C  "C2'" . DC  E 2 26  ? 21.404  73.851  -42.339  1.00 90.56  ?  26  DC  F "C2'" 1 
ATOM   6556 C  "C1'" . DC  E 2 26  ? 21.660  72.387  -42.018  1.00 86.87  ?  26  DC  F "C1'" 1 
ATOM   6557 N  N1    . DC  E 2 26  ? 22.792  72.137  -41.053  1.00 86.07  ?  26  DC  F N1    1 
ATOM   6558 C  C2    . DC  E 2 26  ? 22.511  71.702  -39.744  1.00 84.27  ?  26  DC  F C2    1 
ATOM   6559 O  O2    . DC  E 2 26  ? 21.332  71.541  -39.395  1.00 82.61  ?  26  DC  F O2    1 
ATOM   6560 N  N3    . DC  E 2 26  ? 23.558  71.474  -38.894  1.00 84.92  ?  26  DC  F N3    1 
ATOM   6561 C  C4    . DC  E 2 26  ? 24.825  71.676  -39.296  1.00 86.65  ?  26  DC  F C4    1 
ATOM   6562 N  N4    . DC  E 2 26  ? 25.817  71.451  -38.431  1.00 87.65  ?  26  DC  F N4    1 
ATOM   6563 C  C5    . DC  E 2 26  ? 25.137  72.128  -40.615  1.00 87.85  ?  26  DC  F C5    1 
ATOM   6564 C  C6    . DC  E 2 26  ? 24.098  72.342  -41.440  1.00 87.49  ?  26  DC  F C6    1 
ATOM   6565 P  P     . DT  E 2 27  ? 19.047  75.684  -43.857  1.00 96.85  ?  27  DT  F P     1 
ATOM   6566 O  OP1   . DT  E 2 27  ? 17.903  75.801  -44.795  1.00 97.96  ?  27  DT  F OP1   1 
ATOM   6567 O  OP2   . DT  E 2 27  ? 20.183  76.648  -43.952  1.00 99.70  ?  27  DT  F OP2   1 
ATOM   6568 O  "O5'" . DT  E 2 27  ? 18.504  75.800  -42.357  1.00 94.93  ?  27  DT  F "O5'" 1 
ATOM   6569 C  "C5'" . DT  E 2 27  ? 17.467  74.976  -41.824  1.00 90.10  ?  27  DT  F "C5'" 1 
ATOM   6570 C  "C4'" . DT  E 2 27  ? 17.421  75.172  -40.322  1.00 88.00  ?  27  DT  F "C4'" 1 
ATOM   6571 O  "O4'" . DT  E 2 27  ? 18.642  74.672  -39.725  1.00 86.58  ?  27  DT  F "O4'" 1 
ATOM   6572 C  "C3'" . DT  E 2 27  ? 17.266  76.614  -39.854  1.00 89.66  ?  27  DT  F "C3'" 1 
ATOM   6573 O  "O3'" . DT  E 2 27  ? 16.173  76.650  -38.972  1.00 88.60  ?  27  DT  F "O3'" 1 
ATOM   6574 C  "C2'" . DT  E 2 27  ? 18.580  76.940  -39.146  1.00 90.80  ?  27  DT  F "C2'" 1 
ATOM   6575 C  "C1'" . DT  E 2 27  ? 19.058  75.559  -38.710  1.00 87.76  ?  27  DT  F "C1'" 1 
ATOM   6576 N  N1    . DT  E 2 27  ? 20.524  75.332  -38.419  1.00 86.89  ?  27  DT  F N1    1 
ATOM   6577 C  C2    . DT  E 2 27  ? 20.896  74.636  -37.272  1.00 85.35  ?  27  DT  F C2    1 
ATOM   6578 O  O2    . DT  E 2 27  ? 20.136  74.224  -36.418  1.00 84.16  ?  27  DT  F O2    1 
ATOM   6579 N  N3    . DT  E 2 27  ? 22.243  74.443  -37.122  1.00 85.73  ?  27  DT  F N3    1 
ATOM   6580 C  C4    . DT  E 2 27  ? 23.246  74.801  -37.996  1.00 87.23  ?  27  DT  F C4    1 
ATOM   6581 O  O4    . DT  E 2 27  ? 24.404  74.548  -37.675  1.00 87.76  ?  27  DT  F O4    1 
ATOM   6582 C  C5    . DT  E 2 27  ? 22.806  75.517  -39.180  1.00 88.57  ?  27  DT  F C5    1 
ATOM   6583 C  C7    . DT  E 2 27  ? 23.795  75.997  -40.206  1.00 90.91  ?  27  DT  F C7    1 
ATOM   6584 C  C6    . DT  E 2 27  ? 21.486  75.732  -39.335  1.00 87.97  ?  27  DT  F C6    1 
ATOM   6585 P  P     . DA  E 2 28  ? 15.130  77.855  -38.850  1.00 91.06  ?  28  DA  F P     1 
ATOM   6586 O  OP1   . DA  E 2 28  ? 13.782  77.248  -38.744  1.00 89.97  ?  28  DA  F OP1   1 
ATOM   6587 O  OP2   . DA  E 2 28  ? 15.403  78.897  -39.874  1.00 93.88  ?  28  DA  F OP2   1 
ATOM   6588 O  "O5'" . DA  E 2 28  ? 15.508  78.505  -37.445  1.00 91.48  ?  28  DA  F "O5'" 1 
ATOM   6589 C  "C5'" . DA  E 2 28  ? 15.574  77.774  -36.227  1.00 88.54  ?  28  DA  F "C5'" 1 
ATOM   6590 C  "C4'" . DA  E 2 28  ? 16.677  78.321  -35.338  1.00 89.26  ?  28  DA  F "C4'" 1 
ATOM   6591 O  "O4'" . DA  E 2 28  ? 17.942  77.775  -35.793  1.00 87.50  ?  28  DA  F "O4'" 1 
ATOM   6592 C  "C3'" . DA  E 2 28  ? 16.826  79.848  -35.355  1.00 92.90  ?  28  DA  F "C3'" 1 
ATOM   6593 O  "O3'" . DA  E 2 28  ? 16.683  80.446  -34.063  1.00 94.99  ?  28  DA  F "O3'" 1 
ATOM   6594 C  "C2'" . DA  E 2 28  ? 18.190  80.094  -35.990  1.00 93.53  ?  28  DA  F "C2'" 1 
ATOM   6595 C  "C1'" . DA  E 2 28  ? 18.887  78.798  -35.607  1.00 90.28  ?  28  DA  F "C1'" 1 
ATOM   6596 N  N9    . DA  E 2 28  ? 20.202  78.560  -36.195  1.00 89.60  ?  28  DA  F N9    1 
ATOM   6597 C  C8    . DA  E 2 28  ? 20.719  79.119  -37.333  1.00 90.93  ?  28  DA  F C8    1 
ATOM   6598 N  N7    . DA  E 2 28  ? 21.972  78.822  -37.557  1.00 91.16  ?  28  DA  F N7    1 
ATOM   6599 C  C5    . DA  E 2 28  ? 22.315  78.040  -36.472  1.00 89.93  ?  28  DA  F C5    1 
ATOM   6600 C  C6    . DA  E 2 28  ? 23.528  77.420  -36.095  1.00 90.02  ?  28  DA  F C6    1 
ATOM   6601 N  N6    . DA  E 2 28  ? 24.638  77.499  -36.845  1.00 91.17  ?  28  DA  F N6    1 
ATOM   6602 N  N1    . DA  E 2 28  ? 23.532  76.674  -34.954  1.00 88.60  ?  28  DA  F N1    1 
ATOM   6603 C  C2    . DA  E 2 28  ? 22.417  76.604  -34.205  1.00 87.33  ?  28  DA  F C2    1 
ATOM   6604 N  N3    . DA  E 2 28  ? 21.230  77.170  -34.453  1.00 87.46  ?  28  DA  F N3    1 
ATOM   6605 C  C4    . DA  E 2 28  ? 21.242  77.880  -35.607  1.00 88.76  ?  28  DA  F C4    1 
ATOM   6606 P  P     . DG  E 2 29  ? 16.445  82.026  -33.905  1.00 99.45  ?  29  DG  F P     1 
ATOM   6607 O  OP1   . DG  E 2 29  ? 15.794  82.308  -32.601  1.00 100.75 ?  29  DG  F OP1   1 
ATOM   6608 O  OP2   . DG  E 2 29  ? 15.818  82.548  -35.147  1.00 100.35 ?  29  DG  F OP2   1 
ATOM   6609 O  "O5'" . DG  E 2 29  ? 17.956  82.552  -33.866  1.00 101.76 ?  29  DG  F "O5'" 1 
ATOM   6610 C  "C5'" . DG  E 2 29  ? 18.691  82.849  -32.679  1.00 103.86 ?  29  DG  F "C5'" 1 
ATOM   6611 C  "C4'" . DG  E 2 29  ? 19.330  81.620  -32.064  1.00 101.11 ?  29  DG  F "C4'" 1 
ATOM   6612 O  "O4'" . DG  E 2 29  ? 19.785  80.710  -33.085  1.00 98.34  ?  29  DG  F "O4'" 1 
ATOM   6613 C  "C3'" . DG  E 2 29  ? 20.566  81.921  -31.243  1.00 103.65 ?  29  DG  F "C3'" 1 
ATOM   6614 O  "O3'" . DG  E 2 29  ? 20.169  82.227  -29.928  1.00 105.80 ?  29  DG  F "O3'" 1 
ATOM   6615 C  "C2'" . DG  E 2 29  ? 21.341  80.616  -31.307  1.00 100.39 ?  29  DG  F "C2'" 1 
ATOM   6616 C  "C1'" . DG  E 2 29  ? 21.045  80.175  -32.735  1.00 98.41  ?  29  DG  F "C1'" 1 
ATOM   6617 N  N9    . DG  E 2 29  ? 22.030  80.546  -33.758  1.00 101.01 ?  29  DG  F N9    1 
ATOM   6618 C  C8    . DG  E 2 29  ? 21.791  81.222  -34.939  1.00 102.62 ?  29  DG  F C8    1 
ATOM   6619 N  N7    . DG  E 2 29  ? 22.841  81.387  -35.696  1.00 103.91 ?  29  DG  F N7    1 
ATOM   6620 C  C5    . DG  E 2 29  ? 23.851  80.754  -34.984  1.00 103.78 ?  29  DG  F C5    1 
ATOM   6621 C  C6    . DG  E 2 29  ? 25.227  80.594  -35.303  1.00 105.34 ?  29  DG  F C6    1 
ATOM   6622 O  O6    . DG  E 2 29  ? 25.823  81.029  -36.304  1.00 107.08 ?  29  DG  F O6    1 
ATOM   6623 N  N1    . DG  E 2 29  ? 25.926  79.896  -34.300  1.00 104.85 ?  29  DG  F N1    1 
ATOM   6624 C  C2    . DG  E 2 29  ? 25.353  79.411  -33.133  1.00 103.20 ?  29  DG  F C2    1 
ATOM   6625 N  N2    . DG  E 2 29  ? 26.145  78.764  -32.268  1.00 102.99 ?  29  DG  F N2    1 
ATOM   6626 N  N3    . DG  E 2 29  ? 24.066  79.551  -32.833  1.00 101.89 ?  29  DG  F N3    1 
ATOM   6627 C  C4    . DG  E 2 29  ? 23.371  80.224  -33.794  1.00 102.08 ?  29  DG  F C4    1 
ATOM   6628 P  P     . DT  E 2 30  ? 20.661  83.572  -29.226  1.00 111.19 ?  30  DT  F P     1 
ATOM   6629 O  OP1   . DT  E 2 30  ? 19.744  83.862  -28.099  1.00 112.62 ?  30  DT  F OP1   1 
ATOM   6630 O  OP2   . DT  E 2 30  ? 20.868  84.603  -30.262  1.00 113.86 ?  30  DT  F OP2   1 
ATOM   6631 O  "O5'" . DT  E 2 30  ? 22.102  83.151  -28.679  1.00 111.98 ?  30  DT  F "O5'" 1 
ATOM   6632 C  "C5'" . DT  E 2 30  ? 22.270  82.149  -27.679  1.00 110.80 ?  30  DT  F "C5'" 1 
ATOM   6633 C  "C4'" . DT  E 2 30  ? 23.716  81.702  -27.615  1.00 111.65 ?  30  DT  F "C4'" 1 
ATOM   6634 O  "O4'" . DT  E 2 30  ? 24.098  81.244  -28.929  1.00 109.59 ?  30  DT  F "O4'" 1 
ATOM   6635 C  "C3'" . DT  E 2 30  ? 24.695  82.815  -27.297  1.00 117.24 ?  30  DT  F "C3'" 1 
ATOM   6636 O  "O3'" . DT  E 2 30  ? 24.947  82.867  -25.903  1.00 120.64 ?  30  DT  F "O3'" 1 
ATOM   6637 C  "C2'" . DT  E 2 30  ? 25.946  82.429  -28.069  1.00 116.23 ?  30  DT  F "C2'" 1 
ATOM   6638 C  "C1'" . DT  E 2 30  ? 25.451  81.549  -29.190  1.00 111.66 ?  30  DT  F "C1'" 1 
ATOM   6639 N  N1    . DT  E 2 30  ? 25.649  82.125  -30.562  1.00 112.37 ?  30  DT  F N1    1 
ATOM   6640 C  C2    . DT  E 2 30  ? 26.890  82.034  -31.190  1.00 113.39 ?  30  DT  F C2    1 
ATOM   6641 O  O2    . DT  E 2 30  ? 27.898  81.562  -30.688  1.00 113.95 ?  30  DT  F O2    1 
ATOM   6642 N  N3    . DT  E 2 30  ? 26.924  82.549  -32.464  1.00 114.20 ?  30  DT  F N3    1 
ATOM   6643 C  C4    . DT  E 2 30  ? 25.879  83.134  -33.162  1.00 114.28 ?  30  DT  F C4    1 
ATOM   6644 O  O4    . DT  E 2 30  ? 26.100  83.554  -34.297  1.00 115.51 ?  30  DT  F O4    1 
ATOM   6645 C  C5    . DT  E 2 30  ? 24.613  83.190  -32.454  1.00 113.19 ?  30  DT  F C5    1 
ATOM   6646 C  C7    . DT  E 2 30  ? 23.394  83.805  -33.074  1.00 113.51 ?  30  DT  F C7    1 
ATOM   6647 C  C6    . DT  E 2 30  ? 24.564  82.697  -31.209  1.00 112.30 ?  30  DT  F C6    1 
ATOM   6648 P  P     . DC  E 2 31  ? 25.634  84.138  -25.204  1.00 127.79 ?  31  DC  F P     1 
ATOM   6649 O  OP1   . DC  E 2 31  ? 24.734  84.500  -24.086  1.00 129.60 ?  31  DC  F OP1   1 
ATOM   6650 O  OP2   . DC  E 2 31  ? 26.006  85.186  -26.194  1.00 130.22 ?  31  DC  F OP2   1 
ATOM   6651 O  "O5'" . DC  E 2 31  ? 26.994  83.536  -24.595  1.00 129.54 ?  31  DC  F "O5'" 1 
ATOM   6652 C  "C5'" . DC  E 2 31  ? 27.949  82.678  -25.262  1.00 128.02 ?  31  DC  F "C5'" 1 
ATOM   6653 C  "C4'" . DC  E 2 31  ? 29.086  83.405  -25.974  1.00 131.73 ?  31  DC  F "C4'" 1 
ATOM   6654 O  "O4'" . DC  E 2 31  ? 28.945  83.388  -27.416  1.00 129.52 ?  31  DC  F "O4'" 1 
ATOM   6655 C  "C3'" . DC  E 2 31  ? 29.386  84.842  -25.561  1.00 138.30 ?  31  DC  F "C3'" 1 
ATOM   6656 O  "O3'" . DC  E 2 31  ? 30.650  84.882  -24.909  1.00 142.98 ?  31  DC  F "O3'" 1 
ATOM   6657 C  "C2'" . DC  E 2 31  ? 29.375  85.638  -26.865  1.00 138.75 ?  31  DC  F "C2'" 1 
ATOM   6658 C  "C1'" . DC  E 2 31  ? 29.541  84.558  -27.930  1.00 133.53 ?  31  DC  F "C1'" 1 
ATOM   6659 N  N1    . DC  E 2 31  ? 28.995  84.902  -29.299  1.00 131.58 ?  31  DC  F N1    1 
ATOM   6660 C  C2    . DC  E 2 31  ? 29.847  84.874  -30.428  1.00 131.60 ?  31  DC  F C2    1 
ATOM   6661 O  O2    . DC  E 2 31  ? 31.042  84.559  -30.309  1.00 132.73 ?  31  DC  F O2    1 
ATOM   6662 N  N3    . DC  E 2 31  ? 29.329  85.203  -31.649  1.00 130.54 ?  31  DC  F N3    1 
ATOM   6663 C  C4    . DC  E 2 31  ? 28.041  85.558  -31.776  1.00 129.18 ?  31  DC  F C4    1 
ATOM   6664 N  N4    . DC  E 2 31  ? 27.595  85.877  -32.996  1.00 128.56 ?  31  DC  F N4    1 
ATOM   6665 C  C5    . DC  E 2 31  ? 27.157  85.590  -30.650  1.00 128.93 ?  31  DC  F C5    1 
ATOM   6666 C  C6    . DC  E 2 31  ? 27.675  85.268  -29.451  1.00 130.03 ?  31  DC  F C6    1 
ATOM   6667 P  P     . DT  E 2 32  ? 31.224  86.150  -24.110  1.00 150.79 ?  32  DT  F P     1 
ATOM   6668 O  OP1   . DT  E 2 32  ? 32.037  85.617  -22.991  1.00 151.96 ?  32  DT  F OP1   1 
ATOM   6669 O  OP2   . DT  E 2 32  ? 30.121  87.096  -23.813  1.00 152.43 ?  32  DT  F OP2   1 
ATOM   6670 O  "O5'" . DT  E 2 32  ? 32.178  86.847  -25.200  1.00 154.91 ?  32  DT  F "O5'" 1 
ATOM   6671 C  "C5'" . DT  E 2 32  ? 33.330  86.182  -25.728  1.00 155.16 ?  32  DT  F "C5'" 1 
ATOM   6672 C  "C4'" . DT  E 2 32  ? 33.731  86.694  -27.101  1.00 157.30 ?  32  DT  F "C4'" 1 
ATOM   6673 O  "O4'" . DT  E 2 32  ? 32.611  86.673  -28.017  1.00 153.75 ?  32  DT  F "O4'" 1 
ATOM   6674 C  "C3'" . DT  E 2 32  ? 34.240  88.127  -27.170  1.00 164.88 ?  32  DT  F "C3'" 1 
ATOM   6675 O  "O3'" . DT  E 2 32  ? 35.654  88.151  -26.981  1.00 170.52 ?  32  DT  F "O3'" 1 
ATOM   6676 C  "C2'" . DT  E 2 32  ? 33.861  88.577  -28.581  1.00 163.73 ?  32  DT  F "C2'" 1 
ATOM   6677 C  "C1'" . DT  E 2 32  ? 33.016  87.436  -29.135  1.00 156.34 ?  32  DT  F "C1'" 1 
ATOM   6678 N  N1    . DT  E 2 32  ? 31.863  87.869  -30.020  1.00 153.99 ?  32  DT  F N1    1 
ATOM   6679 C  C2    . DT  E 2 32  ? 32.051  87.962  -31.400  1.00 153.30 ?  32  DT  F C2    1 
ATOM   6680 O  O2    . DT  E 2 32  ? 33.097  87.714  -31.980  1.00 153.95 ?  32  DT  F O2    1 
ATOM   6681 N  N3    . DT  E 2 32  ? 30.941  88.370  -32.110  1.00 152.03 ?  32  DT  F N3    1 
ATOM   6682 C  C4    . DT  E 2 32  ? 29.688  88.695  -31.600  1.00 151.06 ?  32  DT  F C4    1 
ATOM   6683 O  O4    . DT  E 2 32  ? 28.812  89.053  -32.386  1.00 150.26 ?  32  DT  F O4    1 
ATOM   6684 C  C5    . DT  E 2 32  ? 29.556  88.590  -30.154  1.00 151.43 ?  32  DT  F C5    1 
ATOM   6685 C  C7    . DT  E 2 32  ? 28.262  88.923  -29.463  1.00 150.77 ?  32  DT  F C7    1 
ATOM   6686 C  C6    . DT  E 2 32  ? 30.632  88.187  -29.450  1.00 152.83 ?  32  DT  F C6    1 
ATOM   6687 P  P     . DT  E 2 33  ? 36.493  89.476  -26.624  1.00 179.63 ?  33  DT  F P     1 
ATOM   6688 O  OP1   . DT  E 2 33  ? 37.770  89.032  -26.021  1.00 180.40 ?  33  DT  F OP1   1 
ATOM   6689 O  OP2   . DT  E 2 33  ? 35.640  90.436  -25.877  1.00 180.17 ?  33  DT  F OP2   1 
ATOM   6690 O  "O5'" . DT  E 2 33  ? 36.799  90.132  -28.053  1.00 180.43 ?  33  DT  F "O5'" 1 
ATOM   6691 C  "C5'" . DT  E 2 33  ? 37.574  89.488  -29.068  1.00 180.70 ?  33  DT  F "C5'" 1 
ATOM   6692 C  "C4'" . DT  E 2 33  ? 37.391  90.184  -30.408  1.00 181.45 ?  33  DT  F "C4'" 1 
ATOM   6693 O  "O4'" . DT  E 2 33  ? 36.010  90.056  -30.843  1.00 180.32 ?  33  DT  F "O4'" 1 
ATOM   6694 C  "C3'" . DT  E 2 33  ? 37.738  91.676  -30.444  1.00 184.15 ?  33  DT  F "C3'" 1 
ATOM   6695 O  "O3'" . DT  E 2 33  ? 38.668  91.927  -31.501  1.00 185.96 ?  33  DT  F "O3'" 1 
ATOM   6696 C  "C2'" . DT  E 2 33  ? 36.383  92.340  -30.682  1.00 183.45 ?  33  DT  F "C2'" 1 
ATOM   6697 C  "C1'" . DT  E 2 33  ? 35.634  91.265  -31.465  1.00 181.03 ?  33  DT  F "C1'" 1 
ATOM   6698 N  N1    . DT  E 2 33  ? 34.123  91.417  -31.548  1.00 179.97 ?  33  DT  F N1    1 
ATOM   6699 C  C2    . DT  E 2 33  ? 33.493  91.476  -32.791  1.00 177.93 ?  33  DT  F C2    1 
ATOM   6700 O  O2    . DT  E 2 33  ? 34.070  91.406  -33.867  1.00 178.46 ?  33  DT  F O2    1 
ATOM   6701 N  N3    . DT  E 2 33  ? 32.123  91.636  -32.737  1.00 175.40 ?  33  DT  F N3    1 
ATOM   6702 C  C4    . DT  E 2 33  ? 31.329  91.749  -31.600  1.00 174.72 ?  33  DT  F C4    1 
ATOM   6703 O  O4    . DT  E 2 33  ? 30.115  91.894  -31.733  1.00 172.73 ?  33  DT  F O4    1 
ATOM   6704 C  C5    . DT  E 2 33  ? 32.041  91.678  -30.337  1.00 176.83 ?  33  DT  F C5    1 
ATOM   6705 C  C7    . DT  E 2 33  ? 31.316  91.783  -29.026  1.00 176.73 ?  33  DT  F C7    1 
ATOM   6706 C  C6    . DT  E 2 33  ? 33.378  91.531  -30.378  1.00 179.37 ?  33  DT  F C6    1 
ATOM   6707 P  P     . DA  E 2 34  ? 39.497  93.280  -31.783  1.00 188.88 ?  34  DA  F P     1 
ATOM   6708 O  OP1   . DA  E 2 34  ? 40.724  93.244  -30.953  1.00 189.95 ?  34  DA  F OP1   1 
ATOM   6709 O  OP2   . DA  E 2 34  ? 38.619  94.472  -31.705  1.00 189.46 ?  34  DA  F OP2   1 
ATOM   6710 O  "O5'" . DA  E 2 34  ? 39.913  93.099  -33.325  1.00 189.43 ?  34  DA  F "O5'" 1 
ATOM   6711 C  "C5'" . DA  E 2 34  ? 39.134  92.377  -34.307  1.00 188.64 ?  34  DA  F "C5'" 1 
ATOM   6712 C  "C4'" . DA  E 2 34  ? 38.138  93.224  -35.093  1.00 189.27 ?  34  DA  F "C4'" 1 
ATOM   6713 O  "O4'" . DA  E 2 34  ? 36.791  93.110  -34.569  1.00 188.54 ?  34  DA  F "O4'" 1 
ATOM   6714 C  "C3'" . DA  E 2 34  ? 38.418  94.717  -35.250  1.00 191.14 ?  34  DA  F "C3'" 1 
ATOM   6715 O  "O3'" . DA  E 2 34  ? 39.048  94.960  -36.512  1.00 191.56 ?  34  DA  F "O3'" 1 
ATOM   6716 C  "C2'" . DA  E 2 34  ? 37.043  95.381  -35.135  1.00 191.11 ?  34  DA  F "C2'" 1 
ATOM   6717 C  "C1'" . DA  E 2 34  ? 36.058  94.217  -35.056  1.00 189.23 ?  34  DA  F "C1'" 1 
ATOM   6718 N  N9    . DA  E 2 34  ? 34.888  94.475  -34.207  1.00 188.65 ?  34  DA  F N9    1 
ATOM   6719 C  C8    . DA  E 2 34  ? 34.875  94.611  -32.844  1.00 188.88 ?  34  DA  F C8    1 
ATOM   6720 N  N7    . DA  E 2 34  ? 33.692  94.836  -32.328  1.00 188.25 ?  34  DA  F N7    1 
ATOM   6721 C  C5    . DA  E 2 34  ? 32.862  94.886  -33.433  1.00 187.41 ?  34  DA  F C5    1 
ATOM   6722 C  C6    . DA  E 2 34  ? 31.469  95.104  -33.568  1.00 186.59 ?  34  DA  F C6    1 
ATOM   6723 N  N6    . DA  E 2 34  ? 30.664  95.330  -32.525  1.00 186.60 ?  34  DA  F N6    1 
ATOM   6724 N  N1    . DA  E 2 34  ? 30.937  95.093  -34.817  1.00 185.91 ?  34  DA  F N1    1 
ATOM   6725 C  C2    . DA  E 2 34  ? 31.752  94.887  -35.866  1.00 185.95 ?  34  DA  F C2    1 
ATOM   6726 N  N3    . DA  E 2 34  ? 33.074  94.667  -35.861  1.00 186.69 ?  34  DA  F N3    1 
ATOM   6727 C  C4    . DA  E 2 34  ? 33.579  94.671  -34.605  1.00 187.54 ?  34  DA  F C4    1 
ATOM   6728 P  P     . DA  E 2 35  ? 39.573  96.379  -37.057  1.00 193.37 ?  35  DA  F P     1 
ATOM   6729 O  OP1   . DA  E 2 35  ? 40.736  96.106  -37.932  1.00 193.96 ?  35  DA  F OP1   1 
ATOM   6730 O  OP2   . DA  E 2 35  ? 39.726  97.330  -35.930  1.00 194.80 ?  35  DA  F OP2   1 
ATOM   6731 O  "O5'" . DA  E 2 35  ? 38.342  96.886  -37.953  1.00 192.62 ?  35  DA  F "O5'" 1 
ATOM   6732 C  "C5'" . DA  E 2 35  ? 37.833  96.113  -39.053  1.00 191.07 ?  35  DA  F "C5'" 1 
ATOM   6733 C  "C4'" . DA  E 2 35  ? 36.480  96.611  -39.544  1.00 190.37 ?  35  DA  F "C4'" 1 
ATOM   6734 O  "O4'" . DA  E 2 35  ? 35.485  96.516  -38.492  1.00 189.51 ?  35  DA  F "O4'" 1 
ATOM   6735 C  "C3'" . DA  E 2 35  ? 36.430  98.040  -40.084  1.00 191.84 ?  35  DA  F "C3'" 1 
ATOM   6736 O  "O3'" . DA  E 2 35  ? 35.891  98.040  -41.416  1.00 191.48 ?  35  DA  F "O3'" 1 
ATOM   6737 C  "C2'" . DA  E 2 35  ? 35.545  98.785  -39.083  1.00 192.07 ?  35  DA  F "C2'" 1 
ATOM   6738 C  "C1'" . DA  E 2 35  ? 34.669  97.672  -38.513  1.00 190.29 ?  35  DA  F "C1'" 1 
ATOM   6739 N  N9    . DA  E 2 35  ? 34.135  97.905  -37.165  1.00 190.42 ?  35  DA  F N9    1 
ATOM   6740 C  C8    . DA  E 2 35  ? 34.859  98.041  -36.009  1.00 191.20 ?  35  DA  F C8    1 
ATOM   6741 N  N7    . DA  E 2 35  ? 34.134  98.210  -34.929  1.00 191.14 ?  35  DA  F N7    1 
ATOM   6742 C  C5    . DA  E 2 35  ? 32.835  98.183  -35.403  1.00 190.29 ?  35  DA  F C5    1 
ATOM   6743 C  C6    . DA  E 2 35  ? 31.584  98.311  -34.753  1.00 189.94 ?  35  DA  F C6    1 
ATOM   6744 N  N6    . DA  E 2 35  ? 31.473  98.481  -33.431  1.00 190.31 ?  35  DA  F N6    1 
ATOM   6745 N  N1    . DA  E 2 35  ? 30.456  98.224  -35.507  1.00 189.21 ?  35  DA  F N1    1 
ATOM   6746 C  C2    . DA  E 2 35  ? 30.573  98.041  -36.836  1.00 188.74 ?  35  DA  F C2    1 
ATOM   6747 N  N3    . DA  E 2 35  ? 31.697  97.900  -37.553  1.00 188.92 ?  35  DA  F N3    1 
ATOM   6748 C  C4    . DA  E 2 35  ? 32.808  97.995  -36.781  1.00 189.80 ?  35  DA  F C4    1 
ATOM   6749 P  P     . DT  E 2 36  ? 35.862  99.287  -42.432  1.00 192.83 ?  36  DT  F P     1 
ATOM   6750 O  OP1   . DT  E 2 36  ? 35.995  98.738  -43.803  1.00 192.47 ?  36  DT  F OP1   1 
ATOM   6751 O  OP2   . DT  E 2 36  ? 36.801  100.344 -41.981  1.00 193.82 ?  36  DT  F OP2   1 
ATOM   6752 O  "O5'" . DT  E 2 36  ? 34.375  99.853  -42.240  1.00 192.43 ?  36  DT  F "O5'" 1 
ATOM   6753 C  "C5'" . DT  E 2 36  ? 33.203  99.077  -42.535  1.00 190.76 ?  36  DT  F "C5'" 1 
ATOM   6754 C  "C4'" . DT  E 2 36  ? 31.949  99.726  -41.968  1.00 190.79 ?  36  DT  F "C4'" 1 
ATOM   6755 O  "O4'" . DT  E 2 36  ? 32.006  99.735  -40.516  1.00 190.76 ?  36  DT  F "O4'" 1 
ATOM   6756 C  "C3'" . DT  E 2 36  ? 31.688  101.173 -42.400  1.00 191.80 ?  36  DT  F "C3'" 1 
ATOM   6757 O  "O3'" . DT  E 2 36  ? 30.362  101.326 -42.904  1.00 191.30 ?  36  DT  F "O3'" 1 
ATOM   6758 C  "C2'" . DT  E 2 36  ? 31.887  101.979 -41.120  1.00 192.23 ?  36  DT  F "C2'" 1 
ATOM   6759 C  "C1'" . DT  E 2 36  ? 31.452  100.956 -40.076  1.00 191.52 ?  36  DT  F "C1'" 1 
ATOM   6760 N  N1    . DT  E 2 36  ? 31.779  101.245 -38.628  1.00 191.50 ?  36  DT  F N1    1 
ATOM   6761 C  C2    . DT  E 2 36  ? 30.743  101.446 -37.717  1.00 191.38 ?  36  DT  F C2    1 
ATOM   6762 O  O2    . DT  E 2 36  ? 29.553  101.409 -37.995  1.00 191.30 ?  36  DT  F O2    1 
ATOM   6763 N  N3    . DT  E 2 36  ? 31.152  101.692 -36.424  1.00 191.57 ?  36  DT  F N3    1 
ATOM   6764 C  C4    . DT  E 2 36  ? 32.458  101.764 -35.953  1.00 192.01 ?  36  DT  F C4    1 
ATOM   6765 O  O4    . DT  E 2 36  ? 32.641  102.003 -34.762  1.00 192.27 ?  36  DT  F O4    1 
ATOM   6766 C  C5    . DT  E 2 36  ? 33.492  101.544 -36.948  1.00 192.14 ?  36  DT  F C5    1 
ATOM   6767 C  C7    . DT  E 2 36  ? 34.948  101.600 -36.579  1.00 192.48 ?  36  DT  F C7    1 
ATOM   6768 C  C6    . DT  E 2 36  ? 33.106  101.300 -38.214  1.00 191.87 ?  36  DT  F C6    1 
ATOM   6769 P  P     . DT  E 2 37  ? 30.040  101.452 -44.469  1.00 190.91 ?  37  DT  F P     1 
ATOM   6770 O  OP1   . DT  E 2 37  ? 29.992  100.077 -45.022  1.00 189.82 ?  37  DT  F OP1   1 
ATOM   6771 O  OP2   . DT  E 2 37  ? 30.943  102.471 -45.071  1.00 191.86 ?  37  DT  F OP2   1 
ATOM   6772 O  "O5'" . DT  E 2 37  ? 28.554  102.048 -44.475  1.00 190.41 ?  37  DT  F "O5'" 1 
ATOM   6773 C  "C5'" . DT  E 2 37  ? 28.278  103.330 -43.921  1.00 190.50 ?  37  DT  F "C5'" 1 
ATOM   6774 C  "C4'" . DT  E 2 37  ? 27.442  103.211 -42.662  1.00 189.80 ?  37  DT  F "C4'" 1 
ATOM   6775 O  "O4'" . DT  E 2 37  ? 28.288  103.157 -41.489  1.00 189.63 ?  37  DT  F "O4'" 1 
ATOM   6776 C  "C3'" . DT  E 2 37  ? 26.533  104.408 -42.444  1.00 190.19 ?  37  DT  F "C3'" 1 
ATOM   6777 O  "O3'" . DT  E 2 37  ? 25.263  104.107 -43.016  1.00 189.50 ?  37  DT  F "O3'" 1 
ATOM   6778 C  "C2'" . DT  E 2 37  ? 26.478  104.592 -40.928  1.00 190.36 ?  37  DT  F "C2'" 1 
ATOM   6779 C  "C1'" . DT  E 2 37  ? 27.548  103.651 -40.389  1.00 189.54 ?  37  DT  F "C1'" 1 
ATOM   6780 N  N1    . DT  E 2 37  ? 28.435  104.173 -39.269  1.00 189.18 ?  37  DT  F N1    1 
ATOM   6781 C  C2    . DT  E 2 37  ? 27.931  104.334 -37.977  1.00 189.00 ?  37  DT  F C2    1 
ATOM   6782 O  O2    . DT  E 2 37  ? 26.772  104.149 -37.643  1.00 188.90 ?  37  DT  F O2    1 
ATOM   6783 N  N3    . DT  E 2 37  ? 28.852  104.759 -37.047  1.00 189.86 ?  37  DT  F N3    1 
ATOM   6784 C  C4    . DT  E 2 37  ? 30.200  105.017 -37.251  1.00 189.41 ?  37  DT  F C4    1 
ATOM   6785 O  O4    . DT  E 2 37  ? 30.883  105.369 -36.295  1.00 188.85 ?  37  DT  F O4    1 
ATOM   6786 C  C5    . DT  E 2 37  ? 30.672  104.821 -38.607  1.00 189.04 ?  37  DT  F C5    1 
ATOM   6787 C  C7    . DT  E 2 37  ? 32.108  105.071 -38.969  1.00 187.67 ?  37  DT  F C7    1 
ATOM   6788 C  C6    . DT  E 2 37  ? 29.778  104.420 -39.529  1.00 189.56 ?  37  DT  F C6    1 
ATOM   6789 P  P     . DC  E 2 38  ? 24.064  105.152 -43.222  1.00 190.45 ?  38  DC  F P     1 
ATOM   6790 O  OP1   . DC  E 2 38  ? 23.419  104.826 -44.514  1.00 190.11 ?  38  DC  F OP1   1 
ATOM   6791 O  OP2   . DC  E 2 38  ? 24.528  106.541 -42.957  1.00 192.59 ?  38  DC  F OP2   1 
ATOM   6792 O  "O5'" . DC  E 2 38  ? 23.078  104.697 -42.049  1.00 188.72 ?  38  DC  F "O5'" 1 
ATOM   6793 C  "C5'" . DC  E 2 38  ? 21.994  105.532 -41.683  1.00 188.57 ?  38  DC  F "C5'" 1 
ATOM   6794 C  "C4'" . DC  E 2 38  ? 22.176  106.095 -40.287  1.00 188.74 ?  38  DC  F "C4'" 1 
ATOM   6795 O  "O4'" . DC  E 2 38  ? 23.567  106.209 -39.900  1.00 189.07 ?  38  DC  F "O4'" 1 
ATOM   6796 C  "C3'" . DC  E 2 38  ? 21.559  107.470 -40.092  1.00 189.18 ?  38  DC  F "C3'" 1 
ATOM   6797 O  "O3'" . DC  E 2 38  ? 20.392  107.306 -39.295  1.00 188.88 ?  38  DC  F "O3'" 1 
ATOM   6798 C  "C2'" . DC  E 2 38  ? 22.650  108.286 -39.395  1.00 188.72 ?  38  DC  F "C2'" 1 
ATOM   6799 C  "C1'" . DC  E 2 38  ? 23.638  107.225 -38.923  1.00 189.39 ?  38  DC  F "C1'" 1 
ATOM   6800 N  N1    . DC  E 2 38  ? 25.085  107.628 -38.666  1.00 188.68 ?  38  DC  F N1    1 
ATOM   6801 C  C2    . DC  E 2 38  ? 25.581  107.779 -37.344  1.00 188.88 ?  38  DC  F C2    1 
ATOM   6802 O  O2    . DC  E 2 38  ? 24.835  107.654 -36.361  1.00 189.39 ?  38  DC  F O2    1 
ATOM   6803 N  N3    . DC  E 2 38  ? 26.901  108.087 -37.165  1.00 189.94 ?  38  DC  F N3    1 
ATOM   6804 C  C4    . DC  E 2 38  ? 27.719  108.229 -38.219  1.00 190.60 ?  38  DC  F C4    1 
ATOM   6805 N  N4    . DC  E 2 38  ? 29.001  108.525 -37.986  1.00 192.81 ?  38  DC  F N4    1 
ATOM   6806 C  C5    . DC  E 2 38  ? 27.249  108.068 -39.562  1.00 189.09 ?  38  DC  F C5    1 
ATOM   6807 C  C6    . DC  E 2 38  ? 25.945  107.785 -39.730  1.00 188.09 ?  38  DC  F C6    1 
ATOM   6808 P  P     . DC  E 2 39  ? 19.155  108.324 -39.237  1.00 187.80 ?  39  DC  F P     1 
ATOM   6809 O  OP1   . DC  E 2 39  ? 17.979  107.564 -38.755  1.00 188.18 ?  39  DC  F OP1   1 
ATOM   6810 O  OP2   . DC  E 2 39  ? 19.058  109.075 -40.512  1.00 187.11 ?  39  DC  F OP2   1 
ATOM   6811 O  "O5'" . DC  E 2 39  ? 19.617  109.360 -38.106  1.00 187.13 ?  39  DC  F "O5'" 1 
ATOM   6812 C  "C5'" . DC  E 2 39  ? 19.917  108.958 -36.764  1.00 186.69 ?  39  DC  F "C5'" 1 
ATOM   6813 C  "C4'" . DC  E 2 39  ? 20.762  109.991 -36.035  1.00 188.42 ?  39  DC  F "C4'" 1 
ATOM   6814 O  "O4'" . DC  E 2 39  ? 22.150  109.925 -36.464  1.00 187.67 ?  39  DC  F "O4'" 1 
ATOM   6815 C  "C3'" . DC  E 2 39  ? 20.328  111.448 -36.197  1.00 192.84 ?  39  DC  F "C3'" 1 
ATOM   6816 O  "O3'" . DC  E 2 39  ? 20.250  112.086 -34.923  1.00 196.07 ?  39  DC  F "O3'" 1 
ATOM   6817 C  "C2'" . DC  E 2 39  ? 21.436  112.044 -37.063  1.00 194.36 ?  39  DC  F "C2'" 1 
ATOM   6818 C  "C1'" . DC  E 2 39  ? 22.630  111.253 -36.540  1.00 192.35 ?  39  DC  F "C1'" 1 
ATOM   6819 N  N1    . DC  E 2 39  ? 23.959  111.326 -37.270  1.00 193.10 ?  39  DC  F N1    1 
ATOM   6820 C  C2    . DC  E 2 39  ? 25.163  111.382 -36.528  1.00 194.53 ?  39  DC  F C2    1 
ATOM   6821 O  O2    . DC  E 2 39  ? 25.137  111.404 -35.289  1.00 195.04 ?  39  DC  F O2    1 
ATOM   6822 N  N3    . DC  E 2 39  ? 26.350  111.414 -37.203  1.00 194.96 ?  39  DC  F N3    1 
ATOM   6823 C  C4    . DC  E 2 39  ? 26.375  111.385 -38.545  1.00 194.02 ?  39  DC  F C4    1 
ATOM   6824 N  N4    . DC  E 2 39  ? 27.565  111.431 -39.153  1.00 195.04 ?  39  DC  F N4    1 
ATOM   6825 C  C5    . DC  E 2 39  ? 25.172  111.319 -39.319  1.00 192.09 ?  39  DC  F C5    1 
ATOM   6826 C  C6    . DC  E 2 39  ? 24.009  111.309 -38.646  1.00 191.98 ?  39  DC  F C6    1 
ATOM   6827 P  P     . DG  E 2 40  ? 18.870  112.410 -34.175  1.00 196.03 ?  40  DG  F P     1 
ATOM   6828 O  OP1   . DG  E 2 40  ? 18.606  111.297 -33.231  1.00 191.57 ?  40  DG  F OP1   1 
ATOM   6829 O  OP2   . DG  E 2 40  ? 17.842  112.779 -35.178  1.00 197.64 ?  40  DG  F OP2   1 
ATOM   6830 O  "O5'" . DG  E 2 40  ? 19.227  113.749 -33.368  1.00 199.80 ?  40  DG  F "O5'" 1 
ATOM   6831 C  "C5'" . DG  E 2 40  ? 20.133  113.766 -32.258  1.00 199.09 ?  40  DG  F "C5'" 1 
ATOM   6832 C  "C4'" . DG  E 2 40  ? 21.305  114.725 -32.433  1.00 201.07 ?  40  DG  F "C4'" 1 
ATOM   6833 O  "O4'" . DG  E 2 40  ? 22.270  114.212 -33.379  1.00 200.38 ?  40  DG  F "O4'" 1 
ATOM   6834 C  "C3'" . DG  E 2 40  ? 21.016  116.127 -32.946  1.00 200.85 ?  40  DG  F "C3'" 1 
ATOM   6835 O  "O3'" . DG  E 2 40  ? 20.526  116.938 -31.888  1.00 201.20 ?  40  DG  F "O3'" 1 
ATOM   6836 C  "C2'" . DG  E 2 40  ? 22.398  116.584 -33.414  1.00 200.16 ?  40  DG  F "C2'" 1 
ATOM   6837 C  "C1'" . DG  E 2 40  ? 23.124  115.277 -33.753  1.00 199.70 ?  40  DG  F "C1'" 1 
ATOM   6838 N  N9    . DG  E 2 40  ? 23.489  115.120 -35.164  1.00 198.67 ?  40  DG  F N9    1 
ATOM   6839 C  C8    . DG  E 2 40  ? 22.620  115.112 -36.231  1.00 198.30 ?  40  DG  F C8    1 
ATOM   6840 N  N7    . DG  E 2 40  ? 23.199  114.946 -37.387  1.00 197.71 ?  40  DG  F N7    1 
ATOM   6841 C  C5    . DG  E 2 40  ? 24.546  114.822 -37.077  1.00 197.61 ?  40  DG  F C5    1 
ATOM   6842 C  C6    . DG  E 2 40  ? 25.666  114.631 -37.936  1.00 196.72 ?  40  DG  F C6    1 
ATOM   6843 O  O6    . DG  E 2 40  ? 25.668  114.518 -39.171  1.00 195.14 ?  40  DG  F O6    1 
ATOM   6844 N  N1    . DG  E 2 40  ? 26.876  114.557 -37.233  1.00 197.01 ?  40  DG  F N1    1 
ATOM   6845 C  C2    . DG  E 2 40  ? 26.988  114.671 -35.860  1.00 197.44 ?  40  DG  F C2    1 
ATOM   6846 N  N2    . DG  E 2 40  ? 28.229  114.592 -35.354  1.00 197.38 ?  40  DG  F N2    1 
ATOM   6847 N  N3    . DG  E 2 40  ? 25.943  114.856 -35.046  1.00 197.91 ?  40  DG  F N3    1 
ATOM   6848 C  C4    . DG  E 2 40  ? 24.749  114.926 -35.710  1.00 198.09 ?  40  DG  F C4    1 
ATOM   6849 O  "O5'" . DC  F 3 1   ? 38.277  117.033 -36.866  1.00 188.40 ?  1   DC  G "O5'" 1 
ATOM   6850 C  "C5'" . DC  F 3 1   ? 37.178  116.383 -37.491  1.00 188.19 ?  1   DC  G "C5'" 1 
ATOM   6851 C  "C4'" . DC  F 3 1   ? 36.177  115.911 -36.451  1.00 188.32 ?  1   DC  G "C4'" 1 
ATOM   6852 O  "O4'" . DC  F 3 1   ? 34.825  116.001 -36.970  1.00 188.18 ?  1   DC  G "O4'" 1 
ATOM   6853 C  "C3'" . DC  F 3 1   ? 36.359  114.484 -35.931  1.00 188.74 ?  1   DC  G "C3'" 1 
ATOM   6854 O  "O3'" . DC  F 3 1   ? 36.423  114.517 -34.494  1.00 190.07 ?  1   DC  G "O3'" 1 
ATOM   6855 C  "C2'" . DC  F 3 1   ? 35.121  113.735 -36.439  1.00 188.11 ?  1   DC  G "C2'" 1 
ATOM   6856 C  "C1'" . DC  F 3 1   ? 34.101  114.866 -36.532  1.00 188.05 ?  1   DC  G "C1'" 1 
ATOM   6857 N  N1    . DC  F 3 1   ? 32.863  114.647 -37.383  1.00 187.90 ?  1   DC  G N1    1 
ATOM   6858 C  C2    . DC  F 3 1   ? 31.586  114.515 -36.780  1.00 187.20 ?  1   DC  G C2    1 
ATOM   6859 O  O2    . DC  F 3 1   ? 31.452  114.532 -35.547  1.00 186.69 ?  1   DC  G O2    1 
ATOM   6860 N  N3    . DC  F 3 1   ? 30.495  114.361 -37.586  1.00 185.01 ?  1   DC  G N3    1 
ATOM   6861 C  C4    . DC  F 3 1   ? 30.630  114.341 -38.922  1.00 185.07 ?  1   DC  G C4    1 
ATOM   6862 N  N4    . DC  F 3 1   ? 29.527  114.179 -39.660  1.00 182.91 ?  1   DC  G N4    1 
ATOM   6863 C  C5    . DC  F 3 1   ? 31.906  114.485 -39.555  1.00 187.47 ?  1   DC  G C5    1 
ATOM   6864 C  C6    . DC  F 3 1   ? 32.976  114.640 -38.757  1.00 187.75 ?  1   DC  G C6    1 
ATOM   6865 P  P     . DG  F 3 2   ? 37.055  113.393 -33.534  1.00 191.23 ?  2   DG  G P     1 
ATOM   6866 O  OP1   . DG  F 3 2   ? 38.094  114.065 -32.714  1.00 191.02 ?  2   DG  G OP1   1 
ATOM   6867 O  OP2   . DG  F 3 2   ? 37.407  112.183 -34.321  1.00 190.88 ?  2   DG  G OP2   1 
ATOM   6868 O  "O5'" . DG  F 3 2   ? 35.815  112.984 -32.601  1.00 192.56 ?  2   DG  G "O5'" 1 
ATOM   6869 C  "C5'" . DG  F 3 2   ? 35.246  113.812 -31.575  1.00 193.90 ?  2   DG  G "C5'" 1 
ATOM   6870 C  "C4'" . DG  F 3 2   ? 33.976  113.188 -31.002  1.00 195.12 ?  2   DG  G "C4'" 1 
ATOM   6871 O  "O4'" . DG  F 3 2   ? 32.957  113.093 -32.028  1.00 194.89 ?  2   DG  G "O4'" 1 
ATOM   6872 C  "C3'" . DG  F 3 2   ? 34.099  111.792 -30.390  1.00 193.88 ?  2   DG  G "C3'" 1 
ATOM   6873 O  "O3'" . DG  F 3 2   ? 33.423  111.737 -29.131  1.00 195.68 ?  2   DG  G "O3'" 1 
ATOM   6874 C  "C2'" . DG  F 3 2   ? 33.456  110.854 -31.412  1.00 188.28 ?  2   DG  G "C2'" 1 
ATOM   6875 C  "C1'" . DG  F 3 2   ? 32.461  111.768 -32.122  1.00 189.67 ?  2   DG  G "C1'" 1 
ATOM   6876 N  N9    . DG  F 3 2   ? 32.232  111.500 -33.544  1.00 187.49 ?  2   DG  G N9    1 
ATOM   6877 C  C8    . DG  F 3 2   ? 33.183  111.365 -34.530  1.00 187.83 ?  2   DG  G C8    1 
ATOM   6878 N  N7    . DG  F 3 2   ? 32.687  111.206 -35.725  1.00 185.74 ?  2   DG  G N7    1 
ATOM   6879 C  C5    . DG  F 3 2   ? 31.313  111.269 -35.534  1.00 183.88 ?  2   DG  G C5    1 
ATOM   6880 C  C6    . DG  F 3 2   ? 30.247  111.169 -36.472  1.00 183.50 ?  2   DG  G C6    1 
ATOM   6881 O  O6    . DG  F 3 2   ? 30.323  110.992 -37.697  1.00 183.79 ?  2   DG  G O6    1 
ATOM   6882 N  N1    . DG  F 3 2   ? 28.988  111.288 -35.868  1.00 183.50 ?  2   DG  G N1    1 
ATOM   6883 C  C2    . DG  F 3 2   ? 28.789  111.484 -34.515  1.00 183.31 ?  2   DG  G C2    1 
ATOM   6884 N  N2    . DG  F 3 2   ? 27.519  111.577 -34.099  1.00 183.29 ?  2   DG  G N2    1 
ATOM   6885 N  N3    . DG  F 3 2   ? 29.780  111.582 -33.628  1.00 183.34 ?  2   DG  G N3    1 
ATOM   6886 C  C4    . DG  F 3 2   ? 31.015  111.465 -34.196  1.00 184.80 ?  2   DG  G C4    1 
ATOM   6887 P  P     . DG  F 3 3   ? 33.887  110.803 -27.912  1.00 194.98 ?  3   DG  G P     1 
ATOM   6888 O  OP1   . DG  F 3 3   ? 34.001  111.682 -26.721  1.00 198.55 ?  3   DG  G OP1   1 
ATOM   6889 O  OP2   . DG  F 3 3   ? 35.046  109.969 -28.318  1.00 193.37 ?  3   DG  G OP2   1 
ATOM   6890 O  "O5'" . DG  F 3 3   ? 32.656  109.793 -27.741  1.00 191.25 ?  3   DG  G "O5'" 1 
ATOM   6891 C  "C5'" . DG  F 3 3   ? 31.401  110.130 -27.143  1.00 192.58 ?  3   DG  G "C5'" 1 
ATOM   6892 C  "C4'" . DG  F 3 3   ? 30.330  109.135 -27.559  1.00 189.41 ?  3   DG  G "C4'" 1 
ATOM   6893 O  "O4'" . DG  F 3 3   ? 30.192  109.210 -29.001  1.00 189.18 ?  3   DG  G "O4'" 1 
ATOM   6894 C  "C3'" . DG  F 3 3   ? 30.638  107.670 -27.238  1.00 186.87 ?  3   DG  G "C3'" 1 
ATOM   6895 O  "O3'" . DG  F 3 3   ? 29.821  107.100 -26.183  1.00 188.30 ?  3   DG  G "O3'" 1 
ATOM   6896 C  "C2'" . DG  F 3 3   ? 30.653  106.938 -28.581  1.00 187.43 ?  3   DG  G "C2'" 1 
ATOM   6897 C  "C1'" . DG  F 3 3   ? 29.966  107.920 -29.531  1.00 187.23 ?  3   DG  G "C1'" 1 
ATOM   6898 N  N9    . DG  F 3 3   ? 30.398  107.898 -30.937  1.00 187.27 ?  3   DG  G N9    1 
ATOM   6899 C  C8    . DG  F 3 3   ? 31.685  107.775 -31.413  1.00 186.77 ?  3   DG  G C8    1 
ATOM   6900 N  N7    . DG  F 3 3   ? 31.780  107.808 -32.714  1.00 186.69 ?  3   DG  G N7    1 
ATOM   6901 C  C5    . DG  F 3 3   ? 30.470  107.964 -33.147  1.00 187.19 ?  3   DG  G C5    1 
ATOM   6902 C  C6    . DG  F 3 3   ? 29.943  108.057 -34.469  1.00 187.36 ?  3   DG  G C6    1 
ATOM   6903 O  O6    . DG  F 3 3   ? 30.561  108.038 -35.543  1.00 186.98 ?  3   DG  G O6    1 
ATOM   6904 N  N1    . DG  F 3 3   ? 28.552  108.211 -34.483  1.00 187.93 ?  3   DG  G N1    1 
ATOM   6905 C  C2    . DG  F 3 3   ? 27.767  108.297 -33.349  1.00 188.18 ?  3   DG  G C2    1 
ATOM   6906 N  N2    . DG  F 3 3   ? 26.446  108.417 -33.552  1.00 188.51 ?  3   DG  G N2    1 
ATOM   6907 N  N3    . DG  F 3 3   ? 28.245  108.180 -32.106  1.00 188.04 ?  3   DG  G N3    1 
ATOM   6908 C  C4    . DG  F 3 3   ? 29.604  108.028 -32.066  1.00 187.57 ?  3   DG  G C4    1 
ATOM   6909 P  P     . DA  F 3 4   ? 28.351  106.436 -26.180  1.00 189.64 ?  4   DA  G P     1 
ATOM   6910 O  OP1   . DA  F 3 4   ? 27.808  106.618 -24.812  1.00 189.24 ?  4   DA  G OP1   1 
ATOM   6911 O  OP2   . DA  F 3 4   ? 28.455  105.063 -26.728  1.00 189.50 ?  4   DA  G OP2   1 
ATOM   6912 O  "O5'" . DA  F 3 4   ? 27.508  107.338 -27.203  1.00 190.04 ?  4   DA  G "O5'" 1 
ATOM   6913 C  "C5'" . DA  F 3 4   ? 26.096  107.538 -27.105  1.00 191.02 ?  4   DA  G "C5'" 1 
ATOM   6914 C  "C4'" . DA  F 3 4   ? 25.327  106.679 -28.093  1.00 189.30 ?  4   DA  G "C4'" 1 
ATOM   6915 O  "O4'" . DA  F 3 4   ? 26.055  106.519 -29.336  1.00 188.09 ?  4   DA  G "O4'" 1 
ATOM   6916 C  "C3'" . DA  F 3 4   ? 24.926  105.292 -27.610  1.00 186.01 ?  4   DA  G "C3'" 1 
ATOM   6917 O  "O3'" . DA  F 3 4   ? 23.499  105.212 -27.717  1.00 185.38 ?  4   DA  G "O3'" 1 
ATOM   6918 C  "C2'" . DA  F 3 4   ? 25.683  104.332 -28.532  1.00 183.99 ?  4   DA  G "C2'" 1 
ATOM   6919 C  "C1'" . DA  F 3 4   ? 26.010  105.175 -29.764  1.00 184.45 ?  4   DA  G "C1'" 1 
ATOM   6920 N  N9    . DA  F 3 4   ? 27.282  104.875 -30.433  1.00 183.15 ?  4   DA  G N9    1 
ATOM   6921 C  C8    . DA  F 3 4   ? 28.474  104.544 -29.844  1.00 182.88 ?  4   DA  G C8    1 
ATOM   6922 N  N7    . DA  F 3 4   ? 29.473  104.379 -30.678  1.00 182.45 ?  4   DA  G N7    1 
ATOM   6923 C  C5    . DA  F 3 4   ? 28.904  104.620 -31.914  1.00 182.16 ?  4   DA  G C5    1 
ATOM   6924 C  C6    . DA  F 3 4   ? 29.434  104.599 -33.228  1.00 181.92 ?  4   DA  G C6    1 
ATOM   6925 N  N6    . DA  F 3 4   ? 30.710  104.303 -33.499  1.00 182.14 ?  4   DA  G N6    1 
ATOM   6926 N  N1    . DA  F 3 4   ? 28.591  104.869 -34.259  1.00 181.61 ?  4   DA  G N1    1 
ATOM   6927 C  C2    . DA  F 3 4   ? 27.299  105.139 -33.994  1.00 181.65 ?  4   DA  G C2    1 
ATOM   6928 N  N3    . DA  F 3 4   ? 26.697  105.211 -32.799  1.00 182.00 ?  4   DA  G N3    1 
ATOM   6929 C  C4    . DA  F 3 4   ? 27.552  104.930 -31.787  1.00 182.37 ?  4   DA  G C4    1 
ATOM   6930 P  P     . DA  F 3 5   ? 22.528  103.936 -27.592  1.00 183.82 ?  5   DA  G P     1 
ATOM   6931 O  OP1   . DA  F 3 5   ? 21.203  104.453 -27.175  1.00 184.56 ?  5   DA  G OP1   1 
ATOM   6932 O  OP2   . DA  F 3 5   ? 23.177  102.865 -26.796  1.00 183.08 ?  5   DA  G OP2   1 
ATOM   6933 O  "O5'" . DA  F 3 5   ? 22.438  103.404 -29.101  1.00 182.24 ?  5   DA  G "O5'" 1 
ATOM   6934 C  "C5'" . DA  F 3 5   ? 21.983  104.238 -30.175  1.00 182.37 ?  5   DA  G "C5'" 1 
ATOM   6935 C  "C4'" . DA  F 3 5   ? 22.277  103.625 -31.536  1.00 180.40 ?  5   DA  G "C4'" 1 
ATOM   6936 O  "O4'" . DA  F 3 5   ? 23.706  103.552 -31.768  1.00 180.02 ?  5   DA  G "O4'" 1 
ATOM   6937 C  "C3'" . DA  F 3 5   ? 21.725  102.223 -31.775  1.00 178.02 ?  5   DA  G "C3'" 1 
ATOM   6938 O  "O3'" . DA  F 3 5   ? 20.865  102.245 -32.915  1.00 177.78 ?  5   DA  G "O3'" 1 
ATOM   6939 C  "C2'" . DA  F 3 5   ? 22.966  101.354 -31.986  1.00 176.62 ?  5   DA  G "C2'" 1 
ATOM   6940 C  "C1'" . DA  F 3 5   ? 23.985  102.370 -32.487  1.00 177.61 ?  5   DA  G "C1'" 1 
ATOM   6941 N  N9    . DA  F 3 5   ? 25.391  102.010 -32.290  1.00 176.62 ?  5   DA  G N9    1 
ATOM   6942 C  C8    . DA  F 3 5   ? 26.030  101.815 -31.094  1.00 176.67 ?  5   DA  G C8    1 
ATOM   6943 N  N7    . DA  F 3 5   ? 27.304  101.525 -31.203  1.00 176.46 ?  5   DA  G N7    1 
ATOM   6944 C  C5    . DA  F 3 5   ? 27.529  101.559 -32.568  1.00 176.00 ?  5   DA  G C5    1 
ATOM   6945 C  C6    . DA  F 3 5   ? 28.689  101.334 -33.348  1.00 175.79 ?  5   DA  G C6    1 
ATOM   6946 N  N6    . DA  F 3 5   ? 29.877  101.047 -32.808  1.00 176.06 ?  5   DA  G N6    1 
ATOM   6947 N  N1    . DA  F 3 5   ? 28.589  101.449 -34.698  1.00 175.53 ?  5   DA  G N1    1 
ATOM   6948 C  C2    . DA  F 3 5   ? 27.398  101.765 -35.237  1.00 175.39 ?  5   DA  G C2    1 
ATOM   6949 N  N3    . DA  F 3 5   ? 26.234  101.972 -34.604  1.00 175.45 ?  5   DA  G N3    1 
ATOM   6950 C  C4    . DA  F 3 5   ? 26.364  101.862 -33.260  1.00 175.92 ?  5   DA  G C4    1 
ATOM   6951 P  P     . DT  F 3 6   ? 19.913  101.031 -33.359  1.00 176.28 ?  6   DT  G P     1 
ATOM   6952 O  OP1   . DT  F 3 6   ? 18.719  101.626 -34.006  1.00 176.87 ?  6   DT  G OP1   1 
ATOM   6953 O  OP2   . DT  F 3 6   ? 19.731  100.103 -32.217  1.00 175.20 ?  6   DT  G OP2   1 
ATOM   6954 O  "O5'" . DT  F 3 6   ? 20.775  100.251 -34.461  1.00 174.75 ?  6   DT  G "O5'" 1 
ATOM   6955 C  "C5'" . DT  F 3 6   ? 21.219  100.901 -35.651  1.00 175.23 ?  6   DT  G "C5'" 1 
ATOM   6956 C  "C4'" . DT  F 3 6   ? 22.387  100.176 -36.293  1.00 173.82 ?  6   DT  G "C4'" 1 
ATOM   6957 O  "O4'" . DT  F 3 6   ? 23.528  100.113 -35.406  1.00 173.87 ?  6   DT  G "O4'" 1 
ATOM   6958 C  "C3'" . DT  F 3 6   ? 22.118  98.742  -36.728  1.00 171.57 ?  6   DT  G "C3'" 1 
ATOM   6959 O  "O3'" . DT  F 3 6   ? 22.036  98.716  -38.150  1.00 171.71 ?  6   DT  G "O3'" 1 
ATOM   6960 C  "C2'" . DT  F 3 6   ? 23.298  97.933  -36.181  1.00 170.64 ?  6   DT  G "C2'" 1 
ATOM   6961 C  "C1'" . DT  F 3 6   ? 24.311  99.016  -35.825  1.00 171.93 ?  6   DT  G "C1'" 1 
ATOM   6962 N  N1    . DT  F 3 6   ? 25.387  98.693  -34.800  1.00 171.08 ?  6   DT  G N1    1 
ATOM   6963 C  C2    . DT  F 3 6   ? 26.710  98.502  -35.206  1.00 170.71 ?  6   DT  G C2    1 
ATOM   6964 O  O2    . DT  F 3 6   ? 27.101  98.546  -36.363  1.00 170.56 ?  6   DT  G O2    1 
ATOM   6965 N  N3    . DT  F 3 6   ? 27.604  98.279  -34.177  1.00 170.68 ?  6   DT  G N3    1 
ATOM   6966 C  C4    . DT  F 3 6   ? 27.326  98.201  -32.818  1.00 170.62 ?  6   DT  G C4    1 
ATOM   6967 O  O4    . DT  F 3 6   ? 28.252  97.983  -32.037  1.00 170.75 ?  6   DT  G O4    1 
ATOM   6968 C  C5    . DT  F 3 6   ? 25.935  98.424  -32.458  1.00 170.64 ?  6   DT  G C5    1 
ATOM   6969 C  C7    . DT  F 3 6   ? 25.481  98.370  -31.027  1.00 170.79 ?  6   DT  G C7    1 
ATOM   6970 C  C6    . DT  F 3 6   ? 25.054  98.657  -33.449  1.00 170.74 ?  6   DT  G C6    1 
ATOM   6971 P  P     . DT  F 3 7   ? 21.326  97.548  -38.989  1.00 170.29 ?  7   DT  G P     1 
ATOM   6972 O  OP1   . DT  F 3 7   ? 20.567  98.173  -40.097  1.00 170.76 ?  7   DT  G OP1   1 
ATOM   6973 O  OP2   . DT  F 3 7   ? 20.631  96.639  -38.050  1.00 168.34 ?  7   DT  G OP2   1 
ATOM   6974 O  "O5'" . DT  F 3 7   ? 22.578  96.750  -39.584  1.00 169.48 ?  7   DT  G "O5'" 1 
ATOM   6975 C  "C5'" . DT  F 3 7   ? 23.533  97.324  -40.477  1.00 171.06 ?  7   DT  G "C5'" 1 
ATOM   6976 C  "C4'" . DT  F 3 7   ? 24.825  96.526  -40.477  1.00 170.83 ?  7   DT  G "C4'" 1 
ATOM   6977 O  "O4'" . DT  F 3 7   ? 25.455  96.631  -39.178  1.00 170.96 ?  7   DT  G "O4'" 1 
ATOM   6978 C  "C3'" . DT  F 3 7   ? 24.660  95.031  -40.726  1.00 166.90 ?  7   DT  G "C3'" 1 
ATOM   6979 O  "O3'" . DT  F 3 7   ? 24.882  94.684  -42.111  1.00 167.67 ?  7   DT  G "O3'" 1 
ATOM   6980 C  "C2'" . DT  F 3 7   ? 25.489  94.335  -39.641  1.00 163.58 ?  7   DT  G "C2'" 1 
ATOM   6981 C  "C1'" . DT  F 3 7   ? 26.263  95.490  -39.004  1.00 169.02 ?  7   DT  G "C1'" 1 
ATOM   6982 N  N1    . DT  F 3 7   ? 26.679  95.342  -37.551  1.00 167.83 ?  7   DT  G N1    1 
ATOM   6983 C  C2    . DT  F 3 7   ? 28.033  95.298  -37.219  1.00 168.97 ?  7   DT  G C2    1 
ATOM   6984 O  O2    . DT  F 3 7   ? 28.950  95.328  -38.024  1.00 168.94 ?  7   DT  G O2    1 
ATOM   6985 N  N3    . DT  F 3 7   ? 28.294  95.163  -35.872  1.00 168.90 ?  7   DT  G N3    1 
ATOM   6986 C  C4    . DT  F 3 7   ? 27.372  95.090  -34.837  1.00 167.25 ?  7   DT  G C4    1 
ATOM   6987 O  O4    . DT  F 3 7   ? 27.787  94.980  -33.685  1.00 167.65 ?  7   DT  G O4    1 
ATOM   6988 C  C5    . DT  F 3 7   ? 25.979  95.163  -35.239  1.00 165.57 ?  7   DT  G C5    1 
ATOM   6989 C  C7    . DT  F 3 7   ? 24.876  95.097  -34.220  1.00 164.00 ?  7   DT  G C7    1 
ATOM   6990 C  C6    . DT  F 3 7   ? 25.708  95.282  -36.554  1.00 165.87 ?  7   DT  G C6    1 
ATOM   6991 P  P     . DA  F 3 8   ? 26.112  93.970  -42.862  1.00 168.05 ?  8   DA  G P     1 
ATOM   6992 O  OP1   . DA  F 3 8   ? 25.972  94.301  -44.299  1.00 169.96 ?  8   DA  G OP1   1 
ATOM   6993 O  OP2   . DA  F 3 8   ? 26.131  92.543  -42.456  1.00 161.51 ?  8   DA  G OP2   1 
ATOM   6994 O  "O5'" . DA  F 3 8   ? 27.416  94.704  -42.269  1.00 173.48 ?  8   DA  G "O5'" 1 
ATOM   6995 C  "C5'" . DA  F 3 8   ? 28.704  94.725  -42.904  1.00 175.21 ?  8   DA  G "C5'" 1 
ATOM   6996 C  "C4'" . DA  F 3 8   ? 29.673  93.691  -42.344  1.00 175.19 ?  8   DA  G "C4'" 1 
ATOM   6997 O  "O4'" . DA  F 3 8   ? 29.646  93.685  -40.894  1.00 175.34 ?  8   DA  G "O4'" 1 
ATOM   6998 C  "C3'" . DA  F 3 8   ? 29.446  92.247  -42.792  1.00 171.20 ?  8   DA  G "C3'" 1 
ATOM   6999 O  "O3'" . DA  F 3 8   ? 30.486  91.825  -43.708  1.00 173.73 ?  8   DA  G "O3'" 1 
ATOM   7000 C  "C2'" . DA  F 3 8   ? 29.258  91.449  -41.497  1.00 166.18 ?  8   DA  G "C2'" 1 
ATOM   7001 C  "C1'" . DA  F 3 8   ? 29.901  92.366  -40.457  1.00 170.28 ?  8   DA  G "C1'" 1 
ATOM   7002 N  N9    . DA  F 3 8   ? 29.439  92.202  -39.076  1.00 167.62 ?  8   DA  G N9    1 
ATOM   7003 C  C8    . DA  F 3 8   ? 28.145  92.212  -38.628  1.00 165.12 ?  8   DA  G C8    1 
ATOM   7004 N  N7    . DA  F 3 8   ? 28.019  92.053  -37.333  1.00 164.30 ?  8   DA  G N7    1 
ATOM   7005 C  C5    . DA  F 3 8   ? 29.323  91.929  -36.890  1.00 165.90 ?  8   DA  G C5    1 
ATOM   7006 C  C6    . DA  F 3 8   ? 29.880  91.738  -35.601  1.00 165.87 ?  8   DA  G C6    1 
ATOM   7007 N  N6    . DA  F 3 8   ? 29.134  91.613  -34.497  1.00 163.93 ?  8   DA  G N6    1 
ATOM   7008 N  N1    . DA  F 3 8   ? 31.231  91.630  -35.498  1.00 167.88 ?  8   DA  G N1    1 
ATOM   7009 C  C2    . DA  F 3 8   ? 31.979  91.715  -36.614  1.00 169.43 ?  8   DA  G C2    1 
ATOM   7010 N  N3    . DA  F 3 8   ? 31.567  91.929  -37.870  1.00 169.61 ?  8   DA  G N3    1 
ATOM   7011 C  C4    . DA  F 3 8   ? 30.218  92.015  -37.950  1.00 167.83 ?  8   DA  G C4    1 
ATOM   7012 P  P     . DA  F 3 9   ? 31.664  90.728  -43.615  1.00 173.04 ?  9   DA  G P     1 
ATOM   7013 O  OP1   . DA  F 3 9   ? 32.474  90.905  -44.847  1.00 176.08 ?  9   DA  G OP1   1 
ATOM   7014 O  OP2   . DA  F 3 9   ? 31.051  89.402  -43.317  1.00 166.04 ?  9   DA  G OP2   1 
ATOM   7015 O  "O5'" . DA  F 3 9   ? 32.550  91.207  -42.356  1.00 177.29 ?  9   DA  G "O5'" 1 
ATOM   7016 C  "C5'" . DA  F 3 9   ? 33.957  90.929  -42.179  1.00 179.45 ?  9   DA  G "C5'" 1 
ATOM   7017 C  "C4'" . DA  F 3 9   ? 34.236  89.718  -41.293  1.00 175.50 ?  9   DA  G "C4'" 1 
ATOM   7018 O  "O4'" . DA  F 3 9   ? 33.419  89.778  -40.095  1.00 173.48 ?  9   DA  G "O4'" 1 
ATOM   7019 C  "C3'" . DA  F 3 9   ? 33.979  88.353  -41.935  1.00 170.30 ?  9   DA  G "C3'" 1 
ATOM   7020 O  "O3'" . DA  F 3 9   ? 35.206  87.673  -42.331  1.00 171.85 ?  9   DA  G "O3'" 1 
ATOM   7021 C  "C2'" . DA  F 3 9   ? 33.011  87.616  -41.005  1.00 164.48 ?  9   DA  G "C2'" 1 
ATOM   7022 C  "C1'" . DA  F 3 9   ? 32.998  88.476  -39.741  1.00 167.06 ?  9   DA  G "C1'" 1 
ATOM   7023 N  N9    . DA  F 3 9   ? 31.714  88.534  -39.032  1.00 163.74 ?  9   DA  G N9    1 
ATOM   7024 C  C8    . DA  F 3 9   ? 30.458  88.623  -39.577  1.00 161.25 ?  9   DA  G C8    1 
ATOM   7025 N  N7    . DA  F 3 9   ? 29.484  88.633  -38.698  1.00 159.56 ?  9   DA  G N7    1 
ATOM   7026 C  C5    . DA  F 3 9   ? 30.142  88.543  -37.483  1.00 160.57 ?  9   DA  G C5    1 
ATOM   7027 C  C6    . DA  F 3 9   ? 29.678  88.504  -36.145  1.00 159.51 ?  9   DA  G C6    1 
ATOM   7028 N  N6    . DA  F 3 9   ? 28.381  88.565  -35.824  1.00 157.15 ?  9   DA  G N6    1 
ATOM   7029 N  N1    . DA  F 3 9   ? 30.599  88.435  -35.146  1.00 161.33 ?  9   DA  G N1    1 
ATOM   7030 C  C2    . DA  F 3 9   ? 31.907  88.375  -35.466  1.00 163.56 ?  9   DA  G C2    1 
ATOM   7031 N  N3    . DA  F 3 9   ? 32.457  88.396  -36.689  1.00 164.60 ?  9   DA  G N3    1 
ATOM   7032 C  C4    . DA  F 3 9   ? 31.519  88.474  -37.666  1.00 163.06 ?  9   DA  G C4    1 
ATOM   7033 P  P     . DG  F 3 10  ? 35.981  86.385  -41.746  1.00 169.37 ?  10  DG  G P     1 
ATOM   7034 O  OP1   . DG  F 3 10  ? 37.295  86.340  -42.436  1.00 173.03 ?  10  DG  G OP1   1 
ATOM   7035 O  OP2   . DG  F 3 10  ? 35.078  85.206  -41.828  1.00 162.74 ?  10  DG  G OP2   1 
ATOM   7036 O  "O5'" . DG  F 3 10  ? 36.210  86.783  -40.203  1.00 170.76 ?  10  DG  G "O5'" 1 
ATOM   7037 C  "C5'" . DG  F 3 10  ? 37.246  86.251  -39.360  1.00 170.77 ?  10  DG  G "C5'" 1 
ATOM   7038 C  "C4'" . DG  F 3 10  ? 36.745  85.162  -38.421  1.00 164.72 ?  10  DG  G "C4'" 1 
ATOM   7039 O  "O4'" . DG  F 3 10  ? 35.502  85.581  -37.800  1.00 162.18 ?  10  DG  G "O4'" 1 
ATOM   7040 C  "C3'" . DG  F 3 10  ? 36.456  83.814  -39.078  1.00 159.24 ?  10  DG  G "C3'" 1 
ATOM   7041 O  "O3'" . DG  F 3 10  ? 37.509  82.843  -38.854  1.00 159.43 ?  10  DG  G "O3'" 1 
ATOM   7042 C  "C2'" . DG  F 3 10  ? 35.039  83.437  -38.640  1.00 153.62 ?  10  DG  G "C2'" 1 
ATOM   7043 C  "C1'" . DG  F 3 10  ? 34.759  84.422  -37.507  1.00 155.36 ?  10  DG  G "C1'" 1 
ATOM   7044 N  N9    . DG  F 3 10  ? 33.345  84.741  -37.292  1.00 151.60 ?  10  DG  G N9    1 
ATOM   7045 C  C8    . DG  F 3 10  ? 32.364  84.916  -38.246  1.00 149.46 ?  10  DG  G C8    1 
ATOM   7046 N  N7    . DG  F 3 10  ? 31.173  85.117  -37.755  1.00 147.59 ?  10  DG  G N7    1 
ATOM   7047 C  C5    . DG  F 3 10  ? 31.367  85.070  -36.382  1.00 147.78 ?  10  DG  G C5    1 
ATOM   7048 C  C6    . DG  F 3 10  ? 30.437  85.239  -35.322  1.00 146.33 ?  10  DG  G C6    1 
ATOM   7049 O  O6    . DG  F 3 10  ? 29.221  85.459  -35.404  1.00 144.68 ?  10  DG  G O6    1 
ATOM   7050 N  N1    . DG  F 3 10  ? 31.038  85.130  -34.063  1.00 147.44 ?  10  DG  G N1    1 
ATOM   7051 C  C2    . DG  F 3 10  ? 32.379  84.877  -33.858  1.00 149.43 ?  10  DG  G C2    1 
ATOM   7052 N  N2    . DG  F 3 10  ? 32.782  84.793  -32.584  1.00 150.81 ?  10  DG  G N2    1 
ATOM   7053 N  N3    . DG  F 3 10  ? 33.263  84.724  -34.842  1.00 150.56 ?  10  DG  G N3    1 
ATOM   7054 C  C4    . DG  F 3 10  ? 32.697  84.835  -36.077  1.00 149.91 ?  10  DG  G C4    1 
ATOM   7055 P  P     . DA  F 3 11  ? 37.621  81.582  -37.857  1.00 156.20 ?  11  DA  G P     1 
ATOM   7056 O  OP1   . DA  F 3 11  ? 39.046  81.170  -37.868  1.00 159.05 ?  11  DA  G OP1   1 
ATOM   7057 O  OP2   . DA  F 3 11  ? 36.583  80.583  -38.222  1.00 150.05 ?  11  DA  G OP2   1 
ATOM   7058 O  "O5'" . DA  F 3 11  ? 37.276  82.229  -36.425  1.00 157.31 ?  11  DA  G "O5'" 1 
ATOM   7059 C  "C5'" . DA  F 3 11  ? 37.710  81.686  -35.170  1.00 156.66 ?  11  DA  G "C5'" 1 
ATOM   7060 C  "C4'" . DA  F 3 11  ? 36.610  80.926  -34.440  1.00 150.81 ?  11  DA  G "C4'" 1 
ATOM   7061 O  "O4'" . DA  F 3 11  ? 35.336  81.617  -34.556  1.00 149.02 ?  11  DA  G "O4'" 1 
ATOM   7062 C  "C3'" . DA  F 3 11  ? 36.376  79.479  -34.886  1.00 145.44 ?  11  DA  G "C3'" 1 
ATOM   7063 O  "O3'" . DA  F 3 11  ? 36.527  78.570  -33.777  1.00 143.61 ?  11  DA  G "O3'" 1 
ATOM   7064 C  "C2'" . DA  F 3 11  ? 34.941  79.497  -35.410  1.00 141.57 ?  11  DA  G "C2'" 1 
ATOM   7065 C  "C1'" . DA  F 3 11  ? 34.339  80.625  -34.586  1.00 143.29 ?  11  DA  G "C1'" 1 
ATOM   7066 N  N9    . DA  F 3 11  ? 33.045  81.117  -35.064  1.00 140.74 ?  11  DA  G N9    1 
ATOM   7067 C  C8    . DA  F 3 11  ? 32.622  81.271  -36.362  1.00 139.38 ?  11  DA  G C8    1 
ATOM   7068 N  N7    . DA  F 3 11  ? 31.373  81.650  -36.484  1.00 137.63 ?  11  DA  G N7    1 
ATOM   7069 C  C5    . DA  F 3 11  ? 30.937  81.734  -35.173  1.00 137.56 ?  11  DA  G C5    1 
ATOM   7070 C  C6    . DA  F 3 11  ? 29.688  82.080  -34.604  1.00 136.52 ?  11  DA  G C6    1 
ATOM   7071 N  N6    . DA  F 3 11  ? 28.632  82.443  -35.343  1.00 135.44 ?  11  DA  G N6    1 
ATOM   7072 N  N1    . DA  F 3 11  ? 29.584  82.077  -33.248  1.00 137.03 ?  11  DA  G N1    1 
ATOM   7073 C  C2    . DA  F 3 11  ? 30.651  81.726  -32.506  1.00 138.30 ?  11  DA  G C2    1 
ATOM   7074 N  N3    . DA  F 3 11  ? 31.869  81.369  -32.930  1.00 139.33 ?  11  DA  G N3    1 
ATOM   7075 C  C4    . DA  F 3 11  ? 31.948  81.392  -34.282  1.00 139.11 ?  11  DA  G C4    1 
ATOM   7076 P  P     . DC  F 3 12  ? 36.432  76.958  -33.817  1.00 138.56 ?  12  DC  G P     1 
ATOM   7077 O  OP1   . DC  F 3 12  ? 37.607  76.468  -33.058  1.00 141.13 ?  12  DC  G OP1   1 
ATOM   7078 O  OP2   . DC  F 3 12  ? 36.188  76.453  -35.195  1.00 136.01 ?  12  DC  G OP2   1 
ATOM   7079 O  "O5'" . DC  F 3 12  ? 35.100  76.632  -32.991  1.00 133.35 ?  12  DC  G "O5'" 1 
ATOM   7080 C  "C5'" . DC  F 3 12  ? 34.952  76.984  -31.616  1.00 132.97 ?  12  DC  G "C5'" 1 
ATOM   7081 C  "C4'" . DC  F 3 12  ? 33.487  77.027  -31.225  1.00 128.26 ?  12  DC  G "C4'" 1 
ATOM   7082 O  "O4'" . DC  F 3 12  ? 32.770  77.920  -32.110  1.00 127.42 ?  12  DC  G "O4'" 1 
ATOM   7083 C  "C3'" . DC  F 3 12  ? 32.742  75.704  -31.342  1.00 122.55 ?  12  DC  G "C3'" 1 
ATOM   7084 O  "O3'" . DC  F 3 12  ? 32.801  74.994  -30.107  1.00 121.87 ?  12  DC  G "O3'" 1 
ATOM   7085 C  "C2'" . DC  F 3 12  ? 31.312  76.117  -31.681  1.00 119.82 ?  12  DC  G "C2'" 1 
ATOM   7086 C  "C1'" . DC  F 3 12  ? 31.399  77.606  -31.982  1.00 122.94 ?  12  DC  G "C1'" 1 
ATOM   7087 N  N1    . DC  F 3 12  ? 30.578  78.005  -33.180  1.00 120.27 ?  12  DC  G N1    1 
ATOM   7088 C  C2    . DC  F 3 12  ? 29.239  78.423  -32.998  1.00 118.30 ?  12  DC  G C2    1 
ATOM   7089 O  O2    . DC  F 3 12  ? 28.746  78.490  -31.863  1.00 117.98 ?  12  DC  G O2    1 
ATOM   7090 N  N3    . DC  F 3 12  ? 28.501  78.756  -34.094  1.00 117.17 ?  12  DC  G N3    1 
ATOM   7091 C  C4    . DC  F 3 12  ? 29.036  78.678  -35.321  1.00 117.28 ?  12  DC  G C4    1 
ATOM   7092 N  N4    . DC  F 3 12  ? 28.269  79.018  -36.361  1.00 116.55 ?  12  DC  G N4    1 
ATOM   7093 C  C5    . DC  F 3 12  ? 30.385  78.247  -35.533  1.00 118.55 ?  12  DC  G C5    1 
ATOM   7094 C  C6    . DC  F 3 12  ? 31.107  77.920  -34.448  1.00 119.89 ?  12  DC  G C6    1 
ATOM   7095 P  P     . DT  F 3 13  ? 32.454  73.430  -29.959  1.00 117.55 ?  13  DT  G P     1 
ATOM   7096 O  OP1   . DT  F 3 13  ? 33.046  72.984  -28.674  1.00 119.37 ?  13  DT  G OP1   1 
ATOM   7097 O  OP2   . DT  F 3 13  ? 32.799  72.719  -31.218  1.00 115.70 ?  13  DT  G OP2   1 
ATOM   7098 O  "O5'" . DT  F 3 13  ? 30.857  73.398  -29.821  1.00 113.00 ?  13  DT  G "O5'" 1 
ATOM   7099 C  "C5'" . DT  F 3 13  ? 30.174  74.059  -28.752  1.00 112.65 ?  13  DT  G "C5'" 1 
ATOM   7100 C  "C4'" . DT  F 3 13  ? 28.679  74.145  -29.008  1.00 108.46 ?  13  DT  G "C4'" 1 
ATOM   7101 O  "O4'" . DT  F 3 13  ? 28.399  74.989  -30.143  1.00 108.18 ?  13  DT  G "O4'" 1 
ATOM   7102 C  "C3'" . DT  F 3 13  ? 27.994  72.832  -29.338  1.00 103.45 ?  13  DT  G "C3'" 1 
ATOM   7103 O  "O3'" . DT  F 3 13  ? 27.595  72.233  -28.117  1.00 102.45 ?  13  DT  G "O3'" 1 
ATOM   7104 C  "C2'" . DT  F 3 13  ? 26.806  73.238  -30.208  1.00 101.39 ?  13  DT  G "C2'" 1 
ATOM   7105 C  "C1'" . DT  F 3 13  ? 27.116  74.664  -30.636  1.00 104.34 ?  13  DT  G "C1'" 1 
ATOM   7106 N  N1    . DT  F 3 13  ? 27.034  74.928  -32.112  1.00 103.09 ?  13  DT  G N1    1 
ATOM   7107 C  C2    . DT  F 3 13  ? 25.863  75.426  -32.669  1.00 102.10 ?  13  DT  G C2    1 
ATOM   7108 O  O2    . DT  F 3 13  ? 24.836  75.649  -32.049  1.00 101.67 ?  13  DT  G O2    1 
ATOM   7109 N  N3    . DT  F 3 13  ? 25.930  75.658  -34.026  1.00 101.98 ?  13  DT  G N3    1 
ATOM   7110 C  C4    . DT  F 3 13  ? 27.016  75.460  -34.869  1.00 102.57 ?  13  DT  G C4    1 
ATOM   7111 O  O4    . DT  F 3 13  ? 26.896  75.716  -36.066  1.00 102.32 ?  13  DT  G O4    1 
ATOM   7112 C  C5    . DT  F 3 13  ? 28.202  74.933  -34.226  1.00 103.72 ?  13  DT  G C5    1 
ATOM   7113 C  C7    . DT  F 3 13  ? 29.454  74.659  -35.009  1.00 105.13 ?  13  DT  G C7    1 
ATOM   7114 C  C6    . DT  F 3 13  ? 28.149  74.695  -32.904  1.00 103.75 ?  13  DT  G C6    1 
ATOM   7115 P  P     . DA  F 3 14  ? 27.256  70.674  -27.956  1.00 98.67  ?  14  DA  G P     1 
ATOM   7116 O  OP1   . DA  F 3 14  ? 27.433  70.352  -26.516  1.00 100.04 ?  14  DA  G OP1   1 
ATOM   7117 O  OP2   . DA  F 3 14  ? 27.948  69.880  -29.010  1.00 97.31  ?  14  DA  G OP2   1 
ATOM   7118 O  "O5'" . DA  F 3 14  ? 25.703  70.639  -28.326  1.00 94.07  ?  14  DA  G "O5'" 1 
ATOM   7119 C  "C5'" . DA  F 3 14  ? 24.732  71.426  -27.641  1.00 92.91  ?  14  DA  G "C5'" 1 
ATOM   7120 C  "C4'" . DA  F 3 14  ? 23.370  71.213  -28.274  1.00 88.20  ?  14  DA  G "C4'" 1 
ATOM   7121 O  "O4'" . DA  F 3 14  ? 23.339  71.748  -29.615  1.00 87.16  ?  14  DA  G "O4'" 1 
ATOM   7122 C  "C3'" . DA  F 3 14  ? 22.921  69.769  -28.395  1.00 83.76  ?  14  DA  G "C3'" 1 
ATOM   7123 O  "O3'" . DA  F 3 14  ? 21.569  69.688  -28.019  1.00 81.70  ?  14  DA  G "O3'" 1 
ATOM   7124 C  "C2'" . DA  F 3 14  ? 23.127  69.421  -29.866  1.00 82.06  ?  14  DA  G "C2'" 1 
ATOM   7125 C  "C1'" . DA  F 3 14  ? 22.934  70.768  -30.546  1.00 83.51  ?  14  DA  G "C1'" 1 
ATOM   7126 N  N9    . DA  F 3 14  ? 23.759  71.018  -31.718  1.00 83.42  ?  14  DA  G N9    1 
ATOM   7127 C  C8    . DA  F 3 14  ? 25.081  70.706  -31.904  1.00 84.28  ?  14  DA  G C8    1 
ATOM   7128 N  N7    . DA  F 3 14  ? 25.595  71.163  -33.020  1.00 84.79  ?  14  DA  G N7    1 
ATOM   7129 C  C5    . DA  F 3 14  ? 24.546  71.869  -33.577  1.00 84.54  ?  14  DA  G C5    1 
ATOM   7130 C  C6    . DA  F 3 14  ? 24.428  72.598  -34.782  1.00 85.41  ?  14  DA  G C6    1 
ATOM   7131 N  N6    . DA  F 3 14  ? 25.434  72.715  -35.653  1.00 86.40  ?  14  DA  G N6    1 
ATOM   7132 N  N1    . DA  F 3 14  ? 23.229  73.170  -35.062  1.00 85.26  ?  14  DA  G N1    1 
ATOM   7133 C  C2    . DA  F 3 14  ? 22.213  73.019  -34.190  1.00 84.43  ?  14  DA  G C2    1 
ATOM   7134 N  N3    . DA  F 3 14  ? 22.204  72.348  -33.032  1.00 83.49  ?  14  DA  G N3    1 
ATOM   7135 C  C4    . DA  F 3 14  ? 23.407  71.790  -32.788  1.00 83.57  ?  14  DA  G C4    1 
ATOM   7136 P  P     . DG  F 3 15  ? 20.917  68.277  -27.683  1.00 79.00  ?  15  DG  G P     1 
ATOM   7137 O  OP1   . DG  F 3 15  ? 19.954  68.485  -26.574  1.00 80.22  ?  15  DG  G OP1   1 
ATOM   7138 O  OP2   . DG  F 3 15  ? 21.986  67.254  -27.567  1.00 78.63  ?  15  DG  G OP2   1 
ATOM   7139 O  "O5'" . DG  F 3 15  ? 20.135  67.937  -29.029  1.00 75.76  ?  15  DG  G "O5'" 1 
ATOM   7140 C  "C5'" . DG  F 3 15  ? 18.987  68.610  -29.533  1.00 75.23  ?  15  DG  G "C5'" 1 
ATOM   7141 C  "C4'" . DG  F 3 15  ? 18.743  68.192  -30.978  1.00 73.12  ?  15  DG  G "C4'" 1 
ATOM   7142 O  "O4'" . DG  F 3 15  ? 19.812  68.754  -31.784  1.00 74.11  ?  15  DG  G "O4'" 1 
ATOM   7143 C  "C3'" . DG  F 3 15  ? 18.792  66.682  -31.236  1.00 70.65  ?  15  DG  G "C3'" 1 
ATOM   7144 O  "O3'" . DG  F 3 15  ? 17.670  66.149  -31.973  1.00 68.22  ?  15  DG  G "O3'" 1 
ATOM   7145 C  "C2'" . DG  F 3 15  ? 20.143  66.451  -31.915  1.00 70.71  ?  15  DG  G "C2'" 1 
ATOM   7146 C  "C1'" . DG  F 3 15  ? 20.292  67.762  -32.657  1.00 72.17  ?  15  DG  G "C1'" 1 
ATOM   7147 N  N9    . DG  F 3 15  ? 21.616  68.051  -33.198  1.00 73.69  ?  15  DG  G N9    1 
ATOM   7148 C  C8    . DG  F 3 15  ? 22.837  67.537  -32.814  1.00 74.53  ?  15  DG  G C8    1 
ATOM   7149 N  N7    . DG  F 3 15  ? 23.837  67.920  -33.563  1.00 75.72  ?  15  DG  G N7    1 
ATOM   7150 C  C5    . DG  F 3 15  ? 23.238  68.725  -34.523  1.00 75.92  ?  15  DG  G C5    1 
ATOM   7151 C  C6    . DG  F 3 15  ? 23.801  69.406  -35.631  1.00 77.32  ?  15  DG  G C6    1 
ATOM   7152 O  O6    . DG  F 3 15  ? 24.991  69.462  -35.967  1.00 79.16  ?  15  DG  G O6    1 
ATOM   7153 N  N1    . DG  F 3 15  ? 22.853  70.134  -36.347  1.00 77.08  ?  15  DG  G N1    1 
ATOM   7154 C  C2    . DG  F 3 15  ? 21.507  70.149  -36.059  1.00 76.24  ?  15  DG  G C2    1 
ATOM   7155 N  N2    . DG  F 3 15  ? 20.732  70.891  -36.856  1.00 77.24  ?  15  DG  G N2    1 
ATOM   7156 N  N3    . DG  F 3 15  ? 20.958  69.497  -35.044  1.00 74.97  ?  15  DG  G N3    1 
ATOM   7157 C  C4    . DG  F 3 15  ? 21.875  68.810  -34.316  1.00 74.77  ?  15  DG  G C4    1 
ATOM   7158 P  P     . DG  F 3 16  ? 17.486  64.552  -31.996  1.00 65.77  ?  16  DG  G P     1 
ATOM   7159 O  OP1   . DG  F 3 16  ? 16.101  64.225  -32.417  1.00 64.46  ?  16  DG  G OP1   1 
ATOM   7160 O  OP2   . DG  F 3 16  ? 18.022  64.001  -30.725  1.00 66.48  ?  16  DG  G OP2   1 
ATOM   7161 O  "O5'" . DG  F 3 16  ? 18.521  64.064  -33.121  1.00 65.69  ?  16  DG  G "O5'" 1 
ATOM   7162 C  "C5'" . DG  F 3 16  ? 18.240  63.758  -34.487  1.00 65.06  ?  16  DG  G "C5'" 1 
ATOM   7163 C  "C4'" . DG  F 3 16  ? 18.099  64.999  -35.343  1.00 66.39  ?  16  DG  G "C4'" 1 
ATOM   7164 O  "O4'" . DG  F 3 16  ? 19.206  65.885  -35.086  1.00 68.64  ?  16  DG  G "O4'" 1 
ATOM   7165 C  "C3'" . DG  F 3 16  ? 18.149  64.731  -36.833  1.00 65.46  ?  16  DG  G "C3'" 1 
ATOM   7166 O  "O3'" . DG  F 3 16  ? 16.840  64.496  -37.306  1.00 64.44  ?  16  DG  G "O3'" 1 
ATOM   7167 C  "C2'" . DG  F 3 16  ? 18.718  66.019  -37.406  1.00 67.48  ?  16  DG  G "C2'" 1 
ATOM   7168 C  "C1'" . DG  F 3 16  ? 19.608  66.523  -36.279  1.00 69.70  ?  16  DG  G "C1'" 1 
ATOM   7169 N  N9    . DG  F 3 16  ? 21.050  66.337  -36.454  1.00 71.29  ?  16  DG  G N9    1 
ATOM   7170 C  C8    . DG  F 3 16  ? 21.899  65.706  -35.573  1.00 71.67  ?  16  DG  G C8    1 
ATOM   7171 N  N7    . DG  F 3 16  ? 23.147  65.726  -35.927  1.00 72.80  ?  16  DG  G N7    1 
ATOM   7172 C  C5    . DG  F 3 16  ? 23.132  66.425  -37.117  1.00 73.95  ?  16  DG  G C5    1 
ATOM   7173 C  C6    . DG  F 3 16  ? 24.217  66.767  -37.966  1.00 76.62  ?  16  DG  G C6    1 
ATOM   7174 O  O6    . DG  F 3 16  ? 25.415  66.489  -37.791  1.00 78.21  ?  16  DG  G O6    1 
ATOM   7175 N  N1    . DG  F 3 16  ? 23.800  67.481  -39.105  1.00 77.07  ?  16  DG  G N1    1 
ATOM   7176 C  C2    . DG  F 3 16  ? 22.483  67.824  -39.378  1.00 75.83  ?  16  DG  G C2    1 
ATOM   7177 N  N2    . DG  F 3 16  ? 22.259  68.499  -40.517  1.00 76.26  ?  16  DG  G N2    1 
ATOM   7178 N  N3    . DG  F 3 16  ? 21.458  67.526  -38.567  1.00 74.02  ?  16  DG  G N3    1 
ATOM   7179 C  C4    . DG  F 3 16  ? 21.855  66.836  -37.454  1.00 72.95  ?  16  DG  G C4    1 
ATOM   7180 P  P     . DT  F 3 17  ? 16.534  63.406  -38.435  1.00 62.85  ?  17  DT  G P     1 
ATOM   7181 O  OP1   . DT  F 3 17  ? 15.060  63.297  -38.560  1.00 62.73  ?  17  DT  G OP1   1 
ATOM   7182 O  OP2   . DT  F 3 17  ? 17.349  62.184  -38.187  1.00 62.17  ?  17  DT  G OP2   1 
ATOM   7183 O  "O5'" . DT  F 3 17  ? 17.140  64.120  -39.726  1.00 62.56  ?  17  DT  G "O5'" 1 
ATOM   7184 C  "C5'" . DT  F 3 17  ? 16.515  65.243  -40.318  1.00 63.22  ?  17  DT  G "C5'" 1 
ATOM   7185 C  "C4'" . DT  F 3 17  ? 17.219  65.568  -41.620  1.00 63.50  ?  17  DT  G "C4'" 1 
ATOM   7186 O  "O4'" . DT  F 3 17  ? 18.613  65.821  -41.365  1.00 64.04  ?  17  DT  G "O4'" 1 
ATOM   7187 C  "C3'" . DT  F 3 17  ? 17.180  64.502  -42.702  1.00 62.44  ?  17  DT  G "C3'" 1 
ATOM   7188 O  "O3'" . DT  F 3 17  ? 16.830  65.126  -43.932  1.00 64.05  ?  17  DT  G "O3'" 1 
ATOM   7189 C  "C2'" . DT  F 3 17  ? 18.582  63.901  -42.724  1.00 61.54  ?  17  DT  G "C2'" 1 
ATOM   7190 C  "C1'" . DT  F 3 17  ? 19.422  65.070  -42.237  1.00 63.10  ?  17  DT  G "C1'" 1 
ATOM   7191 N  N1    . DT  F 3 17  ? 20.676  64.725  -41.502  1.00 63.67  ?  17  DT  G N1    1 
ATOM   7192 C  C2    . DT  F 3 17  ? 21.911  65.004  -42.070  1.00 65.32  ?  17  DT  G C2    1 
ATOM   7193 O  O2    . DT  F 3 17  ? 22.074  65.481  -43.186  1.00 66.50  ?  17  DT  G O2    1 
ATOM   7194 N  N3    . DT  F 3 17  ? 22.983  64.670  -41.276  1.00 65.87  ?  17  DT  G N3    1 
ATOM   7195 C  C4    . DT  F 3 17  ? 22.963  64.122  -40.004  1.00 65.45  ?  17  DT  G C4    1 
ATOM   7196 O  O4    . DT  F 3 17  ? 24.025  63.878  -39.431  1.00 66.71  ?  17  DT  G O4    1 
ATOM   7197 C  C5    . DT  F 3 17  ? 21.645  63.887  -39.466  1.00 64.00  ?  17  DT  G C5    1 
ATOM   7198 C  C7    . DT  F 3 17  ? 21.468  63.296  -38.105  1.00 63.86  ?  17  DT  G C7    1 
ATOM   7199 C  C6    . DT  F 3 17  ? 20.585  64.199  -40.221  1.00 63.29  ?  17  DT  G C6    1 
ATOM   7200 P  P     . DA  F 3 18  ? 16.269  64.298  -45.181  1.00 63.50  ?  18  DA  G P     1 
ATOM   7201 O  OP1   . DA  F 3 18  ? 15.372  65.208  -45.937  1.00 64.96  ?  18  DA  G OP1   1 
ATOM   7202 O  OP2   . DA  F 3 18  ? 15.808  62.957  -44.720  1.00 61.76  ?  18  DA  G OP2   1 
ATOM   7203 O  "O5'" . DA  F 3 18  ? 17.593  64.044  -46.032  1.00 62.60  ?  18  DA  G "O5'" 1 
ATOM   7204 C  "C5'" . DA  F 3 18  ? 18.433  65.033  -46.589  1.00 62.97  ?  18  DA  G "C5'" 1 
ATOM   7205 C  "C4'" . DA  F 3 18  ? 19.719  64.347  -47.004  1.00 62.35  ?  18  DA  G "C4'" 1 
ATOM   7206 O  "O4'" . DA  F 3 18  ? 20.554  64.097  -45.846  1.00 62.02  ?  18  DA  G "O4'" 1 
ATOM   7207 C  "C3'" . DA  F 3 18  ? 19.539  62.991  -47.683  1.00 61.02  ?  18  DA  G "C3'" 1 
ATOM   7208 O  "O3'" . DA  F 3 18  ? 20.114  63.031  -48.972  1.00 62.54  ?  18  DA  G "O3'" 1 
ATOM   7209 C  "C2'" . DA  F 3 18  ? 20.251  62.007  -46.762  1.00 59.99  ?  18  DA  G "C2'" 1 
ATOM   7210 C  "C1'" . DA  F 3 18  ? 21.274  62.913  -46.099  1.00 61.02  ?  18  DA  G "C1'" 1 
ATOM   7211 N  N9    . DA  F 3 18  ? 21.841  62.392  -44.860  1.00 60.21  ?  18  DA  G N9    1 
ATOM   7212 C  C8    . DA  F 3 18  ? 21.180  61.791  -43.822  1.00 59.36  ?  18  DA  G C8    1 
ATOM   7213 N  N7    . DA  F 3 18  ? 21.946  61.424  -42.818  1.00 59.71  ?  18  DA  G N7    1 
ATOM   7214 C  C5    . DA  F 3 18  ? 23.204  61.823  -43.226  1.00 61.02  ?  18  DA  G C5    1 
ATOM   7215 C  C6    . DA  F 3 18  ? 24.476  61.705  -42.621  1.00 62.12  ?  18  DA  G C6    1 
ATOM   7216 N  N6    . DA  F 3 18  ? 24.666  61.148  -41.423  1.00 62.18  ?  18  DA  G N6    1 
ATOM   7217 N  N1    . DA  F 3 18  ? 25.540  62.187  -43.297  1.00 63.37  ?  18  DA  G N1    1 
ATOM   7218 C  C2    . DA  F 3 18  ? 25.346  62.722  -44.515  1.00 63.75  ?  18  DA  G C2    1 
ATOM   7219 N  N3    . DA  F 3 18  ? 24.202  62.899  -45.182  1.00 62.66  ?  18  DA  G N3    1 
ATOM   7220 C  C4    . DA  F 3 18  ? 23.159  62.413  -44.486  1.00 61.23  ?  18  DA  G C4    1 
ATOM   7221 P  P     . DC  F 3 19  ? 19.999  61.894  -50.094  1.00 62.64  ?  19  DC  G P     1 
ATOM   7222 O  OP1   . DC  F 3 19  ? 19.705  62.558  -51.383  1.00 63.87  ?  19  DC  G OP1   1 
ATOM   7223 O  OP2   . DC  F 3 19  ? 19.125  60.788  -49.622  1.00 62.02  ?  19  DC  G OP2   1 
ATOM   7224 O  "O5'" . DC  F 3 19  ? 21.482  61.305  -50.119  1.00 62.25  ?  19  DC  G "O5'" 1 
ATOM   7225 C  "C5'" . DC  F 3 19  ? 22.617  62.133  -50.238  1.00 63.53  ?  19  DC  G "C5'" 1 
ATOM   7226 C  "C4'" . DC  F 3 19  ? 23.795  61.470  -49.563  1.00 63.93  ?  19  DC  G "C4'" 1 
ATOM   7227 O  "O4'" . DC  F 3 19  ? 23.493  61.230  -48.174  1.00 63.00  ?  19  DC  G "O4'" 1 
ATOM   7228 C  "C3'" . DC  F 3 19  ? 24.140  60.085  -50.091  1.00 63.91  ?  19  DC  G "C3'" 1 
ATOM   7229 O  "O3'" . DC  F 3 19  ? 25.133  60.187  -51.101  1.00 65.99  ?  19  DC  G "O3'" 1 
ATOM   7230 C  "C2'" . DC  F 3 19  ? 24.614  59.300  -48.870  1.00 63.12  ?  19  DC  G "C2'" 1 
ATOM   7231 C  "C1'" . DC  F 3 19  ? 24.457  60.299  -47.742  1.00 62.86  ?  19  DC  G "C1'" 1 
ATOM   7232 N  N1    . DC  F 3 19  ? 24.110  59.683  -46.432  1.00 61.40  ?  19  DC  G N1    1 
ATOM   7233 C  C2    . DC  F 3 19  ? 25.149  59.411  -45.517  1.00 62.55  ?  19  DC  G C2    1 
ATOM   7234 O  O2    . DC  F 3 19  ? 26.320  59.698  -45.807  1.00 64.43  ?  19  DC  G O2    1 
ATOM   7235 N  N3    . DC  F 3 19  ? 24.834  58.853  -44.314  1.00 61.78  ?  19  DC  G N3    1 
ATOM   7236 C  C4    . DC  F 3 19  ? 23.555  58.543  -44.041  1.00 60.40  ?  19  DC  G C4    1 
ATOM   7237 N  N4    . DC  F 3 19  ? 23.291  58.000  -42.854  1.00 60.24  ?  19  DC  G N4    1 
ATOM   7238 C  C5    . DC  F 3 19  ? 22.483  58.793  -44.961  1.00 59.25  ?  19  DC  G C5    1 
ATOM   7239 C  C6    . DC  F 3 19  ? 22.808  59.359  -46.134  1.00 59.82  ?  19  DC  G C6    1 
ATOM   7240 P  P     . DT  F 3 20  ? 25.602  58.936  -51.983  1.00 66.37  ?  20  DT  G P     1 
ATOM   7241 O  OP1   . DT  F 3 20  ? 26.090  59.476  -53.273  1.00 68.31  ?  20  DT  G OP1   1 
ATOM   7242 O  OP2   . DT  F 3 20  ? 24.550  57.895  -51.995  1.00 64.34  ?  20  DT  G OP2   1 
ATOM   7243 O  "O5'" . DT  F 3 20  ? 26.811  58.363  -51.106  1.00 67.19  ?  20  DT  G "O5'" 1 
ATOM   7244 C  "C5'" . DT  F 3 20  ? 27.917  59.182  -50.749  1.00 69.17  ?  20  DT  G "C5'" 1 
ATOM   7245 C  "C4'" . DT  F 3 20  ? 28.880  58.437  -49.855  1.00 70.16  ?  20  DT  G "C4'" 1 
ATOM   7246 O  "O4'" . DT  F 3 20  ? 28.310  58.238  -48.547  1.00 68.78  ?  20  DT  G "O4'" 1 
ATOM   7247 C  "C3'" . DT  F 3 20  ? 29.299  57.072  -50.366  1.00 71.39  ?  20  DT  G "C3'" 1 
ATOM   7248 O  "O3'" . DT  F 3 20  ? 30.708  57.061  -50.440  1.00 74.89  ?  20  DT  G "O3'" 1 
ATOM   7249 C  "C2'" . DT  F 3 20  ? 28.736  56.074  -49.359  1.00 69.63  ?  20  DT  G "C2'" 1 
ATOM   7250 C  "C1'" . DT  F 3 20  ? 28.613  56.933  -48.112  1.00 69.20  ?  20  DT  G "C1'" 1 
ATOM   7251 N  N1    . DT  F 3 20  ? 27.555  56.518  -47.153  1.00 68.27  ?  20  DT  G N1    1 
ATOM   7252 C  C2    . DT  F 3 20  ? 27.890  56.359  -45.822  1.00 69.15  ?  20  DT  G C2    1 
ATOM   7253 O  O2    . DT  F 3 20  ? 29.034  56.448  -45.395  1.00 71.24  ?  20  DT  G O2    1 
ATOM   7254 N  N3    . DT  F 3 20  ? 26.826  56.019  -45.011  1.00 67.82  ?  20  DT  G N3    1 
ATOM   7255 C  C4    . DT  F 3 20  ? 25.498  55.835  -45.385  1.00 66.44  ?  20  DT  G C4    1 
ATOM   7256 O  O4    . DT  F 3 20  ? 24.676  55.519  -44.524  1.00 66.07  ?  20  DT  G O4    1 
ATOM   7257 C  C5    . DT  F 3 20  ? 25.211  56.052  -46.791  1.00 65.73  ?  20  DT  G C5    1 
ATOM   7258 C  C7    . DT  F 3 20  ? 23.822  55.911  -47.345  1.00 63.92  ?  20  DT  G C7    1 
ATOM   7259 C  C6    . DT  F 3 20  ? 26.240  56.380  -47.588  1.00 67.08  ?  20  DT  G C6    1 
ATOM   7260 P  P     . DA  F 3 21  ? 31.515  55.865  -51.123  1.00 77.38  ?  21  DA  G P     1 
ATOM   7261 O  OP1   . DA  F 3 21  ? 32.779  56.448  -51.636  1.00 80.23  ?  21  DA  G OP1   1 
ATOM   7262 O  OP2   . DA  F 3 21  ? 30.593  55.098  -52.001  1.00 75.78  ?  21  DA  G OP2   1 
ATOM   7263 O  "O5'" . DA  F 3 21  ? 31.838  54.923  -49.880  1.00 78.30  ?  21  DA  G "O5'" 1 
ATOM   7264 C  "C5'" . DA  F 3 21  ? 32.487  55.437  -48.729  1.00 80.10  ?  21  DA  G "C5'" 1 
ATOM   7265 C  "C4'" . DA  F 3 21  ? 32.492  54.394  -47.638  1.00 80.68  ?  21  DA  G "C4'" 1 
ATOM   7266 O  "O4'" . DA  F 3 21  ? 31.265  54.416  -46.889  1.00 77.99  ?  21  DA  G "O4'" 1 
ATOM   7267 C  "C3'" . DA  F 3 21  ? 32.671  52.966  -48.122  1.00 82.71  ?  21  DA  G "C3'" 1 
ATOM   7268 O  "O3'" . DA  F 3 21  ? 33.957  52.579  -47.689  1.00 88.03  ?  21  DA  G "O3'" 1 
ATOM   7269 C  "C2'" . DA  F 3 21  ? 31.534  52.173  -47.483  1.00 79.37  ?  21  DA  G "C2'" 1 
ATOM   7270 C  "C1'" . DA  F 3 21  ? 31.072  53.116  -46.384  1.00 77.42  ?  21  DA  G "C1'" 1 
ATOM   7271 N  N9    . DA  F 3 21  ? 29.671  52.994  -45.987  1.00 74.29  ?  21  DA  G N9    1 
ATOM   7272 C  C8    . DA  F 3 21  ? 28.559  53.263  -46.746  1.00 72.04  ?  21  DA  G C8    1 
ATOM   7273 N  N7    . DA  F 3 21  ? 27.426  53.134  -46.101  1.00 69.67  ?  21  DA  G N7    1 
ATOM   7274 C  C5    . DA  F 3 21  ? 27.815  52.737  -44.835  1.00 70.20  ?  21  DA  G C5    1 
ATOM   7275 C  C6    . DA  F 3 21  ? 27.085  52.412  -43.672  1.00 68.91  ?  21  DA  G C6    1 
ATOM   7276 N  N6    . DA  F 3 21  ? 25.753  52.423  -43.624  1.00 67.13  ?  21  DA  G N6    1 
ATOM   7277 N  N1    . DA  F 3 21  ? 27.774  52.070  -42.558  1.00 70.17  ?  21  DA  G N1    1 
ATOM   7278 C  C2    . DA  F 3 21  ? 29.119  52.052  -42.597  1.00 72.55  ?  21  DA  G C2    1 
ATOM   7279 N  N3    . DA  F 3 21  ? 29.919  52.327  -43.636  1.00 73.99  ?  21  DA  G N3    1 
ATOM   7280 C  C4    . DA  F 3 21  ? 29.200  52.668  -44.734  1.00 72.94  ?  21  DA  G C4    1 
ATOM   7281 P  P     . DA  F 3 22  ? 34.702  51.227  -48.101  1.00 92.27  ?  22  DA  G P     1 
ATOM   7282 O  OP1   . DA  F 3 22  ? 36.155  51.533  -48.145  1.00 95.43  ?  22  DA  G OP1   1 
ATOM   7283 O  OP2   . DA  F 3 22  ? 34.005  50.602  -49.256  1.00 91.78  ?  22  DA  G OP2   1 
ATOM   7284 O  "O5'" . DA  F 3 22  ? 34.371  50.298  -46.845  1.00 92.19  ?  22  DA  G "O5'" 1 
ATOM   7285 C  "C5'" . DA  F 3 22  ? 34.722  50.652  -45.507  1.00 92.90  ?  22  DA  G "C5'" 1 
ATOM   7286 C  "C4'" . DA  F 3 22  ? 34.024  49.709  -44.546  1.00 92.14  ?  22  DA  G "C4'" 1 
ATOM   7287 O  "O4'" . DA  F 3 22  ? 32.624  50.078  -44.442  1.00 88.77  ?  22  DA  G "O4'" 1 
ATOM   7288 C  "C3'" . DA  F 3 22  ? 34.062  48.243  -44.977  1.00 93.76  ?  22  DA  G "C3'" 1 
ATOM   7289 O  "O3'" . DA  F 3 22  ? 34.662  47.429  -43.983  1.00 97.09  ?  22  DA  G "O3'" 1 
ATOM   7290 C  "C2'" . DA  F 3 22  ? 32.600  47.889  -45.184  1.00 90.31  ?  22  DA  G "C2'" 1 
ATOM   7291 C  "C1'" . DA  F 3 22  ? 31.894  48.886  -44.281  1.00 87.47  ?  22  DA  G "C1'" 1 
ATOM   7292 N  N9    . DA  F 3 22  ? 30.498  49.077  -44.655  1.00 83.44  ?  22  DA  G N9    1 
ATOM   7293 C  C8    . DA  F 3 22  ? 30.019  49.338  -45.910  1.00 82.19  ?  22  DA  G C8    1 
ATOM   7294 N  N7    . DA  F 3 22  ? 28.714  49.394  -45.986  1.00 79.85  ?  22  DA  G N7    1 
ATOM   7295 C  C5    . DA  F 3 22  ? 28.303  49.137  -44.688  1.00 78.93  ?  22  DA  G C5    1 
ATOM   7296 C  C6    . DA  F 3 22  ? 27.020  49.059  -44.098  1.00 76.19  ?  22  DA  G C6    1 
ATOM   7297 N  N6    . DA  F 3 22  ? 25.895  49.257  -44.789  1.00 73.83  ?  22  DA  G N6    1 
ATOM   7298 N  N1    . DA  F 3 22  ? 26.951  48.784  -42.771  1.00 76.49  ?  22  DA  G N1    1 
ATOM   7299 C  C2    . DA  F 3 22  ? 28.088  48.591  -42.072  1.00 78.44  ?  22  DA  G C2    1 
ATOM   7300 N  N3    . DA  F 3 22  ? 29.348  48.649  -42.519  1.00 80.60  ?  22  DA  G N3    1 
ATOM   7301 C  C4    . DA  F 3 22  ? 29.392  48.910  -43.851  1.00 80.99  ?  22  DA  G C4    1 
ATOM   7302 P  P     . DT  F 3 23  ? 35.159  45.919  -44.219  1.00 100.75 ?  23  DT  G P     1 
ATOM   7303 O  OP1   . DT  F 3 23  ? 36.636  45.915  -44.052  1.00 104.29 ?  23  DT  G OP1   1 
ATOM   7304 O  OP2   . DT  F 3 23  ? 34.520  45.345  -45.434  1.00 99.60  ?  23  DT  G OP2   1 
ATOM   7305 O  "O5'" . DT  F 3 23  ? 34.515  45.136  -42.987  1.00 100.71 ?  23  DT  G "O5'" 1 
ATOM   7306 C  "C5'" . DT  F 3 23  ? 34.605  45.582  -41.636  1.00 100.88 ?  23  DT  G "C5'" 1 
ATOM   7307 C  "C4'" . DT  F 3 23  ? 33.384  45.082  -40.892  1.00 99.28  ?  23  DT  G "C4'" 1 
ATOM   7308 O  "O4'" . DT  F 3 23  ? 32.214  45.685  -41.490  1.00 96.26  ?  23  DT  G "O4'" 1 
ATOM   7309 C  "C3'" . DT  F 3 23  ? 33.184  43.582  -41.036  1.00 100.88 ?  23  DT  G "C3'" 1 
ATOM   7310 O  "O3'" . DT  F 3 23  ? 33.552  42.909  -39.852  1.00 103.17 ?  23  DT  G "O3'" 1 
ATOM   7311 C  "C2'" . DT  F 3 23  ? 31.720  43.375  -41.395  1.00 98.32  ?  23  DT  G "C2'" 1 
ATOM   7312 C  "C1'" . DT  F 3 23  ? 31.138  44.776  -41.417  1.00 95.66  ?  23  DT  G "C1'" 1 
ATOM   7313 N  N1    . DT  F 3 23  ? 30.111  45.025  -42.498  1.00 93.98  ?  23  DT  G N1    1 
ATOM   7314 C  C2    . DT  F 3 23  ? 28.776  45.112  -42.127  1.00 92.26  ?  23  DT  G C2    1 
ATOM   7315 O  O2    . DT  F 3 23  ? 28.386  45.000  -40.973  1.00 92.48  ?  23  DT  G O2    1 
ATOM   7316 N  N3    . DT  F 3 23  ? 27.901  45.358  -43.169  1.00 90.35  ?  23  DT  G N3    1 
ATOM   7317 C  C4    . DT  F 3 23  ? 28.209  45.521  -44.515  1.00 90.29  ?  23  DT  G C4    1 
ATOM   7318 O  O4    . DT  F 3 23  ? 27.297  45.726  -45.317  1.00 88.64  ?  23  DT  G O4    1 
ATOM   7319 C  C5    . DT  F 3 23  ? 29.618  45.402  -44.843  1.00 92.49  ?  23  DT  G C5    1 
ATOM   7320 C  C7    . DT  F 3 23  ? 30.078  45.532  -46.268  1.00 93.14  ?  23  DT  G C7    1 
ATOM   7321 C  C6    . DT  F 3 23  ? 30.487  45.165  -43.836  1.00 94.32  ?  23  DT  G C6    1 
ATOM   7322 P  P     . DA  F 3 24  ? 33.828  41.330  -39.851  1.00 106.29 ?  24  DA  G P     1 
ATOM   7323 O  OP1   . DA  F 3 24  ? 34.841  41.065  -38.798  1.00 109.79 ?  24  DA  G OP1   1 
ATOM   7324 O  OP2   . DA  F 3 24  ? 34.063  40.846  -41.237  1.00 107.25 ?  24  DA  G OP2   1 
ATOM   7325 O  "O5'" . DA  F 3 24  ? 32.411  40.742  -39.404  1.00 103.35 ?  24  DA  G "O5'" 1 
ATOM   7326 C  "C5'" . DA  F 3 24  ? 31.823  40.985  -38.128  1.00 101.24 ?  24  DA  G "C5'" 1 
ATOM   7327 C  "C4'" . DA  F 3 24  ? 30.396  40.467  -38.117  1.00 98.38  ?  24  DA  G "C4'" 1 
ATOM   7328 O  "O4'" . DA  F 3 24  ? 29.632  41.148  -39.141  1.00 95.02  ?  24  DA  G "O4'" 1 
ATOM   7329 C  "C3'" . DA  F 3 24  ? 30.237  38.977  -38.385  1.00 100.03 ?  24  DA  G "C3'" 1 
ATOM   7330 O  "O3'" . DA  F 3 24  ? 29.395  38.399  -37.402  1.00 100.23 ?  24  DA  G "O3'" 1 
ATOM   7331 C  "C2'" . DA  F 3 24  ? 29.639  38.901  -39.788  1.00 98.31  ?  24  DA  G "C2'" 1 
ATOM   7332 C  "C1'" . DA  F 3 24  ? 28.870  40.210  -39.867  1.00 94.59  ?  24  DA  G "C1'" 1 
ATOM   7333 N  N9    . DA  F 3 24  ? 28.660  40.746  -41.209  1.00 92.37  ?  24  DA  G N9    1 
ATOM   7334 C  C8    . DA  F 3 24  ? 29.601  40.977  -42.176  1.00 93.08  ?  24  DA  G C8    1 
ATOM   7335 N  N7    . DA  F 3 24  ? 29.134  41.526  -43.271  1.00 91.03  ?  24  DA  G N7    1 
ATOM   7336 C  C5    . DA  F 3 24  ? 27.785  41.664  -43.006  1.00 88.60  ?  24  DA  G C5    1 
ATOM   7337 C  C6    . DA  F 3 24  ? 26.709  42.150  -43.778  1.00 85.92  ?  24  DA  G C6    1 
ATOM   7338 N  N6    . DA  F 3 24  ? 26.855  42.606  -45.022  1.00 85.63  ?  24  DA  G N6    1 
ATOM   7339 N  N1    . DA  F 3 24  ? 25.473  42.128  -43.233  1.00 84.14  ?  24  DA  G N1    1 
ATOM   7340 C  C2    . DA  F 3 24  ? 25.310  41.620  -42.002  1.00 85.14  ?  24  DA  G C2    1 
ATOM   7341 N  N3    . DA  F 3 24  ? 26.244  41.149  -41.171  1.00 87.54  ?  24  DA  G N3    1 
ATOM   7342 C  C4    . DA  F 3 24  ? 27.470  41.187  -41.740  1.00 89.34  ?  24  DA  G C4    1 
ATOM   7343 P  P     . DG  F 3 25  ? 29.203  36.816  -37.256  1.00 103.78 ?  25  DG  G P     1 
ATOM   7344 O  OP1   . DG  F 3 25  ? 28.867  36.540  -35.840  1.00 105.35 ?  25  DG  G OP1   1 
ATOM   7345 O  OP2   . DG  F 3 25  ? 30.331  36.093  -37.903  1.00 106.80 ?  25  DG  G OP2   1 
ATOM   7346 O  "O5'" . DG  F 3 25  ? 27.908  36.544  -38.146  1.00 101.51 ?  25  DG  G "O5'" 1 
ATOM   7347 C  "C5'" . DG  F 3 25  ? 26.618  36.975  -37.748  1.00 98.62  ?  25  DG  G "C5'" 1 
ATOM   7348 C  "C4'" . DG  F 3 25  ? 25.695  37.017  -38.947  1.00 96.39  ?  25  DG  G "C4'" 1 
ATOM   7349 O  "O4'" . DG  F 3 25  ? 26.311  37.799  -39.989  1.00 95.07  ?  25  DG  G "O4'" 1 
ATOM   7350 C  "C3'" . DG  F 3 25  ? 25.414  35.676  -39.606  1.00 98.52  ?  25  DG  G "C3'" 1 
ATOM   7351 O  "O3'" . DG  F 3 25  ? 24.172  35.173  -39.158  1.00 98.71  ?  25  DG  G "O3'" 1 
ATOM   7352 C  "C2'" . DG  F 3 25  ? 25.388  35.978  -41.100  1.00 97.34  ?  25  DG  G "C2'" 1 
ATOM   7353 C  "C1'" . DG  F 3 25  ? 25.595  37.482  -41.153  1.00 94.50  ?  25  DG  G "C1'" 1 
ATOM   7354 N  N9    . DG  F 3 25  ? 26.331  37.913  -42.331  1.00 94.48  ?  25  DG  G N9    1 
ATOM   7355 C  C8    . DG  F 3 25  ? 27.687  37.846  -42.544  1.00 96.56  ?  25  DG  G C8    1 
ATOM   7356 N  N7    . DG  F 3 25  ? 28.058  38.287  -43.711  1.00 96.21  ?  25  DG  G N7    1 
ATOM   7357 C  C5    . DG  F 3 25  ? 26.867  38.638  -44.323  1.00 94.12  ?  25  DG  G C5    1 
ATOM   7358 C  C6    . DG  F 3 25  ? 26.641  39.189  -45.610  1.00 93.42  ?  25  DG  G C6    1 
ATOM   7359 O  O6    . DG  F 3 25  ? 27.496  39.442  -46.476  1.00 94.47  ?  25  DG  G O6    1 
ATOM   7360 N  N1    . DG  F 3 25  ? 25.276  39.441  -45.841  1.00 91.28  ?  25  DG  G N1    1 
ATOM   7361 C  C2    . DG  F 3 25  ? 24.259  39.181  -44.935  1.00 90.38  ?  25  DG  G C2    1 
ATOM   7362 N  N2    . DG  F 3 25  ? 23.007  39.469  -45.323  1.00 88.45  ?  25  DG  G N2    1 
ATOM   7363 N  N3    . DG  F 3 25  ? 24.471  38.669  -43.720  1.00 91.30  ?  25  DG  G N3    1 
ATOM   7364 C  C4    . DG  F 3 25  ? 25.791  38.422  -43.484  1.00 92.97  ?  25  DG  G C4    1 
ATOM   7365 P  P     . DT  F 3 26  ? 23.738  33.639  -39.360  1.00 102.43 ?  26  DT  G P     1 
ATOM   7366 O  OP1   . DT  F 3 26  ? 22.856  33.280  -38.224  1.00 103.78 ?  26  DT  G OP1   1 
ATOM   7367 O  OP2   . DT  F 3 26  ? 24.923  32.791  -39.662  1.00 105.50 ?  26  DT  G OP2   1 
ATOM   7368 O  "O5'" . DT  F 3 26  ? 22.859  33.697  -40.694  1.00 100.01 ?  26  DT  G "O5'" 1 
ATOM   7369 C  "C5'" . DT  F 3 26  ? 21.746  34.576  -40.842  1.00 95.92  ?  26  DT  G "C5'" 1 
ATOM   7370 C  "C4'" . DT  F 3 26  ? 21.371  34.720  -42.305  1.00 93.57  ?  26  DT  G "C4'" 1 
ATOM   7371 O  "O4'" . DT  F 3 26  ? 22.409  35.424  -43.017  1.00 91.74  ?  26  DT  G "O4'" 1 
ATOM   7372 C  "C3'" . DT  F 3 26  ? 21.257  33.415  -43.071  1.00 95.98  ?  26  DT  G "C3'" 1 
ATOM   7373 O  "O3'" . DT  F 3 26  ? 19.967  32.867  -42.891  1.00 97.17  ?  26  DT  G "O3'" 1 
ATOM   7374 C  "C2'" . DT  F 3 26  ? 21.549  33.807  -44.516  1.00 94.26  ?  26  DT  G "C2'" 1 
ATOM   7375 C  "C1'" . DT  F 3 26  ? 22.199  35.173  -44.388  1.00 91.12  ?  26  DT  G "C1'" 1 
ATOM   7376 N  N1    . DT  F 3 26  ? 23.431  35.400  -45.207  1.00 90.76  ?  26  DT  G N1    1 
ATOM   7377 C  C2    . DT  F 3 26  ? 23.309  35.924  -46.486  1.00 89.33  ?  26  DT  G C2    1 
ATOM   7378 O  O2    . DT  F 3 26  ? 22.246  36.185  -47.030  1.00 88.23  ?  26  DT  G O2    1 
ATOM   7379 N  N3    . DT  F 3 26  ? 24.503  36.133  -47.137  1.00 89.75  ?  26  DT  G N3    1 
ATOM   7380 C  C4    . DT  F 3 26  ? 25.778  35.905  -46.656  1.00 91.61  ?  26  DT  G C4    1 
ATOM   7381 O  O4    . DT  F 3 26  ? 26.733  36.150  -47.388  1.00 92.05  ?  26  DT  G O4    1 
ATOM   7382 C  C5    . DT  F 3 26  ? 25.839  35.360  -45.313  1.00 93.44  ?  26  DT  G C5    1 
ATOM   7383 C  C7    . DT  F 3 26  ? 27.154  35.019  -44.668  1.00 96.38  ?  26  DT  G C7    1 
ATOM   7384 C  C6    . DT  F 3 26  ? 24.679  35.140  -44.666  1.00 92.59  ?  26  DT  G C6    1 
ATOM   7385 P  P     . DA  F 3 27  ? 19.676  31.316  -43.194  1.00 102.00 ?  27  DA  G P     1 
ATOM   7386 O  OP1   . DA  F 3 27  ? 18.459  30.943  -42.433  1.00 103.76 ?  27  DA  G OP1   1 
ATOM   7387 O  OP2   . DA  F 3 27  ? 20.902  30.478  -43.053  1.00 105.05 ?  27  DA  G OP2   1 
ATOM   7388 O  "O5'" . DA  F 3 27  ? 19.288  31.355  -44.743  1.00 99.50  ?  27  DA  G "O5'" 1 
ATOM   7389 C  "C5'" . DA  F 3 27  ? 18.185  32.095  -45.257  1.00 94.62  ?  27  DA  G "C5'" 1 
ATOM   7390 C  "C4'" . DA  F 3 27  ? 18.191  31.991  -46.770  1.00 92.53  ?  27  DA  G "C4'" 1 
ATOM   7391 O  "O4'" . DA  F 3 27  ? 19.405  32.581  -47.290  1.00 90.73  ?  27  DA  G "O4'" 1 
ATOM   7392 C  "C3'" . DA  F 3 27  ? 18.095  30.584  -47.347  1.00 94.81  ?  27  DA  G "C3'" 1 
ATOM   7393 O  "O3'" . DA  F 3 27  ? 17.054  30.570  -48.303  1.00 93.76  ?  27  DA  G "O3'" 1 
ATOM   7394 C  "C2'" . DA  F 3 27  ? 19.460  30.310  -47.974  1.00 96.07  ?  27  DA  G "C2'" 1 
ATOM   7395 C  "C1'" . DA  F 3 27  ? 20.021  31.708  -48.213  1.00 92.68  ?  27  DA  G "C1'" 1 
ATOM   7396 N  N9    . DA  F 3 27  ? 21.458  31.861  -48.010  1.00 92.38  ?  27  DA  G N9    1 
ATOM   7397 C  C8    . DA  F 3 27  ? 22.201  31.416  -46.947  1.00 93.73  ?  27  DA  G C8    1 
ATOM   7398 N  N7    . DA  F 3 27  ? 23.463  31.764  -46.986  1.00 93.57  ?  27  DA  G N7    1 
ATOM   7399 C  C5    . DA  F 3 27  ? 23.554  32.487  -48.158  1.00 91.83  ?  27  DA  G C5    1 
ATOM   7400 C  C6    . DA  F 3 27  ? 24.641  33.129  -48.785  1.00 91.32  ?  27  DA  G C6    1 
ATOM   7401 N  N6    . DA  F 3 27  ? 25.870  33.086  -48.271  1.00 92.47  ?  27  DA  G N6    1 
ATOM   7402 N  N1    . DA  F 3 27  ? 24.417  33.765  -49.967  1.00 90.06  ?  27  DA  G N1    1 
ATOM   7403 C  C2    . DA  F 3 27  ? 23.165  33.785  -50.470  1.00 88.96  ?  27  DA  G C2    1 
ATOM   7404 N  N3    . DA  F 3 27  ? 22.064  33.211  -49.966  1.00 89.20  ?  27  DA  G N3    1 
ATOM   7405 C  C4    . DA  F 3 27  ? 22.327  32.572  -48.802  1.00 90.86  ?  27  DA  G C4    1 
ATOM   7406 P  P     . DG  F 3 28  ? 16.338  29.236  -48.811  1.00 96.85  ?  28  DG  G P     1 
ATOM   7407 O  OP1   . DG  F 3 28  ? 14.983  29.604  -49.285  1.00 96.17  ?  28  DG  G OP1   1 
ATOM   7408 O  OP2   . DG  F 3 28  ? 16.501  28.161  -47.797  1.00 100.01 ?  28  DG  G OP2   1 
ATOM   7409 O  "O5'" . DG  F 3 28  ? 17.230  28.845  -50.073  1.00 97.08  ?  28  DG  G "O5'" 1 
ATOM   7410 C  "C5'" . DG  F 3 28  ? 17.295  29.591  -51.285  1.00 94.07  ?  28  DG  G "C5'" 1 
ATOM   7411 C  "C4'" . DG  F 3 28  ? 18.526  29.187  -52.079  1.00 94.97  ?  28  DG  G "C4'" 1 
ATOM   7412 O  "O4'" . DG  F 3 28  ? 19.684  29.720  -51.386  1.00 93.34  ?  28  DG  G "O4'" 1 
ATOM   7413 C  "C3'" . DG  F 3 28  ? 18.753  27.675  -52.181  1.00 99.15  ?  28  DG  G "C3'" 1 
ATOM   7414 O  "O3'" . DG  F 3 28  ? 18.819  27.163  -53.520  1.00 101.07 ?  28  DG  G "O3'" 1 
ATOM   7415 C  "C2'" . DG  F 3 28  ? 20.017  27.419  -51.368  1.00 100.09 ?  28  DG  G "C2'" 1 
ATOM   7416 C  "C1'" . DG  F 3 28  ? 20.703  28.764  -51.513  1.00 96.63  ?  28  DG  G "C1'" 1 
ATOM   7417 N  N9    . DG  F 3 28  ? 21.858  28.982  -50.646  1.00 96.70  ?  28  DG  G N9    1 
ATOM   7418 C  C8    . DG  F 3 28  ? 22.147  28.363  -49.449  1.00 98.67  ?  28  DG  G C8    1 
ATOM   7419 N  N7    . DG  F 3 28  ? 23.323  28.655  -48.969  1.00 98.85  ?  28  DG  G N7    1 
ATOM   7420 C  C5    . DG  F 3 28  ? 23.871  29.491  -49.930  1.00 97.21  ?  28  DG  G C5    1 
ATOM   7421 C  C6    . DG  F 3 28  ? 25.151  30.101  -49.985  1.00 97.11  ?  28  DG  G C6    1 
ATOM   7422 O  O6    . DG  F 3 28  ? 26.051  30.041  -49.135  1.00 98.42  ?  28  DG  G O6    1 
ATOM   7423 N  N1    . DG  F 3 28  ? 25.315  30.888  -51.132  1.00 95.35  ?  28  DG  G N1    1 
ATOM   7424 C  C2    . DG  F 3 28  ? 24.376  31.002  -52.137  1.00 94.40  ?  28  DG  G C2    1 
ATOM   7425 N  N2    . DG  F 3 28  ? 24.692  31.775  -53.183  1.00 93.50  ?  28  DG  G N2    1 
ATOM   7426 N  N3    . DG  F 3 28  ? 23.178  30.430  -52.098  1.00 94.54  ?  28  DG  G N3    1 
ATOM   7427 C  C4    . DG  F 3 28  ? 22.989  29.691  -50.973  1.00 95.88  ?  28  DG  G C4    1 
ATOM   7428 P  P     . DT  F 3 29  ? 18.739  25.575  -53.759  1.00 105.90 ?  29  DT  G P     1 
ATOM   7429 O  OP1   . DT  F 3 29  ? 18.295  25.317  -55.149  1.00 107.87 ?  29  DT  G OP1   1 
ATOM   7430 O  OP2   . DT  F 3 29  ? 17.983  24.941  -52.649  1.00 106.90 ?  29  DT  G OP2   1 
ATOM   7431 O  "O5'" . DT  F 3 29  ? 20.271  25.131  -53.605  1.00 107.68 ?  29  DT  G "O5'" 1 
ATOM   7432 C  "C5'" . DT  F 3 29  ? 21.192  24.984  -54.685  1.00 109.24 ?  29  DT  G "C5'" 1 
ATOM   7433 C  "C4'" . DT  F 3 29  ? 21.922  26.269  -55.024  1.00 105.68 ?  29  DT  G "C4'" 1 
ATOM   7434 O  "O4'" . DT  F 3 29  ? 22.324  26.971  -53.829  1.00 103.01 ?  29  DT  G "O4'" 1 
ATOM   7435 C  "C3'" . DT  F 3 29  ? 23.251  26.062  -55.719  1.00 108.13 ?  29  DT  G "C3'" 1 
ATOM   7436 O  "O3'" . DT  F 3 29  ? 23.050  25.758  -57.074  1.00 110.47 ?  29  DT  G "O3'" 1 
ATOM   7437 C  "C2'" . DT  F 3 29  ? 23.907  27.417  -55.533  1.00 104.26 ?  29  DT  G "C2'" 1 
ATOM   7438 C  "C1'" . DT  F 3 29  ? 23.518  27.699  -54.084  1.00 102.05 ?  29  DT  G "C1'" 1 
ATOM   7439 N  N1    . DT  F 3 29  ? 24.560  27.407  -53.014  1.00 103.55 ?  29  DT  G N1    1 
ATOM   7440 C  C2    . DT  F 3 29  ? 25.846  27.963  -53.053  1.00 103.37 ?  29  DT  G C2    1 
ATOM   7441 O  O2    . DT  F 3 29  ? 26.303  28.668  -53.944  1.00 102.04 ?  29  DT  G O2    1 
ATOM   7442 N  N3    . DT  F 3 29  ? 26.639  27.623  -51.979  1.00 105.27 ?  29  DT  G N3    1 
ATOM   7443 C  C4    . DT  F 3 29  ? 26.302  26.836  -50.885  1.00 107.33 ?  29  DT  G C4    1 
ATOM   7444 O  O4    . DT  F 3 29  ? 27.154  26.621  -50.022  1.00 109.32 ?  29  DT  G O4    1 
ATOM   7445 C  C5    . DT  F 3 29  ? 24.949  26.312  -50.886  1.00 107.13 ?  29  DT  G C5    1 
ATOM   7446 C  C7    . DT  F 3 29  ? 24.451  25.443  -49.762  1.00 109.24 ?  29  DT  G C7    1 
ATOM   7447 C  C6    . DT  F 3 29  ? 24.167  26.618  -51.934  1.00 105.31 ?  29  DT  G C6    1 
ATOM   7448 P  P     . DA  F 3 30  ? 23.714  24.441  -57.679  1.00 116.53 ?  30  DA  G P     1 
ATOM   7449 O  OP1   . DA  F 3 30  ? 23.001  24.106  -58.931  1.00 118.32 ?  30  DA  G OP1   1 
ATOM   7450 O  OP2   . DA  F 3 30  ? 23.821  23.429  -56.608  1.00 119.40 ?  30  DA  G OP2   1 
ATOM   7451 O  "O5'" . DA  F 3 30  ? 25.204  24.903  -58.002  1.00 117.55 ?  30  DA  G "O5'" 1 
ATOM   7452 C  "C5'" . DA  F 3 30  ? 25.489  25.982  -58.872  1.00 116.57 ?  30  DA  G "C5'" 1 
ATOM   7453 C  "C4'" . DA  F 3 30  ? 26.886  26.495  -58.599  1.00 117.87 ?  30  DA  G "C4'" 1 
ATOM   7454 O  "O4'" . DA  F 3 30  ? 27.004  26.785  -57.187  1.00 116.26 ?  30  DA  G "O4'" 1 
ATOM   7455 C  "C3'" . DA  F 3 30  ? 27.982  25.498  -58.929  1.00 124.01 ?  30  DA  G "C3'" 1 
ATOM   7456 O  "O3'" . DA  F 3 30  ? 28.570  25.852  -60.167  1.00 126.40 ?  30  DA  G "O3'" 1 
ATOM   7457 C  "C2'" . DA  F 3 30  ? 28.976  25.590  -57.777  1.00 123.89 ?  30  DA  G "C2'" 1 
ATOM   7458 C  "C1'" . DA  F 3 30  ? 28.281  26.419  -56.713  1.00 119.11 ?  30  DA  G "C1'" 1 
ATOM   7459 N  N9    . DA  F 3 30  ? 28.175  25.781  -55.401  1.00 120.25 ?  30  DA  G N9    1 
ATOM   7460 C  C8    . DA  F 3 30  ? 27.076  25.166  -54.858  1.00 120.43 ?  30  DA  G C8    1 
ATOM   7461 N  N7    . DA  F 3 30  ? 27.250  24.725  -53.636  1.00 121.34 ?  30  DA  G N7    1 
ATOM   7462 C  C5    . DA  F 3 30  ? 28.555  25.085  -53.348  1.00 122.10 ?  30  DA  G C5    1 
ATOM   7463 C  C6    . DA  F 3 30  ? 29.360  24.910  -52.195  1.00 123.85 ?  30  DA  G C6    1 
ATOM   7464 N  N6    . DA  F 3 30  ? 28.916  24.300  -51.091  1.00 125.01 ?  30  DA  G N6    1 
ATOM   7465 N  N1    . DA  F 3 30  ? 30.641  25.368  -52.231  1.00 124.55 ?  30  DA  G N1    1 
ATOM   7466 C  C2    . DA  F 3 30  ? 31.082  25.975  -53.350  1.00 123.80 ?  30  DA  G C2    1 
ATOM   7467 N  N3    . DA  F 3 30  ? 30.413  26.206  -54.490  1.00 122.28 ?  30  DA  G N3    1 
ATOM   7468 C  C4    . DA  F 3 30  ? 29.145  25.737  -54.425  1.00 121.41 ?  30  DA  G C4    1 
ATOM   7469 P  P     . DT  F 3 31  ? 29.219  24.772  -61.156  1.00 133.43 ?  31  DT  G P     1 
ATOM   7470 O  OP1   . DT  F 3 31  ? 29.395  25.476  -62.449  1.00 133.18 ?  31  DT  G OP1   1 
ATOM   7471 O  OP2   . DT  F 3 31  ? 28.447  23.505  -61.114  1.00 136.74 ?  31  DT  G OP2   1 
ATOM   7472 O  "O5'" . DT  F 3 31  ? 30.645  24.470  -60.483  1.00 136.46 ?  31  DT  G "O5'" 1 
ATOM   7473 C  "C5'" . DT  F 3 31  ? 31.664  25.470  -60.352  1.00 135.21 ?  31  DT  G "C5'" 1 
ATOM   7474 C  "C4'" . DT  F 3 31  ? 32.784  25.026  -59.426  1.00 138.26 ?  31  DT  G "C4'" 1 
ATOM   7475 O  "O4'" . DT  F 3 31  ? 32.304  24.930  -58.064  1.00 135.96 ?  31  DT  G "O4'" 1 
ATOM   7476 C  "C3'" . DT  F 3 31  ? 33.388  23.671  -59.764  1.00 145.50 ?  31  DT  G "C3'" 1 
ATOM   7477 O  "O3'" . DT  F 3 31  ? 34.700  23.816  -60.293  1.00 149.87 ?  31  DT  G "O3'" 1 
ATOM   7478 C  "C2'" . DT  F 3 31  ? 33.350  22.868  -58.468  1.00 146.36 ?  31  DT  G "C2'" 1 
ATOM   7479 C  "C1'" . DT  F 3 31  ? 32.999  23.895  -57.403  1.00 140.09 ?  31  DT  G "C1'" 1 
ATOM   7480 N  N1    . DT  F 3 31  ? 32.170  23.352  -56.269  1.00 138.35 ?  31  DT  G N1    1 
ATOM   7481 C  C2    . DT  F 3 31  ? 32.710  23.268  -54.989  1.00 138.46 ?  31  DT  G C2    1 
ATOM   7482 O  O2    . DT  F 3 31  ? 33.846  23.601  -54.690  1.00 139.44 ?  31  DT  G O2    1 
ATOM   7483 N  N3    . DT  F 3 31  ? 31.850  22.766  -54.035  1.00 137.67 ?  31  DT  G N3    1 
ATOM   7484 C  C4    . DT  F 3 31  ? 30.538  22.346  -54.220  1.00 136.67 ?  31  DT  G C4    1 
ATOM   7485 O  O4    . DT  F 3 31  ? 29.916  21.919  -53.250  1.00 136.48 ?  31  DT  G O4    1 
ATOM   7486 C  C5    . DT  F 3 31  ? 30.036  22.459  -55.579  1.00 136.37 ?  31  DT  G C5    1 
ATOM   7487 C  C7    . DT  F 3 31  ? 28.635  22.053  -55.941  1.00 135.87 ?  31  DT  G C7    1 
ATOM   7488 C  C6    . DT  F 3 31  ? 30.870  22.931  -56.518  1.00 137.07 ?  31  DT  G C6    1 
ATOM   7489 P  P     . DA  F 3 32  ? 35.452  22.616  -61.046  1.00 158.23 ?  32  DA  G P     1 
ATOM   7490 O  OP1   . DA  F 3 32  ? 36.445  23.222  -61.960  1.00 159.59 ?  32  DA  G OP1   1 
ATOM   7491 O  OP2   . DA  F 3 32  ? 34.461  21.654  -61.588  1.00 160.08 ?  32  DA  G OP2   1 
ATOM   7492 O  "O5'" . DA  F 3 32  ? 36.220  21.883  -59.850  1.00 163.07 ?  32  DA  G "O5'" 1 
ATOM   7493 C  "C5'" . DA  F 3 32  ? 37.095  22.580  -58.956  1.00 163.26 ?  32  DA  G "C5'" 1 
ATOM   7494 C  "C4'" . DA  F 3 32  ? 37.354  21.768  -57.696  1.00 167.07 ?  32  DA  G "C4'" 1 
ATOM   7495 O  "O4'" . DA  F 3 32  ? 36.172  21.740  -56.850  1.00 163.74 ?  32  DA  G "O4'" 1 
ATOM   7496 C  "C3'" . DA  F 3 32  ? 37.788  20.318  -57.920  1.00 174.98 ?  32  DA  G "C3'" 1 
ATOM   7497 O  "O3'" . DA  F 3 32  ? 39.030  20.086  -57.266  1.00 178.09 ?  32  DA  G "O3'" 1 
ATOM   7498 C  "C2'" . DA  F 3 32  ? 36.645  19.514  -57.305  1.00 174.37 ?  32  DA  G "C2'" 1 
ATOM   7499 C  "C1'" . DA  F 3 32  ? 36.111  20.469  -56.240  1.00 167.94 ?  32  DA  G "C1'" 1 
ATOM   7500 N  N9    . DA  F 3 32  ? 34.763  20.170  -55.736  1.00 164.80 ?  32  DA  G N9    1 
ATOM   7501 C  C8    . DA  F 3 32  ? 33.619  19.985  -56.471  1.00 163.13 ?  32  DA  G C8    1 
ATOM   7502 N  N7    . DA  F 3 32  ? 32.553  19.698  -55.763  1.00 161.11 ?  32  DA  G N7    1 
ATOM   7503 C  C5    . DA  F 3 32  ? 33.026  19.678  -54.464  1.00 161.31 ?  32  DA  G C5    1 
ATOM   7504 C  C6    . DA  F 3 32  ? 32.389  19.429  -53.223  1.00 160.32 ?  32  DA  G C6    1 
ATOM   7505 N  N6    . DA  F 3 32  ? 31.086  19.146  -53.120  1.00 159.05 ?  32  DA  G N6    1 
ATOM   7506 N  N1    . DA  F 3 32  ? 33.144  19.481  -52.093  1.00 161.11 ?  32  DA  G N1    1 
ATOM   7507 C  C2    . DA  F 3 32  ? 34.458  19.751  -52.202  1.00 162.91 ?  32  DA  G C2    1 
ATOM   7508 N  N3    . DA  F 3 32  ? 35.161  20.014  -53.312  1.00 164.03 ?  32  DA  G N3    1 
ATOM   7509 C  C4    . DA  F 3 32  ? 34.389  19.959  -54.423  1.00 163.36 ?  32  DA  G C4    1 
ATOM   7510 P  P     . DT  F 3 33  ? 40.041  18.872  -57.567  1.00 182.22 ?  33  DT  G P     1 
ATOM   7511 O  OP1   . DT  F 3 33  ? 40.763  19.181  -58.823  1.00 183.23 ?  33  DT  G OP1   1 
ATOM   7512 O  OP2   . DT  F 3 33  ? 39.344  17.568  -57.441  1.00 183.50 ?  33  DT  G OP2   1 
ATOM   7513 O  "O5'" . DT  F 3 33  ? 41.070  18.986  -56.339  1.00 183.48 ?  33  DT  G "O5'" 1 
ATOM   7514 C  "C5'" . DT  F 3 33  ? 40.710  19.453  -55.020  1.00 183.10 ?  33  DT  G "C5'" 1 
ATOM   7515 C  "C4'" . DT  F 3 33  ? 40.140  18.382  -54.095  1.00 184.55 ?  33  DT  G "C4'" 1 
ATOM   7516 O  "O4'" . DT  F 3 33  ? 38.691  18.361  -54.092  1.00 183.27 ?  33  DT  G "O4'" 1 
ATOM   7517 C  "C3'" . DT  F 3 33  ? 40.598  16.935  -54.274  1.00 187.14 ?  33  DT  G "C3'" 1 
ATOM   7518 O  "O3'" . DT  F 3 33  ? 41.618  16.654  -53.307  1.00 188.84 ?  33  DT  G "O3'" 1 
ATOM   7519 C  "C2'" . DT  F 3 33  ? 39.320  16.112  -54.075  1.00 186.68 ?  33  DT  G "C2'" 1 
ATOM   7520 C  "C1'" . DT  F 3 33  ? 38.325  17.126  -53.515  1.00 184.25 ?  33  DT  G "C1'" 1 
ATOM   7521 N  N1    . DT  F 3 33  ? 36.845  16.830  -53.704  1.00 182.92 ?  33  DT  G N1    1 
ATOM   7522 C  C2    . DT  F 3 33  ? 36.029  16.641  -52.588  1.00 182.06 ?  33  DT  G C2    1 
ATOM   7523 O  O2    . DT  F 3 33  ? 36.416  16.678  -51.429  1.00 182.13 ?  33  DT  G O2    1 
ATOM   7524 N  N3    . DT  F 3 33  ? 34.702  16.390  -52.878  1.00 181.18 ?  33  DT  G N3    1 
ATOM   7525 C  C4    . DT  F 3 33  ? 34.111  16.312  -54.133  1.00 180.96 ?  33  DT  G C4    1 
ATOM   7526 O  O4    . DT  F 3 33  ? 32.906  16.078  -54.207  1.00 180.47 ?  33  DT  G O4    1 
ATOM   7527 C  C5    . DT  F 3 33  ? 35.008  16.522  -55.255  1.00 181.65 ?  33  DT  G C5    1 
ATOM   7528 C  C7    . DT  F 3 33  ? 34.503  16.457  -56.670  1.00 181.68 ?  33  DT  G C7    1 
ATOM   7529 C  C6    . DT  F 3 33  ? 36.307  16.762  -54.988  1.00 182.56 ?  33  DT  G C6    1 
ATOM   7530 P  P     . DA  F 3 34  ? 42.373  15.258  -53.048  1.00 191.66 ?  34  DA  G P     1 
ATOM   7531 O  OP1   . DA  F 3 34  ? 43.740  15.580  -52.579  1.00 192.46 ?  34  DA  G OP1   1 
ATOM   7532 O  OP2   . DA  F 3 34  ? 42.213  14.355  -54.215  1.00 192.84 ?  34  DA  G OP2   1 
ATOM   7533 O  "O5'" . DA  F 3 34  ? 41.530  14.645  -51.829  1.00 191.88 ?  34  DA  G "O5'" 1 
ATOM   7534 C  "C5'" . DA  F 3 34  ? 41.409  15.304  -50.557  1.00 191.18 ?  34  DA  G "C5'" 1 
ATOM   7535 C  "C4'" . DA  F 3 34  ? 40.388  14.627  -49.653  1.00 191.44 ?  34  DA  G "C4'" 1 
ATOM   7536 O  "O4'" . DA  F 3 34  ? 39.051  14.811  -50.188  1.00 190.50 ?  34  DA  G "O4'" 1 
ATOM   7537 C  "C3'" . DA  F 3 34  ? 40.585  13.127  -49.436  1.00 193.53 ?  34  DA  G "C3'" 1 
ATOM   7538 O  "O3'" . DA  F 3 34  ? 40.721  12.826  -48.048  1.00 194.25 ?  34  DA  G "O3'" 1 
ATOM   7539 C  "C2'" . DA  F 3 34  ? 39.337  12.496  -50.047  1.00 193.51 ?  34  DA  G "C2'" 1 
ATOM   7540 C  "C1'" . DA  F 3 34  ? 38.311  13.620  -50.016  1.00 191.47 ?  34  DA  G "C1'" 1 
ATOM   7541 N  N9    . DA  F 3 34  ? 37.300  13.502  -51.072  1.00 191.05 ?  34  DA  G N9    1 
ATOM   7542 C  C8    . DA  F 3 34  ? 37.516  13.552  -52.424  1.00 191.26 ?  34  DA  G C8    1 
ATOM   7543 N  N7    . DA  F 3 34  ? 36.438  13.405  -53.155  1.00 190.81 ?  34  DA  G N7    1 
ATOM   7544 C  C5    . DA  F 3 34  ? 35.435  13.222  -52.220  1.00 190.26 ?  34  DA  G C5    1 
ATOM   7545 C  C6    . DA  F 3 34  ? 34.041  13.004  -52.349  1.00 189.77 ?  34  DA  G C6    1 
ATOM   7546 N  N6    . DA  F 3 34  ? 33.415  12.931  -53.529  1.00 189.74 ?  34  DA  G N6    1 
ATOM   7547 N  N1    . DA  F 3 34  ? 33.312  12.861  -51.214  1.00 189.46 ?  34  DA  G N1    1 
ATOM   7548 C  C2    . DA  F 3 34  ? 33.938  12.918  -50.026  1.00 189.58 ?  34  DA  G C2    1 
ATOM   7549 N  N3    . DA  F 3 34  ? 35.238  13.129  -49.782  1.00 189.98 ?  34  DA  G N3    1 
ATOM   7550 C  C4    . DA  F 3 34  ? 35.945  13.272  -50.927  1.00 190.39 ?  34  DA  G C4    1 
ATOM   7551 P  P     . DA  F 3 35  ? 41.300  11.451  -47.438  1.00 196.80 ?  35  DA  G P     1 
ATOM   7552 O  OP1   . DA  F 3 35  ? 42.745  11.647  -47.181  1.00 198.34 ?  35  DA  G OP1   1 
ATOM   7553 O  OP2   . DA  F 3 35  ? 40.887  10.277  -48.247  1.00 198.48 ?  35  DA  G OP2   1 
ATOM   7554 O  "O5'" . DA  F 3 35  ? 40.536  11.346  -46.028  1.00 195.92 ?  35  DA  G "O5'" 1 
ATOM   7555 C  "C5'" . DA  F 3 35  ? 39.283  11.987  -45.705  1.00 194.26 ?  35  DA  G "C5'" 1 
ATOM   7556 C  "C4'" . DA  F 3 35  ? 38.050  11.103  -45.860  1.00 194.57 ?  35  DA  G "C4'" 1 
ATOM   7557 O  "O4'" . DA  F 3 35  ? 37.451  11.217  -47.175  1.00 194.17 ?  35  DA  G "O4'" 1 
ATOM   7558 C  "C3'" . DA  F 3 35  ? 38.164  9.605   -45.561  1.00 195.17 ?  35  DA  G "C3'" 1 
ATOM   7559 O  "O3'" . DA  F 3 35  ? 37.503  9.312   -44.322  1.00 194.84 ?  35  DA  G "O3'" 1 
ATOM   7560 C  "C2'" . DA  F 3 35  ? 37.489  8.933   -46.760  1.00 195.78 ?  35  DA  G "C2'" 1 
ATOM   7561 C  "C1'" . DA  F 3 35  ? 36.649  10.067  -47.337  1.00 195.03 ?  35  DA  G "C1'" 1 
ATOM   7562 N  N9    . DA  F 3 35  ? 36.224  9.907   -48.732  1.00 195.16 ?  35  DA  G N9    1 
ATOM   7563 C  C8    . DA  F 3 35  ? 37.021  9.868   -49.845  1.00 195.33 ?  35  DA  G C8    1 
ATOM   7564 N  N7    . DA  F 3 35  ? 36.370  9.729   -50.976  1.00 195.28 ?  35  DA  G N7    1 
ATOM   7565 C  C5    . DA  F 3 35  ? 35.045  9.661   -50.582  1.00 194.82 ?  35  DA  G C5    1 
ATOM   7566 C  C6    . DA  F 3 35  ? 33.837  9.519   -51.308  1.00 194.38 ?  35  DA  G C6    1 
ATOM   7567 N  N6    . DA  F 3 35  ? 33.802  9.406   -52.638  1.00 194.86 ?  35  DA  G N6    1 
ATOM   7568 N  N1    . DA  F 3 35  ? 32.667  9.493   -50.618  1.00 193.66 ?  35  DA  G N1    1 
ATOM   7569 C  C2    . DA  F 3 35  ? 32.703  9.609   -49.279  1.00 193.48 ?  35  DA  G C2    1 
ATOM   7570 N  N3    . DA  F 3 35  ? 33.777  9.754   -48.490  1.00 193.90 ?  35  DA  G N3    1 
ATOM   7571 C  C4    . DA  F 3 35  ? 34.931  9.763   -49.200  1.00 194.63 ?  35  DA  G C4    1 
ATOM   7572 P  P     . DT  F 3 36  ? 37.428  7.883   -43.580  1.00 196.01 ?  36  DT  G P     1 
ATOM   7573 O  OP1   . DT  F 3 36  ? 37.462  8.148   -42.122  1.00 196.80 ?  36  DT  G OP1   1 
ATOM   7574 O  OP2   . DT  F 3 36  ? 38.410  6.933   -44.163  1.00 197.41 ?  36  DT  G OP2   1 
ATOM   7575 O  "O5'" . DT  F 3 36  ? 35.964  7.367   -43.979  1.00 194.51 ?  36  DT  G "O5'" 1 
ATOM   7576 C  "C5'" . DT  F 3 36  ? 34.787  8.100   -43.622  1.00 193.06 ?  36  DT  G "C5'" 1 
ATOM   7577 C  "C4'" . DT  F 3 36  ? 33.565  7.579   -44.357  1.00 192.37 ?  36  DT  G "C4'" 1 
ATOM   7578 O  "O4'" . DT  F 3 36  ? 33.764  7.668   -45.789  1.00 192.04 ?  36  DT  G "O4'" 1 
ATOM   7579 C  "C3'" . DT  F 3 36  ? 33.172  6.135   -44.056  1.00 190.96 ?  36  DT  G "C3'" 1 
ATOM   7580 O  "O3'" . DT  F 3 36  ? 31.827  6.111   -43.587  1.00 191.58 ?  36  DT  G "O3'" 1 
ATOM   7581 C  "C2'" . DT  F 3 36  ? 33.329  5.406   -45.391  1.00 190.21 ?  36  DT  G "C2'" 1 
ATOM   7582 C  "C1'" . DT  F 3 36  ? 33.153  6.546   -46.389  1.00 191.02 ?  36  DT  G "C1'" 1 
ATOM   7583 N  N1    . DT  F 3 36  ? 33.669  6.338   -47.798  1.00 190.35 ?  36  DT  G N1    1 
ATOM   7584 C  C2    . DT  F 3 36  ? 32.766  6.158   -48.845  1.00 190.13 ?  36  DT  G C2    1 
ATOM   7585 O  O2    . DT  F 3 36  ? 31.551  6.116   -48.719  1.00 190.61 ?  36  DT  G O2    1 
ATOM   7586 N  N3    . DT  F 3 36  ? 33.344  6.015   -50.088  1.00 189.96 ?  36  DT  G N3    1 
ATOM   7587 C  C4    . DT  F 3 36  ? 34.699  6.041   -50.395  1.00 189.63 ?  36  DT  G C4    1 
ATOM   7588 O  O4    . DT  F 3 36  ? 35.039  5.896   -51.568  1.00 189.74 ?  36  DT  G O4    1 
ATOM   7589 C  C5    . DT  F 3 36  ? 35.589  6.246   -49.265  1.00 189.38 ?  36  DT  G C5    1 
ATOM   7590 C  C7    . DT  F 3 36  ? 37.080  6.290   -49.451  1.00 188.90 ?  36  DT  G C7    1 
ATOM   7591 C  C6    . DT  F 3 36  ? 35.040  6.386   -48.044  1.00 189.72 ?  36  DT  G C6    1 
ATOM   7592 P  P     . DT  F 3 37  ? 31.258  5.154   -42.432  1.00 190.84 ?  37  DT  G P     1 
ATOM   7593 O  OP1   . DT  F 3 37  ? 30.583  6.029   -41.443  1.00 191.92 ?  37  DT  G OP1   1 
ATOM   7594 O  OP2   . DT  F 3 37  ? 32.308  4.207   -41.980  1.00 190.34 ?  37  DT  G OP2   1 
ATOM   7595 O  "O5'" . DT  F 3 37  ? 30.160  4.289   -43.211  1.00 188.95 ?  37  DT  G "O5'" 1 
ATOM   7596 C  "C5'" . DT  F 3 37  ? 29.047  4.922   -43.835  1.00 187.85 ?  37  DT  G "C5'" 1 
ATOM   7597 C  "C4'" . DT  F 3 37  ? 28.700  4.278   -45.164  1.00 185.41 ?  37  DT  G "C4'" 1 
ATOM   7598 O  "O4'" . DT  F 3 37  ? 29.808  4.306   -46.097  1.00 184.24 ?  37  DT  G "O4'" 1 
ATOM   7599 C  "C3'" . DT  F 3 37  ? 28.215  2.832   -45.122  1.00 184.00 ?  37  DT  G "C3'" 1 
ATOM   7600 O  "O3'" . DT  F 3 37  ? 26.785  2.863   -45.241  1.00 184.46 ?  37  DT  G "O3'" 1 
ATOM   7601 C  "C2'" . DT  F 3 37  ? 28.973  2.157   -46.272  1.00 182.77 ?  37  DT  G "C2'" 1 
ATOM   7602 C  "C1'" . DT  F 3 37  ? 29.463  3.352   -47.077  1.00 182.74 ?  37  DT  G "C1'" 1 
ATOM   7603 N  N1    . DT  F 3 37  ? 30.569  3.098   -48.074  1.00 180.52 ?  37  DT  G N1    1 
ATOM   7604 C  C2    . DT  F 3 37  ? 30.267  2.999   -49.432  1.00 179.92 ?  37  DT  G C2    1 
ATOM   7605 O  O2    . DT  F 3 37  ? 29.144  3.089   -49.903  1.00 180.11 ?  37  DT  G O2    1 
ATOM   7606 N  N3    . DT  F 3 37  ? 31.353  2.776   -50.252  1.00 179.31 ?  37  DT  G N3    1 
ATOM   7607 C  C4    . DT  F 3 37  ? 32.682  2.641   -49.870  1.00 178.69 ?  37  DT  G C4    1 
ATOM   7608 O  O4    . DT  F 3 37  ? 33.528  2.442   -50.740  1.00 178.25 ?  37  DT  G O4    1 
ATOM   7609 C  C5    . DT  F 3 37  ? 32.932  2.749   -48.442  1.00 178.69 ?  37  DT  G C5    1 
ATOM   7610 C  C7    . DT  F 3 37  ? 34.321  2.622   -47.882  1.00 178.04 ?  37  DT  G C7    1 
ATOM   7611 C  C6    . DT  F 3 37  ? 31.880  2.966   -47.631  1.00 179.33 ?  37  DT  G C6    1 
ATOM   7612 P  P     . DG  F 3 38  ? 25.750  1.818   -45.884  1.00 184.05 ?  38  DG  G P     1 
ATOM   7613 O  OP1   . DG  F 3 38  ? 24.414  2.177   -45.350  1.00 185.22 ?  38  DG  G OP1   1 
ATOM   7614 O  OP2   . DG  F 3 38  ? 26.243  0.430   -45.717  1.00 185.54 ?  38  DG  G OP2   1 
ATOM   7615 O  "O5'" . DG  F 3 38  ? 25.847  2.208   -47.437  1.00 183.81 ?  38  DG  G "O5'" 1 
ATOM   7616 C  "C5'" . DG  F 3 38  ? 24.717  2.376   -48.294  1.00 182.72 ?  38  DG  G "C5'" 1 
ATOM   7617 C  "C4'" . DG  F 3 38  ? 24.598  1.219   -49.268  1.00 180.55 ?  38  DG  G "C4'" 1 
ATOM   7618 O  "O4'" . DG  F 3 38  ? 25.890  0.987   -49.880  1.00 180.10 ?  38  DG  G "O4'" 1 
ATOM   7619 C  "C3'" . DG  F 3 38  ? 24.150  -0.099  -48.647  1.00 181.33 ?  38  DG  G "C3'" 1 
ATOM   7620 O  "O3'" . DG  F 3 38  ? 22.825  -0.484  -49.075  1.00 181.58 ?  38  DG  G "O3'" 1 
ATOM   7621 C  "C2'" . DG  F 3 38  ? 25.278  -1.106  -48.894  1.00 185.49 ?  38  DG  G "C2'" 1 
ATOM   7622 C  "C1'" . DG  F 3 38  ? 26.220  -0.388  -49.864  1.00 183.42 ?  38  DG  G "C1'" 1 
ATOM   7623 N  N9    . DG  F 3 38  ? 27.663  -0.511  -49.615  1.00 182.90 ?  38  DG  G N9    1 
ATOM   7624 C  C8    . DG  F 3 38  ? 28.303  -0.604  -48.398  1.00 182.94 ?  38  DG  G C8    1 
ATOM   7625 N  N7    . DG  F 3 38  ? 29.603  -0.648  -48.480  1.00 182.94 ?  38  DG  G N7    1 
ATOM   7626 C  C5    . DG  F 3 38  ? 29.858  -0.572  -49.842  1.00 181.99 ?  38  DG  G C5    1 
ATOM   7627 C  C6    . DG  F 3 38  ? 31.096  -0.577  -50.547  1.00 181.64 ?  38  DG  G C6    1 
ATOM   7628 O  O6    . DG  F 3 38  ? 32.242  -0.646  -50.077  1.00 181.26 ?  38  DG  G O6    1 
ATOM   7629 N  N1    . DG  F 3 38  ? 30.924  -0.484  -51.935  1.00 182.40 ?  38  DG  G N1    1 
ATOM   7630 C  C2    . DG  F 3 38  ? 29.696  -0.402  -52.563  1.00 182.26 ?  38  DG  G C2    1 
ATOM   7631 N  N2    . DG  F 3 38  ? 29.711  -0.327  -53.903  1.00 182.85 ?  38  DG  G N2    1 
ATOM   7632 N  N3    . DG  F 3 38  ? 28.531  -0.385  -51.912  1.00 181.74 ?  38  DG  G N3    1 
ATOM   7633 C  C4    . DG  F 3 38  ? 28.676  -0.472  -50.557  1.00 182.01 ?  38  DG  G C4    1 
ATOM   7634 P  P     . DG  F 3 39  ? 22.309  -1.211  -50.418  1.00 185.68 ?  39  DG  G P     1 
ATOM   7635 O  OP1   . DG  F 3 39  ? 20.949  -0.678  -50.678  1.00 184.60 ?  39  DG  G OP1   1 
ATOM   7636 O  OP2   . DG  F 3 39  ? 22.500  -2.673  -50.245  1.00 190.89 ?  39  DG  G OP2   1 
ATOM   7637 O  "O5'" . DG  F 3 39  ? 23.299  -0.716  -51.584  1.00 184.18 ?  39  DG  G "O5'" 1 
ATOM   7638 C  "C5'" . DG  F 3 39  ? 23.008  -0.804  -52.980  1.00 184.78 ?  39  DG  G "C5'" 1 
ATOM   7639 C  "C4'" . DG  F 3 39  ? 23.769  -1.924  -53.671  1.00 188.60 ?  39  DG  G "C4'" 1 
ATOM   7640 O  "O4'" . DG  F 3 39  ? 25.135  -2.019  -53.195  1.00 188.23 ?  39  DG  G "O4'" 1 
ATOM   7641 C  "C3'" . DG  F 3 39  ? 23.170  -3.321  -53.548  1.00 193.22 ?  39  DG  G "C3'" 1 
ATOM   7642 O  "O3'" . DG  F 3 39  ? 22.942  -3.831  -54.855  1.00 196.56 ?  39  DG  G "O3'" 1 
ATOM   7643 C  "C2'" . DG  F 3 39  ? 24.244  -4.131  -52.825  1.00 194.62 ?  39  DG  G "C2'" 1 
ATOM   7644 C  "C1'" . DG  F 3 39  ? 25.509  -3.381  -53.231  1.00 192.41 ?  39  DG  G "C1'" 1 
ATOM   7645 N  N9    . DG  F 3 39  ? 26.698  -3.555  -52.390  1.00 191.38 ?  39  DG  G N9    1 
ATOM   7646 C  C8    . DG  F 3 39  ? 26.747  -3.669  -51.018  1.00 191.36 ?  39  DG  G C8    1 
ATOM   7647 N  N7    . DG  F 3 39  ? 27.955  -3.745  -50.534  1.00 191.21 ?  39  DG  G N7    1 
ATOM   7648 C  C5    . DG  F 3 39  ? 28.772  -3.680  -51.654  1.00 191.12 ?  39  DG  G C5    1 
ATOM   7649 C  C6    . DG  F 3 39  ? 30.191  -3.725  -51.755  1.00 191.52 ?  39  DG  G C6    1 
ATOM   7650 O  O6    . DG  F 3 39  ? 31.014  -3.837  -50.835  1.00 191.63 ?  39  DG  G O6    1 
ATOM   7651 N  N1    . DG  F 3 39  ? 30.636  -3.619  -53.080  1.00 192.50 ?  39  DG  G N1    1 
ATOM   7652 C  C2    . DG  F 3 39  ? 29.802  -3.500  -54.178  1.00 192.39 ?  39  DG  G C2    1 
ATOM   7653 N  N2    . DG  F 3 39  ? 30.398  -3.400  -55.375  1.00 193.39 ?  39  DG  G N2    1 
ATOM   7654 N  N3    . DG  F 3 39  ? 28.471  -3.449  -54.093  1.00 191.66 ?  39  DG  G N3    1 
ATOM   7655 C  C4    . DG  F 3 39  ? 28.016  -3.551  -52.808  1.00 191.18 ?  39  DG  G C4    1 
ATOM   7656 P  P     . DC  F 3 40  ? 21.705  -4.770  -55.240  1.00 199.92 ?  40  DC  G P     1 
ATOM   7657 O  OP1   . DC  F 3 40  ? 20.932  -4.036  -56.270  1.00 197.29 ?  40  DC  G OP1   1 
ATOM   7658 O  OP2   . DC  F 3 40  ? 21.014  -5.232  -54.010  1.00 200.62 ?  40  DC  G OP2   1 
ATOM   7659 O  "O5'" . DC  F 3 40  ? 22.428  -6.054  -55.884  1.00 201.95 ?  40  DC  G "O5'" 1 
ATOM   7660 C  "C5'" . DC  F 3 40  ? 23.075  -5.975  -57.156  1.00 201.57 ?  40  DC  G "C5'" 1 
ATOM   7661 C  "C4'" . DC  F 3 40  ? 24.494  -6.523  -57.156  1.00 201.10 ?  40  DC  G "C4'" 1 
ATOM   7662 O  "O4'" . DC  F 3 40  ? 25.261  -6.088  -56.009  1.00 200.81 ?  40  DC  G "O4'" 1 
ATOM   7663 C  "C3'" . DC  F 3 40  ? 24.649  -8.033  -57.135  1.00 200.84 ?  40  DC  G "C3'" 1 
ATOM   7664 O  "O3'" . DC  F 3 40  ? 24.489  -8.540  -58.452  1.00 201.01 ?  40  DC  G "O3'" 1 
ATOM   7665 C  "C2'" . DC  F 3 40  ? 26.084  -8.219  -56.633  1.00 200.53 ?  40  DC  G "C2'" 1 
ATOM   7666 C  "C1'" . DC  F 3 40  ? 26.446  -6.865  -56.016  1.00 200.27 ?  40  DC  G "C1'" 1 
ATOM   7667 N  N1    . DC  F 3 40  ? 27.118  -6.911  -54.650  1.00 199.37 ?  40  DC  G N1    1 
ATOM   7668 C  C2    . DC  F 3 40  ? 28.530  -6.814  -54.523  1.00 198.65 ?  40  DC  G C2    1 
ATOM   7669 O  O2    . DC  F 3 40  ? 29.260  -6.690  -55.519  1.00 198.27 ?  40  DC  G O2    1 
ATOM   7670 N  N3    . DC  F 3 40  ? 29.080  -6.859  -53.274  1.00 198.47 ?  40  DC  G N3    1 
ATOM   7671 C  C4    . DC  F 3 40  ? 28.301  -6.996  -52.189  1.00 198.49 ?  40  DC  G C4    1 
ATOM   7672 N  N4    . DC  F 3 40  ? 28.893  -7.029  -50.991  1.00 198.39 ?  40  DC  G N4    1 
ATOM   7673 C  C5    . DC  F 3 40  ? 26.876  -7.088  -52.288  1.00 198.64 ?  40  DC  G C5    1 
ATOM   7674 C  C6    . DC  F 3 40  ? 26.341  -7.049  -53.521  1.00 199.01 ?  40  DC  G C6    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . LYS A 7   ? 3.2265 1.1777 2.9508 0.1943  0.0959  -0.0646 7   LYS A N     
2    C  CA    . LYS A 7   ? 3.2070 1.1890 2.9918 0.2378  0.0822  -0.1019 7   LYS A CA    
3    C  C     . LYS A 7   ? 3.2155 1.2428 3.0138 0.2305  0.0824  -0.1557 7   LYS A C     
4    O  O     . LYS A 7   ? 3.1930 1.2474 3.0723 0.2380  0.0612  -0.1927 7   LYS A O     
5    C  CB    . LYS A 7   ? 3.1996 1.2329 2.9964 0.2937  0.0830  -0.0891 7   LYS A CB    
6    C  CG    . LYS A 7   ? 3.1547 1.3869 3.1959 0.2793  0.0090  -0.0581 7   LYS A CG    
7    C  CD    . LYS A 7   ? 3.0286 1.4934 3.0679 0.2567  0.0102  -0.0629 7   LYS A CD    
8    C  CE    . LYS A 7   ? 3.1894 1.6516 3.2360 0.2734  0.0051  -0.0297 7   LYS A CE    
9    N  NZ    . LYS A 7   ? 3.4028 1.8054 3.4539 0.2934  0.0076  -0.0428 7   LYS A NZ    
10   N  N     . LEU A 8   ? 3.2471 1.1926 2.8840 0.2233  0.1330  -0.1580 8   LEU A N     
11   C  CA    . LEU A 8   ? 3.2572 1.2008 2.8536 0.2181  0.1485  -0.2043 8   LEU A CA    
12   C  C     . LEU A 8   ? 3.2645 1.2300 2.8954 0.1521  0.1311  -0.2203 8   LEU A C     
13   O  O     . LEU A 8   ? 3.2741 1.2130 2.8537 0.1097  0.1461  -0.1944 8   LEU A O     
14   C  CB    . LEU A 8   ? 3.2742 1.2122 2.7653 0.2453  0.1891  -0.2027 8   LEU A CB    
15   C  CG    . LEU A 8   ? 3.2636 1.2925 2.8121 0.3088  0.1789  -0.2034 8   LEU A CG    
16   C  CD1   . LEU A 8   ? 3.2703 1.3012 2.7251 0.3290  0.2152  -0.1886 8   LEU A CD1   
17   C  CD2   . LEU A 8   ? 3.2466 1.3507 2.8855 0.3327  0.1579  -0.2537 8   LEU A CD2   
18   N  N     . LYS A 9   ? 3.2532 1.1879 2.8960 0.1481  0.1246  -0.2639 9   LYS A N     
19   C  CA    . LYS A 9   ? 3.2535 1.1809 2.9032 0.0918  0.1145  -0.2855 9   LYS A CA    
20   C  C     . LYS A 9   ? 3.2731 1.2372 2.8660 0.0786  0.1329  -0.3101 9   LYS A C     
21   O  O     . LYS A 9   ? 3.2847 1.2436 2.8136 0.1191  0.1609  -0.3169 9   LYS A O     
22   C  CB    . LYS A 9   ? 3.2271 1.2197 3.0191 0.0948  0.0656  -0.3232 9   LYS A CB    
23   C  CG    . LYS A 9   ? 3.1120 1.3485 3.0747 0.0911  0.0140  -0.2726 9   LYS A CG    
24   C  CD    . LYS A 9   ? 3.1850 1.4866 3.1426 0.0896  0.0149  -0.2833 9   LYS A CD    
25   C  CE    . LYS A 9   ? 3.3876 1.6208 3.3435 0.0467  0.0075  -0.2832 9   LYS A CE    
26   N  NZ    . LYS A 9   ? 3.5358 1.7336 3.4835 0.0510  0.0088  -0.3112 9   LYS A NZ    
27   N  N     . LYS A 10  ? 3.2762 1.1842 2.8086 0.0197  0.1464  -0.3222 10  LYS A N     
28   C  CA    . LYS A 10  ? 3.2883 1.1888 2.7351 -0.0080 0.1743  -0.3453 10  LYS A CA    
29   C  C     . LYS A 10  ? 3.2974 1.2444 2.7323 0.0394  0.1807  -0.3791 10  LYS A C     
30   O  O     . LYS A 10  ? 3.3025 1.2412 2.6573 0.0529  0.2165  -0.3683 10  LYS A O     
31   C  CB    . LYS A 10  ? 3.2769 1.2305 2.7950 -0.0648 0.1384  -0.3669 10  LYS A CB    
32   C  CG    . LYS A 10  ? 3.3233 1.4083 2.8840 -0.0870 0.1175  -0.3877 10  LYS A CG    
33   C  CD    . LYS A 10  ? 3.3303 1.5486 3.0477 -0.1113 0.0468  -0.4112 10  LYS A CD    
34   C  CE    . LYS A 10  ? 3.3460 1.7012 3.1201 -0.1349 0.0170  -0.4162 10  LYS A CE    
35   N  NZ    . LYS A 10  ? 3.2721 1.8259 3.1510 -0.1115 -0.0333 -0.4343 10  LYS A NZ    
36   N  N     . ASP A 11  ? 3.2814 1.2095 2.7364 0.0629  0.1693  -0.4197 11  ASP A N     
37   C  CA    . ASP A 11  ? 3.2770 1.2315 2.7078 0.1062  0.1816  -0.4559 11  ASP A CA    
38   C  C     . ASP A 11  ? 3.2876 1.2594 2.7090 0.1697  0.1995  -0.4369 11  ASP A C     
39   O  O     . ASP A 11  ? 3.2841 1.2703 2.6432 0.1938  0.2277  -0.4446 11  ASP A O     
40   C  CB    . ASP A 11  ? 3.2516 1.2819 2.8032 0.1162  0.1354  -0.5050 11  ASP A CB    
41   C  CG    . ASP A 11  ? 3.2417 1.4300 2.9337 0.0729  0.0724  -0.5334 11  ASP A CG    
42   O  OD1   . ASP A 11  ? 3.2562 1.4394 2.8828 0.0350  0.0869  -0.5225 11  ASP A OD1   
43   O  OD2   . ASP A 11  ? 3.2020 1.4981 3.0239 0.0768  0.0250  -0.5569 11  ASP A OD2   
44   N  N     . LYS A 12  ? 3.2842 1.1851 2.7034 0.1987  0.2040  -0.4106 12  LYS A N     
45   C  CA    . LYS A 12  ? 3.2808 1.1795 2.6823 0.2628  0.2218  -0.3895 12  LYS A CA    
46   C  C     . LYS A 12  ? 3.3019 1.1953 2.6261 0.2661  0.2524  -0.3491 12  LYS A C     
47   O  O     . LYS A 12  ? 3.2883 1.2104 2.5834 0.3158  0.2723  -0.3461 12  LYS A O     
48   C  CB    . LYS A 12  ? 3.2649 1.1970 2.7867 0.2795  0.1843  -0.3710 12  LYS A CB    
49   C  CG    . LYS A 12  ? 3.2295 1.3671 3.0184 0.2754  0.1065  -0.4173 12  LYS A CG    
50   C  CD    . LYS A 12  ? 3.1820 1.4990 3.1392 0.3069  0.0725  -0.4104 12  LYS A CD    
51   C  CE    . LYS A 12  ? 3.3140 1.6625 3.2653 0.3048  0.0750  -0.4196 12  LYS A CE    
52   N  NZ    . LYS A 12  ? 3.3834 1.7965 3.3538 0.3401  0.0833  -0.4058 12  LYS A NZ    
53   N  N     . ARG A 13  ? 3.3110 1.1079 2.5482 0.2165  0.2765  -0.3185 13  ARG A N     
54   C  CA    . ARG A 13  ? 3.3175 1.0823 2.4648 0.2112  0.3150  -0.2806 13  ARG A CA    
55   C  C     . ARG A 13  ? 3.3484 1.1274 2.4265 0.2073  0.3472  -0.3002 13  ARG A C     
56   O  O     . ARG A 13  ? 3.3712 1.1269 2.3720 0.2502  0.3859  -0.2800 13  ARG A O     
57   C  CB    . ARG A 13  ? 3.3227 1.0494 2.4599 0.1430  0.3159  -0.2543 13  ARG A CB    
58   C  CG    . ARG A 13  ? 3.3472 1.1100 2.4672 0.1383  0.3327  -0.2127 13  ARG A CG    
59   C  CD    . ARG A 13  ? 3.3567 1.1451 2.4950 0.0612  0.3301  -0.1972 13  ARG A CD    
60   N  NE    . ARG A 13  ? 3.2896 1.2166 2.6084 0.0087  0.2531  -0.2100 13  ARG A NE    
61   C  CZ    . ARG A 13  ? 3.3050 1.3852 2.7529 -0.0260 0.1987  -0.2420 13  ARG A CZ    
62   N  NH1   . ARG A 13  ? 3.3041 1.1888 2.5180 -0.0343 0.2909  -0.2733 13  ARG A NH1   
63   N  NH2   . ARG A 13  ? 3.2363 1.2438 2.6759 -0.0716 0.1956  -0.2508 13  ARG A NH2   
64   N  N     . ARG A 14  ? 3.3549 1.0821 2.3804 0.1607  0.3601  -0.3375 14  ARG A N     
65   C  CA    . ARG A 14  ? 3.3503 1.0944 2.3173 0.1452  0.3871  -0.3602 14  ARG A CA    
66   C  C     . ARG A 14  ? 3.3658 1.1758 2.3473 0.2169  0.3888  -0.3748 14  ARG A C     
67   O  O     . ARG A 14  ? 3.2401 1.1845 2.2740 0.2253  0.3817  -0.3672 14  ARG A O     
68   C  CB    . ARG A 14  ? 3.3668 1.0961 2.3290 0.0806  0.3764  -0.4006 14  ARG A CB    
69   C  CG    . ARG A 14  ? 3.3439 1.1757 2.4088 0.0058  0.3364  -0.3845 14  ARG A CG    
70   C  CD    . ARG A 14  ? 3.3281 1.2856 2.5261 -0.0378 0.2697  -0.4186 14  ARG A CD    
71   N  NE    . ARG A 14  ? 3.3215 1.3760 2.6049 -0.0985 0.2356  -0.4009 14  ARG A NE    
72   C  CZ    . ARG A 14  ? 3.3466 1.5807 2.8003 -0.1237 0.1552  -0.4177 14  ARG A CZ    
73   N  NH1   . ARG A 14  ? 3.3349 1.4653 2.7065 -0.1289 0.1743  -0.4654 14  ARG A NH1   
74   N  NH2   . ARG A 14  ? 3.3008 1.3954 2.6267 -0.2069 0.2084  -0.4104 14  ARG A NH2   
75   N  N     . GLU A 15  ? 3.3217 1.1453 2.3565 0.2624  0.3651  -0.3970 15  GLU A N     
76   C  CA    . GLU A 15  ? 3.3005 1.1789 2.3535 0.3328  0.3682  -0.4150 15  GLU A CA    
77   C  C     . GLU A 15  ? 3.3073 1.2154 2.3495 0.3885  0.3852  -0.3741 15  GLU A C     
78   O  O     . GLU A 15  ? 3.2857 1.2428 2.3054 0.4285  0.4053  -0.3776 15  GLU A O     
79   C  CB    . GLU A 15  ? 3.2892 1.2109 2.4556 0.3560  0.3261  -0.4434 15  GLU A CB    
80   C  CG    . GLU A 15  ? 3.2932 1.4047 2.6194 0.4092  0.2914  -0.4669 15  GLU A CG    
81   C  CD    . GLU A 15  ? 3.2927 1.7518 2.8960 0.3741  0.2138  -0.5267 15  GLU A CD    
82   O  OE1   . GLU A 15  ? 3.3027 1.7229 2.7848 0.3820  0.2544  -0.5216 15  GLU A OE1   
83   O  OE2   . GLU A 15  ? 3.2737 1.6352 2.8311 0.3971  0.2300  -0.5625 15  GLU A OE2   
84   N  N     . ALA A 16  ? 3.3161 1.1320 2.3141 0.3992  0.3967  -0.3323 16  ALA A N     
85   C  CA    . ALA A 16  ? 3.2497 1.1270 2.2721 0.4466  0.3973  -0.2921 16  ALA A CA    
86   C  C     . ALA A 16  ? 3.1339 1.1598 2.2272 0.4027  0.3829  -0.2738 16  ALA A C     
87   O  O     . ALA A 16  ? 3.0347 1.1753 2.1783 0.4392  0.3770  -0.2595 16  ALA A O     
88   C  CB    . ALA A 16  ? 3.3041 1.1104 2.3255 0.4565  0.3881  -0.2582 16  ALA A CB    
89   N  N     . ILE A 17  ? 3.0577 1.0826 2.1557 0.3248  0.3771  -0.2758 17  ILE A N     
90   C  CA    . ILE A 17  ? 2.9064 1.0623 2.0675 0.2789  0.3630  -0.2614 17  ILE A CA    
91   C  C     . ILE A 17  ? 2.8708 1.1432 2.0670 0.2899  0.3595  -0.2855 17  ILE A C     
92   O  O     . ILE A 17  ? 2.7500 1.1423 2.0011 0.3032  0.3511  -0.2672 17  ILE A O     
93   C  CB    . ILE A 17  ? 2.9517 1.0727 2.1059 0.1965  0.3586  -0.2630 17  ILE A CB    
94   C  CG1   . ILE A 17  ? 2.9971 1.0465 2.1368 0.1828  0.3612  -0.2265 17  ILE A CG1   
95   C  CG2   . ILE A 17  ? 2.8235 1.0794 2.0370 0.1500  0.3439  -0.2632 17  ILE A CG2   
96   C  CD1   . ILE A 17  ? 3.1518 1.1254 2.2664 0.1100  0.3635  -0.2331 17  ILE A CD1   
97   N  N     . ARG A 18  ? 2.8915 1.1238 2.0519 0.2843  0.3666  -0.3268 18  ARG A N     
98   C  CA    . ARG A 18  ? 2.8349 1.1590 2.0137 0.2938  0.3669  -0.3543 18  ARG A CA    
99   C  C     . ARG A 18  ? 2.8372 1.2355 2.0455 0.3654  0.3722  -0.3450 18  ARG A C     
100  O  O     . ARG A 18  ? 2.7257 1.2495 1.9821 0.3658  0.3667  -0.3416 18  ARG A O     
101  C  CB    . ARG A 18  ? 2.9540 1.1920 2.0735 0.2827  0.3765  -0.4008 18  ARG A CB    
102  C  CG    . ARG A 18  ? 3.0980 1.3837 2.2107 0.3244  0.3866  -0.4334 18  ARG A CG    
103  C  CD    . ARG A 18  ? 3.1363 1.5535 2.2880 0.2939  0.3778  -0.4412 18  ARG A CD    
104  N  NE    . ARG A 18  ? 3.2955 1.7005 2.4337 0.2215  0.3660  -0.4565 18  ARG A NE    
105  C  CZ    . ARG A 18  ? 3.2543 1.9329 2.6300 0.1951  0.2565  -0.4994 18  ARG A CZ    
106  N  NH1   . ARG A 18  ? 3.2055 1.8080 2.5181 0.2350  0.2860  -0.5326 18  ARG A NH1   
107  N  NH2   . ARG A 18  ? 3.3084 1.7828 2.4979 0.1368  0.3125  -0.5081 18  ARG A NH2   
108  N  N     . GLN A 19  ? 2.8780 1.1989 2.0579 0.4248  0.3822  -0.3399 19  GLN A N     
109  C  CA    . GLN A 19  ? 2.8502 1.2353 2.0577 0.4972  0.3868  -0.3312 19  GLN A CA    
110  C  C     . GLN A 19  ? 2.7859 1.2694 2.0531 0.5015  0.3734  -0.2895 19  GLN A C     
111  O  O     . GLN A 19  ? 2.7010 1.2969 2.0142 0.5340  0.3722  -0.2857 19  GLN A O     
112  C  CB    . GLN A 19  ? 3.0043 1.2711 2.1610 0.5601  0.3992  -0.3376 19  GLN A CB    
113  C  CG    . GLN A 19  ? 3.1668 1.5055 2.3973 0.5546  0.3789  -0.3928 19  GLN A CG    
114  C  CD    . GLN A 19  ? 3.1553 1.7233 2.6934 0.5095  0.2836  -0.4282 19  GLN A CD    
115  O  OE1   . GLN A 19  ? 3.1160 1.6730 2.6652 0.5599  0.2898  -0.4130 19  GLN A OE1   
116  N  NE2   . GLN A 19  ? 3.1443 1.6113 2.6338 0.4922  0.2871  -0.4556 19  GLN A NE2   
117  N  N     . GLN A 20  ? 2.7408 1.1846 2.0070 0.4664  0.3641  -0.2596 20  GLN A N     
118  C  CA    . GLN A 20  ? 2.6407 1.1676 1.9571 0.4654  0.3511  -0.2206 20  GLN A CA    
119  C  C     . GLN A 20  ? 2.5600 1.2208 1.9330 0.4239  0.3406  -0.2202 20  GLN A C     
120  O  O     . GLN A 20  ? 2.4651 1.2307 1.8876 0.4455  0.3335  -0.2028 20  GLN A O     
121  C  CB    . GLN A 20  ? 2.6970 1.1392 1.9903 0.4357  0.3470  -0.1917 20  GLN A CB    
122  C  CG    . GLN A 20  ? 2.8510 1.3633 2.1859 0.4424  0.3349  -0.1510 20  GLN A CG    
123  C  CD    . GLN A 20  ? 3.0954 1.6464 2.4458 0.5168  0.3332  -0.1372 20  GLN A CD    
124  O  OE1   . GLN A 20  ? 3.1266 1.5894 2.4381 0.5616  0.3374  -0.1255 20  GLN A OE1   
125  N  NE2   . GLN A 20  ? 2.8963 1.5822 2.3052 0.5287  0.3252  -0.1345 20  GLN A NE2   
126  N  N     . ILE A 21  ? 2.5076 1.1625 1.8716 0.3650  0.3389  -0.2397 21  ILE A N     
127  C  CA    . ILE A 21  ? 2.3896 1.1573 1.7980 0.3237  0.3285  -0.2416 21  ILE A CA    
128  C  C     . ILE A 21  ? 2.4074 1.2591 1.8344 0.3565  0.3346  -0.2616 21  ILE A C     
129  O  O     . ILE A 21  ? 2.2945 1.2583 1.7697 0.3493  0.3269  -0.2506 21  ILE A O     
130  C  CB    . ILE A 21  ? 2.4407 1.1719 1.8300 0.2550  0.3235  -0.2571 21  ILE A CB    
131  C  CG1   . ILE A 21  ? 2.4426 1.1306 1.8340 0.2169  0.3164  -0.2303 21  ILE A CG1   
132  C  CG2   . ILE A 21  ? 2.3570 1.1948 1.7800 0.2215  0.3140  -0.2671 21  ILE A CG2   
133  C  CD1   . ILE A 21  ? 2.5658 1.1972 1.9331 0.1521  0.3135  -0.2463 21  ILE A CD1   
134  N  N     . ASP A 22  ? 2.4619 1.2581 1.8498 0.3936  0.3497  -0.2904 22  ASP A N     
135  C  CA    . ASP A 22  ? 2.4437 1.3148 1.8453 0.4292  0.3597  -0.3110 22  ASP A CA    
136  C  C     . ASP A 22  ? 2.4411 1.3933 1.8896 0.4811  0.3588  -0.2880 22  ASP A C     
137  O  O     . ASP A 22  ? 2.3552 1.4213 1.8463 0.4844  0.3584  -0.2874 22  ASP A O     
138  C  CB    . ASP A 22  ? 2.5903 1.3733 1.9356 0.4606  0.3773  -0.3480 22  ASP A CB    
139  C  CG    . ASP A 22  ? 2.7155 1.5428 2.0493 0.4468  0.3858  -0.3829 22  ASP A CG    
140  O  OD1   . ASP A 22  ? 2.6395 1.5484 2.0003 0.4018  0.3761  -0.3788 22  ASP A OD1   
141  O  OD2   . ASP A 22  ? 2.8774 1.6544 2.1715 0.4819  0.4023  -0.4145 22  ASP A OD2   
142  N  N     . SER A 23  ? 2.4435 1.3372 1.8832 0.5186  0.3575  -0.2678 23  SER A N     
143  C  CA    . SER A 23  ? 2.3992 1.3617 1.8798 0.5701  0.3538  -0.2453 23  SER A CA    
144  C  C     . SER A 23  ? 2.3193 1.3764 1.8539 0.5396  0.3368  -0.2137 23  SER A C     
145  O  O     . SER A 23  ? 2.2536 1.4078 1.8342 0.5690  0.3329  -0.2024 23  SER A O     
146  C  CB    . SER A 23  ? 2.5470 1.4092 1.9934 0.6198  0.3560  -0.2331 23  SER A CB    
147  O  OG    . SER A 23  ? 2.6251 1.5556 2.1116 0.6637  0.3474  -0.2072 23  SER A OG    
148  N  N     . ASN A 24  ? 2.2366 1.2642 1.7656 0.4822  0.3267  -0.2005 24  ASN A N     
149  C  CA    . ASN A 24  ? 2.1217 1.2277 1.6963 0.4495  0.3110  -0.1729 24  ASN A CA    
150  C  C     . ASN A 24  ? 2.1313 1.2295 1.7012 0.3805  0.3049  -0.1775 24  ASN A C     
151  O  O     . ASN A 24  ? 2.1692 1.1880 1.7125 0.3518  0.3025  -0.1699 24  ASN A O     
152  C  CB    . ASN A 24  ? 2.1243 1.1986 1.6999 0.4692  0.3028  -0.1402 24  ASN A CB    
153  C  CG    . ASN A 24  ? 2.2528 1.4004 1.8707 0.4362  0.2873  -0.1133 24  ASN A CG    
154  O  OD1   . ASN A 24  ? 2.0667 1.3157 1.7275 0.4183  0.2811  -0.1144 24  ASN A OD1   
155  N  ND2   . ASN A 24  ? 2.1704 1.2647 1.7741 0.4280  0.2816  -0.0885 24  ASN A ND2   
156  N  N     . PRO A 25  ? 2.0110 1.1904 1.6052 0.3529  0.3024  -0.1899 25  PRO A N     
157  C  CA    . PRO A 25  ? 1.9765 1.1527 1.5667 0.2906  0.2941  -0.1946 25  PRO A CA    
158  C  C     . PRO A 25  ? 1.9366 1.1496 1.5605 0.2587  0.2787  -0.1651 25  PRO A C     
159  O  O     . PRO A 25  ? 1.9186 1.1162 1.5389 0.2100  0.2712  -0.1654 25  PRO A O     
160  C  CB    . PRO A 25  ? 1.9579 1.2114 1.5606 0.2804  0.2962  -0.2142 25  PRO A CB    
161  C  CG    . PRO A 25  ? 2.0332 1.3208 1.6424 0.3364  0.3095  -0.2235 25  PRO A CG    
162  C  CD    . PRO A 25  ? 1.9805 1.2581 1.6054 0.3759  0.3070  -0.1996 25  PRO A CD    
163  N  N     . PHE A 26  ? 1.8396 1.1030 1.4965 0.2875  0.2739  -0.1411 26  PHE A N     
164  C  CA    . PHE A 26  ? 1.7645 1.0688 1.4541 0.2664  0.2603  -0.1130 26  PHE A CA    
165  C  C     . PHE A 26  ? 1.8533 1.0746 1.5189 0.2584  0.2599  -0.0957 26  PHE A C     
166  O  O     . PHE A 26  ? 1.7974 1.0450 1.4850 0.2388  0.2505  -0.0735 26  PHE A O     
167  C  CB    . PHE A 26  ? 1.7236 1.1170 1.4554 0.2994  0.2549  -0.0975 26  PHE A CB    
168  C  CG    . PHE A 26  ? 1.6902 1.1729 1.4497 0.2981  0.2557  -0.1107 26  PHE A CG    
169  C  CD1   . PHE A 26  ? 1.7653 1.2616 1.5184 0.3348  0.2685  -0.1296 26  PHE A CD1   
170  C  CD2   . PHE A 26  ? 1.6391 1.1909 1.4295 0.2606  0.2447  -0.1037 26  PHE A CD2   
171  C  CE1   . PHE A 26  ? 1.7327 1.3119 1.5090 0.3300  0.2718  -0.1411 26  PHE A CE1   
172  C  CE2   . PHE A 26  ? 1.6350 1.2631 1.4459 0.2571  0.2466  -0.1136 26  PHE A CE2   
173  C  CZ    . PHE A 26  ? 1.6459 1.2882 1.4494 0.2900  0.2609  -0.1319 26  PHE A CZ    
174  N  N     . ILE A 27  ? 1.9040 1.0223 1.5219 0.2718  0.2713  -0.1063 27  ILE A N     
175  C  CA    . ILE A 27  ? 1.9610 0.9865 1.5472 0.2621  0.2741  -0.0906 27  ILE A CA    
176  C  C     . ILE A 27  ? 1.9877 1.0010 1.5756 0.1980  0.2697  -0.0910 27  ILE A C     
177  O  O     . ILE A 27  ? 1.9653 1.0001 1.5568 0.1662  0.2674  -0.1128 27  ILE A O     
178  C  CB    . ILE A 27  ? 2.1235 1.0363 1.6550 0.2950  0.2880  -0.1032 27  ILE A CB    
179  C  CG1   . ILE A 27  ? 2.1968 1.0221 1.6970 0.3042  0.2910  -0.0774 27  ILE A CG1   
180  C  CG2   . ILE A 27  ? 2.1937 1.0465 1.6909 0.2652  0.2959  -0.1362 27  ILE A CG2   
181  C  CD1   . ILE A 27  ? 2.3978 1.1402 1.8561 0.3620  0.3005  -0.0782 27  ILE A CD1   
182  N  N     . THR A 28  ? 1.9465 0.9317 1.5327 0.1797  0.2681  -0.0668 28  THR A N     
183  C  CA    . THR A 28  ? 1.9310 0.9079 1.5222 0.1201  0.2652  -0.0660 28  THR A CA    
184  C  C     . THR A 28  ? 2.1090 0.9662 1.6492 0.1002  0.2773  -0.0743 28  THR A C     
185  O  O     . THR A 28  ? 2.1902 0.9666 1.6906 0.1367  0.2872  -0.0722 28  THR A O     
186  C  CB    . THR A 28  ? 1.9341 0.9565 1.5548 0.1081  0.2585  -0.0362 28  THR A CB    
187  O  OG1   . THR A 28  ? 1.9746 0.9453 1.5710 0.1434  0.2646  -0.0133 28  THR A OG1   
188  C  CG2   . THR A 28  ? 1.8073 0.9454 1.4789 0.1146  0.2452  -0.0307 28  THR A CG2   
189  N  N     . ASP A 29  ? 2.0809 0.9257 1.6224 0.0426  0.2761  -0.0835 29  ASP A N     
190  C  CA    . ASP A 29  ? 2.1886 0.9222 1.6847 0.0129  0.2874  -0.0918 29  ASP A CA    
191  C  C     . ASP A 29  ? 2.3041 0.9751 1.7788 0.0202  0.2967  -0.0603 29  ASP A C     
192  O  O     . ASP A 29  ? 2.4102 0.9681 1.8339 0.0230  0.3092  -0.0607 29  ASP A O     
193  C  CB    . ASP A 29  ? 2.1894 0.9451 1.7020 -0.0530 0.2817  -0.1077 29  ASP A CB    
194  C  CG    . ASP A 29  ? 2.2970 1.0647 1.8036 -0.0677 0.2760  -0.1440 29  ASP A CG    
195  O  OD1   . ASP A 29  ? 2.3618 1.1463 1.8618 -0.0270 0.2758  -0.1564 29  ASP A OD1   
196  O  OD2   . ASP A 29  ? 2.3088 1.0732 1.8175 -0.1202 0.2717  -0.1603 29  ASP A OD2   
197  N  N     . HIS A 30  ? 2.1988 0.9408 1.7089 0.0252  0.2905  -0.0329 30  HIS A N     
198  C  CA    . HIS A 30  ? 2.2391 0.9377 1.7307 0.0345  0.2980  -0.0003 30  HIS A CA    
199  C  C     . HIS A 30  ? 2.3360 0.9712 1.7887 0.0972  0.3030  0.0106  30  HIS A C     
200  O  O     . HIS A 30  ? 2.4325 0.9664 1.8376 0.1017  0.3146  0.0259  30  HIS A O     
201  C  CB    . HIS A 30  ? 2.1554 0.9545 1.6945 0.0294  0.2886  0.0219  30  HIS A CB    
202  C  CG    . HIS A 30  ? 2.2458 1.0036 1.7630 0.0345  0.2969  0.0547  30  HIS A CG    
203  N  ND1   . HIS A 30  ? 2.3156 1.0295 1.8193 -0.0145 0.3082  0.0639  30  HIS A ND1   
204  C  CD2   . HIS A 30  ? 2.2833 1.0365 1.7868 0.0828  0.2956  0.0792  30  HIS A CD2   
205  C  CE1   . HIS A 30  ? 2.3452 1.0270 1.8247 0.0051  0.3147  0.0949  30  HIS A CE1   
206  N  NE2   . HIS A 30  ? 2.3314 1.0345 1.8089 0.0644  0.3062  0.1051  30  HIS A NE2   
207  N  N     . GLU A 31  ? 2.2285 0.9237 1.7014 0.1452  0.2947  0.0027  31  GLU A N     
208  C  CA    . GLU A 31  ? 2.2740 0.9308 1.7202 0.2111  0.2969  0.0094  31  GLU A CA    
209  C  C     . GLU A 31  ? 2.4340 0.9684 1.8231 0.2219  0.3097  -0.0087 31  GLU A C     
210  O  O     . GLU A 31  ? 2.5198 0.9684 1.8649 0.2604  0.3163  0.0062  31  GLU A O     
211  C  CB    . GLU A 31  ? 2.2078 0.9693 1.6963 0.2495  0.2862  -0.0014 31  GLU A CB    
212  C  CG    . GLU A 31  ? 2.2700 1.1252 1.7989 0.2676  0.2742  0.0232  31  GLU A CG    
213  C  CD    . GLU A 31  ? 2.4552 1.4312 2.0378 0.2748  0.2631  0.0105  31  GLU A CD    
214  O  OE1   . GLU A 31  ? 2.4192 1.4144 2.0049 0.3142  0.2639  -0.0046 31  GLU A OE1   
215  O  OE2   . GLU A 31  ? 2.3014 1.3522 1.9225 0.2407  0.2544  0.0156  31  GLU A OE2   
216  N  N     . LEU A 32  ? 2.3893 0.9126 1.7759 0.1878  0.3123  -0.0410 32  LEU A N     
217  C  CA    . LEU A 32  ? 2.5018 0.9100 1.8341 0.1895  0.3241  -0.0646 32  LEU A CA    
218  C  C     . LEU A 32  ? 2.6556 0.9452 1.9407 0.1550  0.3353  -0.0503 32  LEU A C     
219  O  O     . LEU A 32  ? 2.7753 0.9465 2.0035 0.1812  0.3460  -0.0510 32  LEU A O     
220  C  CB    . LEU A 32  ? 2.4776 0.9154 1.8209 0.1550  0.3219  -0.1030 32  LEU A CB    
221  C  CG    . LEU A 32  ? 2.4640 0.9937 1.8379 0.1903  0.3157  -0.1226 32  LEU A CG    
222  C  CD1   . LEU A 32  ? 2.4168 1.0008 1.8106 0.1433  0.3096  -0.1509 32  LEU A CD1   
223  C  CD2   . LEU A 32  ? 2.5781 1.0433 1.9132 0.2494  0.3255  -0.1388 32  LEU A CD2   
224  N  N     . SER A 33  ? 2.5619 0.8835 1.8702 0.0981  0.3338  -0.0362 33  SER A N     
225  C  CA    . SER A 33  ? 2.6463 0.8706 1.9168 0.0562  0.3461  -0.0205 33  SER A CA    
226  C  C     . SER A 33  ? 2.7822 0.9316 2.0113 0.0992  0.3534  0.0151  33  SER A C     
227  O  O     . SER A 33  ? 2.9078 0.9264 2.0772 0.0920  0.3670  0.0210  33  SER A O     
228  C  CB    . SER A 33  ? 2.5998 0.8983 1.9140 -0.0077 0.3427  -0.0130 33  SER A CB    
229  O  OG    . SER A 33  ? 2.6607 0.9912 1.9875 -0.0013 0.3433  0.0238  33  SER A OG    
230  N  N     . ASP A 34  ? 2.6706 0.9002 1.9284 0.1444  0.3436  0.0381  34  ASP A N     
231  C  CA    . ASP A 34  ? 2.7315 0.9070 1.9531 0.1922  0.3463  0.0725  34  ASP A CA    
232  C  C     . ASP A 34  ? 2.8852 0.9787 2.0623 0.2569  0.3488  0.0641  34  ASP A C     
233  O  O     . ASP A 34  ? 3.0030 0.9771 2.1192 0.2777  0.3581  0.0830  34  ASP A O     
234  C  CB    . ASP A 34  ? 2.6405 0.9360 1.9094 0.2180  0.3326  0.0955  34  ASP A CB    
235  C  CG    . ASP A 34  ? 2.7131 1.0647 2.0105 0.1647  0.3331  0.1135  34  ASP A CG    
236  O  OD1   . ASP A 34  ? 2.8936 1.1661 2.1568 0.1227  0.3471  0.1259  34  ASP A OD1   
237  O  OD2   . ASP A 34  ? 2.5887 1.0621 1.9417 0.1660  0.3203  0.1156  34  ASP A OD2   
238  N  N     . LEU A 35  ? 2.7962 0.9517 2.0019 0.2888  0.3414  0.0356  35  LEU A N     
239  C  CA    . LEU A 35  ? 2.8764 0.9720 2.0486 0.3536  0.3440  0.0223  35  LEU A CA    
240  C  C     . LEU A 35  ? 3.0741 1.0153 2.1789 0.3386  0.3593  0.0056  35  LEU A C     
241  O  O     . LEU A 35  ? 3.1868 1.0229 2.2376 0.3877  0.3653  0.0143  35  LEU A O     
242  C  CB    . LEU A 35  ? 2.7887 0.9930 2.0098 0.3771  0.3361  -0.0084 35  LEU A CB    
243  C  CG    . LEU A 35  ? 2.9030 1.0872 2.1075 0.4537  0.3373  -0.0216 35  LEU A CG    
244  C  CD1   . LEU A 35  ? 2.8677 1.1151 2.0938 0.5148  0.3261  0.0068  35  LEU A CD1   
245  C  CD2   . LEU A 35  ? 2.8620 1.1337 2.1049 0.4572  0.3356  -0.0583 35  LEU A CD2   
246  N  N     . PHE A 36  ? 3.0366 0.9631 2.1435 0.2710  0.3646  -0.0184 36  PHE A N     
247  C  CA    . PHE A 36  ? 3.1748 0.9604 2.2208 0.2478  0.3782  -0.0400 36  PHE A CA    
248  C  C     . PHE A 36  ? 3.3046 0.9797 2.3057 0.1971  0.3901  -0.0179 36  PHE A C     
249  O  O     . PHE A 36  ? 3.3166 0.9690 2.3579 0.1708  0.3657  -0.0358 36  PHE A O     
250  C  CB    . PHE A 36  ? 3.1669 0.9918 2.2336 0.2106  0.3765  -0.0851 36  PHE A CB    
251  C  CG    . PHE A 36  ? 3.1581 1.0396 2.2411 0.2691  0.3719  -0.1106 36  PHE A CG    
252  C  CD1   . PHE A 36  ? 3.0603 1.0913 2.2077 0.2926  0.3595  -0.1057 36  PHE A CD1   
253  C  CD2   . PHE A 36  ? 3.3004 1.0843 2.3331 0.3011  0.3813  -0.1396 36  PHE A CD2   
254  C  CE1   . PHE A 36  ? 3.0447 1.1314 2.2081 0.3440  0.3577  -0.1287 36  PHE A CE1   
255  C  CE2   . PHE A 36  ? 3.3013 1.1488 2.3556 0.3549  0.3776  -0.1639 36  PHE A CE2   
256  C  CZ    . PHE A 36  ? 3.1423 1.1371 2.2572 0.3754  0.3684  -0.1577 36  PHE A CZ    
257  N  N     . GLN A 37  ? 3.1985 0.9220 2.2214 0.1773  0.3879  0.0186  37  GLN A N     
258  C  CA    . GLN A 37  ? 3.2694 0.9062 2.2553 0.1274  0.4009  0.0450  37  GLN A CA    
259  C  C     . GLN A 37  ? 3.3159 0.9329 2.3152 0.0460  0.4022  0.0177  37  GLN A C     
260  O  O     . GLN A 37  ? 3.3066 0.9284 2.3717 0.0168  0.3676  0.0175  37  GLN A O     
261  C  CB    . GLN A 37  ? 3.3085 0.9283 2.3328 0.1633  0.3671  0.0694  37  GLN A CB    
262  C  CG    . GLN A 37  ? 3.3476 1.1589 2.5089 0.2133  0.3089  0.0980  37  GLN A CG    
263  C  CD    . GLN A 37  ? 3.3699 1.4070 2.6924 0.1678  0.2530  0.1269  37  GLN A CD    
264  O  OE1   . GLN A 37  ? 3.3692 1.3490 2.5798 0.1737  0.3084  0.1288  37  GLN A OE1   
265  N  NE2   . GLN A 37  ? 3.3670 1.3171 2.6450 0.1587  0.2624  0.1628  37  GLN A NE2   
266  N  N     . VAL A 38  ? 3.1561 0.8747 2.2005 0.0102  0.3990  -0.0068 38  VAL A N     
267  C  CA    . VAL A 38  ? 3.1531 0.8678 2.2075 -0.0645 0.4015  -0.0370 38  VAL A CA    
268  C  C     . VAL A 38  ? 3.0349 0.9004 2.1651 -0.1082 0.3908  -0.0334 38  VAL A C     
269  O  O     . VAL A 38  ? 2.9164 0.8879 2.0899 -0.0726 0.3801  -0.0165 38  VAL A O     
270  C  CB    . VAL A 38  ? 3.2371 0.9240 2.2756 -0.0479 0.3977  -0.0823 38  VAL A CB    
271  C  CG1   . VAL A 38  ? 3.0994 0.9314 2.2034 -0.0602 0.3814  -0.1089 38  VAL A CG1   
272  C  CG2   . VAL A 38  ? 3.2965 0.9246 2.3475 -0.0915 0.3818  -0.1044 38  VAL A CG2   
273  N  N     . SER A 39  ? 2.9846 0.8582 2.1305 -0.1841 0.3936  -0.0483 39  SER A N     
274  C  CA    . SER A 39  ? 2.8503 0.8620 2.0671 -0.2263 0.3836  -0.0463 39  SER A CA    
275  C  C     . SER A 39  ? 2.7676 0.8991 2.0357 -0.2091 0.3641  -0.0724 39  SER A C     
276  O  O     . SER A 39  ? 2.8013 0.9022 2.0493 -0.1939 0.3603  -0.1036 39  SER A O     
277  C  CB    . SER A 39  ? 2.9444 0.9332 2.1648 -0.3102 0.3912  -0.0584 39  SER A CB    
278  O  OG    . SER A 39  ? 2.9476 1.0659 2.2351 -0.3453 0.3836  -0.0503 39  SER A OG    
279  N  N     . ILE A 40  ? 2.5696 0.8344 1.9010 -0.2139 0.3525  -0.0603 40  ILE A N     
280  C  CA    . ILE A 40  ? 2.4414 0.8260 1.8237 -0.2025 0.3337  -0.0802 40  ILE A CA    
281  C  C     . ILE A 40  ? 2.4820 0.8698 1.8679 -0.2505 0.3270  -0.1199 40  ILE A C     
282  O  O     . ILE A 40  ? 2.4362 0.8681 1.8318 -0.2311 0.3156  -0.1441 40  ILE A O     
283  C  CB    . ILE A 40  ? 2.3486 0.8617 1.7931 -0.2032 0.3238  -0.0575 40  ILE A CB    
284  C  CG1   . ILE A 40  ? 2.2440 0.8631 1.7286 -0.1678 0.3063  -0.0683 40  ILE A CG1   
285  C  CG2   . ILE A 40  ? 2.3283 0.8883 1.8082 -0.2708 0.3239  -0.0570 40  ILE A CG2   
286  C  CD1   . ILE A 40  ? 2.2561 0.9561 1.7752 -0.1330 0.3003  -0.0400 40  ILE A CD1   
287  N  N     . GLN A 41  ? 2.4924 0.8292 1.8666 -0.3132 0.3350  -0.1263 41  GLN A N     
288  C  CA    . GLN A 41  ? 2.5172 0.8471 1.8909 -0.3675 0.3289  -0.1633 41  GLN A CA    
289  C  C     . GLN A 41  ? 2.6387 0.8708 1.9552 -0.3457 0.3319  -0.1936 41  GLN A C     
290  O  O     . GLN A 41  ? 2.6117 0.8788 1.9345 -0.3571 0.3194  -0.2274 41  GLN A O     
291  C  CB    . GLN A 41  ? 2.5979 0.8859 1.9691 -0.4382 0.3400  -0.1595 41  GLN A CB    
292  C  CG    . GLN A 41  ? 2.6898 1.0972 2.1278 -0.4730 0.3343  -0.1424 41  GLN A CG    
293  C  CD    . GLN A 41  ? 2.8153 1.2412 2.2638 -0.4461 0.3448  -0.0994 41  GLN A CD    
294  O  OE1   . GLN A 41  ? 2.8053 1.1457 2.2078 -0.4071 0.3578  -0.0776 41  GLN A OE1   
295  N  NE2   . GLN A 41  ? 2.5645 1.1027 2.0724 -0.4663 0.3387  -0.0869 41  GLN A NE2   
296  N  N     . THR A 42  ? 2.6899 0.8004 1.9487 -0.3107 0.3482  -0.1813 42  THR A N     
297  C  CA    . THR A 42  ? 2.7889 0.7947 1.9882 -0.2800 0.3537  -0.2077 42  THR A CA    
298  C  C     . THR A 42  ? 2.7505 0.8343 1.9688 -0.2193 0.3426  -0.2186 42  THR A C     
299  O  O     . THR A 42  ? 2.7588 0.8389 1.9624 -0.2194 0.3372  -0.2549 42  THR A O     
300  C  CB    . THR A 42  ? 2.9961 0.8555 2.1311 -0.2536 0.3732  -0.1868 42  THR A CB    
301  O  OG1   . THR A 42  ? 3.0139 0.8360 2.1462 -0.3050 0.3841  -0.1622 42  THR A OG1   
302  C  CG2   . THR A 42  ? 3.1133 0.8376 2.1793 -0.2452 0.3814  -0.2196 42  THR A CG2   
303  N  N     . ILE A 43  ? 2.6130 0.7750 1.8659 -0.1727 0.3388  -0.1881 43  ILE A N     
304  C  CA    . ILE A 43  ? 2.5232 0.7730 1.8024 -0.1178 0.3292  -0.1930 43  ILE A CA    
305  C  C     . ILE A 43  ? 2.4816 0.8296 1.7972 -0.1496 0.3135  -0.2212 43  ILE A C     
306  O  O     . ILE A 43  ? 2.4785 0.8394 1.7827 -0.1235 0.3104  -0.2472 43  ILE A O     
307  C  CB    . ILE A 43  ? 2.4734 0.7982 1.7902 -0.0779 0.3261  -0.1536 43  ILE A CB    
308  C  CG1   . ILE A 43  ? 2.5675 0.7935 1.8413 -0.0374 0.3397  -0.1255 43  ILE A CG1   
309  C  CG2   . ILE A 43  ? 2.3811 0.8170 1.7366 -0.0339 0.3146  -0.1583 43  ILE A CG2   
310  C  CD1   . ILE A 43  ? 2.7538 0.8995 1.9796 0.0292  0.3472  -0.1371 43  ILE A CD1   
311  N  N     . ARG A 44  ? 2.3707 0.7841 1.7268 -0.2058 0.3042  -0.2167 44  ARG A N     
312  C  CA    . ARG A 44  ? 2.2964 0.8023 1.6872 -0.2404 0.2870  -0.2402 44  ARG A CA    
313  C  C     . ARG A 44  ? 2.4330 0.8729 1.7812 -0.2678 0.2866  -0.2822 44  ARG A C     
314  O  O     . ARG A 44  ? 2.3884 0.8808 1.7408 -0.2621 0.2755  -0.3069 44  ARG A O     
315  C  CB    . ARG A 44  ? 2.2297 0.8099 1.6711 -0.2919 0.2784  -0.2249 44  ARG A CB    
316  C  CG    . ARG A 44  ? 2.2130 0.9168 1.7113 -0.2679 0.2668  -0.2015 44  ARG A CG    
317  C  CD    . ARG A 44  ? 2.2877 1.0108 1.8126 -0.2734 0.2728  -0.1654 44  ARG A CD    
318  N  NE    . ARG A 44  ? 2.2612 1.0700 1.8221 -0.2300 0.2661  -0.1422 44  ARG A NE    
319  C  CZ    . ARG A 44  ? 2.3653 1.2291 1.9623 -0.2334 0.2653  -0.1141 44  ARG A CZ    
320  N  NH1   . ARG A 44  ? 2.2593 1.1072 1.8634 -0.2776 0.2722  -0.1047 44  ARG A NH1   
321  N  NH2   . ARG A 44  ? 2.0600 0.9961 1.6856 -0.1940 0.2583  -0.0965 44  ARG A NH2   
322  N  N     . LEU A 45  ? 2.5170 0.8371 1.8198 -0.2963 0.2993  -0.2902 45  LEU A N     
323  C  CA    . LEU A 45  ? 2.6257 0.8634 1.8800 -0.3241 0.3006  -0.3314 45  LEU A CA    
324  C  C     . LEU A 45  ? 2.7348 0.9196 1.9435 -0.2648 0.3077  -0.3513 45  LEU A C     
325  O  O     . LEU A 45  ? 2.7633 0.9445 1.9497 -0.2734 0.3017  -0.3889 45  LEU A O     
326  C  CB    . LEU A 45  ? 2.7500 0.8636 1.9650 -0.3679 0.3148  -0.3312 45  LEU A CB    
327  C  CG    . LEU A 45  ? 2.7989 0.9477 2.0460 -0.4470 0.3079  -0.3340 45  LEU A CG    
328  C  CD1   . LEU A 45  ? 2.9211 0.9450 2.1291 -0.4842 0.3265  -0.3251 45  LEU A CD1   
329  C  CD2   . LEU A 45  ? 2.8389 1.0228 2.0876 -0.4894 0.2908  -0.3776 45  LEU A CD2   
330  N  N     . ASP A 46  ? 2.7042 0.8522 1.8994 -0.2036 0.3201  -0.3267 46  ASP A N     
331  C  CA    . ASP A 46  ? 2.7531 0.8557 1.9102 -0.1390 0.3288  -0.3418 46  ASP A CA    
332  C  C     . ASP A 46  ? 2.6913 0.9099 1.8793 -0.1135 0.3179  -0.3561 46  ASP A C     
333  O  O     . ASP A 46  ? 2.7336 0.9277 1.8880 -0.1023 0.3198  -0.3916 46  ASP A O     
334  C  CB    . ASP A 46  ? 2.8047 0.8600 1.9500 -0.0798 0.3413  -0.3079 46  ASP A CB    
335  C  CG    . ASP A 46  ? 3.0953 1.0184 2.1972 -0.0989 0.3545  -0.2925 46  ASP A CG    
336  O  OD1   . ASP A 46  ? 3.2172 1.0356 2.2708 -0.1348 0.3606  -0.3198 46  ASP A OD1   
337  O  OD2   . ASP A 46  ? 3.1728 1.0932 2.2853 -0.0790 0.3589  -0.2533 46  ASP A OD2   
338  N  N     . ARG A 47  ? 2.5055 0.8481 1.7546 -0.1082 0.3070  -0.3293 47  ARG A N     
339  C  CA    . ARG A 47  ? 2.4007 0.8599 1.6832 -0.0893 0.2963  -0.3370 47  ARG A CA    
340  C  C     . ARG A 47  ? 2.4617 0.9483 1.7373 -0.1362 0.2841  -0.3718 47  ARG A C     
341  O  O     . ARG A 47  ? 2.4489 0.9754 1.7157 -0.1157 0.2821  -0.3935 47  ARG A O     
342  C  CB    . ARG A 47  ? 2.2448 0.8190 1.5918 -0.0881 0.2855  -0.3016 47  ARG A CB    
343  C  CG    . ARG A 47  ? 2.2507 0.8474 1.6138 -0.0272 0.2926  -0.2726 47  ARG A CG    
344  C  CD    . ARG A 47  ? 2.0897 0.8125 1.5151 -0.0263 0.2798  -0.2465 47  ARG A CD    
345  N  NE    . ARG A 47  ? 2.0190 0.7659 1.4742 -0.0748 0.2714  -0.2279 47  ARG A NE    
346  C  CZ    . ARG A 47  ? 2.0803 0.8896 1.5623 -0.1220 0.2570  -0.2371 47  ARG A CZ    
347  N  NH1   . ARG A 47  ? 1.8713 0.7221 1.3503 -0.1287 0.2484  -0.2630 47  ARG A NH1   
348  N  NH2   . ARG A 47  ? 1.8566 0.6885 1.3675 -0.1617 0.2514  -0.2203 47  ARG A NH2   
349  N  N     . THR A 48  ? 2.4377 0.9058 1.7169 -0.1994 0.2761  -0.3771 48  THR A N     
350  C  CA    . THR A 48  ? 2.4454 0.9388 1.7189 -0.2496 0.2613  -0.4100 48  THR A CA    
351  C  C     . THR A 48  ? 2.6125 1.0160 1.8200 -0.2416 0.2694  -0.4523 48  THR A C     
352  O  O     . THR A 48  ? 2.5922 1.0426 1.7900 -0.2390 0.2612  -0.4778 48  THR A O     
353  C  CB    . THR A 48  ? 2.5515 1.0445 1.8474 -0.3165 0.2526  -0.4049 48  THR A CB    
354  O  OG1   . THR A 48  ? 2.4482 1.0352 1.8057 -0.3174 0.2455  -0.3678 48  THR A OG1   
355  C  CG2   . THR A 48  ? 2.5395 1.0633 1.8317 -0.3697 0.2344  -0.4397 48  THR A CG2   
356  N  N     . TYR A 49  ? 2.6945 0.9666 1.8536 -0.2351 0.2863  -0.4589 49  TYR A N     
357  C  CA    . TYR A 49  ? 2.8215 0.9902 1.9124 -0.2244 0.2963  -0.4996 49  TYR A CA    
358  C  C     . TYR A 49  ? 2.8641 1.0564 1.9407 -0.1548 0.3054  -0.5081 49  TYR A C     
359  O  O     . TYR A 49  ? 2.9141 1.0912 1.9525 -0.1506 0.3061  -0.5464 49  TYR A O     
360  C  CB    . TYR A 49  ? 2.9682 0.9854 2.0111 -0.2300 0.3128  -0.4991 49  TYR A CB    
361  C  CG    . TYR A 49  ? 3.1402 1.0395 2.1099 -0.2339 0.3210  -0.5457 49  TYR A CG    
362  C  CD1   . TYR A 49  ? 3.2279 1.0952 2.1768 -0.3016 0.3105  -0.5792 49  TYR A CD1   
363  C  CD2   . TYR A 49  ? 3.2288 1.0508 2.1512 -0.1689 0.3382  -0.5578 49  TYR A CD2   
364  C  CE1   . TYR A 49  ? 3.2267 1.1228 2.2348 -0.2747 0.2659  -0.6135 49  TYR A CE1   
365  C  CE2   . TYR A 49  ? 3.2533 1.0856 2.2166 -0.1507 0.3037  -0.5963 49  TYR A CE2   
366  C  CZ    . TYR A 49  ? 3.2575 1.1895 2.3223 -0.1909 0.2449  -0.6198 49  TYR A CZ    
367  O  OH    . TYR A 49  ? 3.2687 1.2154 2.3814 -0.1702 0.2099  -0.6591 49  TYR A OH    
368  N  N     . LEU A 50  ? 2.7487 0.9856 1.8578 -0.1019 0.3122  -0.4732 50  LEU A N     
369  C  CA    . LEU A 50  ? 2.7246 0.9985 1.8313 -0.0345 0.3219  -0.4766 50  LEU A CA    
370  C  C     . LEU A 50  ? 2.6497 1.0633 1.7963 -0.0370 0.3092  -0.4777 50  LEU A C     
371  O  O     . LEU A 50  ? 2.6169 1.0775 1.7664 0.0122  0.3173  -0.4812 50  LEU A O     
372  C  CB    . LEU A 50  ? 2.7015 0.9705 1.8287 0.0206  0.3322  -0.4388 50  LEU A CB    
373  C  CG    . LEU A 50  ? 2.8839 1.0118 1.9652 0.0426  0.3472  -0.4332 50  LEU A CG    
374  C  CD1   . LEU A 50  ? 2.8339 0.9801 1.9478 0.0739  0.3490  -0.3872 50  LEU A CD1   
375  C  CD2   . LEU A 50  ? 3.0279 1.0775 2.0553 0.0975  0.3634  -0.4633 50  LEU A CD2   
376  N  N     . ASN A 51  ? 2.5352 1.0148 1.7124 -0.0940 0.2898  -0.4744 51  ASN A N     
377  C  CA    . ASN A 51  ? 2.4249 1.0308 1.6382 -0.1048 0.2744  -0.4720 51  ASN A CA    
378  C  C     . ASN A 51  ? 2.3519 1.0529 1.6153 -0.0620 0.2761  -0.4374 51  ASN A C     
379  O  O     . ASN A 51  ? 2.2964 1.0801 1.5721 -0.0465 0.2733  -0.4407 51  ASN A O     
380  C  CB    . ASN A 51  ? 2.4855 1.0937 1.6559 -0.1119 0.2724  -0.5140 51  ASN A CB    
381  C  CG    . ASN A 51  ? 2.8419 1.4147 1.9883 -0.1755 0.2574  -0.5412 51  ASN A CG    
382  O  OD1   . ASN A 51  ? 2.7156 1.3549 1.8991 -0.2200 0.2370  -0.5299 51  ASN A OD1   
383  N  ND2   . ASN A 51  ? 2.8649 1.3329 1.9496 -0.1810 0.2664  -0.5787 51  ASN A ND2   
384  N  N     . ILE A 52  ? 2.2606 0.9470 1.5508 -0.0458 0.2807  -0.4041 52  ILE A N     
385  C  CA    . ILE A 52  ? 2.1484 0.9150 1.4869 -0.0091 0.2812  -0.3696 52  ILE A CA    
386  C  C     . ILE A 52  ? 2.0691 0.9188 1.4597 -0.0498 0.2623  -0.3450 52  ILE A C     
387  O  O     . ILE A 52  ? 2.0734 0.8879 1.4698 -0.0871 0.2573  -0.3362 52  ILE A O     
388  C  CB    . ILE A 52  ? 2.2272 0.9277 1.5600 0.0330  0.2952  -0.3483 52  ILE A CB    
389  C  CG1   . ILE A 52  ? 2.3358 0.9565 1.6183 0.0814  0.3137  -0.3730 52  ILE A CG1   
390  C  CG2   . ILE A 52  ? 2.1332 0.9215 1.5198 0.0630  0.2919  -0.3112 52  ILE A CG2   
391  C  CD1   . ILE A 52  ? 2.5016 1.0293 1.7633 0.1196  0.3263  -0.3566 52  ILE A CD1   
392  N  N     . PRO A 53  ? 1.9120 0.8703 1.3403 -0.0439 0.2526  -0.3336 53  PRO A N     
393  C  CA    . PRO A 53  ? 1.8085 0.8421 1.2855 -0.0780 0.2346  -0.3102 53  PRO A CA    
394  C  C     . PRO A 53  ? 1.7829 0.8273 1.2959 -0.0607 0.2373  -0.2740 53  PRO A C     
395  O  O     . PRO A 53  ? 1.8035 0.8073 1.3055 -0.0191 0.2514  -0.2655 53  PRO A O     
396  C  CB    . PRO A 53  ? 1.7597 0.8900 1.2548 -0.0716 0.2258  -0.3111 53  PRO A CB    
397  C  CG    . PRO A 53  ? 1.8408 0.9670 1.3187 -0.0206 0.2431  -0.3178 53  PRO A CG    
398  C  CD    . PRO A 53  ? 1.9015 0.9175 1.3298 -0.0061 0.2588  -0.3404 53  PRO A CD    
399  N  N     . GLU A 54  ? 1.6562 0.7559 1.2106 -0.0905 0.2234  -0.2534 54  GLU A N     
400  C  CA    . GLU A 54  ? 1.6045 0.7216 1.1926 -0.0778 0.2248  -0.2197 54  GLU A CA    
401  C  C     . GLU A 54  ? 1.5917 0.7720 1.2048 -0.0321 0.2268  -0.2020 54  GLU A C     
402  O  O     . GLU A 54  ? 1.5622 0.7934 1.1773 -0.0206 0.2243  -0.2126 54  GLU A O     
403  C  CB    . GLU A 54  ? 1.5636 0.7291 1.1897 -0.1210 0.2100  -0.2059 54  GLU A CB    
404  C  CG    . GLU A 54  ? 1.6099 0.8733 1.2686 -0.1330 0.1923  -0.2048 54  GLU A CG    
405  C  CD    . GLU A 54  ? 1.8023 1.1222 1.5070 -0.1561 0.1803  -0.1826 54  GLU A CD    
406  O  OE1   . GLU A 54  ? 1.7049 1.0442 1.4335 -0.1344 0.1842  -0.1570 54  GLU A OE1   
407  O  OE2   . GLU A 54  ? 1.7158 1.0623 1.4326 -0.1951 0.1665  -0.1920 54  GLU A OE2   
408  N  N     . LEU A 55  ? 1.5270 0.7051 1.1578 -0.0085 0.2313  -0.1751 55  LEU A N     
409  C  CA    . LEU A 55  ? 1.4639 0.6998 1.1212 0.0334  0.2323  -0.1567 55  LEU A CA    
410  C  C     . LEU A 55  ? 1.4275 0.7616 1.1174 0.0280  0.2209  -0.1554 55  LEU A C     
411  O  O     . LEU A 55  ? 1.4140 0.7826 1.1044 0.0566  0.2258  -0.1617 55  LEU A O     
412  C  CB    . LEU A 55  ? 1.4371 0.6712 1.1149 0.0410  0.2317  -0.1262 55  LEU A CB    
413  C  CG    . LEU A 55  ? 1.4252 0.7272 1.1357 0.0770  0.2286  -0.1056 55  LEU A CG    
414  C  CD1   . LEU A 55  ? 1.4682 0.7451 1.1604 0.1282  0.2401  -0.1095 55  LEU A CD1   
415  C  CD2   . LEU A 55  ? 1.4258 0.7367 1.1572 0.0720  0.2242  -0.0779 55  LEU A CD2   
416  N  N     . ARG A 56  ? 1.3204 0.6988 1.0372 -0.0084 0.2063  -0.1469 56  ARG A N     
417  C  CA    . ARG A 56  ? 1.2385 0.7024 0.9840 -0.0172 0.1935  -0.1426 56  ARG A CA    
418  C  C     . ARG A 56  ? 1.3200 0.7968 1.0420 -0.0203 0.1938  -0.1663 56  ARG A C     
419  O  O     . ARG A 56  ? 1.2833 0.8190 1.0180 -0.0069 0.1924  -0.1627 56  ARG A O     
420  C  CB    . ARG A 56  ? 1.1600 0.6573 0.9341 -0.0539 0.1778  -0.1312 56  ARG A CB    
421  C  CG    . ARG A 56  ? 1.1761 0.6849 0.9788 -0.0454 0.1777  -0.1049 56  ARG A CG    
422  C  CD    . ARG A 56  ? 1.1971 0.7324 1.0259 -0.0804 0.1653  -0.0967 56  ARG A CD    
423  N  NE    . ARG A 56  ? 1.2081 0.7589 1.0620 -0.0704 0.1663  -0.0724 56  ARG A NE    
424  C  CZ    . ARG A 56  ? 1.3758 0.9227 1.2443 -0.0942 0.1646  -0.0635 56  ARG A CZ    
425  N  NH1   . ARG A 56  ? 1.2051 0.7355 1.0696 -0.1306 0.1614  -0.0769 56  ARG A NH1   
426  N  NH2   . ARG A 56  ? 1.2150 0.7772 1.1022 -0.0825 0.1665  -0.0421 56  ARG A NH2   
427  N  N     . LYS A 57  ? 1.3418 0.7613 1.0270 -0.0381 0.1967  -0.1908 57  LYS A N     
428  C  CA    . LYS A 57  ? 1.3732 0.7965 1.0275 -0.0416 0.1979  -0.2163 57  LYS A CA    
429  C  C     . LYS A 57  ? 1.4774 0.8879 1.1121 0.0020  0.2166  -0.2257 57  LYS A C     
430  O  O     . LYS A 57  ? 1.4677 0.9209 1.0949 0.0101  0.2191  -0.2351 57  LYS A O     
431  C  CB    . LYS A 57  ? 1.4632 0.8283 1.0831 -0.0758 0.1940  -0.2418 57  LYS A CB    
432  C  CG    . LYS A 57  ? 1.5288 0.9306 1.1707 -0.1198 0.1729  -0.2375 57  LYS A CG    
433  C  CD    . LYS A 57  ? 1.6942 1.0467 1.3050 -0.1562 0.1673  -0.2647 57  LYS A CD    
434  C  CE    . LYS A 57  ? 1.7659 1.1673 1.4035 -0.1972 0.1447  -0.2612 57  LYS A CE    
435  N  NZ    . LYS A 57  ? 1.8440 1.3067 1.4765 -0.2033 0.1292  -0.2680 57  LYS A NZ    
436  N  N     . ARG A 58  ? 1.4839 0.8381 1.1105 0.0310  0.2298  -0.2220 58  ARG A N     
437  C  CA    . ARG A 58  ? 1.5185 0.8586 1.1305 0.0790  0.2475  -0.2299 58  ARG A CA    
438  C  C     . ARG A 58  ? 1.5132 0.9414 1.1650 0.1043  0.2476  -0.2112 58  ARG A C     
439  O  O     . ARG A 58  ? 1.5130 0.9758 1.1589 0.1253  0.2576  -0.2235 58  ARG A O     
440  C  CB    . ARG A 58  ? 1.5574 0.8156 1.1531 0.1043  0.2579  -0.2253 58  ARG A CB    
441  C  CG    . ARG A 58  ? 1.7124 0.8701 1.2624 0.0827  0.2618  -0.2461 58  ARG A CG    
442  C  CD    . ARG A 58  ? 1.8144 0.8832 1.3370 0.1184  0.2760  -0.2448 58  ARG A CD    
443  N  NE    . ARG A 58  ? 1.8014 0.8700 1.3495 0.1288  0.2729  -0.2118 58  ARG A NE    
444  C  CZ    . ARG A 58  ? 1.9334 0.9524 1.4772 0.0987  0.2692  -0.1988 58  ARG A CZ    
445  N  NH1   . ARG A 58  ? 1.8259 0.7937 1.3453 0.0543  0.2672  -0.2163 58  ARG A NH1   
446  N  NH2   . ARG A 58  ? 1.6570 0.6809 1.2209 0.1113  0.2676  -0.1687 58  ARG A NH2   
447  N  N     . ILE A 59  ? 1.4166 0.8827 1.1083 0.0998  0.2371  -0.1828 59  ILE A N     
448  C  CA    . ILE A 59  ? 1.3483 0.8965 1.0800 0.1179  0.2348  -0.1643 59  ILE A CA    
449  C  C     . ILE A 59  ? 1.3388 0.9540 1.0775 0.0980  0.2297  -0.1693 59  ILE A C     
450  O  O     . ILE A 59  ? 1.3189 0.9887 1.0711 0.1185  0.2373  -0.1686 59  ILE A O     
451  C  CB    . ILE A 59  ? 1.3419 0.9096 1.1093 0.1142  0.2236  -0.1352 59  ILE A CB    
452  C  CG1   . ILE A 59  ? 1.3244 0.9017 1.1034 0.0697  0.2075  -0.1272 59  ILE A CG1   
453  C  CG2   . ILE A 59  ? 1.3961 0.8999 1.1524 0.1394  0.2303  -0.1272 59  ILE A CG2   
454  C  CD1   . ILE A 59  ? 1.4066 1.0439 1.2277 0.0633  0.1950  -0.1021 59  ILE A CD1   
455  N  N     . LYS A 60  ? 1.2706 0.8809 0.9982 0.0581  0.2172  -0.1747 60  LYS A N     
456  C  CA    . LYS A 60  ? 1.2294 0.8937 0.9558 0.0371  0.2100  -0.1777 60  LYS A CA    
457  C  C     . LYS A 60  ? 1.3304 0.9968 1.0245 0.0525  0.2258  -0.2007 60  LYS A C     
458  O  O     . LYS A 60  ? 1.3007 1.0271 1.0048 0.0581  0.2301  -0.1961 60  LYS A O     
459  C  CB    . LYS A 60  ? 1.2437 0.8976 0.9617 -0.0046 0.1918  -0.1806 60  LYS A CB    
460  C  CG    . LYS A 60  ? 1.2107 0.9274 0.9375 -0.0245 0.1788  -0.1721 60  LYS A CG    
461  C  CD    . LYS A 60  ? 1.3187 1.0233 1.0268 -0.0601 0.1617  -0.1823 60  LYS A CD    
462  C  CE    . LYS A 60  ? 1.3836 1.1452 1.0990 -0.0770 0.1462  -0.1702 60  LYS A CE    
463  N  NZ    . LYS A 60  ? 1.5240 1.2784 1.2223 -0.1088 0.1268  -0.1804 60  LYS A NZ    
464  N  N     . LEU A 61  ? 1.3624 0.9619 1.0172 0.0597  0.2359  -0.2255 61  LEU A N     
465  C  CA    . LEU A 61  ? 1.4222 1.0141 1.0405 0.0772  0.2530  -0.2518 61  LEU A CA    
466  C  C     . LEU A 61  ? 1.4576 1.0908 1.0953 0.1200  0.2712  -0.2481 61  LEU A C     
467  O  O     . LEU A 61  ? 1.4593 1.1319 1.0847 0.1281  0.2834  -0.2601 61  LEU A O     
468  C  CB    . LEU A 61  ? 1.5189 1.0203 1.0922 0.0787  0.2598  -0.2789 61  LEU A CB    
469  C  CG    . LEU A 61  ? 1.6160 1.0840 1.1596 0.0347  0.2450  -0.2940 61  LEU A CG    
470  C  CD1   . LEU A 61  ? 1.6936 1.0660 1.2099 0.0298  0.2474  -0.3097 61  LEU A CD1   
471  C  CD2   . LEU A 61  ? 1.6918 1.1796 1.1966 0.0258  0.2486  -0.3177 61  LEU A CD2   
472  N  N     . VAL A 62  ? 1.3963 1.0249 1.0645 0.1465  0.2726  -0.2314 62  VAL A N     
473  C  CA    . VAL A 62  ? 1.3799 1.0542 1.0744 0.1887  0.2863  -0.2261 62  VAL A CA    
474  C  C     . VAL A 62  ? 1.3604 1.1296 1.0912 0.1755  0.2819  -0.2089 62  VAL A C     
475  O  O     . VAL A 62  ? 1.3599 1.1823 1.0964 0.1926  0.2968  -0.2163 62  VAL A O     
476  C  CB    . VAL A 62  ? 1.4315 1.0737 1.1456 0.2181  0.2846  -0.2108 62  VAL A CB    
477  C  CG1   . VAL A 62  ? 1.4088 1.1107 1.1559 0.2614  0.2949  -0.2043 62  VAL A CG1   
478  C  CG2   . VAL A 62  ? 1.5180 1.0573 1.1902 0.2309  0.2910  -0.2271 62  VAL A CG2   
479  N  N     . ALA A 63  ? 1.2640 1.0518 1.0174 0.1439  0.2624  -0.1870 63  ALA A N     
480  C  CA    . ALA A 63  ? 1.1993 1.0634 0.9838 0.1263  0.2551  -0.1685 63  ALA A CA    
481  C  C     . ALA A 63  ? 1.2959 1.1889 1.0544 0.1048  0.2598  -0.1795 63  ALA A C     
482  O  O     . ALA A 63  ? 1.2726 1.2291 1.0461 0.1075  0.2688  -0.1746 63  ALA A O     
483  C  CB    . ALA A 63  ? 1.1532 1.0144 0.9592 0.0993  0.2331  -0.1466 63  ALA A CB    
484  N  N     . GLU A 64  ? 1.3071 1.1534 1.0247 0.0825  0.2541  -0.1947 64  GLU A N     
485  C  CA    . GLU A 64  ? 1.3321 1.1955 1.0153 0.0608  0.2558  -0.2058 64  GLU A CA    
486  C  C     . GLU A 64  ? 1.4725 1.3565 1.1342 0.0842  0.2814  -0.2260 64  GLU A C     
487  O  O     . GLU A 64  ? 1.4678 1.3975 1.1174 0.0710  0.2871  -0.2248 64  GLU A O     
488  C  CB    . GLU A 64  ? 1.3860 1.1929 1.0306 0.0343  0.2421  -0.2204 64  GLU A CB    
489  C  CG    . GLU A 64  ? 1.4343 1.2433 1.0982 0.0032  0.2160  -0.2008 64  GLU A CG    
490  C  CD    . GLU A 64  ? 1.6946 1.4623 1.3259 -0.0260 0.2003  -0.2151 64  GLU A CD    
491  O  OE1   . GLU A 64  ? 1.6834 1.3928 1.2882 -0.0225 0.2060  -0.2377 64  GLU A OE1   
492  O  OE2   . GLU A 64  ? 1.5093 1.3029 1.1421 -0.0524 0.1811  -0.2038 64  GLU A OE2   
493  N  N     . LYS A 65  ? 1.5137 1.3630 1.1683 0.1195  0.2974  -0.2441 65  LYS A N     
494  C  CA    . LYS A 65  ? 1.5774 1.4446 1.2131 0.1484  0.3238  -0.2666 65  LYS A CA    
495  C  C     . LYS A 65  ? 1.6309 1.5880 1.3042 0.1593  0.3366  -0.2533 65  LYS A C     
496  O  O     . LYS A 65  ? 1.6370 1.6352 1.2909 0.1510  0.3505  -0.2615 65  LYS A O     
497  C  CB    . LYS A 65  ? 1.6668 1.4735 1.2900 0.1880  0.3362  -0.2867 65  LYS A CB    
498  C  CG    . LYS A 65  ? 1.9168 1.6386 1.4834 0.1769  0.3345  -0.3134 65  LYS A CG    
499  C  CD    . LYS A 65  ? 2.1021 1.7494 1.6555 0.2135  0.3439  -0.3291 65  LYS A CD    
500  C  CE    . LYS A 65  ? 2.2970 1.8524 1.7957 0.1962  0.3399  -0.3545 65  LYS A CE    
501  N  NZ    . LYS A 65  ? 2.4606 1.9334 1.9422 0.2315  0.3497  -0.3685 65  LYS A NZ    
502  N  N     . ASN A 66  ? 1.5774 1.5674 1.3025 0.1751  0.3321  -0.2332 66  ASN A N     
503  C  CA    . ASN A 66  ? 1.5505 1.6301 1.3147 0.1799  0.3427  -0.2210 66  ASN A CA    
504  C  C     . ASN A 66  ? 1.5483 1.6600 1.3344 0.1406  0.3230  -0.1928 66  ASN A C     
505  O  O     . ASN A 66  ? 1.4885 1.6195 1.3167 0.1414  0.3102  -0.1724 66  ASN A O     
506  C  CB    . ASN A 66  ? 1.5967 1.7069 1.4025 0.2246  0.3529  -0.2212 66  ASN A CB    
507  C  CG    . ASN A 66  ? 2.0677 2.1426 1.8494 0.2678  0.3724  -0.2494 66  ASN A CG    
508  O  OD1   . ASN A 66  ? 2.0531 2.0689 1.8320 0.2949  0.3673  -0.2526 66  ASN A OD1   
509  N  ND2   . ASN A 66  ? 1.9977 2.1054 1.7592 0.2762  0.3960  -0.2703 66  ASN A ND2   
510  N  N     . TYR A 67  ? 1.5209 1.6298 1.2715 0.1067  0.3195  -0.1932 67  TYR A N     
511  C  CA    . TYR A 67  ? 1.4700 1.5978 1.2241 0.0677  0.3016  -0.1700 67  TYR A CA    
512  C  C     . TYR A 67  ? 1.5516 1.6843 1.2553 0.0448  0.3091  -0.1787 67  TYR A C     
513  O  O     . TYR A 67  ? 1.5960 1.7163 1.2652 0.0596  0.3275  -0.2038 67  TYR A O     
514  C  CB    . TYR A 67  ? 1.4538 1.5284 1.2106 0.0522  0.2739  -0.1589 67  TYR A CB    
515  C  CG    . TYR A 67  ? 1.4165 1.5129 1.1899 0.0212  0.2539  -0.1326 67  TYR A CG    
516  C  CD1   . TYR A 67  ? 1.3841 1.5206 1.2046 0.0231  0.2495  -0.1123 67  TYR A CD1   
517  C  CD2   . TYR A 67  ? 1.4383 1.5135 1.1788 -0.0085 0.2381  -0.1289 67  TYR A CD2   
518  C  CE1   . TYR A 67  ? 1.3531 1.5036 1.1858 -0.0040 0.2317  -0.0896 67  TYR A CE1   
519  C  CE2   . TYR A 67  ? 1.4113 1.5030 1.1650 -0.0329 0.2196  -0.1047 67  TYR A CE2   
520  C  CZ    . TYR A 67  ? 1.4613 1.5874 1.2603 -0.0305 0.2170  -0.0854 67  TYR A CZ    
521  O  OH    . TYR A 67  ? 1.4577 1.5932 1.2664 -0.0532 0.1991  -0.0632 67  TYR A OH    
522  N  N     . ASP A 68  ? 1.4874 1.6365 1.1844 0.0107  0.2951  -0.1581 68  ASP A N     
523  C  CA    . ASP A 68  ? 1.5237 1.6774 1.1707 -0.0147 0.2973  -0.1590 68  ASP A CA    
524  C  C     . ASP A 68  ? 1.5959 1.8020 1.2319 -0.0074 0.3288  -0.1681 68  ASP A C     
525  O  O     . ASP A 68  ? 1.6532 1.8479 1.2442 -0.0006 0.3448  -0.1915 68  ASP A O     
526  C  CB    . ASP A 68  ? 1.5986 1.6916 1.1943 -0.0222 0.2851  -0.1779 68  ASP A CB    
527  C  CG    . ASP A 68  ? 1.7309 1.8008 1.3124 -0.0526 0.2545  -0.1613 68  ASP A CG    
528  O  OD1   . ASP A 68  ? 1.6806 1.7552 1.3020 -0.0593 0.2368  -0.1391 68  ASP A OD1   
529  O  OD2   . ASP A 68  ? 1.8635 1.9104 1.3938 -0.0677 0.2473  -0.1722 68  ASP A OD2   
530  N  N     . GLN A 69  ? 1.5028 1.7687 1.1808 -0.0097 0.3385  -0.1509 69  GLN A N     
531  C  CA    . GLN A 69  ? 1.5180 1.8464 1.1967 -0.0050 0.3701  -0.1574 69  GLN A CA    
532  C  C     . GLN A 69  ? 1.5726 1.9287 1.2195 -0.0411 0.3760  -0.1405 69  GLN A C     
533  O  O     . GLN A 69  ? 1.5267 1.8903 1.1893 -0.0670 0.3604  -0.1133 69  GLN A O     
534  C  CB    . GLN A 69  ? 1.4917 1.8768 1.2366 0.0177  0.3819  -0.1546 69  GLN A CB    
535  C  CG    . GLN A 69  ? 1.6802 2.0606 1.4372 0.0636  0.3971  -0.1819 69  GLN A CG    
536  C  CD    . GLN A 69  ? 1.9713 2.3684 1.6905 0.0784  0.4279  -0.2087 69  GLN A CD    
537  O  OE1   . GLN A 69  ? 1.9165 2.3696 1.6264 0.0627  0.4493  -0.2066 69  GLN A OE1   
538  N  NE2   . GLN A 69  ? 1.9011 2.2481 1.5962 0.1092  0.4321  -0.2351 69  GLN A NE2   
539  N  N     . ILE A 70  ? 0.9765 1.7355 1.2573 -0.2936 0.2207  -0.1937 70  ILE A N     
540  C  CA    . ILE A 70  ? 0.9498 1.7470 1.2231 -0.2644 0.1912  -0.1921 70  ILE A CA    
541  C  C     . ILE A 70  ? 0.9796 1.7225 1.2095 -0.2380 0.1837  -0.1597 70  ILE A C     
542  O  O     . ILE A 70  ? 0.9881 1.6682 1.1926 -0.2443 0.1976  -0.1478 70  ILE A O     
543  C  CB    . ILE A 70  ? 1.0004 1.8378 1.2848 -0.2740 0.1764  -0.2208 70  ILE A CB    
544  C  CG1   . ILE A 70  ? 1.0333 1.8121 1.2946 -0.2893 0.1849  -0.2273 70  ILE A CG1   
545  C  CG2   . ILE A 70  ? 1.0168 1.9272 1.3514 -0.2966 0.1771  -0.2553 70  ILE A CG2   
546  C  CD1   . ILE A 70  ? 1.1153 1.8826 1.3382 -0.2635 0.1673  -0.2141 70  ILE A CD1   
547  N  N     . SER A 71  ? 0.9074 1.6743 1.1303 -0.2089 0.1614  -0.1450 71  SER A N     
548  C  CA    . SER A 71  ? 0.8894 1.6117 1.0778 -0.1872 0.1524  -0.1141 71  SER A CA    
549  C  C     . SER A 71  ? 0.9209 1.6120 1.0808 -0.1911 0.1524  -0.1079 71  SER A C     
550  O  O     . SER A 71  ? 0.9222 1.6452 1.0835 -0.1957 0.1443  -0.1236 71  SER A O     
551  C  CB    . SER A 71  ? 0.9259 1.6778 1.1156 -0.1593 0.1274  -0.1001 71  SER A CB    
552  O  OG    . SER A 71  ? 1.0374 1.8444 1.2341 -0.1548 0.1099  -0.1106 71  SER A OG    
553  N  N     . SER A 72  ? 0.8577 1.4918 0.9922 -0.1878 0.1614  -0.0880 72  SER A N     
554  C  CA    . SER A 72  ? 0.8508 1.4564 0.9582 -0.1873 0.1627  -0.0810 72  SER A CA    
555  C  C     . SER A 72  ? 0.8657 1.4988 0.9600 -0.1715 0.1424  -0.0649 72  SER A C     
556  O  O     . SER A 72  ? 0.8509 1.4968 0.9488 -0.1583 0.1284  -0.0475 72  SER A O     
557  C  CB    . SER A 72  ? 0.8993 1.4468 0.9860 -0.1844 0.1756  -0.0638 72  SER A CB    
558  O  OG    . SER A 72  ? 1.0060 1.5452 1.0919 -0.1712 0.1691  -0.0451 72  SER A OG    
559  N  N     . ILE A 73  ? 0.8131 1.4552 0.8915 -0.1723 0.1412  -0.0703 73  ILE A N     
560  C  CA    . ILE A 73  ? 0.7989 1.4761 0.8613 -0.1602 0.1256  -0.0549 73  ILE A CA    
561  C  C     . ILE A 73  ? 0.8283 1.4968 0.8829 -0.1481 0.1140  -0.0179 73  ILE A C     
562  O  O     . ILE A 73  ? 0.8367 1.5409 0.8881 -0.1389 0.0981  -0.0028 73  ILE A O     
563  C  CB    . ILE A 73  ? 0.8449 1.5231 0.8871 -0.1606 0.1316  -0.0648 73  ILE A CB    
564  C  CG1   . ILE A 73  ? 0.8578 1.5983 0.8893 -0.1523 0.1178  -0.0667 73  ILE A CG1   
565  C  CG2   . ILE A 73  ? 0.8505 1.4892 0.8742 -0.1555 0.1392  -0.0433 73  ILE A CG2   
566  C  CD1   . ILE A 73  ? 1.0049 1.7801 1.0460 -0.1585 0.1160  -0.1067 73  ILE A CD1   
567  N  N     . GLU A 74  ? 0.7571 1.3770 0.8086 -0.1481 0.1210  -0.0039 74  GLU A N     
568  C  CA    . GLU A 74  ? 0.7416 1.3441 0.7890 -0.1402 0.1096  0.0268  74  GLU A CA    
569  C  C     . GLU A 74  ? 0.7786 1.3853 0.8426 -0.1305 0.0959  0.0319  74  GLU A C     
570  O  O     . GLU A 74  ? 0.7842 1.3767 0.8456 -0.1228 0.0820  0.0571  74  GLU A O     
571  C  CB    . GLU A 74  ? 0.7500 1.3070 0.7881 -0.1423 0.1188  0.0356  74  GLU A CB    
572  C  CG    . GLU A 74  ? 0.8402 1.3611 0.8872 -0.1387 0.1203  0.0346  74  GLU A CG    
573  C  CD    . GLU A 74  ? 1.0010 1.5123 1.0556 -0.1429 0.1365  0.0111  74  GLU A CD    
574  O  OE1   . GLU A 74  ? 0.8950 1.4121 0.9468 -0.1518 0.1489  -0.0047 74  GLU A OE1   
575  O  OE2   . GLU A 74  ? 0.8458 1.3428 0.9090 -0.1377 0.1374  0.0084  74  GLU A OE2   
576  N  N     . GLU A 75  ? 0.7197 1.3480 0.8022 -0.1309 0.0991  0.0072  75  GLU A N     
577  C  CA    . GLU A 75  ? 0.7212 1.3652 0.8227 -0.1177 0.0867  0.0051  75  GLU A CA    
578  C  C     . GLU A 75  ? 0.7701 1.4742 0.8793 -0.1108 0.0729  -0.0025 75  GLU A C     
579  O  O     . GLU A 75  ? 0.7734 1.5022 0.9005 -0.0967 0.0612  -0.0079 75  GLU A O     
580  C  CB    . GLU A 75  ? 0.7347 1.3696 0.8547 -0.1219 0.1013  -0.0172 75  GLU A CB    
581  C  CG    . GLU A 75  ? 0.9036 1.4860 1.0143 -0.1199 0.1089  -0.0075 75  GLU A CG    
582  C  CD    . GLU A 75  ? 1.2040 1.7796 1.3253 -0.1250 0.1276  -0.0260 75  GLU A CD    
583  O  OE1   . GLU A 75  ? 1.1082 1.7083 1.2421 -0.1400 0.1421  -0.0455 75  GLU A OE1   
584  O  OE2   . GLU A 75  ? 1.1403 1.6864 1.2567 -0.1155 0.1284  -0.0210 75  GLU A OE2   
585  N  N     . GLN A 76  ? 0.7189 1.4508 0.8131 -0.1174 0.0727  -0.0036 76  GLN A N     
586  C  CA    . GLN A 76  ? 0.7191 1.5144 0.8141 -0.1102 0.0590  -0.0122 76  GLN A CA    
587  C  C     . GLN A 76  ? 0.7976 1.6043 0.8678 -0.0961 0.0422  0.0252  76  GLN A C     
588  O  O     . GLN A 76  ? 0.8012 1.5818 0.8512 -0.1022 0.0476  0.0480  76  GLN A O     
589  C  CB    . GLN A 76  ? 0.7267 1.5496 0.8205 -0.1262 0.0701  -0.0441 76  GLN A CB    
590  C  CG    . GLN A 76  ? 0.8246 1.6364 0.9441 -0.1445 0.0870  -0.0789 76  GLN A CG    
591  C  CD    . GLN A 76  ? 1.0105 1.8353 1.1295 -0.1613 0.0965  -0.1112 76  GLN A CD    
592  O  OE1   . GLN A 76  ? 0.9449 1.8131 1.0517 -0.1564 0.0862  -0.1205 76  GLN A OE1   
593  N  NE2   . GLN A 76  ? 0.8944 1.6815 1.0259 -0.1809 0.1160  -0.1302 76  GLN A NE2   
594  N  N     . GLU A 77  ? 0.7729 1.6221 0.8450 -0.0773 0.0221  0.0328  77  GLU A N     
595  C  CA    . GLU A 77  ? 0.8029 1.6656 0.8492 -0.0624 0.0052  0.0730  77  GLU A CA    
596  C  C     . GLU A 77  ? 0.8684 1.7877 0.8913 -0.0666 0.0069  0.0684  77  GLU A C     
597  O  O     . GLU A 77  ? 0.8487 1.7533 0.8546 -0.0795 0.0197  0.0781  77  GLU A O     
598  C  CB    . GLU A 77  ? 0.8466 1.7303 0.9006 -0.0354 -0.0181 0.0841  77  GLU A CB    
599  C  CG    . GLU A 77  ? 0.9801 1.8102 1.0544 -0.0248 -0.0227 0.0887  77  GLU A CG    
600  C  CD    . GLU A 77  ? 1.2473 2.1034 1.3346 0.0065  -0.0454 0.0891  77  GLU A CD    
601  O  OE1   . GLU A 77  ? 1.0718 1.9653 1.1411 0.0254  -0.0638 0.1104  77  GLU A OE1   
602  O  OE2   . GLU A 77  ? 1.1994 2.0428 1.3140 0.0148  -0.0448 0.0679  77  GLU A OE2   
603  N  N     . PHE A 78  ? 0.8609 1.8508 0.8832 -0.0539 -0.0064 0.0505  78  PHE A N     
604  C  CA    . PHE A 78  ? 0.8748 1.9230 0.8735 -0.0560 -0.0051 0.0393  78  PHE A CA    
605  C  C     . PHE A 78  ? 0.9072 1.9648 0.9229 -0.0748 0.0100  -0.0145 78  PHE A C     
606  O  O     . PHE A 78  ? 0.8989 1.9766 0.9441 -0.0789 0.0077  -0.0523 78  PHE A O     
607  C  CB    . PHE A 78  ? 0.9331 2.0578 0.9149 -0.0325 -0.0274 0.0466  78  PHE A CB    
608  C  CG    . PHE A 78  ? 0.9749 2.1609 0.9240 -0.0314 -0.0261 0.0421  78  PHE A CG    
609  C  CD1   . PHE A 78  ? 1.0410 2.2276 0.9537 -0.0282 -0.0236 0.0902  78  PHE A CD1   
610  C  CD2   . PHE A 78  ? 1.0105 2.2571 0.9663 -0.0343 -0.0273 -0.0119 78  PHE A CD2   
611  C  CE1   . PHE A 78  ? 1.0772 2.3299 0.9582 -0.0249 -0.0207 0.0848  78  PHE A CE1   
612  C  CE2   . PHE A 78  ? 1.0724 2.3787 0.9962 -0.0298 -0.0269 -0.0211 78  PHE A CE2   
613  C  CZ    . PHE A 78  ? 1.0698 2.3819 0.9551 -0.0236 -0.0229 0.0275  78  PHE A CZ    
614  N  N     . ILE A 79  ? 0.8573 1.9004 0.8558 -0.0864 0.0252  -0.0176 79  ILE A N     
615  C  CA    . ILE A 79  ? 0.8476 1.8878 0.8568 -0.1021 0.0391  -0.0657 79  ILE A CA    
616  C  C     . ILE A 79  ? 0.9465 2.0648 0.9415 -0.0946 0.0292  -0.0960 79  ILE A C     
617  O  O     . ILE A 79  ? 0.9650 2.1224 0.9270 -0.0826 0.0256  -0.0765 79  ILE A O     
618  C  CB    . ILE A 79  ? 0.8689 1.8494 0.8694 -0.1137 0.0593  -0.0590 79  ILE A CB    
619  C  CG1   . ILE A 79  ? 0.8518 1.7603 0.8708 -0.1222 0.0683  -0.0433 79  ILE A CG1   
620  C  CG2   . ILE A 79  ? 0.8788 1.8552 0.8838 -0.1245 0.0709  -0.1067 79  ILE A CG2   
621  C  CD1   . ILE A 79  ? 0.9617 1.8432 0.9702 -0.1165 0.0650  0.0020  79  ILE A CD1   
622  N  N     . GLY A 80  ? 0.9161 2.0614 0.9374 -0.1024 0.0248  -0.1438 80  GLY A N     
623  C  CA    . GLY A 80  ? 0.9414 2.1634 0.9559 -0.0966 0.0125  -0.1836 80  GLY A CA    
624  C  C     . GLY A 80  ? 1.0219 2.3163 1.0402 -0.0789 -0.0113 -0.1803 80  GLY A C     
625  O  O     . GLY A 80  ? 1.0165 2.2961 1.0490 -0.0718 -0.0177 -0.1527 80  GLY A O     
626  N  N     . ASP A 81  ? 1.0060 2.3817 1.0116 -0.0688 -0.0258 -0.2123 81  ASP A N     
627  C  CA    . ASP A 81  ? 1.0215 2.4813 1.0255 -0.0473 -0.0515 -0.2137 81  ASP A CA    
628  C  C     . ASP A 81  ? 1.0729 2.5884 1.0234 -0.0218 -0.0610 -0.1824 81  ASP A C     
629  O  O     . ASP A 81  ? 1.0812 2.6264 1.0091 -0.0222 -0.0564 -0.2075 81  ASP A O     
630  C  CB    . ASP A 81  ? 1.0624 2.5817 1.0998 -0.0588 -0.0621 -0.2842 81  ASP A CB    
631  C  CG    . ASP A 81  ? 1.2748 2.8520 1.3417 -0.0476 -0.0831 -0.2917 81  ASP A CG    
632  O  OD1   . ASP A 81  ? 1.3634 2.8971 1.4636 -0.0560 -0.0766 -0.2791 81  ASP A OD1   
633  O  OD2   . ASP A 81  ? 1.3118 2.9837 1.3679 -0.0279 -0.1066 -0.3115 81  ASP A OD2   
634  N  N     . LEU A 82  ? 1.0279 2.5546 0.9570 0.0010  -0.0733 -0.1260 82  LEU A N     
635  C  CA    . LEU A 82  ? 1.0556 2.6345 0.9315 0.0244  -0.0811 -0.0851 82  LEU A CA    
636  C  C     . LEU A 82  ? 1.1296 2.8212 0.9900 0.0454  -0.1040 -0.1214 82  LEU A C     
637  O  O     . LEU A 82  ? 1.1248 2.8581 1.0041 0.0593  -0.1251 -0.1336 82  LEU A O     
638  C  CB    . LEU A 82  ? 1.0695 2.6104 0.9296 0.0395  -0.0871 -0.0109 82  LEU A CB    
639  C  CG    . LEU A 82  ? 1.1693 2.7379 0.9747 0.0555  -0.0881 0.0490  82  LEU A CG    
640  C  CD1   . LEU A 82  ? 1.1624 2.7121 0.9501 0.0368  -0.0632 0.0532  82  LEU A CD1   
641  C  CD2   . LEU A 82  ? 1.2215 2.7320 1.0202 0.0654  -0.0945 0.1184  82  LEU A CD2   
642  N  N     . ILE A 83  ? 1.0981 2.8431 0.9267 0.0484  -0.1001 -0.1447 83  ILE A N     
643  C  CA    . ILE A 83  ? 1.1259 2.9839 0.9346 0.0685  -0.1211 -0.1867 83  ILE A CA    
644  C  C     . ILE A 83  ? 1.2060 3.1330 0.9602 0.1034  -0.1369 -0.1287 83  ILE A C     
645  O  O     . ILE A 83  ? 1.2307 3.2204 0.9836 0.1266  -0.1626 -0.1307 83  ILE A O     
646  C  CB    . ILE A 83  ? 1.1748 3.0604 0.9717 0.0597  -0.1105 -0.2438 83  ILE A CB    
647  C  CG1   . ILE A 83  ? 1.1529 2.9741 1.0030 0.0268  -0.0989 -0.3076 83  ILE A CG1   
648  C  CG2   . ILE A 83  ? 1.2299 3.2420 0.9931 0.0860  -0.1329 -0.2809 83  ILE A CG2   
649  C  CD1   . ILE A 83  ? 1.2610 3.0809 1.0982 0.0199  -0.0857 -0.3557 83  ILE A CD1   
650  N  N     . GLN A 84  ? 1.1648 3.0857 0.8738 0.1071  -0.1213 -0.0778 84  GLN A N     
651  C  CA    . GLN A 84  ? 1.2094 3.1978 0.8588 0.1363  -0.1308 -0.0190 84  GLN A CA    
652  C  C     . GLN A 84  ? 1.2468 3.1652 0.8755 0.1266  -0.1107 0.0632  84  GLN A C     
653  O  O     . GLN A 84  ? 1.2086 3.0667 0.8525 0.1012  -0.0864 0.0597  84  GLN A O     
654  C  CB    . GLN A 84  ? 1.2568 3.3506 0.8673 0.1495  -0.1316 -0.0612 84  GLN A CB    
655  C  CG    . GLN A 84  ? 1.4577 3.4765 0.9984 0.1640  -0.1335 -0.0024 84  GLN A CG    
656  C  CD    . GLN A 84  ? 1.6025 3.4848 1.1172 0.1428  -0.1037 0.0446  84  GLN A CD    
657  O  OE1   . GLN A 84  ? 1.4723 3.4840 1.0028 0.1358  -0.0826 0.0127  84  GLN A OE1   
658  N  NE2   . GLN A 84  ? 1.5254 3.4494 0.9988 0.1546  -0.1017 0.1248  84  GLN A NE2   
659  N  N     . VAL A 85  ? 1.2425 3.1692 0.8370 0.1469  -0.1218 0.1370  85  VAL A N     
660  C  CA    . VAL A 85  ? 1.2562 3.1203 0.8294 0.1364  -0.1057 0.2209  85  VAL A CA    
661  C  C     . VAL A 85  ? 1.3734 3.3076 0.8820 0.1621  -0.1137 0.2878  85  VAL A C     
662  O  O     . VAL A 85  ? 1.4125 3.3875 0.9024 0.1932  -0.1398 0.3027  85  VAL A O     
663  C  CB    . VAL A 85  ? 1.2848 3.0309 0.8977 0.1245  -0.1077 0.2536  85  VAL A CB    
664  C  CG1   . VAL A 85  ? 1.3254 3.0175 0.9105 0.1205  -0.1008 0.3464  85  VAL A CG1   
665  C  CG2   . VAL A 85  ? 1.2157 2.8846 0.8806 0.0925  -0.0892 0.2084  85  VAL A CG2   
666  N  N     . ASN A 86  ? 1.3405 3.2909 0.8154 0.1494  -0.0905 0.3297  86  ASN A N     
667  C  CA    . ASN A 86  ? 1.4084 3.4024 0.8208 0.1638  -0.0897 0.4056  86  ASN A CA    
668  C  C     . ASN A 86  ? 1.4657 3.3663 0.8904 0.1336  -0.0701 0.4794  86  ASN A C     
669  O  O     . ASN A 86  ? 1.4300 3.3142 0.8685 0.1047  -0.0437 0.4730  86  ASN A O     
670  C  CB    . ASN A 86  ? 1.3994 3.4108 0.7665 0.1634  -0.0768 0.3715  86  ASN A CB    
671  C  CG    . ASN A 86  ? 1.6171 3.3970 0.9073 0.1593  -0.0820 0.3957  86  ASN A CG    
672  O  OD1   . ASN A 86  ? 1.5253 3.3408 0.7944 0.1683  -0.0872 0.4819  86  ASN A OD1   
673  N  ND2   . ASN A 86  ? 1.4854 3.3777 0.7356 0.1727  -0.0758 0.3734  86  ASN A ND2   
674  N  N     . PRO A 87  ? 1.4617 3.2833 0.8900 0.1389  -0.0848 0.5387  87  PRO A N     
675  C  CA    . PRO A 87  ? 1.4659 3.1769 0.9140 0.1067  -0.0695 0.5983  87  PRO A CA    
676  C  C     . PRO A 87  ? 1.5464 3.2817 0.9683 0.0792  -0.0402 0.6496  87  PRO A C     
677  O  O     . PRO A 87  ? 1.6104 3.3099 0.9693 0.0867  -0.0383 0.6682  87  PRO A O     
678  C  CB    . PRO A 87  ? 1.5516 3.2027 0.9879 0.1282  -0.0940 0.6593  87  PRO A CB    
679  C  CG    . PRO A 87  ? 1.5934 3.2920 1.0353 0.1660  -0.1224 0.6049  87  PRO A CG    
680  C  CD    . PRO A 87  ? 1.5210 3.3443 0.9381 0.1760  -0.1179 0.5488  87  PRO A CD    
681  N  N     . ASN A 88  ? 1.4435 3.1202 0.9063 0.0428  -0.0183 0.6342  88  ASN A N     
682  C  CA    . ASN A 88  ? 1.4473 3.1418 0.9024 0.0105  0.0116  0.6715  88  ASN A CA    
683  C  C     . ASN A 88  ? 1.5099 3.3382 0.9270 0.0211  0.0274  0.6444  88  ASN A C     
684  O  O     . ASN A 88  ? 1.5413 3.3311 0.9306 0.0018  0.0506  0.6673  88  ASN A O     
685  C  CB    . ASN A 88  ? 1.5094 3.1516 0.9450 -0.0073 0.0146  0.7734  88  ASN A CB    
686  C  CG    . ASN A 88  ? 1.6731 3.1863 1.1366 -0.0071 -0.0067 0.7990  88  ASN A CG    
687  O  OD1   . ASN A 88  ? 1.5613 2.9843 1.0761 -0.0272 -0.0054 0.7714  88  ASN A OD1   
688  N  ND2   . ASN A 88  ? 1.5793 3.0830 1.0075 0.0189  -0.0276 0.8523  88  ASN A ND2   
689  N  N     . VAL A 89  ? 1.4318 3.3295 0.8441 0.0502  0.0147  0.5689  89  VAL A N     
690  C  CA    . VAL A 89  ? 1.4331 3.4054 0.8082 0.0646  0.0247  0.5192  89  VAL A CA    
691  C  C     . VAL A 89  ? 1.4011 3.4302 0.8162 0.0662  0.0285  0.4298  89  VAL A C     
692  O  O     . VAL A 89  ? 1.3689 3.4038 0.7988 0.0483  0.0519  0.4126  89  VAL A O     
693  C  CB    . VAL A 89  ? 1.5465 3.4212 0.8570 0.0939  0.0028  0.4923  89  VAL A CB    
694  C  CG1   . VAL A 89  ? 1.5556 3.4445 0.8265 0.1031  0.0134  0.4365  89  VAL A CG1   
695  C  CG2   . VAL A 89  ? 1.6281 3.3866 0.8893 0.0910  -0.0023 0.5664  89  VAL A CG2   
696  N  N     . LYS A 90  ? 1.3229 3.3497 0.7540 0.0865  0.0050  0.3653  90  LYS A N     
697  C  CA    . LYS A 90  ? 1.2613 3.2840 0.7272 0.0867  0.0047  0.2705  90  LYS A CA    
698  C  C     . LYS A 90  ? 1.2898 3.2440 0.7972 0.0891  -0.0181 0.2320  90  LYS A C     
699  O  O     . LYS A 90  ? 1.3190 3.2879 0.8132 0.1082  -0.0409 0.2527  90  LYS A O     
700  C  CB    . LYS A 90  ? 1.3127 3.4625 0.7411 0.1135  0.0019  0.2158  90  LYS A CB    
701  C  CG    . LYS A 90  ? 1.3707 3.4792 0.8321 0.1116  0.0018  0.1145  90  LYS A CG    
702  C  CD    . LYS A 90  ? 1.4699 3.4498 0.9001 0.1266  -0.0141 0.0481  90  LYS A CD    
703  C  CE    . LYS A 90  ? 1.5022 3.4479 0.9719 0.1238  -0.0202 -0.0415 90  LYS A CE    
704  N  NZ    . LYS A 90  ? 1.5780 3.4519 1.0237 0.1362  -0.0408 -0.0930 90  LYS A NZ    
705  N  N     . ALA A 91  ? 1.1919 3.0751 0.7489 0.0709  -0.0115 0.1774  91  ALA A N     
706  C  CA    . ALA A 91  ? 1.1538 2.9752 0.7553 0.0683  -0.0280 0.1364  91  ALA A CA    
707  C  C     . ALA A 91  ? 1.1609 2.9678 0.7962 0.0588  -0.0221 0.0512  91  ALA A C     
708  O  O     . ALA A 91  ? 1.1470 2.9489 0.7819 0.0493  -0.0022 0.0343  91  ALA A O     
709  C  CB    . ALA A 91  ? 1.1406 2.8510 0.7731 0.0495  -0.0251 0.1844  91  ALA A CB    
710  N  N     . GLN A 92  ? 1.0977 2.9007 0.7624 0.0620  -0.0399 -0.0022 92  GLN A N     
711  C  CA    . GLN A 92  ? 1.0663 2.8490 0.7655 0.0502  -0.0366 -0.0827 92  GLN A CA    
712  C  C     . GLN A 92  ? 1.0775 2.7840 0.8297 0.0334  -0.0428 -0.1040 92  GLN A C     
713  O  O     . GLN A 92  ? 1.0837 2.8006 0.8442 0.0425  -0.0609 -0.0866 92  GLN A O     
714  C  CB    . GLN A 92  ? 1.1165 3.0015 0.7965 0.0695  -0.0519 -0.1459 92  GLN A CB    
715  C  CG    . GLN A 92  ? 1.2859 3.2547 0.9144 0.0874  -0.0431 -0.1413 92  GLN A CG    
716  C  CD    . GLN A 92  ? 1.4748 3.5007 1.1011 0.0973  -0.0502 -0.2285 92  GLN A CD    
717  O  OE1   . GLN A 92  ? 1.3839 3.3629 1.0339 0.0848  -0.0379 -0.2775 92  GLN A OE1   
718  N  NE2   . GLN A 92  ? 1.3793 3.4708 0.9761 0.1194  -0.0716 -0.2473 92  GLN A NE2   
719  N  N     . SER A 93  ? 0.9907 2.6247 0.7777 0.0111  -0.0275 -0.1413 93  SER A N     
720  C  CA    . SER A 93  ? 0.9496 2.5148 0.7870 -0.0080 -0.0289 -0.1652 93  SER A CA    
721  C  C     . SER A 93  ? 0.9758 2.5164 0.8414 -0.0249 -0.0218 -0.2379 93  SER A C     
722  O  O     . SER A 93  ? 0.9803 2.5186 0.8299 -0.0242 -0.0097 -0.2592 93  SER A O     
723  C  CB    . SER A 93  ? 0.9626 2.4348 0.8157 -0.0214 -0.0158 -0.1124 93  SER A CB    
724  O  OG    . SER A 93  ? 1.0380 2.4451 0.8973 -0.0373 0.0066  -0.1154 93  SER A OG    
725  N  N     . ILE A 94  ? 0.9159 2.4398 0.8240 -0.0396 -0.0295 -0.2758 94  ILE A N     
726  C  CA    . ILE A 94  ? 0.9161 2.4078 0.8563 -0.0611 -0.0234 -0.3425 94  ILE A CA    
727  C  C     . ILE A 94  ? 0.9371 2.3277 0.9178 -0.0883 -0.0066 -0.3366 94  ILE A C     
728  O  O     . ILE A 94  ? 0.9064 2.2807 0.9067 -0.0915 -0.0094 -0.3058 94  ILE A O     
729  C  CB    . ILE A 94  ? 0.9813 2.5548 0.9367 -0.0596 -0.0458 -0.4045 94  ILE A CB    
730  C  CG1   . ILE A 94  ? 1.0124 2.5758 0.9779 -0.0724 -0.0425 -0.4765 94  ILE A CG1   
731  C  CG2   . ILE A 94  ? 0.9755 2.5601 0.9748 -0.0710 -0.0579 -0.4110 94  ILE A CG2   
732  C  CD1   . ILE A 94  ? 1.1343 2.7664 1.0544 -0.0469 -0.0489 -0.4984 94  ILE A CD1   
733  N  N     . LEU A 95  ? 0.9024 2.2258 0.8923 -0.1044 0.0106  -0.3643 95  LEU A N     
734  C  CA    . LEU A 95  ? 0.8821 2.1116 0.9044 -0.1290 0.0279  -0.3575 95  LEU A CA    
735  C  C     . LEU A 95  ? 0.9708 2.1597 1.0208 -0.1528 0.0346  -0.4176 95  LEU A C     
736  O  O     . LEU A 95  ? 0.9880 2.1506 1.0209 -0.1486 0.0416  -0.4415 95  LEU A O     
737  C  CB    . LEU A 95  ? 0.8596 2.0230 0.8615 -0.1240 0.0459  -0.3060 95  LEU A CB    
738  C  CG    . LEU A 95  ? 0.8953 1.9638 0.9223 -0.1446 0.0641  -0.2929 95  LEU A CG    
739  C  CD1   . LEU A 95  ? 0.8725 1.9402 0.9240 -0.1506 0.0597  -0.2668 95  LEU A CD1   
740  C  CD2   . LEU A 95  ? 0.9118 1.9273 0.9152 -0.1367 0.0793  -0.2556 95  LEU A CD2   
741  N  N     . ASP A 96  ? 0.9383 2.1226 1.0322 -0.1777 0.0325  -0.4422 96  ASP A N     
742  C  CA    . ASP A 96  ? 0.9736 2.1112 1.1001 -0.2080 0.0403  -0.4950 96  ASP A CA    
743  C  C     . ASP A 96  ? 1.0234 2.0521 1.1551 -0.2234 0.0657  -0.4681 96  ASP A C     
744  O  O     . ASP A 96  ? 0.9864 1.9911 1.1306 -0.2295 0.0747  -0.4287 96  ASP A O     
745  C  CB    . ASP A 96  ? 1.0050 2.1911 1.1799 -0.2321 0.0293  -0.5301 96  ASP A CB    
746  C  CG    . ASP A 96  ? 1.1963 2.4855 1.3694 -0.2207 0.0029  -0.5761 96  ASP A CG    
747  O  OD1   . ASP A 96  ? 1.2720 2.6409 1.4277 -0.1944 -0.0140 -0.5520 96  ASP A OD1   
748  O  OD2   . ASP A 96  ? 1.2494 2.5377 1.4360 -0.2363 -0.0018 -0.6363 96  ASP A OD2   
749  N  N     . ILE A 97  ? 1.0189 1.9839 1.1370 -0.2247 0.0763  -0.4885 97  ILE A N     
750  C  CA    . ILE A 97  ? 1.0217 1.8832 1.1380 -0.2342 0.0991  -0.4633 97  ILE A CA    
751  C  C     . ILE A 97  ? 1.1192 1.9283 1.2783 -0.2734 0.1110  -0.4823 97  ILE A C     
752  O  O     . ILE A 97  ? 1.1681 1.9508 1.3455 -0.2938 0.1106  -0.5308 97  ILE A O     
753  C  CB    . ILE A 97  ? 1.0875 1.9022 1.1693 -0.2134 0.1053  -0.4708 97  ILE A CB    
754  C  CG1   . ILE A 97  ? 1.0671 1.9492 1.1090 -0.1772 0.0961  -0.4473 97  ILE A CG1   
755  C  CG2   . ILE A 97  ? 1.1021 1.8130 1.1797 -0.2190 0.1270  -0.4423 97  ILE A CG2   
756  C  CD1   . ILE A 97  ? 1.0868 1.9815 1.1148 -0.1657 0.1001  -0.3803 97  ILE A CD1   
757  N  N     . THR A 98  ? 1.0554 1.8541 1.2314 -0.2845 0.1211  -0.4445 98  THR A N     
758  C  CA    . THR A 98  ? 1.0694 1.8298 1.2855 -0.3218 0.1363  -0.4501 98  THR A CA    
759  C  C     . THR A 98  ? 1.1369 1.7894 1.3385 -0.3281 0.1607  -0.4226 98  THR A C     
760  O  O     . THR A 98  ? 1.1231 1.7409 1.2864 -0.3007 0.1634  -0.3970 98  THR A O     
761  C  CB    . THR A 98  ? 1.1714 1.9949 1.4117 -0.3240 0.1324  -0.4273 98  THR A CB    
762  O  OG1   . THR A 98  ? 1.2424 2.0410 1.5230 -0.3605 0.1493  -0.4331 98  THR A OG1   
763  C  CG2   . THR A 98  ? 1.1036 1.9234 1.3135 -0.2935 0.1333  -0.3712 98  THR A CG2   
764  N  N     . SER A 99  ? 1.1211 1.7267 1.3536 -0.3642 0.1786  -0.4262 99  SER A N     
765  C  CA    . SER A 99  ? 1.1432 1.6477 1.3630 -0.3733 0.2030  -0.3980 99  SER A CA    
766  C  C     . SER A 99  ? 1.1403 1.6331 1.3311 -0.3469 0.2104  -0.3431 99  SER A C     
767  O  O     . SER A 99  ? 1.1570 1.5738 1.3204 -0.3375 0.2241  -0.3183 99  SER A O     
768  C  CB    . SER A 99  ? 1.2228 1.7008 1.4844 -0.4201 0.2211  -0.4074 99  SER A CB    
769  O  OG    . SER A 99  ? 1.2867 1.8499 1.5851 -0.4341 0.2178  -0.4080 99  SER A OG    
770  N  N     . ASP A 100 ? 1.0362 1.6041 1.2321 -0.3328 0.1988  -0.3264 100 ASP A N     
771  C  CA    . ASP A 100 ? 0.9897 1.5555 1.1637 -0.3091 0.2013  -0.2798 100 ASP A CA    
772  C  C     . ASP A 100 ? 1.0132 1.5726 1.1465 -0.2749 0.1915  -0.2621 100 ASP A C     
773  O  O     . ASP A 100 ? 0.9785 1.5161 1.0911 -0.2580 0.1957  -0.2253 100 ASP A O     
774  C  CB    . ASP A 100 ? 0.9766 1.6207 1.1738 -0.3058 0.1902  -0.2724 100 ASP A CB    
775  C  CG    . ASP A 100 ? 1.1954 1.8709 1.4393 -0.3385 0.1976  -0.2954 100 ASP A CG    
776  O  OD1   . ASP A 100 ? 1.2330 1.8605 1.4876 -0.3613 0.2204  -0.2865 100 ASP A OD1   
777  O  OD2   . ASP A 100 ? 1.2892 2.0425 1.5590 -0.3411 0.1808  -0.3212 100 ASP A OD2   
778  N  N     . SER A 101 ? 0.9909 1.5754 1.1141 -0.2653 0.1784  -0.2902 101 SER A N     
779  C  CA    . SER A 101 ? 0.9779 1.5733 1.0653 -0.2342 0.1698  -0.2776 101 SER A CA    
780  C  C     . SER A 101 ? 1.0585 1.5857 1.1228 -0.2250 0.1794  -0.2866 101 SER A C     
781  O  O     . SER A 101 ? 1.0283 1.5570 1.0642 -0.1993 0.1773  -0.2685 101 SER A O     
782  C  CB    . SER A 101 ? 1.0181 1.6975 1.1035 -0.2231 0.1493  -0.3004 101 SER A CB    
783  O  OG    . SER A 101 ? 1.1122 1.8542 1.2210 -0.2301 0.1383  -0.2983 101 SER A OG    
784  N  N     . VAL A 102 ? 1.0781 1.5457 1.1558 -0.2460 0.1896  -0.3136 102 VAL A N     
785  C  CA    . VAL A 102 ? 1.1338 1.5258 1.1910 -0.2360 0.1974  -0.3257 102 VAL A CA    
786  C  C     . VAL A 102 ? 1.2252 1.5317 1.2715 -0.2386 0.2169  -0.2921 102 VAL A C     
787  O  O     . VAL A 102 ? 1.2075 1.5035 1.2706 -0.2604 0.2280  -0.2716 102 VAL A O     
788  C  CB    . VAL A 102 ? 1.2430 1.6121 1.3175 -0.2541 0.1937  -0.3803 102 VAL A CB    
789  C  CG1   . VAL A 102 ? 1.2350 1.6876 1.3082 -0.2406 0.1727  -0.4177 102 VAL A CG1   
790  C  CG2   . VAL A 102 ? 1.2603 1.6096 1.3746 -0.2981 0.2031  -0.3913 102 VAL A CG2   
791  N  N     . PHE A 103 ? 1.2376 1.4862 1.2546 -0.2142 0.2208  -0.2886 103 PHE A N     
792  C  CA    . PHE A 103 ? 1.2782 1.4408 1.2785 -0.2113 0.2377  -0.2592 103 PHE A CA    
793  C  C     . PHE A 103 ? 1.4093 1.4994 1.4278 -0.2435 0.2493  -0.2804 103 PHE A C     
794  O  O     . PHE A 103 ? 1.4604 1.5248 1.4828 -0.2447 0.2428  -0.3209 103 PHE A O     
795  C  CB    . PHE A 103 ? 1.3318 1.4615 1.2972 -0.1716 0.2352  -0.2548 103 PHE A CB    
796  C  CG    . PHE A 103 ? 1.3020 1.4913 1.2493 -0.1425 0.2275  -0.2281 103 PHE A CG    
797  C  CD1   . PHE A 103 ? 1.3109 1.5010 1.2525 -0.1417 0.2338  -0.1863 103 PHE A CD1   
798  C  CD2   . PHE A 103 ? 1.3288 1.5719 1.2644 -0.1158 0.2149  -0.2458 103 PHE A CD2   
799  C  CE1   . PHE A 103 ? 1.2784 1.5196 1.2074 -0.1191 0.2259  -0.1635 103 PHE A CE1   
800  C  CE2   . PHE A 103 ? 1.3211 1.6199 1.2435 -0.0941 0.2097  -0.2190 103 PHE A CE2   
801  C  CZ    . PHE A 103 ? 1.2622 1.5569 1.1832 -0.0976 0.2147  -0.1784 103 PHE A CZ    
802  N  N     . HIS A 104 ? 1.3695 1.4321 1.4014 -0.2714 0.2662  -0.2549 104 HIS A N     
803  C  CA    . HIS A 104 ? 1.4346 1.4342 1.4889 -0.3111 0.2816  -0.2656 104 HIS A CA    
804  C  C     . HIS A 104 ? 1.5578 1.4576 1.5980 -0.3076 0.2844  -0.2858 104 HIS A C     
805  O  O     . HIS A 104 ? 1.6023 1.4777 1.6698 -0.3382 0.2835  -0.3231 104 HIS A O     
806  C  CB    . HIS A 104 ? 1.4467 1.4250 1.5015 -0.3290 0.3033  -0.2218 104 HIS A CB    
807  C  CG    . HIS A 104 ? 1.5785 1.4769 1.6465 -0.3674 0.3246  -0.2192 104 HIS A CG    
808  N  ND1   . HIS A 104 ? 1.6351 1.5442 1.7473 -0.4117 0.3261  -0.2545 104 HIS A ND1   
809  C  CD2   . HIS A 104 ? 1.6655 1.4760 1.7079 -0.3684 0.3449  -0.1834 104 HIS A CD2   
810  C  CE1   . HIS A 104 ? 1.7085 1.5324 1.8229 -0.4417 0.3485  -0.2381 104 HIS A CE1   
811  N  NE2   . HIS A 104 ? 1.7352 1.4962 1.8058 -0.4160 0.3609  -0.1932 104 HIS A NE2   
812  N  N     . LYS A 105 ? 1.5300 1.3731 1.5294 -0.2697 0.2861  -0.2635 105 LYS A N     
813  C  CA    . LYS A 105 ? 1.6184 1.3572 1.5977 -0.2562 0.2879  -0.2771 105 LYS A CA    
814  C  C     . LYS A 105 ? 1.6640 1.4164 1.6434 -0.2344 0.2675  -0.3307 105 LYS A C     
815  O  O     . LYS A 105 ? 1.7410 1.4225 1.7303 -0.2488 0.2665  -0.3651 105 LYS A O     
816  C  CB    . LYS A 105 ? 1.6771 1.3564 1.6123 -0.2192 0.2962  -0.2326 105 LYS A CB    
817  C  CG    . LYS A 105 ? 1.9209 1.5563 1.8513 -0.2436 0.3196  -0.1846 105 LYS A CG    
818  C  CD    . LYS A 105 ? 2.0585 1.6649 1.9441 -0.2034 0.3244  -0.1396 105 LYS A CD    
819  C  CE    . LYS A 105 ? 2.2152 1.7753 2.0910 -0.2262 0.3484  -0.0940 105 LYS A CE    
820  N  NZ    . LYS A 105 ? 2.3165 1.8570 2.1467 -0.1849 0.3510  -0.0519 105 LYS A NZ    
821  N  N     . THR A 106 ? 1.5341 1.3772 1.5027 -0.2011 0.2516  -0.3383 106 THR A N     
822  C  CA    . THR A 106 ? 1.5392 1.4139 1.5029 -0.1747 0.2330  -0.3875 106 THR A CA    
823  C  C     . THR A 106 ? 1.5408 1.4898 1.5375 -0.2011 0.2201  -0.4334 106 THR A C     
824  O  O     . THR A 106 ? 1.5865 1.5246 1.5867 -0.1950 0.2081  -0.4854 106 THR A O     
825  C  CB    . THR A 106 ? 1.5967 1.5344 1.5309 -0.1256 0.2242  -0.3728 106 THR A CB    
826  O  OG1   . THR A 106 ? 1.4717 1.5063 1.4147 -0.1336 0.2222  -0.3458 106 THR A OG1   
827  C  CG2   . THR A 106 ? 1.6271 1.4951 1.5281 -0.0919 0.2323  -0.3389 106 THR A CG2   
828  N  N     . GLY A 107 ? 1.4060 1.4327 1.4248 -0.2258 0.2209  -0.4159 107 GLY A N     
829  C  CA    . GLY A 107 ? 1.3710 1.4824 1.4200 -0.2475 0.2072  -0.4535 107 GLY A CA    
830  C  C     . GLY A 107 ? 1.3503 1.5649 1.3827 -0.2139 0.1897  -0.4635 107 GLY A C     
831  O  O     . GLY A 107 ? 1.3309 1.6173 1.3789 -0.2212 0.1748  -0.5013 107 GLY A O     
832  N  N     . ILE A 108 ? 1.2707 1.4972 1.2713 -0.1777 0.1915  -0.4288 108 ILE A N     
833  C  CA    . ILE A 108 ? 1.2179 1.5400 1.1995 -0.1461 0.1790  -0.4272 108 ILE A CA    
834  C  C     . ILE A 108 ? 1.1823 1.5655 1.1678 -0.1527 0.1805  -0.3790 108 ILE A C     
835  O  O     . ILE A 108 ? 1.1612 1.5013 1.1464 -0.1597 0.1927  -0.3390 108 ILE A O     
836  C  CB    . ILE A 108 ? 1.2816 1.5807 1.2296 -0.1025 0.1800  -0.4242 108 ILE A CB    
837  C  CG1   . ILE A 108 ? 1.3821 1.5984 1.3252 -0.0924 0.1788  -0.4703 108 ILE A CG1   
838  C  CG2   . ILE A 108 ? 1.2479 1.6553 1.1784 -0.0732 0.1693  -0.4241 108 ILE A CG2   
839  C  CD1   . ILE A 108 ? 1.5251 1.6797 1.4394 -0.0540 0.1847  -0.4562 108 ILE A CD1   
840  N  N     . ALA A 109 ? 1.0940 1.5761 1.0811 -0.1482 0.1671  -0.3831 109 ALA A N     
841  C  CA    . ALA A 109 ? 1.0235 1.5647 1.0135 -0.1514 0.1648  -0.3401 109 ALA A CA    
842  C  C     . ALA A 109 ? 1.0418 1.5718 1.0099 -0.1306 0.1718  -0.2951 109 ALA A C     
843  O  O     . ALA A 109 ? 1.0547 1.5838 1.0010 -0.1043 0.1723  -0.3003 109 ALA A O     
844  C  CB    . ALA A 109 ? 1.0111 1.6545 0.9983 -0.1437 0.1483  -0.3529 109 ALA A CB    
845  N  N     . ARG A 110 ? 0.9554 1.4795 0.9315 -0.1417 0.1764  -0.2544 110 ARG A N     
846  C  CA    . ARG A 110 ? 0.9257 1.4416 0.8862 -0.1266 0.1811  -0.2130 110 ARG A CA    
847  C  C     . ARG A 110 ? 0.9522 1.5491 0.9002 -0.1104 0.1711  -0.1975 110 ARG A C     
848  O  O     . ARG A 110 ? 0.9306 1.5888 0.8841 -0.1157 0.1607  -0.2028 110 ARG A O     
849  C  CB    . ARG A 110 ? 0.9024 1.3900 0.8760 -0.1433 0.1873  -0.1806 110 ARG A CB    
850  C  CG    . ARG A 110 ? 1.0831 1.4934 1.0655 -0.1599 0.2011  -0.1891 110 ARG A CG    
851  C  CD    . ARG A 110 ? 1.1898 1.5749 1.1788 -0.1705 0.2096  -0.1567 110 ARG A CD    
852  N  NE    . ARG A 110 ? 1.2513 1.6561 1.2688 -0.1958 0.2102  -0.1639 110 ARG A NE    
853  C  CZ    . ARG A 110 ? 1.4568 1.8251 1.4915 -0.2196 0.2216  -0.1812 110 ARG A CZ    
854  N  NH1   . ARG A 110 ? 1.4430 1.7413 1.4665 -0.2215 0.2332  -0.1904 110 ARG A NH1   
855  N  NH2   . ARG A 110 ? 1.1760 1.5771 1.2403 -0.2416 0.2218  -0.1880 110 ARG A NH2   
856  N  N     . GLY A 111 ? 0.9144 1.5141 0.8456 -0.0908 0.1744  -0.1786 111 GLY A N     
857  C  CA    . GLY A 111 ? 0.8933 1.5695 0.8132 -0.0779 0.1686  -0.1600 111 GLY A CA    
858  C  C     . GLY A 111 ? 0.9052 1.6286 0.8333 -0.0919 0.1603  -0.1287 111 GLY A C     
859  O  O     . GLY A 111 ? 0.8909 1.6841 0.8118 -0.0883 0.1526  -0.1286 111 GLY A O     
860  N  N     . HIS A 112 ? 0.8458 1.5297 0.7868 -0.1058 0.1614  -0.1028 112 HIS A N     
861  C  CA    . HIS A 112 ? 0.8195 1.5309 0.7696 -0.1165 0.1524  -0.0721 112 HIS A CA    
862  C  C     . HIS A 112 ? 0.8738 1.6193 0.8331 -0.1240 0.1428  -0.0869 112 HIS A C     
863  O  O     . HIS A 112 ? 0.8586 1.6428 0.8183 -0.1252 0.1325  -0.0622 112 HIS A O     
864  C  CB    . HIS A 112 ? 0.8141 1.4726 0.7751 -0.1249 0.1554  -0.0479 112 HIS A CB    
865  C  CG    . HIS A 112 ? 0.8710 1.4712 0.8422 -0.1330 0.1640  -0.0671 112 HIS A CG    
866  N  ND1   . HIS A 112 ? 0.9111 1.4576 0.8739 -0.1274 0.1757  -0.0741 112 HIS A ND1   
867  C  CD2   . HIS A 112 ? 0.9005 1.4932 0.8894 -0.1464 0.1630  -0.0783 112 HIS A CD2   
868  C  CE1   . HIS A 112 ? 0.9205 1.4250 0.8946 -0.1402 0.1830  -0.0860 112 HIS A CE1   
869  N  NE2   . HIS A 112 ? 0.9147 1.4488 0.9070 -0.1531 0.1763  -0.0905 112 HIS A NE2   
870  N  N     . VAL A 113 ? 0.8515 1.5829 0.8186 -0.1289 0.1449  -0.1270 113 VAL A N     
871  C  CA    . VAL A 113 ? 0.8542 1.6256 0.8338 -0.1364 0.1344  -0.1497 113 VAL A CA    
872  C  C     . VAL A 113 ? 0.9152 1.7680 0.8762 -0.1228 0.1230  -0.1514 113 VAL A C     
873  O  O     . VAL A 113 ? 0.9031 1.8028 0.8656 -0.1223 0.1108  -0.1359 113 VAL A O     
874  C  CB    . VAL A 113 ? 0.9318 1.6697 0.9267 -0.1487 0.1398  -0.1959 113 VAL A CB    
875  C  CG1   . VAL A 113 ? 0.9351 1.7259 0.9474 -0.1578 0.1271  -0.2236 113 VAL A CG1   
876  C  CG2   . VAL A 113 ? 0.9299 1.5909 0.9395 -0.1632 0.1537  -0.1886 113 VAL A CG2   
877  N  N     . LEU A 114 ? 0.8883 1.7601 0.8299 -0.1089 0.1269  -0.1692 114 LEU A N     
878  C  CA    . LEU A 114 ? 0.8970 1.8529 0.8167 -0.0938 0.1188  -0.1728 114 LEU A CA    
879  C  C     . LEU A 114 ? 0.9095 1.9059 0.8152 -0.0897 0.1171  -0.1191 114 LEU A C     
880  O  O     . LEU A 114 ? 0.9197 1.9860 0.8108 -0.0832 0.1074  -0.1076 114 LEU A O     
881  C  CB    . LEU A 114 ? 0.9327 1.8982 0.8367 -0.0774 0.1244  -0.2104 114 LEU A CB    
882  C  CG    . LEU A 114 ? 1.0346 1.9793 0.9492 -0.0810 0.1207  -0.2696 114 LEU A CG    
883  C  CD1   . LEU A 114 ? 1.0640 1.9309 0.9805 -0.0768 0.1323  -0.2931 114 LEU A CD1   
884  C  CD2   . LEU A 114 ? 1.1020 2.1319 0.9995 -0.0662 0.1090  -0.3040 114 LEU A CD2   
885  N  N     . PHE A 115 ? 0.8245 1.7773 0.7343 -0.0943 0.1258  -0.0856 115 PHE A N     
886  C  CA    . PHE A 115 ? 0.8029 1.7827 0.7055 -0.0967 0.1244  -0.0337 115 PHE A CA    
887  C  C     . PHE A 115 ? 0.8341 1.8094 0.7461 -0.1055 0.1121  -0.0066 115 PHE A C     
888  O  O     . PHE A 115 ? 0.8348 1.8546 0.7342 -0.1041 0.1052  0.0286  115 PHE A O     
889  C  CB    . PHE A 115 ? 0.8094 1.7430 0.7190 -0.1010 0.1344  -0.0118 115 PHE A CB    
890  C  CG    . PHE A 115 ? 0.8203 1.7747 0.7288 -0.1098 0.1322  0.0400  115 PHE A CG    
891  C  CD1   . PHE A 115 ? 0.8675 1.8897 0.7608 -0.1060 0.1369  0.0590  115 PHE A CD1   
892  C  CD2   . PHE A 115 ? 0.8367 1.7448 0.7603 -0.1226 0.1254  0.0691  115 PHE A CD2   
893  C  CE1   . PHE A 115 ? 0.8797 1.9186 0.7749 -0.1198 0.1357  0.1094  115 PHE A CE1   
894  C  CE2   . PHE A 115 ? 0.8740 1.7927 0.7983 -0.1332 0.1218  0.1159  115 PHE A CE2   
895  C  CZ    . PHE A 115 ? 0.8607 1.8429 0.7716 -0.1342 0.1273  0.1374  115 PHE A CZ    
896  N  N     . ALA A 116 ? 0.7771 1.6993 0.7107 -0.1134 0.1098  -0.0218 116 ALA A N     
897  C  CA    . ALA A 116 ? 0.7671 1.6827 0.7136 -0.1174 0.0976  -0.0036 116 ALA A CA    
898  C  C     . ALA A 116 ? 0.8239 1.8096 0.7594 -0.1080 0.0834  -0.0079 116 ALA A C     
899  O  O     . ALA A 116 ? 0.8198 1.8234 0.7494 -0.1037 0.0720  0.0288  116 ALA A O     
900  C  CB    . ALA A 116 ? 0.7650 1.6268 0.7371 -0.1263 0.1009  -0.0285 116 ALA A CB    
901  N  N     . GLN A 117 ? 0.7964 1.8209 0.7273 -0.1033 0.0828  -0.0526 117 GLN A N     
902  C  CA    . GLN A 117 ? 0.8173 1.9192 0.7353 -0.0919 0.0681  -0.0651 117 GLN A CA    
903  C  C     . GLN A 117 ? 0.8677 2.0286 0.7519 -0.0801 0.0661  -0.0262 117 GLN A C     
904  O  O     . GLN A 117 ? 0.8848 2.0907 0.7560 -0.0710 0.0522  -0.0005 117 GLN A O     
905  C  CB    . GLN A 117 ? 0.8504 1.9762 0.7716 -0.0910 0.0683  -0.1275 117 GLN A CB    
906  C  CG    . GLN A 117 ? 0.9163 2.1270 0.8274 -0.0792 0.0504  -0.1496 117 GLN A CG    
907  C  CD    . GLN A 117 ? 1.0612 2.3054 0.9666 -0.0752 0.0500  -0.2097 117 GLN A CD    
908  O  OE1   . GLN A 117 ? 0.9823 2.1901 0.8855 -0.0768 0.0633  -0.2313 117 GLN A OE1   
909  N  NE2   . GLN A 117 ? 0.9657 2.2818 0.8677 -0.0670 0.0328  -0.2397 117 GLN A NE2   
910  N  N     . ALA A 118 ? 0.8014 1.9636 0.6721 -0.0799 0.0803  -0.0198 118 ALA A N     
911  C  CA    . ALA A 118 ? 0.8100 2.0326 0.6513 -0.0729 0.0837  0.0174  118 ALA A CA    
912  C  C     . ALA A 118 ? 0.8550 2.0575 0.6956 -0.0816 0.0799  0.0824  118 ALA A C     
913  O  O     . ALA A 118 ? 0.8681 2.1225 0.6862 -0.0749 0.0718  0.1167  118 ALA A O     
914  C  CB    . ALA A 118 ? 0.8135 2.0373 0.6496 -0.0716 0.1007  0.0058  118 ALA A CB    
915  N  N     . ASN A 119 ? 0.8032 1.9279 0.6675 -0.0957 0.0847  0.0984  119 ASN A N     
916  C  CA    . ASN A 119 ? 0.8093 1.8982 0.6787 -0.1059 0.0799  0.1537  119 ASN A CA    
917  C  C     . ASN A 119 ? 0.8871 1.9777 0.7550 -0.0971 0.0609  0.1701  119 ASN A C     
918  O  O     . ASN A 119 ? 0.9128 2.0218 0.7636 -0.0957 0.0537  0.2188  119 ASN A O     
919  C  CB    . ASN A 119 ? 0.7677 1.7740 0.6641 -0.1192 0.0861  0.1529  119 ASN A CB    
920  C  CG    . ASN A 119 ? 1.0097 1.9796 0.9121 -0.1321 0.0824  0.2050  119 ASN A CG    
921  O  OD1   . ASN A 119 ? 0.9435 1.9378 0.8375 -0.1423 0.0898  0.2366  119 ASN A OD1   
922  N  ND2   . ASN A 119 ? 0.9003 1.8131 0.8191 -0.1325 0.0708  0.2135  119 ASN A ND2   
923  N  N     . SER A 120 ? 0.8324 1.9084 0.7179 -0.0907 0.0531  0.1298  120 SER A N     
924  C  CA    . SER A 120 ? 0.8423 1.9281 0.7315 -0.0782 0.0339  0.1355  120 SER A CA    
925  C  C     . SER A 120 ? 0.9227 2.0899 0.7788 -0.0620 0.0228  0.1534  120 SER A C     
926  O  O     . SER A 120 ? 0.9476 2.1170 0.7930 -0.0516 0.0083  0.1947  120 SER A O     
927  C  CB    . SER A 120 ? 0.8609 1.9396 0.7769 -0.0772 0.0310  0.0807  120 SER A CB    
928  O  OG    . SER A 120 ? 0.9414 1.9465 0.8862 -0.0865 0.0350  0.0787  120 SER A OG    
929  N  N     . LEU A 121 ? 0.8801 2.1130 0.7178 -0.0575 0.0293  0.1228  121 LEU A N     
930  C  CA    . LEU A 121 ? 0.9120 2.2364 0.7132 -0.0400 0.0207  0.1317  121 LEU A CA    
931  C  C     . LEU A 121 ? 0.9919 2.3323 0.7631 -0.0412 0.0239  0.2019  121 LEU A C     
932  O  O     . LEU A 121 ? 1.0257 2.4142 0.7691 -0.0254 0.0106  0.2338  121 LEU A O     
933  C  CB    . LEU A 121 ? 0.9077 2.2898 0.6980 -0.0359 0.0294  0.0776  121 LEU A CB    
934  C  CG    . LEU A 121 ? 1.0003 2.4884 0.7536 -0.0148 0.0196  0.0667  121 LEU A CG    
935  C  CD1   . LEU A 121 ? 1.0197 2.5399 0.7756 0.0005  -0.0044 0.0540  121 LEU A CD1   
936  C  CD2   . LEU A 121 ? 1.0207 2.5478 0.7703 -0.0110 0.0277  0.0035  121 LEU A CD2   
937  N  N     . CYS A 122 ? 0.9324 2.2325 0.7105 -0.0606 0.0411  0.2272  122 CYS A N     
938  C  CA    . CYS A 122 ? 0.9607 2.2698 0.7184 -0.0705 0.0474  0.2943  122 CYS A CA    
939  C  C     . CYS A 122 ? 1.0484 2.3003 0.8094 -0.0714 0.0321  0.3472  122 CYS A C     
940  O  O     . CYS A 122 ? 1.0946 2.3785 0.8254 -0.0663 0.0268  0.4001  122 CYS A O     
941  C  CB    . CYS A 122 ? 0.9397 2.2239 0.7123 -0.0925 0.0682  0.2990  122 CYS A CB    
942  S  SG    . CYS A 122 ? 0.9722 2.3343 0.7326 -0.0848 0.0860  0.2469  122 CYS A SG    
943  N  N     . VAL A 123 ? 0.9888 2.1575 0.7840 -0.0751 0.0245  0.3327  123 VAL A N     
944  C  CA    . VAL A 123 ? 1.0185 2.1230 0.8213 -0.0711 0.0076  0.3731  123 VAL A CA    
945  C  C     . VAL A 123 ? 1.1078 2.2594 0.8877 -0.0415 -0.0138 0.3811  123 VAL A C     
946  O  O     . VAL A 123 ? 1.1569 2.2900 0.9192 -0.0330 -0.0267 0.4363  123 VAL A O     
947  C  CB    . VAL A 123 ? 1.0300 2.0489 0.8739 -0.0771 0.0051  0.3440  123 VAL A CB    
948  C  CG1   . VAL A 123 ? 1.0665 2.0131 0.9186 -0.0726 -0.0116 0.3856  123 VAL A CG1   
949  C  CG2   . VAL A 123 ? 0.9875 1.9739 0.8504 -0.1013 0.0251  0.3276  123 VAL A CG2   
950  N  N     . ALA A 124 ? 1.0422 2.2553 0.8220 -0.0260 -0.0181 0.3259  124 ALA A N     
951  C  CA    . ALA A 124 ? 1.0708 2.3458 0.8317 0.0034  -0.0393 0.3209  124 ALA A CA    
952  C  C     . ALA A 124 ? 1.1799 2.5322 0.8899 0.0140  -0.0398 0.3638  124 ALA A C     
953  O  O     . ALA A 124 ? 1.2267 2.6013 0.9114 0.0373  -0.0586 0.4007  124 ALA A O     
954  C  CB    . ALA A 124 ? 1.0398 2.3618 0.8195 0.0098  -0.0416 0.2447  124 ALA A CB    
955  N  N     . LEU A 125 ? 1.1362 2.5318 0.8300 -0.0008 -0.0189 0.3600  125 LEU A N     
956  C  CA    . LEU A 125 ? 1.1865 2.6683 0.8311 0.0068  -0.0137 0.3968  125 LEU A CA    
957  C  C     . LEU A 125 ? 1.3018 2.7511 0.9232 -0.0003 -0.0140 0.4857  125 LEU A C     
958  O  O     . LEU A 125 ? 1.3533 2.8580 0.9319 0.0192  -0.0239 0.5272  125 LEU A O     
959  C  CB    . LEU A 125 ? 1.1590 2.6901 0.7993 -0.0073 0.0106  0.3657  125 LEU A CB    
960  C  CG    . LEU A 125 ? 1.2592 2.8863 0.8517 -0.0036 0.0231  0.4003  125 LEU A CG    
961  C  CD1   . LEU A 125 ? 1.3067 3.0285 0.8563 0.0292  0.0057  0.3963  125 LEU A CD1   
962  C  CD2   . LEU A 125 ? 1.2470 2.9156 0.8449 -0.0126 0.0450  0.3557  125 LEU A CD2   
963  N  N     . ILE A 126 ? 1.2513 2.6107 0.9001 -0.0283 -0.0040 0.5149  126 ILE A N     
964  C  CA    . ILE A 126 ? 1.3115 2.6255 0.9457 -0.0422 -0.0036 0.5976  126 ILE A CA    
965  C  C     . ILE A 126 ? 1.4173 2.6583 1.0549 -0.0230 -0.0301 0.6270  126 ILE A C     
966  O  O     . ILE A 126 ? 1.3849 2.5441 1.0621 -0.0246 -0.0387 0.6010  126 ILE A O     
967  C  CB    . ILE A 126 ? 1.3276 2.5914 0.9882 -0.0827 0.0184  0.6162  126 ILE A CB    
968  C  CG1   . ILE A 126 ? 1.3079 2.6653 0.9545 -0.0941 0.0435  0.5992  126 ILE A CG1   
969  C  CG2   . ILE A 126 ? 1.4085 2.6116 1.0617 -0.1027 0.0169  0.6994  126 ILE A CG2   
970  C  CD1   . ILE A 126 ? 1.3014 2.6407 0.9844 -0.1080 0.0570  0.5430  126 ILE A CD1   
971  N  N     . LYS A 127 ? 1.4554 2.7318 1.0489 -0.0010 -0.0433 0.6805  127 LYS A N     
972  C  CA    . LYS A 127 ? 1.5137 2.7310 1.1005 0.0253  -0.0706 0.7170  127 LYS A CA    
973  C  C     . LYS A 127 ? 1.6461 2.7670 1.2327 0.0001  -0.0676 0.7949  127 LYS A C     
974  O  O     . LYS A 127 ? 1.7284 2.8645 1.2728 0.0001  -0.0671 0.8675  127 LYS A O     
975  C  CB    . LYS A 127 ? 1.5932 2.9024 1.1290 0.0655  -0.0879 0.7338  127 LYS A CB    
976  C  CG    . LYS A 127 ? 1.7420 3.0050 1.2713 0.1038  -0.1204 0.7590  127 LYS A CG    
977  C  CD    . LYS A 127 ? 1.8779 3.1558 1.3397 0.1387  -0.1385 0.7536  127 LYS A CD    
978  C  CE    . LYS A 127 ? 2.0348 3.0942 1.4542 0.1645  -0.1753 0.7347  127 LYS A CE    
979  N  NZ    . LYS A 127 ? 2.1626 3.1120 1.5031 0.1816  -0.2007 0.6808  127 LYS A NZ    
980  N  N     . GLN A 128 ? 1.5842 2.6078 1.2182 -0.0240 -0.0643 0.7781  128 GLN A N     
981  C  CA    . GLN A 128 ? 1.6463 2.5652 1.2930 -0.0527 -0.0631 0.8368  128 GLN A CA    
982  C  C     . GLN A 128 ? 1.6985 2.5079 1.3899 -0.0456 -0.0805 0.8054  128 GLN A C     
983  O  O     . GLN A 128 ? 1.6170 2.4408 1.3368 -0.0346 -0.0814 0.7342  128 GLN A O     
984  C  CB    . GLN A 128 ? 1.6380 2.5716 1.2980 -0.1018 -0.0330 0.8470  128 GLN A CB    
985  C  CG    . GLN A 128 ? 1.8117 2.8419 1.4274 -0.1143 -0.0138 0.8967  128 GLN A CG    
986  C  CD    . GLN A 128 ? 2.0881 2.9890 1.6383 -0.1042 -0.0181 0.9358  128 GLN A CD    
987  O  OE1   . GLN A 128 ? 2.0790 2.9098 1.6524 -0.1209 -0.0299 0.9991  128 GLN A OE1   
988  N  NE2   . GLN A 128 ? 2.0117 2.9813 1.5031 -0.0862 -0.0135 0.9525  128 GLN A NE2   
989  N  N     . PRO A 129 ? 1.7388 2.4383 1.4373 -0.0518 -0.0942 0.8555  129 PRO A N     
990  C  CA    . PRO A 129 ? 1.7266 2.3268 1.4663 -0.0409 -0.1115 0.8202  129 PRO A CA    
991  C  C     . PRO A 129 ? 1.6856 2.2729 1.4702 -0.0683 -0.0950 0.7586  129 PRO A C     
992  O  O     . PRO A 129 ? 1.6163 2.2037 1.4256 -0.0480 -0.1012 0.6968  129 PRO A O     
993  C  CB    . PRO A 129 ? 1.8536 2.3401 1.5904 -0.0524 -0.1245 0.8895  129 PRO A CB    
994  C  CG    . PRO A 129 ? 1.9831 2.5138 1.6683 -0.0511 -0.1221 0.9639  129 PRO A CG    
995  C  CD    . PRO A 129 ? 1.8608 2.5192 1.5299 -0.0683 -0.0949 0.9453  129 PRO A CD    
996  N  N     . THR A 130 ? 1.6331 2.2185 1.4272 -0.1137 -0.0732 0.7761  130 THR A N     
997  C  CA    . THR A 130 ? 1.5491 2.1263 1.3815 -0.1399 -0.0574 0.7243  130 THR A CA    
998  C  C     . THR A 130 ? 1.5277 2.2062 1.3506 -0.1604 -0.0301 0.7098  130 THR A C     
999  O  O     . THR A 130 ? 1.5611 2.2762 1.3651 -0.1848 -0.0165 0.7588  130 THR A O     
1000 C  CB    . THR A 130 ? 1.7163 2.1875 1.5798 -0.1705 -0.0616 0.7440  130 THR A CB    
1001 O  OG1   . THR A 130 ? 1.8219 2.2645 1.6669 -0.1934 -0.0622 0.8210  130 THR A OG1   
1002 C  CG2   . THR A 130 ? 1.7120 2.0906 1.5982 -0.1442 -0.0860 0.7173  130 THR A CG2   
1003 N  N     . VAL A 131 ? 1.3909 2.1167 1.2258 -0.1484 -0.0223 0.6426  131 VAL A N     
1004 C  CA    . VAL A 131 ? 1.3296 2.1463 1.1578 -0.1597 0.0010  0.6149  131 VAL A CA    
1005 C  C     . VAL A 131 ? 1.2904 2.0800 1.1554 -0.1724 0.0111  0.5592  131 VAL A C     
1006 O  O     . VAL A 131 ? 1.2563 2.0084 1.1398 -0.1548 0.0016  0.5158  131 VAL A O     
1007 C  CB    . VAL A 131 ? 1.3645 2.2717 1.1639 -0.1281 -0.0010 0.5874  131 VAL A CB    
1008 C  CG1   . VAL A 131 ? 1.3165 2.3129 1.1074 -0.1371 0.0218  0.5571  131 VAL A CG1   
1009 C  CG2   . VAL A 131 ? 1.4404 2.3749 1.1997 -0.1094 -0.0142 0.6424  131 VAL A CG2   
1010 N  N     . LEU A 132 ? 1.2054 2.0169 1.0806 -0.2020 0.0303  0.5628  132 LEU A N     
1011 C  CA    . LEU A 132 ? 1.1320 1.9230 1.0378 -0.2131 0.0401  0.5159  132 LEU A CA    
1012 C  C     . LEU A 132 ? 1.1383 2.0117 1.0384 -0.2235 0.0627  0.5000  132 LEU A C     
1013 O  O     . LEU A 132 ? 1.1691 2.0930 1.0564 -0.2411 0.0734  0.5402  132 LEU A O     
1014 C  CB    . LEU A 132 ? 1.1518 1.8600 1.0876 -0.2395 0.0345  0.5354  132 LEU A CB    
1015 C  CG    . LEU A 132 ? 1.2496 1.8623 1.1964 -0.2295 0.0111  0.5465  132 LEU A CG    
1016 C  CD1   . LEU A 132 ? 1.2861 1.8281 1.2595 -0.2614 0.0065  0.5711  132 LEU A CD1   
1017 C  CD2   . LEU A 132 ? 1.2386 1.8235 1.1981 -0.2017 0.0032  0.4894  132 LEU A CD2   
1018 N  N     . THR A 133 ? 1.0322 1.9181 0.9423 -0.2124 0.0703  0.4429  133 THR A N     
1019 C  CA    . THR A 133 ? 0.9991 1.9550 0.9058 -0.2159 0.0899  0.4201  133 THR A CA    
1020 C  C     . THR A 133 ? 1.0550 1.9928 0.9875 -0.2442 0.0981  0.4340  133 THR A C     
1021 O  O     . THR A 133 ? 1.0376 1.9044 0.9952 -0.2504 0.0908  0.4202  133 THR A O     
1022 C  CB    . THR A 133 ? 1.0439 2.0036 0.9529 -0.1940 0.0933  0.3564  133 THR A CB    
1023 O  OG1   . THR A 133 ? 1.0692 2.0249 0.9665 -0.1725 0.0809  0.3404  133 THR A OG1   
1024 C  CG2   . THR A 133 ? 0.9882 2.0260 0.8852 -0.1879 0.1105  0.3310  133 THR A CG2   
1025 N  N     . HIS A 134 ? 1.0346 2.0428 0.9617 -0.2612 0.1128  0.4609  134 HIS A N     
1026 C  CA    . HIS A 134 ? 1.0348 2.0458 0.9896 -0.2909 0.1213  0.4749  134 HIS A CA    
1027 C  C     . HIS A 134 ? 1.0283 2.1007 0.9887 -0.2819 0.1371  0.4340  134 HIS A C     
1028 O  O     . HIS A 134 ? 1.0076 2.0554 0.9951 -0.2912 0.1378  0.4160  134 HIS A O     
1029 C  CB    . HIS A 134 ? 1.1083 2.1513 1.0605 -0.3223 0.1268  0.5400  134 HIS A CB    
1030 C  CG    . HIS A 134 ? 1.2035 2.1538 1.1723 -0.3450 0.1104  0.5792  134 HIS A CG    
1031 N  ND1   . HIS A 134 ? 1.2811 2.2333 1.2647 -0.3854 0.1148  0.6333  134 HIS A ND1   
1032 C  CD2   . HIS A 134 ? 1.2337 2.0885 1.2081 -0.3323 0.0899  0.5688  134 HIS A CD2   
1033 C  CE1   . HIS A 134 ? 1.3143 2.1642 1.3106 -0.3951 0.0953  0.6531  134 HIS A CE1   
1034 N  NE2   . HIS A 134 ? 1.2904 2.0816 1.2811 -0.3616 0.0797  0.6145  134 HIS A NE2   
1035 N  N     . GLU A 135 ? 0.9632 2.1153 0.8973 -0.2607 0.1480  0.4169  135 GLU A N     
1036 C  CA    . GLU A 135 ? 0.9260 2.1385 0.8604 -0.2443 0.1619  0.3749  135 GLU A CA    
1037 C  C     . GLU A 135 ? 0.9644 2.2081 0.8693 -0.2103 0.1625  0.3353  135 GLU A C     
1038 O  O     . GLU A 135 ? 0.9822 2.2403 0.8631 -0.2034 0.1565  0.3505  135 GLU A O     
1039 C  CB    . GLU A 135 ? 0.9624 2.2729 0.9001 -0.2619 0.1793  0.4027  135 GLU A CB    
1040 C  CG    . GLU A 135 ? 1.1135 2.4129 1.0895 -0.2934 0.1819  0.4206  135 GLU A CG    
1041 C  CD    . GLU A 135 ? 1.4469 2.8461 1.4319 -0.3196 0.1993  0.4579  135 GLU A CD    
1042 O  OE1   . GLU A 135 ? 1.3936 2.8873 1.3528 -0.3056 0.2132  0.4596  135 GLU A OE1   
1043 O  OE2   . GLU A 135 ? 1.4223 2.8094 1.4416 -0.3551 0.1991  0.4835  135 GLU A OE2   
1044 N  N     . SER A 136 ? 0.8938 2.1477 0.8004 -0.1882 0.1686  0.2839  136 SER A N     
1045 C  CA    . SER A 136 ? 0.8880 2.1688 0.7711 -0.1573 0.1694  0.2381  136 SER A CA    
1046 C  C     . SER A 136 ? 0.9285 2.2426 0.8138 -0.1365 0.1803  0.1943  136 SER A C     
1047 O  O     . SER A 136 ? 0.9077 2.1803 0.8143 -0.1381 0.1815  0.1826  136 SER A O     
1048 C  CB    . SER A 136 ? 0.9127 2.1129 0.7962 -0.1479 0.1555  0.2123  136 SER A CB    
1049 O  OG    . SER A 136 ? 1.0025 2.2356 0.8647 -0.1239 0.1546  0.1717  136 SER A OG    
1050 N  N     . SER A 137 ? 0.8953 2.2866 0.7568 -0.1140 0.1871  0.1693  137 SER A N     
1051 C  CA    . SER A 137 ? 0.8875 2.3148 0.7461 -0.0865 0.1959  0.1226  137 SER A CA    
1052 C  C     . SER A 137 ? 0.9367 2.3534 0.7740 -0.0605 0.1894  0.0728  137 SER A C     
1053 O  O     . SER A 137 ? 0.9509 2.4248 0.7645 -0.0551 0.1872  0.0745  137 SER A O     
1054 C  CB    . SER A 137 ? 0.9613 2.5068 0.8132 -0.0842 0.2110  0.1386  137 SER A CB    
1055 O  OG    . SER A 137 ? 1.0972 2.6720 0.9522 -0.0555 0.2184  0.0947  137 SER A OG    
1056 N  N     . ILE A 138 ? 0.8751 2.2128 0.7212 -0.0475 0.1850  0.0312  138 ILE A N     
1057 C  CA    . ILE A 138 ? 0.8813 2.1897 0.7151 -0.0298 0.1776  -0.0182 138 ILE A CA    
1058 C  C     . ILE A 138 ? 0.9411 2.2419 0.7703 0.0007  0.1818  -0.0734 138 ILE A C     
1059 O  O     . ILE A 138 ? 0.9283 2.2126 0.7683 0.0091  0.1883  -0.0745 138 ILE A O     
1060 C  CB    . ILE A 138 ? 0.9021 2.1152 0.7495 -0.0469 0.1666  -0.0156 138 ILE A CB    
1061 C  CG1   . ILE A 138 ? 0.8848 2.0112 0.7538 -0.0532 0.1689  -0.0131 138 ILE A CG1   
1062 C  CG2   . ILE A 138 ? 0.9037 2.1317 0.7502 -0.0685 0.1590  0.0322  138 ILE A CG2   
1063 C  CD1   . ILE A 138 ? 0.9922 2.0316 0.8720 -0.0618 0.1620  -0.0268 138 ILE A CD1   
1064 N  N     . GLN A 139 ? 0.9240 2.2357 0.7374 0.0186  0.1764  -0.1206 139 GLN A N     
1065 C  CA    . GLN A 139 ? 0.9556 2.2532 0.7621 0.0498  0.1776  -0.1791 139 GLN A CA    
1066 C  C     . GLN A 139 ? 1.0310 2.2593 0.8385 0.0495  0.1671  -0.2240 139 GLN A C     
1067 O  O     . GLN A 139 ? 1.0250 2.2835 0.8255 0.0406  0.1585  -0.2299 139 GLN A O     
1068 C  CB    . GLN A 139 ? 1.0029 2.4155 0.7867 0.0771  0.1828  -0.2003 139 GLN A CB    
1069 C  CG    . GLN A 139 ? 1.1800 2.6713 0.9664 0.0803  0.1961  -0.1650 139 GLN A CG    
1070 C  CD    . GLN A 139 ? 1.4656 3.0773 1.2286 0.1085  0.2026  -0.1890 139 GLN A CD    
1071 O  OE1   . GLN A 139 ? 1.4654 3.0881 1.2219 0.1444  0.2039  -0.2395 139 GLN A OE1   
1072 N  NE2   . GLN A 139 ? 1.3672 3.0711 1.1146 0.0953  0.2064  -0.1541 139 GLN A NE2   
1073 N  N     . PHE A 140 ? 1.0194 2.1579 0.8359 0.0592  0.1677  -0.2553 140 PHE A N     
1074 C  CA    . PHE A 140 ? 1.0547 2.1183 0.8768 0.0550  0.1599  -0.2992 140 PHE A CA    
1075 C  C     . PHE A 140 ? 1.1610 2.2341 0.9690 0.0881  0.1575  -0.3615 140 PHE A C     
1076 O  O     . PHE A 140 ? 1.1907 2.1929 1.0006 0.1057  0.1604  -0.3848 140 PHE A O     
1077 C  CB    . PHE A 140 ? 1.0735 2.0218 0.9143 0.0387  0.1631  -0.2859 140 PHE A CB    
1078 C  CG    . PHE A 140 ? 1.0530 1.9880 0.9082 0.0087  0.1636  -0.2326 140 PHE A CG    
1079 C  CD1   . PHE A 140 ? 1.0880 2.0047 0.9550 -0.0162 0.1566  -0.2300 140 PHE A CD1   
1080 C  CD2   . PHE A 140 ? 1.0547 1.9965 0.9137 0.0064  0.1699  -0.1885 140 PHE A CD2   
1081 C  CE1   . PHE A 140 ? 1.0629 1.9652 0.9428 -0.0389 0.1559  -0.1843 140 PHE A CE1   
1082 C  CE2   . PHE A 140 ? 1.0544 1.9778 0.9269 -0.0196 0.1685  -0.1443 140 PHE A CE2   
1083 C  CZ    . PHE A 140 ? 1.0235 1.9252 0.9052 -0.0402 0.1615  -0.1425 140 PHE A CZ    
1084 N  N     . ILE A 141 ? 1.1281 2.2913 0.9195 0.0992  0.1513  -0.3879 141 ILE A N     
1085 C  CA    . ILE A 141 ? 1.1778 2.3754 0.9520 0.1335  0.1467  -0.4515 141 ILE A CA    
1086 C  C     . ILE A 141 ? 1.2694 2.3602 1.0540 0.1358  0.1390  -0.5082 141 ILE A C     
1087 O  O     . ILE A 141 ? 1.3103 2.3621 1.0892 0.1662  0.1405  -0.5434 141 ILE A O     
1088 C  CB    . ILE A 141 ? 1.2251 2.5476 0.9775 0.1405  0.1405  -0.4629 141 ILE A CB    
1089 C  CG1   . ILE A 141 ? 1.1965 2.6253 0.9353 0.1439  0.1520  -0.4080 141 ILE A CG1   
1090 C  CG2   . ILE A 141 ? 1.3028 2.6589 1.0377 0.1756  0.1326  -0.5389 141 ILE A CG2   
1091 C  CD1   . ILE A 141 ? 1.2491 2.7005 0.9918 0.1111  0.1515  -0.3475 141 ILE A CD1   
1092 N  N     . GLU A 142 ? 1.2142 2.2587 1.0152 0.1040  0.1307  -0.5168 142 GLU A N     
1093 C  CA    . GLU A 142 ? 1.2596 2.2012 1.0756 0.0962  0.1243  -0.5669 142 GLU A CA    
1094 C  C     . GLU A 142 ? 1.2709 2.1199 1.1135 0.0566  0.1286  -0.5337 142 GLU A C     
1095 O  O     . GLU A 142 ? 1.2129 2.0917 1.0626 0.0347  0.1313  -0.4829 142 GLU A O     
1096 C  CB    . GLU A 142 ? 1.3198 2.3070 1.1334 0.0968  0.1084  -0.6293 142 GLU A CB    
1097 C  CG    . GLU A 142 ? 1.5083 2.5911 1.2929 0.1389  0.1031  -0.6725 142 GLU A CG    
1098 C  CD    . GLU A 142 ? 1.8919 2.9307 1.6657 0.1789  0.1061  -0.7120 142 GLU A CD    
1099 O  OE1   . GLU A 142 ? 1.9373 2.8507 1.7261 0.1741  0.1064  -0.7302 142 GLU A OE1   
1100 O  OE2   . GLU A 142 ? 1.8399 2.9721 1.5891 0.2169  0.1080  -0.7252 142 GLU A OE2   
1101 N  N     . LYS A 143 ? 1.2581 1.9939 1.1147 0.0479  0.1294  -0.5621 143 LYS A N     
1102 C  CA    . LYS A 143 ? 1.2294 1.8776 1.1109 0.0101  0.1357  -0.5348 143 LYS A CA    
1103 C  C     . LYS A 143 ? 1.2417 1.9199 1.1455 -0.0241 0.1259  -0.5527 143 LYS A C     
1104 O  O     . LYS A 143 ? 1.2803 1.9644 1.1899 -0.0257 0.1144  -0.6110 143 LYS A O     
1105 C  CB    . LYS A 143 ? 1.3247 1.8432 1.2114 0.0112  0.1413  -0.5563 143 LYS A CB    
1106 C  CG    . LYS A 143 ? 1.4747 1.9445 1.3446 0.0385  0.1523  -0.5229 143 LYS A CG    
1107 C  CD    . LYS A 143 ? 1.6634 2.0554 1.5208 0.0707  0.1503  -0.5667 143 LYS A CD    
1108 C  CE    . LYS A 143 ? 1.7982 2.0511 1.6683 0.0480  0.1556  -0.5718 143 LYS A CE    
1109 N  NZ    . LYS A 143 ? 2.0045 2.1722 1.8599 0.0829  0.1522  -0.6111 143 LYS A NZ    
1110 N  N     . VAL A 144 ? 1.1223 1.8243 1.0391 -0.0489 0.1287  -0.5055 144 VAL A N     
1111 C  CA    . VAL A 144 ? 1.0995 1.8340 1.0404 -0.0794 0.1193  -0.5175 144 VAL A CA    
1112 C  C     . VAL A 144 ? 1.1643 1.7968 1.1351 -0.1130 0.1276  -0.5220 144 VAL A C     
1113 O  O     . VAL A 144 ? 1.1364 1.7130 1.1110 -0.1222 0.1412  -0.4771 144 VAL A O     
1114 C  CB    . VAL A 144 ? 1.0786 1.8904 1.0184 -0.0852 0.1165  -0.4668 144 VAL A CB    
1115 C  CG1   . VAL A 144 ? 1.0649 1.9030 1.0331 -0.1140 0.1066  -0.4792 144 VAL A CG1   
1116 C  CG2   . VAL A 144 ? 1.0644 1.9792 0.9736 -0.0561 0.1097  -0.4597 144 VAL A CG2   
1117 N  N     . LYS A 145 ? 1.1680 1.7771 1.1596 -0.1315 0.1201  -0.5770 145 LYS A N     
1118 C  CA    . LYS A 145 ? 1.1967 1.7106 1.2190 -0.1683 0.1297  -0.5828 145 LYS A CA    
1119 C  C     . LYS A 145 ? 1.2086 1.7638 1.2675 -0.2065 0.1263  -0.5801 145 LYS A C     
1120 O  O     . LYS A 145 ? 1.1530 1.8081 1.2113 -0.2008 0.1138  -0.5749 145 LYS A O     
1121 C  CB    . LYS A 145 ? 1.3163 1.7546 1.3428 -0.1693 0.1264  -0.6420 145 LYS A CB    
1122 C  CG    . LYS A 145 ? 1.5091 1.8547 1.5094 -0.1416 0.1380  -0.6269 145 LYS A CG    
1123 C  CD    . LYS A 145 ? 1.7427 2.0092 1.7428 -0.1347 0.1322  -0.6861 145 LYS A CD    
1124 C  CE    . LYS A 145 ? 1.9588 2.0847 1.9707 -0.1582 0.1471  -0.6740 145 LYS A CE    
1125 N  NZ    . LYS A 145 ? 2.0589 2.1297 2.0436 -0.1339 0.1628  -0.6157 145 LYS A NZ    
1126 N  N     . LEU A 146 ? 1.1912 1.6711 1.2808 -0.2440 0.1383  -0.5789 146 LEU A N     
1127 C  CA    . LEU A 146 ? 1.1684 1.6822 1.2991 -0.2830 0.1381  -0.5793 146 LEU A CA    
1128 C  C     . LEU A 146 ? 1.2553 1.8444 1.4088 -0.2943 0.1166  -0.6412 146 LEU A C     
1129 O  O     . LEU A 146 ? 1.3084 1.8759 1.4573 -0.2886 0.1074  -0.6937 146 LEU A O     
1130 C  CB    . LEU A 146 ? 1.2071 1.6184 1.3632 -0.3208 0.1587  -0.5687 146 LEU A CB    
1131 C  CG    . LEU A 146 ? 1.2567 1.6935 1.4621 -0.3674 0.1635  -0.5726 146 LEU A CG    
1132 C  CD1   . LEU A 146 ? 1.1782 1.6939 1.3870 -0.3605 0.1630  -0.5299 146 LEU A CD1   
1133 C  CD2   . LEU A 146 ? 1.3355 1.6662 1.5581 -0.4024 0.1873  -0.5576 146 LEU A CD2   
1134 N  N     . ASN A 147 ? 1.1769 1.8581 1.3528 -0.3058 0.1069  -0.6359 147 ASN A N     
1135 C  CA    . ASN A 147 ? 1.1895 1.9643 1.3888 -0.3151 0.0841  -0.6883 147 ASN A CA    
1136 C  C     . ASN A 147 ? 1.2378 2.1042 1.4004 -0.2740 0.0629  -0.7071 147 ASN A C     
1137 O  O     . ASN A 147 ? 1.2436 2.1981 1.4195 -0.2762 0.0419  -0.7493 147 ASN A O     
1138 C  CB    . ASN A 147 ? 1.2712 2.0032 1.5142 -0.3577 0.0827  -0.7485 147 ASN A CB    
1139 C  CG    . ASN A 147 ? 1.5655 2.2447 1.8512 -0.4036 0.1027  -0.7266 147 ASN A CG    
1140 O  OD1   . ASN A 147 ? 1.4527 2.1891 1.7585 -0.4131 0.1054  -0.6961 147 ASN A OD1   
1141 N  ND2   . ASN A 147 ? 1.5299 2.0986 1.8292 -0.4318 0.1176  -0.7410 147 ASN A ND2   
1142 N  N     . ASP A 148 ? 1.1774 2.0319 1.2939 -0.2367 0.0687  -0.6736 148 ASP A N     
1143 C  CA    . ASP A 148 ? 1.1668 2.1119 1.2443 -0.1973 0.0534  -0.6803 148 ASP A CA    
1144 C  C     . ASP A 148 ? 1.1562 2.1920 1.2276 -0.1879 0.0456  -0.6347 148 ASP A C     
1145 O  O     . ASP A 148 ? 1.1063 2.1151 1.1911 -0.2002 0.0564  -0.5855 148 ASP A O     
1146 C  CB    . ASP A 148 ? 1.1905 2.0967 1.2259 -0.1638 0.0650  -0.6556 148 ASP A CB    
1147 C  CG    . ASP A 148 ? 1.3570 2.1887 1.3866 -0.1567 0.0677  -0.7050 148 ASP A CG    
1148 O  OD1   . ASP A 148 ? 1.4769 2.3433 1.5080 -0.1521 0.0514  -0.7698 148 ASP A OD1   
1149 O  OD2   . ASP A 148 ? 1.3630 2.1024 1.3855 -0.1534 0.0844  -0.6809 148 ASP A OD2   
1150 N  N     . THR A 149 ? 1.1182 2.2599 1.1672 -0.1640 0.0263  -0.6505 149 THR A N     
1151 C  CA    . THR A 149 ? 1.0699 2.2958 1.1060 -0.1494 0.0169  -0.6044 149 THR A CA    
1152 C  C     . THR A 149 ? 1.1058 2.3717 1.0898 -0.1127 0.0190  -0.5696 149 THR A C     
1153 O  O     . THR A 149 ? 1.1391 2.4577 1.0965 -0.0912 0.0103  -0.6064 149 THR A O     
1154 C  CB    . THR A 149 ? 1.1835 2.5041 1.2393 -0.1547 -0.0073 -0.6435 149 THR A CB    
1155 O  OG1   . THR A 149 ? 1.2081 2.4876 1.3162 -0.1933 -0.0068 -0.6881 149 THR A OG1   
1156 C  CG2   . THR A 149 ? 1.1234 2.5085 1.1750 -0.1434 -0.0163 -0.5916 149 THR A CG2   
1157 N  N     . VAL A 150 ? 1.0056 2.2450 0.9768 -0.1072 0.0317  -0.5012 150 VAL A N     
1158 C  CA    . VAL A 150 ? 0.9859 2.2585 0.9140 -0.0794 0.0373  -0.4603 150 VAL A CA    
1159 C  C     . VAL A 150 ? 1.0156 2.3898 0.9192 -0.0616 0.0224  -0.4287 150 VAL A C     
1160 O  O     . VAL A 150 ? 0.9877 2.3652 0.9034 -0.0684 0.0175  -0.3891 150 VAL A O     
1161 C  CB    . VAL A 150 ? 1.0001 2.1929 0.9271 -0.0836 0.0577  -0.4062 150 VAL A CB    
1162 C  CG1   . VAL A 150 ? 0.9948 2.2268 0.8828 -0.0587 0.0646  -0.3717 150 VAL A CG1   
1163 C  CG2   . VAL A 150 ? 1.0131 2.1042 0.9611 -0.0988 0.0714  -0.4341 150 VAL A CG2   
1164 N  N     . ARG A 151 ? 0.9878 2.4445 0.8548 -0.0364 0.0151  -0.4459 151 ARG A N     
1165 C  CA    . ARG A 151 ? 0.9841 2.5432 0.8181 -0.0157 0.0019  -0.4144 151 ARG A CA    
1166 C  C     . ARG A 151 ? 1.0192 2.5869 0.8192 -0.0024 0.0172  -0.3507 151 ARG A C     
1167 O  O     . ARG A 151 ? 1.0344 2.6335 0.8077 0.0141  0.0256  -0.3646 151 ARG A O     
1168 C  CB    . ARG A 151 ? 1.0201 2.6752 0.8330 0.0037  -0.0155 -0.4754 151 ARG A CB    
1169 C  CG    . ARG A 151 ? 1.1179 2.8816 0.9015 0.0234  -0.0341 -0.4497 151 ARG A CG    
1170 C  CD    . ARG A 151 ? 1.2175 3.0851 0.9710 0.0475  -0.0497 -0.5069 151 ARG A CD    
1171 N  NE    . ARG A 151 ? 1.3065 3.2308 1.0092 0.0732  -0.0381 -0.4818 151 ARG A NE    
1172 C  CZ    . ARG A 151 ? 1.4990 3.4152 1.1904 0.0833  -0.0269 -0.5216 151 ARG A CZ    
1173 N  NH1   . ARG A 151 ? 1.3323 3.1791 1.0577 0.0701  -0.0269 -0.5883 151 ARG A NH1   
1174 N  NH2   . ARG A 151 ? 1.3404 3.3255 0.9869 0.1075  -0.0155 -0.4961 151 ARG A NH2   
1175 N  N     . ALA A 152 ? 0.9463 2.4841 0.7504 -0.0106 0.0212  -0.2837 152 ALA A N     
1176 C  CA    . ALA A 152 ? 0.9370 2.4784 0.7157 -0.0050 0.0353  -0.2198 152 ALA A CA    
1177 C  C     . ALA A 152 ? 1.0256 2.6590 0.7663 0.0121  0.0253  -0.1765 152 ALA A C     
1178 O  O     . ALA A 152 ? 1.0277 2.6803 0.7717 0.0142  0.0084  -0.1619 152 ALA A O     
1179 C  CB    . ALA A 152 ? 0.9083 2.3572 0.7131 -0.0250 0.0448  -0.1731 152 ALA A CB    
1180 N  N     . GLU A 153 ? 1.0139 2.7080 0.7179 0.0258  0.0360  -0.1547 153 GLU A N     
1181 C  CA    . GLU A 153 ? 1.0457 2.8275 0.7080 0.0408  0.0306  -0.1036 153 GLU A CA    
1182 C  C     . GLU A 153 ? 1.0839 2.8578 0.7321 0.0323  0.0499  -0.0331 153 GLU A C     
1183 O  O     . GLU A 153 ? 1.0685 2.8430 0.7161 0.0313  0.0679  -0.0433 153 GLU A O     
1184 C  CB    . GLU A 153 ? 1.1112 3.0104 0.7353 0.0678  0.0203  -0.1456 153 GLU A CB    
1185 C  CG    . GLU A 153 ? 1.2933 3.2165 0.9130 0.0788  0.0293  -0.2127 153 GLU A CG    
1186 C  CD    . GLU A 153 ? 1.6532 3.5033 1.2324 0.0981  0.0183  -0.2394 153 GLU A CD    
1187 O  OE1   . GLU A 153 ? 1.6124 3.4696 1.1839 0.1037  -0.0038 -0.2501 153 GLU A OE1   
1188 O  OE2   . GLU A 153 ? 1.6358 3.4934 1.1927 0.1110  0.0307  -0.2603 153 GLU A OE2   
1189 N  N     . ALA A 154 ? 1.0444 2.8035 0.6863 0.0252  0.0454  0.0369  154 ALA A N     
1190 C  CA    . ALA A 154 ? 1.0453 2.7905 0.6783 0.0110  0.0614  0.1098  154 ALA A CA    
1191 C  C     . ALA A 154 ? 1.1494 2.9891 0.7333 0.0237  0.0604  0.1633  154 ALA A C     
1192 O  O     . ALA A 154 ? 1.1753 3.0517 0.7383 0.0399  0.0412  0.1716  154 ALA A O     
1193 C  CB    . ALA A 154 ? 1.0305 2.6717 0.6955 -0.0093 0.0573  0.1506  154 ALA A CB    
1194 N  N     . ARG A 155 ? 1.1171 3.0020 0.6820 0.0170  0.0815  0.1999  155 ARG A N     
1195 C  CA    . ARG A 155 ? 1.1686 3.1472 0.6848 0.0248  0.0865  0.2585  155 ARG A CA    
1196 C  C     . ARG A 155 ? 1.2069 3.1574 0.7287 -0.0042 0.1056  0.3359  155 ARG A C     
1197 O  O     . ARG A 155 ? 1.1691 3.0892 0.7199 -0.0217 0.1227  0.3257  155 ARG A O     
1198 C  CB    . ARG A 155 ? 1.2185 3.3196 0.6994 0.0486  0.0958  0.2161  155 ARG A CB    
1199 C  CG    . ARG A 155 ? 1.4610 3.5099 0.9241 0.0749  0.0736  0.1425  155 ARG A CG    
1200 C  CD    . ARG A 155 ? 1.7367 3.5348 1.1651 0.0827  0.0805  0.0818  155 ARG A CD    
1201 N  NE    . ARG A 155 ? 1.9991 3.5499 1.4488 0.0681  0.1018  0.0468  155 ARG A NE    
1202 C  CZ    . ARG A 155 ? 2.2267 3.5796 1.7134 0.0625  0.0998  -0.0071 155 ARG A CZ    
1203 N  NH1   . ARG A 155 ? 2.0533 3.5796 1.5630 0.0731  0.0790  -0.0432 155 ARG A NH1   
1204 N  NH2   . ARG A 155 ? 2.0670 3.5595 1.5671 0.0697  0.1188  -0.0253 155 ARG A NH2   
1205 N  N     . VAL A 156 ? 1.1964 3.1568 0.6909 -0.0094 0.1018  0.4134  156 VAL A N     
1206 C  CA    . VAL A 156 ? 1.2086 3.1445 0.7073 -0.0412 0.1191  0.4925  156 VAL A CA    
1207 C  C     . VAL A 156 ? 1.2751 3.3342 0.7426 -0.0408 0.1443  0.5060  156 VAL A C     
1208 O  O     . VAL A 156 ? 1.3171 3.3974 0.7317 -0.0181 0.1431  0.5016  156 VAL A O     
1209 C  CB    . VAL A 156 ? 1.3090 3.1981 0.7903 -0.0475 0.1053  0.5726  156 VAL A CB    
1210 C  CG1   . VAL A 156 ? 1.3371 3.2010 0.8244 -0.0854 0.1242  0.6536  156 VAL A CG1   
1211 C  CG2   . VAL A 156 ? 1.2784 3.0534 0.7931 -0.0438 0.0807  0.5534  156 VAL A CG2   
1212 N  N     . VAL A 157 ? 1.1981 3.2557 0.6952 -0.0628 0.1663  0.5008  157 VAL A N     
1213 C  CA    . VAL A 157 ? 1.2176 3.3967 0.6940 -0.0627 0.1926  0.5074  157 VAL A CA    
1214 C  C     . VAL A 157 ? 1.3193 3.3647 0.7818 -0.0951 0.2123  0.5712  157 VAL A C     
1215 O  O     . VAL A 157 ? 1.3641 3.3622 0.7794 -0.0889 0.2302  0.5704  157 VAL A O     
1216 C  CB    . VAL A 157 ? 1.2094 3.3978 0.7195 -0.0580 0.2053  0.4370  157 VAL A CB    
1217 C  CG1   . VAL A 157 ? 1.2319 3.4410 0.7119 -0.0428 0.2287  0.4072  157 VAL A CG1   
1218 C  CG2   . VAL A 157 ? 1.1632 3.2957 0.6883 -0.0317 0.1854  0.3506  157 VAL A CG2   
1219 N  N     . ASN A 158 ? 1.2607 3.3239 0.7669 -0.1330 0.2079  0.6419  158 ASN A N     
1220 C  CA    . ASN A 158 ? 1.3056 3.2841 0.8087 -0.1699 0.2242  0.7114  158 ASN A CA    
1221 C  C     . ASN A 158 ? 1.3574 3.2388 0.8855 -0.1927 0.2038  0.7650  158 ASN A C     
1222 O  O     . ASN A 158 ? 1.3055 3.1489 0.8631 -0.1830 0.1818  0.7339  158 ASN A O     
1223 C  CB    . ASN A 158 ? 1.2957 3.2817 0.8349 -0.1970 0.2513  0.7012  158 ASN A CB    
1224 C  CG    . ASN A 158 ? 1.6624 3.2630 1.1641 -0.2073 0.2833  0.6658  158 ASN A CG    
1225 O  OD1   . ASN A 158 ? 1.6576 3.2348 1.1002 -0.1992 0.2956  0.6819  158 ASN A OD1   
1226 N  ND2   . ASN A 158 ? 1.5367 3.2188 1.0980 -0.2531 0.2912  0.7199  158 ASN A ND2   
1227 N  N     . GLN A 159 ? 1.3806 3.1871 0.8923 -0.2198 0.2120  0.8350  159 GLN A N     
1228 C  CA    . GLN A 159 ? 1.4087 3.1297 0.9434 -0.2432 0.1926  0.8972  159 GLN A CA    
1229 C  C     . GLN A 159 ? 1.5401 3.0942 1.0680 -0.2793 0.2171  0.9223  159 GLN A C     
1230 O  O     . GLN A 159 ? 1.6129 3.0858 1.0787 -0.2742 0.2386  0.9272  159 GLN A O     
1231 C  CB    . GLN A 159 ? 1.4697 3.1259 0.9540 -0.2067 0.1683  0.9057  159 GLN A CB    
1232 C  CG    . GLN A 159 ? 1.5318 3.0624 1.0387 -0.2173 0.1441  0.9462  159 GLN A CG    
1233 C  CD    . GLN A 159 ? 1.7898 3.0761 1.2087 -0.1772 0.1328  0.9113  159 GLN A CD    
1234 O  OE1   . GLN A 159 ? 1.7036 3.0803 1.0868 -0.1416 0.1188  0.9025  159 GLN A OE1   
1235 N  NE2   . GLN A 159 ? 1.7712 2.9847 1.1908 -0.2006 0.1282  0.9858  159 GLN A NE2   
1236 N  N     . THR A 160 ? 1.4804 3.0511 1.0793 -0.3242 0.2116  0.9602  160 THR A N     
1237 C  CA    . THR A 160 ? 1.5391 2.9983 1.1504 -0.3677 0.2305  0.9972  160 THR A CA    
1238 C  C     . THR A 160 ? 1.6607 2.9448 1.2633 -0.3689 0.2088  1.0259  160 THR A C     
1239 O  O     . THR A 160 ? 1.6555 2.9466 1.2412 -0.3370 0.1800  1.0323  160 THR A O     
1240 C  CB    . THR A 160 ? 1.5903 3.0170 1.2603 -0.3926 0.2465  0.9462  160 THR A CB    
1241 O  OG1   . THR A 160 ? 1.5386 3.0009 1.2656 -0.4006 0.2143  0.9453  160 THR A OG1   
1242 C  CG2   . THR A 160 ? 1.5287 3.0748 1.1965 -0.3799 0.2714  0.8992  160 THR A CG2   
1243 N  N     . ALA A 161 ? 1.6829 2.8739 1.3079 -0.4125 0.2181  1.0680  161 ALA A N     
1244 C  CA    . ALA A 161 ? 1.7551 2.8021 1.3774 -0.4184 0.1961  1.1072  161 ALA A CA    
1245 C  C     . ALA A 161 ? 1.7567 2.7898 1.4447 -0.4208 0.1605  1.0930  161 ALA A C     
1246 O  O     . ALA A 161 ? 1.7878 2.7406 1.4740 -0.4074 0.1312  1.1191  161 ALA A O     
1247 C  CB    . ALA A 161 ? 1.8435 2.7480 1.4581 -0.4555 0.2257  1.1221  161 ALA A CB    
1248 N  N     . LYS A 162 ? 1.6227 2.8026 1.3818 -0.4501 0.1552  1.0880  162 LYS A N     
1249 C  CA    . LYS A 162 ? 1.5559 2.6405 1.3553 -0.4377 0.1348  1.0222  162 LYS A CA    
1250 C  C     . LYS A 162 ? 1.5203 2.6542 1.3131 -0.3912 0.1320  0.9373  162 LYS A C     
1251 O  O     . LYS A 162 ? 1.4692 2.5247 1.2836 -0.3720 0.1133  0.8874  162 LYS A O     
1252 C  CB    . LYS A 162 ? 1.5679 2.6200 1.4260 -0.4865 0.1428  1.0143  162 LYS A CB    
1253 C  CG    . LYS A 162 ? 1.8128 2.7105 1.6835 -0.5164 0.1371  1.0494  162 LYS A CG    
1254 C  CD    . LYS A 162 ? 1.9158 2.7249 1.8216 -0.5421 0.1639  0.9901  162 LYS A CD    
1255 C  CE    . LYS A 162 ? 2.1213 2.6966 2.0223 -0.5385 0.1714  0.9518  162 LYS A CE    
1256 N  NZ    . LYS A 162 ? 2.1991 2.7118 2.1439 -0.5300 0.1456  0.9013  162 LYS A NZ    
1257 N  N     . HIS A 163 ? 1.4552 2.7172 1.2187 -0.3734 0.1504  0.9199  163 HIS A N     
1258 C  CA    . HIS A 163 ? 1.3712 2.6779 1.1300 -0.3329 0.1486  0.8386  163 HIS A CA    
1259 C  C     . HIS A 163 ? 1.4242 2.8248 1.1306 -0.2934 0.1497  0.8285  163 HIS A C     
1260 O  O     . HIS A 163 ? 1.4914 2.9608 1.1598 -0.2974 0.1598  0.8839  163 HIS A O     
1261 C  CB    . HIS A 163 ? 1.3199 2.6833 1.1113 -0.3470 0.1682  0.7936  163 HIS A CB    
1262 C  CG    . HIS A 163 ? 1.3389 2.6128 1.1831 -0.3740 0.1620  0.7782  163 HIS A CG    
1263 N  ND1   . HIS A 163 ? 1.4043 2.6586 1.2777 -0.4228 0.1697  0.8276  163 HIS A ND1   
1264 C  CD2   . HIS A 163 ? 1.3057 2.5097 1.1766 -0.3589 0.1488  0.7192  163 HIS A CD2   
1265 C  CE1   . HIS A 163 ? 1.3620 2.5376 1.2784 -0.4335 0.1591  0.7931  163 HIS A CE1   
1266 N  NE2   . HIS A 163 ? 1.3058 2.4501 1.2201 -0.3949 0.1471  0.7293  163 HIS A NE2   
1267 N  N     . TYR A 164 ? 1.3068 2.7117 1.0118 -0.2565 0.1394  0.7558  164 TYR A N     
1268 C  CA    . TYR A 164 ? 1.2948 2.7863 0.9590 -0.2166 0.1372  0.7223  164 TYR A CA    
1269 C  C     . TYR A 164 ? 1.2742 2.8178 0.9551 -0.2057 0.1498  0.6471  164 TYR A C     
1270 O  O     . TYR A 164 ? 1.2159 2.6902 0.9340 -0.2069 0.1443  0.6007  164 TYR A O     
1271 C  CB    . TYR A 164 ? 1.3066 2.7375 0.9624 -0.1845 0.1092  0.6995  164 TYR A CB    
1272 C  CG    . TYR A 164 ? 1.4082 2.8460 1.0216 -0.1704 0.0956  0.7600  164 TYR A CG    
1273 C  CD1   . TYR A 164 ? 1.4591 2.9986 1.0239 -0.1389 0.0936  0.7549  164 TYR A CD1   
1274 C  CD2   . TYR A 164 ? 1.4715 2.8092 1.0925 -0.1836 0.0813  0.8173  164 TYR A CD2   
1275 C  CE1   . TYR A 164 ? 1.5489 3.0965 1.0711 -0.1209 0.0788  0.8107  164 TYR A CE1   
1276 C  CE2   . TYR A 164 ? 1.5635 2.9002 1.1432 -0.1657 0.0666  0.8747  164 TYR A CE2   
1277 C  CZ    . TYR A 164 ? 1.6838 3.1278 1.2130 -0.1336 0.0655  0.8727  164 TYR A CZ    
1278 O  OH    . TYR A 164 ? 1.7947 3.1339 1.2627 -0.1069 0.0520  0.8888  164 TYR A OH    
1279 N  N     . TYR A 165 ? 1.2435 2.9074 0.8964 -0.1940 0.1668  0.6363  165 TYR A N     
1280 C  CA    . TYR A 165 ? 1.1901 2.9045 0.8554 -0.1788 0.1779  0.5651  165 TYR A CA    
1281 C  C     . TYR A 165 ? 1.2315 2.9819 0.8698 -0.1375 0.1653  0.5053  165 TYR A C     
1282 O  O     . TYR A 165 ? 1.2756 3.1063 0.8700 -0.1190 0.1639  0.5203  165 TYR A O     
1283 C  CB    . TYR A 165 ? 1.2206 3.0429 0.8816 -0.1931 0.2055  0.5833  165 TYR A CB    
1284 C  CG    . TYR A 165 ? 1.2547 3.0402 0.9531 -0.2386 0.2170  0.6331  165 TYR A CG    
1285 C  CD1   . TYR A 165 ? 1.2292 2.9666 0.9746 -0.2509 0.2194  0.5974  165 TYR A CD1   
1286 C  CD2   . TYR A 165 ? 1.3315 3.1286 1.0186 -0.2703 0.2244  0.7164  165 TYR A CD2   
1287 C  CE1   . TYR A 165 ? 1.2509 2.9598 1.0337 -0.2937 0.2276  0.6381  165 TYR A CE1   
1288 C  CE2   . TYR A 165 ? 1.3560 3.1161 1.0823 -0.3170 0.2336  0.7596  165 TYR A CE2   
1289 C  CZ    . TYR A 165 ? 1.3908 3.1100 1.1664 -0.3287 0.2345  0.7178  165 TYR A CZ    
1290 O  OH    . TYR A 165 ? 1.4168 3.1062 1.2334 -0.3756 0.2416  0.7561  165 TYR A OH    
1291 N  N     . VAL A 166 ? 1.1272 2.8132 0.7921 -0.1247 0.1547  0.4400  166 VAL A N     
1292 C  CA    . VAL A 166 ? 1.1085 2.8100 0.7588 -0.0917 0.1404  0.3774  166 VAL A CA    
1293 C  C     . VAL A 166 ? 1.1241 2.8519 0.7855 -0.0758 0.1493  0.3028  166 VAL A C     
1294 O  O     . VAL A 166 ? 1.0914 2.7679 0.7859 -0.0877 0.1574  0.2859  166 VAL A O     
1295 C  CB    . VAL A 166 ? 1.1373 2.7365 0.8079 -0.0896 0.1175  0.3667  166 VAL A CB    
1296 C  CG1   . VAL A 166 ? 1.1319 2.7611 0.7876 -0.0598 0.1017  0.3098  166 VAL A CG1   
1297 C  CG2   . VAL A 166 ? 1.1754 2.7308 0.8396 -0.1030 0.1073  0.4401  166 VAL A CG2   
1298 N  N     . GLU A 167 ? 1.0911 2.8961 0.7233 -0.0467 0.1458  0.2568  167 GLU A N     
1299 C  CA    . GLU A 167 ? 1.0651 2.8904 0.7035 -0.0262 0.1501  0.1800  167 GLU A CA    
1300 C  C     . GLU A 167 ? 1.0900 2.8701 0.7346 -0.0113 0.1296  0.1229  167 GLU A C     
1301 O  O     . GLU A 167 ? 1.1128 2.9355 0.7323 0.0018  0.1151  0.1228  167 GLU A O     
1302 C  CB    . GLU A 167 ? 1.1198 3.0769 0.7207 -0.0039 0.1623  0.1653  167 GLU A CB    
1303 C  CG    . GLU A 167 ? 1.2821 3.2827 0.8930 -0.0098 0.1860  0.1735  167 GLU A CG    
1304 C  CD    . GLU A 167 ? 1.6405 3.5871 1.2138 0.0105  0.2004  0.1505  167 GLU A CD    
1305 O  OE1   . GLU A 167 ? 1.6204 3.5894 1.1610 0.0358  0.1904  0.1124  167 GLU A OE1   
1306 O  OE2   . GLU A 167 ? 1.6127 3.5870 1.1909 0.0003  0.2217  0.1763  167 GLU A OE2   
1307 N  N     . VAL A 168 ? 0.9993 2.6954 0.6781 -0.0145 0.1283  0.0768  168 VAL A N     
1308 C  CA    . VAL A 168 ? 0.9802 2.6267 0.6733 -0.0070 0.1119  0.0208  168 VAL A CA    
1309 C  C     . VAL A 168 ? 1.0186 2.6837 0.7107 0.0127  0.1153  -0.0542 168 VAL A C     
1310 O  O     . VAL A 168 ? 1.0013 2.6539 0.7022 0.0152  0.1297  -0.0661 168 VAL A O     
1311 C  CB    . VAL A 168 ? 0.9948 2.5229 0.7271 -0.0280 0.1072  0.0301  168 VAL A CB    
1312 C  CG1   . VAL A 168 ? 0.9857 2.4724 0.7356 -0.0242 0.0927  -0.0256 168 VAL A CG1   
1313 C  CG2   . VAL A 168 ? 0.9949 2.4995 0.7281 -0.0441 0.1020  0.1008  168 VAL A CG2   
1314 N  N     . LYS A 169 ? 0.9939 2.6906 0.6757 0.0279  0.1004  -0.1059 169 LYS A N     
1315 C  CA    . LYS A 169 ? 1.0097 2.7166 0.6910 0.0467  0.0991  -0.1838 169 LYS A CA    
1316 C  C     . LYS A 169 ? 1.0590 2.7072 0.7650 0.0392  0.0820  -0.2318 169 LYS A C     
1317 O  O     . LYS A 169 ? 1.0692 2.7598 0.7667 0.0414  0.0653  -0.2351 169 LYS A O     
1318 C  CB    . LYS A 169 ? 1.0831 2.9166 0.7221 0.0748  0.0985  -0.2054 169 LYS A CB    
1319 C  CG    . LYS A 169 ? 1.2514 3.1458 0.8725 0.0849  0.1196  -0.1801 169 LYS A CG    
1320 C  CD    . LYS A 169 ? 1.3960 3.4278 0.9714 0.1132  0.1202  -0.1960 169 LYS A CD    
1321 C  CE    . LYS A 169 ? 1.4987 3.4864 1.0584 0.1175  0.1435  -0.1666 169 LYS A CE    
1322 N  NZ    . LYS A 169 ? 1.5850 3.5086 1.1413 0.0902  0.1570  -0.0765 169 LYS A NZ    
1323 N  N     . SER A 170 ? 0.9974 2.5485 0.7353 0.0289  0.0864  -0.2640 170 SER A N     
1324 C  CA    . SER A 170 ? 0.9962 2.4866 0.7632 0.0158  0.0739  -0.3084 170 SER A CA    
1325 C  C     . SER A 170 ? 1.0845 2.5753 0.8516 0.0295  0.0696  -0.3885 170 SER A C     
1326 O  O     . SER A 170 ? 1.0916 2.5689 0.8510 0.0445  0.0809  -0.4079 170 SER A O     
1327 C  CB    . SER A 170 ? 1.0107 2.3891 0.8126 -0.0084 0.0818  -0.2849 170 SER A CB    
1328 O  OG    . SER A 170 ? 1.1070 2.4825 0.9101 -0.0199 0.0825  -0.2173 170 SER A OG    
1329 N  N     . TYR A 171 ? 1.0634 2.5723 0.8403 0.0256  0.0518  -0.4367 171 TYR A N     
1330 C  CA    . TYR A 171 ? 1.1094 2.6208 0.8888 0.0357  0.0432  -0.5190 171 TYR A CA    
1331 C  C     . TYR A 171 ? 1.1752 2.6124 0.9968 0.0084  0.0339  -0.5616 171 TYR A C     
1332 O  O     . TYR A 171 ? 1.1420 2.5683 0.9858 -0.0130 0.0282  -0.5356 171 TYR A O     
1333 C  CB    . TYR A 171 ? 1.1603 2.7986 0.9056 0.0602  0.0274  -0.5491 171 TYR A CB    
1334 C  CG    . TYR A 171 ? 1.1838 2.9156 0.8841 0.0863  0.0370  -0.5077 171 TYR A CG    
1335 C  CD1   . TYR A 171 ? 1.1679 2.9516 0.8500 0.0833  0.0384  -0.4338 171 TYR A CD1   
1336 C  CD2   . TYR A 171 ? 1.2432 3.0164 0.9189 0.1148  0.0444  -0.5439 171 TYR A CD2   
1337 C  CE1   . TYR A 171 ? 1.1885 3.0601 0.8303 0.1023  0.0493  -0.3917 171 TYR A CE1   
1338 C  CE2   . TYR A 171 ? 1.2571 3.1285 0.8932 0.1369  0.0556  -0.5056 171 TYR A CE2   
1339 C  CZ    . TYR A 171 ? 1.3027 3.2232 0.9222 0.1279  0.0590  -0.4274 171 TYR A CZ    
1340 O  OH    . TYR A 171 ? 1.3119 3.3301 0.8934 0.1447  0.0720  -0.3852 171 TYR A OH    
1341 N  N     . VAL A 172 ? 1.1870 2.5769 1.0200 0.0099  0.0320  -0.6293 172 VAL A N     
1342 C  CA    . VAL A 172 ? 1.2130 2.5366 1.0866 -0.0183 0.0235  -0.6808 172 VAL A CA    
1343 C  C     . VAL A 172 ? 1.3261 2.7013 1.1889 -0.0008 0.0065  -0.7641 172 VAL A C     
1344 O  O     . VAL A 172 ? 1.3618 2.7114 1.2087 0.0212  0.0114  -0.7981 172 VAL A O     
1345 C  CB    . VAL A 172 ? 1.2675 2.4529 1.1683 -0.0384 0.0405  -0.6756 172 VAL A CB    
1346 C  CG1   . VAL A 172 ? 1.3046 2.4264 1.2464 -0.0700 0.0329  -0.7320 172 VAL A CG1   
1347 C  CG2   . VAL A 172 ? 1.2054 2.3489 1.1151 -0.0535 0.0554  -0.5982 172 VAL A CG2   
1348 N  N     . LYS A 173 ? 1.2889 2.7427 1.1589 -0.0070 -0.0151 -0.7983 173 LYS A N     
1349 C  CA    . LYS A 173 ? 1.3472 2.8658 1.2073 0.0090  -0.0357 -0.8816 173 LYS A CA    
1350 C  C     . LYS A 173 ? 1.4193 3.0161 1.2256 0.0554  -0.0328 -0.8865 173 LYS A C     
1351 O  O     . LYS A 173 ? 1.4734 3.0478 1.2705 0.0741  -0.0353 -0.9470 173 LYS A O     
1352 C  CB    . LYS A 173 ? 1.4343 2.8503 1.3323 -0.0133 -0.0392 -0.9545 173 LYS A CB    
1353 C  CG    . LYS A 173 ? 1.5438 2.9150 1.4971 -0.0610 -0.0460 -0.9689 173 LYS A CG    
1354 C  CD    . LYS A 173 ? 1.7041 2.8740 1.6589 -0.0808 -0.0518 -0.9848 173 LYS A CD    
1355 C  CE    . LYS A 173 ? 1.8202 2.8566 1.8005 -0.1254 -0.0602 -0.9418 173 LYS A CE    
1356 N  NZ    . LYS A 173 ? 1.9351 2.8902 1.8726 -0.1266 -0.0929 -0.8936 173 LYS A NZ    
1357 N  N     . HIS A 174 ? 1.3350 3.0162 1.1057 0.0735  -0.0265 -0.8189 174 HIS A N     
1358 C  CA    . HIS A 174 ? 1.3446 3.1118 1.0644 0.1136  -0.0187 -0.8069 174 HIS A CA    
1359 C  C     . HIS A 174 ? 1.3967 3.1004 1.1108 0.1318  -0.0011 -0.8219 174 HIS A C     
1360 O  O     . HIS A 174 ? 1.4389 3.1389 1.1218 0.1606  -0.0034 -0.8591 174 HIS A O     
1361 C  CB    . HIS A 174 ? 1.3952 3.1868 1.0620 0.1347  -0.0349 -0.8037 174 HIS A CB    
1362 C  CG    . HIS A 174 ? 1.4876 3.1593 1.1531 0.1187  -0.0581 -0.8362 174 HIS A CG    
1363 N  ND1   . HIS A 174 ? 1.5794 3.1303 1.2055 0.1288  -0.0638 -0.8601 174 HIS A ND1   
1364 C  CD2   . HIS A 174 ? 1.5001 3.1584 1.1908 0.0936  -0.0770 -0.8370 174 HIS A CD2   
1365 C  CE1   . HIS A 174 ? 1.6027 3.1011 1.2354 0.1092  -0.0872 -0.8858 174 HIS A CE1   
1366 N  NE2   . HIS A 174 ? 1.5602 3.1183 1.2339 0.0880  -0.0960 -0.8729 174 HIS A NE2   
1367 N  N     . THR A 175 ? 1.3029 2.9002 1.0409 0.1119  0.0169  -0.7732 175 THR A N     
1368 C  CA    . THR A 175 ? 1.3000 2.8234 1.0378 0.1253  0.0350  -0.7676 175 THR A CA    
1369 C  C     . THR A 175 ? 1.2762 2.7772 1.0170 0.1107  0.0535  -0.6757 175 THR A C     
1370 O  O     . THR A 175 ? 1.2355 2.6654 1.0059 0.0777  0.0549  -0.6424 175 THR A O     
1371 C  CB    . THR A 175 ? 1.4193 2.8066 1.1929 0.1086  0.0328  -0.8179 175 THR A CB    
1372 O  OG1   . THR A 175 ? 1.4860 2.8910 1.2642 0.1125  0.0122  -0.9032 175 THR A OG1   
1373 C  CG2   . THR A 175 ? 1.4084 2.7200 1.1775 0.1303  0.0483  -0.8181 175 THR A CG2   
1374 N  N     . LEU A 176 ? 1.2172 2.7851 0.9290 0.1342  0.0673  -0.6366 176 LEU A N     
1375 C  CA    . LEU A 176 ? 1.1598 2.7126 0.8751 0.1201  0.0838  -0.5528 176 LEU A CA    
1376 C  C     . LEU A 176 ? 1.2062 2.6282 0.9513 0.1065  0.0943  -0.5446 176 LEU A C     
1377 O  O     . LEU A 176 ? 1.2362 2.6180 0.9802 0.1280  0.0992  -0.5817 176 LEU A O     
1378 C  CB    . LEU A 176 ? 1.1549 2.8122 0.8370 0.1452  0.0972  -0.5188 176 LEU A CB    
1379 C  CG    . LEU A 176 ? 1.1560 2.8130 0.8422 0.1264  0.1122  -0.4311 176 LEU A CG    
1380 C  CD1   . LEU A 176 ? 1.1375 2.8554 0.8111 0.1100  0.1056  -0.3797 176 LEU A CD1   
1381 C  CD2   . LEU A 176 ? 1.1859 2.9088 0.8546 0.1488  0.1296  -0.4124 176 LEU A CD2   
1382 N  N     . VAL A 177 ? 1.1199 2.4760 0.8899 0.0737  0.0962  -0.4992 177 VAL A N     
1383 C  CA    . VAL A 177 ? 1.1020 2.3366 0.8985 0.0574  0.1058  -0.4846 177 VAL A CA    
1384 C  C     . VAL A 177 ? 1.1051 2.3344 0.9029 0.0488  0.1193  -0.4103 177 VAL A C     
1385 O  O     . VAL A 177 ? 1.0904 2.2439 0.8996 0.0478  0.1295  -0.3962 177 VAL A O     
1386 C  CB    . VAL A 177 ? 1.1508 2.3063 0.9792 0.0255  0.0977  -0.5029 177 VAL A CB    
1387 C  CG1   . VAL A 177 ? 1.2097 2.3461 1.0441 0.0301  0.0858  -0.5823 177 VAL A CG1   
1388 C  CG2   . VAL A 177 ? 1.1110 2.3144 0.9463 0.0042  0.0892  -0.4674 177 VAL A CG2   
1389 N  N     . PHE A 178 ? 1.0356 2.3443 0.8212 0.0427  0.1179  -0.3633 178 PHE A N     
1390 C  CA    . PHE A 178 ? 0.9896 2.2979 0.7784 0.0299  0.1278  -0.2929 178 PHE A CA    
1391 C  C     . PHE A 178 ? 1.0375 2.4598 0.7996 0.0381  0.1299  -0.2555 178 PHE A C     
1392 O  O     . PHE A 178 ? 1.0476 2.5408 0.7913 0.0437  0.1195  -0.2659 178 PHE A O     
1393 C  CB    . PHE A 178 ? 0.9807 2.2235 0.7939 -0.0001 0.1226  -0.2622 178 PHE A CB    
1394 C  CG    . PHE A 178 ? 0.9619 2.1922 0.7815 -0.0157 0.1291  -0.1938 178 PHE A CG    
1395 C  CD1   . PHE A 178 ? 0.9787 2.2726 0.7858 -0.0215 0.1244  -0.1476 178 PHE A CD1   
1396 C  CD2   . PHE A 178 ? 0.9801 2.1308 0.8177 -0.0246 0.1383  -0.1760 178 PHE A CD2   
1397 C  CE1   . PHE A 178 ? 0.9873 2.2605 0.8025 -0.0378 0.1289  -0.0871 178 PHE A CE1   
1398 C  CE2   . PHE A 178 ? 0.9600 2.0984 0.8055 -0.0398 0.1419  -0.1188 178 PHE A CE2   
1399 C  CZ    . PHE A 178 ? 0.9416 2.1377 0.7776 -0.0475 0.1370  -0.0759 178 PHE A CZ    
1400 N  N     . LYS A 179 ? 0.9783 2.4185 0.7390 0.0368  0.1433  -0.2096 179 LYS A N     
1401 C  CA    . LYS A 179 ? 0.9767 2.5169 0.7160 0.0375  0.1499  -0.1619 179 LYS A CA    
1402 C  C     . LYS A 179 ? 1.0020 2.5017 0.7603 0.0121  0.1575  -0.0972 179 LYS A C     
1403 O  O     . LYS A 179 ? 0.9743 2.4117 0.7531 0.0092  0.1643  -0.0986 179 LYS A O     
1404 C  CB    . LYS A 179 ? 1.0252 2.6520 0.7444 0.0667  0.1609  -0.1875 179 LYS A CB    
1405 C  CG    . LYS A 179 ? 1.1260 2.8802 0.8145 0.0718  0.1667  -0.1536 179 LYS A CG    
1406 C  CD    . LYS A 179 ? 1.2446 3.0917 0.9135 0.1048  0.1777  -0.1894 179 LYS A CD    
1407 C  CE    . LYS A 179 ? 1.3135 3.2094 0.9900 0.0991  0.1971  -0.1439 179 LYS A CE    
1408 N  NZ    . LYS A 179 ? 1.4205 3.3999 1.0842 0.1357  0.2077  -0.1871 179 LYS A NZ    
1409 N  N     . GLY A 180 ? 0.9663 2.4974 0.7172 -0.0051 0.1546  -0.0426 180 GLY A N     
1410 C  CA    . GLY A 180 ? 0.9441 2.4361 0.7130 -0.0314 0.1590  0.0188  180 GLY A CA    
1411 C  C     . GLY A 180 ? 1.0188 2.5869 0.7698 -0.0429 0.1638  0.0800  180 GLY A C     
1412 O  O     . GLY A 180 ? 1.0425 2.6722 0.7661 -0.0350 0.1574  0.0876  180 GLY A O     
1413 N  N     . ASN A 181 ? 0.9664 2.5322 0.7329 -0.0623 0.1749  0.1242  181 ASN A N     
1414 C  CA    . ASN A 181 ? 0.9867 2.6098 0.7427 -0.0819 0.1816  0.1909  181 ASN A CA    
1415 C  C     . ASN A 181 ? 1.0219 2.5539 0.8035 -0.1117 0.1742  0.2368  181 ASN A C     
1416 O  O     . ASN A 181 ? 0.9930 2.4580 0.8043 -0.1210 0.1752  0.2270  181 ASN A O     
1417 C  CB    . ASN A 181 ? 1.0075 2.7174 0.7637 -0.0822 0.2016  0.2007  181 ASN A CB    
1418 C  CG    . ASN A 181 ? 1.3451 3.1580 1.0710 -0.0495 0.2085  0.1588  181 ASN A CG    
1419 O  OD1   . ASN A 181 ? 1.2970 3.2050 0.9920 -0.0463 0.2144  0.1846  181 ASN A OD1   
1420 N  ND2   . ASN A 181 ? 1.2464 3.0405 0.9781 -0.0230 0.2074  0.0928  181 ASN A ND2   
1421 N  N     . PHE A 182 ? 0.9982 2.5243 0.7664 -0.1228 0.1648  0.2833  182 PHE A N     
1422 C  CA    . PHE A 182 ? 0.9935 2.4281 0.7835 -0.1462 0.1543  0.3230  182 PHE A CA    
1423 C  C     . PHE A 182 ? 1.0778 2.5319 0.8633 -0.1728 0.1588  0.3970  182 PHE A C     
1424 O  O     . PHE A 182 ? 1.1101 2.6370 0.8630 -0.1689 0.1619  0.4290  182 PHE A O     
1425 C  CB    . PHE A 182 ? 1.0169 2.3978 0.8021 -0.1330 0.1343  0.3068  182 PHE A CB    
1426 C  CG    . PHE A 182 ? 0.9983 2.3259 0.8012 -0.1193 0.1294  0.2425  182 PHE A CG    
1427 C  CD1   . PHE A 182 ? 1.0226 2.3962 0.8124 -0.0968 0.1321  0.1866  182 PHE A CD1   
1428 C  CD2   . PHE A 182 ? 1.0136 2.2445 0.8458 -0.1294 0.1222  0.2378  182 PHE A CD2   
1429 C  CE1   . PHE A 182 ? 1.0339 2.3508 0.8413 -0.0884 0.1287  0.1312  182 PHE A CE1   
1430 C  CE2   . PHE A 182 ? 0.9976 2.1810 0.8446 -0.1194 0.1202  0.1838  182 PHE A CE2   
1431 C  CZ    . PHE A 182 ? 0.9856 2.2091 0.8209 -0.1009 0.1239  0.1329  182 PHE A CZ    
1432 N  N     . LYS A 183 ? 1.0297 2.4167 0.8472 -0.2007 0.1586  0.4244  183 LYS A N     
1433 C  CA    . LYS A 183 ? 1.0731 2.4543 0.8953 -0.2331 0.1611  0.4948  183 LYS A CA    
1434 C  C     . LYS A 183 ? 1.1546 2.4267 0.9872 -0.2386 0.1399  0.5147  183 LYS A C     
1435 O  O     . LYS A 183 ? 1.1190 2.3094 0.9838 -0.2485 0.1329  0.4995  183 LYS A O     
1436 C  CB    . LYS A 183 ? 1.0871 2.4830 0.9420 -0.2618 0.1759  0.5052  183 LYS A CB    
1437 C  CG    . LYS A 183 ? 1.2122 2.6088 1.0763 -0.3023 0.1808  0.5778  183 LYS A CG    
1438 C  CD    . LYS A 183 ? 1.2720 2.7043 1.1717 -0.3314 0.1962  0.5823  183 LYS A CD    
1439 C  CE    . LYS A 183 ? 1.4483 2.8862 1.3599 -0.3773 0.2026  0.6548  183 LYS A CE    
1440 N  NZ    . LYS A 183 ? 1.5611 3.0649 1.5079 -0.4067 0.2204  0.6581  183 LYS A NZ    
1441 N  N     . MSE A 184 ? 1.1767 2.4526 0.9798 -0.2268 0.1287  0.5440  184 MSE A N     
1442 C  CA    . MSE A 184 ? 1.2087 2.3912 1.0171 -0.2231 0.1067  0.5608  184 MSE A CA    
1443 C  C     . MSE A 184 ? 1.3380 2.4812 1.1476 -0.2515 0.1037  0.6349  184 MSE A C     
1444 O  O     . MSE A 184 ? 1.3897 2.5920 1.1695 -0.2574 0.1109  0.6851  184 MSE A O     
1445 C  CB    . MSE A 184 ? 1.2551 2.4637 1.0322 -0.1883 0.0927  0.5447  184 MSE A CB    
1446 C  CG    . MSE A 184 ? 1.3096 2.5724 1.0812 -0.1634 0.0972  0.4742  184 MSE A CG    
1447 SE SE    . MSE A 184 ? 1.3549 2.5305 1.1711 -0.1616 0.0945  0.4039  184 MSE A SE    
1448 C  CE    . MSE A 184 ? 1.3295 2.4183 1.1541 -0.1479 0.0666  0.4118  184 MSE A CE    
1449 N  N     . PHE A 185 ? 1.3062 2.3490 1.1489 -0.2693 0.0930  0.6423  185 PHE A N     
1450 C  CA    . PHE A 185 ? 1.3795 2.3627 1.2284 -0.2975 0.0864  0.7085  185 PHE A CA    
1451 C  C     . PHE A 185 ? 1.4895 2.4241 1.3135 -0.2720 0.0642  0.7343  185 PHE A C     
1452 O  O     . PHE A 185 ? 1.4557 2.3553 1.2834 -0.2418 0.0488  0.6909  185 PHE A O     
1453 C  CB    . PHE A 185 ? 1.3904 2.2844 1.2857 -0.3238 0.0808  0.6978  185 PHE A CB    
1454 C  CG    . PHE A 185 ? 1.4888 2.2872 1.3942 -0.3452 0.0651  0.7519  185 PHE A CG    
1455 C  CD1   . PHE A 185 ? 1.5991 2.4086 1.5044 -0.3843 0.0748  0.8178  185 PHE A CD1   
1456 C  CD2   . PHE A 185 ? 1.5281 2.2258 1.4435 -0.3259 0.0409  0.7371  185 PHE A CD2   
1457 C  CE1   . PHE A 185 ? 1.6928 2.4028 1.6072 -0.4049 0.0591  0.8689  185 PHE A CE1   
1458 C  CE2   . PHE A 185 ? 1.6455 2.2480 1.5691 -0.3415 0.0242  0.7845  185 PHE A CE2   
1459 C  CZ    . PHE A 185 ? 1.6932 2.2967 1.6162 -0.3816 0.0328  0.8504  185 PHE A CZ    
1460 N  N     . TYR A 186 ? 1.5366 2.4705 1.3362 -0.2839 0.0627  0.8061  186 TYR A N     
1461 C  CA    . TYR A 186 ? 1.6017 2.4895 1.3743 -0.2569 0.0401  0.8388  186 TYR A CA    
1462 C  C     . TYR A 186 ? 1.7640 2.5582 1.5426 -0.2834 0.0305  0.9093  186 TYR A C     
1463 O  O     . TYR A 186 ? 1.8006 2.6052 1.5877 -0.3262 0.0470  0.9537  186 TYR A O     
1464 C  CB    . TYR A 186 ? 1.6388 2.6298 1.3594 -0.2283 0.0434  0.8534  186 TYR A CB    
1465 C  CG    . TYR A 186 ? 1.7392 2.7886 1.4269 -0.2513 0.0597  0.9290  186 TYR A CG    
1466 C  CD1   . TYR A 186 ? 1.7286 2.8608 1.4217 -0.2818 0.0882  0.9323  186 TYR A CD1   
1467 C  CD2   . TYR A 186 ? 1.8604 2.8880 1.5098 -0.2404 0.0471  0.9983  186 TYR A CD2   
1468 C  CE1   . TYR A 186 ? 1.8108 3.0080 1.4738 -0.3043 0.1061  1.0028  186 TYR A CE1   
1469 C  CE2   . TYR A 186 ? 1.9470 2.9568 1.5437 -0.2523 0.0697  1.0336  186 TYR A CE2   
1470 C  CZ    . TYR A 186 ? 1.9930 2.9979 1.5771 -0.2721 0.1070  0.9898  186 TYR A CZ    
1471 O  OH    . TYR A 186 ? 2.0735 2.9988 1.5907 -0.2752 0.1371  0.9911  186 TYR A OH    
1472 N  N     . ASP A 187 ? 1.7726 2.4757 1.5490 -0.2580 0.0035  0.9182  187 ASP A N     
1473 C  CA    . ASP A 187 ? 1.8759 2.4712 1.6565 -0.2758 -0.0109 0.9816  187 ASP A CA    
1474 C  C     . ASP A 187 ? 1.9935 2.5507 1.7393 -0.2308 -0.0369 1.0104  187 ASP A C     
1475 O  O     . ASP A 187 ? 1.9428 2.4932 1.6915 -0.1886 -0.0541 0.9591  187 ASP A O     
1476 C  CB    . ASP A 187 ? 1.8849 2.3740 1.7184 -0.2977 -0.0202 0.9509  187 ASP A CB    
1477 C  CG    . ASP A 187 ? 2.1322 2.4989 1.9777 -0.3214 -0.0359 1.0084  187 ASP A CG    
1478 O  OD1   . ASP A 187 ? 2.2986 2.6293 2.0998 -0.3327 -0.0198 1.0527  187 ASP A OD1   
1479 O  OD2   . ASP A 187 ? 2.1394 2.4068 2.0182 -0.3178 -0.0546 0.9773  187 ASP A OD2   
1480 N  N     . LYS A 188 ? 2.0569 2.5929 1.7699 -0.2408 -0.0389 1.0949  188 LYS A N     
1481 C  CA    . LYS A 188 ? 2.1422 2.6425 1.8141 -0.1996 -0.0631 1.1416  188 LYS A CA    
1482 C  C     . LYS A 188 ? 2.2387 2.6008 1.9348 -0.1760 -0.0950 1.1310  188 LYS A C     
1483 O  O     . LYS A 188 ? 2.2785 2.6132 1.9448 -0.1261 -0.1188 1.1390  188 LYS A O     
1484 C  CB    . LYS A 188 ? 2.2793 2.6445 1.8456 -0.1985 -0.0343 1.1416  188 LYS A CB    
1485 C  CG    . LYS A 188 ? 2.3719 2.7412 1.8648 -0.2026 0.0135  1.0739  188 LYS A CG    
1486 C  CD    . LYS A 188 ? 2.4620 2.7895 1.8445 -0.1470 0.0177  1.0030  188 LYS A CD    
1487 C  CE    . LYS A 188 ? 2.5124 2.8266 1.8341 -0.1547 0.0599  0.9456  188 LYS A CE    
1488 N  NZ    . LYS A 188 ? 2.5914 2.8680 1.8221 -0.1110 0.0536  0.8835  188 LYS A NZ    
1489 N  N     . ARG A 189 ? 2.1869 2.4605 1.9330 -0.2087 -0.0957 1.1073  189 ARG A N     
1490 C  CA    . ARG A 189 ? 2.2604 2.4020 2.0349 -0.1903 -0.1244 1.0888  189 ARG A CA    
1491 C  C     . ARG A 189 ? 2.2970 2.4577 2.1015 -0.1593 -0.1309 0.9942  189 ARG A C     
1492 O  O     . ARG A 189 ? 2.3461 2.4634 2.1495 -0.1109 -0.1565 0.9723  189 ARG A O     
1493 C  CB    . ARG A 189 ? 2.3189 2.3570 2.1303 -0.2455 -0.1221 1.1154  189 ARG A CB    
1494 C  CG    . ARG A 189 ? 2.5215 2.3358 2.2879 -0.1992 -0.1259 1.0380  189 ARG A CG    
1495 C  CD    . ARG A 189 ? 2.7643 2.3521 2.3637 -0.1453 -0.0795 0.9704  189 ARG A CD    
1496 N  NE    . ARG A 189 ? 2.8829 2.4016 2.3649 -0.0648 -0.0838 0.9186  189 ARG A NE    
1497 C  CZ    . ARG A 189 ? 3.0883 2.5292 2.4050 -0.0180 -0.0469 0.8256  189 ARG A CZ    
1498 N  NH1   . ARG A 189 ? 2.9173 2.4808 2.2832 -0.0800 -0.0341 0.9130  189 ARG A NH1   
1499 N  NH2   . ARG A 189 ? 3.0092 2.4857 2.3164 0.0159  -0.0958 0.8843  189 ARG A NH2   
1500 N  N     . GLY A 190 ? 2.4208 2.6421 2.2491 -0.1823 -0.1101 0.9439  190 GLY A N     
1501 N  N     . GLU B 4   ? 1.6089 1.2125 1.2912 0.1171  -0.3552 0.2988  4   GLU B N     
1502 C  CA    . GLU B 4   ? 1.5204 1.2022 1.2457 0.0969  -0.3386 0.2762  4   GLU B CA    
1503 C  C     . GLU B 4   ? 1.4886 1.1765 1.2417 0.0679  -0.3049 0.2620  4   GLU B C     
1504 O  O     . GLU B 4   ? 1.4029 1.1504 1.2051 0.0618  -0.2916 0.2398  4   GLU B O     
1505 C  CB    . GLU B 4   ? 1.4871 1.2386 1.2694 0.1259  -0.3546 0.2562  4   GLU B CB    
1506 N  N     . THR B 5   ? 1.4780 1.1035 1.1973 0.0490  -0.2918 0.2757  5   THR B N     
1507 C  CA    . THR B 5   ? 1.4283 1.0543 1.1686 0.0221  -0.2629 0.2648  5   THR B CA    
1508 C  C     . THR B 5   ? 1.3963 1.0711 1.1472 -0.0088 -0.2396 0.2547  5   THR B C     
1509 O  O     . THR B 5   ? 1.4112 1.0904 1.1269 -0.0233 -0.2394 0.2645  5   THR B O     
1510 C  CB    . THR B 5   ? 1.6355 1.1828 1.3372 0.0088  -0.2577 0.2815  5   THR B CB    
1511 O  OG1   . THR B 5   ? 1.6190 1.1779 1.3475 -0.0162 -0.2321 0.2680  5   THR B OG1   
1512 C  CG2   . THR B 5   ? 1.6901 1.1887 1.3234 -0.0120 -0.2593 0.3091  5   THR B CG2   
1513 N  N     . LEU B 6   ? 1.2679 0.9768 1.0648 -0.0172 -0.2199 0.2349  6   LEU B N     
1514 C  CA    . LEU B 6   ? 1.2019 0.9547 1.0145 -0.0418 -0.1965 0.2229  6   LEU B CA    
1515 C  C     . LEU B 6   ? 1.2698 0.9957 1.0672 -0.0699 -0.1757 0.2289  6   LEU B C     
1516 O  O     . LEU B 6   ? 1.2395 0.9659 1.0654 -0.0723 -0.1654 0.2188  6   LEU B O     
1517 C  CB    . LEU B 6   ? 1.1207 0.9276 0.9911 -0.0314 -0.1892 0.1989  6   LEU B CB    
1518 C  CG    . LEU B 6   ? 1.1370 0.9945 1.0197 -0.0401 -0.1815 0.1870  6   LEU B CG    
1519 C  CD1   . LEU B 6   ? 1.0856 0.9874 1.0182 -0.0237 -0.1836 0.1680  6   LEU B CD1   
1520 C  CD2   . LEU B 6   ? 1.1551 1.0230 1.0335 -0.0670 -0.1551 0.1830  6   LEU B CD2   
1521 N  N     . LYS B 7   ? 1.2752 0.9785 1.0253 -0.0916 -0.1705 0.2459  7   LYS B N     
1522 C  CA    . LYS B 7   ? 1.2945 0.9740 1.0213 -0.1234 -0.1510 0.2557  7   LYS B CA    
1523 C  C     . LYS B 7   ? 1.2871 0.9995 1.0561 -0.1382 -0.1284 0.2383  7   LYS B C     
1524 O  O     . LYS B 7   ? 1.2992 0.9839 1.0631 -0.1561 -0.1200 0.2432  7   LYS B O     
1525 C  CB    . LYS B 7   ? 1.3516 1.0337 1.0326 -0.1438 -0.1430 0.2687  7   LYS B CB    
1526 C  CG    . LYS B 7   ? 1.5590 1.1886 1.1890 -0.1708 -0.1352 0.2923  7   LYS B CG    
1527 C  CD    . LYS B 7   ? 1.7621 1.3211 1.3461 -0.1573 -0.1595 0.3158  7   LYS B CD    
1528 C  CE    . LYS B 7   ? 1.9888 1.4913 1.5229 -0.1892 -0.1481 0.3391  7   LYS B CE    
1529 N  NZ    . LYS B 7   ? 2.1883 1.6088 1.6811 -0.1760 -0.1701 0.3609  7   LYS B NZ    
1530 N  N     . LEU B 8   ? 1.1712 0.9404 0.9805 -0.1305 -0.1199 0.2183  8   LEU B N     
1531 C  CA    . LEU B 8   ? 1.1144 0.9179 0.9623 -0.1400 -0.1003 0.2024  8   LEU B CA    
1532 C  C     . LEU B 8   ? 1.1189 0.9287 1.0078 -0.1203 -0.1061 0.1882  8   LEU B C     
1533 O  O     . LEU B 8   ? 1.0911 0.9214 1.0023 -0.0980 -0.1151 0.1785  8   LEU B O     
1534 C  CB    . LEU B 8   ? 1.0738 0.9291 0.9354 -0.1452 -0.0838 0.1901  8   LEU B CB    
1535 C  CG    . LEU B 8   ? 1.1609 1.0216 0.9878 -0.1677 -0.0697 0.1987  8   LEU B CG    
1536 C  CD1   . LEU B 8   ? 1.1276 1.0329 0.9662 -0.1643 -0.0582 0.1836  8   LEU B CD1   
1537 C  CD2   . LEU B 8   ? 1.2082 1.0688 1.0346 -0.1933 -0.0512 0.2028  8   LEU B CD2   
1538 N  N     . LYS B 9   ? 1.0592 0.8544 0.9578 -0.1305 -0.1000 0.1858  9   LYS B N     
1539 C  CA    . LYS B 9   ? 1.0129 0.8142 0.9460 -0.1145 -0.1030 0.1712  9   LYS B CA    
1540 C  C     . LYS B 9   ? 0.9678 0.8247 0.9372 -0.1153 -0.0865 0.1548  9   LYS B C     
1541 O  O     . LYS B 9   ? 0.9445 0.8286 0.9115 -0.1301 -0.0722 0.1550  9   LYS B O     
1542 C  CB    . LYS B 9   ? 1.0813 0.8395 1.0045 -0.1263 -0.1052 0.1743  9   LYS B CB    
1543 C  CG    . LYS B 9   ? 1.3520 1.0427 1.2337 -0.1255 -0.1212 0.1920  9   LYS B CG    
1544 C  CD    . LYS B 9   ? 1.5426 1.1934 1.4273 -0.0982 -0.1389 0.1874  9   LYS B CD    
1545 C  CE    . LYS B 9   ? 1.7486 1.3744 1.6405 -0.1071 -0.1362 0.1775  9   LYS B CE    
1546 N  NZ    . LYS B 9   ? 1.8885 1.4841 1.7859 -0.0757 -0.1513 0.1690  9   LYS B NZ    
1547 N  N     . LYS B 10  ? 0.8784 0.7503 0.8787 -0.0977 -0.0880 0.1410  10  LYS B N     
1548 C  CA    . LYS B 10  ? 0.8221 0.7393 0.8540 -0.0937 -0.0746 0.1267  10  LYS B CA    
1549 C  C     . LYS B 10  ? 0.8623 0.8056 0.8971 -0.1142 -0.0576 0.1255  10  LYS B C     
1550 O  O     . LYS B 10  ? 0.8340 0.8078 0.8745 -0.1142 -0.0468 0.1220  10  LYS B O     
1551 C  CB    . LYS B 10  ? 0.8315 0.7481 0.8855 -0.0779 -0.0784 0.1153  10  LYS B CB    
1552 C  CG    . LYS B 10  ? 0.8066 0.7635 0.8882 -0.0720 -0.0660 0.1026  10  LYS B CG    
1553 C  CD    . LYS B 10  ? 0.9045 0.8550 0.9983 -0.0614 -0.0697 0.0928  10  LYS B CD    
1554 C  CE    . LYS B 10  ? 1.1023 1.0744 1.2065 -0.0712 -0.0607 0.0858  10  LYS B CE    
1555 N  NZ    . LYS B 10  ? 1.2744 1.2673 1.3968 -0.0535 -0.0572 0.0746  10  LYS B NZ    
1556 N  N     . ASP B 11  ? 0.8454 0.7774 0.8761 -0.1319 -0.0552 0.1274  11  ASP B N     
1557 C  CA    . ASP B 11  ? 0.8401 0.8045 0.8788 -0.1516 -0.0397 0.1252  11  ASP B CA    
1558 C  C     . ASP B 11  ? 0.9087 0.8812 0.9266 -0.1678 -0.0294 0.1349  11  ASP B C     
1559 O  O     . ASP B 11  ? 0.8848 0.8984 0.9153 -0.1699 -0.0146 0.1290  11  ASP B O     
1560 C  CB    . ASP B 11  ? 0.8904 0.8433 0.9318 -0.1698 -0.0412 0.1235  11  ASP B CB    
1561 C  CG    . ASP B 11  ? 1.0468 1.0119 1.1132 -0.1564 -0.0456 0.1090  11  ASP B CG    
1562 O  OD1   . ASP B 11  ? 1.0142 1.0050 1.0989 -0.1341 -0.0434 0.1007  11  ASP B OD1   
1563 O  OD2   . ASP B 11  ? 1.1561 1.1046 1.2215 -0.1698 -0.0506 0.1055  11  ASP B OD2   
1564 N  N     . LYS B 12  ? 0.9050 0.8371 0.8884 -0.1770 -0.0372 0.1498  12  LYS B N     
1565 C  CA    . LYS B 12  ? 0.9214 0.8552 0.8761 -0.1929 -0.0283 0.1608  12  LYS B CA    
1566 C  C     . LYS B 12  ? 0.9250 0.8834 0.8803 -0.1770 -0.0253 0.1551  12  LYS B C     
1567 O  O     . LYS B 12  ? 0.9212 0.9063 0.8695 -0.1865 -0.0099 0.1539  12  LYS B O     
1568 C  CB    . LYS B 12  ? 1.0172 0.8948 0.9295 -0.2034 -0.0401 0.1799  12  LYS B CB    
1569 C  CG    . LYS B 12  ? 1.3363 1.1836 1.2392 -0.2281 -0.0391 0.1872  12  LYS B CG    
1570 C  CD    . LYS B 12  ? 1.5506 1.3718 1.4105 -0.2567 -0.0317 0.2067  12  LYS B CD    
1571 C  CE    . LYS B 12  ? 1.6836 1.4657 1.5317 -0.2839 -0.0318 0.2145  12  LYS B CE    
1572 N  NZ    . LYS B 12  ? 1.8309 1.5664 1.6265 -0.3085 -0.0292 0.2382  12  LYS B NZ    
1573 N  N     . ARG B 13  ? 0.8427 0.7934 0.8070 -0.1535 -0.0390 0.1501  13  ARG B N     
1574 C  CA    . ARG B 13  ? 0.8098 0.7803 0.7767 -0.1400 -0.0385 0.1428  13  ARG B CA    
1575 C  C     . ARG B 13  ? 0.8008 0.8120 0.7942 -0.1364 -0.0211 0.1283  13  ARG B C     
1576 O  O     . ARG B 13  ? 0.7927 0.8209 0.7769 -0.1381 -0.0109 0.1239  13  ARG B O     
1577 C  CB    . ARG B 13  ? 0.7885 0.7478 0.7670 -0.1183 -0.0563 0.1395  13  ARG B CB    
1578 C  CG    . ARG B 13  ? 0.8280 0.8043 0.8056 -0.1095 -0.0586 0.1328  13  ARG B CG    
1579 C  CD    . ARG B 13  ? 0.8389 0.8219 0.8414 -0.0900 -0.0703 0.1246  13  ARG B CD    
1580 N  NE    . ARG B 13  ? 0.7811 0.7767 0.8167 -0.0810 -0.0634 0.1151  13  ARG B NE    
1581 C  CZ    . ARG B 13  ? 0.9033 0.8851 0.9505 -0.0719 -0.0712 0.1160  13  ARG B CZ    
1582 N  NH1   . ARG B 13  ? 0.7697 0.7206 0.7993 -0.0697 -0.0862 0.1262  13  ARG B NH1   
1583 N  NH2   . ARG B 13  ? 0.7214 0.7169 0.7942 -0.0642 -0.0640 0.1067  13  ARG B NH2   
1584 N  N     . ARG B 14  ? 0.7208 0.7446 0.7439 -0.1298 -0.0184 0.1206  14  ARG B N     
1585 C  CA    . ARG B 14  ? 0.6781 0.7369 0.7260 -0.1223 -0.0042 0.1085  14  ARG B CA    
1586 C  C     . ARG B 14  ? 0.7459 0.8310 0.7893 -0.1360 0.0131  0.1079  14  ARG B C     
1587 O  O     . ARG B 14  ? 0.7360 0.8434 0.7844 -0.1279 0.0251  0.0993  14  ARG B O     
1588 C  CB    . ARG B 14  ? 0.6237 0.6883 0.6979 -0.1132 -0.0075 0.1027  14  ARG B CB    
1589 C  CG    . ARG B 14  ? 0.6961 0.7491 0.7807 -0.0945 -0.0176 0.0984  14  ARG B CG    
1590 C  CD    . ARG B 14  ? 0.8051 0.8578 0.9074 -0.0870 -0.0222 0.0938  14  ARG B CD    
1591 N  NE    . ARG B 14  ? 0.8622 0.9112 0.9761 -0.0688 -0.0274 0.0886  14  ARG B NE    
1592 C  CZ    . ARG B 14  ? 1.0849 1.1358 1.2125 -0.0584 -0.0296 0.0829  14  ARG B CZ    
1593 N  NH1   . ARG B 14  ? 0.9390 0.9944 1.0703 -0.0641 -0.0296 0.0805  14  ARG B NH1   
1594 N  NH2   . ARG B 14  ? 0.9171 0.9679 1.0543 -0.0434 -0.0316 0.0786  14  ARG B NH2   
1595 N  N     . GLU B 15  ? 0.7197 0.8006 0.7515 -0.1572 0.0152  0.1170  15  GLU B N     
1596 C  CA    . GLU B 15  ? 0.7248 0.8369 0.7537 -0.1726 0.0335  0.1167  15  GLU B CA    
1597 C  C     . GLU B 15  ? 0.7813 0.8910 0.7812 -0.1739 0.0408  0.1183  15  GLU B C     
1598 O  O     . GLU B 15  ? 0.7688 0.9103 0.7732 -0.1706 0.0574  0.1094  15  GLU B O     
1599 C  CB    . GLU B 15  ? 0.7737 0.8813 0.7963 -0.1998 0.0353  0.1265  15  GLU B CB    
1600 C  CG    . GLU B 15  ? 0.9339 1.0838 0.9596 -0.2182 0.0566  0.1254  15  GLU B CG    
1601 C  CD    . GLU B 15  ? 1.2206 1.4274 1.2806 -0.2046 0.0710  0.1101  15  GLU B CD    
1602 O  OE1   . GLU B 15  ? 1.1099 1.3270 1.1974 -0.1850 0.0642  0.1008  15  GLU B OE1   
1603 O  OE2   . GLU B 15  ? 1.1649 1.4062 1.2224 -0.2124 0.0897  0.1076  15  GLU B OE2   
1604 N  N     . ALA B 16  ? 0.7617 0.8341 0.7316 -0.1757 0.0271  0.1280  16  ALA B N     
1605 C  CA    . ALA B 16  ? 0.7839 0.8507 0.7210 -0.1770 0.0298  0.1293  16  ALA B CA    
1606 C  C     . ALA B 16  ? 0.7974 0.8786 0.7466 -0.1575 0.0330  0.1132  16  ALA B C     
1607 O  O     . ALA B 16  ? 0.8133 0.9064 0.7449 -0.1585 0.0449  0.1065  16  ALA B O     
1608 C  CB    . ALA B 16  ? 0.8279 0.8531 0.7327 -0.1800 0.0101  0.1436  16  ALA B CB    
1609 N  N     . ILE B 17  ? 0.7028 0.7815 0.6801 -0.1409 0.0240  0.1064  17  ILE B N     
1610 C  CA    . ILE B 17  ? 0.6751 0.7612 0.6648 -0.1246 0.0272  0.0923  17  ILE B CA    
1611 C  C     . ILE B 17  ? 0.7151 0.8304 0.7195 -0.1187 0.0477  0.0817  17  ILE B C     
1612 O  O     . ILE B 17  ? 0.7197 0.8394 0.7136 -0.1129 0.0580  0.0713  17  ILE B O     
1613 C  CB    . ILE B 17  ? 0.6833 0.7590 0.6976 -0.1110 0.0137  0.0904  17  ILE B CB    
1614 C  CG1   . ILE B 17  ? 0.7072 0.7602 0.7073 -0.1113 -0.0060 0.0966  17  ILE B CG1   
1615 C  CG2   . ILE B 17  ? 0.6563 0.7412 0.6887 -0.0963 0.0221  0.0770  17  ILE B CG2   
1616 C  CD1   . ILE B 17  ? 0.8176 0.8623 0.8403 -0.1004 -0.0194 0.0980  17  ILE B CD1   
1617 N  N     . ARG B 18  ? 0.6545 0.7898 0.6822 -0.1197 0.0527  0.0836  18  ARG B N     
1618 C  CA    . ARG B 18  ? 0.6383 0.8085 0.6857 -0.1117 0.0695  0.0747  18  ARG B CA    
1619 C  C     . ARG B 18  ? 0.7110 0.8994 0.7386 -0.1195 0.0867  0.0712  18  ARG B C     
1620 O  O     . ARG B 18  ? 0.7104 0.9116 0.7397 -0.1048 0.0996  0.0591  18  ARG B O     
1621 C  CB    . ARG B 18  ? 0.6315 0.8229 0.7039 -0.1180 0.0678  0.0790  18  ARG B CB    
1622 C  CG    . ARG B 18  ? 0.7542 0.9849 0.8552 -0.1029 0.0791  0.0692  18  ARG B CG    
1623 C  CD    . ARG B 18  ? 0.8681 1.1330 0.9901 -0.1167 0.0809  0.0718  18  ARG B CD    
1624 N  NE    . ARG B 18  ? 0.9896 1.2673 1.0974 -0.1426 0.0907  0.0779  18  ARG B NE    
1625 C  CZ    . ARG B 18  ? 1.1984 1.5071 1.3017 -0.1442 0.1095  0.0729  18  ARG B CZ    
1626 N  NH1   . ARG B 18  ? 1.0546 1.3800 1.1651 -0.1192 0.1197  0.0608  18  ARG B NH1   
1627 N  NH2   . ARG B 18  ? 1.0517 1.3715 1.1402 -0.1706 0.1193  0.0801  18  ARG B NH2   
1628 N  N     . GLN B 19  ? 0.6874 0.8721 0.6920 -0.1418 0.0871  0.0821  19  GLN B N     
1629 C  CA    . GLN B 19  ? 0.7136 0.9152 0.6935 -0.1531 0.1044  0.0809  19  GLN B CA    
1630 C  C     . GLN B 19  ? 0.7782 0.9602 0.7273 -0.1452 0.1055  0.0726  19  GLN B C     
1631 O  O     . GLN B 19  ? 0.7978 0.9993 0.7355 -0.1419 0.1237  0.0622  19  GLN B O     
1632 C  CB    . GLN B 19  ? 0.7635 0.9564 0.7202 -0.1811 0.1030  0.0978  19  GLN B CB    
1633 C  CG    . GLN B 19  ? 0.9642 1.1873 0.9466 -0.1966 0.1106  0.1025  19  GLN B CG    
1634 C  CD    . GLN B 19  ? 1.2975 1.4987 1.2511 -0.2265 0.1083  0.1209  19  GLN B CD    
1635 O  OE1   . GLN B 19  ? 1.2634 1.4213 1.2042 -0.2313 0.0890  0.1327  19  GLN B OE1   
1636 N  NE2   . GLN B 19  ? 1.2549 1.4842 1.1957 -0.2467 0.1288  0.1240  19  GLN B NE2   
1637 N  N     . GLN B 20  ? 0.7297 0.8758 0.6661 -0.1423 0.0861  0.0755  20  GLN B N     
1638 C  CA    . GLN B 20  ? 0.7485 0.8758 0.6567 -0.1378 0.0831  0.0663  20  GLN B CA    
1639 C  C     . GLN B 20  ? 0.7988 0.9310 0.7222 -0.1181 0.0935  0.0475  20  GLN B C     
1640 O  O     . GLN B 20  ? 0.8212 0.9518 0.7209 -0.1153 0.1044  0.0349  20  GLN B O     
1641 C  CB    . GLN B 20  ? 0.7632 0.8595 0.6617 -0.1398 0.0581  0.0739  20  GLN B CB    
1642 C  CG    . GLN B 20  ? 0.8444 0.9247 0.7105 -0.1405 0.0511  0.0654  20  GLN B CG    
1643 C  CD    . GLN B 20  ? 0.9755 1.0589 0.7970 -0.1529 0.0612  0.0663  20  GLN B CD    
1644 O  OE1   . GLN B 20  ? 0.8847 0.9736 0.6899 -0.1493 0.0748  0.0504  20  GLN B OE1   
1645 N  NE2   . GLN B 20  ? 0.8323 0.9101 0.6305 -0.1678 0.0565  0.0848  20  GLN B NE2   
1646 N  N     . ILE B 21  ? 0.7263 0.8609 0.6854 -0.1042 0.0904  0.0458  21  ILE B N     
1647 C  CA    . ILE B 21  ? 0.7164 0.8490 0.6895 -0.0841 0.0995  0.0313  21  ILE B CA    
1648 C  C     . ILE B 21  ? 0.8139 0.9771 0.7916 -0.0742 0.1217  0.0227  21  ILE B C     
1649 O  O     . ILE B 21  ? 0.8348 0.9905 0.8037 -0.0595 0.1332  0.0080  21  ILE B O     
1650 C  CB    . ILE B 21  ? 0.7114 0.8371 0.7160 -0.0730 0.0895  0.0350  21  ILE B CB    
1651 C  CG1   . ILE B 21  ? 0.7035 0.8013 0.7033 -0.0791 0.0711  0.0381  21  ILE B CG1   
1652 C  CG2   . ILE B 21  ? 0.7134 0.8388 0.7315 -0.0510 0.1013  0.0241  21  ILE B CG2   
1653 C  CD1   . ILE B 21  ? 0.6776 0.7714 0.7052 -0.0722 0.0607  0.0441  21  ILE B CD1   
1654 N  N     . ASP B 22  ? 0.7818 0.9794 0.7727 -0.0829 0.1278  0.0309  22  ASP B N     
1655 C  CA    . ASP B 22  ? 0.7961 1.0347 0.7964 -0.0755 0.1491  0.0231  22  ASP B CA    
1656 C  C     . ASP B 22  ? 0.8707 1.1089 0.8339 -0.0813 0.1636  0.0144  22  ASP B C     
1657 O  O     . ASP B 22  ? 0.8795 1.1313 0.8412 -0.0636 0.1809  -0.0009 22  ASP B O     
1658 C  CB    . ASP B 22  ? 0.8201 1.0979 0.8439 -0.0904 0.1510  0.0342  22  ASP B CB    
1659 C  CG    . ASP B 22  ? 1.0887 1.4120 1.1518 -0.0727 0.1606  0.0275  22  ASP B CG    
1660 O  OD1   . ASP B 22  ? 1.1146 1.4311 1.1883 -0.0453 0.1619  0.0177  22  ASP B OD1   
1661 O  OD2   . ASP B 22  ? 1.2134 1.5789 1.2964 -0.0867 0.1661  0.0325  22  ASP B OD2   
1662 N  N     . SER B 23  ? 0.8448 1.0642 0.7749 -0.1038 0.1557  0.0238  23  SER B N     
1663 C  CA    . SER B 23  ? 0.8897 1.1063 0.7768 -0.1124 0.1671  0.0173  23  SER B CA    
1664 C  C     . SER B 23  ? 0.9605 1.1433 0.8233 -0.0996 0.1649  0.0001  23  SER B C     
1665 O  O     . SER B 23  ? 0.9975 1.1833 0.8305 -0.0969 0.1805  -0.0137 23  SER B O     
1666 C  CB    . SER B 23  ? 0.9607 1.1646 0.8165 -0.1393 0.1568  0.0352  23  SER B CB    
1667 O  OG    . SER B 23  ? 1.1428 1.3378 0.9504 -0.1463 0.1642  0.0290  23  SER B OG    
1668 N  N     . ASN B 24  ? 0.8844 1.0353 0.7582 -0.0939 0.1463  0.0002  24  ASN B N     
1669 C  CA    . ASN B 24  ? 0.8939 1.0099 0.7488 -0.0861 0.1422  -0.0160 24  ASN B CA    
1670 C  C     . ASN B 24  ? 0.8880 0.9859 0.7752 -0.0726 0.1332  -0.0168 24  ASN B C     
1671 O  O     . ASN B 24  ? 0.8581 0.9429 0.7558 -0.0809 0.1140  -0.0065 24  ASN B O     
1672 C  CB    . ASN B 24  ? 0.9375 1.0305 0.7552 -0.1047 0.1254  -0.0137 24  ASN B CB    
1673 C  CG    . ASN B 24  ? 1.2165 1.2760 1.0167 -0.1018 0.1188  -0.0316 24  ASN B CG    
1674 O  OD1   . ASN B 24  ? 1.1424 1.1896 0.9389 -0.0879 0.1331  -0.0500 24  ASN B OD1   
1675 N  ND2   . ASN B 24  ? 1.1023 1.1458 0.8910 -0.1152 0.0965  -0.0272 24  ASN B ND2   
1676 N  N     . PRO B 25  ? 0.8356 0.9329 0.7379 -0.0503 0.1471  -0.0280 25  PRO B N     
1677 C  CA    . PRO B 25  ? 0.8092 0.8861 0.7370 -0.0377 0.1399  -0.0266 25  PRO B CA    
1678 C  C     . PRO B 25  ? 0.8731 0.9058 0.7833 -0.0431 0.1310  -0.0362 25  PRO B C     
1679 O  O     . PRO B 25  ? 0.8584 0.8735 0.7870 -0.0405 0.1225  -0.0318 25  PRO B O     
1680 C  CB    . PRO B 25  ? 0.8378 0.9262 0.7798 -0.0106 0.1579  -0.0350 25  PRO B CB    
1681 C  CG    . PRO B 25  ? 0.9116 1.0365 0.8436 -0.0101 0.1746  -0.0404 25  PRO B CG    
1682 C  CD    . PRO B 25  ? 0.8800 0.9945 0.7756 -0.0334 0.1703  -0.0421 25  PRO B CD    
1683 N  N     . PHE B 26  ? 0.8515 0.8689 0.7255 -0.0530 0.1328  -0.0494 26  PHE B N     
1684 C  CA    . PHE B 26  ? 0.8691 0.8481 0.7231 -0.0628 0.1242  -0.0620 26  PHE B CA    
1685 C  C     . PHE B 26  ? 0.9025 0.8836 0.7603 -0.0840 0.1004  -0.0517 26  PHE B C     
1686 O  O     . PHE B 26  ? 0.9224 0.8796 0.7702 -0.0950 0.0907  -0.0617 26  PHE B O     
1687 C  CB    . PHE B 26  ? 0.9440 0.9078 0.7553 -0.0642 0.1352  -0.0828 26  PHE B CB    
1688 C  CG    . PHE B 26  ? 0.9862 0.9435 0.7927 -0.0394 0.1588  -0.0966 26  PHE B CG    
1689 C  CD1   . PHE B 26  ? 1.0218 1.0177 0.8300 -0.0284 0.1747  -0.0947 26  PHE B CD1   
1690 C  CD2   . PHE B 26  ? 1.0381 0.9502 0.8374 -0.0270 0.1656  -0.1119 26  PHE B CD2   
1691 C  CE1   . PHE B 26  ? 1.0550 1.0508 0.8619 -0.0018 0.1962  -0.1086 26  PHE B CE1   
1692 C  CE2   . PHE B 26  ? 1.1007 1.0035 0.8938 0.0006  0.1865  -0.1247 26  PHE B CE2   
1693 C  CZ    . PHE B 26  ? 1.0711 1.0187 0.8695 0.0146  0.2014  -0.1236 26  PHE B CZ    
1694 N  N     . ILE B 27  ? 0.8188 0.8280 0.6923 -0.0892 0.0908  -0.0326 27  ILE B N     
1695 C  CA    . ILE B 27  ? 0.8034 0.8164 0.6824 -0.1037 0.0678  -0.0213 27  ILE B CA    
1696 C  C     . ILE B 27  ? 0.8711 0.8737 0.7817 -0.1014 0.0593  -0.0194 27  ILE B C     
1697 O  O     . ILE B 27  ? 0.8574 0.8571 0.7903 -0.0880 0.0696  -0.0175 27  ILE B O     
1698 C  CB    . ILE B 27  ? 0.8160 0.8534 0.6987 -0.1082 0.0617  -0.0015 27  ILE B CB    
1699 C  CG1   . ILE B 27  ? 0.8123 0.8488 0.6825 -0.1217 0.0380  0.0077  27  ILE B CG1   
1700 C  CG2   . ILE B 27  ? 0.7886 0.8398 0.7090 -0.0980 0.0650  0.0108  27  ILE B CG2   
1701 C  CD1   . ILE B 27  ? 0.8705 0.9172 0.7185 -0.1299 0.0350  0.0228  27  ILE B CD1   
1702 N  N     . THR B 28  ? 0.8545 0.8543 0.7664 -0.1141 0.0408  -0.0203 28  THR B N     
1703 C  CA    . THR B 28  ? 0.8347 0.8312 0.7774 -0.1150 0.0332  -0.0186 28  THR B CA    
1704 C  C     . THR B 28  ? 0.8606 0.8790 0.8278 -0.1127 0.0190  -0.0006 28  THR B C     
1705 O  O     . THR B 28  ? 0.8525 0.8826 0.8075 -0.1145 0.0111  0.0094  28  THR B O     
1706 C  CB    . THR B 28  ? 0.9826 0.9701 0.9168 -0.1312 0.0217  -0.0325 28  THR B CB    
1707 O  OG1   . THR B 28  ? 0.9831 0.9855 0.8963 -0.1411 0.0042  -0.0310 28  THR B OG1   
1708 C  CG2   . THR B 28  ? 1.0199 0.9755 0.9328 -0.1342 0.0364  -0.0522 28  THR B CG2   
1709 N  N     . ASP B 29  ? 0.8110 0.8320 0.8096 -0.1089 0.0165  0.0033  29  ASP B N     
1710 C  CA    . ASP B 29  ? 0.7885 0.8274 0.8106 -0.1046 0.0034  0.0173  29  ASP B CA    
1711 C  C     . ASP B 29  ? 0.8726 0.9238 0.8899 -0.1135 -0.0186 0.0185  29  ASP B C     
1712 O  O     . ASP B 29  ? 0.8605 0.9211 0.8809 -0.1091 -0.0312 0.0310  29  ASP B O     
1713 C  CB    . ASP B 29  ? 0.7872 0.8269 0.8405 -0.0984 0.0078  0.0188  29  ASP B CB    
1714 C  CG    . ASP B 29  ? 0.9088 0.9429 0.9703 -0.0845 0.0232  0.0240  29  ASP B CG    
1715 O  OD1   . ASP B 29  ? 0.9526 0.9831 0.9988 -0.0794 0.0333  0.0235  29  ASP B OD1   
1716 O  OD2   . ASP B 29  ? 0.9166 0.9527 0.9995 -0.0783 0.0256  0.0277  29  ASP B OD2   
1717 N  N     . HIS B 30  ? 0.8653 0.9146 0.8723 -0.1258 -0.0239 0.0048  30  HIS B N     
1718 C  CA    . HIS B 30  ? 0.8789 0.9445 0.8799 -0.1340 -0.0468 0.0034  30  HIS B CA    
1719 C  C     . HIS B 30  ? 0.9162 0.9798 0.8817 -0.1337 -0.0551 0.0119  30  HIS B C     
1720 O  O     . HIS B 30  ? 0.9217 0.9967 0.8877 -0.1298 -0.0743 0.0233  30  HIS B O     
1721 C  CB    . HIS B 30  ? 0.9247 0.9894 0.9207 -0.1502 -0.0498 -0.0156 30  HIS B CB    
1722 C  CG    . HIS B 30  ? 0.9964 1.0856 0.9902 -0.1577 -0.0760 -0.0180 30  HIS B CG    
1723 N  ND1   . HIS B 30  ? 1.0059 1.1248 1.0370 -0.1557 -0.0911 -0.0154 30  HIS B ND1   
1724 C  CD2   . HIS B 30  ? 1.0638 1.1547 1.0221 -0.1649 -0.0898 -0.0224 30  HIS B CD2   
1725 C  CE1   . HIS B 30  ? 1.0265 1.1657 1.0461 -0.1607 -0.1149 -0.0183 30  HIS B CE1   
1726 N  NE2   . HIS B 30  ? 1.0660 1.1878 1.0398 -0.1668 -0.1156 -0.0221 30  HIS B NE2   
1727 N  N     . GLU B 31  ? 0.8611 0.9095 0.7942 -0.1371 -0.0406 0.0068  31  GLU B N     
1728 C  CA    . GLU B 31  ? 0.8742 0.9206 0.7695 -0.1392 -0.0446 0.0158  31  GLU B CA    
1729 C  C     . GLU B 31  ? 0.8746 0.9226 0.7793 -0.1308 -0.0456 0.0366  31  GLU B C     
1730 O  O     . GLU B 31  ? 0.8755 0.9234 0.7625 -0.1314 -0.0617 0.0499  31  GLU B O     
1731 C  CB    . GLU B 31  ? 0.9180 0.9519 0.7812 -0.1428 -0.0239 0.0048  31  GLU B CB    
1732 C  CG    . GLU B 31  ? 1.0738 1.1075 0.8929 -0.1482 -0.0254 0.0126  31  GLU B CG    
1733 C  CD    . GLU B 31  ? 1.3718 1.3975 1.1554 -0.1521 -0.0061 -0.0023 31  GLU B CD    
1734 O  OE1   . GLU B 31  ? 1.2890 1.3058 1.0840 -0.1474 0.0105  -0.0181 31  GLU B OE1   
1735 O  OE2   . GLU B 31  ? 1.2959 1.3221 1.0373 -0.1588 -0.0077 0.0015  31  GLU B OE2   
1736 N  N     . LEU B 32  ? 0.7851 0.8325 0.7168 -0.1228 -0.0298 0.0392  32  LEU B N     
1737 C  CA    . LEU B 32  ? 0.7582 0.8061 0.7008 -0.1170 -0.0299 0.0559  32  LEU B CA    
1738 C  C     . LEU B 32  ? 0.8059 0.8555 0.7626 -0.1118 -0.0524 0.0662  32  LEU B C     
1739 O  O     . LEU B 32  ? 0.8216 0.8624 0.7641 -0.1115 -0.0612 0.0813  32  LEU B O     
1740 C  CB    . LEU B 32  ? 0.7197 0.7707 0.6907 -0.1087 -0.0125 0.0540  32  LEU B CB    
1741 C  CG    . LEU B 32  ? 0.7746 0.8274 0.7349 -0.1085 0.0098  0.0469  32  LEU B CG    
1742 C  CD1   . LEU B 32  ? 0.7424 0.7979 0.7316 -0.0967 0.0227  0.0420  32  LEU B CD1   
1743 C  CD2   . LEU B 32  ? 0.8131 0.8719 0.7562 -0.1145 0.0157  0.0581  32  LEU B CD2   
1744 N  N     . SER B 33  ? 0.7308 0.7910 0.7139 -0.1080 -0.0612 0.0577  33  SER B N     
1745 C  CA    . SER B 33  ? 0.7164 0.7853 0.7179 -0.0996 -0.0820 0.0642  33  SER B CA    
1746 C  C     . SER B 33  ? 0.8062 0.8724 0.7770 -0.1013 -0.1033 0.0725  33  SER B C     
1747 O  O     . SER B 33  ? 0.8088 0.8661 0.7759 -0.0923 -0.1168 0.0869  33  SER B O     
1748 C  CB    . SER B 33  ? 0.7327 0.8208 0.7679 -0.0987 -0.0844 0.0514  33  SER B CB    
1749 O  OG    . SER B 33  ? 0.8872 0.9864 0.9114 -0.1090 -0.0951 0.0406  33  SER B OG    
1750 N  N     . ASP B 34  ? 0.7925 0.8615 0.7358 -0.1123 -0.1058 0.0636  34  ASP B N     
1751 C  CA    . ASP B 34  ? 0.8294 0.8965 0.7359 -0.1146 -0.1263 0.0707  34  ASP B CA    
1752 C  C     . ASP B 34  ? 0.8735 0.9161 0.7412 -0.1168 -0.1216 0.0886  34  ASP B C     
1753 O  O     . ASP B 34  ? 0.8882 0.9197 0.7367 -0.1106 -0.1402 0.1048  34  ASP B O     
1754 C  CB    . ASP B 34  ? 0.8850 0.9610 0.7695 -0.1276 -0.1282 0.0535  34  ASP B CB    
1755 C  CG    . ASP B 34  ? 1.0820 1.1848 0.9966 -0.1291 -0.1435 0.0388  34  ASP B CG    
1756 O  OD1   . ASP B 34  ? 1.0681 1.1771 1.0141 -0.1335 -0.1296 0.0253  34  ASP B OD1   
1757 O  OD2   . ASP B 34  ? 1.2378 1.3565 1.1430 -0.1269 -0.1694 0.0407  34  ASP B OD2   
1758 N  N     . LEU B 35  ? 0.8158 0.8503 0.6725 -0.1252 -0.0964 0.0863  35  LEU B N     
1759 C  CA    . LEU B 35  ? 0.8347 0.8517 0.6577 -0.1321 -0.0868 0.1018  35  LEU B CA    
1760 C  C     . LEU B 35  ? 0.8761 0.8774 0.7111 -0.1256 -0.0931 0.1200  35  LEU B C     
1761 O  O     . LEU B 35  ? 0.8993 0.8790 0.7005 -0.1292 -0.1011 0.1380  35  LEU B O     
1762 C  CB    . LEU B 35  ? 0.8174 0.8397 0.6407 -0.1396 -0.0571 0.0927  35  LEU B CB    
1763 C  CG    . LEU B 35  ? 0.8890 0.9174 0.6864 -0.1469 -0.0454 0.0761  35  LEU B CG    
1764 C  CD1   . LEU B 35  ? 0.8660 0.9018 0.6763 -0.1467 -0.0174 0.0666  35  LEU B CD1   
1765 C  CD2   . LEU B 35  ? 0.9754 0.9953 0.7172 -0.1570 -0.0499 0.0847  35  LEU B CD2   
1766 N  N     . PHE B 36  ? 0.8045 0.8126 0.6840 -0.1163 -0.0896 0.1152  36  PHE B N     
1767 C  CA    . PHE B 36  ? 0.8027 0.7944 0.6954 -0.1097 -0.0942 0.1282  36  PHE B CA    
1768 C  C     . PHE B 36  ? 0.8702 0.8560 0.7756 -0.0933 -0.1191 0.1337  36  PHE B C     
1769 O  O     . PHE B 36  ? 0.8772 0.8423 0.7874 -0.0865 -0.1244 0.1443  36  PHE B O     
1770 C  CB    . PHE B 36  ? 0.7814 0.7823 0.7083 -0.1091 -0.0749 0.1210  36  PHE B CB    
1771 C  CG    . PHE B 36  ? 0.8027 0.8073 0.7151 -0.1231 -0.0527 0.1211  36  PHE B CG    
1772 C  CD1   . PHE B 36  ? 0.8568 0.8457 0.7514 -0.1342 -0.0482 0.1355  36  PHE B CD1   
1773 C  CD2   . PHE B 36  ? 0.8184 0.8422 0.7349 -0.1253 -0.0358 0.1064  36  PHE B CD2   
1774 C  CE1   . PHE B 36  ? 0.8744 0.8756 0.7599 -0.1480 -0.0267 0.1347  36  PHE B CE1   
1775 C  CE2   . PHE B 36  ? 0.8612 0.8943 0.7670 -0.1349 -0.0148 0.1053  36  PHE B CE2   
1776 C  CZ    . PHE B 36  ? 0.8534 0.8797 0.7461 -0.1466 -0.0101 0.1192  36  PHE B CZ    
1777 N  N     . GLN B 37  ? 0.8297 0.8341 0.7392 -0.0870 -0.1349 0.1259  37  GLN B N     
1778 C  CA    . GLN B 37  ? 0.8336 0.8441 0.7599 -0.0688 -0.1595 0.1286  37  GLN B CA    
1779 C  C     . GLN B 37  ? 0.8653 0.8805 0.8354 -0.0554 -0.1557 0.1244  37  GLN B C     
1780 O  O     . GLN B 37  ? 0.8847 0.8818 0.8573 -0.0407 -0.1679 0.1342  37  GLN B O     
1781 C  CB    . GLN B 37  ? 0.9019 0.8840 0.7874 -0.0623 -0.1808 0.1484  37  GLN B CB    
1782 C  CG    . GLN B 37  ? 0.9908 0.9765 0.8339 -0.0715 -0.1905 0.1505  37  GLN B CG    
1783 C  CD    . GLN B 37  ? 1.1828 1.2067 1.0459 -0.0646 -0.2084 0.1359  37  GLN B CD    
1784 O  OE1   . GLN B 37  ? 1.0545 1.1052 0.9377 -0.0752 -0.1972 0.1168  37  GLN B OE1   
1785 N  NE2   . GLN B 37  ? 1.2254 1.2523 1.0836 -0.0469 -0.2371 0.1444  37  GLN B NE2   
1786 N  N     . VAL B 38  ? 0.7728 0.8086 0.7731 -0.0605 -0.1373 0.1098  38  VAL B N     
1787 C  CA    . VAL B 38  ? 0.7267 0.7707 0.7655 -0.0507 -0.1291 0.1036  38  VAL B CA    
1788 C  C     . VAL B 38  ? 0.7491 0.8258 0.8185 -0.0537 -0.1215 0.0867  38  VAL B C     
1789 O  O     . VAL B 38  ? 0.7609 0.8461 0.8179 -0.0663 -0.1185 0.0794  38  VAL B O     
1790 C  CB    . VAL B 38  ? 0.7615 0.7854 0.7947 -0.0574 -0.1109 0.1081  38  VAL B CB    
1791 C  CG1   . VAL B 38  ? 0.7245 0.7644 0.7748 -0.0647 -0.0888 0.0961  38  VAL B CG1   
1792 C  CG2   . VAL B 38  ? 0.7590 0.7660 0.8041 -0.0444 -0.1164 0.1137  38  VAL B CG2   
1793 N  N     . SER B 39  ? 0.6690 0.7625 0.7753 -0.0430 -0.1188 0.0803  39  SER B N     
1794 C  CA    . SER B 39  ? 0.6381 0.7604 0.7730 -0.0483 -0.1103 0.0660  39  SER B CA    
1795 C  C     . SER B 39  ? 0.6979 0.8106 0.8271 -0.0609 -0.0871 0.0603  39  SER B C     
1796 O  O     . SER B 39  ? 0.7029 0.7966 0.8218 -0.0597 -0.0759 0.0661  39  SER B O     
1797 C  CB    . SER B 39  ? 0.6412 0.7829 0.8134 -0.0340 -0.1101 0.0621  39  SER B CB    
1798 O  OG    . SER B 39  ? 0.7104 0.8344 0.8849 -0.0278 -0.0967 0.0655  39  SER B OG    
1799 N  N     . ILE B 40  ? 0.6431 0.7686 0.7796 -0.0728 -0.0802 0.0483  40  ILE B N     
1800 C  CA    . ILE B 40  ? 0.6270 0.7388 0.7570 -0.0817 -0.0583 0.0422  40  ILE B CA    
1801 C  C     . ILE B 40  ? 0.6715 0.7781 0.8180 -0.0717 -0.0439 0.0458  40  ILE B C     
1802 O  O     . ILE B 40  ? 0.6634 0.7542 0.7977 -0.0712 -0.0300 0.0476  40  ILE B O     
1803 C  CB    . ILE B 40  ? 0.6640 0.7834 0.7988 -0.0966 -0.0536 0.0283  40  ILE B CB    
1804 C  CG1   . ILE B 40  ? 0.6695 0.7634 0.7835 -0.1038 -0.0341 0.0227  40  ILE B CG1   
1805 C  CG2   . ILE B 40  ? 0.6577 0.7993 0.8287 -0.0970 -0.0509 0.0230  40  ILE B CG2   
1806 C  CD1   . ILE B 40  ? 0.7853 0.8740 0.8836 -0.1198 -0.0343 0.0095  40  ILE B CD1   
1807 N  N     . GLN B 41  ? 0.6260 0.7490 0.7993 -0.0619 -0.0485 0.0465  41  GLN B N     
1808 C  CA    . GLN B 41  ? 0.6092 0.7299 0.7962 -0.0516 -0.0371 0.0490  41  GLN B CA    
1809 C  C     . GLN B 41  ? 0.6532 0.7555 0.8245 -0.0444 -0.0374 0.0575  41  GLN B C     
1810 O  O     . GLN B 41  ? 0.6376 0.7319 0.8070 -0.0418 -0.0241 0.0583  41  GLN B O     
1811 C  CB    . GLN B 41  ? 0.6187 0.7632 0.8347 -0.0419 -0.0428 0.0466  41  GLN B CB    
1812 C  CG    . GLN B 41  ? 0.7974 0.9649 1.0346 -0.0527 -0.0361 0.0374  41  GLN B CG    
1813 C  CD    . GLN B 41  ? 0.9220 1.1126 1.1671 -0.0607 -0.0526 0.0317  41  GLN B CD    
1814 O  OE1   . GLN B 41  ? 0.8511 1.0405 1.0841 -0.0554 -0.0709 0.0358  41  GLN B OE1   
1815 N  NE2   . GLN B 41  ? 0.7520 0.9645 1.0165 -0.0748 -0.0469 0.0223  41  GLN B NE2   
1816 N  N     . THR B 42  ? 0.6134 0.7083 0.7718 -0.0424 -0.0530 0.0642  42  THR B N     
1817 C  CA    . THR B 42  ? 0.6169 0.6925 0.7587 -0.0411 -0.0532 0.0725  42  THR B CA    
1818 C  C     . THR B 42  ? 0.6679 0.7375 0.7925 -0.0518 -0.0394 0.0723  42  THR B C     
1819 O  O     . THR B 42  ? 0.6455 0.7121 0.7710 -0.0500 -0.0299 0.0736  42  THR B O     
1820 C  CB    . THR B 42  ? 0.7456 0.8080 0.8735 -0.0379 -0.0719 0.0812  42  THR B CB    
1821 O  OG1   . THR B 42  ? 0.7605 0.8294 0.9082 -0.0226 -0.0821 0.0794  42  THR B OG1   
1822 C  CG2   . THR B 42  ? 0.7498 0.7887 0.8583 -0.0423 -0.0709 0.0900  42  THR B CG2   
1823 N  N     . ILE B 43  ? 0.6404 0.7113 0.7509 -0.0615 -0.0381 0.0687  43  ILE B N     
1824 C  CA    . ILE B 43  ? 0.6405 0.7072 0.7342 -0.0689 -0.0237 0.0659  43  ILE B CA    
1825 C  C     . ILE B 43  ? 0.6814 0.7502 0.7885 -0.0626 -0.0070 0.0607  43  ILE B C     
1826 O  O     . ILE B 43  ? 0.6804 0.7496 0.7829 -0.0606 0.0028  0.0624  43  ILE B O     
1827 C  CB    . ILE B 43  ? 0.6929 0.7584 0.7672 -0.0791 -0.0255 0.0596  43  ILE B CB    
1828 C  CG1   . ILE B 43  ? 0.7194 0.7812 0.7719 -0.0843 -0.0423 0.0674  43  ILE B CG1   
1829 C  CG2   . ILE B 43  ? 0.6994 0.7597 0.7584 -0.0830 -0.0076 0.0527  43  ILE B CG2   
1830 C  CD1   . ILE B 43  ? 0.8007 0.8518 0.8304 -0.0889 -0.0401 0.0787  43  ILE B CD1   
1831 N  N     . ARG B 44  ? 0.6329 0.7048 0.7567 -0.0591 -0.0043 0.0555  44  ARG B N     
1832 C  CA    . ARG B 44  ? 0.6248 0.6933 0.7566 -0.0522 0.0108  0.0527  44  ARG B CA    
1833 C  C     . ARG B 44  ? 0.6681 0.7413 0.8086 -0.0415 0.0117  0.0585  44  ARG B C     
1834 O  O     . ARG B 44  ? 0.6562 0.7283 0.7942 -0.0348 0.0222  0.0588  44  ARG B O     
1835 C  CB    . ARG B 44  ? 0.6270 0.6968 0.7725 -0.0546 0.0137  0.0477  44  ARG B CB    
1836 C  CG    . ARG B 44  ? 0.8066 0.8753 0.9464 -0.0684 0.0099  0.0399  44  ARG B CG    
1837 C  CD    . ARG B 44  ? 1.0081 1.0701 1.1555 -0.0747 0.0211  0.0337  44  ARG B CD    
1838 N  NE    . ARG B 44  ? 1.1441 1.2213 1.3040 -0.0883 0.0121  0.0267  44  ARG B NE    
1839 C  CZ    . ARG B 44  ? 1.4148 1.4864 1.5625 -0.1030 0.0090  0.0173  44  ARG B CZ    
1840 N  NH1   . ARG B 44  ? 1.2260 1.2743 1.3465 -0.1045 0.0155  0.0136  44  ARG B NH1   
1841 N  NH2   . ARG B 44  ? 1.3570 1.4494 1.5201 -0.1160 -0.0009 0.0101  44  ARG B NH2   
1842 N  N     . LEU B 45  ? 0.6210 0.6989 0.7701 -0.0389 -0.0007 0.0623  45  LEU B N     
1843 C  CA    . LEU B 45  ? 0.6045 0.6841 0.7592 -0.0308 -0.0025 0.0656  45  LEU B CA    
1844 C  C     . LEU B 45  ? 0.6819 0.7612 0.8256 -0.0357 -0.0014 0.0691  45  LEU B C     
1845 O  O     . LEU B 45  ? 0.6742 0.7601 0.8220 -0.0306 0.0033  0.0689  45  LEU B O     
1846 C  CB    . LEU B 45  ? 0.5967 0.6750 0.7592 -0.0266 -0.0164 0.0671  45  LEU B CB    
1847 C  CG    . LEU B 45  ? 0.6280 0.7156 0.8080 -0.0173 -0.0150 0.0628  45  LEU B CG    
1848 C  CD1   . LEU B 45  ? 0.6242 0.7116 0.8114 -0.0103 -0.0295 0.0630  45  LEU B CD1   
1849 C  CD2   . LEU B 45  ? 0.6444 0.7340 0.8272 -0.0089 -0.0048 0.0615  45  LEU B CD2   
1850 N  N     . ASP B 46  ? 0.6670 0.7417 0.7964 -0.0465 -0.0057 0.0720  46  ASP B N     
1851 C  CA    . ASP B 46  ? 0.6812 0.7587 0.7993 -0.0552 -0.0028 0.0758  46  ASP B CA    
1852 C  C     . ASP B 46  ? 0.7203 0.8116 0.8397 -0.0520 0.0125  0.0713  46  ASP B C     
1853 O  O     . ASP B 46  ? 0.7117 0.8165 0.8378 -0.0510 0.0161  0.0719  46  ASP B O     
1854 C  CB    . ASP B 46  ? 0.7395 0.8071 0.8369 -0.0674 -0.0099 0.0813  46  ASP B CB    
1855 C  CG    . ASP B 46  ? 0.9921 1.0431 1.0857 -0.0673 -0.0272 0.0879  46  ASP B CG    
1856 O  OD1   . ASP B 46  ? 1.0124 1.0572 1.1155 -0.0624 -0.0324 0.0893  46  ASP B OD1   
1857 O  OD2   . ASP B 46  ? 1.1144 1.1579 1.1944 -0.0704 -0.0363 0.0908  46  ASP B OD2   
1858 N  N     . ARG B 47  ? 0.6840 0.7718 0.7983 -0.0488 0.0208  0.0656  47  ARG B N     
1859 C  CA    . ARG B 47  ? 0.6853 0.7797 0.7983 -0.0408 0.0356  0.0603  47  ARG B CA    
1860 C  C     . ARG B 47  ? 0.7624 0.8641 0.8901 -0.0262 0.0392  0.0606  47  ARG B C     
1861 O  O     . ARG B 47  ? 0.7686 0.8857 0.8996 -0.0180 0.0471  0.0591  47  ARG B O     
1862 C  CB    . ARG B 47  ? 0.6625 0.7409 0.7649 -0.0403 0.0420  0.0534  47  ARG B CB    
1863 C  CG    . ARG B 47  ? 0.7107 0.7858 0.7924 -0.0507 0.0442  0.0493  47  ARG B CG    
1864 C  CD    . ARG B 47  ? 0.7311 0.7881 0.8007 -0.0486 0.0534  0.0388  47  ARG B CD    
1865 N  NE    . ARG B 47  ? 0.6762 0.7189 0.7522 -0.0522 0.0478  0.0368  47  ARG B NE    
1866 C  CZ    . ARG B 47  ? 0.7628 0.7945 0.8484 -0.0439 0.0543  0.0362  47  ARG B CZ    
1867 N  NH1   . ARG B 47  ? 0.5812 0.6122 0.6689 -0.0285 0.0647  0.0380  47  ARG B NH1   
1868 N  NH2   . ARG B 47  ? 0.5113 0.5349 0.6041 -0.0511 0.0506  0.0345  47  ARG B NH2   
1869 N  N     . THR B 48  ? 0.7245 0.8180 0.8603 -0.0220 0.0335  0.0621  48  THR B N     
1870 C  CA    . THR B 48  ? 0.7199 0.8176 0.8642 -0.0084 0.0360  0.0632  48  THR B CA    
1871 C  C     . THR B 48  ? 0.7896 0.9074 0.9414 -0.0073 0.0307  0.0647  48  THR B C     
1872 O  O     . THR B 48  ? 0.8008 0.9333 0.9563 0.0039  0.0356  0.0639  48  THR B O     
1873 C  CB    . THR B 48  ? 0.7804 0.8678 0.9298 -0.0068 0.0324  0.0639  48  THR B CB    
1874 O  OG1   . THR B 48  ? 0.7459 0.8187 0.8905 -0.0110 0.0387  0.0613  48  THR B OG1   
1875 C  CG2   . THR B 48  ? 0.7972 0.8879 0.9499 0.0067  0.0353  0.0656  48  THR B CG2   
1876 N  N     . TYR B 49  ? 0.7420 0.8597 0.8954 -0.0191 0.0199  0.0666  49  TYR B N     
1877 C  CA    . TYR B 49  ? 0.7357 0.8678 0.8951 -0.0241 0.0138  0.0669  49  TYR B CA    
1878 C  C     . TYR B 49  ? 0.7592 0.9146 0.9204 -0.0300 0.0209  0.0663  49  TYR B C     
1879 O  O     . TYR B 49  ? 0.7601 0.9399 0.9320 -0.0276 0.0206  0.0641  49  TYR B O     
1880 C  CB    . TYR B 49  ? 0.7739 0.8895 0.9295 -0.0359 0.0014  0.0696  49  TYR B CB    
1881 C  CG    . TYR B 49  ? 0.8404 0.9626 1.0005 -0.0423 -0.0058 0.0681  49  TYR B CG    
1882 C  CD1   . TYR B 49  ? 0.8672 0.9886 1.0322 -0.0324 -0.0113 0.0635  49  TYR B CD1   
1883 C  CD2   . TYR B 49  ? 0.8799 1.0094 1.0378 -0.0603 -0.0064 0.0704  49  TYR B CD2   
1884 C  CE1   . TYR B 49  ? 0.8989 1.0253 1.0663 -0.0400 -0.0190 0.0595  49  TYR B CE1   
1885 C  CE2   . TYR B 49  ? 0.9096 1.0449 1.0723 -0.0704 -0.0132 0.0676  49  TYR B CE2   
1886 C  CZ    . TYR B 49  ? 1.0288 1.1617 1.1961 -0.0601 -0.0203 0.0613  49  TYR B CZ    
1887 O  OH    . TYR B 49  ? 1.0899 1.2269 1.2601 -0.0718 -0.0281 0.0562  49  TYR B OH    
1888 N  N     . LEU B 50  ? 0.6966 0.8482 0.8477 -0.0371 0.0275  0.0671  50  LEU B N     
1889 C  CA    . LEU B 50  ? 0.6893 0.8653 0.8408 -0.0427 0.0373  0.0655  50  LEU B CA    
1890 C  C     . LEU B 50  ? 0.7270 0.9188 0.8841 -0.0230 0.0491  0.0600  50  LEU B C     
1891 O  O     . LEU B 50  ? 0.7429 0.9602 0.9033 -0.0224 0.0589  0.0567  50  LEU B O     
1892 C  CB    . LEU B 50  ? 0.7024 0.8659 0.8351 -0.0571 0.0402  0.0680  50  LEU B CB    
1893 C  CG    . LEU B 50  ? 0.7723 0.9189 0.8936 -0.0761 0.0294  0.0758  50  LEU B CG    
1894 C  CD1   . LEU B 50  ? 0.7935 0.9206 0.8920 -0.0829 0.0287  0.0783  50  LEU B CD1   
1895 C  CD2   . LEU B 50  ? 0.8211 0.9874 0.9451 -0.0933 0.0322  0.0791  50  LEU B CD2   
1896 N  N     . ASN B 51  ? 0.6482 0.8239 0.8050 -0.0062 0.0489  0.0593  51  ASN B N     
1897 C  CA    . ASN B 51  ? 0.6393 0.8168 0.7956 0.0156  0.0587  0.0561  51  ASN B CA    
1898 C  C     . ASN B 51  ? 0.6626 0.8321 0.8064 0.0182  0.0713  0.0509  51  ASN B C     
1899 O  O     . ASN B 51  ? 0.6615 0.8445 0.8073 0.0354  0.0808  0.0466  51  ASN B O     
1900 C  CB    . ASN B 51  ? 0.6623 0.8738 0.8344 0.0300  0.0570  0.0555  51  ASN B CB    
1901 C  CG    . ASN B 51  ? 1.1421 1.3467 1.3164 0.0371  0.0473  0.0589  51  ASN B CG    
1902 O  OD1   . ASN B 51  ? 1.0884 1.2664 1.2518 0.0494  0.0499  0.0616  51  ASN B OD1   
1903 N  ND2   . ASN B 51  ? 1.0783 1.3047 1.2641 0.0277  0.0368  0.0584  51  ASN B ND2   
1904 N  N     . ILE B 52  ? 0.5990 0.7462 0.7287 0.0026  0.0703  0.0503  52  ILE B N     
1905 C  CA    . ILE B 52  ? 0.6037 0.7369 0.7158 0.0011  0.0802  0.0436  52  ILE B CA    
1906 C  C     . ILE B 52  ? 0.6559 0.7520 0.7573 0.0089  0.0828  0.0409  52  ILE B C     
1907 O  O     . ILE B 52  ? 0.6462 0.7265 0.7490 0.0003  0.0744  0.0445  52  ILE B O     
1908 C  CB    . ILE B 52  ? 0.6413 0.7720 0.7407 -0.0214 0.0753  0.0449  52  ILE B CB    
1909 C  CG1   . ILE B 52  ? 0.6361 0.7990 0.7423 -0.0326 0.0754  0.0489  52  ILE B CG1   
1910 C  CG2   . ILE B 52  ? 0.6827 0.7949 0.7591 -0.0235 0.0837  0.0361  52  ILE B CG2   
1911 C  CD1   . ILE B 52  ? 0.7335 0.8887 0.8243 -0.0550 0.0680  0.0549  52  ILE B CD1   
1912 N  N     . PRO B 53  ? 0.6207 0.7018 0.7115 0.0249  0.0951  0.0342  53  PRO B N     
1913 C  CA    . PRO B 53  ? 0.6386 0.6777 0.7160 0.0281  0.0989  0.0319  53  PRO B CA    
1914 C  C     . PRO B 53  ? 0.7278 0.7457 0.7894 0.0082  0.0974  0.0248  53  PRO B C     
1915 O  O     . PRO B 53  ? 0.7242 0.7579 0.7807 -0.0042 0.0944  0.0220  53  PRO B O     
1916 C  CB    . PRO B 53  ? 0.6834 0.7103 0.7515 0.0528  0.1119  0.0269  53  PRO B CB    
1917 C  CG    . PRO B 53  ? 0.7427 0.8029 0.8142 0.0565  0.1172  0.0209  53  PRO B CG    
1918 C  CD    . PRO B 53  ? 0.6553 0.7553 0.7453 0.0405  0.1069  0.0278  53  PRO B CD    
1919 N  N     . GLU B 54  ? 0.7064 0.6892 0.7589 0.0036  0.0992  0.0221  54  GLU B N     
1920 C  CA    . GLU B 54  ? 0.7206 0.6850 0.7595 -0.0163 0.0963  0.0134  54  GLU B CA    
1921 C  C     . GLU B 54  ? 0.7968 0.7474 0.8116 -0.0144 0.1058  -0.0001 54  GLU B C     
1922 O  O     . GLU B 54  ? 0.8072 0.7539 0.8160 0.0056  0.1175  -0.0032 54  GLU B O     
1923 C  CB    . GLU B 54  ? 0.7566 0.6901 0.7946 -0.0240 0.0976  0.0130  54  GLU B CB    
1924 C  CG    . GLU B 54  ? 0.9604 0.8528 0.9822 -0.0099 0.1122  0.0104  54  GLU B CG    
1925 C  CD    . GLU B 54  ? 1.3397 1.1945 1.3524 -0.0272 0.1155  0.0057  54  GLU B CD    
1926 O  OE1   . GLU B 54  ? 1.3724 1.2161 1.3737 -0.0457 0.1131  -0.0069 54  GLU B OE1   
1927 O  OE2   . GLU B 54  ? 1.2798 1.1175 1.2956 -0.0242 0.1204  0.0146  54  GLU B OE2   
1928 N  N     . LEU B 55  ? 0.7634 0.7088 0.7639 -0.0338 0.1001  -0.0087 55  LEU B N     
1929 C  CA    . LEU B 55  ? 0.7881 0.7200 0.7606 -0.0362 0.1074  -0.0238 55  LEU B CA    
1930 C  C     . LEU B 55  ? 0.8747 0.7698 0.8304 -0.0183 0.1240  -0.0343 55  LEU B C     
1931 O  O     . LEU B 55  ? 0.8847 0.7871 0.8302 -0.0024 0.1351  -0.0407 55  LEU B O     
1932 C  CB    . LEU B 55  ? 0.8001 0.7215 0.7592 -0.0611 0.0961  -0.0324 55  LEU B CB    
1933 C  CG    . LEU B 55  ? 0.8968 0.7966 0.8217 -0.0673 0.1019  -0.0510 55  LEU B CG    
1934 C  CD1   . LEU B 55  ? 0.8980 0.8256 0.8091 -0.0653 0.1035  -0.0512 55  LEU B CD1   
1935 C  CD2   . LEU B 55  ? 0.9403 0.8280 0.8564 -0.0918 0.0890  -0.0601 55  LEU B CD2   
1936 N  N     . ARG B 56  ? 0.8492 0.7045 0.8017 -0.0205 0.1264  -0.0356 56  ARG B N     
1937 C  CA    . ARG B 56  ? 0.8889 0.6956 0.8207 -0.0041 0.1413  -0.0442 56  ARG B CA    
1938 C  C     . ARG B 56  ? 0.9340 0.7513 0.8737 0.0295  0.1506  -0.0367 56  ARG B C     
1939 O  O     . ARG B 56  ? 0.9800 0.7748 0.9010 0.0503  0.1632  -0.0471 56  ARG B O     
1940 C  CB    . ARG B 56  ? 0.8907 0.6529 0.8182 -0.0178 0.1417  -0.0433 56  ARG B CB    
1941 C  CG    . ARG B 56  ? 1.0082 0.7552 0.9232 -0.0493 0.1349  -0.0575 56  ARG B CG    
1942 C  CD    . ARG B 56  ? 1.1210 0.8368 1.0398 -0.0690 0.1348  -0.0553 56  ARG B CD    
1943 N  NE    . ARG B 56  ? 1.1625 0.8719 1.0736 -0.1011 0.1265  -0.0706 56  ARG B NE    
1944 C  CZ    . ARG B 56  ? 1.2451 0.9631 1.1746 -0.1269 0.1189  -0.0684 56  ARG B CZ    
1945 N  NH1   . ARG B 56  ? 1.0033 0.7341 0.9574 -0.1242 0.1202  -0.0513 56  ARG B NH1   
1946 N  NH2   . ARG B 56  ? 1.0670 0.7858 0.9910 -0.1556 0.1096  -0.0842 56  ARG B NH2   
1947 N  N     . LYS B 57  ? 0.8241 0.6786 0.7915 0.0357  0.1436  -0.0202 57  LYS B N     
1948 C  CA    . LYS B 57  ? 0.8053 0.6811 0.7848 0.0658  0.1486  -0.0128 57  LYS B CA    
1949 C  C     . LYS B 57  ? 0.8352 0.7562 0.8205 0.0735  0.1524  -0.0193 57  LYS B C     
1950 O  O     . LYS B 57  ? 0.8501 0.7803 0.8361 0.1011  0.1621  -0.0227 57  LYS B O     
1951 C  CB    . LYS B 57  ? 0.7930 0.6932 0.7972 0.0671  0.1389  0.0045  57  LYS B CB    
1952 C  CG    . LYS B 57  ? 1.0011 0.8571 0.9968 0.0676  0.1406  0.0122  57  LYS B CG    
1953 C  CD    . LYS B 57  ? 1.1010 0.9827 1.1171 0.0710  0.1322  0.0279  57  LYS B CD    
1954 C  CE    . LYS B 57  ? 1.2853 1.1245 1.2895 0.0712  0.1364  0.0367  57  LYS B CE    
1955 N  NZ    . LYS B 57  ? 1.4577 1.2898 1.4666 0.0400  0.1325  0.0360  57  LYS B NZ    
1956 N  N     . ARG B 58  ? 0.7608 0.7099 0.7486 0.0496  0.1455  -0.0208 58  ARG B N     
1957 C  CA    . ARG B 58  ? 0.7497 0.7409 0.7392 0.0507  0.1508  -0.0257 58  ARG B CA    
1958 C  C     . ARG B 58  ? 0.8662 0.8348 0.8278 0.0615  0.1658  -0.0441 58  ARG B C     
1959 O  O     . ARG B 58  ? 0.8774 0.8714 0.8435 0.0834  0.1779  -0.0495 58  ARG B O     
1960 C  CB    . ARG B 58  ? 0.7021 0.7174 0.6927 0.0217  0.1395  -0.0208 58  ARG B CB    
1961 C  CG    . ARG B 58  ? 0.7230 0.7611 0.7398 0.0125  0.1251  -0.0043 58  ARG B CG    
1962 C  CD    . ARG B 58  ? 0.7009 0.7647 0.7174 -0.0098 0.1160  0.0017  58  ARG B CD    
1963 N  NE    . ARG B 58  ? 0.7650 0.8066 0.7594 -0.0291 0.1081  -0.0028 58  ARG B NE    
1964 C  CZ    . ARG B 58  ? 0.9204 0.9490 0.9200 -0.0416 0.0934  0.0024  58  ARG B CZ    
1965 N  NH1   . ARG B 58  ? 0.7803 0.8123 0.8041 -0.0370 0.0868  0.0122  58  ARG B NH1   
1966 N  NH2   . ARG B 58  ? 0.7055 0.7208 0.6864 -0.0578 0.0851  -0.0031 58  ARG B NH2   
1967 N  N     . ILE B 59  ? 0.8589 0.7809 0.7925 0.0469  0.1652  -0.0554 59  ILE B N     
1968 C  CA    . ILE B 59  ? 0.9098 0.7994 0.8103 0.0546  0.1785  -0.0762 59  ILE B CA    
1969 C  C     . ILE B 59  ? 1.0132 0.8783 0.9109 0.0909  0.1925  -0.0813 59  ILE B C     
1970 O  O     . ILE B 59  ? 1.0361 0.9067 0.9208 0.1104  0.2068  -0.0954 59  ILE B O     
1971 C  CB    . ILE B 59  ? 0.9751 0.8172 0.8475 0.0290  0.1723  -0.0878 59  ILE B CB    
1972 C  CG1   . ILE B 59  ? 0.9467 0.8188 0.8189 -0.0018 0.1574  -0.0839 59  ILE B CG1   
1973 C  CG2   . ILE B 59  ? 1.0531 0.8525 0.8876 0.0389  0.1866  -0.1118 59  ILE B CG2   
1974 C  CD1   . ILE B 59  ? 1.0309 0.8690 0.8826 -0.0288 0.1466  -0.0943 59  ILE B CD1   
1975 N  N     . LYS B 60  ? 0.9911 0.8317 0.9002 0.1019  0.1885  -0.0690 60  LYS B N     
1976 C  CA    . LYS B 60  ? 1.0336 0.8466 0.9382 0.1391  0.1988  -0.0697 60  LYS B CA    
1977 C  C     . LYS B 60  ? 1.0764 0.9508 1.0052 0.1676  0.2047  -0.0678 60  LYS B C     
1978 O  O     . LYS B 60  ? 1.1200 0.9858 1.0376 0.1978  0.2181  -0.0803 60  LYS B O     
1979 C  CB    . LYS B 60  ? 1.0636 0.8430 0.9735 0.1419  0.1920  -0.0531 60  LYS B CB    
1980 C  CG    . LYS B 60  ? 1.3397 1.0645 1.2297 0.1769  0.2022  -0.0542 60  LYS B CG    
1981 C  CD    . LYS B 60  ? 1.4776 1.1907 1.3776 0.1848  0.1951  -0.0328 60  LYS B CD    
1982 C  CE    . LYS B 60  ? 1.7036 1.3559 1.5787 0.2196  0.2035  -0.0298 60  LYS B CE    
1983 N  NZ    . LYS B 60  ? 1.8543 1.5002 1.7360 0.2265  0.1962  -0.0071 60  LYS B NZ    
1984 N  N     . LEU B 61  ? 0.9761 0.9132 0.9379 0.1571  0.1950  -0.0541 61  LEU B N     
1985 C  CA    . LEU B 61  ? 0.9549 0.9605 0.9457 0.1766  0.1990  -0.0521 61  LEU B CA    
1986 C  C     . LEU B 61  ? 1.0313 1.0662 1.0137 0.1795  0.2141  -0.0692 61  LEU B C     
1987 O  O     . LEU B 61  ? 1.0357 1.1082 1.0324 0.2088  0.2248  -0.0754 61  LEU B O     
1988 C  CB    . LEU B 61  ? 0.8955 0.9533 0.9178 0.1554  0.1850  -0.0360 61  LEU B CB    
1989 C  CG    . LEU B 61  ? 0.9429 0.9940 0.9807 0.1630  0.1727  -0.0201 61  LEU B CG    
1990 C  CD1   . LEU B 61  ? 0.9040 0.9750 0.9571 0.1313  0.1578  -0.0078 61  LEU B CD1   
1991 C  CD2   . LEU B 61  ? 0.9754 1.0703 1.0377 0.1964  0.1738  -0.0169 61  LEU B CD2   
1992 N  N     . VAL B 62  ? 1.0002 1.0200 0.9586 0.1501  0.2149  -0.0772 62  VAL B N     
1993 C  CA    . VAL B 62  ? 1.0261 1.0675 0.9675 0.1483  0.2297  -0.0937 62  VAL B CA    
1994 C  C     . VAL B 62  ? 1.1590 1.1569 1.0738 0.1801  0.2455  -0.1138 62  VAL B C     
1995 O  O     . VAL B 62  ? 1.1749 1.2079 1.0933 0.2035  0.2618  -0.1259 62  VAL B O     
1996 C  CB    . VAL B 62  ? 1.0686 1.1004 0.9860 0.1091  0.2231  -0.0953 62  VAL B CB    
1997 C  CG1   . VAL B 62  ? 1.1003 1.1507 0.9925 0.1078  0.2397  -0.1125 62  VAL B CG1   
1998 C  CG2   . VAL B 62  ? 1.0076 1.0781 0.9497 0.0822  0.2077  -0.0750 62  VAL B CG2   
1999 N  N     . ALA B 63  ? 1.1634 1.0852 1.0527 0.1812  0.2414  -0.1175 63  ALA B N     
2000 C  CA    . ALA B 63  ? 1.2398 1.1011 1.0977 0.2095  0.2546  -0.1360 63  ALA B CA    
2001 C  C     . ALA B 63  ? 1.3186 1.1919 1.1953 0.2572  0.2620  -0.1332 63  ALA B C     
2002 O  O     . ALA B 63  ? 1.3660 1.2333 1.2292 0.2891  0.2781  -0.1511 63  ALA B O     
2003 C  CB    . ALA B 63  ? 1.2808 1.0591 1.1109 0.1926  0.2466  -0.1365 63  ALA B CB    
2004 N  N     . GLU B 64  ? 1.2424 1.1346 1.1494 0.2638  0.2496  -0.1115 64  GLU B N     
2005 C  CA    . GLU B 64  ? 1.2548 1.1635 1.1817 0.3087  0.2514  -0.1051 64  GLU B CA    
2006 C  C     . GLU B 64  ? 1.3053 1.3011 1.2633 0.3313  0.2615  -0.1125 64  GLU B C     
2007 O  O     . GLU B 64  ? 1.3363 1.3367 1.2981 0.3764  0.2704  -0.1199 64  GLU B O     
2008 C  CB    . GLU B 64  ? 1.2301 1.1449 1.1794 0.3042  0.2339  -0.0803 64  GLU B CB    
2009 C  CG    . GLU B 64  ? 1.3976 1.2240 1.3168 0.2967  0.2282  -0.0724 64  GLU B CG    
2010 C  CD    . GLU B 64  ? 1.7054 1.5338 1.6408 0.2957  0.2137  -0.0486 64  GLU B CD    
2011 O  OE1   . GLU B 64  ? 1.5967 1.4865 1.5639 0.2767  0.2026  -0.0376 64  GLU B OE1   
2012 O  OE2   . GLU B 64  ? 1.7290 1.4915 1.6408 0.3125  0.2139  -0.0412 64  GLU B OE2   
2013 N  N     . LYS B 65  ? 1.2307 1.2950 1.2108 0.3006  0.2607  -0.1104 65  LYS B N     
2014 C  CA    . LYS B 65  ? 1.2243 1.3779 1.2359 0.3131  0.2722  -0.1171 65  LYS B CA    
2015 C  C     . LYS B 65  ? 1.3777 1.5222 1.3642 0.3352  0.2948  -0.1425 65  LYS B C     
2016 O  O     . LYS B 65  ? 1.3949 1.5824 1.4004 0.3745  0.3070  -0.1523 65  LYS B O     
2017 C  CB    . LYS B 65  ? 1.1958 1.4086 1.2269 0.2687  0.2672  -0.1079 65  LYS B CB    
2018 C  CG    . LYS B 65  ? 1.3247 1.5751 1.3930 0.2566  0.2485  -0.0864 65  LYS B CG    
2019 C  CD    . LYS B 65  ? 1.3923 1.6797 1.4703 0.2102  0.2425  -0.0770 65  LYS B CD    
2020 C  CE    . LYS B 65  ? 1.4380 1.7476 1.5454 0.1957  0.2229  -0.0576 65  LYS B CE    
2021 N  NZ    . LYS B 65  ? 1.4805 1.8163 1.5929 0.1521  0.2172  -0.0487 65  LYS B NZ    
2022 N  N     . ASN B 66  ? 1.4035 1.4883 1.3455 0.3116  0.2990  -0.1542 66  ASN B N     
2023 C  CA    . ASN B 66  ? 1.4844 1.5430 1.3897 0.3251  0.3191  -0.1808 66  ASN B CA    
2024 C  C     . ASN B 66  ? 1.6422 1.6368 1.5271 0.3731  0.3264  -0.1936 66  ASN B C     
2025 O  O     . ASN B 66  ? 1.6851 1.6904 1.5607 0.4061  0.3458  -0.2149 66  ASN B O     
2026 C  CB    . ASN B 66  ? 1.5140 1.5198 1.3755 0.2834  0.3156  -0.1880 66  ASN B CB    
2027 C  CG    . ASN B 66  ? 1.7471 1.8036 1.6174 0.2380  0.3088  -0.1767 66  ASN B CG    
2028 O  OD1   . ASN B 66  ? 1.6470 1.7832 1.5509 0.2338  0.3129  -0.1682 66  ASN B OD1   
2029 N  ND2   . ASN B 66  ? 1.6404 1.6506 1.4782 0.2027  0.2986  -0.1776 66  ASN B ND2   
2030 N  N     . TYR B 67  ? 1.6397 1.5649 1.5146 0.3770  0.3121  -0.1806 67  TYR B N     
2031 C  CA    . TYR B 67  ? 1.7254 1.5763 1.5753 0.4207  0.3174  -0.1887 67  TYR B CA    
2032 C  C     . TYR B 67  ? 1.7996 1.7017 1.6843 0.4747  0.3208  -0.1846 67  TYR B C     
2033 O  O     . TYR B 67  ? 1.8579 1.7406 1.7278 0.5196  0.3357  -0.2030 67  TYR B O     
2034 C  CB    . TYR B 67  ? 1.7645 1.5221 1.5883 0.4041  0.3031  -0.1752 67  TYR B CB    
2035 C  CG    . TYR B 67  ? 1.8923 1.5533 1.6756 0.4414  0.3115  -0.1867 67  TYR B CG    
2036 C  CD1   . TYR B 67  ? 1.9944 1.5933 1.7319 0.4421  0.3257  -0.2144 67  TYR B CD1   
2037 C  CD2   . TYR B 67  ? 1.9272 1.5576 1.7148 0.4785  0.3054  -0.1704 67  TYR B CD2   
2038 C  CE1   . TYR B 67  ? 2.1060 1.6099 1.8034 0.4779  0.3341  -0.2263 67  TYR B CE1   
2039 C  CE2   . TYR B 67  ? 2.0365 1.5716 1.7829 0.5155  0.3134  -0.1795 67  TYR B CE2   
2040 C  CZ    . TYR B 67  ? 2.2167 1.6866 1.9184 0.5147  0.3281  -0.2079 67  TYR B CZ    
2041 O  OH    . TYR B 67  ? 2.3404 1.7083 1.9980 0.5509  0.3364  -0.2180 67  TYR B OH    
2042 N  N     . ASP B 68  ? 1.7059 1.6778 1.6372 0.4711  0.3068  -0.1624 68  ASP B N     
2043 C  CA    . ASP B 68  ? 1.7051 1.7410 1.6762 0.5183  0.3056  -0.1570 68  ASP B CA    
2044 C  C     . ASP B 68  ? 1.7707 1.9019 1.7718 0.5370  0.3239  -0.1754 68  ASP B C     
2045 O  O     . ASP B 68  ? 1.7573 1.9610 1.7998 0.5732  0.3232  -0.1731 68  ASP B O     
2046 C  CB    . ASP B 68  ? 1.6578 1.7417 1.6675 0.5022  0.2840  -0.1301 68  ASP B CB    
2047 C  CG    . ASP B 68  ? 1.7876 1.7898 1.7729 0.4897  0.2674  -0.1103 68  ASP B CG    
2048 O  OD1   . ASP B 68  ? 1.8630 1.7678 1.8039 0.5035  0.2717  -0.1149 68  ASP B OD1   
2049 O  OD2   . ASP B 68  ? 1.7950 1.8298 1.8043 0.4649  0.2510  -0.0909 68  ASP B OD2   
2050 N  N     . GLN B 69  ? 1.7522 1.8849 1.7315 0.5125  0.3404  -0.1942 69  GLN B N     
2051 C  CA    . GLN B 69  ? 1.7574 1.9743 1.7562 0.5220  0.3621  -0.2132 69  GLN B CA    
2052 C  C     . GLN B 69  ? 1.7542 2.0939 1.8142 0.5068  0.3589  -0.2010 69  GLN B C     
2053 O  O     . GLN B 69  ? 1.7540 2.1787 1.8477 0.5336  0.3744  -0.2130 69  GLN B O     
2054 C  CB    . GLN B 69  ? 1.8505 2.0507 1.8357 0.5834  0.3811  -0.2376 69  GLN B CB    
2055 C  CG    . GLN B 69  ? 2.0677 2.1649 1.9874 0.5824  0.3933  -0.2596 69  GLN B CG    
2056 C  CD    . GLN B 69  ? 2.3614 2.4404 2.2660 0.6444  0.4132  -0.2856 69  GLN B CD    
2057 O  OE1   . GLN B 69  ? 2.3555 2.3649 2.2436 0.6875  0.4080  -0.2848 69  GLN B OE1   
2058 N  NE2   . GLN B 69  ? 2.2655 2.4034 2.1721 0.6510  0.4374  -0.3094 69  GLN B NE2   
2059 N  N     . ILE B 70  ? 1.8378 1.7985 1.6791 -0.3339 0.5260  0.1812  70  ILE B N     
2060 C  CA    . ILE B 70  ? 1.7705 1.7900 1.5967 -0.2911 0.5038  0.1720  70  ILE B CA    
2061 C  C     . ILE B 70  ? 1.7615 1.8166 1.6286 -0.2869 0.4727  0.1304  70  ILE B C     
2062 O  O     . ILE B 70  ? 1.7282 1.8279 1.6448 -0.3165 0.4736  0.1058  70  ILE B O     
2063 C  CB    . ILE B 70  ? 1.7930 1.8906 1.6202 -0.2916 0.5204  0.1793  70  ILE B CB    
2064 C  CG1   . ILE B 70  ? 1.8848 1.9505 1.6694 -0.3002 0.5556  0.2246  70  ILE B CG1   
2065 C  CG2   . ILE B 70  ? 1.7370 1.8859 1.5495 -0.2471 0.4944  0.1653  70  ILE B CG2   
2066 C  CD1   . ILE B 70  ? 1.9657 2.1120 1.7606 -0.3158 0.5823  0.2318  70  ILE B CD1   
2067 N  N     . SER B 71  ? 1.7042 1.7413 1.5500 -0.2508 0.4459  0.1243  71  SER B N     
2068 C  CA    . SER B 71  ? 1.6472 1.7086 1.5201 -0.2418 0.4163  0.0926  71  SER B CA    
2069 C  C     . SER B 71  ? 1.7315 1.7478 1.6245 -0.2648 0.4156  0.0767  71  SER B C     
2070 O  O     . SER B 71  ? 1.7356 1.7657 1.6661 -0.3020 0.4268  0.0623  71  SER B O     
2071 C  CB    . SER B 71  ? 1.6281 1.7740 1.5393 -0.2450 0.4043  0.0694  71  SER B CB    
2072 O  OG    . SER B 71  ? 1.6893 1.8565 1.6222 -0.2367 0.3770  0.0448  71  SER B OG    
2073 N  N     . SER B 72  ? 1.7070 1.6720 1.5752 -0.2412 0.4021  0.0769  72  SER B N     
2074 C  CA    . SER B 72  ? 1.7369 1.6526 1.6159 -0.2526 0.3978  0.0585  72  SER B CA    
2075 C  C     . SER B 72  ? 1.7212 1.6939 1.6432 -0.2642 0.3786  0.0202  72  SER B C     
2076 O  O     . SER B 72  ? 1.6503 1.6935 1.5879 -0.2557 0.3650  0.0122  72  SER B O     
2077 C  CB    . SER B 72  ? 1.8090 1.6697 1.6479 -0.2146 0.3863  0.0674  72  SER B CB    
2078 O  OG    . SER B 72  ? 1.8357 1.7487 1.6717 -0.1835 0.3619  0.0578  72  SER B OG    
2079 N  N     . ILE B 73  ? 1.7004 1.6398 1.6393 -0.2813 0.3762  -0.0038 73  ILE B N     
2080 C  CA    . ILE B 73  ? 1.6479 1.6395 1.6223 -0.2900 0.3573  -0.0417 73  ILE B CA    
2081 C  C     . ILE B 73  ? 1.6147 1.6408 1.5732 -0.2514 0.3327  -0.0461 73  ILE B C     
2082 O  O     . ILE B 73  ? 1.5447 1.6415 1.5248 -0.2501 0.3174  -0.0596 73  ILE B O     
2083 C  CB    . ILE B 73  ? 1.7498 1.6939 1.7432 -0.3170 0.3606  -0.0696 73  ILE B CB    
2084 C  CG1   . ILE B 73  ? 1.7970 1.7330 1.8213 -0.3656 0.3842  -0.0681 73  ILE B CG1   
2085 C  CG2   . ILE B 73  ? 1.7189 1.7160 1.7375 -0.3151 0.3372  -0.1108 73  ILE B CG2   
2086 C  CD1   . ILE B 73  ? 1.9794 1.8254 2.0080 -0.3943 0.3972  -0.0769 73  ILE B CD1   
2087 N  N     . GLU B 74  ? 1.5803 1.5593 1.5007 -0.2198 0.3298  -0.0310 74  GLU B N     
2088 C  CA    . GLU B 74  ? 1.5273 1.5380 1.4316 -0.1842 0.3096  -0.0313 74  GLU B CA    
2089 C  C     . GLU B 74  ? 1.4791 1.5537 1.3884 -0.1766 0.3012  -0.0176 74  GLU B C     
2090 O  O     . GLU B 74  ? 1.4247 1.5524 1.3443 -0.1665 0.2831  -0.0267 74  GLU B O     
2091 C  CB    . GLU B 74  ? 1.5930 1.5441 1.4565 -0.1519 0.3113  -0.0138 74  GLU B CB    
2092 C  CG    . GLU B 74  ? 1.8101 1.6970 1.6651 -0.1466 0.3122  -0.0315 74  GLU B CG    
2093 C  CD    . GLU B 74  ? 2.2007 1.9997 2.0474 -0.1668 0.3330  -0.0212 74  GLU B CD    
2094 O  OE1   . GLU B 74  ? 2.1868 1.9621 2.0165 -0.1718 0.3491  0.0115  74  GLU B OE1   
2095 O  OE2   . GLU B 74  ? 2.1729 1.9243 2.0281 -0.1766 0.3330  -0.0456 74  GLU B OE2   
2096 N  N     . GLU B 75  ? 1.4137 1.4812 1.3150 -0.1817 0.3149  0.0042  75  GLU B N     
2097 C  CA    . GLU B 75  ? 1.3503 1.4672 1.2544 -0.1738 0.3087  0.0151  75  GLU B CA    
2098 C  C     . GLU B 75  ? 1.3052 1.4840 1.2484 -0.1923 0.3009  -0.0024 75  GLU B C     
2099 O  O     . GLU B 75  ? 1.2501 1.4716 1.1996 -0.1808 0.2867  -0.0002 75  GLU B O     
2100 C  CB    . GLU B 75  ? 1.4058 1.4978 1.2886 -0.1746 0.3285  0.0389  75  GLU B CB    
2101 C  CG    . GLU B 75  ? 1.5264 1.6530 1.3967 -0.1540 0.3204  0.0506  75  GLU B CG    
2102 C  CD    . GLU B 75  ? 1.7873 1.9084 1.6409 -0.1572 0.3408  0.0689  75  GLU B CD    
2103 O  OE1   . GLU B 75  ? 1.8047 1.8749 1.6255 -0.1523 0.3569  0.0898  75  GLU B OE1   
2104 O  OE2   . GLU B 75  ? 1.6285 1.7974 1.4999 -0.1621 0.3406  0.0631  75  GLU B OE2   
2105 N  N     . GLN B 76  ? 1.2486 1.4308 1.2187 -0.2201 0.3089  -0.0203 76  GLN B N     
2106 C  CA    . GLN B 76  ? 1.1963 1.4406 1.2049 -0.2367 0.3014  -0.0391 76  GLN B CA    
2107 C  C     . GLN B 76  ? 1.1780 1.4584 1.1988 -0.2299 0.2788  -0.0582 76  GLN B C     
2108 O  O     . GLN B 76  ? 1.1346 1.4709 1.1765 -0.2291 0.2654  -0.0649 76  GLN B O     
2109 C  CB    . GLN B 76  ? 1.2487 1.4898 1.2838 -0.2720 0.3205  -0.0510 76  GLN B CB    
2110 C  CG    . GLN B 76  ? 1.5038 1.7306 1.5314 -0.2818 0.3447  -0.0296 76  GLN B CG    
2111 C  CD    . GLN B 76  ? 1.8425 2.0296 1.8802 -0.3170 0.3697  -0.0296 76  GLN B CD    
2112 O  OE1   . GLN B 76  ? 1.8214 1.9807 1.8722 -0.3350 0.3684  -0.0486 76  GLN B OE1   
2113 N  NE2   . GLN B 76  ? 1.7754 1.9579 1.8066 -0.3282 0.3935  -0.0082 76  GLN B NE2   
2114 N  N     . GLU B 77  ? 1.1246 1.3743 1.1298 -0.2222 0.2748  -0.0662 77  GLU B N     
2115 C  CA    . GLU B 77  ? 1.0863 1.3702 1.0963 -0.2139 0.2563  -0.0844 77  GLU B CA    
2116 C  C     . GLU B 77  ? 1.0530 1.3575 1.0437 -0.1865 0.2413  -0.0674 77  GLU B C     
2117 O  O     . GLU B 77  ? 1.0358 1.3712 1.0249 -0.1772 0.2282  -0.0768 77  GLU B O     
2118 C  CB    . GLU B 77  ? 1.1551 1.3955 1.1569 -0.2168 0.2607  -0.1048 77  GLU B CB    
2119 C  CG    . GLU B 77  ? 1.3503 1.5672 1.3754 -0.2489 0.2732  -0.1266 77  GLU B CG    
2120 C  CD    . GLU B 77  ? 1.6659 1.8251 1.6824 -0.2512 0.2764  -0.1486 77  GLU B CD    
2121 O  OE1   . GLU B 77  ? 1.5506 1.6654 1.5358 -0.2253 0.2762  -0.1387 77  GLU B OE1   
2122 O  OE2   . GLU B 77  ? 1.6104 1.7708 1.6530 -0.2776 0.2774  -0.1786 77  GLU B OE2   
2123 N  N     . PHE B 78  ? 0.9552 1.2474 0.9324 -0.1752 0.2436  -0.0435 78  PHE B N     
2124 C  CA    . PHE B 78  ? 0.9135 1.2180 0.8750 -0.1536 0.2316  -0.0267 78  PHE B CA    
2125 C  C     . PHE B 78  ? 0.9132 1.2617 0.8898 -0.1529 0.2170  -0.0177 78  PHE B C     
2126 O  O     . PHE B 78  ? 0.9083 1.2611 0.8967 -0.1595 0.2202  -0.0156 78  PHE B O     
2127 C  CB    . PHE B 78  ? 0.9495 1.2084 0.8851 -0.1405 0.2419  -0.0099 78  PHE B CB    
2128 C  CG    . PHE B 78  ? 0.9457 1.2154 0.8657 -0.1188 0.2303  0.0039  78  PHE B CG    
2129 C  CD1   . PHE B 78  ? 0.9986 1.2645 0.9040 -0.1023 0.2266  0.0016  78  PHE B CD1   
2130 C  CD2   . PHE B 78  ? 0.9401 1.2266 0.8622 -0.1146 0.2224  0.0164  78  PHE B CD2   
2131 C  CE1   . PHE B 78  ? 0.9912 1.2769 0.8873 -0.0846 0.2161  0.0130  78  PHE B CE1   
2132 C  CE2   . PHE B 78  ? 0.9628 1.2618 0.8752 -0.0987 0.2107  0.0264  78  PHE B CE2   
2133 C  CZ    . PHE B 78  ? 0.9501 1.2520 0.8510 -0.0852 0.2081  0.0254  78  PHE B CZ    
2134 N  N     . ILE B 79  ? 0.8233 1.2046 0.7996 -0.1445 0.2013  -0.0120 79  ILE B N     
2135 C  CA    . ILE B 79  ? 0.7824 1.1951 0.7711 -0.1436 0.1858  0.0005  79  ILE B CA    
2136 C  C     . ILE B 79  ? 0.8145 1.2102 0.7930 -0.1333 0.1818  0.0169  79  ILE B C     
2137 O  O     . ILE B 79  ? 0.8199 1.2131 0.7849 -0.1244 0.1803  0.0235  79  ILE B O     
2138 C  CB    . ILE B 79  ? 0.8037 1.2618 0.7984 -0.1441 0.1720  0.0025  79  ILE B CB    
2139 C  CG1   . ILE B 79  ? 0.8125 1.2956 0.8171 -0.1528 0.1733  -0.0193 79  ILE B CG1   
2140 C  CG2   . ILE B 79  ? 0.7946 1.2717 0.7988 -0.1429 0.1555  0.0223  79  ILE B CG2   
2141 C  CD1   . ILE B 79  ? 0.9239 1.4051 0.9477 -0.1651 0.1796  -0.0358 79  ILE B CD1   
2142 N  N     . GLY B 80  ? 0.7527 1.1414 0.7389 -0.1333 0.1797  0.0199  80  GLY B N     
2143 C  CA    . GLY B 80  ? 0.7479 1.1214 0.7258 -0.1235 0.1743  0.0293  80  GLY B CA    
2144 C  C     . GLY B 80  ? 0.8039 1.1475 0.7640 -0.1174 0.1903  0.0268  80  GLY B C     
2145 O  O     . GLY B 80  ? 0.8288 1.1599 0.7868 -0.1245 0.2068  0.0200  80  GLY B O     
2146 N  N     . ASP B 81  ? 0.7361 1.0697 0.6834 -0.1054 0.1853  0.0326  81  ASP B N     
2147 C  CA    . ASP B 81  ? 0.7469 1.0566 0.6705 -0.0953 0.1989  0.0341  81  ASP B CA    
2148 C  C     . ASP B 81  ? 0.7675 1.0677 0.6694 -0.0814 0.1966  0.0412  81  ASP B C     
2149 O  O     . ASP B 81  ? 0.7451 1.0628 0.6521 -0.0765 0.1800  0.0431  81  ASP B O     
2150 C  CB    . ASP B 81  ? 0.7785 1.0933 0.7033 -0.0878 0.1930  0.0301  81  ASP B CB    
2151 C  CG    . ASP B 81  ? 0.9897 1.3183 0.9350 -0.0960 0.1972  0.0211  81  ASP B CG    
2152 O  OD1   . ASP B 81  ? 1.0769 1.4224 1.0465 -0.1034 0.1850  0.0179  81  ASP B OD1   
2153 O  OD2   . ASP B 81  ? 1.0254 1.3527 0.9622 -0.0936 0.2129  0.0181  81  ASP B OD2   
2154 N  N     . LEU B 82  ? 0.7248 0.9977 0.6045 -0.0755 0.2125  0.0451  82  LEU B N     
2155 C  CA    . LEU B 82  ? 0.7192 0.9835 0.5764 -0.0562 0.2101  0.0512  82  LEU B CA    
2156 C  C     . LEU B 82  ? 0.7612 1.0223 0.5959 -0.0386 0.2076  0.0570  82  LEU B C     
2157 O  O     . LEU B 82  ? 0.7825 1.0226 0.5988 -0.0359 0.2219  0.0621  82  LEU B O     
2158 C  CB    . LEU B 82  ? 0.7456 0.9730 0.5856 -0.0525 0.2262  0.0529  82  LEU B CB    
2159 C  CG    . LEU B 82  ? 0.8007 1.0210 0.6211 -0.0289 0.2223  0.0559  82  LEU B CG    
2160 C  CD1   . LEU B 82  ? 0.7642 1.0319 0.6053 -0.0288 0.2059  0.0487  82  LEU B CD1   
2161 C  CD2   . LEU B 82  ? 0.8489 1.0207 0.6536 -0.0257 0.2376  0.0553  82  LEU B CD2   
2162 N  N     . ILE B 83  ? 0.6726 0.9606 0.5099 -0.0279 0.1894  0.0554  83  ILE B N     
2163 C  CA    . ILE B 83  ? 0.6685 0.9644 0.4881 -0.0107 0.1813  0.0552  83  ILE B CA    
2164 C  C     . ILE B 83  ? 0.7391 1.0274 0.5259 0.0164  0.1834  0.0633  83  ILE B C     
2165 O  O     . ILE B 83  ? 0.7622 1.0355 0.5171 0.0334  0.1904  0.0699  83  ILE B O     
2166 C  CB    . ILE B 83  ? 0.6715 1.0011 0.5196 -0.0198 0.1579  0.0448  83  ILE B CB    
2167 C  CG1   . ILE B 83  ? 0.6642 0.9893 0.5242 -0.0294 0.1563  0.0364  83  ILE B CG1   
2168 C  CG2   . ILE B 83  ? 0.6928 1.0465 0.5320 -0.0030 0.1415  0.0400  83  ILE B CG2   
2169 C  CD1   . ILE B 83  ? 0.7177 1.0341 0.5960 -0.0470 0.1658  0.0369  83  ILE B CD1   
2170 N  N     . GLN B 84  ? 0.6906 0.9928 0.4834 0.0231  0.1773  0.0631  84  GLN B N     
2171 C  CA    . GLN B 84  ? 0.7236 1.0252 0.4889 0.0538  0.1756  0.0686  84  GLN B CA    
2172 C  C     . GLN B 84  ? 0.7905 1.0883 0.5605 0.0592  0.1796  0.0677  84  GLN B C     
2173 O  O     . GLN B 84  ? 0.7541 1.0804 0.5547 0.0410  0.1744  0.0600  84  GLN B O     
2174 C  CB    . GLN B 84  ? 0.7279 1.0799 0.5009 0.0641  0.1536  0.0605  84  GLN B CB    
2175 C  CG    . GLN B 84  ? 1.0128 1.3888 0.7694 0.0959  0.1449  0.0614  84  GLN B CG    
2176 C  CD    . GLN B 84  ? 1.2501 1.6889 1.0346 0.0904  0.1216  0.0480  84  GLN B CD    
2177 O  OE1   . GLN B 84  ? 1.1273 1.5791 0.9061 0.0939  0.1104  0.0409  84  GLN B OE1   
2178 N  NE2   . GLN B 84  ? 1.1857 1.6668 1.0030 0.0789  0.1141  0.0429  84  GLN B NE2   
2179 N  N     . VAL B 85  ? 0.8057 1.0661 0.5427 0.0861  0.1889  0.0760  85  VAL B N     
2180 C  CA    . VAL B 85  ? 0.8286 1.0769 0.5638 0.0998  0.1923  0.0717  85  VAL B CA    
2181 C  C     . VAL B 85  ? 0.9445 1.1859 0.6478 0.1431  0.1877  0.0778  85  VAL B C     
2182 O  O     . VAL B 85  ? 0.9951 1.1936 0.6614 0.1618  0.1947  0.0937  85  VAL B O     
2183 C  CB    . VAL B 85  ? 0.9022 1.0906 0.6345 0.0835  0.2110  0.0718  85  VAL B CB    
2184 C  CG1   . VAL B 85  ? 0.9453 1.1021 0.6635 0.1075  0.2146  0.0663  85  VAL B CG1   
2185 C  CG2   . VAL B 85  ? 0.8510 1.0650 0.6202 0.0477  0.2107  0.0601  85  VAL B CG2   
2186 N  N     . ASN B 86  ? 0.8936 1.1814 0.6106 0.1606  0.1763  0.0662  86  ASN B N     
2187 C  CA    . ASN B 86  ? 0.9403 1.2305 0.6328 0.2066  0.1699  0.0673  86  ASN B CA    
2188 C  C     . ASN B 86  ? 1.0223 1.2903 0.7199 0.2135  0.1769  0.0552  86  ASN B C     
2189 O  O     . ASN B 86  ? 0.9795 1.3067 0.7096 0.2019  0.1712  0.0393  86  ASN B O     
2190 C  CB    . ASN B 86  ? 0.9188 1.2990 0.6312 0.2194  0.1496  0.0582  86  ASN B CB    
2191 C  CG    . ASN B 86  ? 1.2238 1.6169 0.9096 0.2715  0.1401  0.0595  86  ASN B CG    
2192 O  OD1   . ASN B 86  ? 1.2319 1.5652 0.8849 0.3038  0.1476  0.0662  86  ASN B OD1   
2193 N  ND2   . ASN B 86  ? 1.0676 1.5408 0.7694 0.2812  0.1217  0.0519  86  ASN B ND2   
2194 N  N     . PRO B 87  ? 1.0492 1.2301 0.7168 0.2266  0.1903  0.0621  87  PRO B N     
2195 C  CA    . PRO B 87  ? 1.0723 1.2247 0.7464 0.2296  0.1961  0.0447  87  PRO B CA    
2196 C  C     . PRO B 87  ? 1.1247 1.3419 0.8130 0.2590  0.1839  0.0240  87  PRO B C     
2197 O  O     . PRO B 87  ? 1.1627 1.4009 0.8349 0.3013  0.1738  0.0262  87  PRO B O     
2198 C  CB    . PRO B 87  ? 1.1814 1.2268 0.8161 0.2477  0.2086  0.0586  87  PRO B CB    
2199 C  CG    . PRO B 87  ? 1.2455 1.2642 0.8632 0.2298  0.2170  0.0843  87  PRO B CG    
2200 C  CD    . PRO B 87  ? 1.1351 1.2382 0.7620 0.2359  0.2016  0.0863  87  PRO B CD    
2201 N  N     . ASN B 88  ? 1.0237 1.2830 0.7428 0.2366  0.1846  0.0040  88  ASN B N     
2202 C  CA    . ASN B 88  ? 1.0002 1.3343 0.7373 0.2571  0.1766  -0.0178 88  ASN B CA    
2203 C  C     . ASN B 88  ? 1.0126 1.4479 0.7694 0.2645  0.1631  -0.0141 88  ASN B C     
2204 O  O     . ASN B 88  ? 1.0200 1.5221 0.7870 0.2924  0.1563  -0.0293 88  ASN B O     
2205 C  CB    . ASN B 88  ? 1.0583 1.3433 0.7706 0.3047  0.1770  -0.0335 88  ASN B CB    
2206 C  CG    . ASN B 88  ? 1.2985 1.4692 0.9900 0.2968  0.1892  -0.0350 88  ASN B CG    
2207 O  OD1   . ASN B 88  ? 1.1833 1.3424 0.8910 0.2643  0.1962  -0.0492 88  ASN B OD1   
2208 N  ND2   . ASN B 88  ? 1.2497 1.3344 0.9051 0.3256  0.1918  -0.0194 88  ASN B ND2   
2209 N  N     . VAL B 89  ? 0.9276 1.3787 0.6927 0.2385  0.1590  0.0031  89  VAL B N     
2210 C  CA    . VAL B 89  ? 0.8902 1.4314 0.6779 0.2378  0.1449  0.0051  89  VAL B CA    
2211 C  C     . VAL B 89  ? 0.8960 1.4780 0.7186 0.1855  0.1432  0.0107  89  VAL B C     
2212 O  O     . VAL B 89  ? 0.8650 1.5180 0.7186 0.1681  0.1413  0.0044  89  VAL B O     
2213 C  CB    . VAL B 89  ? 0.9681 1.4970 0.7301 0.2683  0.1355  0.0161  89  VAL B CB    
2214 C  CG1   . VAL B 89  ? 0.9292 1.5595 0.7204 0.2665  0.1186  0.0116  89  VAL B CG1   
2215 C  CG2   . VAL B 89  ? 1.0386 1.5194 0.7625 0.3237  0.1362  0.0150  89  VAL B CG2   
2216 N  N     . LYS B 90  ? 0.8449 1.3829 0.6609 0.1628  0.1439  0.0235  90  LYS B N     
2217 C  CA    . LYS B 90  ? 0.7940 1.3551 0.6390 0.1183  0.1401  0.0290  90  LYS B CA    
2218 C  C     . LYS B 90  ? 0.8587 1.3442 0.6881 0.0997  0.1494  0.0376  90  LYS B C     
2219 O  O     . LYS B 90  ? 0.9089 1.3402 0.7060 0.1192  0.1544  0.0441  90  LYS B O     
2220 C  CB    . LYS B 90  ? 0.8077 1.4277 0.6706 0.1153  0.1232  0.0296  90  LYS B CB    
2221 C  CG    . LYS B 90  ? 0.9389 1.5802 0.8348 0.0706  0.1161  0.0340  90  LYS B CG    
2222 C  CD    . LYS B 90  ? 1.1091 1.7795 1.0141 0.0692  0.0991  0.0308  90  LYS B CD    
2223 C  CE    . LYS B 90  ? 1.3499 2.0076 1.2773 0.0302  0.0923  0.0337  90  LYS B CE    
2224 N  NZ    . LYS B 90  ? 1.5590 2.2365 1.4918 0.0315  0.0743  0.0247  90  LYS B NZ    
2225 N  N     . ALA B 91  ? 0.7621 1.2488 0.6141 0.0631  0.1519  0.0393  91  ALA B N     
2226 C  CA    . ALA B 91  ? 0.7498 1.1807 0.5950 0.0434  0.1599  0.0448  91  ALA B CA    
2227 C  C     . ALA B 91  ? 0.7424 1.1980 0.6176 0.0095  0.1514  0.0479  91  ALA B C     
2228 O  O     . ALA B 91  ? 0.7033 1.2095 0.6046 -0.0054 0.1441  0.0483  91  ALA B O     
2229 C  CB    . ALA B 91  ? 0.7755 1.1628 0.6118 0.0403  0.1748  0.0401  91  ALA B CB    
2230 N  N     . GLN B 92  ? 0.7006 1.1208 0.5715 -0.0017 0.1529  0.0510  92  GLN B N     
2231 C  CA    . GLN B 92  ? 0.6705 1.1014 0.5670 -0.0289 0.1438  0.0526  92  GLN B CA    
2232 C  C     . GLN B 92  ? 0.7309 1.1196 0.6235 -0.0402 0.1538  0.0525  92  GLN B C     
2233 O  O     . GLN B 92  ? 0.7475 1.1015 0.6172 -0.0291 0.1634  0.0526  92  GLN B O     
2234 C  CB    . GLN B 92  ? 0.6861 1.1371 0.5903 -0.0283 0.1272  0.0501  92  GLN B CB    
2235 C  CG    . GLN B 92  ? 0.7953 1.2455 0.7255 -0.0539 0.1156  0.0499  92  GLN B CG    
2236 C  CD    . GLN B 92  ? 0.9138 1.3738 0.8506 -0.0532 0.0982  0.0413  92  GLN B CD    
2237 O  OE1   . GLN B 92  ? 0.7891 1.2222 0.7192 -0.0513 0.0954  0.0340  92  GLN B OE1   
2238 N  NE2   . GLN B 92  ? 0.8158 1.3199 0.7699 -0.0566 0.0852  0.0394  92  GLN B NE2   
2239 N  N     . SER B 93  ? 0.6709 1.0688 0.5860 -0.0619 0.1518  0.0537  93  SER B N     
2240 C  CA    . SER B 93  ? 0.6649 1.0387 0.5853 -0.0741 0.1578  0.0516  93  SER B CA    
2241 C  C     . SER B 93  ? 0.6961 1.0816 0.6404 -0.0889 0.1422  0.0541  93  SER B C     
2242 O  O     . SER B 93  ? 0.6824 1.0942 0.6432 -0.0979 0.1291  0.0607  93  SER B O     
2243 C  CB    . SER B 93  ? 0.7176 1.0904 0.6411 -0.0818 0.1682  0.0482  93  SER B CB    
2244 O  OG    . SER B 93  ? 0.8197 1.2277 0.7630 -0.0949 0.1592  0.0521  93  SER B OG    
2245 N  N     . ILE B 94  ? 0.6551 1.0205 0.6019 -0.0914 0.1442  0.0493  94  ILE B N     
2246 C  CA    . ILE B 94  ? 0.6460 1.0115 0.6130 -0.0996 0.1288  0.0488  94  ILE B CA    
2247 C  C     . ILE B 94  ? 0.6929 1.0599 0.6738 -0.1087 0.1310  0.0492  94  ILE B C     
2248 O  O     . ILE B 94  ? 0.6933 1.0569 0.6676 -0.1084 0.1465  0.0438  94  ILE B O     
2249 C  CB    . ILE B 94  ? 0.7010 1.0498 0.6570 -0.0867 0.1265  0.0380  94  ILE B CB    
2250 C  CG1   . ILE B 94  ? 0.7268 1.0822 0.6910 -0.0868 0.1067  0.0355  94  ILE B CG1   
2251 C  CG2   . ILE B 94  ? 0.7015 1.0386 0.6618 -0.0840 0.1300  0.0287  94  ILE B CG2   
2252 C  CD1   . ILE B 94  ? 0.9122 1.2905 0.8709 -0.0850 0.1054  0.0413  94  ILE B CD1   
2253 N  N     . LEU B 95  ? 0.6393 1.0115 0.6400 -0.1172 0.1148  0.0562  95  LEU B N     
2254 C  CA    . LEU B 95  ? 0.6329 1.0114 0.6457 -0.1211 0.1140  0.0569  95  LEU B CA    
2255 C  C     . LEU B 95  ? 0.7262 1.0916 0.7556 -0.1200 0.0952  0.0597  95  LEU B C     
2256 O  O     . LEU B 95  ? 0.7389 1.1016 0.7780 -0.1285 0.0801  0.0745  95  LEU B O     
2257 C  CB    . LEU B 95  ? 0.6194 1.0254 0.6336 -0.1304 0.1166  0.0671  95  LEU B CB    
2258 C  CG    . LEU B 95  ? 0.6715 1.0936 0.6961 -0.1327 0.1142  0.0667  95  LEU B CG    
2259 C  CD1   . LEU B 95  ? 0.6668 1.0898 0.6898 -0.1302 0.1298  0.0475  95  LEU B CD1   
2260 C  CD2   . LEU B 95  ? 0.7105 1.1648 0.7333 -0.1401 0.1124  0.0787  95  LEU B CD2   
2261 N  N     . ASP B 96  ? 0.7121 1.0692 0.7458 -0.1091 0.0963  0.0455  96  ASP B N     
2262 C  CA    . ASP B 96  ? 0.7379 1.0789 0.7871 -0.1018 0.0772  0.0442  96  ASP B CA    
2263 C  C     . ASP B 96  ? 0.7950 1.1513 0.8559 -0.1043 0.0704  0.0564  96  ASP B C     
2264 O  O     . ASP B 96  ? 0.7854 1.1682 0.8469 -0.1037 0.0822  0.0497  96  ASP B O     
2265 C  CB    . ASP B 96  ? 0.7736 1.1084 0.8229 -0.0844 0.0806  0.0215  96  ASP B CB    
2266 C  CG    . ASP B 96  ? 0.9578 1.2709 1.0226 -0.0714 0.0583  0.0157  96  ASP B CG    
2267 O  OD1   . ASP B 96  ? 1.0704 1.3541 1.1384 -0.0737 0.0409  0.0185  96  ASP B OD1   
2268 O  OD2   . ASP B 96  ? 0.9767 1.3020 1.0527 -0.0593 0.0566  0.0080  96  ASP B OD2   
2269 N  N     . ILE B 97  ? 0.7642 1.1048 0.8339 -0.1086 0.0510  0.0754  97  ILE B N     
2270 C  CA    . ILE B 97  ? 0.7674 1.1216 0.8431 -0.1084 0.0418  0.0928  97  ILE B CA    
2271 C  C     . ILE B 97  ? 0.8487 1.1943 0.9366 -0.0873 0.0301  0.0816  97  ILE B C     
2272 O  O     . ILE B 97  ? 0.8746 1.1816 0.9706 -0.0775 0.0121  0.0822  97  ILE B O     
2273 C  CB    . ILE B 97  ? 0.8221 1.1675 0.8983 -0.1243 0.0297  0.1250  97  ILE B CB    
2274 C  CG1   . ILE B 97  ? 0.8036 1.1719 0.8703 -0.1423 0.0432  0.1318  97  ILE B CG1   
2275 C  CG2   . ILE B 97  ? 0.8444 1.2070 0.9206 -0.1213 0.0207  0.1473  97  ILE B CG2   
2276 C  CD1   . ILE B 97  ? 0.8330 1.2457 0.8870 -0.1433 0.0623  0.1247  97  ILE B CD1   
2277 N  N     . THR B 98  ? 0.7963 1.1798 0.8874 -0.0797 0.0402  0.0679  98  THR B N     
2278 C  CA    . THR B 98  ? 0.8057 1.2005 0.9113 -0.0577 0.0317  0.0536  98  THR B CA    
2279 C  C     . THR B 98  ? 0.8808 1.2907 0.9899 -0.0507 0.0153  0.0739  98  THR B C     
2280 O  O     . THR B 98  ? 0.8751 1.2934 0.9732 -0.0652 0.0147  0.0976  98  THR B O     
2281 C  CB    . THR B 98  ? 0.8671 1.3026 0.9783 -0.0570 0.0529  0.0267  98  THR B CB    
2282 O  OG1   . THR B 98  ? 0.8341 1.3041 0.9408 -0.0738 0.0657  0.0298  98  THR B OG1   
2283 C  CG2   . THR B 98  ? 0.8556 1.2758 0.9594 -0.0589 0.0687  0.0101  98  THR B CG2   
2284 N  N     . SER B 99  ? 0.8641 1.2828 0.9870 -0.0255 0.0019  0.0644  99  SER B N     
2285 C  CA    . SER B 99  ? 0.8896 1.3254 1.0146 -0.0106 -0.0166 0.0824  99  SER B CA    
2286 C  C     . SER B 99  ? 0.9307 1.4270 1.0502 -0.0225 -0.0069 0.0851  99  SER B C     
2287 O  O     . SER B 99  ? 0.9507 1.4609 1.0613 -0.0176 -0.0203 0.1095  99  SER B O     
2288 C  CB    . SER B 99  ? 0.9553 1.3997 1.0984 0.0232  -0.0306 0.0634  99  SER B CB    
2289 O  OG    . SER B 99  ? 1.0429 1.5290 1.2008 0.0257  -0.0125 0.0273  99  SER B OG    
2290 N  N     . ASP B 100 ? 0.8662 1.3952 0.9890 -0.0383 0.0160  0.0605  100 ASP B N     
2291 C  CA    . ASP B 100 ? 0.8573 1.4401 0.9778 -0.0516 0.0266  0.0529  100 ASP B CA    
2292 C  C     . ASP B 100 ? 0.9119 1.4890 1.0101 -0.0708 0.0318  0.0745  100 ASP B C     
2293 O  O     . ASP B 100 ? 0.9092 1.5307 1.0013 -0.0767 0.0341  0.0722  100 ASP B O     
2294 C  CB    . ASP B 100 ? 0.8618 1.4687 0.9956 -0.0637 0.0496  0.0191  100 ASP B CB    
2295 C  CG    . ASP B 100 ? 1.0586 1.6781 1.2153 -0.0474 0.0500  -0.0034 100 ASP B CG    
2296 O  OD1   . ASP B 100 ? 1.0776 1.7320 1.2498 -0.0267 0.0342  -0.0083 100 ASP B OD1   
2297 O  OD2   . ASP B 100 ? 1.1579 1.7570 1.3157 -0.0530 0.0660  -0.0159 100 ASP B OD2   
2298 N  N     . SER B 101 ? 0.8677 1.3970 0.9555 -0.0798 0.0330  0.0923  101 SER B N     
2299 C  CA    . SER B 101 ? 0.8568 1.3855 0.9267 -0.0977 0.0392  0.1120  101 SER B CA    
2300 C  C     . SER B 101 ? 0.9344 1.4535 0.9942 -0.0972 0.0223  0.1516  101 SER B C     
2301 O  O     . SER B 101 ? 0.9331 1.4738 0.9784 -0.1103 0.0274  0.1697  101 SER B O     
2302 C  CB    . SER B 101 ? 0.8871 1.3804 0.9541 -0.1095 0.0519  0.1060  101 SER B CB    
2303 O  OG    . SER B 101 ? 0.9735 1.4663 1.0470 -0.1083 0.0670  0.0758  101 SER B OG    
2304 N  N     . VAL B 102 ? 0.9179 1.4043 0.9850 -0.0818 0.0029  0.1658  102 VAL B N     
2305 C  CA    . VAL B 102 ? 0.9588 1.4215 1.0169 -0.0818 -0.0143 0.2082  102 VAL B CA    
2306 C  C     . VAL B 102 ? 1.0435 1.5427 1.0926 -0.0633 -0.0282 0.2252  102 VAL B C     
2307 O  O     . VAL B 102 ? 1.0356 1.5668 1.0939 -0.0438 -0.0317 0.1998  102 VAL B O     
2308 C  CB    . VAL B 102 ? 1.0408 1.4303 1.1104 -0.0767 -0.0298 0.2170  102 VAL B CB    
2309 C  CG1   . VAL B 102 ? 1.0211 1.3801 1.0955 -0.0976 -0.0195 0.2082  102 VAL B CG1   
2310 C  CG2   . VAL B 102 ? 1.0464 1.4227 1.1313 -0.0472 -0.0407 0.1901  102 VAL B CG2   
2311 N  N     . PHE B 103 ? 1.0359 1.5323 1.0673 -0.0692 -0.0367 0.2699  103 PHE B N     
2312 C  CA    . PHE B 103 ? 1.0730 1.5982 1.0893 -0.0491 -0.0527 0.2955  103 PHE B CA    
2313 C  C     . PHE B 103 ? 1.1820 1.6492 1.2098 -0.0231 -0.0757 0.3028  103 PHE B C     
2314 O  O     . PHE B 103 ? 1.2083 1.6038 1.2409 -0.0309 -0.0836 0.3234  103 PHE B O     
2315 C  CB    . PHE B 103 ? 1.1321 1.6655 1.1234 -0.0654 -0.0526 0.3471  103 PHE B CB    
2316 C  CG    . PHE B 103 ? 1.1186 1.7218 1.0936 -0.0831 -0.0331 0.3433  103 PHE B CG    
2317 C  CD1   . PHE B 103 ? 1.1431 1.8213 1.1065 -0.0692 -0.0313 0.3226  103 PHE B CD1   
2318 C  CD2   . PHE B 103 ? 1.1432 1.7416 1.1148 -0.1121 -0.0186 0.3606  103 PHE B CD2   
2319 C  CE1   . PHE B 103 ? 1.1333 1.8742 1.0803 -0.0822 -0.0151 0.3154  103 PHE B CE1   
2320 C  CE2   . PHE B 103 ? 1.1577 1.8244 1.1137 -0.1234 -0.0013 0.3551  103 PHE B CE2   
2321 C  CZ    . PHE B 103 ? 1.1180 1.8525 1.0605 -0.1074 0.0001  0.3319  103 PHE B CZ    
2322 N  N     . HIS B 104 ? 1.1608 1.6604 1.1954 0.0080  -0.0873 0.2823  104 HIS B N     
2323 C  CA    . HIS B 104 ? 1.2111 1.6670 1.2587 0.0413  -0.1098 0.2804  104 HIS B CA    
2324 C  C     . HIS B 104 ? 1.3221 1.7047 1.3565 0.0500  -0.1314 0.3312  104 HIS B C     
2325 O  O     . HIS B 104 ? 1.3498 1.6599 1.3983 0.0619  -0.1445 0.3272  104 HIS B O     
2326 C  CB    . HIS B 104 ? 1.2216 1.7453 1.2789 0.0737  -0.1184 0.2518  104 HIS B CB    
2327 C  CG    . HIS B 104 ? 1.2066 1.7957 1.2803 0.0593  -0.0964 0.2032  104 HIS B CG    
2328 N  ND1   . HIS B 104 ? 1.1945 1.7592 1.2847 0.0403  -0.0775 0.1732  104 HIS B ND1   
2329 C  CD2   . HIS B 104 ? 1.2098 1.8828 1.2842 0.0599  -0.0912 0.1820  104 HIS B CD2   
2330 C  CE1   . HIS B 104 ? 1.1426 1.7706 1.2426 0.0290  -0.0605 0.1389  104 HIS B CE1   
2331 N  NE2   . HIS B 104 ? 1.1533 1.8470 1.2468 0.0390  -0.0685 0.1401  104 HIS B NE2   
2332 N  N     . LYS B 105 ? 1.3003 1.6999 1.3069 0.0423  -0.1343 0.3786  105 LYS B N     
2333 C  CA    . LYS B 105 ? 1.3765 1.7067 1.3666 0.0453  -0.1524 0.4364  105 LYS B CA    
2334 C  C     . LYS B 105 ? 1.4325 1.6851 1.4313 0.0085  -0.1461 0.4548  105 LYS B C     
2335 O  O     . LYS B 105 ? 1.4919 1.6556 1.4993 0.0163  -0.1645 0.4699  105 LYS B O     
2336 C  CB    . LYS B 105 ? 1.4336 1.8171 1.3880 0.0442  -0.1528 0.4839  105 LYS B CB    
2337 C  CG    . LYS B 105 ? 1.6146 2.0346 1.5534 0.0904  -0.1752 0.4936  105 LYS B CG    
2338 C  CD    . LYS B 105 ? 1.8224 2.2025 1.7267 0.0999  -0.1923 0.5676  105 LYS B CD    
2339 C  CE    . LYS B 105 ? 1.9376 2.3643 1.8088 0.0687  -0.1756 0.6130  105 LYS B CE    
2340 N  NZ    . LYS B 105 ? 2.0053 2.5516 1.8565 0.0822  -0.1697 0.5943  105 LYS B NZ    
2341 N  N     . THR B 106 ? 1.3270 1.6145 1.3252 -0.0301 -0.1217 0.4504  106 THR B N     
2342 C  CA    . THR B 106 ? 1.3297 1.5655 1.3375 -0.0695 -0.1136 0.4676  106 THR B CA    
2343 C  C     . THR B 106 ? 1.3246 1.5236 1.3608 -0.0778 -0.1089 0.4204  106 THR B C     
2344 O  O     . THR B 106 ? 1.3552 1.4837 1.4050 -0.0966 -0.1159 0.4310  106 THR B O     
2345 C  CB    . THR B 106 ? 1.4060 1.7058 1.3975 -0.1033 -0.0913 0.4915  106 THR B CB    
2346 O  OG1   . THR B 106 ? 1.3194 1.6946 1.3124 -0.1026 -0.0722 0.4459  106 THR B OG1   
2347 C  CG2   . THR B 106 ? 1.4510 1.7818 1.4102 -0.0992 -0.0959 0.5474  106 THR B CG2   
2348 N  N     . GLY B 107 ? 1.2010 1.4496 1.2453 -0.0659 -0.0967 0.3699  107 GLY B N     
2349 C  CA    . GLY B 107 ? 1.1503 1.3777 1.2154 -0.0711 -0.0891 0.3251  107 GLY B CA    
2350 C  C     . GLY B 107 ? 1.1401 1.3942 1.2056 -0.1061 -0.0672 0.3200  107 GLY B C     
2351 O  O     . GLY B 107 ? 1.1124 1.3426 1.1920 -0.1147 -0.0624 0.2921  107 GLY B O     
2352 N  N     . ILE B 108 ? 1.0802 1.3893 1.1288 -0.1232 -0.0544 0.3456  108 ILE B N     
2353 C  CA    . ILE B 108 ? 1.0372 1.3847 1.0840 -0.1522 -0.0336 0.3432  108 ILE B CA    
2354 C  C     . ILE B 108 ? 1.0194 1.4345 1.0584 -0.1429 -0.0158 0.3079  108 ILE B C     
2355 O  O     . ILE B 108 ? 1.0116 1.4676 1.0390 -0.1257 -0.0176 0.3067  108 ILE B O     
2356 C  CB    . ILE B 108 ? 1.1132 1.4803 1.1471 -0.1772 -0.0306 0.3952  108 ILE B CB    
2357 C  CG1   . ILE B 108 ? 1.1940 1.4849 1.2359 -0.1885 -0.0495 0.4357  108 ILE B CG1   
2358 C  CG2   . ILE B 108 ? 1.0858 1.4979 1.1221 -0.2050 -0.0097 0.3904  108 ILE B CG2   
2359 C  CD1   . ILE B 108 ? 1.3408 1.6481 1.3633 -0.2023 -0.0504 0.4957  108 ILE B CD1   
2360 N  N     . ALA B 109 ? 0.9340 1.3594 0.9795 -0.1542 0.0001  0.2795  109 ALA B N     
2361 C  CA    . ALA B 109 ? 0.8848 1.3599 0.9241 -0.1488 0.0178  0.2459  109 ALA B CA    
2362 C  C     . ALA B 109 ? 0.9512 1.4914 0.9718 -0.1530 0.0265  0.2595  109 ALA B C     
2363 O  O     . ALA B 109 ? 0.9774 1.5332 0.9901 -0.1689 0.0279  0.2928  109 ALA B O     
2364 C  CB    . ALA B 109 ? 0.8618 1.3272 0.9074 -0.1601 0.0312  0.2235  109 ALA B CB    
2365 N  N     . ARG B 110 ? 0.8875 1.4691 0.9020 -0.1396 0.0323  0.2326  110 ARG B N     
2366 C  CA    . ARG B 110 ? 0.8855 1.5338 0.8813 -0.1394 0.0393  0.2349  110 ARG B CA    
2367 C  C     . ARG B 110 ? 0.9287 1.6013 0.9190 -0.1527 0.0576  0.2240  110 ARG B C     
2368 O  O     . ARG B 110 ? 0.9061 1.5497 0.9067 -0.1565 0.0664  0.2013  110 ARG B O     
2369 C  CB    . ARG B 110 ? 0.8788 1.5615 0.8749 -0.1228 0.0377  0.2028  110 ARG B CB    
2370 C  CG    . ARG B 110 ? 1.0403 1.7125 1.0416 -0.1047 0.0180  0.2143  110 ARG B CG    
2371 C  CD    . ARG B 110 ? 1.1592 1.8821 1.1628 -0.0893 0.0140  0.1848  110 ARG B CD    
2372 N  NE    . ARG B 110 ? 1.3092 2.0104 1.3285 -0.0701 -0.0023 0.1833  110 ARG B NE    
2373 C  CZ    . ARG B 110 ? 1.5469 2.2281 1.5899 -0.0661 0.0012  0.1512  110 ARG B CZ    
2374 N  NH1   . ARG B 110 ? 1.3984 2.0723 1.4497 -0.0816 0.0208  0.1218  110 ARG B NH1   
2375 N  NH2   . ARG B 110 ? 1.4087 2.0761 1.4659 -0.0449 -0.0143 0.1502  110 ARG B NH2   
2376 N  N     . GLY B 111 ? 0.9048 1.6326 0.8773 -0.1572 0.0626  0.2421  111 GLY B N     
2377 C  CA    . GLY B 111 ? 0.8885 1.6518 0.8545 -0.1656 0.0787  0.2342  111 GLY B CA    
2378 C  C     . GLY B 111 ? 0.8971 1.6569 0.8663 -0.1582 0.0907  0.1873  111 GLY B C     
2379 O  O     . GLY B 111 ? 0.8794 1.6227 0.8546 -0.1634 0.0999  0.1785  111 GLY B O     
2380 N  N     . HIS B 112 ? 0.8314 1.6047 0.7978 -0.1464 0.0894  0.1575  112 HIS B N     
2381 C  CA    . HIS B 112 ? 0.8024 1.5668 0.7719 -0.1416 0.1004  0.1137  112 HIS B CA    
2382 C  C     . HIS B 112 ? 0.8262 1.5271 0.8113 -0.1445 0.1049  0.1009  112 HIS B C     
2383 O  O     . HIS B 112 ? 0.8140 1.4993 0.7981 -0.1429 0.1169  0.0747  112 HIS B O     
2384 C  CB    . HIS B 112 ? 0.8143 1.6106 0.7819 -0.1335 0.0965  0.0852  112 HIS B CB    
2385 C  CG    . HIS B 112 ? 0.8610 1.6481 0.8407 -0.1295 0.0826  0.0909  112 HIS B CG    
2386 N  ND1   . HIS B 112 ? 0.9077 1.7313 0.8776 -0.1221 0.0681  0.1170  112 HIS B ND1   
2387 C  CD2   . HIS B 112 ? 0.8667 1.6170 0.8666 -0.1294 0.0816  0.0738  112 HIS B CD2   
2388 C  CE1   . HIS B 112 ? 0.9000 1.7059 0.8855 -0.1152 0.0570  0.1132  112 HIS B CE1   
2389 N  NE2   . HIS B 112 ? 0.8790 1.6446 0.8843 -0.1200 0.0654  0.0864  112 HIS B NE2   
2390 N  N     . VAL B 113 ? 0.7754 1.4390 0.7727 -0.1467 0.0951  0.1191  113 VAL B N     
2391 C  CA    . VAL B 113 ? 0.7602 1.3699 0.7699 -0.1470 0.0982  0.1078  113 VAL B CA    
2392 C  C     . VAL B 113 ? 0.8025 1.3955 0.8080 -0.1515 0.1075  0.1090  113 VAL B C     
2393 O  O     . VAL B 113 ? 0.7937 1.3639 0.7974 -0.1480 0.1187  0.0872  113 VAL B O     
2394 C  CB    . VAL B 113 ? 0.8224 1.4006 0.8447 -0.1446 0.0830  0.1251  113 VAL B CB    
2395 C  CG1   . VAL B 113 ? 0.8139 1.3451 0.8463 -0.1422 0.0865  0.1100  113 VAL B CG1   
2396 C  CG2   . VAL B 113 ? 0.8304 1.4311 0.8571 -0.1348 0.0723  0.1227  113 VAL B CG2   
2397 N  N     . LEU B 114 ? 0.7614 1.3690 0.7657 -0.1594 0.1030  0.1360  114 LEU B N     
2398 C  CA    . LEU B 114 ? 0.7493 1.3534 0.7538 -0.1636 0.1090  0.1383  114 LEU B CA    
2399 C  C     . LEU B 114 ? 0.7738 1.4100 0.7656 -0.1558 0.1226  0.1198  114 LEU B C     
2400 O  O     . LEU B 114 ? 0.7648 1.3856 0.7548 -0.1502 0.1293  0.1082  114 LEU B O     
2401 C  CB    . LEU B 114 ? 0.7656 1.3819 0.7783 -0.1789 0.1003  0.1720  114 LEU B CB    
2402 C  CG    . LEU B 114 ? 0.8407 1.4067 0.8683 -0.1855 0.0858  0.1850  114 LEU B CG    
2403 C  CD1   . LEU B 114 ? 0.8812 1.4517 0.9112 -0.1951 0.0736  0.2194  114 LEU B CD1   
2404 C  CD2   . LEU B 114 ? 0.8538 1.4006 0.8926 -0.1937 0.0840  0.1837  114 LEU B CD2   
2405 N  N     . PHE B 115 ? 0.7157 1.3966 0.6971 -0.1520 0.1253  0.1150  115 PHE B N     
2406 C  CA    . PHE B 115 ? 0.7053 1.4156 0.6739 -0.1408 0.1366  0.0917  115 PHE B CA    
2407 C  C     . PHE B 115 ? 0.7512 1.4158 0.7176 -0.1319 0.1440  0.0589  115 PHE B C     
2408 O  O     . PHE B 115 ? 0.7583 1.4128 0.7167 -0.1211 0.1529  0.0424  115 PHE B O     
2409 C  CB    . PHE B 115 ? 0.7353 1.5069 0.6919 -0.1376 0.1359  0.0905  115 PHE B CB    
2410 C  CG    . PHE B 115 ? 0.7617 1.5612 0.7051 -0.1224 0.1459  0.0595  115 PHE B CG    
2411 C  CD1   . PHE B 115 ? 0.8063 1.6476 0.7444 -0.1160 0.1525  0.0639  115 PHE B CD1   
2412 C  CD2   . PHE B 115 ? 0.7969 1.5793 0.7360 -0.1144 0.1483  0.0233  115 PHE B CD2   
2413 C  CE1   . PHE B 115 ? 0.8308 1.6947 0.7564 -0.0966 0.1603  0.0317  115 PHE B CE1   
2414 C  CE2   . PHE B 115 ? 0.8494 1.6461 0.7767 -0.0989 0.1558  -0.0086 115 PHE B CE2   
2415 C  CZ    . PHE B 115 ? 0.8304 1.6663 0.7497 -0.0874 0.1612  -0.0048 115 PHE B CZ    
2416 N  N     . ALA B 116 ? 0.6904 1.3293 0.6643 -0.1360 0.1406  0.0509  116 ALA B N     
2417 C  CA    . ALA B 116 ? 0.6844 1.2820 0.6600 -0.1341 0.1492  0.0240  116 ALA B CA    
2418 C  C     . ALA B 116 ? 0.7157 1.2646 0.6886 -0.1302 0.1565  0.0254  116 ALA B C     
2419 O  O     . ALA B 116 ? 0.7232 1.2450 0.6867 -0.1232 0.1673  0.0076  116 ALA B O     
2420 C  CB    . ALA B 116 ? 0.6907 1.2823 0.6803 -0.1411 0.1435  0.0200  116 ALA B CB    
2421 N  N     . GLN B 117 ? 0.6513 1.1884 0.6306 -0.1334 0.1495  0.0466  117 GLN B N     
2422 C  CA    . GLN B 117 ? 0.6516 1.1520 0.6267 -0.1279 0.1533  0.0485  117 GLN B CA    
2423 C  C     . GLN B 117 ? 0.7153 1.2288 0.6783 -0.1167 0.1581  0.0467  117 GLN B C     
2424 O  O     . GLN B 117 ? 0.7304 1.2119 0.6813 -0.1051 0.1664  0.0374  117 GLN B O     
2425 C  CB    . GLN B 117 ? 0.6591 1.1520 0.6459 -0.1341 0.1409  0.0672  117 GLN B CB    
2426 C  CG    . GLN B 117 ? 0.7268 1.1871 0.7086 -0.1271 0.1424  0.0654  117 GLN B CG    
2427 C  CD    . GLN B 117 ? 0.8103 1.2705 0.8042 -0.1333 0.1277  0.0798  117 GLN B CD    
2428 O  OE1   . GLN B 117 ? 0.7243 1.2062 0.7304 -0.1449 0.1173  0.0961  117 GLN B OE1   
2429 N  NE2   . GLN B 117 ? 0.7009 1.1358 0.6907 -0.1264 0.1262  0.0743  117 GLN B NE2   
2430 N  N     . ALA B 118 ? 0.6549 1.2188 0.6206 -0.1187 0.1534  0.0570  118 ALA B N     
2431 C  CA    . ALA B 118 ? 0.6518 1.2463 0.6103 -0.1067 0.1571  0.0547  118 ALA B CA    
2432 C  C     . ALA B 118 ? 0.7214 1.3058 0.6640 -0.0892 0.1674  0.0287  118 ALA B C     
2433 O  O     . ALA B 118 ? 0.7256 1.2890 0.6574 -0.0719 0.1723  0.0204  118 ALA B O     
2434 C  CB    . ALA B 118 ? 0.6535 1.3128 0.6200 -0.1163 0.1521  0.0724  118 ALA B CB    
2435 N  N     . ASN B 119 ? 0.7011 1.2967 0.6419 -0.0926 0.1691  0.0147  119 ASN B N     
2436 C  CA    . ASN B 119 ? 0.7352 1.3165 0.6638 -0.0791 0.1768  -0.0149 119 ASN B CA    
2437 C  C     . ASN B 119 ? 0.8212 1.3278 0.7432 -0.0753 0.1850  -0.0251 119 ASN B C     
2438 O  O     . ASN B 119 ? 0.8484 1.3282 0.7563 -0.0564 0.1909  -0.0379 119 ASN B O     
2439 C  CB    . ASN B 119 ? 0.7607 1.3706 0.6923 -0.0875 0.1741  -0.0297 119 ASN B CB    
2440 C  CG    . ASN B 119 ? 1.1006 1.7086 1.0210 -0.0733 0.1789  -0.0645 119 ASN B CG    
2441 O  OD1   . ASN B 119 ? 1.0658 1.7139 0.9763 -0.0557 0.1795  -0.0732 119 ASN B OD1   
2442 N  ND2   . ASN B 119 ? 0.9980 1.5608 0.9218 -0.0808 0.1824  -0.0871 119 ASN B ND2   
2443 N  N     . SER B 120 ? 0.7729 1.2475 0.7041 -0.0913 0.1855  -0.0171 120 SER B N     
2444 C  CA    . SER B 120 ? 0.7978 1.2081 0.7229 -0.0919 0.1956  -0.0209 120 SER B CA    
2445 C  C     . SER B 120 ? 0.8648 1.2488 0.7732 -0.0732 0.1985  -0.0103 120 SER B C     
2446 O  O     . SER B 120 ? 0.9093 1.2439 0.8015 -0.0620 0.2081  -0.0176 120 SER B O     
2447 C  CB    . SER B 120 ? 0.8335 1.2337 0.7727 -0.1095 0.1949  -0.0115 120 SER B CB    
2448 O  OG    . SER B 120 ? 0.9609 1.3663 0.9136 -0.1246 0.1968  -0.0277 120 SER B OG    
2449 N  N     . LEU B 121 ? 0.7820 1.1991 0.6945 -0.0699 0.1892  0.0070  121 LEU B N     
2450 C  CA    . LEU B 121 ? 0.7809 1.1895 0.6810 -0.0518 0.1879  0.0161  121 LEU B CA    
2451 C  C     . LEU B 121 ? 0.8720 1.2847 0.7571 -0.0262 0.1909  0.0047  121 LEU B C     
2452 O  O     . LEU B 121 ? 0.9009 1.2783 0.7670 -0.0055 0.1945  0.0062  121 LEU B O     
2453 C  CB    . LEU B 121 ? 0.7445 1.1973 0.6601 -0.0597 0.1750  0.0322  121 LEU B CB    
2454 C  CG    . LEU B 121 ? 0.7980 1.2524 0.7073 -0.0456 0.1695  0.0398  121 LEU B CG    
2455 C  CD1   . LEU B 121 ? 0.8154 1.2153 0.7071 -0.0384 0.1752  0.0412  121 LEU B CD1   
2456 C  CD2   . LEU B 121 ? 0.7919 1.2872 0.7236 -0.0618 0.1558  0.0522  121 LEU B CD2   
2457 N  N     . CYS B 122 ? 0.8277 1.2842 0.7188 -0.0245 0.1891  -0.0074 122 CYS B N     
2458 C  CA    . CYS B 122 ? 0.8543 1.3234 0.7330 0.0032  0.1910  -0.0237 122 CYS B CA    
2459 C  C     . CYS B 122 ? 0.9496 1.3460 0.8098 0.0166  0.1999  -0.0416 122 CYS B C     
2460 O  O     . CYS B 122 ? 0.9891 1.3586 0.8314 0.0457  0.2015  -0.0454 122 CYS B O     
2461 C  CB    . CYS B 122 ? 0.8465 1.3880 0.7353 0.0008  0.1876  -0.0329 122 CYS B CB    
2462 S  SG    . CYS B 122 ? 0.8557 1.4824 0.7652 -0.0138 0.1790  -0.0070 122 CYS B SG    
2463 N  N     . VAL B 123 ? 0.8969 1.2597 0.7625 -0.0049 0.2052  -0.0515 123 VAL B N     
2464 C  CA    . VAL B 123 ? 0.9436 1.2312 0.7971 -0.0019 0.2146  -0.0679 123 VAL B CA    
2465 C  C     . VAL B 123 ? 1.0244 1.2451 0.8596 0.0057  0.2223  -0.0479 123 VAL B C     
2466 O  O     . VAL B 123 ? 1.0783 1.2370 0.8932 0.0249  0.2283  -0.0531 123 VAL B O     
2467 C  CB    . VAL B 123 ? 0.9866 1.2665 0.8570 -0.0327 0.2177  -0.0826 123 VAL B CB    
2468 C  CG1   . VAL B 123 ? 1.0505 1.2576 0.9136 -0.0333 0.2263  -0.1048 123 VAL B CG1   
2469 C  CG2   . VAL B 123 ? 0.9516 1.3079 0.8361 -0.0387 0.2084  -0.0963 123 VAL B CG2   
2470 N  N     . ALA B 124 ? 0.9452 1.1795 0.7855 -0.0069 0.2212  -0.0249 124 ALA B N     
2471 C  CA    . ALA B 124 ? 0.9649 1.1524 0.7860 0.0006  0.2277  -0.0045 124 ALA B CA    
2472 C  C     . ALA B 124 ? 1.0347 1.2273 0.8348 0.0372  0.2215  0.0026  124 ALA B C     
2473 O  O     . ALA B 124 ? 1.0936 1.2296 0.8668 0.0564  0.2280  0.0128  124 ALA B O     
2474 C  CB    . ALA B 124 ? 0.9280 1.1410 0.7620 -0.0196 0.2251  0.0111  124 ALA B CB    
2475 N  N     . LEU B 125 ? 0.9376 1.2013 0.7505 0.0468  0.2092  -0.0016 125 LEU B N     
2476 C  CA    . LEU B 125 ? 0.9397 1.2306 0.7409 0.0804  0.2011  0.0018  125 LEU B CA    
2477 C  C     . LEU B 125 ? 1.0516 1.3044 0.8309 0.1158  0.2041  -0.0118 125 LEU B C     
2478 O  O     . LEU B 125 ? 1.0862 1.3125 0.8415 0.1474  0.2025  -0.0027 125 LEU B O     
2479 C  CB    . LEU B 125 ? 0.8837 1.2675 0.7110 0.0740  0.1895  0.0003  125 LEU B CB    
2480 C  CG    . LEU B 125 ? 0.9418 1.3798 0.7680 0.1046  0.1802  -0.0010 125 LEU B CG    
2481 C  CD1   . LEU B 125 ? 0.9575 1.3762 0.7664 0.1231  0.1753  0.0128  125 LEU B CD1   
2482 C  CD2   . LEU B 125 ? 0.9269 1.4545 0.7840 0.0857  0.1721  0.0011  125 LEU B CD2   
2483 N  N     . ILE B 126 ? 1.0207 1.2696 0.8068 0.1132  0.2069  -0.0348 126 ILE B N     
2484 C  CA    . ILE B 126 ? 1.0812 1.2899 0.8485 0.1481  0.2080  -0.0540 126 ILE B CA    
2485 C  C     . ILE B 126 ? 1.2061 1.3037 0.9515 0.1466  0.2191  -0.0504 126 ILE B C     
2486 O  O     . ILE B 126 ? 1.2123 1.2755 0.9684 0.1142  0.2271  -0.0585 126 ILE B O     
2487 C  CB    . ILE B 126 ? 1.1080 1.3715 0.8903 0.1526  0.2040  -0.0848 126 ILE B CB    
2488 C  CG1   . ILE B 126 ? 1.0586 1.4321 0.8578 0.1602  0.1951  -0.0817 126 ILE B CG1   
2489 C  CG2   . ILE B 126 ? 1.1902 1.4025 0.9532 0.1903  0.2041  -0.1107 126 ILE B CG2   
2490 C  CD1   . ILE B 126 ? 1.0866 1.5269 0.9100 0.1276  0.1942  -0.0837 126 ILE B CD1   
2491 N  N     . LYS B 127 ? 1.2163 1.2611 0.9316 0.1812  0.2195  -0.0362 127 LYS B N     
2492 C  CA    . LYS B 127 ? 1.2944 1.2273 0.9829 0.1842  0.2309  -0.0247 127 LYS B CA    
2493 C  C     . LYS B 127 ? 1.4190 1.2967 1.0973 0.2119  0.2291  -0.0522 127 LYS B C     
2494 O  O     . LYS B 127 ? 1.4708 1.3177 1.1233 0.2593  0.2234  -0.0504 127 LYS B O     
2495 C  CB    . LYS B 127 ? 1.3525 1.2588 1.0089 0.2094  0.2314  0.0091  127 LYS B CB    
2496 C  CG    . LYS B 127 ? 1.5644 1.3594 1.1910 0.2039  0.2468  0.0327  127 LYS B CG    
2497 C  CD    . LYS B 127 ? 1.7001 1.4761 1.2882 0.2375  0.2455  0.0660  127 LYS B CD    
2498 C  CE    . LYS B 127 ? 1.9236 1.5877 1.4778 0.2330  0.2627  0.0946  127 LYS B CE    
2499 N  NZ    . LYS B 127 ? 2.0755 1.7299 1.5880 0.2643  0.2622  0.1307  127 LYS B NZ    
2500 N  N     . GLN B 128 ? 1.3786 1.2496 1.0782 0.1848  0.2319  -0.0810 128 GLN B N     
2501 C  CA    . GLN B 128 ? 1.4500 1.2706 1.1455 0.2043  0.2290  -0.1164 128 GLN B CA    
2502 C  C     . GLN B 128 ? 1.5465 1.3048 1.2574 0.1589  0.2388  -0.1313 128 GLN B C     
2503 O  O     . GLN B 128 ? 1.4880 1.2847 1.2214 0.1149  0.2444  -0.1230 128 GLN B O     
2504 C  CB    . GLN B 128 ? 1.4228 1.3421 1.1344 0.2258  0.2165  -0.1508 128 GLN B CB    
2505 C  CG    . GLN B 128 ? 1.5451 1.5211 1.2440 0.2774  0.2063  -0.1462 128 GLN B CG    
2506 C  CD    . GLN B 128 ? 1.8864 1.7771 1.5528 0.3291  0.2031  -0.1472 128 GLN B CD    
2507 O  OE1   . GLN B 128 ? 1.9321 1.7368 1.5885 0.3401  0.2039  -0.1708 128 GLN B OE1   
2508 N  NE2   . GLN B 128 ? 1.7729 1.6861 1.4224 0.3639  0.1976  -0.1228 128 GLN B NE2   
2509 N  N     . PRO B 129 ? 1.6002 1.2640 1.3020 0.1680  0.2400  -0.1550 129 PRO B N     
2510 C  CA    . PRO B 129 ? 1.6304 1.2399 1.3527 0.1196  0.2486  -0.1721 129 PRO B CA    
2511 C  C     . PRO B 129 ? 1.6157 1.3194 1.3734 0.0877  0.2431  -0.2032 129 PRO B C     
2512 O  O     . PRO B 129 ? 1.5696 1.2886 1.3494 0.0409  0.2510  -0.1942 129 PRO B O     
2513 C  CB    . PRO B 129 ? 1.7688 1.2717 1.4762 0.1441  0.2453  -0.2003 129 PRO B CB    
2514 C  CG    . PRO B 129 ? 1.8678 1.3398 1.5388 0.2026  0.2402  -0.1797 129 PRO B CG    
2515 C  CD    . PRO B 129 ? 1.7089 1.3089 1.3834 0.2226  0.2324  -0.1688 129 PRO B CD    
2516 N  N     . THR B 130 ? 1.5627 1.3368 1.3243 0.1160  0.2295  -0.2378 130 THR B N     
2517 C  CA    . THR B 130 ? 1.4978 1.3679 1.2861 0.0935  0.2228  -0.2659 130 THR B CA    
2518 C  C     . THR B 130 ? 1.4628 1.4527 1.2523 0.1128  0.2157  -0.2540 130 THR B C     
2519 O  O     . THR B 130 ? 1.4714 1.4891 1.2462 0.1570  0.2091  -0.2619 130 THR B O     
2520 C  CB    . THR B 130 ? 1.6534 1.4992 1.4482 0.0982  0.2150  -0.3224 130 THR B CB    
2521 O  OG1   . THR B 130 ? 1.7061 1.4983 1.4764 0.1495  0.2092  -0.3404 130 THR B OG1   
2522 C  CG2   . THR B 130 ? 1.6869 1.4510 1.4994 0.0523  0.2220  -0.3356 130 THR B CG2   
2523 N  N     . VAL B 131 ? 1.3371 1.3958 1.1453 0.0791  0.2172  -0.2330 131 VAL B N     
2524 C  CA    . VAL B 131 ? 1.2581 1.4253 1.0721 0.0857  0.2116  -0.2158 131 VAL B CA    
2525 C  C     . VAL B 131 ? 1.2616 1.5043 1.0972 0.0563  0.2071  -0.2304 131 VAL B C     
2526 O  O     . VAL B 131 ? 1.2521 1.4754 1.1032 0.0198  0.2106  -0.2265 131 VAL B O     
2527 C  CB    . VAL B 131 ? 1.2692 1.4371 1.0808 0.0777  0.2160  -0.1690 131 VAL B CB    
2528 C  CG1   . VAL B 131 ? 1.1968 1.4696 1.0176 0.0815  0.2092  -0.1527 131 VAL B CG1   
2529 C  CG2   . VAL B 131 ? 1.3231 1.4157 1.1091 0.1080  0.2198  -0.1532 131 VAL B CG2   
2530 N  N     . LEU B 132 ? 1.1891 1.5218 1.0249 0.0740  0.1996  -0.2469 132 LEU B N     
2531 C  CA    . LEU B 132 ? 1.1454 1.5584 0.9952 0.0529  0.1942  -0.2584 132 LEU B CA    
2532 C  C     . LEU B 132 ? 1.1318 1.6518 0.9816 0.0630  0.1908  -0.2387 132 LEU B C     
2533 O  O     . LEU B 132 ? 1.1419 1.6942 0.9811 0.0960  0.1904  -0.2443 132 LEU B O     
2534 C  CB    . LEU B 132 ? 1.1986 1.6118 1.0463 0.0617  0.1885  -0.3117 132 LEU B CB    
2535 C  CG    . LEU B 132 ? 1.3274 1.6385 1.1802 0.0462  0.1905  -0.3398 132 LEU B CG    
2536 C  CD1   . LEU B 132 ? 1.3887 1.7030 1.2369 0.0645  0.1821  -0.3980 132 LEU B CD1   
2537 C  CD2   . LEU B 132 ? 1.3366 1.6388 1.2121 -0.0007 0.1930  -0.3278 132 LEU B CD2   
2538 N  N     . THR B 133 ? 1.0263 1.6025 0.8889 0.0350  0.1884  -0.2159 133 THR B N     
2539 C  CA    . THR B 133 ? 0.9788 1.6534 0.8430 0.0370  0.1862  -0.1923 133 THR B CA    
2540 C  C     . THR B 133 ? 1.0572 1.8073 0.9123 0.0538  0.1828  -0.2244 133 THR B C     
2541 O  O     . THR B 133 ? 1.0727 1.8254 0.9283 0.0437  0.1782  -0.2506 133 THR B O     
2542 C  CB    . THR B 133 ? 1.0207 1.7169 0.8993 0.0033  0.1836  -0.1565 133 THR B CB    
2543 O  OG1   . THR B 133 ? 1.0527 1.6710 0.9389 -0.0123 0.1866  -0.1391 133 THR B OG1   
2544 C  CG2   . THR B 133 ? 0.9419 1.7168 0.8242 0.0008  0.1826  -0.1220 133 THR B CG2   
2545 N  N     . HIS B 134 ? 1.0156 1.8325 0.8628 0.0807  0.1848  -0.2253 134 HIS B N     
2546 C  CA    . HIS B 134 ? 1.0301 1.9323 0.8656 0.1020  0.1833  -0.2558 134 HIS B CA    
2547 C  C     . HIS B 134 ? 1.0387 2.0516 0.8760 0.0885  0.1850  -0.2229 134 HIS B C     
2548 O  O     . HIS B 134 ? 1.0448 2.1220 0.8726 0.0874  0.1823  -0.2367 134 HIS B O     
2549 C  CB    . HIS B 134 ? 1.0819 1.9859 0.9062 0.1465  0.1853  -0.2869 134 HIS B CB    
2550 C  CG    . HIS B 134 ? 1.1902 2.0156 1.0050 0.1660  0.1808  -0.3389 134 HIS B CG    
2551 N  ND1   . HIS B 134 ? 1.2660 2.1089 1.0671 0.2104  0.1790  -0.3822 134 HIS B ND1   
2552 C  CD2   . HIS B 134 ? 1.2364 1.9685 1.0556 0.1450  0.1776  -0.3543 134 HIS B CD2   
2553 C  CE1   . HIS B 134 ? 1.3165 2.0669 1.1135 0.2146  0.1737  -0.4222 134 HIS B CE1   
2554 N  NE2   . HIS B 134 ? 1.3047 1.9882 1.1136 0.1734  0.1735  -0.4062 134 HIS B NE2   
2555 N  N     . GLU B 135 ? 0.9574 1.9914 0.8061 0.0772  0.1891  -0.1790 135 GLU B N     
2556 C  CA    . GLU B 135 ? 0.9250 2.0519 0.7788 0.0584  0.1919  -0.1393 135 GLU B CA    
2557 C  C     . GLU B 135 ? 0.9448 2.0350 0.8175 0.0290  0.1910  -0.0923 135 GLU B C     
2558 O  O     . GLU B 135 ? 0.9322 1.9519 0.8120 0.0330  0.1904  -0.0920 135 GLU B O     
2559 C  CB    . GLU B 135 ? 0.9514 2.1781 0.8016 0.0833  0.1996  -0.1438 135 GLU B CB    
2560 C  CG    . GLU B 135 ? 1.1049 2.4109 0.9349 0.1075  0.2012  -0.1799 135 GLU B CG    
2561 C  CD    . GLU B 135 ? 1.3117 2.7138 1.1383 0.1402  0.2097  -0.1945 135 GLU B CD    
2562 O  OE1   . GLU B 135 ? 1.0238 2.4592 0.8675 0.1360  0.2155  -0.1654 135 GLU B OE1   
2563 O  OE2   . GLU B 135 ? 1.3074 2.7578 1.1155 0.1709  0.2099  -0.2381 135 GLU B OE2   
2564 N  N     . SER B 136 ? 0.8890 2.0264 0.7679 0.0012  0.1903  -0.0527 136 SER B N     
2565 C  CA    . SER B 136 ? 0.8605 1.9701 0.7584 -0.0277 0.1877  -0.0089 136 SER B CA    
2566 C  C     . SER B 136 ? 0.9229 2.1109 0.8255 -0.0509 0.1896  0.0336  136 SER B C     
2567 O  O     . SER B 136 ? 0.9412 2.1770 0.8293 -0.0539 0.1894  0.0381  136 SER B O     
2568 C  CB    . SER B 136 ? 0.8871 1.9050 0.7895 -0.0443 0.1800  -0.0059 136 SER B CB    
2569 O  OG    . SER B 136 ? 0.9729 1.9581 0.8931 -0.0655 0.1767  0.0282  136 SER B OG    
2570 N  N     . SER B 137 ? 0.8650 2.0676 0.7876 -0.0676 0.1914  0.0648  137 SER B N     
2571 C  CA    . SER B 137 ? 0.8633 2.1284 0.7959 -0.0964 0.1940  0.1112  137 SER B CA    
2572 C  C     . SER B 137 ? 0.8920 2.0856 0.8461 -0.1245 0.1849  0.1404  137 SER B C     
2573 O  O     . SER B 137 ? 0.8819 2.0441 0.8524 -0.1229 0.1829  0.1337  137 SER B O     
2574 C  CB    . SER B 137 ? 0.9237 2.2869 0.8657 -0.0909 0.2054  0.1151  137 SER B CB    
2575 O  OG    . SER B 137 ? 1.0957 2.5219 1.0168 -0.0578 0.2130  0.0797  137 SER B OG    
2576 N  N     . ILE B 138 ? 0.8412 2.0044 0.7931 -0.1454 0.1775  0.1681  138 ILE B N     
2577 C  CA    . ILE B 138 ? 0.8246 1.9126 0.7949 -0.1683 0.1666  0.1910  138 ILE B CA    
2578 C  C     . ILE B 138 ? 0.8888 1.9977 0.8697 -0.2012 0.1636  0.2424  138 ILE B C     
2579 O  O     . ILE B 138 ? 0.9090 2.0797 0.8754 -0.2059 0.1690  0.2647  138 ILE B O     
2580 C  CB    . ILE B 138 ? 0.8536 1.8598 0.8152 -0.1589 0.1576  0.1710  138 ILE B CB    
2581 C  CG1   . ILE B 138 ? 0.8684 1.8965 0.8107 -0.1564 0.1546  0.1762  138 ILE B CG1   
2582 C  CG2   . ILE B 138 ? 0.8528 1.8227 0.8083 -0.1330 0.1614  0.1258  138 ILE B CG2   
2583 C  CD1   . ILE B 138 ? 0.9151 1.8761 0.8576 -0.1559 0.1439  0.1690  138 ILE B CD1   
2584 N  N     . GLN B 139 ? 0.8303 1.8870 0.8353 -0.2236 0.1549  0.2614  139 GLN B N     
2585 C  CA    . GLN B 139 ? 0.8508 1.9059 0.8691 -0.2576 0.1498  0.3103  139 GLN B CA    
2586 C  C     . GLN B 139 ? 0.8959 1.8548 0.9296 -0.2699 0.1333  0.3172  139 GLN B C     
2587 O  O     . GLN B 139 ? 0.8802 1.7973 0.9282 -0.2652 0.1284  0.2927  139 GLN B O     
2588 C  CB    . GLN B 139 ? 0.8813 2.0141 0.9193 -0.2821 0.1601  0.3356  139 GLN B CB    
2589 C  CG    . GLN B 139 ? 1.0926 2.2363 1.1568 -0.2820 0.1612  0.3119  139 GLN B CG    
2590 C  CD    . GLN B 139 ? 1.3417 2.5656 1.4333 -0.3129 0.1699  0.3397  139 GLN B CD    
2591 O  OE1   . GLN B 139 ? 1.2700 2.5348 1.3620 -0.3400 0.1763  0.3826  139 GLN B OE1   
2592 N  NE2   . GLN B 139 ? 1.2591 2.5092 1.3748 -0.3105 0.1701  0.3172  139 GLN B NE2   
2593 N  N     . PHE B 140 ? 0.8689 1.7940 0.8962 -0.2806 0.1240  0.3486  140 PHE B N     
2594 C  CA    . PHE B 140 ? 0.8741 1.7080 0.9123 -0.2869 0.1066  0.3554  140 PHE B CA    
2595 C  C     . PHE B 140 ? 0.9368 1.7508 1.0004 -0.3233 0.0996  0.3944  140 PHE B C     
2596 O  O     . PHE B 140 ? 0.9755 1.7793 1.0344 -0.3393 0.0948  0.4372  140 PHE B O     
2597 C  CB    . PHE B 140 ? 0.9124 1.7217 0.9283 -0.2706 0.0987  0.3626  140 PHE B CB    
2598 C  CG    . PHE B 140 ? 0.9010 1.7249 0.8978 -0.2397 0.1038  0.3209  140 PHE B CG    
2599 C  CD1   . PHE B 140 ? 0.9267 1.8243 0.9011 -0.2277 0.1146  0.3154  140 PHE B CD1   
2600 C  CD2   . PHE B 140 ? 0.9223 1.6875 0.9240 -0.2239 0.0978  0.2865  140 PHE B CD2   
2601 C  CE1   . PHE B 140 ? 0.9416 1.8467 0.9016 -0.2024 0.1176  0.2737  140 PHE B CE1   
2602 C  CE2   . PHE B 140 ? 0.9135 1.6890 0.9012 -0.2012 0.1032  0.2496  140 PHE B CE2   
2603 C  CZ    . PHE B 140 ? 0.8990 1.7407 0.8673 -0.1916 0.1121  0.2424  140 PHE B CZ    
2604 N  N     . ILE B 141 ? 0.8604 1.6696 0.9507 -0.3364 0.0987  0.3791  141 ILE B N     
2605 C  CA    . ILE B 141 ? 0.8813 1.6770 1.0042 -0.3747 0.0919  0.4047  141 ILE B CA    
2606 C  C     . ILE B 141 ? 0.9784 1.6816 1.1096 -0.3888 0.0724  0.4276  141 ILE B C     
2607 O  O     . ILE B 141 ? 1.0427 1.7408 1.1833 -0.4199 0.0702  0.4733  141 ILE B O     
2608 C  CB    . ILE B 141 ? 0.8848 1.6979 1.0330 -0.3775 0.0919  0.3715  141 ILE B CB    
2609 C  CG1   . ILE B 141 ? 0.8547 1.7694 0.9986 -0.3675 0.1109  0.3594  141 ILE B CG1   
2610 C  CG2   . ILE B 141 ? 0.9322 1.7223 1.1193 -0.4186 0.0804  0.3894  141 ILE B CG2   
2611 C  CD1   . ILE B 141 ? 0.8801 1.7975 1.0026 -0.3269 0.1159  0.3166  141 ILE B CD1   
2612 N  N     . GLU B 142 ? 0.9032 1.5340 1.0309 -0.3654 0.0589  0.3971  142 GLU B N     
2613 C  CA    . GLU B 142 ? 0.9411 1.4817 1.0760 -0.3701 0.0386  0.4106  142 GLU B CA    
2614 C  C     . GLU B 142 ? 0.9698 1.4757 1.0793 -0.3335 0.0330  0.3961  142 GLU B C     
2615 O  O     . GLU B 142 ? 0.9079 1.4470 1.0001 -0.3072 0.0434  0.3656  142 GLU B O     
2616 C  CB    . GLU B 142 ? 0.9659 1.4512 1.1298 -0.3807 0.0235  0.3847  142 GLU B CB    
2617 C  CG    . GLU B 142 ? 1.1139 1.6319 1.3107 -0.4201 0.0250  0.3947  142 GLU B CG    
2618 C  CD    . GLU B 142 ? 1.4479 1.9632 1.6617 -0.4633 0.0236  0.4484  142 GLU B CD    
2619 O  OE1   . GLU B 142 ? 1.4503 1.9002 1.6558 -0.4651 0.0123  0.4783  142 GLU B OE1   
2620 O  OE2   . GLU B 142 ? 1.4020 1.9817 1.6385 -0.4956 0.0339  0.4616  142 GLU B OE2   
2621 N  N     . LYS B 143 ? 0.9796 1.4182 1.0888 -0.3321 0.0159  0.4176  143 LYS B N     
2622 C  CA    . LYS B 143 ? 0.9752 1.3842 1.0657 -0.2975 0.0079  0.4051  143 LYS B CA    
2623 C  C     . LYS B 143 ? 0.9965 1.3632 1.0960 -0.2764 0.0010  0.3561  143 LYS B C     
2624 O  O     . LYS B 143 ? 1.0230 1.3331 1.1428 -0.2855 -0.0128 0.3475  143 LYS B O     
2625 C  CB    . LYS B 143 ? 1.0770 1.4297 1.1639 -0.2990 -0.0096 0.4464  143 LYS B CB    
2626 C  CG    . LYS B 143 ? 1.2482 1.6502 1.3124 -0.3067 -0.0017 0.4955  143 LYS B CG    
2627 C  CD    . LYS B 143 ? 1.4384 1.7915 1.5099 -0.3357 -0.0124 0.5522  143 LYS B CD    
2628 C  CE    . LYS B 143 ? 1.6066 1.8888 1.6659 -0.3127 -0.0339 0.5741  143 LYS B CE    
2629 N  NZ    . LYS B 143 ? 1.8038 2.0318 1.8673 -0.3423 -0.0433 0.6348  143 LYS B NZ    
2630 N  N     . VAL B 144 ? 0.8959 1.2924 0.9804 -0.2497 0.0111  0.3232  144 VAL B N     
2631 C  CA    . VAL B 144 ? 0.8646 1.2292 0.9535 -0.2287 0.0082  0.2801  144 VAL B CA    
2632 C  C     . VAL B 144 ? 0.9395 1.2624 1.0258 -0.2059 -0.0066 0.2794  144 VAL B C     
2633 O  O     . VAL B 144 ? 0.9284 1.2803 1.0004 -0.1915 -0.0040 0.2864  144 VAL B O     
2634 C  CB    . VAL B 144 ? 0.8558 1.2670 0.9320 -0.2147 0.0274  0.2476  144 VAL B CB    
2635 C  CG1   . VAL B 144 ? 0.8359 1.2151 0.9134 -0.1936 0.0261  0.2100  144 VAL B CG1   
2636 C  CG2   . VAL B 144 ? 0.8334 1.2830 0.9129 -0.2310 0.0393  0.2457  144 VAL B CG2   
2637 N  N     . LYS B 145 ? 0.9245 1.1835 1.0255 -0.2011 -0.0237 0.2694  145 LYS B N     
2638 C  CA    . LYS B 145 ? 0.9496 1.1681 1.0506 -0.1750 -0.0399 0.2665  145 LYS B CA    
2639 C  C     . LYS B 145 ? 0.9583 1.1787 1.0600 -0.1471 -0.0364 0.2209  145 LYS B C     
2640 O  O     . LYS B 145 ? 0.9064 1.1523 1.0059 -0.1494 -0.0212 0.1945  145 LYS B O     
2641 C  CB    . LYS B 145 ? 1.0510 1.1937 1.1667 -0.1835 -0.0634 0.2875  145 LYS B CB    
2642 C  CG    . LYS B 145 ? 1.2532 1.3885 1.3619 -0.1990 -0.0697 0.3425  145 LYS B CG    
2643 C  CD    . LYS B 145 ? 1.4376 1.5761 1.5566 -0.2422 -0.0647 0.3733  145 LYS B CD    
2644 C  CE    . LYS B 145 ? 1.7045 1.7594 1.8432 -0.2630 -0.0857 0.3962  145 LYS B CE    
2645 N  NZ    . LYS B 145 ? 1.9013 1.9055 2.0294 -0.2502 -0.1023 0.4362  145 LYS B NZ    
2646 N  N     . LEU B 146 ? 0.9369 1.1351 1.0406 -0.1197 -0.0497 0.2141  146 LEU B N     
2647 C  CA    . LEU B 146 ? 0.9099 1.1153 1.0172 -0.0924 -0.0469 0.1736  146 LEU B CA    
2648 C  C     . LEU B 146 ? 0.9730 1.1418 1.0893 -0.0914 -0.0503 0.1440  146 LEU B C     
2649 O  O     . LEU B 146 ? 1.0126 1.1296 1.1383 -0.1024 -0.0665 0.1527  146 LEU B O     
2650 C  CB    . LEU B 146 ? 0.9441 1.1345 1.0551 -0.0620 -0.0646 0.1764  146 LEU B CB    
2651 C  CG    . LEU B 146 ? 0.9840 1.1859 1.1037 -0.0302 -0.0648 0.1362  146 LEU B CG    
2652 C  CD1   . LEU B 146 ? 0.9206 1.1905 1.0364 -0.0324 -0.0400 0.1143  146 LEU B CD1   
2653 C  CD2   . LEU B 146 ? 1.0584 1.2488 1.1832 0.0013  -0.0854 0.1433  146 LEU B CD2   
2654 N  N     . ASN B 147 ? 0.8946 1.0929 1.0072 -0.0804 -0.0345 0.1098  147 ASN B N     
2655 C  CA    . ASN B 147 ? 0.8941 1.0746 1.0085 -0.0746 -0.0337 0.0780  147 ASN B CA    
2656 C  C     . ASN B 147 ? 0.9099 1.0932 1.0200 -0.0989 -0.0266 0.0794  147 ASN B C     
2657 O  O     . ASN B 147 ? 0.8974 1.0733 1.0052 -0.0930 -0.0260 0.0530  147 ASN B O     
2658 C  CB    . ASN B 147 ? 0.9849 1.1136 1.1113 -0.0521 -0.0573 0.0601  147 ASN B CB    
2659 C  CG    . ASN B 147 ? 1.4257 1.5684 1.5562 -0.0199 -0.0604 0.0470  147 ASN B CG    
2660 O  OD1   . ASN B 147 ? 1.3934 1.5863 1.5198 -0.0094 -0.0416 0.0281  147 ASN B OD1   
2661 N  ND2   . ASN B 147 ? 1.3800 1.4790 1.5199 -0.0038 -0.0845 0.0574  147 ASN B ND2   
2662 N  N     . ASP B 148 ? 0.8462 1.0493 0.9538 -0.1234 -0.0203 0.1085  148 ASP B N     
2663 C  CA    . ASP B 148 ? 0.8258 1.0451 0.9315 -0.1445 -0.0127 0.1105  148 ASP B CA    
2664 C  C     . ASP B 148 ? 0.8168 1.0776 0.9051 -0.1365 0.0108  0.0929  148 ASP B C     
2665 O  O     . ASP B 148 ? 0.7854 1.0702 0.8655 -0.1268 0.0236  0.0909  148 ASP B O     
2666 C  CB    . ASP B 148 ? 0.8563 1.0935 0.9654 -0.1710 -0.0117 0.1476  148 ASP B CB    
2667 C  CG    . ASP B 148 ? 1.0863 1.2801 1.2128 -0.1892 -0.0325 0.1733  148 ASP B CG    
2668 O  OD1   . ASP B 148 ? 1.1434 1.2841 1.2821 -0.1830 -0.0511 0.1579  148 ASP B OD1   
2669 O  OD2   . ASP B 148 ? 1.1752 1.3875 1.3026 -0.2103 -0.0299 0.2086  148 ASP B OD2   
2670 N  N     . THR B 149 ? 0.7554 1.0241 0.8388 -0.1409 0.0154  0.0803  149 THR B N     
2671 C  CA    . THR B 149 ? 0.7103 1.0098 0.7743 -0.1330 0.0368  0.0684  149 THR B CA    
2672 C  C     . THR B 149 ? 0.7258 1.0554 0.7884 -0.1498 0.0429  0.0839  149 THR B C     
2673 O  O     . THR B 149 ? 0.7328 1.0620 0.8057 -0.1616 0.0322  0.0853  149 THR B O     
2674 C  CB    . THR B 149 ? 0.8000 1.0888 0.8533 -0.1152 0.0383  0.0405  149 THR B CB    
2675 O  OG1   . THR B 149 ? 0.8301 1.0945 0.8903 -0.1001 0.0285  0.0260  149 THR B OG1   
2676 C  CG2   . THR B 149 ? 0.7322 1.0432 0.7626 -0.1049 0.0621  0.0332  149 THR B CG2   
2677 N  N     . VAL B 150 ? 0.6540 1.0133 0.7069 -0.1511 0.0585  0.0937  150 VAL B N     
2678 C  CA    . VAL B 150 ? 0.6394 1.0354 0.6899 -0.1623 0.0658  0.1063  150 VAL B CA    
2679 C  C     . VAL B 150 ? 0.6964 1.1049 0.7302 -0.1496 0.0781  0.0905  150 VAL B C     
2680 O  O     . VAL B 150 ? 0.7055 1.1086 0.7220 -0.1356 0.0926  0.0792  150 VAL B O     
2681 C  CB    . VAL B 150 ? 0.6743 1.0989 0.7214 -0.1674 0.0741  0.1220  150 VAL B CB    
2682 C  CG1   . VAL B 150 ? 0.6656 1.1348 0.7121 -0.1776 0.0803  0.1342  150 VAL B CG1   
2683 C  CG2   . VAL B 150 ? 0.6913 1.1018 0.7502 -0.1751 0.0606  0.1408  150 VAL B CG2   
2684 N  N     . ARG B 151 ? 0.6442 1.0695 0.6841 -0.1551 0.0718  0.0906  151 ARG B N     
2685 C  CA    . ARG B 151 ? 0.6348 1.0755 0.6585 -0.1397 0.0797  0.0781  151 ARG B CA    
2686 C  C     . ARG B 151 ? 0.6971 1.1820 0.7196 -0.1421 0.0890  0.0878  151 ARG B C     
2687 O  O     . ARG B 151 ? 0.7041 1.2242 0.7450 -0.1571 0.0817  0.0977  151 ARG B O     
2688 C  CB    . ARG B 151 ? 0.6267 1.0676 0.6597 -0.1409 0.0639  0.0674  151 ARG B CB    
2689 C  CG    . ARG B 151 ? 0.6859 1.1352 0.6954 -0.1171 0.0698  0.0525  151 ARG B CG    
2690 C  CD    . ARG B 151 ? 0.7235 1.1879 0.7441 -0.1186 0.0519  0.0400  151 ARG B CD    
2691 N  NE    . ARG B 151 ? 0.7997 1.3160 0.8355 -0.1270 0.0491  0.0461  151 ARG B NE    
2692 C  CZ    . ARG B 151 ? 1.0150 1.5555 1.0850 -0.1559 0.0371  0.0548  151 ARG B CZ    
2693 N  NH1   . ARG B 151 ? 0.8647 1.3714 0.9550 -0.1781 0.0251  0.0596  151 ARG B NH1   
2694 N  NH2   . ARG B 151 ? 0.8550 1.4538 0.9398 -0.1627 0.0372  0.0594  151 ARG B NH2   
2695 N  N     . ALA B 152 ? 0.6576 1.1427 0.6606 -0.1285 0.1051  0.0839  152 ALA B N     
2696 C  CA    . ALA B 152 ? 0.6546 1.1805 0.6536 -0.1248 0.1142  0.0874  152 ALA B CA    
2697 C  C     . ALA B 152 ? 0.7053 1.2394 0.6879 -0.1020 0.1193  0.0759  152 ALA B C     
2698 O  O     . ALA B 152 ? 0.7112 1.2078 0.6726 -0.0847 0.1258  0.0663  152 ALA B O     
2699 C  CB    . ALA B 152 ? 0.6607 1.1805 0.6491 -0.1221 0.1260  0.0852  152 ALA B CB    
2700 N  N     . GLU B 153 ? 0.6470 1.2329 0.6389 -0.1008 0.1169  0.0785  153 GLU B N     
2701 C  CA    . GLU B 153 ? 0.6535 1.2547 0.6301 -0.0738 0.1200  0.0677  153 GLU B CA    
2702 C  C     . GLU B 153 ? 0.6978 1.3436 0.6722 -0.0627 0.1289  0.0655  153 GLU B C     
2703 O  O     . GLU B 153 ? 0.6933 1.3945 0.6889 -0.0796 0.1270  0.0746  153 GLU B O     
2704 C  CB    . GLU B 153 ? 0.6768 1.3013 0.6646 -0.0721 0.1058  0.0639  153 GLU B CB    
2705 C  CG    . GLU B 153 ? 0.8305 1.4946 0.8550 -0.1040 0.0924  0.0730  153 GLU B CG    
2706 C  CD    . GLU B 153 ? 1.1765 1.8651 1.2158 -0.1048 0.0763  0.0635  153 GLU B CD    
2707 O  OE1   . GLU B 153 ? 1.2292 1.8848 1.2491 -0.0860 0.0714  0.0509  153 GLU B OE1   
2708 O  OE2   . GLU B 153 ? 1.0860 1.8307 1.1573 -0.1262 0.0685  0.0685  153 GLU B OE2   
2709 N  N     . ALA B 154 ? 0.6535 1.2727 0.6013 -0.0346 0.1393  0.0539  154 ALA B N     
2710 C  CA    . ALA B 154 ? 0.6524 1.3044 0.5935 -0.0165 0.1473  0.0449  154 ALA B CA    
2711 C  C     . ALA B 154 ? 0.7223 1.3932 0.6521 0.0178  0.1452  0.0356  154 ALA B C     
2712 O  O     . ALA B 154 ? 0.7390 1.3648 0.6487 0.0362  0.1438  0.0339  154 ALA B O     
2713 C  CB    . ALA B 154 ? 0.6747 1.2756 0.5962 -0.0102 0.1589  0.0353  154 ALA B CB    
2714 N  N     . ARG B 155 ? 0.6758 1.4188 0.6174 0.0283  0.1450  0.0302  155 ARG B N     
2715 C  CA    . ARG B 155 ? 0.6913 1.4673 0.6257 0.0655  0.1415  0.0193  155 ARG B CA    
2716 C  C     . ARG B 155 ? 0.7693 1.5764 0.6960 0.0917  0.1496  0.0036  155 ARG B C     
2717 O  O     . ARG B 155 ? 0.7539 1.6125 0.6962 0.0742  0.1544  0.0041  155 ARG B O     
2718 C  CB    . ARG B 155 ? 0.6586 1.5154 0.6246 0.0533  0.1297  0.0245  155 ARG B CB    
2719 C  CG    . ARG B 155 ? 0.7914 1.6202 0.7611 0.0408  0.1177  0.0307  155 ARG B CG    
2720 C  CD    . ARG B 155 ? 0.9104 1.8207 0.9172 0.0229  0.1046  0.0321  155 ARG B CD    
2721 N  NE    . ARG B 155 ? 1.0877 1.9700 1.1064 -0.0039 0.0923  0.0371  155 ARG B NE    
2722 C  CZ    . ARG B 155 ? 1.2973 2.1608 1.3357 -0.0449 0.0906  0.0496  155 ARG B CZ    
2723 N  NH1   . ARG B 155 ? 1.1004 1.9727 1.1466 -0.0646 0.1010  0.0618  155 ARG B NH1   
2724 N  NH2   . ARG B 155 ? 1.1719 2.0070 1.2201 -0.0633 0.0774  0.0490  155 ARG B NH2   
2725 N  N     . VAL B 156 ? 0.7661 1.5423 0.6669 0.1360  0.1506  -0.0103 156 VAL B N     
2726 C  CA    . VAL B 156 ? 0.7901 1.5911 0.6819 0.1690  0.1560  -0.0310 156 VAL B CA    
2727 C  C     . VAL B 156 ? 0.8314 1.7467 0.7483 0.1820  0.1502  -0.0356 156 VAL B C     
2728 O  O     . VAL B 156 ? 0.8388 1.7762 0.7583 0.2016  0.1406  -0.0342 156 VAL B O     
2729 C  CB    . VAL B 156 ? 0.8943 1.6089 0.7489 0.2127  0.1582  -0.0433 156 VAL B CB    
2730 C  CG1   . VAL B 156 ? 0.9282 1.6698 0.7755 0.2513  0.1611  -0.0697 156 VAL B CG1   
2731 C  CG2   . VAL B 156 ? 0.9035 1.5135 0.7391 0.1927  0.1662  -0.0377 156 VAL B CG2   
2732 N  N     . VAL B 157 ? 0.7674 1.7623 0.7040 0.1689  0.1562  -0.0402 157 VAL B N     
2733 C  CA    . VAL B 157 ? 0.7534 1.8715 0.7189 0.1750  0.1543  -0.0434 157 VAL B CA    
2734 C  C     . VAL B 157 ? 0.8338 1.9925 0.7873 0.2294  0.1568  -0.0719 157 VAL B C     
2735 O  O     . VAL B 157 ? 0.8339 2.0740 0.8034 0.2548  0.1513  -0.0797 157 VAL B O     
2736 C  CB    . VAL B 157 ? 0.7671 1.9642 0.7649 0.1249  0.1596  -0.0246 157 VAL B CB    
2737 C  CG1   . VAL B 157 ? 0.7395 1.9034 0.7546 0.0780  0.1523  0.0015  157 VAL B CG1   
2738 C  CG2   . VAL B 157 ? 0.7677 1.9583 0.7526 0.1156  0.1709  -0.0285 157 VAL B CG2   
2739 N  N     . ASN B 158 ? 0.8127 1.9156 0.7396 0.2484  0.1638  -0.0902 158 ASN B N     
2740 C  CA    . ASN B 158 ? 0.8526 1.9754 0.7640 0.3034  0.1653  -0.1227 158 ASN B CA    
2741 C  C     . ASN B 158 ? 0.9398 1.9388 0.8153 0.3234  0.1674  -0.1398 158 ASN B C     
2742 O  O     . ASN B 158 ? 0.9205 1.8429 0.7883 0.2879  0.1709  -0.1277 158 ASN B O     
2743 C  CB    . ASN B 158 ? 0.8493 2.0932 0.7797 0.3000  0.1738  -0.1347 158 ASN B CB    
2744 C  CG    . ASN B 158 ? 1.1389 2.4433 1.0636 0.3607  0.1733  -0.1694 158 ASN B CG    
2745 O  OD1   . ASN B 158 ? 1.0984 2.4306 1.0275 0.3986  0.1650  -0.1757 158 ASN B OD1   
2746 N  ND2   . ASN B 158 ? 1.0150 2.3483 0.9300 0.3738  0.1811  -0.1945 158 ASN B ND2   
2747 N  N     . GLN B 159 ? 0.9497 1.9279 0.8049 0.3807  0.1645  -0.1688 159 GLN B N     
2748 C  CA    . GLN B 159 ? 1.0055 1.8633 0.8285 0.4030  0.1656  -0.1887 159 GLN B CA    
2749 C  C     . GLN B 159 ? 1.1176 2.0034 0.9300 0.4605  0.1638  -0.2298 159 GLN B C     
2750 O  O     . GLN B 159 ? 1.1384 2.0579 0.9483 0.5104  0.1565  -0.2390 159 GLN B O     
2751 C  CB    . GLN B 159 ? 1.0558 1.7957 0.8542 0.4152  0.1606  -0.1706 159 GLN B CB    
2752 C  CG    . GLN B 159 ? 1.2302 1.8334 0.9987 0.4236  0.1641  -0.1834 159 GLN B CG    
2753 C  CD    . GLN B 159 ? 1.5174 2.0182 1.2548 0.4598  0.1592  -0.1715 159 GLN B CD    
2754 O  OE1   . GLN B 159 ? 1.4532 1.9440 1.1865 0.4525  0.1562  -0.1411 159 GLN B OE1   
2755 N  NE2   . GLN B 159 ? 1.4695 1.8862 1.1822 0.4991  0.1580  -0.1950 159 GLN B NE2   
2756 N  N     . THR B 160 ? 1.0959 1.9724 0.9024 0.4555  0.1691  -0.2572 160 THR B N     
2757 C  CA    . THR B 160 ? 1.1531 2.0461 0.9474 0.5087  0.1670  -0.3036 160 THR B CA    
2758 C  C     . THR B 160 ? 1.2881 2.0222 1.0518 0.5301  0.1629  -0.3219 160 THR B C     
2759 O  O     . THR B 160 ? 1.2924 1.9232 1.0459 0.5062  0.1632  -0.2936 160 THR B O     
2760 C  CB    . THR B 160 ? 1.2391 2.2334 1.0455 0.4911  0.1744  -0.3246 160 THR B CB    
2761 O  OG1   . THR B 160 ? 1.2129 2.1444 1.0152 0.4425  0.1785  -0.3191 160 THR B OG1   
2762 C  CG2   . THR B 160 ? 1.1634 2.3138 0.9998 0.4700  0.1802  -0.3024 160 THR B CG2   
2763 N  N     . ALA B 161 ? 1.3156 2.0292 1.0649 0.5747  0.1592  -0.3689 161 ALA B N     
2764 C  CA    . ALA B 161 ? 1.4024 1.9603 1.1251 0.5937  0.1548  -0.3894 161 ALA B CA    
2765 C  C     . ALA B 161 ? 1.4396 1.9291 1.1640 0.5363  0.1608  -0.3912 161 ALA B C     
2766 O  O     . ALA B 161 ? 1.4870 1.8387 1.1961 0.5275  0.1604  -0.3891 161 ALA B O     
2767 C  CB    . ALA B 161 ? 1.4935 2.0551 1.2033 0.6602  0.1469  -0.4441 161 ALA B CB    
2768 N  N     . LYS B 162 ? 1.3337 1.9230 1.0771 0.4972  0.1664  -0.3932 162 LYS B N     
2769 C  CA    . LYS B 162 ? 1.3182 1.8705 1.0665 0.4455  0.1703  -0.3982 162 LYS B CA    
2770 C  C     . LYS B 162 ? 1.2809 1.8731 1.0475 0.3849  0.1771  -0.3511 162 LYS B C     
2771 O  O     . LYS B 162 ? 1.2649 1.8071 1.0354 0.3421  0.1796  -0.3474 162 LYS B O     
2772 C  CB    . LYS B 162 ? 1.3679 1.9943 1.1169 0.4572  0.1685  -0.4478 162 LYS B CB    
2773 C  CG    . LYS B 162 ? 1.6472 2.1852 1.3783 0.4986  0.1603  -0.5033 162 LYS B CG    
2774 C  CD    . LYS B 162 ? 1.7677 2.4000 1.4977 0.5187  0.1574  -0.5560 162 LYS B CD    
2775 C  CE    . LYS B 162 ? 2.0179 2.5495 1.7327 0.5517  0.1472  -0.6158 162 LYS B CE    
2776 N  NZ    . LYS B 162 ? 2.1932 2.7449 1.8948 0.6270  0.1403  -0.6516 162 LYS B NZ    
2777 N  N     . HIS B 163 ? 1.1814 1.8628 0.9614 0.3810  0.1790  -0.3172 163 HIS B N     
2778 C  CA    . HIS B 163 ? 1.0993 1.8172 0.8975 0.3262  0.1836  -0.2745 163 HIS B CA    
2779 C  C     . HIS B 163 ? 1.0982 1.8134 0.9034 0.3197  0.1826  -0.2331 163 HIS B C     
2780 O  O     . HIS B 163 ? 1.1114 1.8381 0.9115 0.3601  0.1783  -0.2343 163 HIS B O     
2781 C  CB    . HIS B 163 ? 1.0606 1.9136 0.8746 0.3087  0.1872  -0.2743 163 HIS B CB    
2782 C  CG    . HIS B 163 ? 1.1230 1.9851 0.9301 0.3019  0.1876  -0.3080 163 HIS B CG    
2783 N  ND1   . HIS B 163 ? 1.1976 2.0920 0.9926 0.3452  0.1853  -0.3563 163 HIS B ND1   
2784 C  CD2   . HIS B 163 ? 1.1212 1.9678 0.9320 0.2597  0.1884  -0.3024 163 HIS B CD2   
2785 C  CE1   . HIS B 163 ? 1.1967 2.0950 0.9877 0.3262  0.1845  -0.3793 163 HIS B CE1   
2786 N  NE2   . HIS B 163 ? 1.1546 2.0270 0.9553 0.2749  0.1861  -0.3473 163 HIS B NE2   
2787 N  N     . TYR B 164 ? 0.9978 1.7026 0.8152 0.2703  0.1852  -0.1990 164 TYR B N     
2788 C  CA    . TYR B 164 ? 0.9540 1.6628 0.7812 0.2535  0.1833  -0.1609 164 TYR B CA    
2789 C  C     . TYR B 164 ? 0.9525 1.7557 0.8053 0.2122  0.1850  -0.1389 164 TYR B C     
2790 O  O     . TYR B 164 ? 0.9304 1.7300 0.7872 0.1795  0.1879  -0.1368 164 TYR B O     
2791 C  CB    . TYR B 164 ? 0.9692 1.5631 0.7852 0.2314  0.1850  -0.1426 164 TYR B CB    
2792 C  CG    . TYR B 164 ? 1.0375 1.5481 0.8297 0.2672  0.1828  -0.1400 164 TYR B CG    
2793 C  CD1   . TYR B 164 ? 1.0471 1.5683 0.8382 0.2754  0.1780  -0.1144 164 TYR B CD1   
2794 C  CD2   . TYR B 164 ? 1.1188 1.5330 0.8882 0.2899  0.1849  -0.1612 164 TYR B CD2   
2795 C  CE1   . TYR B 164 ? 1.1123 1.5572 0.8763 0.3101  0.1756  -0.1078 164 TYR B CE1   
2796 C  CE2   . TYR B 164 ? 1.1906 1.5194 0.9341 0.3225  0.1834  -0.1525 164 TYR B CE2   
2797 C  CZ    . TYR B 164 ? 1.2606 1.6070 0.9993 0.3341  0.1790  -0.1241 164 TYR B CZ    
2798 O  OH    . TYR B 164 ? 1.3239 1.5894 1.0321 0.3698  0.1770  -0.1125 164 TYR B OH    
2799 N  N     . TYR B 165 ? 0.8878 1.7772 0.7587 0.2140  0.1825  -0.1230 165 TYR B N     
2800 C  CA    . TYR B 165 ? 0.8342 1.8086 0.7306 0.1732  0.1843  -0.0982 165 TYR B CA    
2801 C  C     . TYR B 165 ? 0.8541 1.7945 0.7628 0.1416  0.1792  -0.0661 165 TYR B C     
2802 O  O     . TYR B 165 ? 0.8523 1.7894 0.7634 0.1580  0.1733  -0.0610 165 TYR B O     
2803 C  CB    . TYR B 165 ? 0.8419 1.9458 0.7554 0.1886  0.1868  -0.1035 165 TYR B CB    
2804 C  CG    . TYR B 165 ? 0.8973 2.0431 0.7971 0.2195  0.1922  -0.1382 165 TYR B CG    
2805 C  CD1   . TYR B 165 ? 0.9128 2.1035 0.8118 0.1966  0.1983  -0.1390 165 TYR B CD1   
2806 C  CD2   . TYR B 165 ? 0.9540 2.0933 0.8395 0.2750  0.1898  -0.1719 165 TYR B CD2   
2807 C  CE1   . TYR B 165 ? 0.9571 2.1913 0.8414 0.2271  0.2022  -0.1754 165 TYR B CE1   
2808 C  CE2   . TYR B 165 ? 1.0002 2.1752 0.8726 0.3066  0.1932  -0.2097 165 TYR B CE2   
2809 C  CZ    . TYR B 165 ? 1.0799 2.3052 0.9518 0.2819  0.1995  -0.2129 165 TYR B CZ    
2810 O  OH    . TYR B 165 ? 1.1299 2.3966 0.9871 0.3153  0.2019  -0.2544 165 TYR B OH    
2811 N  N     . VAL B 166 ? 0.7899 1.6993 0.7039 0.1007  0.1800  -0.0481 166 VAL B N     
2812 C  CA    . VAL B 166 ? 0.7666 1.6334 0.6904 0.0710  0.1745  -0.0221 166 VAL B CA    
2813 C  C     . VAL B 166 ? 0.7950 1.7222 0.7452 0.0299  0.1724  0.0046  166 VAL B C     
2814 O  O     . VAL B 166 ? 0.7879 1.7480 0.7402 0.0130  0.1767  0.0089  166 VAL B O     
2815 C  CB    . VAL B 166 ? 0.8222 1.5838 0.7289 0.0617  0.1763  -0.0238 166 VAL B CB    
2816 C  CG1   . VAL B 166 ? 0.8015 1.5207 0.7143 0.0414  0.1707  -0.0024 166 VAL B CG1   
2817 C  CG2   . VAL B 166 ? 0.8673 1.5618 0.7477 0.0974  0.1801  -0.0478 166 VAL B CG2   
2818 N  N     . GLU B 167 ? 0.7397 1.6762 0.7085 0.0138  0.1647  0.0226  167 GLU B N     
2819 C  CA    . GLU B 167 ? 0.7156 1.6902 0.7114 -0.0279 0.1605  0.0498  167 GLU B CA    
2820 C  C     . GLU B 167 ? 0.7354 1.6282 0.7306 -0.0483 0.1530  0.0611  167 GLU B C     
2821 O  O     . GLU B 167 ? 0.7361 1.5865 0.7252 -0.0353 0.1473  0.0549  167 GLU B O     
2822 C  CB    . GLU B 167 ? 0.7326 1.7879 0.7562 -0.0326 0.1559  0.0565  167 GLU B CB    
2823 C  CG    . GLU B 167 ? 0.9441 2.1062 0.9837 -0.0402 0.1644  0.0626  167 GLU B CG    
2824 C  CD    . GLU B 167 ? 1.4313 2.6865 1.5042 -0.0480 0.1617  0.0681  167 GLU B CD    
2825 O  OE1   . GLU B 167 ? 1.5012 2.7383 1.5911 -0.0589 0.1500  0.0717  167 GLU B OE1   
2826 O  OE2   . GLU B 167 ? 1.4203 2.7736 1.5041 -0.0442 0.1712  0.0673  167 GLU B OE2   
2827 N  N     . VAL B 168 ? 0.6672 1.5410 0.6662 -0.0762 0.1528  0.0767  168 VAL B N     
2828 C  CA    . VAL B 168 ? 0.6526 1.4556 0.6529 -0.0941 0.1455  0.0860  168 VAL B CA    
2829 C  C     . VAL B 168 ? 0.7050 1.5309 0.7330 -0.1291 0.1361  0.1115  168 VAL B C     
2830 O  O     . VAL B 168 ? 0.7154 1.5952 0.7552 -0.1479 0.1388  0.1296  168 VAL B O     
2831 C  CB    . VAL B 168 ? 0.6918 1.4463 0.6756 -0.0947 0.1503  0.0808  168 VAL B CB    
2832 C  CG1   . VAL B 168 ? 0.6821 1.3726 0.6692 -0.1093 0.1431  0.0881  168 VAL B CG1   
2833 C  CG2   . VAL B 168 ? 0.7033 1.4290 0.6632 -0.0648 0.1592  0.0546  168 VAL B CG2   
2834 N  N     . LYS B 169 ? 0.6463 1.4315 0.6839 -0.1376 0.1251  0.1129  169 LYS B N     
2835 C  CA    . LYS B 169 ? 0.6406 1.4284 0.7056 -0.1708 0.1132  0.1326  169 LYS B CA    
2836 C  C     . LYS B 169 ? 0.7004 1.4092 0.7603 -0.1742 0.1044  0.1302  169 LYS B C     
2837 O  O     . LYS B 169 ? 0.7024 1.3749 0.7517 -0.1570 0.1011  0.1128  169 LYS B O     
2838 C  CB    . LYS B 169 ? 0.6671 1.5005 0.7553 -0.1763 0.1056  0.1290  169 LYS B CB    
2839 C  CG    . LYS B 169 ? 0.8558 1.7824 0.9613 -0.1850 0.1131  0.1386  169 LYS B CG    
2840 C  CD    . LYS B 169 ? 0.9710 1.9517 1.1028 -0.1883 0.1050  0.1303  169 LYS B CD    
2841 C  CE    . LYS B 169 ? 1.1028 2.1882 1.2568 -0.1983 0.1139  0.1394  169 LYS B CE    
2842 N  NZ    . LYS B 169 ? 1.2161 2.3422 1.3467 -0.1569 0.1265  0.1210  169 LYS B NZ    
2843 N  N     . SER B 170 ? 0.6505 1.3358 0.7146 -0.1924 0.1013  0.1476  170 SER B N     
2844 C  CA    . SER B 170 ? 0.6461 1.2638 0.7077 -0.1931 0.0926  0.1444  170 SER B CA    
2845 C  C     . SER B 170 ? 0.6962 1.2961 0.7838 -0.2192 0.0759  0.1586  170 SER B C     
2846 O  O     . SER B 170 ? 0.7006 1.3311 0.8060 -0.2443 0.0736  0.1831  170 SER B O     
2847 C  CB    . SER B 170 ? 0.6894 1.2895 0.7375 -0.1890 0.0982  0.1492  170 SER B CB    
2848 O  OG    . SER B 170 ? 0.7760 1.3837 0.8026 -0.1671 0.1121  0.1310  170 SER B OG    
2849 N  N     . TYR B 171 ? 0.6465 1.1972 0.7360 -0.2137 0.0647  0.1427  171 TYR B N     
2850 C  CA    . TYR B 171 ? 0.6650 1.1874 0.7793 -0.2351 0.0458  0.1472  171 TYR B CA    
2851 C  C     . TYR B 171 ? 0.7409 1.1975 0.8509 -0.2268 0.0358  0.1391  171 TYR B C     
2852 O  O     . TYR B 171 ? 0.7199 1.1569 0.8084 -0.2023 0.0434  0.1225  171 TYR B O     
2853 C  CB    . TYR B 171 ? 0.6793 1.2184 0.8042 -0.2338 0.0374  0.1267  171 TYR B CB    
2854 C  CG    . TYR B 171 ? 0.6868 1.2985 0.8193 -0.2370 0.0452  0.1292  171 TYR B CG    
2855 C  CD1   . TYR B 171 ? 0.6751 1.3139 0.7830 -0.2070 0.0589  0.1156  171 TYR B CD1   
2856 C  CD2   . TYR B 171 ? 0.7249 1.3783 0.8908 -0.2697 0.0384  0.1440  171 TYR B CD2   
2857 C  CE1   . TYR B 171 ? 0.6803 1.3890 0.7956 -0.2039 0.0647  0.1150  171 TYR B CE1   
2858 C  CE2   . TYR B 171 ? 0.7189 1.4511 0.8953 -0.2709 0.0460  0.1440  171 TYR B CE2   
2859 C  CZ    . TYR B 171 ? 0.7872 1.5481 0.9375 -0.2351 0.0585  0.1282  171 TYR B CZ    
2860 O  OH    . TYR B 171 ? 0.8024 1.6434 0.9630 -0.2304 0.0647  0.1254  171 TYR B OH    
2861 N  N     . VAL B 172 ? 0.7428 1.1652 0.8749 -0.2474 0.0184  0.1500  172 VAL B N     
2862 C  CA    . VAL B 172 ? 0.7677 1.1264 0.9009 -0.2384 0.0041  0.1395  172 VAL B CA    
2863 C  C     . VAL B 172 ? 0.8639 1.1991 1.0225 -0.2558 -0.0166 0.1278  172 VAL B C     
2864 O  O     . VAL B 172 ? 0.8938 1.2271 1.0772 -0.2872 -0.0255 0.1501  172 VAL B O     
2865 C  CB    . VAL B 172 ? 0.8313 1.1627 0.9654 -0.2430 0.0005  0.1662  172 VAL B CB    
2866 C  CG1   . VAL B 172 ? 0.8604 1.1264 0.9997 -0.2309 -0.0175 0.1529  172 VAL B CG1   
2867 C  CG2   . VAL B 172 ? 0.7965 1.1577 0.9076 -0.2261 0.0187  0.1714  172 VAL B CG2   
2868 N  N     . LYS B 173 ? 0.8244 1.1458 0.9767 -0.2370 -0.0236 0.0928  173 LYS B N     
2869 C  CA    . LYS B 173 ? 0.8613 1.1653 1.0356 -0.2492 -0.0452 0.0713  173 LYS B CA    
2870 C  C     . LYS B 173 ? 0.9498 1.3055 1.1490 -0.2802 -0.0463 0.0827  173 LYS B C     
2871 O  O     . LYS B 173 ? 0.9940 1.3326 1.2260 -0.3134 -0.0623 0.0913  173 LYS B O     
2872 C  CB    . LYS B 173 ? 0.9384 1.1720 1.1321 -0.2599 -0.0670 0.0725  173 LYS B CB    
2873 C  CG    . LYS B 173 ? 1.0714 1.2585 1.2477 -0.2269 -0.0719 0.0505  173 LYS B CG    
2874 C  CD    . LYS B 173 ? 1.2496 1.3645 1.4483 -0.2361 -0.0974 0.0491  173 LYS B CD    
2875 C  CE    . LYS B 173 ? 1.4558 1.5303 1.6427 -0.2004 -0.1074 0.0150  173 LYS B CE    
2876 N  NZ    . LYS B 173 ? 1.5645 1.6354 1.7331 -0.1756 -0.0948 0.0276  173 LYS B NZ    
2877 N  N     . HIS B 174 ? 0.8813 1.3004 1.0666 -0.2698 -0.0290 0.0834  174 HIS B N     
2878 C  CA    . HIS B 174 ? 0.8819 1.3677 1.0896 -0.2931 -0.0264 0.0933  174 HIS B CA    
2879 C  C     . HIS B 174 ? 0.9281 1.4239 1.1663 -0.3357 -0.0268 0.1303  174 HIS B C     
2880 O  O     . HIS B 174 ? 0.9403 1.4520 1.2148 -0.3701 -0.0390 0.1331  174 HIS B O     
2881 C  CB    . HIS B 174 ? 0.9033 1.4233 1.1225 -0.2899 -0.0393 0.0616  174 HIS B CB    
2882 C  CG    . HIS B 174 ? 0.9912 1.4649 1.2295 -0.2998 -0.0651 0.0358  174 HIS B CG    
2883 N  ND1   . HIS B 174 ? 1.0174 1.4887 1.2384 -0.2713 -0.0752 -0.0021 174 HIS B ND1   
2884 C  CD2   . HIS B 174 ? 1.0623 1.4928 1.3346 -0.3349 -0.0832 0.0421  174 HIS B CD2   
2885 C  CE1   . HIS B 174 ? 1.0566 1.4856 1.3017 -0.2879 -0.0995 -0.0221 174 HIS B CE1   
2886 N  NE2   . HIS B 174 ? 1.0909 1.4888 1.3683 -0.3266 -0.1056 0.0032  174 HIS B NE2   
2887 N  N     . THR B 175 ? 0.8645 1.3509 1.0864 -0.3329 -0.0132 0.1589  175 THR B N     
2888 C  CA    . THR B 175 ? 0.8739 1.3731 1.1091 -0.3637 -0.0075 0.2010  175 THR B CA    
2889 C  C     . THR B 175 ? 0.8762 1.4211 1.0818 -0.3425 0.0155  0.2134  175 THR B C     
2890 O  O     . THR B 175 ? 0.8562 1.3689 1.0344 -0.3151 0.0202  0.2071  175 THR B O     
2891 C  CB    . THR B 175 ? 0.9908 1.4080 1.2305 -0.3741 -0.0219 0.2187  175 THR B CB    
2892 O  OG1   . THR B 175 ? 1.0357 1.4004 1.2982 -0.3844 -0.0451 0.1955  175 THR B OG1   
2893 C  CG2   . THR B 175 ? 0.9949 1.4201 1.2464 -0.4076 -0.0175 0.2679  175 THR B CG2   
2894 N  N     . LEU B 176 ? 0.8123 1.4367 1.0252 -0.3544 0.0295  0.2271  176 LEU B N     
2895 C  CA    . LEU B 176 ? 0.7761 1.4492 0.9624 -0.3341 0.0500  0.2342  176 LEU B CA    
2896 C  C     . LEU B 176 ? 0.8432 1.4922 1.0162 -0.3400 0.0532  0.2656  176 LEU B C     
2897 O  O     . LEU B 176 ? 0.8902 1.5392 1.0804 -0.3723 0.0494  0.3002  176 LEU B O     
2898 C  CB    . LEU B 176 ? 0.7634 1.5324 0.9629 -0.3444 0.0628  0.2404  176 LEU B CB    
2899 C  CG    . LEU B 176 ? 0.7937 1.6161 0.9650 -0.3170 0.0826  0.2375  176 LEU B CG    
2900 C  CD1   . LEU B 176 ? 0.7692 1.5902 0.9203 -0.2774 0.0861  0.2000  176 LEU B CD1   
2901 C  CD2   . LEU B 176 ? 0.8206 1.7380 1.0075 -0.3355 0.0952  0.2572  176 LEU B CD2   
2902 N  N     . VAL B 177 ? 0.7638 1.3896 0.9071 -0.3095 0.0588  0.2539  177 VAL B N     
2903 C  CA    . VAL B 177 ? 0.7726 1.3790 0.8997 -0.3068 0.0597  0.2770  177 VAL B CA    
2904 C  C     . VAL B 177 ? 0.8089 1.4765 0.9120 -0.2905 0.0777  0.2778  177 VAL B C     
2905 O  O     . VAL B 177 ? 0.8277 1.5100 0.9189 -0.2941 0.0804  0.3035  177 VAL B O     
2906 C  CB    . VAL B 177 ? 0.8230 1.3539 0.9408 -0.2867 0.0480  0.2607  177 VAL B CB    
2907 C  CG1   . VAL B 177 ? 0.8589 1.3268 0.9996 -0.3028 0.0277  0.2632  177 VAL B CG1   
2908 C  CG2   . VAL B 177 ? 0.7841 1.3096 0.8854 -0.2561 0.0553  0.2212  177 VAL B CG2   
2909 N  N     . PHE B 178 ? 0.7285 1.4299 0.8227 -0.2703 0.0886  0.2483  178 PHE B N     
2910 C  CA    . PHE B 178 ? 0.7031 1.4556 0.7749 -0.2504 0.1041  0.2386  178 PHE